GenomeNet

Database: RefSeq
Entry: NC_040197
LinkDB: NC_040197
Original site: NC_040197 
LOCUS       NC_040197             836807 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome V, complete sequence.
ACCESSION   NC_040197
VERSION     NC_040197.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 836807)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 836807)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 836807)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030255.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..836807
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="V"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            complement(<259..>537)
                     /locus_tag="MRET_2828"
                     /db_xref="GeneID:38739594"
     mRNA            complement(<259..>537)
                     /locus_tag="MRET_2828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629455.1"
                     /db_xref="GeneID:38739594"
     CDS             complement(259..537)
                     /locus_tag="MRET_2828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485741.1"
                     /db_xref="GeneID:38739594"
                     /translation="MIKAFVVLAAAAATLVAASDRVSVKGYTSDPKGDLDCKFGSGEI
                     MKKCGACAKSITECAVAGPVQKKQICVEDISSFAEDCGSCAVDILECL"
     gene            <757..>978
                     /locus_tag="MRET_2829"
                     /db_xref="GeneID:38739595"
     mRNA            <757..>978
                     /locus_tag="MRET_2829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629456.1"
                     /db_xref="GeneID:38739595"
     CDS             757..978
                     /locus_tag="MRET_2829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485706.1"
                     /db_xref="GeneID:38739595"
                     /translation="MLFDVHLVLCFIRPTASRGLNLAHTCRSLKGKPNHSGGFLVFAP
                     RKASIPPHWLGAIHSGVFLQQPQHMRVDQ"
     gene            complement(<1891..>3306)
                     /locus_tag="MRET_2830"
                     /db_xref="GeneID:38739596"
     mRNA            complement(<1891..>3306)
                     /locus_tag="MRET_2830"
                     /product="MFS monocarboxylate transporter"
                     /transcript_id="XM_027629457.1"
                     /db_xref="GeneID:38739596"
     CDS             complement(1891..3306)
                     /locus_tag="MRET_2830"
                     /codon_start=1
                     /product="MFS monocarboxylate transporter"
                     /protein_id="XP_027485737.1"
                     /db_xref="GeneID:38739596"
                     /translation="MGEPAIVAPPMAHTSAVSRRESISISDHAFRHRGLEGRPPLHQV
                     VAHDHICTAEPFEDPTLLPVLSILPHHAGLDLTKLRPMTQVLSAFLFLFCSWGVIGCY
                     GTFFLYFRDILLMQHSASDVAWIGSIQQFLAVLVGILTSKWVDYGYMYAMCTVGSILI
                     VLGIMMNGQGTRYVHIFFSHGVCVGVGTGLIYLPCITCCSEYHHQKPGVALGLATLGS
                     SLGSLIFPIMFNKLQPNIGYAWTIRIIGFLIMALLLLALLLLRPRSRAIESRRLFALH
                     VFKDPVYIVFVLGYFLGNMGLYVPPYFLPSFGKHHKFSDAIFPFTTSLLKTGGILGRL
                     LSIFLTKRIGAFGLYVPRTFSAALVAFVWIAVRQQGSFVVVVVLYGLLSGSLLSAIPM
                     IVTKITDDESDVNVRLSVASLLSSVGSLVGPPIAASLLDIEPPKYVRAQVFAGIFIAL
                     SGLCMFIVRVMKVGPNWMVPF"
     gene            complement(<3375..>5192)
                     /locus_tag="MRET_2831"
                     /note="MRES_09410"
                     /db_xref="GeneID:38739597"
     mRNA            complement(<3375..>5192)
                     /locus_tag="MRET_2831"
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /transcript_id="XM_027629458.1"
                     /db_xref="GeneID:38739597"
     CDS             complement(3375..5192)
                     /locus_tag="MRET_2831"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="XP_027485738.1"
                     /db_xref="GeneID:38739597"
                     /translation="MPTVGVDKALLFEGLGHEYTTQEFDELCFQFGIELDEDTTEEVA
                     GTDERPQLKIDIPANRYDLLCFEGILRALRVFLGLQEPPKYTLSQPKELLTMKLTPAT
                     ARIRPYFAGAVLRNITFTQERYNNFIDFQDKIHQNLARQRTLVSIGTHDLDTIEAPFV
                     YDALPPNDIKFAPLNLEEEFTGSGLMDLYETDRHLGRYLHIIRDSPVYPIIFDQQKRV
                     LSMPPIINSNHSKIKLDTKNVFIDVTALDKTKLDIVISDLVAMFSEYCAEPFVVEPIR
                     VVYPDGAEVITPNLDARETAVRVSYVNRCTGLDQDAEKIAGLLRRMGHGAQPSATDPD
                     VVEVQVPVTRPDILHECDLMEDAAVAHGFDNLPKTFPTTNTVGGPLPINKLSDIIRHE
                     CAQAGWIEVLPLILCSHDENFAWMKRTDDGKTAIVLENPKTSEYQIVRTSLLPGILKT
                     IRENKKHALPIQVFEVSDVAFKDPTETQRMARNERHMAAIYSNKAAGFEVVHGLLDKL
                     MMMLGVPRISREDAKAECGYYLQEADDPSFFPGRAAHIVLRTPSSSARGLDSTDDLKK
                     ALDGDERIGTLGVLHPDVLERFELAFPCSALEFNVEPFL"
     gene            complement(<5302..>7209)
                     /locus_tag="MRET_2832"
                     /note="MRES_09415"
                     /db_xref="GeneID:38739598"
     mRNA            complement(<5302..>7209)
                     /locus_tag="MRET_2832"
                     /product="electron-transferring-flavoprotein
                     dehydrogenase"
                     /transcript_id="XM_027629459.1"
                     /db_xref="GeneID:38739598"
     CDS             complement(5302..7209)
                     /locus_tag="MRET_2832"
                     /codon_start=1
                     /product="electron-transferring-flavoprotein
                     dehydrogenase"
                     /protein_id="XP_027485735.1"
                     /db_xref="GeneID:38739598"
                     /translation="MLARQVARVPRVSALGRVGHSFAFASRRSILSGACRGIRLAKFS
                     PAPCRRFFHAGTALREEDTAEEIQEEERVVDEVDVLIVGGGPAGLSAAIKIKQLAEAK
                     GEDIRVVLLEKGAEIGNHILSGAVIQTNALDELIPDWKEKGAPLNQPALHDKMVFLTE
                     TGSIPMPHPPQMNNKGNYIVSLSRVATWLGEQAEEAGVEIYPGFAGAQIVWDEDANGN
                     KRGIRGIVTNDIGLNKEGQPKDNYEPGMEFRAPITLFAEGAHGSLSLKIMKELKLREE
                     VGADPQTYGIGIKEVWRVKPENHEAGLVAHTMGHPLSTDTYGGSFMYHMDDNMVSLGL
                     VVGLDYGNPYLSPYQEFQRMKHHPFFARVLEGGQCLAYGARALNEGGYQSIPKVHFPG
                     GALVGCSAGFLNVPKIKGTHNAMKSGMLAAEAAVEALAHRSENDPYAPIDIAEYKNKL
                     DNSWIMKELYEVRNIRPSFHAFGFLGALIYSGLETMFLKGKVPWTLHHEKEDYQYTKP
                     KDQCKPISYPKPDGKLSFDILTSVSRTGTNHAENQPVHLVVKDGHYKGHVERNVGIFD
                     GPLGRVCPAAVYEYVNKEDANGREDACGKKLVINSQNCIHCKTCSIKTPDQSIEWTVP
                     EGGGGPKYSLT"
     gene            complement(<7739..>8140)
                     /locus_tag="MRET_2833"
                     /db_xref="GeneID:38739599"
     mRNA            complement(<7739..>8140)
                     /locus_tag="MRET_2833"
                     /product="Rare lipoprotein A (RlpA)-like double-psi
                     beta-barrel"
                     /transcript_id="XM_027629460.1"
                     /db_xref="GeneID:38739599"
     CDS             complement(7739..8140)
                     /locus_tag="MRET_2833"
                     /codon_start=1
                     /product="Rare lipoprotein A (RlpA)-like double-psi
                     beta-barrel"
                     /protein_id="XP_027485736.1"
                     /db_xref="GeneID:38739599"
                     /translation="MKFSFVAAAAALIASVAAAPASQVQSRGIFGGKATWYAADKSEG
                     NCGWWSTNADHIVALNAHQYGSTDKKSEHCGKLIRIVNEKNKKVIHAVVADSCPSCEE
                     GSLDLSKGLFSELTDGDMDLGIFPISWSFLN"
     gene            <8644..>9113
                     /locus_tag="MRET_2834"
                     /note="MRES_09420"
                     /db_xref="GeneID:38739600"
     mRNA            join(<8644..8698,8734..8804,8842..8966,8999..9059,
                     9087..>9113)
                     /locus_tag="MRET_2834"
                     /product="prefoldin beta subunit"
                     /transcript_id="XM_027629461.1"
                     /db_xref="GeneID:38739600"
     CDS             join(8644..8698,8734..8804,8842..8966,8999..9059,
                     9087..9113)
                     /locus_tag="MRET_2834"
                     /codon_start=1
                     /product="prefoldin beta subunit"
                     /protein_id="XP_027485421.1"
                     /db_xref="GeneID:38739600"
                     /translation="MASEQVKSILAQFQEVQNELNNLIDTHQQLLSQLSENQQVLKEL
                     EKLEPDARVFKRLGPVLLPQEFAEAKTNVEKRIDFIQTESQRVDKRIEHLISKRNELQ
                     TEIVKSKQAP"
     gene            complement(<9128..>10849)
                     /locus_tag="MRET_2835"
                     /db_xref="GeneID:38739601"
     mRNA            complement(join(<9128..9352,9381..9609,9635..9705,
                     9734..>10849))
                     /locus_tag="MRET_2835"
                     /product="rabenosyn-5"
                     /transcript_id="XM_027629462.1"
                     /db_xref="GeneID:38739601"
     CDS             complement(join(9128..9352,9381..9609,9635..9705,
                     9734..10849))
                     /locus_tag="MRET_2835"
                     /codon_start=1
                     /product="rabenosyn-5"
                     /protein_id="XP_027485430.1"
                     /db_xref="GeneID:38739601"
                     /translation="MHQRREMEPRDAEHPKTPASNYGDLLYTPYMKRKSPIRTTSHPS
                     LSPSRSASEQGFPLSSRDGSPLRVMSASRPVPGKVEPHDQQSSLKKIDSDAVSPFRSA
                     SPSSRKVAMETPASLRLTTEPVRRINSLPREYGAESISRRMPYRPGFQPKGVVRHRTD
                     EFLERRAKHVDMMDLDEQRMERRLGKLMTIYSPEFELPQTVGSSHFWQIGGDRVWDMF
                     SSQHERQLQRLQRSRRVAEQRVVKWQEGGEHPRCHICQTPFSLAVRRHHCRLCGNLVC
                     SSPRLPQVLLHDEEMHAKQLESWEPCSSLMLYDASSKTLRDIPNRPDTPATSTEWRDY
                     EVAEKDGIRFCRSCKSIVHRIMLRNRRSDDMPLCPLYQNLLILQKDINEALPDFHEMI
                     LGLKKNDTDLSLASTVRDSHALQANAFQARKDLLARFSRFEQLARKIESMPPIVDGVT
                     SAAQKRLQQAIFARASLFLQRNMIPLQGLSSQPTPNASKKKVPRHIQEQLHALKVQDT
                     LLSEYMESAQKLRNLDDMASLRQSQEEIRAEIARLQQE"
     gene            complement(<10938..>13070)
                     /locus_tag="MRET_2836"
                     /note="MRES_09425"
                     /db_xref="GeneID:38739602"
     mRNA            complement(<10938..>13070)
                     /locus_tag="MRET_2836"
                     /product="carboxyl methyltransferase"
                     /transcript_id="XM_027629463.1"
                     /db_xref="GeneID:38739602"
     CDS             complement(10938..13070)
                     /locus_tag="MRET_2836"
                     /codon_start=1
                     /product="carboxyl methyltransferase"
                     /protein_id="XP_027485739.1"
                     /db_xref="GeneID:38739602"
                     /translation="MKDHELDGETKYYEPAKSNRTRNPVKGMGRLNISIDTGINSSGT
                     SGVKLEPISTVSRHDSTDKLGCDSYQSNSAQTWHHSERDDLPPLAQAQYDNEPSSAAS
                     SREDATYQTNGMANAPWHNYSPNMPIAYSYLKTDDILQGKLSGQLVEQVLSSQYISSA
                     SDDGSDLISTWSSSHEGPTKPRATAFGSQRSDKPIPKTEYTALQRTNHSTGNYSFPQP
                     SHDLQSNSEAPKQGIFPTLSDRADQGETYVTRPPLKSSGSAGSASFFSDFASGSHNNQ
                     FGPGVRAKISTVLPSLIETIPISSYATIFLTEYGCMHSRAVHMFKGMIECFVARVREK
                     LEKDPSFHENQRLEARRASRTGYAEETADWVSFVIIHEDSEQSDLRSFQHMLDSHPES
                     YLDPLWQSSRNPSLQNAIFSMSVMRPFGSRIVPPDTLHLGFSLMDLHWTHAPTNNVSI
                     ASMAHAELTMSLSARAKEFRRGGIYVMAYIARSESVAAEEASGQSAVAASHTRRSLES
                     PAAMSGKDASRLAAADTASVEPRPKNIWNTMSDMIVPCLQRLVSCGMMKVDVARHMLT
                     LPMYPRTKKQTLRVLEKFTDVWSLDWSCGLGKSDLKEIVTDSGKVVTLQSEPNPLHLP
                     QPAWLALKAGKITRESYNDHVLQMFKNVYEGHFRMVLQERGQLSKGATEFILDSLWDV
                     LRSRMDEPENCQLANSELEVQLMALRRL"
     gene            complement(<14771..>17111)
                     /locus_tag="MRET_2837"
                     /note="MRES_09430"
                     /db_xref="GeneID:38739603"
     mRNA            complement(join(<14771..17066,17107..>17111))
                     /locus_tag="MRET_2837"
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /transcript_id="XM_027629464.1"
                     /db_xref="GeneID:38739603"
     CDS             complement(join(14771..17066,17107..17111))
                     /locus_tag="MRET_2837"
                     /codon_start=1
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="XP_027485740.1"
                     /db_xref="GeneID:38739603"
                     /translation="MATSAVLGFPRIGPQREVKKALEAYWGDKISAEELLKVAKEQRL
                     NTYATIKEQGVDFVPTGTFSLYDHVLDMSNTLGIIPEAYAKSGLSQLDTYFAMARGHQ
                     KGGVDLPATEMKKWFDSNYHYLVPEFSEKSEFKLNDNKPVDDFIEAKEAGYNARPVIL
                     GPLTLLWLGKTSKDAQDPNFNRYSLLPKLAQTYVQLFEKLAAAGAPWVQLDEPILVVD
                     TAKQLSNEFKQTYELFHKSVPNLNILVAAYFGRLEDNIDFVKELPIAGLHIDLDRAPE
                     QLEPVLSAIAPTKIGLSLGLVSGRNIWKTDLGAAIKLAQKAVDAIGADRIQVASSSSL
                     LHTPITVANEKKLKPEVADWFSFATEKCGEVATIGVALKDQAAAAQKLEANAKSIAAR
                     RDFEKNSDPAVRERVANIKPEDLNRKSPFPQRREVQRQFLKLPPFPTTTIGSFPQTKE
                     IRQYRARFTKGEISQEEYEKFLENEIKMVVEKQEALGLDVLVHGEPERNDMVQYFGEQ
                     LDGFVFTQNAWVQSFGSRYVRPPIIVSDVSRPQPMTVRWSSYAQSLTQKIMKGMLTGP
                     VTILNWSFPRVDIGRDQQAFQIALALRDEVVDLEKAGIRAVQVDEPAIREGLPLRRQQ
                     WDAYLKWAVDSFRLAVSGASDAMNTASHFCYSDFNDIMDSVIALDADMISIENSKSDA
                     KLLKIFQTTKYPNEIGPGVFDIHSPRVPSAEEMTQRIKEMSQFIDPKLLWVNPDCGLK
                     TRTWDECTAQLKAMVTAAEEARKTFL"
     gene            complement(<17839..>18387)
                     /locus_tag="MRET_2838"
                     /note="MRES_09435"
                     /db_xref="GeneID:38739604"
     mRNA            complement(<17839..>18387)
                     /locus_tag="MRET_2838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629465.1"
                     /db_xref="GeneID:38739604"
     CDS             complement(17839..18387)
                     /locus_tag="MRET_2838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485418.1"
                     /db_xref="GeneID:38739604"
                     /translation="MVSFYTFSATFVAALASIATAAPMERRAAPDNQVWVTSVADHCL
                     ILPRHRMSIGDSESPGNMRSFCTKPYSSSQGQLSSNFWKKAHFKKTDSYVQLTGCINP
                     SAQSTLLSDDDGGQYDSNGGEGGRGNPEGSVCLGYASYVQFVEPSGNRACIRCCKNPH
                     ECDIAHDEDGCENAIPGNYSCE"
     gene            <18932..>19990
                     /locus_tag="MRET_2839"
                     /note="MRES_09440"
                     /db_xref="GeneID:38739605"
     mRNA            <18932..>19990
                     /locus_tag="MRET_2839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629466.1"
                     /db_xref="GeneID:38739605"
     CDS             18932..19990
                     /locus_tag="MRET_2839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485716.1"
                     /db_xref="GeneID:38739605"
                     /translation="MKTTSFISTVVALLGAYSVGVSAGLPDTINVHVKNLAPEDTIYD
                     RTRQLFYQSNLWKGMIEVWDNKRQSHFNVKIDGVSSGGDGEQQMSGLSLLTHDDSKRL
                     FAVAKNSHSFDFSPNQKNDGPSSFHCFKLPLSEQSKPEWSVYLQGVQDEFQRQTGRRP
                     FGVVQSAQDRDGNSYIAFALGMPAVAKISPDGKNVEAWAHEDGNGGQRPGYSGITFDP
                     HSNKILAFGGPRPLTAFSLDKPNPQPEPVHINGDFGKLDGTEKIVTVPVNGQSVLVGA
                     RAPYAISFQSWDGWKSASIKKTKREELRNSGFTAVTEYYEGKELGLYGVSAFFDNGAH
                     GGRADWPLFKLDSGILYF"
     gene            <20122..>20874
                     /locus_tag="MRET_2840"
                     /note="MRES_09445"
                     /db_xref="GeneID:38739606"
     mRNA            <20122..>20874
                     /locus_tag="MRET_2840"
                     /product="protein YOP1"
                     /transcript_id="XM_027629467.1"
                     /db_xref="GeneID:38739606"
     CDS             20122..20874
                     /locus_tag="MRET_2840"
                     /codon_start=1
                     /product="protein YOP1"
                     /protein_id="XP_027485405.1"
                     /db_xref="GeneID:38739606"
                     /translation="MSTLLVTYTLTTCVAYLYPLYASYKALSATSRRGSTPGAYQWHA
                     GADKEEAQAAATELSELETWTMYWCIVSLFWLVDAWIGWMFQWVSLYAHARLLFMCWL
                     ALPQTHGASILYKHYLAPFLAQHEGDIEGLLDMGRTRMVATLSKTFQVIVAIVMSEFR
                     PDPEPEPAPEGAADDAPLPPPASDHASEEPPDYSAVAERQSDDVPPILPSAPQAVNWL
                     AQLAHTSVLPENDTEPAPDQATKQRLFRRLRK"
     gene            complement(<20876..>21721)
                     /locus_tag="MRET_2841"
                     /note="MRES_09450"
                     /db_xref="GeneID:38739607"
     mRNA            complement(<20876..>21721)
                     /locus_tag="MRET_2841"
                     /product="protein-tyrosine phosphatase"
                     /transcript_id="XM_027629468.1"
                     /db_xref="GeneID:38739607"
     CDS             complement(20876..21721)
                     /locus_tag="MRET_2841"
                     /codon_start=1
                     /product="protein-tyrosine phosphatase"
                     /protein_id="XP_027485466.1"
                     /db_xref="GeneID:38739607"
                     /translation="MSQVGEASYALDWLNRIDALRRTDPRYSCHAAAVHTEANRYTNV
                     APYDGAVLPGPYINASLIPPLPDAERGFPCIASQAPLPSTYPTFFEHICTQKSRIILN
                     LTPLEERGIPKSDRYWPWDTASPLLIGPWSVTLLSIESASEAFPGTKAAALDKLCVRR
                     LQLSRPGMSHPVTQLHFVGWPDHGDLDVQSFCGLLEAVHAVQGESATPAWIHCSAGIG
                     RSGTVIGALLAQMQPSLFFAQGTALEQATYLTAYMRKFRPGSVQTPTQLVSMAATLAA
                     LCSGV"
     gene            <21758..>23614
                     /locus_tag="MRET_2842"
                     /note="MRES_09455"
                     /db_xref="GeneID:38739608"
     mRNA            <21758..>23614
                     /locus_tag="MRET_2842"
                     /product="exocyst complex component 7"
                     /transcript_id="XM_027629469.1"
                     /db_xref="GeneID:38739608"
     CDS             21758..23614
                     /locus_tag="MRET_2842"
                     /codon_start=1
                     /product="exocyst complex component 7"
                     /protein_id="XP_027485464.1"
                     /db_xref="GeneID:38739608"
                     /translation="MSSYSARATTQPMQETDVALMEMELLEQNQRRLGNLTSRMTTIL
                     NGFDRRLIRLESSILPIHKSTQLLSRIHGNVEAVQRHLEQHIRHYGIEIQDEPFLRQG
                     PDPQNPWAYMEAIQRVVNDATPSQGAPADDVISKRKAIVDMAARKLVQLVQQYAVSEP
                     IDPRSYLASQMPHLSGECLTSIKALIQFLYTLSDTQSKSDNTFRLALKSLARVRASYL
                     TSSMQSLTHAVVQAADHVQSQPSDMPREAHVKYVCGAAPFSEWLRALVMMMESEQAAV
                     SSLFQGMSWKALLGSTLSHIFQPIVTNINTLLPRILPRLQHGLQAHRFLALDFVRASR
                     AALGPSCEIWNGLLQHTKCSSTELSSAVISSQKDAILFFPELLRDIKVIPVQREHEAL
                     HADVSDIARYGIRLLRDLTDYQDILTVLLTSMGTKNWTSDASDVSPLADGLWAEYARD
                     MLASIVSSLERAVAGSSQPMIASIFLLNNYTFLHTELRSMSLIPGAMSACDQVLSRGL
                     RTARVSYLETWKGIIQPLQTEPSFVHTSSTRQHTVRTDPIQVFFGLLQKMEQVHHTHP
                     LVPGITASVRDDVIQIVMPLYVTALAKRPADAGVRMPTDTDILRMIEHMYAS"
     gene            <23753..>24490
                     /locus_tag="MRET_2843"
                     /db_xref="GeneID:38739609"
     mRNA            <23753..>24490
                     /locus_tag="MRET_2843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629470.1"
                     /db_xref="GeneID:38739609"
     CDS             23753..24490
                     /locus_tag="MRET_2843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485463.1"
                     /db_xref="GeneID:38739609"
                     /translation="MTPFPLRLRARSAGRTCTLFSAWVLATTYSLTQVRGAPASTYHI
                     LYAHHHPRRAVISSTPKDSDKPESEPSVFSPKNSFFPVIIVALISVGLTALGLLVFIL
                     HQTRRKLANKGTCDEADSSTMEKFDHIHPIDLSKPAKVHPIMSSVSRGTPMRFSPNFD
                     STKYAFLDMNDESFVHRGGSEKAHSLILDSDSAFSMDIKDTSDGHSLRQSDLCRPCVT
                     HGSPGWNIQACEESHDEVPATSRPDAS"
     gene            <24570..>25703
                     /locus_tag="MRET_2844"
                     /note="MRES_09460"
                     /db_xref="GeneID:38739610"
     mRNA            <24570..>25703
                     /locus_tag="MRET_2844"
                     /product="verprolin, proline-rich actin-associated
                     protein"
                     /transcript_id="XM_027629471.1"
                     /db_xref="GeneID:38739610"
     CDS             24570..25703
                     /locus_tag="MRET_2844"
                     /codon_start=1
                     /product="verprolin, proline-rich actin-associated
                     protein"
                     /protein_id="XP_027485495.1"
                     /db_xref="GeneID:38739610"
                     /translation="MDAALQDAIKKGKTLKKVQTNDRSAPTVAGNTSGTAPSGGGGPS
                     PMHARPPRPPVAPGGPPVGIGDIFAAGRPKLRSVSGTPSPARSAPTVRPPPPPPPGPA
                     PSLRPPAPRPPTATAPKPPRPSVPVPPPPGPRTTKPRPPAPPPAKPPSLSAKPKPPPP
                     PRTRAPAKFSQTSVPAAPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPSAPPAPPAPP
                     APPAPPAPPAPPAPSAPPAAPKRAAPPRPPTTAPPPPPPPTPSVSTPSPGIPGAGLFP
                     PPPASTMPPSISKAIPAPTSMPPSQATSVHASLPVRSGAFSSTTTTTAPRIPSPPPMV
                     GSRTYPTSKDFPPPRSFPRTTHRYPSGSSQGSSFDLVGRLGSR"
     gene            <25875..>26750
                     /locus_tag="MRET_2845"
                     /note="MRES_09465"
                     /db_xref="GeneID:38739611"
     mRNA            <25875..>26750
                     /locus_tag="MRET_2845"
                     /product="translation initiation factor 4E"
                     /transcript_id="XM_027629472.1"
                     /db_xref="GeneID:38739611"
     CDS             25875..26750
                     /locus_tag="MRET_2845"
                     /codon_start=1
                     /product="translation initiation factor 4E"
                     /protein_id="XP_027485492.1"
                     /db_xref="GeneID:38739611"
                     /translation="MSSDANAAPAAEYKQKENSALAPEPAAASKAALDVALEENQVSA
                     PNTDNNDESQARTVFQDPVHFNVKHPLYNEWTMWFDNPSHKGSWSAKERRETWGANLH
                     KVVNIKSVEEFWGLYNNIVPPSTLPQSANYYLFKDGIQPAWEDPANGNGGKWSIQLPR
                     EKHRNQIDKLWLYTMLSAIGEMLEAPSSDSKLPQSREDELVTGVVLQARSNYYRVSIW
                     TRYADEWDSPNSQEKEVTESIATGRRLLALGRFFKTEVLGYPLDAKIGGGFSSEVEFQ
                     SHKDSEKKRGKRGLV"
     gene            complement(<26872..>28569)
                     /locus_tag="MRET_2846"
                     /note="MRES_09470"
                     /db_xref="GeneID:38739612"
     mRNA            complement(<26872..>28569)
                     /locus_tag="MRET_2846"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629473.1"
                     /db_xref="GeneID:38739612"
     CDS             complement(26872..28569)
                     /locus_tag="MRET_2846"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485468.1"
                     /db_xref="GeneID:38739612"
                     /translation="MPSTEGGPDNTSSSIGTSLKEGDAAAMPQPSKASFSAEAGPHQP
                     AGINTKATLQRTSPSLPTSPTGGQFPISAENDKVKEKENSSLRILRRMLPGSSASNTN
                     DRDTGIHGMSASMQDAGLLSRRNSGAPPSPAQESFAQKNGSIRADADESALTDSLENL
                     HLKSHSGQPLSRTPSFKARDRQNSTHAIDSIPENRLTSKALQDLDARGRSNSISQQEK
                     AKATSHGASLREMIMNNPMISRKSSSHRSDGSTSSKGTKDGKKRKGLGAMSSVPGSGE
                     VASLLKKYGTCERVAIGKGATAVVRVAYKRDQSKEQMYAVKEFRKRRKNESEKDYVKK
                     LTSEFCISSTLHHVNIVETVDLVQDENQHWCEVMEYCPGGDLYAAIKKGGMKQVEMES
                     YFKQTVNGIHYLHSMGVAHRDIKPENLLLDGKGHVKITDFGVSDVFRMCWEKSTHYSK
                     GLCGSEPYIAPEQFEQKEYDARLVDIWAIAIVFYCMQCQELPWRVAKMSDPTFQEFVH
                     SYLGSAMPRPLPNLSPRECRPLLKKMLCPDPKMRCMTDEVVKDPWFIQVPSVVPQSL"
     gene            <28902..>29989
                     /locus_tag="MRET_2847"
                     /note="MRES_09475"
                     /db_xref="GeneID:38739613"
     mRNA            join(<28902..28912,28954..29045,29091..>29989)
                     /locus_tag="MRET_2847"
                     /product="porphobilinogen synthase"
                     /transcript_id="XM_027629474.1"
                     /db_xref="GeneID:38739613"
     CDS             join(28902..28912,28954..29045,29091..29989)
                     /locus_tag="MRET_2847"
                     /codon_start=1
                     /product="porphobilinogen synthase"
                     /protein_id="XP_027485680.1"
                     /db_xref="GeneID:38739613"
                     /translation="MGHNTILHSSIQTPLGRELQAQGVTLKKSSLMYPIFLTDEPFAK
                     EPLGSMPNQFRWGVERLGEFLGPLVERGLCSVIIFGVPTTKPKDEVGTLADDCEGPVI
                     QGIKKIRQIFPSLYVAVDVCLCEYTSHGHCGILCPDGSINNDKSIARLSDVAVAYAKA
                     GAHCVAPSDMMDNRIQAIHEGLKREGLAHRTSIMAYSAKFASSMYGPFREAVASAPAF
                     GDRRCYQLPPNARGLARRAILRDVQEGADIVMVKPTMPYLDVLADARELAPDHPRACY
                     HVSGEYAILHAAASAGVGDLRAMVEESMTSMLRAGATLILTYFTPELLTWLDHPRAC"
     gene            complement(<29993..>30858)
                     /locus_tag="MRET_2848"
                     /note="MRES_09480"
                     /db_xref="GeneID:38739614"
     mRNA            complement(join(<29993..30804,30831..>30858))
                     /locus_tag="MRET_2848"
                     /product="protein FET5"
                     /transcript_id="XM_027629475.1"
                     /db_xref="GeneID:38739614"
     CDS             complement(join(29993..30804,30831..30858))
                     /locus_tag="MRET_2848"
                     /codon_start=1
                     /product="protein FET5"
                     /protein_id="XP_027485428.1"
                     /db_xref="GeneID:38739614"
                     /translation="MGRYAVLVTGPAGAGKSTFCASLMAHAHSLGRNMHLFNLDPAAE
                     RFEYEPTIDIRELISLEDVMEEMDLGPNGGLIYCFDYLLNNLDWLETELGEYDNDYLV
                     IDCPGQIELYTHFPVISRFVELMQQQFHFRVCATYLLDSHFIDDKAKYFAGVLSAMSA
                     MINLDISHLNIMTKMDLVAQHEKNGLSYAQRREIERYMEPDPLLFADQDESLNNARFH
                     ALNQAVVQLIEDYSMVSFLPLDLSSEESINLIFSCIDNVMQFGEDEEPVEPKDLENED
                     ANE"
     gene            complement(<30922..>31664)
                     /locus_tag="MRET_2849"
                     /note="MRES_09485"
                     /db_xref="GeneID:38739615"
     mRNA            complement(join(<30922..30936,30965..30993,31022..>31664))
                     /locus_tag="MRET_2849"
                     /product="protein CWC15"
                     /transcript_id="XM_027629476.1"
                     /db_xref="GeneID:38739615"
     CDS             complement(join(30922..30936,30965..30993,31022..31664))
                     /locus_tag="MRET_2849"
                     /codon_start=1
                     /product="protein CWC15"
                     /protein_id="XP_027485424.1"
                     /db_xref="GeneID:38739615"
                     /translation="MSSAHRPTWEPARAKADVAHISQVQSKYATPTHTRLKFRRPGDT
                     QKRSLQELKAELEAGENRAFVERHPDAEMPHAKQPKLITLEEDADDEDLRIPAANDDD
                     DNEVDDEDEDDDEDDTEALLRELEKVKQERREQQERQEQSAKTQQQLSREEEIARGNP
                     LLNLERALHGDKIPTASEPLDTPQERWDDDLIFRNQAMNDENALSKRGFVNDLTRTEF
                     HKKFMSRYIK"
     gene            <31663..>33030
                     /locus_tag="MRET_2850"
                     /note="MRES_09490"
                     /db_xref="GeneID:38739616"
     mRNA            <31663..>33030
                     /locus_tag="MRET_2850"
                     /product="PCI domain 2 protein"
                     /transcript_id="XM_027629477.1"
                     /db_xref="GeneID:38739616"
     CDS             31663..33030
                     /locus_tag="MRET_2850"
                     /codon_start=1
                     /product="PCI domain 2 protein"
                     /protein_id="XP_027485406.1"
                     /db_xref="GeneID:38739616"
                     /translation="MVNGLVARETPIPRTILVTSTLPTRMAAVSHFVSEFAQACQTND
                     GEGLFKCMALDDESFYMLQSALQSVSVGDVCDKALSLSSSMHTKRFTSLLHDTLEYTK
                     SKPFVLNAYSHTGAYDAWVKVYSSMMSCFTLPETVWLLRALKYVALQLVLLAIHMDNG
                     PPYGKTIDAAGRLSKAAGLAANDRSSLPGTCTKRAAVLKLANLSFRAYFKLRNTRLCE
                     TVLGSVNNALLMNRQNDDSDPTGEALYPVSERVTYHFYVGQIRLLQHRVQVAAQHLHW
                     AFDHCTNSHPHNKRKILISLMAAQLILGRYPHAVLLDQFHLRDTFGPMVHCHRLGHAV
                     GVMSELERHREWLRTRGLYMLLREKLVLGLWRNLFQRCMRLNPHVDEASNAPPTLPLA
                     MLVGPARLAWKDNTLLLEDMECMAANLVDQGLMKAYILHSKSMIVLQRGPFRGFPPMS
                     DVYQA"
     gene            complement(<33027..>33995)
                     /locus_tag="MRET_2851"
                     /note="MRES_09495"
                     /db_xref="GeneID:38739617"
     mRNA            complement(<33027..>33995)
                     /locus_tag="MRET_2851"
                     /product="tRNA (guanine9-N1)-methyltransferase"
                     /transcript_id="XM_027629478.1"
                     /db_xref="GeneID:38739617"
     CDS             complement(33027..33995)
                     /locus_tag="MRET_2851"
                     /codon_start=1
                     /product="tRNA (guanine9-N1)-methyltransferase"
                     /protein_id="XP_027485410.1"
                     /db_xref="GeneID:38739617"
                     /translation="MGEDAGPGTAPPVEMRDPVTGKMVLMTKSAAKKLARRERREQKK
                     ESTKLERRTRERARRKERRKQEREAREKDPSLEVHRERKPPAQVFDARVVVDLGFDDL
                     MTVDETTSLAAQLGYLYGVNRSSSHPFREVVFTGADRISGRGLGFFPPEGGANTFPSM
                     PSTSESSLFQDRVGQHMEVKSVGMWRRWKRIKLQEYGGLEALWHGHKDQLPVCDKQDV
                     IYLTADTDDTIATLEPGKTYVIGGIVDRNRYKHLCAKKAEALGVRVARLPIDPSFLDG
                     QKINARKVLTVNQVFAILVGWTETRDWTAALKRGLPTRKFENEESS"
     gene            <34097..>35699
                     /locus_tag="MRET_2852"
                     /note="MRES_09500"
                     /db_xref="GeneID:38739618"
     mRNA            join(<34097..34193,34219..>35699)
                     /locus_tag="MRET_2852"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629479.1"
                     /db_xref="GeneID:38739618"
     CDS             join(34097..34193,34219..35699)
                     /locus_tag="MRET_2852"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485413.1"
                     /db_xref="GeneID:38739618"
                     /translation="MDRRVPWGTSSEGHPYAYRQDMANPYATQADISSSPYGDSVPSA
                     QASAQPVPTEQERDYVYFRRDTNHMNKATVDAAKSAKMRLEHYYRMTVDQAIERNQRR
                     TDLEKRLLNPPDGIPISDERKARQLAQLGRRETSFLRLRRTRLGLSDFRTVKVIGKGS
                     FGEVRVVQKVDTGKIYAMKTLRKSEMLKKDQLAHVRAERDVLAESNSPWVVQLYYSFQ
                     DSAYLYLLMEFLPGGDLMTMLIKYDTFSEDVTRFYIAECVLALEGIHQLGFIHRDIKP
                     DNILIDRKGHIKLSDFGLSTGFHKQHDNAYYQKLLEDPPQQSPVQSNRNSVAVNSITL
                     TLSSKDQIATWKANRRKLAYSTVGTPDYIAPEIFLQQGYGHECDWWSLGTIMFECLCG
                     YPPFCSENAHDTYRKILAWRETLQIPDDIHLSPEAEDMIFQLITAPEKRLGRNGAQEI
                     KDHPFFAGVDWSTIRQIDAPFVPHLSSVTDTSYFPTEDYQDVPDVPVGADTDVGAKDL
                     AFLGYTFRRYEANESAL"
     gene            <35901..>38975
                     /locus_tag="MRET_2853"
                     /note="MRES_09505"
                     /db_xref="GeneID:38739619"
     mRNA            <35901..>38975
                     /locus_tag="MRET_2853"
                     /product="glycine dehydrogenase"
                     /transcript_id="XM_027629480.1"
                     /db_xref="GeneID:38739619"
     CDS             35901..38975
                     /locus_tag="MRET_2853"
                     /codon_start=1
                     /product="glycine dehydrogenase"
                     /protein_id="XP_027485415.1"
                     /db_xref="GeneID:38739619"
                     /translation="MFALRSVAKGRGVWSFPLRAQALSASARRALATASGADDVFHLE
                     TPRESESVFTAQDTFLRRHVGPRPEQVKHILNTLGYSSMDEFVRKTVPEEVYLPESSA
                     DERFLPALSESELARRGKELASQNKVFRSYIGMGYHNTQVPPVIMRNVLENPAWYTSY
                     TPYQPEISQGRLESLLNYQTMVKSLTGLDISNASLLDESTAAAEAMILALNNTKDKKR
                     KVFLVDEKVLPQTLSVLKGRALGFGIEVVQAPLHSDGKSALPADLKDRIMGVLVQYPD
                     MDGSLVDWAPLAKEVKQEGGLVVAATDLLALTMIKPPAEWGADVAVGNAGRFGVPPGY
                     GGPQAGFFAASDALKRRMPGRLIGVSRDVTGRPAYRLALQTREQHIRREKATSNICTA
                     QALLANMSAMYAVYHGPRGLRRIAAKVHALTLVLKQQLQALGIKVLNHDALFFDTLTV
                     EAPATEVHEVARAKEINLRRITEDRVGITLDETVRLEDLADVVNVFARVLSKPELSAQ
                     DLMTTASKQGLSSASLDQLNVHPNFARTSSYLTQPVFNAYHSETSLLRYIHALQNKDL
                     SLVHAMIPLGSCTMKLNSTSSMNMLSFPEYHALHPFAPTEQAEGYQTLIKELEHDLAL
                     LTGFAAVSLQPNSGAQGEFTGLSVIRAYLAAHGQNHRHICLIPTSAHGTNPASAVMAG
                     MKVVPVKTLPDGTIDLDDLRAKAEANKDVLAASMITEPGTTGIFFSKIKEAIDIVHEF
                     GGQVYLDGANLQAQVGVTNPCIMGADVTHLNLHKTFSIPHGGGGPGVGPIGVKAHLAA
                     YLPGHPVVKTGGEHAIEPVSAAPWGSASILTIAWAYIRMLGWHGIRTSTIMSLLNANY
                     VKNRIQHKYKVKYVGKHGNVAHELLVDVAEFQKCGVQVMDVAKRLIDYGFHPPTCSWP
                     ISTGLLIEITESEPFEEIERLVEALLSIADEVQEINDGKQPKDVNLLKMAPHTIETLT
                     TEKWDRPYSRERAAFPVRALRNNKFWPPVSRVDDAYGDRNLVCECGDVESFA"
     gene            complement(<39079..>40551)
                     /locus_tag="MRET_2854"
                     /note="MRES_09510"
                     /db_xref="GeneID:38739620"
     mRNA            complement(<39079..>40551)
                     /locus_tag="MRET_2854"
                     /product="hexokinase"
                     /transcript_id="XM_027629481.1"
                     /db_xref="GeneID:38739620"
     CDS             complement(39079..40551)
                     /locus_tag="MRET_2854"
                     /codon_start=1
                     /product="hexokinase"
                     /protein_id="XP_027485705.1"
                     /db_xref="GeneID:38739620"
                     /translation="MVQQQETEDNNVTIFSRGSLCFDRPAAREDVLQEYQKHFEKLLT
                     VSNEALKEITDNFVRVLGEGLEKEGQAVPMLPTFVFGWPTGEEKGDFLALDMGGTNLR
                     TCLVKLNGDRTFELNQTKFRIQENHKHESGQKLFDYFGVCIREFLEKQYGSCDHLDEH
                     LSLGFTFSFPTIQKRIDHGELIRWTKGFGNPETEGHDCAEMLRQGLRDAAVPVKLSSI
                     INDTTGTLIASNYVEPDTKIACIFGTGCNAAYMEDVSEIPKLRHLNLPPHEKMAINCE
                     YGAFDSYEHKYLASVRTKYDEEIDLTSNKPHEQTFEKMIAGMYLGEIFRLILCDLVYE
                     GVLFLGQETYKIEKPFCFDTAFLSLIEADSTEELLTVMGLFKYFFSLETDLDERQFFR
                     RVAQLIGTRSARLSACGIAAIVKKKNLLEEGCTVGVDGSLYCKYPHFADRLHGALADI
                     LGPEAKKIKTRQAEDGSGAGSAVIAAMTTARKNKGHLADV"
     gene            complement(<40671..>42257)
                     /locus_tag="MRET_2855"
                     /note="MRES_09515"
                     /db_xref="GeneID:38739621"
     mRNA            complement(join(<40671..42101,42136..42176,42218..>42257))
                     /locus_tag="MRET_2855"
                     /product="UDP-galactopyranose mutase"
                     /transcript_id="XM_027629482.1"
                     /db_xref="GeneID:38739621"
     CDS             complement(join(40671..42101,42136..42176,42218..42257))
                     /locus_tag="MRET_2855"
                     /codon_start=1
                     /product="UDP-galactopyranose mutase"
                     /protein_id="XP_027485404.1"
                     /db_xref="GeneID:38739621"
                     /translation="MASQQVDTLVIGAGPTGLGAAKRLNQLNLGSWTLVDANEEAGGL
                     ASTDVTKEGFLFDVGGHVIFSHYAYFDDVLAQALPNKEDWYEHQRISYVRSRNVWVPY
                     PYQNNISMLPTDDQVKAIDGMIDAAELRIRAKEPPQTFDEWIIRMMGEGIADLFMRPY
                     NFKVWAVPTTMMQCKWLGERVAAPNLKLVVSNTLNKKIAGNWGPNATFKFPARDGTGG
                     IWKAVSKTLPQEKLQFKKKVLKVDAAAHTAYLSDGSSIKYKHLVSTMGLDYLVNTLEG
                     IDSDLKQRLQKSVTEKLVYSSTHVIGIGIRGELPNRIGDKCWLYFPEDDCPFYRATIF
                     SNYSPNNCPQKDAKLPTLQYADPAHGTPSSEAKEGPYWSLMMEVSESHLKPVDNDKLL
                     EDTIRGCVNTQLLLPDSEIVSTYHRKFTPGYPTPSLERDAGLQEILPTLLDQFDILSR
                     GRFGSWKYEVGNQDHSFMLGVEAADRALFGSPEVTLESPNFVNGRRNTERRLT"
     gene            <42553..>42959
                     /locus_tag="MRET_2856"
                     /note="MRES_09520"
                     /db_xref="GeneID:38739622"
     mRNA            join(<42553..42614,42660..42787,42829..>42959)
                     /locus_tag="MRET_2856"
                     /product="large subunit ribosomal protein L44e"
                     /transcript_id="XM_027629483.1"
                     /db_xref="GeneID:38739622"
     CDS             join(42553..42614,42660..42787,42829..42959)
                     /locus_tag="MRET_2856"
                     /codon_start=1
                     /product="large subunit ribosomal protein L44e"
                     /protein_id="XP_027485707.1"
                     /db_xref="GeneID:38739622"
                     /translation="MVNVPKTRRTYCKGKTCRKHTPHKVTQYKTGKASEFAQGKRRYV
                     RKQKGYGGQTKPVFQKKAKTTKKVVLRLECTVCKYRSHLALKRCKHFELGGEKKTKGA
                     ALVF"
     gene            complement(<43139..>45160)
                     /locus_tag="MRET_2857"
                     /note="MRES_09525"
                     /db_xref="GeneID:38739623"
     mRNA            complement(<43139..>45160)
                     /locus_tag="MRET_2857"
                     /product="serine/threonine-protein kinase BUR1"
                     /transcript_id="XM_027629484.1"
                     /db_xref="GeneID:38739623"
     CDS             complement(43139..45160)
                     /locus_tag="MRET_2857"
                     /codon_start=1
                     /product="serine/threonine-protein kinase BUR1"
                     /protein_id="XP_027485710.1"
                     /db_xref="GeneID:38739623"
                     /translation="MQRDESSSNAQLEARPSRSEETSNRTYDERSRSRSPPPRTGGSV
                     YGDRRSPTRSAPLIDRIRDGPPHGRRRPEDWADRSRDDRGKRNWSYDEDRPYSRREYS
                     YERPRPAPYYLDDANGGDSRRDELERNWKERQRPPRDDQRRWPPRNDLRRDDFRRSDT
                     RRDHHQPSQPCLIPPKRPPPPSRPQLQTPVKVRNGPRPGTLARRERAKPVSLPERSFL
                     GCSPVHAYEVSVKLGQGTFGEVKQGKQLSTGRSVALKKVTIYDAKDGLPITALREIKL
                     LKALKHPHIVSVIDMAYKPSSERGKMGEVYMVEPYMDHDLNGLLDNPNVQLPMNQIKL
                     YMRELLEGMMYLHKNRIMHRDMKAANLLIDNNGQLQIADFGLARPFHDFDEAWRTRGW
                     VSTHNYTEMVVTRWYRPPELLVGQRNYGPAIDMWGVGCILAEMITRKPIFKGTSEMNQ
                     LELIAALCGSPNDDNFPGWSKLPGVKNATPSGRPDNNPNIIGRHDFGRHPRVVKQHFT
                     TVVDCGRECADLIDRLLVLDPAKRLTAAEALEHEWFWTKPFPADPASLPKYLPSKEID
                     RNKRAPHNGMPMNPVGRPPIMTRPPPSIIPPGGMQSRPPAAPHGSMAVPTGMPPRPPP
                     RLGGSGAYPPLPRLPAAPSTGTGYGRPKDYGWYNPSAPRGSGGPPPRPY"
     gene            <45308..>46636
                     /locus_tag="MRET_2858"
                     /note="MRES_09530"
                     /db_xref="GeneID:38739624"
     mRNA            <45308..>46636
                     /locus_tag="MRET_2858"
                     /product="pre-mRNA-processing factor SLU7"
                     /transcript_id="XM_027629485.1"
                     /db_xref="GeneID:38739624"
     CDS             45308..46636
                     /locus_tag="MRET_2858"
                     /codon_start=1
                     /product="pre-mRNA-processing factor SLU7"
                     /protein_id="XP_027485375.1"
                     /db_xref="GeneID:38739624"
                     /translation="MSGSGFRDAFRPRDTDSARKPKNPNEEVNPNVPLYMAQTPWYLA
                     SGGNASLEHQRKPVQSGKAVAGLDDWYKRGIATSTATRFRKGACENCGAMSHKTRDCL
                     ERPRKRGAKWTGKDIKPDELTENLDHLDYNYDAKRDRWNGYDPASHMAVVERFEAVEE
                     ERRRLREEALDAQASTDVNMAKRIAKKEKSHRHHDDDFDSSSSDDDDDDNEKYAEKAN
                     MVGQKMDSDKRFTIRNLRIREDRAKYLYDLNADSAAHYDPKTRSMREAPLPNTSVEEL
                     KSGSDAFERASNGPTDVKQMQMFAWQAEQRSGTLLHMQANPTDHELQFRQAQQRKEQE
                     AKETKSSILERYGGAEHLDSIPAELRTGQTEAYVEYSRTGEIIRGQERAKPRSRYEED
                     VHENNHTSVWGSWYDLERGLWGYQCCHNTLRRSYCTGEAGKAANATAVLY"
     gene            complement(<46633..>47424)
                     /locus_tag="MRET_2859"
                     /db_xref="GeneID:38739625"
     mRNA            complement(join(<46633..46710,46741..>47424))
                     /locus_tag="MRET_2859"
                     /product="ribosome recycling factor"
                     /transcript_id="XM_027629486.1"
                     /db_xref="GeneID:38739625"
     CDS             complement(join(46633..46710,46741..47424))
                     /locus_tag="MRET_2859"
                     /codon_start=1
                     /product="ribosome recycling factor"
                     /protein_id="XP_027485378.1"
                     /db_xref="GeneID:38739625"
                     /translation="MSQRLLKLFHVAITQHVPRILARAPMIMPKYPSTARLLSSSHAV
                     LKKSKGGNSTVKNTEPMDVTPQLDLDGVVTQMFSAVKHCSETVRSMVGSLGRIDASIL
                     DDVRVSTGKGVKPTPLHDYATVGVRDDVLVITAFDSSSLKHIEKAVYALGRDLAPQIM
                     PDEEDVMIVHVPKPTGETRKMLLQRCIKECDHAKTKLRSVRQAAQKHMKHDMDNKLLS
                     KNDSQREAKKLEDITKKHSALIDQLVSDAQKRLLN"
     gene            complement(<47576..>48210)
                     /locus_tag="MRET_2860"
                     /db_xref="GeneID:38739626"
     mRNA            complement(join(<47576..48027,48054..>48210))
                     /locus_tag="MRET_2860"
                     /product="transcription initiation factor TFIID subunit
                     9B"
                     /transcript_id="XM_027629487.1"
                     /db_xref="GeneID:38739626"
     CDS             complement(join(47576..48027,48054..48210))
                     /locus_tag="MRET_2860"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     9B"
                     /protein_id="XP_027485292.1"
                     /db_xref="GeneID:38739626"
                     /translation="MSTDRTDTACRDEKPKSAPVPRDARLISLILASMGIEDAEPAVL
                     VQLLEFAHRYTSQVLQDALVYSDHASSRQGGSSVSIDDVQLAIQSRVNYSFTQPPPKE
                     MLLSLATTLNSVPLPPVSNRYGIRLPPPEHCLTNLNFAIVPDPPPKPEFGDSVIQPPV
                     VGQSVAQPDVSANDVEDTSMGEADTGESRGVKRTLDEDEDYD"
     gene            complement(<48331..>50963)
                     /locus_tag="MRET_2861"
                     /note="MRES_09535"
                     /db_xref="GeneID:38739627"
     mRNA            complement(join(<48331..50843,50882..50921,50961..>50963))
                     /locus_tag="MRET_2861"
                     /product="coatomer subunit delta"
                     /transcript_id="XM_027629488.1"
                     /db_xref="GeneID:38739627"
     CDS             complement(join(48331..50843,50882..50921,50961..50963))
                     /locus_tag="MRET_2861"
                     /codon_start=1
                     /product="coatomer subunit delta"
                     /protein_id="XP_027485291.1"
                     /db_xref="GeneID:38739627"
                     /translation="MVLLAASIATRGGKPVISRQFREMAGSRIEALLASFPKLINSGS
                     QHTFVETDTVRFVYQPLEDLYMILITTKHSNMLQDIDTLHLFARAVSDRCHSLDEQDI
                     LMSCFEILEAFDEIVSLGYRENVTLSQVRTMLEMDSHEERIHEIIERNKELEAKEELK
                     RRARQLEMQRRDAARRNHSGLGGDMSAISRTYEAVPSAPVYGLQDTIETASPAQAGPL
                     KGKGMSLGKKSKGSAILGSVQKTAPQAAALASKPAPKQQKPNIGVAPARKAERATNAP
                     QKVRAHAPLSHERSLAQEQEKARIPVQTQVSAPTESLMEESVLPTVNLPSVVHQAQDA
                     WAVAGSTEEQFNEVPDQASQTVYNEEAVDNAHEDGPTRAGILYEPQSIESAHQPEPYE
                     SENPYEKELYHGEQDHVQKTYDSGEIFESDKIYQPDEAYQPEQAYQPGDAYQPEEAYQ
                     PEEAYQSEEVYQPEEAYQSEEAYQPEEVYQPEEAYQPEEAYQTEEAYQTEEAYQPEEV
                     YQSEEAYQPQEADRPGEPYQPHNTYEGVGYDPEQVYHSQDSYHQSESIYQPEQSDAPK
                     QAYDHELETQVPTAVIPEVPSALDTQPAPIVSPTEPVSDQVHFMVKERVSATGNRDGG
                     LETLEVKGDLLLKITDPASTRLSILMDAQERFGGAEVQYRTHPHVDKQPWASERKIAL
                     RDPKREFPVNQQVGVLRWRAVTKDESVLPLSITVWVNPSGDGASEVVIEYQLENTSLV
                     LSDVVFAIPVPVGVLPEVSEPENGLYEVDPTNSRVLWRLPSVSDLNASASLELSVPNG
                     ADSADVFFPVSVDFSAEQTLLPLQILQVFDTRSGAQQPFSNEALLVADNYKIQ"
     gene            complement(<51132..>51802)
                     /locus_tag="MRET_2862"
                     /db_xref="GeneID:38739628"
     mRNA            complement(join(<51132..51507,51547..51604,51652..>51802))
                     /locus_tag="MRET_2862"
                     /product="20S proteasome subunit beta 4"
                     /transcript_id="XM_027629489.1"
                     /db_xref="GeneID:38739628"
     CDS             complement(join(51132..51507,51547..51604,51652..51802))
                     /locus_tag="MRET_2862"
                     /codon_start=1
                     /product="20S proteasome subunit beta 4"
                     /protein_id="XP_027485294.1"
                     /db_xref="GeneID:38739628"
                     /translation="MESLFGITGKGFTIIASDNNAARSIIKMKSDDDKQKVLSNHLVM
                     TYAGESGDTIQFAEYIERNMRLYSIRNNIDLRPKAAASWIRSQLAESIRSRHPYQVNL
                     LLGGYDEPSSEPALYWIDYLGTLVQVPFAAHGYASYLTLSTMDRYHRPDMSLEEGLQL
                     LKQCINEMRTRFVIDVGSFSVRIITREGVREVAI"
     gene            <51946..>52785
                     /locus_tag="MRET_2863"
                     /note="MRES_09540"
                     /db_xref="GeneID:38739629"
     mRNA            <51946..>52785
                     /locus_tag="MRET_2863"
                     /product="kinetochore protein Mis12/MTW1"
                     /transcript_id="XM_027629490.1"
                     /db_xref="GeneID:38739629"
     CDS             51946..52785
                     /locus_tag="MRET_2863"
                     /codon_start=1
                     /product="kinetochore protein Mis12/MTW1"
                     /protein_id="XP_027485293.1"
                     /db_xref="GeneID:38739629"
                     /translation="MSDTAGVSDAEAARRHIILTEVFGVHPRVIVDALVVSANEHLYI
                     RGSQLEDTVYALLGDTEHADKAAEEGVHSITTLLEHVIDHTMDTFELYCLRSIFVITP
                     EQSQFMTMAHHRGLDLRPAEPAPQEAQSDDSNTVSIVPGLEDQLQRRLACARATQHRL
                     AQAEAASKLRLNRIITAARAFDFILEGARTFCEENDANASGAVTNTADDIMSQVYNVL
                     EALSTLMDAEPLTVSLPPTSHNTINDSEESATVDTRREWEKGRDEYLNWEAQRILASM
                     KRT"
     gene            complement(<52850..>54334)
                     /locus_tag="MRET_2864"
                     /note="MRES_09545"
                     /db_xref="GeneID:38739630"
     mRNA            complement(<52850..>54334)
                     /locus_tag="MRET_2864"
                     /product="splicing factor 1"
                     /transcript_id="XM_027629491.1"
                     /db_xref="GeneID:38739630"
     CDS             complement(52850..54334)
                     /locus_tag="MRET_2864"
                     /codon_start=1
                     /product="splicing factor 1"
                     /protein_id="XP_027485289.1"
                     /db_xref="GeneID:38739630"
                     /translation="MSWRNSAQRTGMNAQPLGNTRRWGSGASSGIGAGGYERAPPKRS
                     YDYDMSRASHHEGARKRRSRWGDESDRKDASSAAITGNVSGQELDRYAIQVRLDEINR
                     KLRTGDVIPPERERSPSPPPTYDSQGFRNNTREIRYHRKLSEERTRLIERQMRLDPSY
                     RPPLDYQSSRKSGRPTEKVYLPVREFPEINFFGLLVGPRGNTLKKMESQSGAKIHIRG
                     RGSVKHGKGSTEGEEEDMHCIVTADSERSIKLCIKLINEVVATAASTPETQNDHKRSQ
                     LRELAVLNGTLRDDENQVCQNCGERGHRKFECPHERNWTTYTVCHRCGQSGHLARDCF
                     SAPRAAGDGMDAVGNQVDTEYATLMAELGEQPGGYASGYLGVPGYAGPPKNERGEKIP
                     PWRDPSVWNAPGPGRSQHDSLPDSSYAEGGWTAVGYDYGWGTDGGQAGADGQRDYSAE
                     WAAYYAAQAAQQQQMQESGGQGVRDYSKEWEEYYRQQALAQQQQ"
     gene            <54483..>55408
                     /locus_tag="MRET_2865"
                     /db_xref="GeneID:38739631"
     mRNA            join(<54483..55001,55031..55117,55146..55160,
                     55187..>55408)
                     /locus_tag="MRET_2865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629492.1"
                     /db_xref="GeneID:38739631"
     CDS             join(54483..55001,55031..55117,55146..55160,55187..55408)
                     /locus_tag="MRET_2865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485288.1"
                     /db_xref="GeneID:38739631"
                     /translation="MAKDSNAAQRRSNKARQQAKGKKVQANAPKKEPKTSELETSTAP
                     PNLDKQDAPTQLVLEQTLHEQEDQIAALRQKNEALQNELKETQHTLQESHRAFADQMV
                     GLSASFDQDKEEACKQVRTELDQVRAELNVSRYKERALTEQLHELENKIQIDASAALS
                     PFTALKDIQAQLHDVVAHASNPPNESFASIAESFGYTQDSEYTFVEKLHAAHHAKYTN
                     LYLATKQGFQALTNEFTRTLTQMEQALKDTTPDKMESVLRSVRDYQARLMQECRHFIG
                     PESR"
     gene            <55497..>56525
                     /locus_tag="MRET_2866"
                     /note="MRES_09550"
                     /db_xref="GeneID:38739632"
     mRNA            <55497..>56525
                     /locus_tag="MRET_2866"
                     /product="diacylglycerol kinase (CTP)"
                     /transcript_id="XM_027629493.1"
                     /db_xref="GeneID:38739632"
     CDS             55497..56525
                     /locus_tag="MRET_2866"
                     /codon_start=1
                     /product="diacylglycerol kinase (CTP)"
                     /protein_id="XP_027485580.1"
                     /db_xref="GeneID:38739632"
                     /translation="MGDTNTLKQAPPAMPQRSNSRDTGGAVLRALARSPHYNENLHRE
                     DLKPVPALDLNDKTGGSMYANLVYEWEVPRKLFHCITGFVVLYLYKMNVNVEVIIQTL
                     FNIFLVVASADLLRLNSPTFERFFESILSVLMRESEKERVNGVVWYLIGVMTSLHFFP
                     EDIASVSIIVLSWCDPAASTFGRMFGKCTPSLPGGIFARRKSLAGFLAAWAVGSLIAY
                     LFWGAGIAKAGERASGLSWEPASNAMFGTALMPDALRTGWRGFARGFAVTDSNFAERL
                     RNLTRPRIPAMPPILMFTLCGLIAAMTEALELGGLDDNVAIPILFSFLLWFSLWAWGQ
                     IMSSMSLL"
     gene            complement(<56618..>57069)
                     /locus_tag="MRET_2867"
                     /db_xref="GeneID:38739633"
     mRNA            complement(join(<56618..56752,56783..56923,56959..>57069))
                     /locus_tag="MRET_2867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629494.1"
                     /db_xref="GeneID:38739633"
     CDS             complement(join(56618..56752,56783..56923,56959..57069))
                     /locus_tag="MRET_2867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485290.1"
                     /db_xref="GeneID:38739633"
                     /translation="MTSTEKPAAWLEHASGALDREYICMPVGECQPCPEDHLAYPYCR
                     PYNNRQPVECLQTITGAQVPGWSACGKFIHAEVYKYTQYVLINVLIMVLALSVYIWRQ
                     VYQTRKYEGMLYQRVHGRSTLRRPRE"
     gene            complement(<57132..>59300)
                     /locus_tag="MRET_2868"
                     /note="MRES_09555"
                     /db_xref="GeneID:38739634"
     mRNA            complement(<57132..>59300)
                     /locus_tag="MRET_2868"
                     /product="pre-mRNA-splicing factor clf1"
                     /transcript_id="XM_027629495.1"
                     /db_xref="GeneID:38739634"
     CDS             complement(57132..59300)
                     /locus_tag="MRET_2868"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor clf1"
                     /protein_id="XP_027485296.1"
                     /db_xref="GeneID:38739634"
                     /translation="MSIEGRAPRIKNRAPAPLQITAEQLLREAQERQIAPKRKAPRLR
                     IESYEELEDYRARKRTEFEDAIRRLRGNMAAWIRYATWEATQGQMDRARSVFERALDV
                     NPHHIPLWLRYTEQELKMRNINHARNLFDRAVSILPRIDQLWYKYVHVEELLGNVNGT
                     REIFERWMEWEPDERAWNAYIAFEMRYHEFDKASAVWERAVTCHPEPKQWIKWAKYEE
                     DRDSLDKARQVFHMALDFYGEEEEALERAQTIFTAFAKMEIRQGEYDRARMIYKYALE
                     RIPRAKSEGIYTSYTKFEKQFGNMKGVEDTVTQKRRLQYEEEIEEADGTSNYDTWFNY
                     TRLEEEYYRSLLEEDASGATLESACNKVRNVYERALRLVPPAPEKRLWRRYIYLWLRY
                     ALFEELDAQDLDRAKKVYASGLSLVPHQEFTFAKLWLNYAKFEIRRLDLPLARKLLGT
                     AIGVSPKPKLFKGYIELELKLKEFDRARKLYEKWLEWDAGNAATWVKFAELEQNLFDL
                     DRARAIYELGIGQAESDSVGMDMPEVLWKAYIDFEFSERELERVDALYERLLGKTNHV
                     KVWISYALSKMAAALALEEDEDAEAEEEGLEIVLTEEKQAQRAAVRHEAANQTRQVFE
                     RGYKSLKEEGLKEERVVLLEAWKAFEAEHGDQTSLDTVQAKMPRITKQRRPVPNGIEG
                     TTEEYYDLTFPEDEEQHKPSHKLLQMARAWHAQRTASEAS"
     gene            <59544..>60362
                     /locus_tag="MRET_2869"
                     /db_xref="GeneID:38739635"
     mRNA            <59544..>60362
                     /locus_tag="MRET_2869"
                     /product="copper ion binding protein"
                     /transcript_id="XM_027629496.1"
                     /db_xref="GeneID:38739635"
     CDS             59544..60362
                     /locus_tag="MRET_2869"
                     /codon_start=1
                     /product="copper ion binding protein"
                     /protein_id="XP_027485295.1"
                     /db_xref="GeneID:38739635"
                     /translation="MSAVPTRKIPSEGGKSLKLACATCIQGHRASSCKHQDGSKGPLL
                     VVKRRGRPLSQCQECRERRLLTGRHTRCDCKKKEKKTAEPSEERPMKRRVSNSSTPID
                     LSSRASSCKQGPLSFEFLLNPCKCEDGTICVCCRSPYDDQKLEPITSCYKENFANIAP
                     TLPKEQSSSSCCVPPSIKLQDDVNRSMKLLAKAADMSRSYTPECQCIGPCRCKGCLGH
                     DSKYNQAELSDAPTCKTCVACDISMENPTGIDTIDRWAFTDAGVSSQRFAYDVK"
     gene            complement(60774..60880)
                     /locus_tag="MRET_t0047"
                     /db_xref="GeneID:38741241"
     tRNA            complement(60774..60880)
                     /locus_tag="MRET_t0047"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:38741241"
     gene            complement(<61002..>62855)
                     /locus_tag="MRET_2870"
                     /note="MRES_09560"
                     /db_xref="GeneID:38739636"
     mRNA            complement(<61002..>62855)
                     /locus_tag="MRET_2870"
                     /product="eukaryotic sulfide quinone oxidoreductase"
                     /transcript_id="XM_027629497.1"
                     /db_xref="GeneID:38739636"
     CDS             complement(61002..62855)
                     /locus_tag="MRET_2870"
                     /codon_start=1
                     /product="eukaryotic sulfide quinone oxidoreductase"
                     /protein_id="XP_027485336.1"
                     /db_xref="GeneID:38739636"
                     /translation="MMALFSQGMRVATMPKRMGRVQLFSSSARALNAAHKVVVVGGGT
                     AGLSVAHQLLNSGKFAQDEIAIVEPSNFHDYQPGWTLVGGGLKTRENLRRREDSLVDS
                     KIQLYKDAVTTMSPEQNQVMMASGEKLEYDHLVIASGYSITLDSIKGLREALYNPESS
                     VASIYTYDTVEQVFPKLNRLKEGEAIFTQPSSPIKCAGAPQKIMWLALDHWQNAGLYK
                     KDPSSPIKITFAQGMPTMFSVPHYSKVLDELREERGVTGLFQHNLVAIEDNAKTAVFQ
                     RPDGEQVKKSFDFMHVVPTMSPPEFLKKSPLANGGGYAEVDQGTLRHVKYDNVWSLGD
                     SSSLPTSKTAAAITGQSPVLVANLLSALENKEPIATYDGYTSCPLITEYGKVLLAEFK
                     YGLQLKETFSKYGLDQSKPQRAFYYLKKDFFPWVYYNSMVKGKWAGPKGFLGSVRSFS
                     TSARNMRNTPVRHPRDPLDTSAYATRFPLTSGETFVVRPPPSQESSRMNVEASQALFD
                     AAAPLSDERLANLPPALAKHHRQARAATNQVTDDQIAQMQVLRNQDPYTNTAGHLAKE
                     FGCSPTFVSIVAPAPKSVRQAREAESELKKATWGMNKRISRAQRAERRALW"
     gene            complement(<63040..>64806)
                     /locus_tag="MRET_2871"
                     /note="MRES_09565"
                     /db_xref="GeneID:38739637"
     mRNA            complement(<63040..>64806)
                     /locus_tag="MRET_2871"
                     /product="transporter"
                     /transcript_id="XM_027629498.1"
                     /db_xref="GeneID:38739637"
     CDS             complement(63040..64806)
                     /locus_tag="MRET_2871"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027485337.1"
                     /db_xref="GeneID:38739637"
                     /translation="MSGQPQDSVPRVRIEEELVEQPTSTWHDEEVKADYESIDSNVLF
                     AKEVGVSVDYSRQIALVNKIIHEDIGFGAFQIKLTLLAGFGWLADNIWFEVLSMTLTL
                     VKEEWNLGEREHSPKWATFSLYSGLLIGSLAWGFLSDVIGRRPSWNLTLFISAAFGIA
                     VGAAPSFPVMCVLLGLLGLGLGGNLPVDGAMLIEYIPGPQQWILTFLSLFWCIGQLYA
                     ALISWAFITNYYCEDNINWKGSDNDKPPCLKADNWGWRYSWFLLGGTVMLMFIIRFLV
                     YPVPESPKFLLAAGREEEAYEVLLFIAKENKKKLHLTFEQLRDAKFKPIAYDATNTVH
                     AVVESDSPKENPKSQVQYGSKYTRWMQRSWNMSGLRPDNIRRTLKHIDRSPLSALFAS
                     RKMARNTIFITLCWGLIGLAYPLYNSFIATYLAQINDASDDAESLSRQYRDLVIMSVC
                     GIPGSFVAAAGVEIPRIGRRGTMAFFTMLTGLFLFLFTTANNSSAILGWNCAVNLTQN
                     AMYAVLYAITYEVFPAPQRGTGDGLSMSVQRVFGIVATIVAVYASQNGFKPPIYVSAS
                     AFIVTSALMLLLPYEPRGTTAI"
     gene            <65050..>65850
                     /locus_tag="MRET_2872"
                     /db_xref="GeneID:38739638"
     mRNA            join(<65050..65744,65772..>65850)
                     /locus_tag="MRET_2872"
                     /product="mitochondrial genome maintenance protein MGM101"
                     /transcript_id="XM_027629499.1"
                     /db_xref="GeneID:38739638"
     CDS             join(65050..65744,65772..65850)
                     /locus_tag="MRET_2872"
                     /codon_start=1
                     /product="mitochondrial genome maintenance protein MGM101"
                     /protein_id="XP_027485334.1"
                     /db_xref="GeneID:38739638"
                     /translation="MLSTGHAVRHTLFKGAPLRCFSLSAQRSSANVSSWADRMTSASS
                     VRTPKPANANVPPPIQSNKDNLPNKPEQMNPASQMECSLGYDGIGIRPFPSHVAQVLC
                     EPIQKDDVEIKPDGLLYLPEIKYRRILNRAFGPGGWGLKPQGEPEIAQGILSREWTLI
                     CLGRFVSTARGEQEFFRPNGVPTANEGAKSNALMRCCKDLGIASELWDPRFVRQFKAK
                     HCVEVWCQTADGKKKKYWRRRDDEPFQYPAKEVGTVGKT"
     gene            complement(<65853..>67253)
                     /locus_tag="MRET_2873"
                     /note="MRES_09570"
                     /db_xref="GeneID:38739639"
     mRNA            complement(<65853..>67253)
                     /locus_tag="MRET_2873"
                     /product="ATP-dependent RNA helicase DDX47/RRP3"
                     /transcript_id="XM_027629500.1"
                     /db_xref="GeneID:38739639"
     CDS             complement(65853..67253)
                     /locus_tag="MRET_2873"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX47/RRP3"
                     /protein_id="XP_027485335.1"
                     /db_xref="GeneID:38739639"
                     /translation="MDSRPDEKAPREASSDVQVEESEEPIVSFKELGVIDPICEACEK
                     LHFSRPTPIQTKAIPEALQGRDVIGLAQTGSGKTAAFGIPILQGLWNDPRPFYACILS
                     PTRELSYQISQQIEALGATIGVRCATIVGGMDMMTQAIALSKRPHVIVATPGRLQDHL
                     ENTKGFSLRTLKYLVLDEADRLLDLDFGPVIDKLLQNIPKERRTMLFSATMTTKVAKL
                     QRASLRSPVRVEIGSKYSTASTLHQYYLFMPFAHKDTYLVHLANEQAGHSIIVFTRTV
                     HDAQRLAVLLRLLGFSAIPLHGQLSQTARLGALNKFKAGGRSIMVCTDVAARGLDIPA
                     VDMVVNFDIPTHSKDYIHRVGRTARAGRQGRSVTLVTQYDVELLQRIEAAIGKRLEEF
                     PEANDREMVMLLSERVGEAQRAALRELQEKGLGSASGAGRRKRKQAAGLDDDRDRDDD
                     VMEAGAYRSKKGHKRR"
     gene            <67357..>68990
                     /locus_tag="MRET_2874"
                     /note="MRES_09575"
                     /db_xref="GeneID:38739640"
     mRNA            join(<67357..67784,67817..>68990)
                     /locus_tag="MRET_2874"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629501.1"
                     /db_xref="GeneID:38739640"
     CDS             join(67357..67784,67817..68990)
                     /locus_tag="MRET_2874"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485332.1"
                     /db_xref="GeneID:38739640"
                     /translation="MPWDQWRHDLNHKLDKWGEEKFNLPASRESKKDKRGLSYEERLA
                     NIRSGGGAAGHMQVTPSQQRPRAVPPPPSSAQPSHPTTQYVTSQEAPAVVTASATPGA
                     TGPTGTTHIEFSRFTESDKQAFFALLDEYFSKQGVHGGDMWLDDAFDFDTELQPVGHG
                     LCSAVYKARSSLQAVIQEGGVPGYACLKQVDVDVQNAPHDIQREIALLQRTRHANLSV
                     LLAAFTDTPDPFTTIYNLVMPLYPIQLTDVLNSPHFQPANCSLSDVTNEDIPWIHLLG
                     SHTFASLVSTCFQQLMQAIAYLHREGIAHRDIKPSNVLFSTDGMLKLIDLGVAWEVNM
                     REIPPYGFHTSDGCSDRAYISDVGSGAFRAPELLFAPKNGYDAFKADIWSLGTVMAGF
                     FTVLLEEETPSMDYMPWERELFPSRPMRPQSRIYHRSTLFDSSSGDITLACDIFKVCG
                     LPSSVSDWPEAEHFQPPLGEFPFMHGAPRESLHERLPNWTQLSISDTSPAAQTLQVFV
                     QKILPTMMQLSASKRPSIDYLVTQL"
     gene            complement(<68987..>70177)
                     /locus_tag="MRET_2875"
                     /db_xref="GeneID:38739641"
     mRNA            complement(<68987..>70177)
                     /locus_tag="MRET_2875"
                     /product="mitochondrial inner membrane"
                     /transcript_id="XM_027629502.1"
                     /db_xref="GeneID:38739641"
     CDS             complement(68987..70177)
                     /locus_tag="MRET_2875"
                     /codon_start=1
                     /product="mitochondrial inner membrane"
                     /protein_id="XP_027485333.1"
                     /db_xref="GeneID:38739641"
                     /translation="MMLAARMCGRQYHGIGASRSAGLYGLIRLYAFHTGRVRSRQPRR
                     PRTQGEQFAELLRERMEEQLKHSTPPIKRATYQRPSTYRVPAQPVNQFVEARRRASGV
                     VDHPRLSLVAIILGGAGIYYVCHLEQVPSTGRWRFIDVGPLDEWKMGQEAYRSVLQQY
                     NGRILPSWSVQHAQVNRVAQRIIQACRYLDIHRAQGAPPSQWTVHVVNDPRQKNAFVL
                     PGGHIFVFTGILPVCENDAGLATVLAHEVAHQIARHSAEKMAGSKILMAGAFALDMLG
                     LDIGLSRIMLNLLLSLPNSRRIESEADELGLRIMSQACYDPRQAVQFWQRMNADEARS
                     GPLADSARQLLSTHPVNSQRISNIQHWLPYAERIYHSQHCGSTMPAIQALQRNASLQP
                     IPVN"
     gene            <70377..>72068
                     /locus_tag="MRET_2876"
                     /note="MRES_09580"
                     /db_xref="GeneID:38739642"
     mRNA            <70377..>72068
                     /locus_tag="MRET_2876"
                     /product="amino acid permease"
                     /transcript_id="XM_027629503.1"
                     /db_xref="GeneID:38739642"
     CDS             70377..72068
                     /locus_tag="MRET_2876"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_027485330.1"
                     /db_xref="GeneID:38739642"
                     /translation="MLSGPWADEKKNVYENIADENPKVVMKDVSHLSEALDDDDAALA
                     RRVGHRSEFAREFKSFSTISFAFAIMGLVSSIATTFASPFLLGGPASTVWAWFIGSIF
                     NMTLGTAIAELVSAYPSSGGLYSASGLLVPYKYRPTVAWITGWLNLTGQIAGIAGSEW
                     GLAQMIYAWAHVISDRKFSASRNATVGLYYALLFIHGLINSLDSKTLARLTSGYVVVN
                     IGITFVIIITLLATTPLHEMHGPSYTFGTIINQSGWQGQGGTALSFLFGLLSVQFVMT
                     DYDATAHISEEVHRASIAAPVAITVAVAGTGIIGWLLNIVLVITSGNIVHQNVDDMPG
                     GLPMAQIMVDRMGKVGFLVVWPFVCLVAFFVVTTATQANARSFYAFSRDHGLPDFGFF
                     AKVWKRTGTTVNAVWLVIFLCILLGLLGFISQAAINAIFALAALGMDVSYLIPIVCRQ
                     IFQDHPEVKFEPGPFTLGRGWFGRLINITAILWTIFECTILSIPQTLPLKATEFNYSW
                     VIMVGVLILSLIWYVAHAHRHYHGPRSTMPPELLSSLESTNEKQEKQDASSHAPE"
     gene            complement(<72347..>73396)
                     /locus_tag="MRET_2877"
                     /db_xref="GeneID:38739643"
     mRNA            complement(<72347..>73396)
                     /locus_tag="MRET_2877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629504.1"
                     /db_xref="GeneID:38739643"
     CDS             complement(72347..73396)
                     /locus_tag="MRET_2877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485331.1"
                     /db_xref="GeneID:38739643"
                     /translation="MLEGGETSETLAPPPMQDASRLKRPRVTSPGSKTLIEPEHGSAR
                     SPSLSASSADGGGNSARTSPSHRLPRYPIDAIEPPRKGPRLEPRLSPRPDALSEHRST
                     LAPYPTIVQRRAEKSMQKVPNLYLTPSRDGEVPEADTMGPSVRSAPPQQHHFGSDARL
                     PPPSLLFRASRRESLPENEDARKRQLPTALHQQDLQGYFPTPGGTPRLHLPPQGALPS
                     PAYHTVRMDPHTPRVNVERMLPAYEYSGRVTDASDAELASAPPRSPMAQKAQFLSLFS
                     DFFDSLADSRTLKATLEHQIRASHTLLQTLQRSNEVFEQAVEQRVKQETMAWETHFAR
                     LEDRIKHLESRLPDA"
     gene            complement(<73632..>75542)
                     /locus_tag="MRET_2878"
                     /note="MRES_09585"
                     /db_xref="GeneID:38739644"
     mRNA            complement(<73632..>75542)
                     /locus_tag="MRET_2878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629505.1"
                     /db_xref="GeneID:38739644"
     CDS             complement(73632..75542)
                     /locus_tag="MRET_2878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485338.1"
                     /db_xref="GeneID:38739644"
                     /translation="MPPRRKEIRKQREPESFESCMDAGVDQDERGERFSVGAKAERHY
                     VKALSLYQQAAQFRPSSVDAWYNAARVQYVLGTQFHLPPDALVTLIESCQLYVEALER
                     APMPSDGIPSASRLDVLSNGGYALQALAEFIDEWGTIEMDAACIITAERAGIKLRTTL
                     PTSLYMAAAMWFEQVIQGQELVLQQALVSITDPNAAHMKGPIIGDDKDDDAAEYTTSL
                     VSPSSLLESLCDEVNVYLAILPQTHDSHELESVLSMARTGLERAEQYVQSLPPGYGAS
                     QSPTNEWDEQIRSLDMAALGMQVMAMEQAAEWGAWPQLADLEALETSIQERAAALLAE
                     PPPSQSLTAVRLGAEAEARVQRYEENVSRLCDLGDYAHDLARLRIKLLASHVDAVSAE
                     HAWSLCTCASKCVRAAVAALETPGSASVARNLQGEKTWVPRDTQTTHVAPATNTSTSV
                     TRHRASMYMELSRISLTRCHEVLVAKYAPAAEAKGQLLDHARIYARKALADEGLAWIC
                     QIHQLPMQPGCVCGGALMHAPANGGSESLAQDANVLWQYVRALWMRGATKRTPEGEQE
                     LRVALAAIWSLSLSSDAYHLVLADAKHLQDMLDNTAAVLSDDERVFWDTVWTHVMTSM
                     EYDPFISHPLYE"
     gene            <75712..>79716
                     /locus_tag="MRET_2879"
                     /note="MRES_09590"
                     /db_xref="GeneID:38739645"
     mRNA            <75712..>79716
                     /locus_tag="MRET_2879"
                     /product="PH domain protein"
                     /transcript_id="XM_027629506.1"
                     /db_xref="GeneID:38739645"
     CDS             75712..79716
                     /locus_tag="MRET_2879"
                     /codon_start=1
                     /product="PH domain protein"
                     /protein_id="XP_027485339.1"
                     /db_xref="GeneID:38739645"
                     /translation="MTPDARQHCYSLSAHPHADHPLRRKVLGPIPSHVASNQMLLAEL
                     ERLGLANNAGLGASVPLSDANMIFSKRWNPRRAMRQRSVRSSQRLPRLPRRKRRGSTS
                     IVSSPSSPHETPTSPLSTIPEGLPANAPVSPTTPLPVHTPPSDTVRSKHRPPSIHTLT
                     PNEQSSSLNSRSKYSDTDSLFSPRSHHRHAWPHHGKLRRLGVFSPHSAATPLVWDETW
                     ATTEELDSEKLDEEERKNLISQLSITFLHQKMLGDSFEVGRTFFEQILKEEAETEVPV
                     SASAPPSIHMSPCAAKPLASSRHDNRNELVSKPRFLSSRPKRMPFGTRPKNDQAHVKF
                     ALPNDSNEIEDRTGWDAIRQKLESEGAVSIHTGRPSNTMLALENELDSKRAELTEMVS
                     SSHSLEYGIPHAPPNVSPPTIDTNNASTHVVPLTPPHETDMPSDDKRRRKGHHWIPHP
                     TVPQWFHDRQKALMGHKKVGGQSATPYAETSHSKSSASLETLAAEPTLDEGVHKVSEK
                     ITMETVTRTPTPPRPSDSSLQLKNPIEAHNEIHIPSPHRVAEVAHTSTTPMRLPQSLE
                     DGSIPVGLGDQSPPPVDEVLSRPIVAPVPSPATPNDHACLVLKRDRMLVKVQVATSDV
                     MGADFDEFEARRYDVRSFRWAEYVVILRPGRLELWSESSVCSHVLGDSDRLKLRYSVS
                     LRPEEATLSLYSETDRLLCLTCPRPLGTMGRLPFRRHGSMILILNARTFTAAADWMWL
                     LWRELGGSVPPHVFVYIPGISMRVRVPIPKLPDIHGLSREYDTVLDVPSPTPIEDYEE
                     YMPAALLREARRLVKAVPQWASLAEDMRARGLSPTLAWRSGTIYNWVLYDHTPEGAKR
                     YWNVLVGALLTNRRRAPVLELVMNNHYPTHVLHPSGHALSEPCGVEGFVGRLRNVSNV
                     ASRVYLSVHDGCVFLLRESYACVPDAFTGVPLGPIQGATRKERLSARIKQFEHYERVR
                     ESYQIRHSEGFIDLRDVCAIGHVETGIVLSIELQRHMMQLGQDPILSSALKNAQCVHD
                     YDGTRTAIDRRLEKVLRIDSTSRPMRRFQLFLNNGREVVFECASPSLACDWIVHLFML
                     TVYWRCRQKTDIRMLMNASGNRREHRYGAAYVDDLSLLSLPYLWNWCRIDHCRAVNLM
                     GHLFWRTNARHPFRRRVFVLCNGQILGFKLMSSTRTSTSRQNEGIVYRHKGAPILLRD
                     AYVYTGQMSDRSSDLQSNEFSIARSRNAKKHEIYEQLPRLYRDGLTSSESHEECSFVL
                     HVRRKPDSALPTHLSGHTAPSIAPRDYTEYMFRARTVLERDIWVRQICIEIEKMVRAD
                     PKREESIRRFGRIH"
     gene            complement(<79722..>80225)
                     /locus_tag="MRET_2880"
                     /db_xref="GeneID:38739646"
     mRNA            complement(<79722..>80225)
                     /locus_tag="MRET_2880"
                     /product="small subunit ribosomal protein S12"
                     /transcript_id="XM_027629507.1"
                     /db_xref="GeneID:38739646"
     CDS             complement(79722..80225)
                     /locus_tag="MRET_2880"
                     /codon_start=1
                     /product="small subunit ribosomal protein S12"
                     /protein_id="XP_027485636.1"
                     /db_xref="GeneID:38739646"
                     /translation="MWQALRGVAAGFASSSVRQNPRPVQYIPIVHRTLTTTPVWNVTL
                     QQAMRGARRPHRPPVNRVPALEGCPFVKGVCTKIFTTKPKKPNSAIRKMARVRLTNGR
                     TVTAYIPGEGHNLQEHSVVLMRGGRVQDVPGVRYTLVRGALDFGGVVGRTTSRSKYGA
                     KKPKDAL"
     gene            <80347..>81138
                     /locus_tag="MRET_2881"
                     /db_xref="GeneID:38739647"
     mRNA            <80347..>81138
                     /locus_tag="MRET_2881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629508.1"
                     /db_xref="GeneID:38739647"
     CDS             80347..81138
                     /locus_tag="MRET_2881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485627.1"
                     /db_xref="GeneID:38739647"
                     /translation="MNSEAANDASAPRFHGAIAYTLQKDAISRSLVCTAPDLAQVHGE
                     AFAACVPLASRLGEQAPVGRDAAVLWGADTAIHDIPRKIEDQVSSLLPSWYRMCNPVC
                     TQCHVPLVGGWTATRVPYYRRRPRQIRHRNNSKSTYSACTATACTVCKHQQPIAKPAS
                     ARSFSTVRQRQRQRACILAGQVSEVKPSLQTPSQKKKDAAIPPPAPAPTPPIPHLAIP
                     PPTTTKRKAPDNKAGLRALLQQKKQKEENASKKPTSNLAHFLQQL"
     gene            complement(<81200..>82077)
                     /locus_tag="MRET_2882"
                     /note="MRES_09595"
                     /db_xref="GeneID:38739648"
     mRNA            complement(join(<81200..81776,81998..>82077))
                     /locus_tag="MRET_2882"
                     /product="elongation factor 1-beta"
                     /transcript_id="XM_027629509.1"
                     /db_xref="GeneID:38739648"
     CDS             complement(join(81200..81776,81998..82077))
                     /locus_tag="MRET_2882"
                     /codon_start=1
                     /product="elongation factor 1-beta"
                     /protein_id="XP_027485262.1"
                     /db_xref="GeneID:38739648"
                     /translation="MSLPDFSNADTLSKFESFLSSKSYIDGHEATQADVAVYEAIKSP
                     VDSAKYPNISRWQEHIKSFEAEHASLKGDKSKAAELLNFSAAQGGDDEDIDLFGDEDE
                     VDPEAERIKAERVKEYEARKAAKGPRPPAKSVVTFDVKPWDDETDMVALEKEVRAIEM
                     DGLVWGASKLVPIGYGVNKLQITLVVEDDKVSMDDLQERVQEIEDYVQSSDIAAMQKL
                     "
     gene            <82315..>83709
                     /locus_tag="MRET_2883"
                     /note="MRES_09600"
                     /db_xref="GeneID:38739649"
     mRNA            join(<82315..82558,82590..82762,82801..>83709)
                     /locus_tag="MRET_2883"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027629510.1"
                     /db_xref="GeneID:38739649"
     CDS             join(82315..82558,82590..82762,82801..83709)
                     /locus_tag="MRET_2883"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027485582.1"
                     /db_xref="GeneID:38739649"
                     /translation="MLPPEYPVMYGVPSGMHPGMTASLESLHPFFPQARMPEAPLSED
                     DLAFFMLLVTYSDALDALPLETTRSFSDLRELDAVLGAHLGSLTQRLQHLASVIENPD
                     VPPSERLMILKEVAEEARAYKMGGEDKIRVAVNMSDMLASHTEYIDSLLRSLTSLPTL
                     GPYVQESRPQYKHLSDLSAYSVHGDPYSSGSNTLSASMELSAANIHRHYAPYQEMSSS
                     RARVERDPPNASRVNKKRKTMPPSVASRSERGAAPGSKRQYDDMDHGESSDDQGEAYE
                     TSADRLIRPHQRARTRVSDHDAPTKQQTATWSGRRAVDGSLSKDGASQGEVHRGSGRT
                     RPSKTTHAGSSGNEQDDQRYCFCNNVSYGDMIGCDDDDCEREWFHLGCVGLSKPPQGT
                     WYCDACLERRSQQSRAKTKRNSRPSRGVTTTAVVPDHPASARRITSTRR"
     gene            complement(<83780..>84121)
                     /locus_tag="MRET_2884"
                     /db_xref="GeneID:38739650"
     mRNA            complement(<83780..>84121)
                     /locus_tag="MRET_2884"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_027629511.1"
                     /db_xref="GeneID:38739650"
     CDS             complement(83780..84121)
                     /locus_tag="MRET_2884"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_027485261.1"
                     /db_xref="GeneID:38739650"
                     /translation="MGFQVDTIAPGDGKTFPKPGDTVDMHYVGKLQSNGNKFDSSRDR
                     GQPFRTRIGVGQVIRGWDEGVQQLSLGQKANLICSPDYAYGARGFPPIIPPNSTLVFE
                     VELLAINGKSA"
     gene            complement(<84348..>84919)
                     /locus_tag="MRET_2885"
                     /note="MRES_09605"
                     /db_xref="GeneID:38739651"
     mRNA            complement(join(<84348..84363,84404..84459,84490..84525,
                     84561..84662,84690..84761,84803..84862,84899..>84919))
                     /locus_tag="MRET_2885"
                     /product="nuclear transport factor"
                     /transcript_id="XM_027629512.1"
                     /db_xref="GeneID:38739651"
     CDS             complement(join(84348..84363,84404..84459,84490..84525,
                     84561..84662,84690..84761,84803..84862,84899..84919))
                     /locus_tag="MRET_2885"
                     /codon_start=1
                     /product="nuclear transport factor"
                     /protein_id="XP_027485382.1"
                     /db_xref="GeneID:38739651"
                     /translation="MEQVAQQFTDFYYSTFDTDRSQLGSLYRPHSMLTFEGAQTQGAQ
                     AIVEKLVSLPFQKVQHKVDTRDAQPTGDGNSLVVLVTGMLLVDDGQNPLKFSQLFTLV
                     PEGGSFYVFNDIFRLNYG"
     gene            <85600..>87177
                     /locus_tag="MRET_2886"
                     /note="MRES_09610"
                     /db_xref="GeneID:38739652"
     mRNA            <85600..>87177
                     /locus_tag="MRET_2886"
                     /product="aspartic-type endopeptidase CTSD"
                     /transcript_id="XM_027629513.1"
                     /db_xref="GeneID:38739652"
     CDS             85600..87177
                     /locus_tag="MRET_2886"
                     /codon_start=1
                     /product="aspartic-type endopeptidase CTSD"
                     /protein_id="XP_027485259.1"
                     /db_xref="GeneID:38739652"
                     /translation="MVQITSSCFIPLIALIPTFLNGILSDVTGSSYSPLSFVNAASTH
                     SDNSTDLQAGLIHMSLMSDVDEDDASFVHPWIKLQQHMNHGKRRMAQMKGMDSPSKEE
                     MLDAVKRRELDVRRESEDDAKMLDFRLPRIKSKPQSIKSDESNTRPKRRDSRFDAASP
                     FGLSPRRAGFSSTEAKMQSSYSVTNAPDVSAKNTEGLAIEANDVGYFVEVKIGSSDTT
                     FKMLVDSGSSDTWVTGTSCKNCGPSSRQKMGKSLSQSLKTTNDNFKISYGSGNVGVTL
                     VKDSFSIAGLSLDTYTFGMASSESDDFGADKIPFDGLIGLGGSSLSITKQDTLVDALA
                     KANKINKPIVGIRLGRAADGSGGNKGQITFGGVDQSQIDGNLNQVENQSKEGYWAVQV
                     DSVSLDSNQVSGSSTAVLDTGTSLIIAPKSAADKIHDAIPGAKSDGHGGYTLPCTTRK
                     KLSFKISGTTYTMDSRDLLFAPKDSNNLKGTCISAVSSGETMDGASWLLGAAFLKNVY
                     FATNSDANRIGLGKLKN"
     gene            complement(<87314..>88048)
                     /locus_tag="MRET_2887"
                     /note="MRES_09615"
                     /db_xref="GeneID:38739653"
     mRNA            complement(<87314..>88048)
                     /locus_tag="MRET_2887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629514.1"
                     /db_xref="GeneID:38739653"
     CDS             complement(87314..88048)
                     /locus_tag="MRET_2887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485539.1"
                     /db_xref="GeneID:38739653"
                     /translation="MHCILVLLSFFLGLLALVRAEAHEEAPELNVITTFPNNPFNIVK
                     NGQSTRVVFTFTQPRGVERAIAVNSLTGAFLDPARKDGERKRIMRNMTNRILHDDPLV
                     QFTNGKPLQLPYDIHSEFKPQKLDIELRATVTDKSSLNKYNVLLYRGSVTVEEPPQSL
                     WDLELLSVYLFLAGLVGAVAYYVYVSYIQPTLRANISTSSSKRKDKTPAPVANKDGKT
                     YDESWIPEEAISQQQRPRARKNRSRK"
     gene            complement(<88144..>92874)
                     /locus_tag="MRET_2888"
                     /note="MRES_09620"
                     /db_xref="GeneID:38739654"
     mRNA            complement(<88144..>92874)
                     /locus_tag="MRET_2888"
                     /product="transcription initiation factor TFIID subunit 2"
                     /transcript_id="XM_027629515.1"
                     /db_xref="GeneID:38739654"
     CDS             complement(88144..92874)
                     /locus_tag="MRET_2888"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 2"
                     /protein_id="XP_027485286.1"
                     /db_xref="GeneID:38739654"
                     /translation="MQADRGFTLSHQKVALELGFSGVLAGFTELTIVPSNVALRHIYL
                     HARCMDIQRVLCNGQEVRFEHTDAVQSLALSDIHGHAQLKRDLFSATSQGAEGELRIS
                     LPDHLRPERVSSGTEGNADGEEFSMMTIRIDYVLEDVHEAIQVIQPTADAPYRVPHMY
                     TRPLGLNSSRCWVPCLDSLWDRCTWELEYVVPRRLSVDMGDLDDETPEIYVISSGELT
                     EHAMHPQNPEKSVFYYTQQVATSVQHVAFCAGPFVMTRLSPAGLQTCETLSFCLPEHE
                     HELRSTTQFAWQAIEYISSEYGSYPFGSFKLVFVDGTHEDCHTASTLAICSSDLLHPP
                     SVIDQAFENRHILSHAVAFQWVGINIIQKTWADTWLIHGLSQYLASMFLRWLLGNNEY
                     RFRMKKDCDRLCHWDIGMPPLYQAGRDEPLDPQLLSFVNLKAPLVLYLLDRRLCKMGA
                     SLGLGRVIPKVFLQAITGEMSNNALGTHSFLRTCKKVSSADLRLFMDQWINGSGCPRF
                     ICTATFNRKKLLIEMHVHQESPAHLYAQAQPENALASNPVSLWEGQMTVRIHEADGTP
                     YEHVLDIKSEHQRYDVPFNTKYKRVRRNTKRFQARQAAAAAAAAGDEDAAEAIGMIDL
                     GFGLGMWEDEEERKRWRVADWTEEDEAIMASAPYEWIRLDADFEWMAQIQFEQPDYMW
                     VSQLQRDRDVVAQLVAVHALSQMPSLITSSMLTRTVLVTKYFHRIRAEAAYGLANCAL
                     PHLDLLGLFHLLLLFRTMYCLDVPHEVDSTSMDALCIPKPNNFSDMTDYFVRRALIHA
                     IARVRDHRGRALPIVQRFLVYLLRYNDNSTNQFVDDYYLASIINALASTLIPVDTVGY
                     STHADESYTPEEMQLRSAAIQEVERLQALDRLVPSFHNVITLAALDFQQALVFANLRP
                     LELMQFVEYTREGNFTPVRMAAFNALLLFHGLQHKVLTRYYFAVLASDEDRVVRTELA
                     RGLCDALAVAVAMGELGITRQRHEMLQEGDPSANHADQEAMLAEEAAQNEQMIKVFRR
                     EIGRSASVRDGFLAAFQSSKGNFRTRMALLRLAELLFKPVEDTKKPADRTAASSGSEQ
                     TGAMRIRLMIKNAPQREKQTAPHTLRVVLPKSAKAKKPKAPEPGQAMGMFTSDLSACR
                     MCIQKLMANKHCEPFIRPVDPVRDEAPDYFDVIKEPMDLSSVSNKLESGQYRDRFQFA
                     DDIHLIFRNAKTYTPDPKAWIHYEASRSETAFRQLWNRISKTLEQAAARAEKLHTEEP
                     ESDSRPEVSKTSAEEPKPPAEVAPKKITLKLNRHKGEKRAAAETPPRPPLKIKRQRSD
                     AEQAPRQDEVSAEKTDPQMAKSASEDPVLPGEYETPLNVKKVRSVLQVITKTPEASIF
                     LYPIDPIRDGAPTYYDEIKHPMDLSKIDKKLKSGEYKTMGDFAADMRLMFSNCRQFNP
                     PGTAPALMEQVVSSVWRREWSRAMERKLEYSQKRSLQSMMSRLKQHPSGGLFLYAVDP
                     VALNIPTYFDVIPKENARDLTLIGNKLRSDRYDSIDALDADIRLMLTNCFTFNAGNEP
                     VCDIARAFEKVYQQEIRAVRKAYT"
     gene            <93045..>93803
                     /locus_tag="MRET_2889"
                     /note="MRES_09625"
                     /db_xref="GeneID:38739655"
     mRNA            <93045..>93803
                     /locus_tag="MRET_2889"
                     /product="mediator of RNA polymerase II transcription
                     subunit 7"
                     /transcript_id="XM_027629516.1"
                     /db_xref="GeneID:38739655"
     CDS             93045..93803
                     /locus_tag="MRET_2889"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 7"
                     /protein_id="XP_027485285.1"
                     /db_xref="GeneID:38739655"
                     /translation="MATETGTGDAPEVLANTSVFPPPPSMYKMFTKQNVAWLAVLRKY
                     KGEADWTHMDADARLEAQRKVLQQAVEGEDTLANHIPMDVDLERELLPPRIDWIEEDG
                     GYQLFGQRWPIPDMAPSLDQLGIPRYFPEGSFDRNEALNKLLRTLLQTYFEIVCDLLQ
                     PIRPYDIPVPAPEAHTGAQTAWIPSSHLKERIQHMETVVINFQFLLNELRPAQTRTEL
                     SALLRSQLSERRQATQYIRAKCQSIRDEIARLEM"
     gene            complement(<93820..>97236)
                     /locus_tag="MRET_2890"
                     /note="MRES_09630"
                     /db_xref="GeneID:38739656"
     mRNA            complement(<93820..>97236)
                     /locus_tag="MRET_2890"
                     /product="DNA replication ATP-dependent helicase DNA2"
                     /transcript_id="XM_027629517.1"
                     /db_xref="GeneID:38739656"
     CDS             complement(93820..97236)
                     /locus_tag="MRET_2890"
                     /codon_start=1
                     /product="DNA replication ATP-dependent helicase DNA2"
                     /protein_id="XP_027485594.1"
                     /db_xref="GeneID:38739656"
                     /translation="MLSPKSTHARYGCEDVDEKDLRKSTVVSNTSSYATRAFSRARVL
                     NFYEQAYPTKRGSAIEKVLVLDVIQGPLPSRTSSCTLNQSMYFQESLHHAPPVRCYAR
                     LRDEWQSLAVRPDDMVHLIGEWDAEGDVPIMTLATFVADTSRESQRLLILHPDVIISA
                     SRLASVASCMRKSMLQERIRSPTESTYVAVMGTAVHGLLQACLVASVDPVSESKMPTA
                     GVQAPKAWDRLGNFSQAFLAAEVERQLELVQEALVLVHVATETARTDLYAAIPSLVRF
                     AETYLAFRDGRASSMAVVQDPRTDTHVSMRFTRVVGIESDITCPMYGLKGRMDVCMEA
                     EILSEAGLQRALLPIEIKTGRVTSSMEHMAQTSLYTMLLADAYGMHVDCGLLLYIQNC
                     EMRRVHRVVREVRSLIMARNDMASYKVQKALLPSPTSLSVDVVHESTTQTEPPSSPDS
                     FEFELTEADLEDVVCDIRPPILPPTIDSRFKCQRCYSRDACMLYRRALERVTDIDSPI
                     ADLYTESTSHLTPQDLSFFADWDALLSHEERSLQRHQAELWTMSAEARQAAGRCLSHV
                     SMRQCTDSACTFDVLSEHVPFVAEDLVILAVQTPVTAFLSRARVLPGMHLCVRFESSM
                     DMALTQYKAQYGNPQTFRIDLDDIMSMMGVPRYNLACLFYKDVPPQVEALRRRVVHLD
                     APQWTGMDDRMRTCMKRHTMHCNEDQCRAIERALCARDYALILGMPGTGKSSTIAMLV
                     RILVELGQRVLLCSHTHSAVDTIVSKLLDAPVLRLGPLSRVHPRVHACTLTARLGTCA
                     TSEEVVQVVAEAQVVAATCLGTSDAVLARRAFDVCIIDEASQITVPTCLGPLRLADRF
                     VMIGDHHQLTPLVRDTDAAQHGMSVSLFQRLCKAHPSSVAMLCTQYRMNADIMALSNA
                     LVYDGRLVCGNESVACAKFTMKRDACPSWLWDVLDPARPAVFVDTDAVKAVESRADTL
                     VENRVEAEWIVRMSDVLIQANVAAADIGILTPYRQQAKLLRDRCACEVLTVDQAQGRD
                     WPVVLVSLVRSNKTHTVGELLRDQRRVNVMITRAKTKLVLVGSYSTMIHGPCTEPMPA
                     LLPLLRMIQPKEPADIPVHVSPGRQRYVKKARRPTPVVTDLLNEQDCIAE"
     gene            complement(<97486..>99231)
                     /locus_tag="MRET_2891"
                     /db_xref="GeneID:38739657"
     mRNA            complement(<97486..>99231)
                     /locus_tag="MRET_2891"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629518.1"
                     /db_xref="GeneID:38739657"
     CDS             complement(97486..99231)
                     /locus_tag="MRET_2891"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485595.1"
                     /db_xref="GeneID:38739657"
                     /translation="MSIIQNWVDSFKRAPDEYGADPDYAGDGCEKEGKPEILGDENYG
                     NAERFVETDDHRMVAVPEKSGLKRTLDNRHVQFIALGGGIGTGLFISSGTELATGGPG
                     SLLINFIIIGIMLISVVFALGELAVTLPVSGAYSAYATRFIDPAWGFAMGYNYFIKWI
                     ISAPIEFTAATIMVASWDEDNNIVPKGALLAMFIALITFINIFGVRGYAEFEFVSTLV
                     KIITVIGLIIVLIVIDCGGTPNGVHLGAHTWHDPGSFNNAFKGFCSTFAGVAFAFSGS
                     ELVGLAAAETREPRKVLPKACQQIVVRILIFYILSLFLITLVVPYDHPRLQSGSGSAY
                     DPSRSPFVIAMDIGKIKVLPHIINAVIILSTLSVSNAAVFASSRTLLSLAEQGFAPKL
                     FCYVDRAGRPLPAVILTLLFSFISFLIYSADQSTVFSWLVGLSGLAMIFAWGSISLCH
                     IRFRKAWIKQGNSIAELPWASPFGVTGSYIGLAVSILVVVANFYSSAFPIGEGELSSD
                     DRAYHFFEKMISLAVIIVFFVGYKLYHRTRIVSLDDMDLHTGRREAVPLEVLEQERAE
                     KRARPLFKKLLGLVF"
     gene            complement(<99802..>101466)
                     /locus_tag="MRET_2892"
                     /db_xref="GeneID:38739658"
     mRNA            complement(<99802..>101466)
                     /locus_tag="MRET_2892"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629519.1"
                     /db_xref="GeneID:38739658"
     CDS             complement(99802..101466)
                     /locus_tag="MRET_2892"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485509.1"
                     /db_xref="GeneID:38739658"
                     /translation="MEGYENDAANLHQGKGIVTCNSESFGSTDDAATDDSITHTRPGN
                     AAESKELRRDLNMRHLCFLALGSGVGTGLFMGSGNILKYGGPGSLMISFVLLGFMVIT
                     VIFAVGELVSVFPSSASYAEMLKRFVHPSAGFAIGINFVTTWLIILPTELTVSCMAIS
                     YWDKDEVVPKGVWVAIILVAVFSVNLFGVRFFGEFEMLTTSIKMAGCIGFIVACIVFA
                     CGGANSEHVGAHYWHQPGAFKNSFKGFCNSFAFTALAYGGTEIIGVTVGESSHPRRHL
                     PKAAKYVVYRVLIFFILSLFMVSLLVPSDNPELSNYSPFVMAIESGGVRALPQIFNAV
                     TLISFISVANAAVYTASRLLYTMAEKHFIPSIFLFSDRQGRPIAGYIFVFLFGLLGFL
                     VYSSSEEEVFNWLGSISGMSVILLWFSIALAHIRFRFAWKRAGYSVKDLPWSSPLGIW
                     GSLIALTLNMLVLMATFYISVFPIDEAQSDGYARAKEFFQSYLSVVIMLFSFLLHLIT
                     TRSKFIRLSDIDLQTGRRDPNEGHEWEFEKGELMKPRWRRILDIFF"
     gene            complement(<101699..>103444)
                     /locus_tag="MRET_2893"
                     /db_xref="GeneID:38739659"
     mRNA            complement(<101699..>103444)
                     /locus_tag="MRET_2893"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629520.1"
                     /db_xref="GeneID:38739659"
     CDS             complement(101699..103444)
                     /locus_tag="MRET_2893"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485600.1"
                     /db_xref="GeneID:38739659"
                     /translation="MGAFRRWLDDFKPADRGIGKEVNYVGEFSSEDHKHLDTKEALGK
                     DEYTNTTVAVKTEDGGVALIPEETGLKRNLSGRHIQLIALGGSIGTGLFIGSGQNLAT
                     GGPGSLMLGFIIVAVCVILTMLSLGELAAVLPVSGSFCTYSVRFLDPSWGFAMGWNYW
                     LQWLAAFPLEATAVTIVISFWDKDETVPRGVWVAIYLVLMMSIHLIGVRGYGEFEFLA
                     ALIKILGCLGFIIACIVIDVGGSPRGEYLGAHSWHHPPPFLNGFKGFCSVFITAAFAY
                     SGTEIVGIAAAESSNPRKYIPRATKQVVGRVLLFYIVSILMITFIVPSDTKSLMGDSN
                     DPSSSPFVIALQQGQIHALPQIFNAIILISALSVGNASVYGGSRTLLSLAELGMAPKI
                     FTYVDRKGRPLPAMFVSFLFGLLGFLIYASDPNTIFDWLLSISGLSVIFSWGSTCLAH
                     IRFRKAWLLQGNSLAQLPYKSPCGIIGAILGLFLNILIIAAAFYSGAWPIGEGNMTGN
                     DRANSFFESMISLIIVLVVFGVHKLYTRSRVVHMNEIDVQTGRRDPVSLEVLEQERAE
                     ERAKPFILKLKDFFF"
     gene            complement(<103897..>105645)
                     /locus_tag="MRET_2894"
                     /note="MRES_09635"
                     /db_xref="GeneID:38739660"
     mRNA            complement(<103897..>105645)
                     /locus_tag="MRET_2894"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629521.1"
                     /db_xref="GeneID:38739660"
     CDS             complement(103897..105645)
                     /locus_tag="MRET_2894"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485596.1"
                     /db_xref="GeneID:38739660"
                     /translation="MSVFQNWIDGFKPAVTDGEYADPSEGDIEQEGASFPLKPSHDIT
                     SEDLKGIKPTKRPMLKKELGSRHLAFIALGGGIGTGLFVGSGSKLYQGGPGSIIIDYT
                     LMGIMILTVLFALGELATLFPTPGAFSAYSTRFIDPAAGFAIGYNYFMSWCSTLPLEF
                     TAAAIVVRYWNHDKLDPDKEGPMPNGALVAIFWVLVILINLFGARGYAEFEFIATSCK
                     MLVLVGFIIYAAVVDCGGTSGTNHKYLGARYWHDPGAFNNGFKGFCNVFTTAAFAFTG
                     TEVLGLAVAESSNPRKAMPRACKLVLYRVIIFYAIALFMVTLLVPYNTPDLHGKTDND
                     PKSSPFVIAIKAGQVSVLPDIVNAVIMLSAISVSNSAAYAGSRMLHALADNGMAPQIF
                     AYVDRQGRPLVATLFTLMFGALAFLIYVGDDNGGEVFSWLLGISGLAILFTWSSICIS
                     HIRFRAAWKLQGHSLSELPWLSPLGVMGSYIGLTFNILVIIAQFYNSAFPIGEGEKNG
                     NDRGYNFFLGMISLPIIMVFFFGYKIVKKTKIIPLQEIDLVSGMREQISLEEHDQERA
                     ERQNRPFHKKVLHFFF"
     gene            complement(<105962..>107377)
                     /locus_tag="MRET_2895"
                     /note="MRES_09640"
                     /db_xref="GeneID:38739661"
     mRNA            complement(<105962..>107377)
                     /locus_tag="MRET_2895"
                     /product="SNW domain protein 1"
                     /transcript_id="XM_027629522.1"
                     /db_xref="GeneID:38739661"
     CDS             complement(105962..107377)
                     /locus_tag="MRET_2895"
                     /codon_start=1
                     /product="SNW domain protein 1"
                     /protein_id="XP_027485597.1"
                     /db_xref="GeneID:38739661"
                     /translation="MLGTGKALTLHAGRDGKPQYDAIVHQGRREDQHVQSKFTDLLPL
                     SQRDDLKDRQRSIDRPSEEEVLSTAERTRLALESIVHGKVKSTQPKNVPGASSNTSYL
                     RYTPASQGPGGKKQRIIKMTEVVEDPLEPPKHRFKKVPNGPPSPPAPVLRSPPRKVTA
                     QEQKEWMIPPCISNWKNNKGYTIPLDKRLAASGRGMQDVEVNDNFAQFSEALNMADRH
                     AREEVRQRNIMQQKIAAQEKAAREESLRMLAQRARDERAGISSHDDRLAHSGSALTAY
                     GSSESDDEDDEDVAQRNRLREERRRERERELRMSNMGQEQRARAFAKEQNRDISEKVA
                     LGLAKPTMSKESMTDARLFNREALSNTFGDDDSYNVYDKPLFQGSSAATAIYTRPGTG
                     GSDEMFGNGTASGIQNELQHDRFGLGVKRGFKGSQSKETRSGPVQFEKDDSDPFAIDQ
                     FLDEAKRGIKRSADESNELDA"
     gene            <107500..>109425
                     /locus_tag="MRET_2896"
                     /db_xref="GeneID:38739662"
     mRNA            <107500..>109425
                     /locus_tag="MRET_2896"
                     /product="DNA polymerase eta"
                     /transcript_id="XM_027629523.1"
                     /db_xref="GeneID:38739662"
     CDS             107500..109425
                     /locus_tag="MRET_2896"
                     /codon_start=1
                     /product="DNA polymerase eta"
                     /protein_id="XP_027485598.1"
                     /db_xref="GeneID:38739662"
                     /translation="MSTERSGEKHRFRYHSDKIEADYENSEHVPCPRVTYRHLLSTSY
                     EPENPLRVIAHCDVDAAYAQFEASRLGIDSRSNPLVVLQWKQIIAVNYVARKFGVSRF
                     NCTLEEAKQRCPDLRLVHVASYGPGDKSPKYYEDPDPSSHKISLDMYRRESKKIMDIF
                     QRQLCHDHVPYGHANYELESITTEGWSPSVLHMKGQSKDHDIIFEKASIDESFFDLSR
                     YVRKQILSRFPSLDIRKEVNGFDADTRAARLDAELPPIPMHVRDEMSMRAWLALGTWL
                     PPSEHREEQSLLTPLTWIDVAHAMAAERMISVRWHILNELGYTTSAGIASNKTLAKLC
                     SSFRKPCSQTMLLPRYTCAFLAPMPYRKIRFLGGKFGADIEGEWSQSTVRELWGVSLL
                     DMEKRFGADGKWLYHLIRGIDTSNVVQRSANHSMMSAKNFRPGISSTAVALSWIAIMS
                     SELSMRLQEEREEVKMMYPRTLVLRYLLADSTSMKSHQVPFGKIANEHLDHEIYVRAE
                     KLWNETLGRAMQQPGRIDVRVLSLSFAGIERKMKDQQPLSNFFSKRKSDHDAKVALKL
                     PRTQSPPYDLVTDPTSQTEMAQWTCLKCSHVLSVPIFEDVEPHATEPPSYLGILQRAC
                     EEHEHWHMALALAERLE"
     gene            <109495..>110985
                     /locus_tag="MRET_2897"
                     /note="MRES_09645"
                     /db_xref="GeneID:38739663"
     mRNA            <109495..>110985
                     /locus_tag="MRET_2897"
                     /product="coproporphyrinogen III oxidase"
                     /transcript_id="XM_027629524.1"
                     /db_xref="GeneID:38739663"
     CDS             109495..110985
                     /locus_tag="MRET_2897"
                     /codon_start=1
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="XP_027485599.1"
                     /db_xref="GeneID:38739663"
                     /translation="MLPPLVLRSARAQLRACSPTFQSQTRLWSQLASRRSIAARQPFI
                     GKAVAVASLGAAAAVTFSMMSNQGSSLTECEDVSQVNQMTKVSSKPDVSMLDPNILDD
                     ERKPMRKRMETYVKLLQRRLVDMIEAEENAGRASHEPKHFTVETWTRKQGGEGTSCVI
                     QDGEVIEKGGINVSVVYGNLPPSAIRQMSADHDGLIERIGYKVEGPDAQVDGLPFFAT
                     GISVVIHPKNPMSPTSHFNYRYFELMHPEKLKDGSPNPNYHEEPVAWWFGGGADLTPM
                     YLFPDDAKHFHRVLKDAADSQDPAFYVAWKKWCDKYFWLTHRGENRGIGGVFFDDLTL
                     PMWNQRRTTFIPLMDGTNQANQVLVSSKQHNKESLFRAVRAMGDAFIPAYLPLVHKHK
                     NDPFNADNLEWQRLRRGRYVEFNLVYDRGTKFGLMTPGARIESILMSLPLVARWEYME
                     GTTGTARESSTAAHINDGENRKKHSEDEMKAREAMQDALEHPRAWI"
     gene            complement(<111172..>111884)
                     /locus_tag="MRET_2898"
                     /note="MRES_09650"
                     /db_xref="GeneID:38739664"
     mRNA            complement(join(<111172..111293,111322..111458,
                     111486..111694,111726..111776,111804..>111884))
                     /locus_tag="MRET_2898"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629525.1"
                     /db_xref="GeneID:38739664"
     CDS             complement(join(111172..111293,111322..111458,
                     111486..111694,111726..111776,111804..111884))
                     /locus_tag="MRET_2898"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485416.1"
                     /db_xref="GeneID:38739664"
                     /translation="MAGLVTGAAKMLASDHIEKFAHQFEPEDPYYEYYTENGKQKRRK
                     RQIPPGLSKHDEKILHKIKKRAHVLDKGFKMCGMRFGWTFVIGLIPVVGDVTDFLLSH
                     NLVVKKAEQIENFPPELLARMKANNTVSAGLGFIPFVGDIVLATFKTNSRNAHIVEEF
                     LRERGQENLRNGMAPEPPESRRPWMSSLFGTHQQHHAQA"
     gene            complement(<111964..>114870)
                     /locus_tag="MRET_2899"
                     /note="MRES_09655"
                     /db_xref="GeneID:38739665"
     mRNA            complement(<111964..>114870)
                     /locus_tag="MRET_2899"
                     /product="3-phosphoinositide dependent protein kinase-1"
                     /transcript_id="XM_027629526.1"
                     /db_xref="GeneID:38739665"
     CDS             complement(111964..114870)
                     /locus_tag="MRET_2899"
                     /codon_start=1
                     /product="3-phosphoinositide dependent protein kinase-1"
                     /protein_id="XP_027485593.1"
                     /db_xref="GeneID:38739665"
                     /translation="MVMEQVSLAHLHTPGNDTLAHSNVPVAQADVPRASLATVHDTGP
                     QASIKRSDGDLHTARTDSMSSISSANSTSSIEAVPFRAPPRGNVRNSQEMAPPVCVRV
                     PAVHASLPWQASASGSDVPPISSPPPITPILDAEDSTPVTPMPHRSSESSKTESLVRP
                     PPCVSPGPVAKHRMPPKYPSSRWMYRNGPGVSRRLPMLGPTVDDDTRRFMSRPSSRNS
                     LGVLDAASQRSSGSYTHSKAHEPMAPPIVQVDEDARSLRSSSSVATLAPRQDQTSVEW
                     YASQLRDMSPRSRTLHWLNNVRQHDGLPFEESPDRPRACDDARNLLFRHSNLSSSLTL
                     TPRSPSPRMPASETSSLLMDTPPSRPMPLHASDMPNRSVSATPVTVASSQGAADSTRP
                     TRRRTTSDFVFGEVLGEGSYSTVLKAWDVHDWPDAERHALAARANALSATAGQAGSIP
                     QTEHMPKAYAVKVLDKVHILKEKKQKYVRVEKEALSLLVNTPGVVTLYHTFQDRESLY
                     FVLELAENCELLHYVQKYGALDIDSATFYAAQLADAIDRIHRAGVVHRDIKPENVLLD
                     KNMRVMVTDFGSARILVRPPDGPSDERAYSFVGTAEYVSPELLNDQVVGMPADWWAFG
                     CVFYQIIAGHSPFRAINEYQTFQKILHRSFTYPPSFPADARTLIDALLCLDPKTRASA
                     KDVKRHTMFHSIDFATLWMVQPPKIQPNQMQRSRVDGQQRVMEELDKLMNDLSFQRED
                     SFASQEPSIATDDSSVTSSCDHSKKTVPPSRSASGSSRGRKSYAWNDILLPNEDVALA
                     SPMLLRRAANTGMFARKCKLVLTTRPRLLCLKETTRSPEVLVDIPLHPPGEATNDAPK
                     SVPHLVRSDSRRSAQSQSRSQGAPSLKAPMQAITRTLGLRHKDDDPNDQTTSPDAAPT
                     PDEASDVWPVHVDARGSRGFVVHTPVRQWQFEDPAGDASFWVQNILEVLQSRMT"
     gene            complement(<114973..>116472)
                     /locus_tag="MRET_2900"
                     /db_xref="GeneID:38739666"
     mRNA            complement(<114973..>116472)
                     /locus_tag="MRET_2900"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027629527.1"
                     /db_xref="GeneID:38739666"
     CDS             complement(114973..116472)
                     /locus_tag="MRET_2900"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027485732.1"
                     /db_xref="GeneID:38739666"
                     /translation="MKRIADRQIQREDGDDPHSIGAEEHDGEQSPSAPQERQPRVIRG
                     LPKRKGLTASPSAPPTSNPFAVLAQPEAPKPSSSPFASVRLAPTPRPPAKAEAQPAEF
                     WKGVRGLNWSLTRQLVHVLNQSDELANLHDTLAAFARIYARHHDDLASKWLKRQPEVK
                     APETPLSAHDTKPSTSFSFTQPKDASAPAVSTSFSFTPKRHDASSHPKPQETTSPAPS
                     APSPTPAVSSAPPSKAFSFGTAAPHTSAFSLSQAPTSSASALSFGASSALRTDALTPA
                     KKPAVPDEQKQDPASDKANNVVKDAPPPEDAPPEKESAHEETFEKKETLTPAVAPPTQ
                     ERAALPSLPSGGFSFAGKSTQTFLDGNAPKTFTGPKPPTFQVPAGGFSFGASQSKESK
                     KDTKDPPTTPSAPSVTTNKPITFGSATSTPSHGSPTAPHRFSFGTSPPSGGTSSSFTK
                     SAIGPSFANTAGVASGGSFQFGAAPIAFGTPDPQDQSSTPSVDDPESRE"
     gene            <116592..>117794
                     /locus_tag="MRET_2901"
                     /note="MRES_09660"
                     /db_xref="GeneID:38739667"
     mRNA            join(<116592..116861,116891..117354,117380..>117794)
                     /locus_tag="MRET_2901"
                     /product="HIV Tat-specific factor 1"
                     /transcript_id="XM_027629528.1"
                     /db_xref="GeneID:38739667"
     CDS             join(116592..116861,116891..117354,117380..117794)
                     /locus_tag="MRET_2901"
                     /codon_start=1
                     /product="HIV Tat-specific factor 1"
                     /protein_id="XP_027485733.1"
                     /db_xref="GeneID:38739667"
                     /translation="MSAGGRPPAYLDVRDAAVHYDKQSQRWIWEDDRGTEFEWHGEAP
                     SQEIVDAANTESETTRITRGGWIRVIGDDEVAKQQEIYRVDGVDEHTPAAPVLMREQQ
                     SKKRKDDSQTHASAPKRARPNTSVFVSGLPLDASVNEIADVFARYGVLLEDDDGHPRI
                     KMYRDPETQAFKGEALVVYFKPESVDLAIQLLDDTYLRAARGVHSGPCMRVERASFQD
                     TPRPDAKAPLSDADKKSIQRRMNRMHNKINDWDSDSDERRTAGPSATARTVVLKKMFT
                     LAELDEDPTLLLDLKQDVREECETLGDVTNVVLWDKESEGIMTVRFREPEAARRCEMR
                     MHGRYFAGRQITAVRVDGKPKFRRTARQDDDEHGHERHDAFGAWLEQS"
     gene            complement(<117810..>119237)
                     /locus_tag="MRET_2902"
                     /note="MRES_09665"
                     /db_xref="GeneID:38739668"
     mRNA            complement(<117810..>119237)
                     /locus_tag="MRET_2902"
                     /product="hexaprenyl-diphosphate synthase"
                     /transcript_id="XM_027629529.1"
                     /db_xref="GeneID:38739668"
     CDS             complement(117810..119237)
                     /locus_tag="MRET_2902"
                     /codon_start=1
                     /product="hexaprenyl-diphosphate synthase"
                     /protein_id="XP_027485730.1"
                     /db_xref="GeneID:38739668"
                     /translation="MAWHGRAWRASSAAFTRCTRSASSWSDVVTTAKKVVASDGAEAS
                     MTRDPLEVVGQDLSSLRHNIATLLGSGHPSLDRIAKYYFAAEGKHVRPMIVLLMCKAT
                     NGLSATWHTQRAAAVGEHVDIPMTRASVLNDANPSAAHPHAPVAAAPRTTPYVPTLQS
                     TILPTQRRLAEITEMIHVASLLHDDVIDESPLRRGAPSAPSSFGNKLSILGGDFLLGR
                     ASIALARLRDPEVTELMSTVIANLVEGEVMQLKSMASDQVPVTDVQSARPSAEVMERF
                     WHAYDQAPAGRDDAPSAALFEFYLQKTYLKTASLMAKSARSATVLGGCGTWSNQLASM
                     TADERASAAAVCDAAYTFGRNVGISFQLVDDLLDFHATTEAFGKPSGGADLKLGLATA
                     PVLYAWQQYPDSNLGTLVQRRFAQPGDVEQALALVHKSDGLSRTAALARYHADTAQQA
                     LLTLPPSDARAALEKLNHQIITRAR"
     gene            <119347..>120117
                     /locus_tag="MRET_2903"
                     /note="MRES_09670"
                     /db_xref="GeneID:38739669"
     mRNA            <119347..>120117
                     /locus_tag="MRET_2903"
                     /product="peptidyl-tRNA hydrolase, PTH1 family"
                     /transcript_id="XM_027629530.1"
                     /db_xref="GeneID:38739669"
     CDS             119347..120117
                     /locus_tag="MRET_2903"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase, PTH1 family"
                     /protein_id="XP_027485731.1"
                     /db_xref="GeneID:38739669"
                     /translation="MMPPPLFSVADMRVADRHVVRKAAMLVGLGNYSHPTTRHSIGQY
                     CLSPLIHRAEAHDAALRAEVARRVARLSPDAQTFELPVPAATEPFRPVAASKGWLARV
                     SVLLDAAPPKGDAARRSPHFRMHAYPYVLYDLVLYIPRMLMNVNGKGVAAARALYPEL
                     AVSDTLLVHDELQRAFGKVSFKHGGSAAGHNGVKSVQHLLGNDVPRIRIGIDRPPDGN
                     VSAYVLGPMPPDWLETCAHGDVLERLWSTLQTWCLSRT"
     gene            complement(<120114..>122189)
                     /locus_tag="MRET_2904"
                     /note="MRES_09675"
                     /db_xref="GeneID:38739670"
     mRNA            complement(<120114..>122189)
                     /locus_tag="MRET_2904"
                     /product="PAB1 binding protein"
                     /transcript_id="XM_027629531.1"
                     /db_xref="GeneID:38739670"
     CDS             complement(120114..122189)
                     /locus_tag="MRET_2904"
                     /codon_start=1
                     /product="PAB1 binding protein"
                     /protein_id="XP_027485729.1"
                     /db_xref="GeneID:38739670"
                     /translation="MTPNPAAPSARRSSHSNNSSRGGGGHSARGAWHGGHGGASQAGR
                     AGGGRGGARHGWGGHASRSNSTNGRPATSTHSSKGMRDRIECWYAMLVGQMIVVSLQN
                     GERHVGVVSAATMERDDLGLVLMMAQSMAITEDGAIQWGRVVPSLVVPGADLLEVDAS
                     TVKQSSPAEVQAAQRRASGFRTDTEISSSASASSDGRALQRWDDGGAPETASLEQSTD
                     SGPWDQFAANEARFGVKSDYEETMYTTKLDRSGKDFKSREKEAERLAKEILESSTGNV
                     HVAEERNQLGQKDMDEEDRFGAVVREERAPAPPPPKPSKALTADFRQFVSAERERLVV
                     RKAELAKKEKQSRLADLKIWAQNFQLKTPVPEDVANMRRVAASKRPTATPSKGVEEAR
                     AKLASMTLPAIPPFKKPQDKPSSKLSAKAASFNPQAASFTPRAKAGPPTTPKPSVPEL
                     PFFGTRELKNRPGSTSMRIMDEFRASKTKKLGEASKVSVWWSYTGRPFRQLMALSNMF
                     PSKAPMPTSMPLYEGAMPMAQPPVMFPVAAAAVPYAPSPGLSPVMQHVSSPTVPHGSS
                     PSMLPRPPNTAGGTKAPQAAPVMMPPPVPQGQGSPQPYAFVYPMGQYGLPYAPAEAQG
                     APFMYRPSPADAVPAGSGMLPPMSYGPYHQPVPSSPHKRGGSVHARGNNKGARKPPRS
                     DDAAPKEGS"
     gene            complement(<122357..>122923)
                     /locus_tag="MRET_2905"
                     /db_xref="GeneID:38739671"
     mRNA            complement(join(<122357..122622,122649..122881,
                     122910..>122923))
                     /locus_tag="MRET_2905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629532.1"
                     /db_xref="GeneID:38739671"
     CDS             complement(join(122357..122622,122649..122881,
                     122910..122923))
                     /locus_tag="MRET_2905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485379.1"
                     /db_xref="GeneID:38739671"
                     /translation="MVLDAHDGLAIKAFTCVLIVLTSYLAIRTMYRTIRHMLSMVTFM
                     IRWGLVLYLLFFLWLWWTEGRDQSGLHQSLAATYSMVQNAGVAAATLLWQLSQRPDTW
                     QSIARHAHSVLQPSKPKHRRTPKRRGTHAAEDDLAELVHALGWEKWLDSLVYPQKNKK
                     RWNPMPTGWK"
     gene            <122980..>123777
                     /locus_tag="MRET_2906"
                     /note="MRES_09680"
                     /db_xref="GeneID:38739672"
     mRNA            <122980..>123777
                     /locus_tag="MRET_2906"
                     /product="mRNA splicing protein"
                     /transcript_id="XM_027629533.1"
                     /db_xref="GeneID:38739672"
     CDS             122980..123777
                     /locus_tag="MRET_2906"
                     /codon_start=1
                     /product="mRNA splicing protein"
                     /protein_id="XP_027485377.1"
                     /db_xref="GeneID:38739672"
                     /translation="MSERKVLQKYYPPDFDPSVVKRRKTGGGRQKTVRLMAPFSMRCN
                     TCGEYIYRGKKFNARKETVNDDDYYGITIYRFYIKCSHCSSEITFKTDPRNADYAAEH
                     GASRNFEPWREKEEDKEPEPDSDEEKEESEGEIDPMKALEQRMEESQREMEVMDALQD
                     IRTRNARFERMDTNTVLDTIAENKRKAEPASEHAEPEETKEEEALVRKYFSKNEDPDA
                     SAVPDTSHLLSDRAREQIRALATPTNIPRPAAKRKRGPNALGIVRKT"
     gene            complement(<123782..>125005)
                     /locus_tag="MRET_2907"
                     /note="MRES_09685"
                     /db_xref="GeneID:38739673"
     mRNA            complement(<123782..>125005)
                     /locus_tag="MRET_2907"
                     /product="kynureninase"
                     /transcript_id="XM_027629534.1"
                     /db_xref="GeneID:38739673"
     CDS             complement(123782..125005)
                     /locus_tag="MRET_2907"
                     /codon_start=1
                     /product="kynureninase"
                     /protein_id="XP_027485728.1"
                     /db_xref="GeneID:38739673"
                     /translation="MAAAEALQSILLRLCVLCSTSLQTIQTSPTETIDRETSRQDGRA
                     LSEKLYQDLLILNQQVRKEATALSLAMRPSSREMHDDADPLDGLDEKSIEAASHLLQS
                     LATDAVPKLVFLANLAQKNQRVYDTTDAVANDTSLQEAREMGAHIVLGENAMGKHVVS
                     ASVGSLFANDVRRYTADVIETIGLLCQSFMNVRTRTVLARAQEKRGEQSESPTPPSRQ
                     ASLALTKKLWTLCDAAEGDKTHTPAYIARLPRNNYEALYKLARQHELVMRDGVTELEE
                     SLENDSLDSPQPPSDDVEDMWERHVQLSEEEKKAVRNVLDLVRSGIALLKQAMSAAAA
                     AKDVDLDRVAELMEELASTQDDLIASVLYEEETDEGLGEVAQAYVDACEALHECVDTS
                     SGMDAIEAAWHSLSL"
     gene            <125066..>125596
                     /locus_tag="MRET_2908"
                     /note="MRES_09690"
                     /db_xref="GeneID:38739674"
     mRNA            join(<125066..125108,125142..>125596)
                     /locus_tag="MRET_2908"
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /transcript_id="XM_027629535.1"
                     /db_xref="GeneID:38739674"
     CDS             join(125066..125108,125142..125596)
                     /locus_tag="MRET_2908"
                     /codon_start=1
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="XP_027485734.1"
                     /db_xref="GeneID:38739674"
                     /translation="MKAVLQRVKQASVHVQGQPVSTIGPGILALIGVCQDDTPEHMDL
                     LTKKILQLKLWPEGARVVDGVLAPGDEHARAWRSNVMELGGDVLCVSQFTLHARTSKG
                     TRPDFHLAMAGDQARPFYDAFLEKMRAAYAPHRIHNGAFGAMMDVSLINDGPVTITMD
                     TFEKK"
     gene            complement(<125571..>126873)
                     /locus_tag="MRET_2909"
                     /note="MRES_09695"
                     /db_xref="GeneID:38739675"
     mRNA            complement(join(<125571..125667,125693..>126873))
                     /locus_tag="MRET_2909"
                     /product="RAD51-like protein 2"
                     /transcript_id="XM_027629536.1"
                     /db_xref="GeneID:38739675"
     CDS             complement(join(125571..125667,125693..126873))
                     /locus_tag="MRET_2909"
                     /codon_start=1
                     /product="RAD51-like protein 2"
                     /protein_id="XP_027485392.1"
                     /db_xref="GeneID:38739675"
                     /translation="MPLPWDDVPHEQAAWAPIGAAAELRRPASQPVERVSWMPLSQMP
                     MPQTQHELDEYTMDSVSVESSESSASSEAQDTVVPISRAPLRLLSGIEALDTYAGRWQ
                     SGGAYAPLDKPASHDVLRRGFPIGSALEVVGPPGVGKTTWAMQMAISERLEHMMHTMQ
                     LCMDQYGTADDAPTPPSSPRTLMDAMDVDIEPWCAQVVLVDTEGSIAPVRLLSMTRAA
                     ITQHHVSMAQRYAHCAGVDADVHHAIERAVLRGIHLVRCTTLGELLAFAGIAACTVLK
                     VPGLPPRTSLLIIDTLSFFTYAHALPINATREQRKAREDAIQCIVRSLTTLRDSQIPE
                     QDRITVVVTMQMSTRRLNDAGSVLQPSLLSKSSTRDDSESVLGRSAQRFFLAYSDVRG
                     HRVIYLPWDTSAVGVMIHAHGLTQSLTFSQMYP"
     gene            <126945..>127935
                     /locus_tag="MRET_2910"
                     /note="MRES_09700"
                     /db_xref="GeneID:38739676"
     mRNA            join(<126945..127047,127073..>127935)
                     /locus_tag="MRET_2910"
                     /product="myo-inositol-1(or 4)-monophosphatase"
                     /transcript_id="XM_027629537.1"
                     /db_xref="GeneID:38739676"
     CDS             join(126945..127047,127073..127935)
                     /locus_tag="MRET_2910"
                     /codon_start=1
                     /product="myo-inositol-1(or 4)-monophosphatase"
                     /protein_id="XP_027485699.1"
                     /db_xref="GeneID:38739676"
                     /translation="MALPLQDVLDFAIDLAKQAGEAIVKGSETRFEKAAGFEEKKNTA
                     DLVTETDQHTEKLVCQAIREKYPDHKFIGEESWAAGEQAAITNEPTWIIDPIDGTTNF
                     VKGFPFVCISIGFVYHGEPTIGVIYAPFLGYLYAARKGHGAFITTPLHPQRRSLPLTQ
                     PAPLPSFKQALVAFEWGSDRSAEIMEKKTRSFQRLVGDRDSGVPGGEMALGVRSMGSA
                     ALNFAHVAMGTLDAYWEIGCWAWDVCAGVVIAREAGCLVLGSQAHAAHALDGPVYPPP
                     TTPDVLTGRKYLVVRAIGDSPHESGVDAQKRIARTFYGAVEEWDL"
     gene            complement(<127937..>129400)
                     /locus_tag="MRET_2911"
                     /note="MRES_09705"
                     /db_xref="GeneID:38739677"
     mRNA            complement(<127937..>129400)
                     /locus_tag="MRET_2911"
                     /product="nuclear pore complex protein Nup54"
                     /transcript_id="XM_027629538.1"
                     /db_xref="GeneID:38739677"
     CDS             complement(127937..129400)
                     /locus_tag="MRET_2911"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup54"
                     /protein_id="XP_027485698.1"
                     /db_xref="GeneID:38739677"
                     /translation="MAFSFGKPPSSTPSFGATPLFGAQSTGAATAPQQTTSSTSLFGQ
                     KPAGQGLFGAAPPSGANNSFGSMPPSNPTNTLGTQQSGLFGGKAPGSGGTSGGLFGSQ
                     PPSNGGLSQNQPQQGGLFGSQPQPQQGSGTFGSQPPQGGLFGSQPQQGSGTFGSQPPQ
                     GGLFGSQPQQSGLFGSQPQQGSLFGQPAKPAAQPTSAPQATPAVQDKKFGAPLHTQLE
                     RIASSWDTSNLSTCQFQYYLYNRAPDAQSLSQLCVRRPDAVGPMHDALWNKALQENPE
                     PDRLYPVLAVGFGDLQIRSNAQATEAARQTNKAAELTKKLAELRQKHDLANVVRAQSA
                     MMMQTRIRQRLLSLTKDAGVMIPALRGQSLTASEDAVKAALENCDAQLNGALPHYASN
                     TTPEHARLRAQLNELWAQLSIVRAKREAAQAQGRVNGGTEWVVVDESSFDEITQILGL
                     LQQGLVHLSNTLMSDSKALDTVCEGLKGVPLVGVRHT"
     gene            complement(<129471..>131507)
                     /locus_tag="MRET_2912"
                     /note="MRES_09710"
                     /db_xref="GeneID:38739678"
     mRNA            complement(<129471..>131507)
                     /locus_tag="MRET_2912"
                     /product="serine dehydratase beta chain"
                     /transcript_id="XM_027629539.1"
                     /db_xref="GeneID:38739678"
     CDS             complement(129471..131507)
                     /locus_tag="MRET_2912"
                     /codon_start=1
                     /product="serine dehydratase beta chain"
                     /protein_id="XP_027485701.1"
                     /db_xref="GeneID:38739678"
                     /translation="MLLPWQFARFAARNGRIMWPPLSHTRWMSASHKSRTISGPRSNA
                     DMHFPSTGRGNGGGGDRPPLIDQDVDDIPGSTTEHAVISMFDLFSIGIGPSSSHTVGP
                     MRAGAIFVQDLRDSGILSSVASIKLALYGSLAATGKGHMTPQALLLGLEGADCETVDT
                     DSVPVRYESIIRDKKLTLGKDSPDQGHVQSVHFDYDKDLEWNWSQKLPMHSNGMRFSV
                     FNNEGDLLATNEFYSIGGGFVVNGQMAIADRPGPRPAREMLPAPPPSENHPQDTMENV
                     YYKSIRRNDADGERREGAMPSTPGQAALPPPSHSDQLSEQARKEPRFPFRTMSQLLSL
                     SRKHNLTIAQIVYENELTWYTPEEIDAKIMHIWNVMDEGIRAGVLSEQEVLPGSLRMK
                     RRAPKLYARLMRGLNMGPRRLGNRHGSSEADKSYLGPGTAMTNSATCAWPSAKSRSAP
                     RVPRIRGSFQHEIMPVPPRRTNFPAMDWLSCWAIATNEQVAAGGRIVIAPTLGAAGII
                     PSVLRYVVEFVALTPEDEENLVKTFLLTAAAIGMLFKRGATISAAEGGCMAEVGTSCS
                     MAAAAFTACMGGSPEVIEQAAETAIEHNLGLTCDPVDGLVQAPCIERNAVGAVKAVVS
                     ANLALSTDGIHTVTLDEAIHAARLTAADMHTKYKETSLSGLATTVKIPVAVPDC"
     gene            complement(<131642..>134203)
                     /locus_tag="MRET_2913"
                     /note="MRES_09715"
                     /db_xref="GeneID:38739679"
     mRNA            complement(<131642..>134203)
                     /locus_tag="MRET_2913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629540.1"
                     /db_xref="GeneID:38739679"
     CDS             complement(131642..134203)
                     /locus_tag="MRET_2913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485700.1"
                     /db_xref="GeneID:38739679"
                     /translation="MTLFSGTVPKNHQAPGSSAEAVDPNKQRASRRPGVLSLASLSKR
                     APQVSTSTPPTTPPTHVTHTASQAVMQTDPSRLSQFSLRMNELLNKAFVASQCNVSSI
                     AHSGTSPFTGTSISVPRIQNIVYGNNRLPNRVKVIEMTRLIIDELHNAERVDPYLLRA
                     VSRTVLKTVSHFISRIESQLVSPRTDPTALQVPVSLRGAQHISPAMEFNLALISLEWI
                     VEESLERCLEGLPPLALLHSPNILMPTAAEGMAKPPMPPFVHDILSPLREQMETSIIH
                     VVQPLLVSVKSSITECLSRANPRPFQPQMTPPLLSKTDGSTEKRQTWHKELEERLDAA
                     YRLLVLRIVDRCGQDGQAWFISVAIHIIWKGLLIITSRSVFAPASLVEAEFSHAFGRA
                     PGSMPSSMVLNALLSVEHSKRVPTPTQLAHALRNVSRPSGQRKWQGESASGTQSPTMT
                     SEDFESWSGQFALPATDVDCYVVNPLLVAEQLQDLHVFERLMLQFCTNFYPSVSYKHK
                     RNTSTTETSASADVAGRAHPENGHSDDDGEEDLAHEALREAFEALQSTITVLRTLLHD
                     PDALNHLTNDTDFENLLSPAAKQAFQMIPSLLLIQIAFCRVPPGWVGKGSAGSSGLQL
                     MNDLFLTPPSIINYTWSQYESALPGFMAAEGAALSLSERYEPLVAQILAALDQLVEKV
                     DQEHASSLQTKRSNSEPPSDDSNEDLPAVMTQSMPALDTGASEFHQPVSSANSKSSKM
                     PPISTAMSSMTVDDKQTRNHRGHARTGSSFAPRLWRRHASQAPKSAMQHALPPRVSRA
                     HATSSIGLPRGRSLHRTHQAGLPRSSNLTLAHMQRHALYTFANVVHRVPDMLSDS"
     gene            complement(<134592..>135551)
                     /locus_tag="MRET_2914"
                     /note="MRES_09720"
                     /db_xref="GeneID:38739680"
     mRNA            complement(<134592..>135551)
                     /locus_tag="MRET_2914"
                     /product="dehydrogenase"
                     /transcript_id="XM_027629541.1"
                     /db_xref="GeneID:38739680"
     CDS             complement(134592..135551)
                     /locus_tag="MRET_2914"
                     /codon_start=1
                     /product="dehydrogenase"
                     /protein_id="XP_027485696.1"
                     /db_xref="GeneID:38739680"
                     /translation="MLGLSALFPPAPKWNIDQVPDLTGRIAIVTGGNSGIGYETVRVL
                     LSKNAKVYMAARSEERAQHAITDLAKLQLPGQVEWMLLDLASLESIKKFAGEYLTKVQ
                     RVDMLFNSAGVMNPVVGPTTKDGYELHVGTNSLGHHYLTLLLLPALRASAQATPDQPP
                     RVCFTSSIAHRNSSPKGFDPTDVTGIHTSCYVPAHTRAYGQSKLYNILSANWFHRHYG
                     KENIVFTSCHPGILESELVRDWDKGLNAIAIPLLKSTIFYPAHMGAITQLYLNTAPEA
                     AGEGGSYYVAWARKYKSIPISRNERVQDAFAAWVNEQVAQHAS"
     gene            <136509..>137570
                     /locus_tag="MRET_2915"
                     /db_xref="GeneID:38739681"
     mRNA            <136509..>137570
                     /locus_tag="MRET_2915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629542.1"
                     /db_xref="GeneID:38739681"
     CDS             136509..137570
                     /locus_tag="MRET_2915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485695.1"
                     /db_xref="GeneID:38739681"
                     /translation="MSESVPANVQQLRAMFEGGDTSTNATQSTENEAFITKPSLKPKP
                     AHLSKAADRAGADSAKLSGDKPSDPRQGIQASEADTPIHAQSSVLSTEALSESDSQEN
                     ATNAQSTGNERASSLPLESIQAPMSNMSLSDDKMQHDHVILPEPHSPSLEKSPANEDP
                     ASTEVTDTNASQSTNRTPINVNVSEKKCKPQLPPRPPKPHAEKSVASSSSYVARRPAP
                     ARPATKHSLHARTPSAADAEGTQATAMRAAPPSSGQVPSRYDICFDSICTDSSSPIAR
                     SGTVYEVWMRSGLPQDELAAIWRVVAGSDPTIEGLSRTQFTTGLRTIDSYLRRDYILS
                     STASGPSPASAAPVLPARS"
     gene            <137704..>139515
                     /locus_tag="MRET_2916"
                     /note="MRES_09725"
                     /db_xref="GeneID:38739682"
     mRNA            join(<137704..137824,137855..>139515)
                     /locus_tag="MRET_2916"
                     /product="chromatin assembly factor 1 subunit B"
                     /transcript_id="XM_027629543.1"
                     /db_xref="GeneID:38739682"
     CDS             join(137704..137824,137855..139515)
                     /locus_tag="MRET_2916"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit B"
                     /protein_id="XP_027485697.1"
                     /db_xref="GeneID:38739682"
                     /translation="MVQCVTFEIRWHNTLPIYSCSFQPISAARLTQVLDHNLGQAAGL
                     PPGQCLAGDERKGQEDHQAKVPVLAGGQSWRLATAGGDNNVRIWMIHPNIPSPSALAA
                     ASGVKPNPPRSEYIATLARHTGVVNVVRFSPHGDMLASAGDDGNVLFWVRQDPSRQPF
                     GETQFSAGAETDGVIDKESWRVRLMTRATTLELYDLAWSPDGDYVAVGGTDFCVRVIR
                     VSDGSIVRSISDHQHYVQGIAWDPLQMYLATQSSDRHMHVYELQQGKTTVSTQLLSRH
                     TRSEMRCRAVSEALPSSQTAPASNAPLQDSSVTIPPIKAPKPTPVASSAQPDQVQKLY
                     GDDRCTSFFRRLDFSPDGALLATPAGLFPSSSDEHEKATTASTSATYIYGRANFSRAN
                     TPIAALPGHKSTVVVVRFSPILYGLRPTSLNTERGHPLHVAGKDHDEPMSASASVPVS
                     VIGLPYRMVYAVATQESVWIYDTQQAGPLCCFSNLHYASFTDLTWSPDGQSLMMSSSD
                     GYCSLAVFDYHELGRPYLYGKQPSLHPIPSRAPEPSAPIPAPAPQTAHPANSPAEPMK
                     EEKEAPSTTSEPKKKRRVALTYEGPLS"
     gene            <139592..>140429
                     /locus_tag="MRET_2917"
                     /db_xref="GeneID:38739683"
     mRNA            join(<139592..139610,139636..139808,139834..140116,
                     140143..>140429)
                     /locus_tag="MRET_2917"
                     /product="UBX domain protein"
                     /transcript_id="XM_027629544.1"
                     /db_xref="GeneID:38739683"
     CDS             join(139592..139610,139636..139808,139834..140116,
                     140143..140429)
                     /locus_tag="MRET_2917"
                     /codon_start=1
                     /product="UBX domain protein"
                     /protein_id="XP_027485717.1"
                     /db_xref="GeneID:38739683"
                     /translation="MSARESLMEMGFAPERIEWALRSTNATLEAALDHIEMHQDEPVP
                     PDATSPVGDDAESSETAVPQSIKCNVCNKQFRDMDLAKYHADKSGHEDFSESAEAIKP
                     LSPEEREKRLAELREKAALRRSAQEAEYAKDQRANEMIRRKAGQEAVQAREELERKER
                     IKEAEKKRRERLEDVRATILTSRWQRKSVFGAKLRKTSSAGPKRLRAKKSCVKAFRSQ
                     PHQPCHWLHSFLKSVVTEPRHDCACAHRGVYGWAR"
     gene            complement(<140609..>142117)
                     /locus_tag="MRET_2918"
                     /db_xref="GeneID:38739684"
     mRNA            complement(<140609..>142117)
                     /locus_tag="MRET_2918"
                     /product="cell division control protein"
                     /transcript_id="XM_027629545.1"
                     /db_xref="GeneID:38739684"
     CDS             complement(140609..142117)
                     /locus_tag="MRET_2918"
                     /codon_start=1
                     /product="cell division control protein"
                     /protein_id="XP_027485703.1"
                     /db_xref="GeneID:38739684"
                     /translation="MRGRAPLPLIAWGLVWPSHTVQLLRCVWCLLVFWVERGVFYRAT
                     SACDVPEHGASFRVLIISDPQVVSLHTYKSFSHAMTALVSHVSDQYIRKSWLAVTRQG
                     LGASLWRGPRPADLVIFLGDMTDRGRWFLSFDRWLALQTRWKALFQGMQLLRHASSLP
                     LRPRLAHDTWPALVIPGNHDTGLPHFQTGEPGPGTARAKSWFEQEHAPFVNEQYVLSE
                     SGQTSWNARIPIAVAGQATTHELILLDALDLVSMEPVGHDVPWELAKSNAARTTRLVD
                     MLRQNQTVPRVLFSHVPLERKEAEHACDIPWRSAIHGVHRESSRASARGGDILQGGDA
                     ARTYQNLVRKNVSHYVLDSIQPALIFSGDDHDHCEAIHKGIRTTPRGHVAGFDSADAP
                     ELTVKSISMLEGVRHPGYAWLQLHAEAPMEYTPCLLPDQVGLWLFVYLPCFIASVMYL
                     TWRRLSLRSSAYLPIHNDTTHAPSKTAMLRRILRDIGHTTLIPLLLWLCLQR"
     gene            complement(<142154..>143503)
                     /locus_tag="MRET_2919"
                     /note="MRES_09730"
                     /db_xref="GeneID:38739685"
     mRNA            complement(<142154..>143503)
                     /locus_tag="MRET_2919"
                     /product="RNA exonuclease NGL2"
                     /transcript_id="XM_027629546.1"
                     /db_xref="GeneID:38739685"
     CDS             complement(142154..143503)
                     /locus_tag="MRET_2919"
                     /codon_start=1
                     /product="RNA exonuclease NGL2"
                     /protein_id="XP_027485702.1"
                     /db_xref="GeneID:38739685"
                     /translation="MDHHPEAIAKKRAERARRKHEASAKPLEEDPVNTKEAIVRRSWM
                     PVNSHASAGARRVRIVSWNMLAQCLVRRELFPGSDCLKLRTRLPGIVAELTETDYDIG
                     CFQEVDSLEDIGPPLTRAGYDYVYERGYKEKKHGLMIAWRQSPGARTSFGAPVFRKMV
                     RLDEAMLTQGTSSLTRITRNIMLVLALPFASGDGGVLVATAHLFWHPRYAFERARQAA
                     VIMQELNALRRGQEAWASWPVVLAGDLNDQPHSSTYSLLTGQAERYRDRIWTDLMPSR
                     VVHTSVDELRGLRTVHYASTVTESGDEDRVLGRHRPPEDEELCTPDDLIQLAQLSSTR
                     PHFQSAYGSAYDQLAPHAEFFCDRGTAPERYDQTESPMPTDPRQLQSHEPKWTLHSTL
                     FRLSLDYILVAPRLDEADVPVITALLPLHPEHVLQPGIPRQKVCSSDHVMLGAEVAL"
     gene            <143527..>144369
                     /locus_tag="MRET_2920"
                     /note="MRES_09735"
                     /db_xref="GeneID:38739686"
     mRNA            <143527..>144369
                     /locus_tag="MRET_2920"
                     /product="tRNA
                     (cytidine32/guanosine34-2'-O)-methyltransferase"
                     /transcript_id="XM_027629547.1"
                     /db_xref="GeneID:38739686"
     CDS             143527..144369
                     /locus_tag="MRET_2920"
                     /codon_start=1
                     /product="tRNA
                     (cytidine32/guanosine34-2'-O)-methyltransferase"
                     /protein_id="XP_027485422.1"
                     /db_xref="GeneID:38739686"
                     /translation="MGKSTKDQRDHFYRQGKQEGYRARSAFKLLHLDEQYALFGRPGH
                     SLGARIVNQERGAPLPSDAASRLCAELGEKLGRSVYAALARDAHPPGYVIDLCAAPGS
                     WSQVLSRQLKSSGACIVAVDLQSMAPLEGVTQVVGDITTEETCVAVQQAFQRAQSTAY
                     TQPADLIVCDGAPDVTGLQLVDEFLHAQLMASAVSMVVRLLRKDGTFVAKVFAEPHTP
                     STDMLLAQLRRLFRYVELAKPPSSRASSAEHFVVCMGFFGTQKSIPTLQQEFLGDLSG
                     YNAT"
     gene            complement(<144362..>145658)
                     /locus_tag="MRET_2921"
                     /note="MRES_09740"
                     /db_xref="GeneID:38739687"
     mRNA            complement(join(<144362..145438,145464..145574,
                     145599..>145658))
                     /locus_tag="MRET_2921"
                     /product="tRNA
                     (adenine57-N1/adenine58-N1)-methyltransferase catalytic
                     subunit"
                     /transcript_id="XM_027629548.1"
                     /db_xref="GeneID:38739687"
     CDS             complement(join(144362..145438,145464..145574,
                     145599..145658))
                     /locus_tag="MRET_2921"
                     /codon_start=1
                     /product="tRNA
                     (adenine57-N1/adenine58-N1)-methyltransferase catalytic
                     subunit"
                     /protein_id="XP_027485426.1"
                     /db_xref="GeneID:38739687"
                     /translation="MSHTRASRLIAEGDVVIVFVSRDRTPTVLVVQRGEQLINMFGVF
                     PHDDMIGRAYGSKMHSNNKKGFIYLLRPSPELWTISLPHRTQILYAPDMSFITMKLGL
                     SPGACVFEAGTGSGSFTHFLARTVARGPSPDYERGQVAEVWRGEGLARTPGASDVQAS
                     EYGGRVYSFEFHAERVDKARKEFAAHGLDSIVVLDHRNVCKDGFGITNRADAVFLDLP
                     APWEAVPFAKEVLRQDISTRICCFSPCIEQVLRTVTSLSEHGFTDVTMYESLVRTHES
                     LTNVAPLDSISQVVERIRQSEAKRESRRQMQIAHSRADRERRLAEQQGMQTSEPHAQA
                     PCSDGSLKRKADATEEPAEAAPGTLAENEQDTAAEMLYSAGFRQKVERRPMTLANVYS
                     RPYAQMRGHTSYLTFATLLPRST"
     gene            complement(<145727..>148765)
                     /locus_tag="MRET_2922"
                     /note="MRES_09745"
                     /db_xref="GeneID:38739688"
     mRNA            complement(<145727..>148765)
                     /locus_tag="MRET_2922"
                     /product="ribosome biogenesis protein MAK21"
                     /transcript_id="XM_027629549.1"
                     /db_xref="GeneID:38739688"
     CDS             complement(145727..148765)
                     /locus_tag="MRET_2922"
                     /codon_start=1
                     /product="ribosome biogenesis protein MAK21"
                     /protein_id="XP_027485431.1"
                     /db_xref="GeneID:38739688"
                     /translation="MPRDFRPKGQSSSSRKRNDGHEKPKMNVADDDPNVPDDVLREQV
                     AAMGGTDEDLDLIQGKARGPATKLTDAELSSELMAFMAKENMPTQPKPAKVANVPAKP
                     EPSKRSTKNKEPQEAPKPPRKESKQQHPTKPMRQEIPKPSTSNKHVVFDGDDATPKAA
                     KPASLRLLIEPVSDWLHISRPEIHGGKVPAEVSNDLITTLHDLGKQVMHSENDIYDRL
                     ASGEGGRNVILGSMNFSDLQFARTLLMSSKASTLSDRISAVTLLLQSSPVHNLKALEL
                     LMSMSGKPSREESSRATRALADWFASGGGLGTDKLHYFRDQPELPQAAAAYKSGVTDQ
                     LKTCLCLWAFEDYLKRTYFAFVQLLERQTHDTLVFMRRQAVTQVYVLLRDKSEQEHNL
                     LRLLTNKLGDPDRSVASKASTHLMELLQVHPAMKPIVLREVSEAVLRSQQPSAGQHVK
                     GNQHATYYGVLTLNQTLFVESDAPLANDIFTVYFQLFDVCLQEEEQPDAESEPAKDKK
                     RWRDRHKATPASQNKAASDVYNRLLAGILTGIRRVFPFTTLSTDALDRHLDTLFRITH
                     THSFNIAIQALQLIFQVAIGTSSNGEAARGFSPHVADRYYRILYDSLLDSRLATTSKQ
                     AMYLNLVYKSIKADADPERVKALVKRLCQILNVQEPPFIVGALVLLGELLKAKPGLRA
                     MLTEAEEEGVEHFEDVDDEAPSKPSHTPIVSSYDGRKRDPRFAHAGDTALWDLLTLKD
                     HYHPSVRLNAMQLLQGEKVTSDADLTLNTLMHFLDRFVFKNPKKRSGVKGSSIMQPSL
                     SDAQGDVLVRRTDAPLSYVNTAAFWSQKPENIPADQQFFHQYFQTKLKRSHVPEKPQE
                     QPAEEEASEPATDDEEEDEIWKAMKSSMPSHEEGDDVDQDDEEDDDELLAQLKADAEL
                     DGSEPDEVDDDGRESASVSDDEDDNEDDGMFLEDEEDLVPFTNFEDEEEDAPAAGTKR
                     SADEADDDATRSSRSKRRAMPAFASAEDYAHMLDSDDEGN"
     gene            complement(<148872..>149764)
                     /locus_tag="MRET_2923"
                     /note="MRES_09750"
                     /db_xref="GeneID:38739689"
     mRNA            complement(join(<148872..149594,149627..>149764))
                     /locus_tag="MRET_2923"
                     /product="transcription elongation factor S-II"
                     /transcript_id="XM_027629550.1"
                     /db_xref="GeneID:38739689"
     CDS             complement(join(148872..149594,149627..149764))
                     /locus_tag="MRET_2923"
                     /codon_start=1
                     /product="transcription elongation factor S-II"
                     /protein_id="XP_027485437.1"
                     /db_xref="GeneID:38739689"
                     /translation="MSSLLEKTRDLSKQLSKAAANSQPDDMIMLLKQLKEVVEPSEEL
                     IRTTKIGVTVGKLRTHSDNRVSELAKDLVKSWKTQIEKQRREATSMDKSKKEAQPADT
                     KPSTTTPSTKSIDINFEVLNDKVRNACLKLLYSSLELQEDAEPKTVFASAMEIEQAVY
                     AKIGGGSINNDYRSKVRSLSLNLKDKNNPELRQKVLKGEIPAETLVVMRSEELASKVL
                     KEQHEALRQQNLHNAKGAEAQEAETDAFQCGKCKQKKTRYYQMQTRSADEPMTTFVTC
                     VNCNHKWKFS"
     gene            complement(<149921..>150283)
                     /locus_tag="MRET_2924"
                     /db_xref="GeneID:38739690"
     mRNA            complement(join(<149921..150001,150029..150115,
                     150158..150217,150248..>150283))
                     /locus_tag="MRET_2924"
                     /product="signal peptidase complex subunit 1"
                     /transcript_id="XM_027629551.1"
                     /db_xref="GeneID:38739690"
     CDS             complement(join(149921..150001,150029..150115,
                     150158..150217,150248..150283))
                     /locus_tag="MRET_2924"
                     /codon_start=1
                     /product="signal peptidase complex subunit 1"
                     /protein_id="XP_027485391.1"
                     /db_xref="GeneID:38739690"
                     /translation="MNSLLDVFQGNIDFQGQALAEYLLHRVMIVSAVVAFITGYIRQD
                     LSLCYQIVGAGLLVCVLLCIPPWPAYKRYHVKWLSPGSSSGSS"
     gene            <150414..>151819
                     /locus_tag="MRET_2925"
                     /note="MRES_09755"
                     /db_xref="GeneID:38739691"
     mRNA            join(<150414..151351,151378..>151819)
                     /locus_tag="MRET_2925"
                     /product="DnaJ domain protein"
                     /transcript_id="XM_027629552.1"
                     /db_xref="GeneID:38739691"
     CDS             join(150414..151351,151378..151819)
                     /locus_tag="MRET_2925"
                     /codon_start=1
                     /product="DnaJ domain protein"
                     /protein_id="XP_027485419.1"
                     /db_xref="GeneID:38739691"
                     /translation="MSSDTAKLVLPSRKKEPYVTVSCPYVDCRVSIEYLAPTKESVST
                     LPAHVTTFSVTCAACHRNFDPPASSKTLREIRAQLQHRERGPQKIRRRIGTDENPLDM
                     TYYDVLGVPATATDVDIKKAYRKMAIKLHPDKNPNDPEGEEKFKTLGAAYHVLSDRDL
                     RHKYNEFGPSTPGLIDPDGVVDPEEVFGGLFGGERFYDIIGNISIGRDLKEALQKDSD
                     ELSAGAEGQEAPTKGDKHLTPEQAEAKKAEEEKQEKEKEAQREKRVSMLADKLAHKLS
                     VYVESVKTADDPALVEEVREGFQRITLLEAEELKKENFGVELLHAVGFIYGAKSRHYA
                     ASNGMLGSLGGFFHAASSSFHTVRETVSTFRAALDLKSVFDELAKAEEEGITEERKKQ
                     LEDQAAEKGLHALFKSAKLEIESIIRDVCDRVLYDTRLSRQTQKLRADALGIVGHVYV
                     HVQSDEDHP"
     gene            complement(<151824..>153425)
                     /locus_tag="MRET_2926"
                     /note="MRES_09760"
                     /db_xref="GeneID:38739692"
     mRNA            complement(<151824..>153425)
                     /locus_tag="MRET_2926"
                     /product="amyloid beta precursor protein binding protein
                     1"
                     /transcript_id="XM_027629553.1"
                     /db_xref="GeneID:38739692"
     CDS             complement(151824..153425)
                     /locus_tag="MRET_2926"
                     /codon_start=1
                     /product="amyloid beta precursor protein binding protein
                     1"
                     /protein_id="XP_027485470.1"
                     /db_xref="GeneID:38739692"
                     /translation="MTSRPDRHTQRYDRQLRLWNKSGQSSLEAAHVLVVGASSLSSHI
                     LKNLVLPGLGSFTVCDDARVSPDDVASNFFLETDSVGASYADELVRLVRELNPATSAH
                     ACTKAPAWLLEHEPAFFTQFSLIICVRQTRLLAETLADISWHHTPPIPVVCVRNSGFQ
                     GCVGVSVGELGIMETHPDSLVDLRLTRPFPELTAYARQFALDTSDSLALSHTPYVVLI
                     LRALDAWASRHQGALPTSAERREFIDTMASQRAKYGDAENLDEALAALAPHVWRPLQC
                     PAVPAHVTALFDDAQCRHSTHGFWLLVAALHAFVQQCGTLPLTGAVPDMKAMSLEYAA
                     LQRIYVDQARRDLDMFQHILDDVVTKAGTSREAAGLEDDTVRTFVKHAAFLQLVRGRR
                     LRLQRTEPNIGALATALADPVNPVTAQYHLAFVASDTFYEHTHRYPGQRHDWQADVDP
                     LLSHAQTYCARIGLDLSDSDRVRLQHACYELTRGAHSDTPSTAAYLGGVAAQEVIKIL
                     TVQYIPLDNTCVYDGIVQAVSSFRL"
     gene            <153539..>158644
                     /locus_tag="MRET_2927"
                     /note="MRES_09765"
                     /db_xref="GeneID:38739693"
     mRNA            <153539..>158644
                     /locus_tag="MRET_2927"
                     /product="nucleolar pre-ribosomal-associated protein 1"
                     /transcript_id="XM_027629554.1"
                     /db_xref="GeneID:38739693"
     CDS             153539..158644
                     /locus_tag="MRET_2927"
                     /codon_start=1
                     /product="nucleolar pre-ribosomal-associated protein 1"
                     /protein_id="XP_027485297.1"
                     /db_xref="GeneID:38739693"
                     /translation="MTRPSASELCEQLASPSADVVARALGEVRAWTRLHPSELGDYGD
                     AIMIRASDERLRWTVALCTEGAIPRVLDAWTLAEKRDVHPLRILVFQVLAQILHLLSC
                     HQPNHVHGDALLTTLLDPASPWMAHIQESVSRASQPTKRDKASADMIRLLLALRLCTA
                     MAMYARGKYAQMVWERFHWTSEAHARMASMRRRAGAQAVSMRDMDVRTQYLAFLLAML
                     TQTYSTALKMVVLDIGTDAWQALCRGITSDPPDVVRFVLLVVHEEVCKDEQLARSVKA
                     KFLGDVCPLLLGLYAREREEAGSTSVADVVHHFLLSTATHPGFGMCYADRGWYGRDGQ
                     DSDTLHNKMLLHLVRKLDVTNDLRQQELALRICEACPELVGPVLARAVIDVRADQTAC
                     YVHWAYVGRVLQLPVPALGALPPPRATILAHTAPEPVCRAVAKALAPSHALLQYVACT
                     VCACMLERMCAFRRAASQAAQAAEEGPDGPWTRCVASLELAWRTRLPAIELVAPLMHK
                     ACAMQREAALRVLALYMEALPGTAFDTHWDAGSLLTRAFLDPPPTGLHWERVSQMHVL
                     RMLMSASVDMLSKVPTPWPAHARRSYAHFVLVAYTRAAPALRAQCAALLRHWLGRTAV
                     LTHDPTELDAWLVPLDDDADVLAFWDDCLVRCVRTPYRYAERIRELVGEHAAMSPLLA
                     VVWEQAEIRLAKRLWTDAQAQRIVAYMARLCVELLRHGCAARPLRTLAHRIGDPIAAW
                     MDAACVVPTRAVPHPVLQSRPATYARVADTLSAYDAPLMLQVWLERVHPAHAPDLVSC
                     TWDALDRWAARHALAPSLQARVWEHATTRAWLEAEDATYLVRLVAFLCTMPSARLLRR
                     VVDVVVERAARAPAPWLATLARLAPYASEAHLVTLLRAWPSPAEASEAQLQALAQLVP
                     HTGTEALRLLHTHMASLMQRASDAACDVLDAVLDATLPPGLDPFTPPTHGSLAALAHA
                     RTYVPRALPVLRDTTAARAMYAAASAPPPRPWGPYTTLAALEGPHACASPPVASLVPA
                     CLHDPLACATVAAAYALDAASWDAALDAALRGASLTTFCAPHVAWLVHTCGSDRLHAA
                     LVDVGLRFLTRRMAEDAHDAPRTVAWTRALRRIVRRVPTSLAEPMLEAIVHHRATDTD
                     AIRLALAVARACTLRDSVAERLLHALVAQTDVVYAATHTPAFRRPCVALLVRLVQRDS
                     LATPTTLARLVYLYRGTTDACDAALWAVLERGTRDGAWAAAWSADKQTVPTSLPLASC
                     LTALLSLLPTASYDPWLVLNLVGGAILERETHDAYLTGLEWLAILRTGAMGRVVTCLS
                     THRAALRLHAMRVLGQVHASLQPTAFREKELVLLVLERVRDALPPPPPTSVAGTYDEV
                     PWLPSMTTMLAAHALRLVATPHASAFPDVCRYLLQRPRLDVLDVPMLYRSLHSTHDSW
                     AAQRAWILRFLHDAWQAHASVADTPHPRGLQRARTEWSMFKRRHVWDLVLSMYGTMLS
                     SAAAPDHRFAQQLEDVMLAAAAIPHVAQDLITRRGLLGWITLRIASERPTSERAVFWY
                     TWLWTLCAPPSLPPHATLARLERLDHQLDGALVPAVLLPATHLVRTAPWTDACARPAL
                     ALLAVLAEYAALQDTTCRDLRPCLAVLAPLASWLRTHPDRDLHSTALRCTLLLSDAGA
                     PPPHIRRLFALLRLDQVPATRPWAAAALRSLHL"
     gene            <158692..>159026
                     /locus_tag="MRET_2928"
                     /db_xref="GeneID:38739694"
     mRNA            join(<158692..158879,158906..>159026)
                     /locus_tag="MRET_2928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629555.1"
                     /db_xref="GeneID:38739694"
     CDS             join(158692..158879,158906..159026)
                     /locus_tag="MRET_2928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485358.1"
                     /db_xref="GeneID:38739694"
                     /translation="MWRRVVKSRPGASTCRARRTRSSRCGSSGTSPACDTAKSCWTGT
                     SSPKTARTMRRRAAPSGASSPTRRAPPAASICGAPSCASRVRTQRACSVIRCAMPRCP
                     "
     gene            <159260..>160465
                     /locus_tag="MRET_2929"
                     /db_xref="GeneID:38739695"
     mRNA            <159260..>160465
                     /locus_tag="MRET_2929"
                     /product="ubiquitin carboxyl-terminal hydrolase 22/27/51"
                     /transcript_id="XM_027629556.1"
                     /db_xref="GeneID:38739695"
     CDS             159260..160465
                     /locus_tag="MRET_2929"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 22/27/51"
                     /protein_id="XP_027485417.1"
                     /db_xref="GeneID:38739695"
                     /translation="MNDARTPHSESLPCVCRMPRGLRNMGATCFLNVILQAFLHNPLL
                     RNYFLSDRHNAALCSLGRDCLACEMDKLYKEFFGASDTQGPYGPTSFLFAIWMDVSSA
                     ELSQAGQHDAHEMFISALNGIHNALTAHALERTKLPPCPWTDDRHLELLSEHADDHTP
                     VPKPAVDHVAMCPCVIHRTFCGILQSSVTCQSCQLSTHTHEPFLDVSLQVHAPGDTDE
                     SKKKRHDPKKQKQSIEAPAQTLHASLLRYCAPEQLPEASYRCSHCQKSARATKQLRLF
                     QLPPVLCIQLKRYEHGLSATKVDTRVQFPFVLDVHECCAHTAHGDESLDPYAYAYDLF
                     TVVVHEGTLTSGHYTNYSKWRGLWYRYDDDKVTRVSTHQVLEARAYQLFYLRRRLWNQ
                     PGHGIYTNS"
     gene            complement(<160460..>162175)
                     /locus_tag="MRET_2930"
                     /note="MRES_09770"
                     /db_xref="GeneID:38739696"
     mRNA            complement(<160460..>162175)
                     /locus_tag="MRET_2930"
                     /product="protein of unknown function (DUF2424)"
                     /transcript_id="XM_027629557.1"
                     /db_xref="GeneID:38739696"
     CDS             complement(160460..162175)
                     /locus_tag="MRET_2930"
                     /codon_start=1
                     /product="protein of unknown function (DUF2424)"
                     /protein_id="XP_027485476.1"
                     /db_xref="GeneID:38739696"
                     /translation="MRKGSLAPDASYESKSQKSFCVDHASMSSDHGLDDDKWLRLSFP
                     FPLPHVQRKREQDLDLHGQRDSVPGRRTMRMIHFPLTLPTTDFPNQGQGQLSEFFVQR
                     PIWAMEPCRTLYCAAFATYMLCLYVPYKAVINIPPCNRPRRSWTWKKAMLVSLIRRCT
                     VFICKTHILLTGQPSEKPPKCTKSLYVHIDPQTVLSGSESEKPGDIRGELARAMKLQR
                     IKPVCISGFFVAAPDEPIPASDRAMPDERIIVHLHGGAYWMGTANEKSPSAAFCRDLL
                     RRLEGEKGMPQRAFLVEYRLARHGDYEHGSYPAALLDAFVAYLYLIRTCGFRPENIIL
                     SGDSSGGNLALALCRYLRDEGVENVPGSLLLLSPWCDVSRSHSGPLPAPNPFSTTVLN
                     NQSDVITASLLYRNSAVCPLLGRLPASETYKNPYISPVSLQLDAQSGVYPPHWGFCGF
                     PRHVFINTGRAELNSEQHVTLAHRMAEGTVSGVPQYSGDCDYSEDRAHNMSWRDQFPR
                     TKGWVSRHDSHVQRHACDQRPLENRRVVLDEAIDGVHIYPFFLWFEPERSDTLDRIAA
                     WIRAL"
     gene            complement(<162320..>163276)
                     /locus_tag="MRET_2931"
                     /db_xref="GeneID:38739697"
     mRNA            complement(<162320..>163276)
                     /locus_tag="MRET_2931"
                     /product="phosphatidylinositol glycan, class C"
                     /transcript_id="XM_027629558.1"
                     /db_xref="GeneID:38739697"
     CDS             complement(162320..163276)
                     /locus_tag="MRET_2931"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class C"
                     /protein_id="XP_027485474.1"
                     /db_xref="GeneID:38739697"
                     /translation="MGDDTIAPAACWEKVLWKKQAYEDNYVDASFLSQLRTNATASFP
                     TWEFIMLSSLSIGQKLSIVLLFVAIFAHLYMGLLHSSALIWLSTLTTFILACMGSCVP
                     KESELVNEGKSIAHTISSIVVLIFALQALSPVVRTFSETTTDGSVWACAAILFGGHLA
                     FADYSMLQDPRSRLRSTISLNMAMCASVVLSSRLTMDADVYALLLVALQLFAIYPLLR
                     DRVYTYYGNVTTRDQRQIPRMVVPITSLFVCASMYAMWRVSPVVAVFLEPCALFFVCL
                     LCPLWMRRAQRWKTEMRGPWDEAVLVPPPLQRVDSACGVRLG"
     gene            <163694..>165631
                     /locus_tag="MRET_2932"
                     /db_xref="GeneID:38739698"
     mRNA            <163694..>165631
                     /locus_tag="MRET_2932"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027629559.1"
                     /db_xref="GeneID:38739698"
     CDS             163694..165631
                     /locus_tag="MRET_2932"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027485472.1"
                     /db_xref="GeneID:38739698"
                     /translation="MTSATQGPIPIIRSGETTNSNAMHDGTPMARTNTSGSYLGLSAG
                     LSGSASFREAMAVSFGKDVADLLEYSIGRFSSSTDSDATVAGPSSVRLESTFCRNFTC
                     CGKELDDLHDLLQHYEECHVRFEDDDTESMVTDEDMDDASMTTEASASSQHPTAAAPL
                     AATTDVGMSNSSVDEEMPSARSRPLISSTINNTPMVSTTNENLEYPSAFDTAVMCSPS
                     GRGKKRTHGQQAGGSSSNPLFRALLENGGRHPLSMSGTYSSPFSSPGTSRAGTPSIDS
                     ENEAFLGSTTQPTIFSNLNIRGNAADDQLPSCAPPNLFFPSANVASLQRPVKRERFGP
                     ITTPSTPSTPTTANFSGSSTSAADNSTSEHRPYKCPAPGCDKAYKQMNGLKYHRLHGH
                     CNQNLRNVNSGNATSSPNTVTTASSTQGSTAQKPSTPNVLGAGVTSASASSNDTSIGT
                     PGPVLGSGDATAKSEFKPDSPQSDVIMTGISTPAQGLFSSLNYGTPLGSPTAPNKQEP
                     VSVSPAKNLNNAQPDKMYVCQVGNCDKRYKNLNGLRYHYLHSGSHGLLGLQLLHANGG
                     GASAKADSVSGRPPVSTDTLSREQIVQAAAAAQALLSQQGANCNKGPNGNTNPNLTAA
                     AFLSSVTNNNAAIAMANAEPL"
     gene            complement(<165807..>166418)
                     /locus_tag="MRET_2933"
                     /db_xref="GeneID:38739699"
     mRNA            complement(join(<165807..165856,165886..165903,
                     165939..165959,165990..166318,166350..166374,
                     166403..>166418))
                     /locus_tag="MRET_2933"
                     /product="monomeric glyoxalase I"
                     /transcript_id="XM_027629560.1"
                     /db_xref="GeneID:38739699"
     CDS             complement(join(165807..165856,165886..165903,
                     165939..165959,165990..166318,166350..166374,
                     166403..166418))
                     /locus_tag="MRET_2933"
                     /codon_start=1
                     /product="monomeric glyoxalase I"
                     /protein_id="XP_027485471.1"
                     /db_xref="GeneID:38739699"
                     /translation="MGYSEETASFRFHHTMIRVKDPKVSLDFYENVLGMELIDKMEGS
                     DFTLYFLAYQHQKNEPLGKREAVLELTHNHGTENDPNLSYHNGNSEPRGFGHLAISVD
                     NIEAACERFERLGVKWQKRLTDGRMKTIAFILDPDNYWIEVVPSTLSFSK"
     gene            complement(<166530..>167928)
                     /locus_tag="MRET_2934"
                     /note="MRES_09780"
                     /db_xref="GeneID:38739700"
     mRNA            complement(join(<166530..166738,166767..>167928))
                     /locus_tag="MRET_2934"
                     /product="tyrosyl-tRNA synthetase"
                     /transcript_id="XM_027629561.1"
                     /db_xref="GeneID:38739700"
     CDS             complement(join(166530..166738,166767..167928))
                     /locus_tag="MRET_2934"
                     /codon_start=1
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="XP_027485648.1"
                     /db_xref="GeneID:38739700"
                     /translation="MTAEVTLSKQERYALITRGIEEIIGGESIQQVLDANERPLRCYW
                     GTAPTGRPHVGYLVPLTKLADFLRAGVQVKVLFADIHAFLDNMKAPIELVKHRAHYYQ
                     QILTCVMKSIGVPTERLTFVMGSSYQLTEKYNFDVYRLAAMVTEHDAKKAGAEVVKQV
                     ASPLLSGLLYPGLQALDEQYLDVDFQFGGLDQRKIFMFAEQYLPKLGYQKRAHIMNGM
                     VPGMNGSKMSSSDTDSKIDFLDSPSEVSKKIKAAYCMEGEVEENGVLAFVGAVLMPIA
                     RVRAEMMDKHTRLEGQSRSFIPDEAPEGTLFSIMRPEKFGGPLHYVSYDDLVRDFKEK
                     KLHPADLKPAVATALNTLLEPVQKLYETEEFKKIKALAYPDEEPKAKKVKAKKLNPMI
                     APYFTKEEGGLAESPEEAAANAKAAGFEYKQRKGKKGNAQKQDDSAQAEADAPTEALQ
                     NLSVHP"
     gene            complement(<168098..>168754)
                     /locus_tag="MRET_2935"
                     /note="MRES_09785"
                     /db_xref="GeneID:38739701"
     mRNA            complement(<168098..>168754)
                     /locus_tag="MRET_2935"
                     /product="endosomal cargo receptor (Erp3)"
                     /transcript_id="XM_027629562.1"
                     /db_xref="GeneID:38739701"
     CDS             complement(168098..168754)
                     /locus_tag="MRET_2935"
                     /codon_start=1
                     /product="endosomal cargo receptor (Erp3)"
                     /protein_id="XP_027485647.1"
                     /db_xref="GeneID:38739701"
                     /translation="MSVRTNALAVLLLVLTIYTTITDAAALTASVPQRGKSCYFAWVD
                     QKYEKVGFYFAVQEGGDFDVDYTLISPHDKIILHGEKSSQEDFVFTANEAGEYSFCFE
                     NRVSTHEEKLVDFDITVESEPRLELPLAKAALLRDQSSPVEESMSKIDSDLTSIERTL
                     RYFRLRDNQGYVLVDHTQHRITRYSIFQALIILGVSVGQVYMVKYFFDRGSSASRFRV
                     "
     gene            <170375..>171721
                     /locus_tag="MRET_2936"
                     /note="MRES_09790"
                     /db_xref="GeneID:38739702"
     mRNA            <170375..>171721
                     /locus_tag="MRET_2936"
                     /product="solute carrier family 29 (equilibrative
                     nucleoside transporter), member 1/2/3"
                     /transcript_id="XM_027629563.1"
                     /db_xref="GeneID:38739702"
     CDS             170375..171721
                     /locus_tag="MRET_2936"
                     /codon_start=1
                     /product="solute carrier family 29 (equilibrative
                     nucleoside transporter), member 1/2/3"
                     /protein_id="XP_027485607.1"
                     /db_xref="GeneID:38739702"
                     /translation="MTDAECDISQTRPRMLVPVTAALLGMCVLAPFNALVSSIEYFHD
                     AFRLTPLESVFSSGIMTVFNATAVVCAVTALFPQGTKRFMVMKRIQIMLVASMALSSV
                     VIVSIWIRGNDAPRNPTLYYIILLVMSIALALVQTYLQNATMAFCTSLDIHGYVTGYM
                     LLGQALNGVFGSVLNLASSMSASKISHEAVAQNKRSALTVYVSTALLQLVTWWAFRRM
                     LRAPLIKQRMEGWTQVEHDRQGPDMSWTRIKRVQASLVPWSASIFVLFAVTLCVYPGI
                     TSRVRTTTQSAWLQNEGVFVALHIVCMNIGDLMGRRLPIIFPATNVRRVSVAIACTAA
                     RILFLPFFLMCHLGKHVSSPIPDSLFFLCVWGIGLTSGWLSTSLLICGPQSVNTAHPH
                     GERNILLQQEDSYEIPATERTAAQDATVASMLLSFWIVSGLTAGGALSLLVNILLG"
     gene            complement(<171767..>172127)
                     /locus_tag="MRET_2937"
                     /note="MRES_09795"
                     /db_xref="GeneID:38739703"
     mRNA            complement(join(<171767..171813,171854..171937,
                     171976..172033,172074..>172127))
                     /locus_tag="MRET_2937"
                     /product="NADH-ubiquinone oxidoreductase 9.5 kDa subunit"
                     /transcript_id="XM_027629564.1"
                     /db_xref="GeneID:38739703"
     CDS             complement(join(171767..171813,171854..171937,
                     171976..172033,172074..172127))
                     /locus_tag="MRET_2937"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 9.5 kDa subunit"
                     /protein_id="XP_027485477.1"
                     /db_xref="GeneID:38739703"
                     /translation="MGVFSSVARPAVNTFKYMRWAAHERPVVFFSLIVGAIGPIAVVT
                     VPQYRAKLGWKPAERIPVTYPLPDRPRQPVSGYDDE"
     gene            <172488..>174074
                     /locus_tag="MRET_2938"
                     /note="MRES_09800"
                     /db_xref="GeneID:38739704"
     mRNA            <172488..>174074
                     /locus_tag="MRET_2938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629565.1"
                     /db_xref="GeneID:38739704"
     CDS             172488..174074
                     /locus_tag="MRET_2938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485469.1"
                     /db_xref="GeneID:38739704"
                     /translation="MGSPYYDHFDASLNSFVDYSEAAPEIGAFTFEDGPFSSLSGAGI
                     GNTDESSLALQRTKSEVLPSNVEAMPKSHDILGAFSGRLRMQWPADDMPLGIESSSST
                     GSTSSIVSQSKQTSSDVPPLGPRRKGEQHMHNTTDSESEIGEADHPAFAPSAPLQVDS
                     TSPPVTPQAVSRSLPQVMKMPMAVPLQVSPSQESLQRMRHLQLTSNVGPVLPKTRMQD
                     NLMMLMPESWAMSAQPLQQHMEPHMLHHMAVKNNVMLGSSPSSQQTEPSLCINPASTQ
                     ARTRPSSVDGAHMLWAPISLGSSQEDPSQQQGALPLSQSPSAMPAQVHAPVRAMHRPP
                     MASPSGVRRTTHQRLPRKAQSTPHIRTMDGDPSRASTALSSPNKTRSSAKSVRRLQSQ
                     MRLSTTPGQGDQTKTPTGRLRMRGSMAALREANAMHAAKQSPGPRKPLTLSFVNYGIE
                     DAEELCSAVAPSGSYKVPLRNFKDSDDEGEPQASSPQAPPSEPLTPRSRNSPSALAPD
                     PLTLPMSMPGQHEIKLESGV"
     gene            complement(<174142..>174542)
                     /locus_tag="MRET_2939"
                     /note="MRES_09805"
                     /db_xref="GeneID:38739705"
     mRNA            complement(join(<174142..174384,174417..>174542))
                     /locus_tag="MRET_2939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629566.1"
                     /db_xref="GeneID:38739705"
     CDS             complement(join(174142..174384,174417..174542))
                     /locus_tag="MRET_2939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485467.1"
                     /db_xref="GeneID:38739705"
                     /translation="MASPAAKASAAALFSFASLEAATTRASTREVAERVLTEIRSSRN
                     HNASQTTALASWTQLYAGQPPHAVQALANVELFLRSKRKHYALMEKYNPLYGMSDKDR
                     IRATARTVGLQVPTKDKPNL"
     gene            complement(<174655..>175721)
                     /locus_tag="MRET_2940"
                     /note="MRES_09810"
                     /db_xref="GeneID:38739706"
     mRNA            complement(join(<174655..174667,174697..175583,
                     175622..175693,175719..>175721))
                     /locus_tag="MRET_2940"
                     /product="protein transport protein SEC13"
                     /transcript_id="XM_027629567.1"
                     /db_xref="GeneID:38739706"
     CDS             complement(join(174655..174667,174697..175583,
                     175622..175693,175719..175721))
                     /locus_tag="MRET_2940"
                     /codon_start=1
                     /product="protein transport protein SEC13"
                     /protein_id="XP_027485587.1"
                     /db_xref="GeneID:38739706"
                     /translation="MEMQASTADLSSDAKMVETYHEDAVHDAQFDFYGSKLATCSSDR
                     TIRVFDVQKGEAVGAGETLVGHEGPVWQVAWAHPSFGTILASASYDGKVFIWKNEPAN
                     GSYGSGGWARIKDHALHTASVNAIAWAPHELGATLACASSDGRVSVLTFNEDGSWSVD
                     LVAAHPGGCHAVSWMPVSTATTEPGAPMMCRLATAGCDAVVKIWEFSEEHNRYVEIDQ
                     LKQHRDWVRDVAFAPSLGLARTYLATASQDRTVLIWTQDTPNDPWKCTPLLPGAKPED
                     RTKFADTVWRVSWSVSGNVLAVSCGDGKVSLWKENLKGDWECISDLDA"
     gene            <175866..>178175
                     /locus_tag="MRET_2941"
                     /note="MRES_09815"
                     /db_xref="GeneID:38739707"
     mRNA            <175866..>178175
                     /locus_tag="MRET_2941"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX15/PRP43"
                     /transcript_id="XM_027629568.1"
                     /db_xref="GeneID:38739707"
     CDS             175866..178175
                     /locus_tag="MRET_2941"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX15/PRP43"
                     /protein_id="XP_027485588.1"
                     /db_xref="GeneID:38739707"
                     /translation="MSTSVPPPPSTRSSDDENPYLQHQKKKKKKDMKKDTSEDGSPSD
                     PLQGVVRRKVTGAQARRILDSETNVFVSDGPRNYSEKYQKILKDRKELPVYAQMDEFY
                     EKFNANQITVVIGETGSGKTTQIPQFVALSDLPQKNRVRAADGVEVPRMIACTQPRRV
                     AAMSVAKRVSEEMDLKFGKEVGYTIRFEDMTERGSTFLKYMTDGMLLREAMNDPNLER
                     YSTVILDEAHERTLATDILMGLLKDVAKRRPDLKIIVMSATLDALKFQKYFNNAPLLK
                     VPGRTFPVEVFYTQEPEKDYVEAAIRTVLMIHQAEDPGDVLVFLTGEDEIEDACRKIR
                     TEGEKLLEEEPDLCGPLKVVPLYSSLPPSQQQRIFDPAPEPSRPNGPPGRKVVVSTNI
                     AETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKC
                     YRLYTERDWASELIEQSYPEILRSNLANTVLELKKLGIDNLVTFDYMDPPAPETVMRA
                     LELLNYLGAFDDHGNLTPLGEVMAEFPLDPQLAKMLIVSPEFKCSNEILSVAAMLSVP
                     NVFVRPSQASQRQAADAARAEFAHPDGDHLTLLNVYHAYKTYCQDMKTGSDWCWENYL
                     SHRALIQADNVRQQLQRTMERFDLSLVSLPFEDKRYYSNIRQAIACGFFMQVAHKSAG
                     GGGRGAYTTIKDNQIVTPHPSTTLDHMPEFVVYHEFVLTSRNFIRTVTEVRPEWLLEF
                     APAYYDPRTFEGELKRIFTALQNKGKRKS"
     gene            <178245..>180250
                     /locus_tag="MRET_2942"
                     /note="MRES_09820"
                     /db_xref="GeneID:38739708"
     mRNA            join(<178245..178277,178304..>180250)
                     /locus_tag="MRET_2942"
                     /product="nuclear pore complex protein Nup85"
                     /transcript_id="XM_027629569.1"
                     /db_xref="GeneID:38739708"
     CDS             join(178245..178277,178304..180250)
                     /locus_tag="MRET_2942"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup85"
                     /protein_id="XP_027485585.1"
                     /db_xref="GeneID:38739708"
                     /translation="MTTAEHDARISFYTQSFTIFTSLQSIAAAQANEAPPPESAWLAG
                     GPSAQTMQYYYRIGTLYCEAIQEYLTSLEPQQGEDESEFERHVQDMHMIFHLARVLYV
                     PEDGSGVGVVGEELLHWLNAHDVAPTTEQGQQIAQTIPPHQHPDYWDYVLRCVLRGFY
                     GTAATVLQSYVDAPESPTLQSIAAETVHMLQTVPRSTSFSTEQSFLSAHRHWHTSLRI
                     FLSSIQRKMDAVESELHQASMPSSSDVRLELEAQFRCLYELLCGVEDRVLEFAEDWKE
                     ALCAWGMLVSPSMKRDDVPETVQHITASLQVDETLARETILSHLTRGDLVKALKQCTN
                     FDLWIAAHLGDYFCKTQVLEEPQMLPDILMTWADTLLEEERLWRMALSYLDAIHTTEA
                     RDKMRSILFSVPLFGRDESDDFTKVEEVLGACIEYGMDDEVRIICRRLADALLKQQKY
                     GVAIAYSVRARDARQVQAIADHMLNDYVTHGAEHYMESVDSVPRKLLEDVLQEEQMGV
                     TPFATSSSIFSSQTFAPLVFHIKYHDFHQLFSQHNTWREAAQLLVGLLTSDVTPASFL
                     SVLLVDALPLLQSTTTLFFTLPEAYELLRVAEKVTSVEGDQADLYFYWLEQLLVNDDH
                     DETRRRKLANERMLVVRLALSQYMSRIVIESDSSL"
     gene            complement(<180479..>180930)
                     /locus_tag="MRET_2943"
                     /note="MRES_09825"
                     /db_xref="GeneID:38739709"
     mRNA            complement(join(<180479..180675,180717..>180930))
                     /locus_tag="MRET_2943"
                     /product="large subunit ribosomal protein L23e"
                     /transcript_id="XM_027629570.1"
                     /db_xref="GeneID:38739709"
     CDS             complement(join(180479..180675,180717..180930))
                     /locus_tag="MRET_2943"
                     /codon_start=1
                     /product="large subunit ribosomal protein L23e"
                     /protein_id="XP_027485586.1"
                     /db_xref="GeneID:38739709"
                     /translation="MAKISVGNKYRMSLALPAGAVVNCADNSGAKNLYVIAVFGAGAR
                     LNRLPAASAGDMVVASVKKGKPELRKKVMPAVIVRQRKPWRRHDGVFLYFEDNAGVIV
                     NPKGEMKGSAITGPVAKECADLWPRIASNAGTVV"
     gene            complement(<181196..>182115)
                     /locus_tag="MRET_2944"
                     /note="MRES_09830"
                     /db_xref="GeneID:38739710"
     mRNA            complement(join(<181196..181800,181831..182035,
                     182071..>182115))
                     /locus_tag="MRET_2944"
                     /product="GTP cyclohydrolase IA"
                     /transcript_id="XM_027629571.1"
                     /db_xref="GeneID:38739710"
     CDS             complement(join(181196..181800,181831..182035,
                     182071..182115))
                     /locus_tag="MRET_2944"
                     /codon_start=1
                     /product="GTP cyclohydrolase IA"
                     /protein_id="XP_027485591.1"
                     /db_xref="GeneID:38739710"
                     /translation="MDPAMGNRGTKRSLELYQTEDDDVADVPSLTELPPSSSSAAVPR
                     QKHGGGLGTPSGAMTVISGFSDENDPIATVLNKHGLGWPAKSTLSRLNYTPEESSANE
                     EKLAGAVRTILECLGEDPDRSGLKDTPKRYARALLWMTKGYEERLCDVISNAIFDENH
                     DEMVIVRDIDVYSLCEHHLVPFKGKIHIGYIPNRMVIGLSKLARIAETFARRLSVQER
                     LTRQVALALNEALKPHGVAVVMECEHMCMAMRGVQKPGANTVTSCMLGVFRNHAKTRE
                     EFLSLIRR"
     gene            <182283..>182572
                     /locus_tag="MRET_2945"
                     /note="MRES_09835"
                     /db_xref="GeneID:38739711"
     mRNA            join(<182283..182328,182370..>182572)
                     /locus_tag="MRET_2945"
                     /product="cytochrome b5"
                     /transcript_id="XM_027629572.1"
                     /db_xref="GeneID:38739711"
     CDS             join(182283..182328,182370..182572)
                     /locus_tag="MRET_2945"
                     /codon_start=1
                     /product="cytochrome b5"
                     /protein_id="XP_027485592.1"
                     /db_xref="GeneID:38739711"
                     /translation="MSSKITLEEVKQHASETSAWVIIKGDVYDVTEWLDEHPGGRKIL
                     LKNVGKDATDKFMNFHPDHVLKEVAPKFKIGTLVDAKL"
     gene            <183234..>186467
                     /locus_tag="MRET_2946"
                     /note="MRES_09840"
                     /db_xref="GeneID:38739712"
     mRNA            <183234..>186467
                     /locus_tag="MRET_2946"
                     /product="serine/threonine-protein kinase KIN1/2"
                     /transcript_id="XM_027629573.1"
                     /db_xref="GeneID:38739712"
     CDS             183234..186467
                     /locus_tag="MRET_2946"
                     /codon_start=1
                     /product="serine/threonine-protein kinase KIN1/2"
                     /protein_id="XP_027485589.1"
                     /db_xref="GeneID:38739712"
                     /translation="MFHPDQTHCKHKTSRKLTEATSSLRHSATLPTIAVPQQVSASAN
                     TKNDRGYFPSYSAQPFVASASPPAPKRTSSPLRPVVQESRFIPNTLDNTGLVDVEALQ
                     ALQRLTDQSSHNASRQPSIAQATANVPDSRRTTICPPDKTSVQRETPPDPPSKPLPRP
                     HEDQFRWNLGDYMLGRTIGAGSMGKVKFGYCKTDGQKVAVKIVPRNTSLNAVKQSRGK
                     SKHSGLPMTEDELEATMNRAKAKDFSKEVRVIREASLQMLLRHPYVCRMREFITHPNH
                     HYMVFEHINGGQMLDYIISHGRLRERSARNFARQIGSALQYCHANNIVHRDLKIENIL
                     ISKSGNIKIIDFGLSNVFKPQGHLNTFCGSLYFAAPELLNARVYTGPEVDVWSFGVVL
                     YVLVCGKVPFDDQSMPVLHARIKRGLVDYPNWLSADCKHILSRMIDVNPHTRASLNEI
                     VSHPWMLQDHGAPEPAYLPKRKPLTAVSIDPVVIERMTGFEFGSPQEIYHELKKILCS
                     EEYVAAVARHEDPAMASAAIEAVGLVQSAATESVPRGNRLSRQISAGINFYHRHVSRS
                     SSDVQDVSDSGESTPGVKGPLHPCYGFHPLISIYFLVKEKMDREKLGQEIYSSSDLLL
                     SEPGPVPTFNHKPALDVPESAAHDHIDRVSAYGAATFASSLPMARFAPDKSSSIIRPP
                     EKTHVSSRTMSTAVTLPVTPSPPPPSAVMMAPPQPEPQTPVFESRQKSQPQGIMLGPP
                     RPLARVDELESSLRTPPKASFMTTDASQAPSAFQRAAMPQRSVSMMHARHADQLKSLQ
                     DRHASMAFSTSGARPLPTLDAIQSEAGKNLLPCVSEAANSAGTVFADSGPNLTRRFGT
                     MSVRPTHEASDSFVPQQLSPENSHINTMDSNQQSLPFEMPSPLSNEDASKPVFLKGLF
                     SVQTTSRRPRVMIRRDLIRVFEQFKIQFTELKNGFECSYAGPLTDTDTQFAPAEAFTD
                     MTSTPATDSMNDPTPIAATGVGDVPIDRSGQSDVVLATPNSDAPSLRIGVNKPLPCNE
                     EAEVCFEICLVKVPLLLGMNGIQFRRVSGNPWKYQALAKRILNELHL"
     gene            <186638..>188341
                     /locus_tag="MRET_2947"
                     /note="MRES_09845"
                     /db_xref="GeneID:38739713"
     mRNA            <186638..>188341
                     /locus_tag="MRET_2947"
                     /product="T-complex protein 1 subunit zeta"
                     /transcript_id="XM_027629574.1"
                     /db_xref="GeneID:38739713"
     CDS             186638..188341
                     /locus_tag="MRET_2947"
                     /codon_start=1
                     /product="T-complex protein 1 subunit zeta"
                     /protein_id="XP_027485590.1"
                     /db_xref="GeneID:38739713"
                     /translation="MSAVELINPRAESVRRFQALQVNIAGAVGLAQVVRSNLGPRGTL
                     KMLVDGSGNLKMTKDGKVLLTEMQIQNPTAAMIARTAVAQDEQCGDGTTSVVLLVGEL
                     LKQAERYIQEGVHSRVISEGFDVAKAGTLQFLEQFKQPMQGDRATLLAVANTALATKL
                     PTKLAKQLAEGVVDAVLAIKPKTTGSSEVPSFKEDGSSERVGEWKTRDPIDLHMVEIM
                     KMQHKSATDSQLVRGLVMDHGARHPDMPKRVRNAFVLTLNVSLEYEKTEVNSGFFYSS
                     AEQREKLVESERRFVDAKLKKIVELKNQVCDAPANTPESERKSFVIFNQKGIDPMSLD
                     ILAKNGIFALRRAKRRNMERLQLCCGGVAQNSVDDLSPDVLGWAGLVYEHTLGEEKYT
                     FVEDVKDPKSVTLLIKGPNTHTLNQIQDAIRDGLRSVKNAIEDNSLVPGAGAFEVAAA
                     ADLLDNVRRNAKGRAKLGVEAFAQALMVIPKTLANNAGLDIQDSIVNLQDECAEGHVV
                     GLDTQTGECMDPISCGVWDNYRVKRHMIHSSAVIASNLLSVDEILRAGRSSLKGDAPG
                     P"
     gene            <188469..>191306
                     /locus_tag="MRET_2948"
                     /db_xref="GeneID:38739714"
     mRNA            <188469..>191306
                     /locus_tag="MRET_2948"
                     /product="WD repeat protein 48"
                     /transcript_id="XM_027629575.1"
                     /db_xref="GeneID:38739714"
     CDS             188469..191306
                     /locus_tag="MRET_2948"
                     /codon_start=1
                     /product="WD repeat protein 48"
                     /protein_id="XP_027485583.1"
                     /db_xref="GeneID:38739714"
                     /translation="MVHRTALDQLGNAPPIRVSYTLPSILSFQDDNAHRYVPNADNSI
                     AHSLPVLHLPASKEKPLARTVNGSSFPKIRYSANSQQCTRPMPPEDLQPQHLRPVNAL
                     ALDVRSSGTRLFSAGVDGLVCVWDLDYQNMTATPRLNSKFRPHRSWIWDMKYCSHLST
                     VLTCSSDCTIKAWNVDTAHSALELGTHRDYVKALAPSNASDWVASGSLDHHLCLWDLR
                     EGRKKPMWQIRTPSSIYSVASNHSGSVIATAGLDGVVHGWDPRMRDSAFELVGHEDLI
                     RTMIMSSDGTRVISGSSDSTVRLWSTNERRCMHTYTHHNSSVWKLYSDDENMSTFYSG
                     DRDGFLCKVYLDPSGHAENDQCIVLAHEAQDNSVHGSGITSIVAYQDKFVWTSNSLSP
                     TFRCWQDTSDLNIFKSSQVNLHDSAVFNLFNSNAPNYRPNQTELPLVASEATPLSSQP
                     MREVFGYHGILRGTMLNDRMHALTIDSGGVVVLWNVFHGSCIGTFNVNDLFAAAMSNK
                     CTSAWQPQHSPSSTLEFVQYLIEGEGCVIPWCSLDTSDGRLTITIDQSNLWSSSMYLD
                     ELHELLGNPPTIRWTEDRVILGVCVLRNLFKNLLLSESEMRRDIKDGQLMLLNWMKRL
                     NTSPEALMHMPISQLPNPPGPNPAPNQHFHAILTEMTGSNSAKGKESLSTSIPESPLM
                     HDIVRFLHEMTNKQALNTEEQVASQSSDSGNTFFGSFRRNASKRKTQNASYTVSKDEE
                     APQDYLGELASLLSGSWREKSPLTGIPKIQFSDTTSIQISRVDRENGRQVMLYHGTVG
                     STGTDAPLLELLAPLWLLSVVLSPEVVQKDAPLIKVVLLKWTPSQAAQETSSSSNLEL
                     DQLPTESTSLTAPRNIRVGRIAQYVKQSLLSMGIQIPDSGENLADIPIEILCNGYLVP
                     PRYTMAQCQTFCWKNATPGMVRLRYRRKQLL"
     gene            191355..191438
                     /locus_tag="MRET_t0048"
                     /db_xref="GeneID:38741242"
     tRNA            191355..191438
                     /locus_tag="MRET_t0048"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741242"
     gene            complement(<191509..>194858)
                     /locus_tag="MRET_2949"
                     /note="MRES_09850"
                     /db_xref="GeneID:38739715"
     mRNA            complement(join(<191509..191678,191720..>194858))
                     /locus_tag="MRET_2949"
                     /product="actin cytoskeleton-regulatory complex protein
                     PAN1"
                     /transcript_id="XM_027629576.1"
                     /db_xref="GeneID:38739715"
     CDS             complement(join(191509..191678,191720..194858))
                     /locus_tag="MRET_2949"
                     /codon_start=1
                     /product="actin cytoskeleton-regulatory complex protein
                     PAN1"
                     /protein_id="XP_027485584.1"
                     /db_xref="GeneID:38739715"
                     /translation="MFPVNQWGGTGTPNYGLYQNPQMTSGIPIQMQGTGFPTGMLPNA
                     SFVQRPSAPPPPPPQIAAAATGSTPQMMTPMNSMRPMMGQMTGMSPMMGQPTGMSPMM
                     GQPTGMSPMMGQPTGMPPMMAQMTGLPMTPQMTGASADPSMRLMYTQFLPAAQPYSGM
                     PTPSNMNFNQNSLQPAQFQSKLQSLTQIQAGPAKKSLSWAMSKEERKSYDNIFRAWDS
                     KRTGWISGDVARELFSQSGLSREQLLQIWHLADPENRGKLNIAEFHIAMALIYRALNG
                     NEIPDELPSELIPSSTRDLSESVDFLKDLLKQDTHVRKSTALNLAEPGSNKDTKYSES
                     RSFYKNPVEREATSRPSDAIAYRHQDTDSAGYRSRSRHLDRREVSFNGQVAAESLGEM
                     KRQLEKTQRMLERTDLRDEEDHDLQNEMEDVQFAIRRLQDDIEYYNRKGPHAGEQRRK
                     AERTLMQLLHERLPQLERRLERRQNLDYQRGVQESRQRDERNNDRYAHLRESATISTP
                     SVQANPQEQDVTKKETSKNPSTLSAPAAKLSPSERDAWIRSEAQRRVQERMRMLGVGG
                     GTVDKMPSVDVSVEQRLAAERSEAEARAAQADKEAKEREEARKARMRGNRQAPQPPPR
                     SHTSEARQSRPMASPEPESERALDSQHKLTPEPELGQAPDTQFKSMPEPVPVPNPPRE
                     FTSQPELVSEPEPEPEPEPGPVPDPPREFTPQPGPVSAPDPEPEPEDEPQPSRPSNNP
                     FFRSHNAESMKQQEQRPEILSKPEFVPELPVETPSAPQPTSAFPSQRYTPSTSSSRSI
                     HLPPSNEDDWDEEEEEEENPMSSRATRQQLAQQLFSGIVPTSEPAPPAPEAPPASHYP
                     ALEPAPSTSRTSLGGGMGDRNALLSQIRGGQMLRKTVTHDRSGAQSAGAVLGSSSPPN
                     GLSLASVPEPESSDDDEAGLVMPMHATKEMIQAPDANEPSFDSKAYQETRSANNADVD
                     ASLGFDMGRTMHFRSIYPFEGGEGMLSFSENQVFLIHPSLSGMSVEGDWTYGALLSDP
                     AHKGLIPAAYVTDMEHVVAAEALYDYDATSPEEASLKEGEMVQIVDQSDENWWLIVQH
                     DKCLMVPSNYVAVA"
     gene            <195028..>195274
                     /locus_tag="MRET_2950"
                     /db_xref="GeneID:38739716"
     mRNA            join(<195028..195050,195085..>195274)
                     /locus_tag="MRET_2950"
                     /product="non-classical export protein 1"
                     /transcript_id="XM_027629577.1"
                     /db_xref="GeneID:38739716"
     CDS             join(195028..195050,195085..195274)
                     /locus_tag="MRET_2950"
                     /codon_start=1
                     /product="non-classical export protein 1"
                     /protein_id="XP_027485744.1"
                     /db_xref="GeneID:38739716"
                     /translation="MVKYLIGRVADPIFGIATGIGAFFIWENDRRNAHDHGPGNTLLD
                     LLSRRMGVNNYLRERENKLEISPSSK"
     gene            complement(<195299..>197938)
                     /locus_tag="MRET_2951"
                     /db_xref="GeneID:38739717"
     mRNA            complement(<195299..>197938)
                     /locus_tag="MRET_2951"
                     /product="chitin synthase"
                     /transcript_id="XM_027629578.1"
                     /db_xref="GeneID:38739717"
     CDS             complement(195299..197938)
                     /locus_tag="MRET_2951"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027485743.1"
                     /db_xref="GeneID:38739717"
                     /translation="MRSFLHPRRVFTTPASVGTSEYGEADPEQDHLMNPYDVQSFNEH
                     SYIEEYFYDNAEGRNFEPKALSVTGLDSRHSDMVSSENDMPYLEPEQEYTKDAWNTAM
                     SFHDGRDQSVNALMPQSDIQNGGSEWPMLPTNTVSGDEEKYAAHYGQIPQRQPRRYRT
                     LKRVPLHNGHLVLDCPIPPRLMRLLPIREGREFGYMRYTAITCDPDHFVTDRYTIRQQ
                     LYGRPRTTELCIILTMYNEDERLFTRTMHGVMLNIAYLCSLRNHSTWGEGTWKKVVVL
                     IVSDGRQKIHSRTLSVLAAMGIYQEGVGKNAVQGTPVQAHMYEYTAQISVDSSLKFRS
                     AERGIVPVQVIFLLKEENKKKINSHRWAFNALSPLLNPRICILLDVGTMPKPHSIYHL
                     WRAFDSDPNVGGACGEIVVQKGKLWHELLNPLVAAQHFEYKMSNILDKPMESAFGYIS
                     VLPGAFSAYRYTALQNDPMGHGPLHSYLKGETMHGGKHDADIFSSNMYLAEDRILCWE
                     LVTKRDSAWLLRFVKRAQAETDVPTHVAELISQRRRWLNGSFFAAIHSIIKFGRIYRS
                     KHSVFRKFLLHVEMLYQTVMLFFTWFSLANYFLIFHILSRSMEDIAHWIHVPTLICEY
                     IYLAFIIYCFLLSMGNRPQGNRIGYLVSMIVFGFVMLILVSFVVFLAYWSIKKEVVHH
                     KNAEILTDGVFVRIVISVLSTYGIWLLASLMFLDPWHIFTSLFQYILVSPSFINVINI
                     YAFCNTHDVSWGTKGSTTLSMDLGQASGTSNDAVEVTVPDRMKDIDAAYDDACQALSS
                     RESLPAPPRDTEQAQKDYYATVRTNVVLAWTLTNVALVIVILNVSRKVHNIYMAVLFY
                     TFTSLAFFRFLGAFVYLVRKLFP"
     gene            <198157..>202194
                     /locus_tag="MRET_2952"
                     /note="MRES_09855"
                     /db_xref="GeneID:38739718"
     mRNA            <198157..>202194
                     /locus_tag="MRET_2952"
                     /product="phosphatase domain, paladin 1"
                     /transcript_id="XM_027629579.1"
                     /db_xref="GeneID:38739718"
     CDS             198157..202194
                     /locus_tag="MRET_2952"
                     /codon_start=1
                     /product="phosphatase domain, paladin 1"
                     /protein_id="XP_027485329.1"
                     /db_xref="GeneID:38739718"
                     /translation="MKILTSRWAQNERKIVRERHGSVLSRGLILKRDQAASGEDYALE
                     HAVALEGAPLFREADVGLGVYGVAQPTIIGLKTALSVLQCDPQDDGNGSTRRCAWVCT
                     REEPVVFVGDTPYVLRETHKPRNTYSMSDRAENLEGIEKRLKNDILAEASKNNGLLLV
                     HQEQDSTTELKSKWVAVQRDNVRTMREVFTWIQSQGWRVSYHRLPIAPDQPLEHNYLD
                     AYTQIIKDNDPLNTCFIANCGAGVFRTTFAMIAAVLVRRRQTHLLTQVDPLLDTDNVG
                     NVDKHAPSKSLVHTLRRVQDNMVHDRHLLRLVHVLNHSLSTHDTRSVIEQLLMQPSLL
                     KSLQEANTGNYGMVRQLCGLLDNGLACKEIVDTAIDACSHMTNLRESILAHRLRYSTA
                     AAIDEPQAHALLRRAAKALEVYYFLIAFSSYVEDSRTAVFHVRFVDWLKERAEIWRGI
                     GRIRGLHHHLSLFDPVADLSLISRGDTGVLAAPNESVRQRFGEVIAQGALVTGDEFAD
                     FVVRNRTGTVLRSGLLLKRDVWRKFEHQAKVPCIRGAVNFRRIRDTNVFGTGQPSVDG
                     IRNLLMTVLDDIPRQDNEIRTVLWINLREEPLVYVSGGPYCLRQRELSLRNITDYSGI
                     TSERLAQLEERLRQDVIQELSASDNKLLLHTETEDGTVVPLWEDAEPSDISTMQEVMD
                     HISASLPNDVHLVFRRVPITAEKSLDSSDICDLINAVLHSYNNRMPIIVNCQLGRGRT
                     TLVSVLILLIKHWMGDAPLSTQTQDKQPLTYHVINSLLRVVPYGQETKRIVDNAIDSC
                     GYMINIRDDIEESRCKAIETSDEAKKQQYIARGVQSLRRYFQILTFQAYLNSVRPDTI
                     MSHTYEHFIRKQPVLETIARDLNQWELSTITPLRKVDIGDGVALTDEVEEVVRNRTGN
                     ILSASTILKSDFFSGILKAGLPLRIEGMPNLRGVCPLVSLQHSLIHKKITLHTARETW
                     GCGMPTIDGLRAGLSRMNAAPNGYGRIVWTNLREEPVLYVNGRPHVLRLADQPLTNVE
                     ATGVTTEVVERIERALQRDLREEARQRNGHVLLHDEVALENGEYAIVPVWETVQDSDI
                     LTPRDVYERVSSEGFRVDYARVAITDEQAPVPEVFSHLEERVQRAIDTDSMCVFNCQM
                     GRGRTTSGMVIASMIVSVREYGQLWLEQDVWATMDQAQAEDESRELREDELRSDGEYR
                     CILQLVAVLSHGRLAKMLLDHAIDRMDTIQNLRKAISMMKLRADNASPDSPRHKQLVT
                     AFHNYLGRYGYLIAYASYLLDKHQFDAHLRDGDVLFGSPLRPHRSHSGSIEDASALAG
                     IYPSFPEWLHKRREISAILDREELD"
     gene            complement(<202449..>203431)
                     /locus_tag="MRET_2953"
                     /db_xref="GeneID:38739719"
     mRNA            complement(join(<202449..202626,202653..>203431))
                     /locus_tag="MRET_2953"
                     /product="protein of unknown function (DUF1749)"
                     /transcript_id="XM_027629580.1"
                     /db_xref="GeneID:38739719"
     CDS             complement(join(202449..202626,202653..203431))
                     /locus_tag="MRET_2953"
                     /codon_start=1
                     /product="protein of unknown function (DUF1749)"
                     /protein_id="XP_027485540.1"
                     /db_xref="GeneID:38739719"
                     /translation="MVHEPSPLQGTLRLFQTEPIPLPYFETNAQHPNKLIFIPGLTDT
                     MGVVPYLPSLASVLNDLEYSLIQFVKCSDLGGFGTSSLEGDAQEIAQLAEHLLTRSDS
                     PCTGKLVLMGHSTGCQDVVTFLSEERLNLKTGQQILVHGGICQAPVSDSEYFDSHDGS
                     QNSARELLSKSQECVKKGLPGALLDRSHISPVRTSVKGRGEGNSAAVLTPAFTAYRFA
                     SLNGHHGDDDLFSSYLDSEGIVRTLQPALHRAPLLMLFGMNDEYAPPDVDPVQIAKHW
                     ETSLRNLPLSTKVVPRANHKVDDAVAQKTLCDAVATFLRGLS"
     gene            complement(<203757..>204469)
                     /locus_tag="MRET_2954"
                     /db_xref="GeneID:38739720"
     mRNA            complement(join(<203757..204329,204467..>204469))
                     /locus_tag="MRET_2954"
                     /product="large subunit ribosomal protein L17e"
                     /transcript_id="XM_027629581.1"
                     /db_xref="GeneID:38739720"
     CDS             complement(join(203757..204329,204467..204469))
                     /locus_tag="MRET_2954"
                     /codon_start=1
                     /product="large subunit ribosomal protein L17e"
                     /protein_id="XP_027485542.1"
                     /db_xref="GeneID:38739720"
                     /translation="MVRYAFDDTKVPEATAKSRGSYLRVHFKNTRETAAAVTGMPLQK
                     AYEYFDNVLERKQAIPFRRFNGGVGRTPQVNYLGTTQGRWPVKSVKFLRELLKNAESN
                     AEAKDMDAQTLIIRNIVVQQAPTTYRRTYRAHGRINPYRSNPCHIEIHLASPAEQVQK
                     TKSVVPVRLNKRQLAKKRVAASRAVAPAKTQ"
     gene            <204736..>205179
                     /locus_tag="MRET_2955"
                     /db_xref="GeneID:38739721"
     mRNA            <204736..>205179
                     /locus_tag="MRET_2955"
                     /product="vesicle-associated membrane protein 4"
                     /transcript_id="XM_027629582.1"
                     /db_xref="GeneID:38739721"
     CDS             204736..205179
                     /locus_tag="MRET_2955"
                     /codon_start=1
                     /product="vesicle-associated membrane protein 4"
                     /protein_id="XP_027485541.1"
                     /db_xref="GeneID:38739721"
                     /translation="MGDEATRYDPYIPAESATKSAGAGSSRTAQIQAQIDETVGVMRD
                     NINRVNERGENLDALQDKTDNLAVSAQGFRRGANQVRKRMWWKDVKMRLLIVLAIIIL
                     LCVIIIPAAVTTTDKNDDKNTNNNKTASDNVTRSGSAENAQATSR"
     gene            complement(<205313..>208369)
                     /locus_tag="MRET_2956"
                     /note="MRES_09860"
                     /db_xref="GeneID:38739722"
     mRNA            complement(<205313..>208369)
                     /locus_tag="MRET_2956"
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /transcript_id="XM_027629583.1"
                     /db_xref="GeneID:38739722"
     CDS             complement(205313..208369)
                     /locus_tag="MRET_2956"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="XP_027485544.1"
                     /db_xref="GeneID:38739722"
                     /translation="MLRNMMNISSRALASSRSLRPVATTNGWRLLTTSARTLAKPSGP
                     SPNDSFANTTNAYYAEEMHRRWLEDPKSVHSSWDAYFKGLNNGLPSQQAFTPAPSQLP
                     PSSATLKSHVHPANDYLKLQLLVRAYQVQGHIISKLDPLKIIDSEREGHMPQEMNPSF
                     YGWSESDLDKEMQLGPGLLPNFVTNGIEKLTIREVIQACERIYGGSIGYQYVHVPDRN
                     MCDWLRQRIEVPTPYSYSRDQKRRIFDRLAWSDSFERFIASKYPNEKRFGLEGGESLI
                     PGIKTIIDRAVDYGVSSITMGMPHRGRLNVLGNVIRRPIEGILHQFADNSNEEGGGDV
                     KYHLGANYIRPTPSGSKVALSLVANPSHLEAEDPVVLGKTRALQDFAGDHEHTSSMAL
                     LLHGDAAFAGQGVVYETMGMYNLPKYATGGTIHIIVNNQIGFTTDPRFSRSTPYPSDI
                     AKAIDAPIFHVNGDDVEAVNFVCQLAVDWRHEFKKDVVIDLVCYRRHGHNEIDQPAFT
                     QPRMYKAIENQKPTLEQYSKRLVDEGSLSQKEIDDHLQWVWNLLQEMFEKSKTFEPEE
                     RQWLSSAWEGFPSPRELKERVLEQHDTGVDEDRLKYIGTVSASHPDDFVVHRNLARIL
                     KGRKKAIDDGEGIDMSTAEALAFGSLAMEKNLVRVAGQDVERGTFSQRHAVLHDQKSE
                     RTYTPLAHLSEDQAPFTICNSSLSEFGALGFELGFSLVDPNNLTIWEAQFGDFANNAQ
                     CIIDQFIASGEQKWLQRTGLVMNLPHGYDGQGPEHSSARIERFLQLCDDHPYRFPTKE
                     QLSRQHQDANMAVVYCTTPANLFHVLRRQVHRDFRKPLINLFSKSLLRHPEARSTLAE
                     MLPGTSFQRYIPEPHATEGKDALVAPEQISRHIITVGQAYYALLNYRREHKINDVAIS
                     RIEQISPLDYESLLESIDKYPNALLLFAQEEPVNGGAWSYLEPRLRRICMKSEHHKDN
                     EFLVSARPPTSSVATGHKAAHIAEVKNYLHNAFHKQRGGEDEVASS"
     gene            complement(<208677..>211925)
                     /locus_tag="MRET_2957"
                     /note="MRES_09865"
                     /db_xref="GeneID:38739723"
     mRNA            complement(<208677..>211925)
                     /locus_tag="MRET_2957"
                     /product="glutamate dehydrogenase"
                     /transcript_id="XM_027629584.1"
                     /db_xref="GeneID:38739723"
     CDS             complement(208677..211925)
                     /locus_tag="MRET_2957"
                     /codon_start=1
                     /product="glutamate dehydrogenase"
                     /protein_id="XP_027485543.1"
                     /db_xref="GeneID:38739723"
                     /translation="MLRVHSALPTLKMFRPIIGAPVLYLSTCWCPRPLPSGILSHVRM
                     LSTSARLLAMRSPILTMPHSSKPSSSHALTDRSYSAVKVQKAVPETFSSKVDKKAQAE
                     RVISILEKDGMLPKERIRSEVNWFYEDLGIDITYFILENAETIASHIVSLYAAKISEY
                     AKNTGHINIELQKRTNNSAVFIHSSEPGVSLSESQWERKIDVEYLNKPDVNHAYRLES
                     YRSTGVVAENAPEQLRCYFLQECNFAEPVPNLYSEAARDIRSVADKTFLTKTSEPILK
                     IYEDVMQQALEHDGPAIEMFQVENSSEHHIVVGYRMGSTSNFFSAVTDLCHYYGLYST
                     RKSVEHFSNGITIMSIYLKPMPSEAPPINISIYRVLEEVSLIYALPDNPFFSVHEGES
                     KLGVQEATYAYVGWLFAQHFCNRLGTAYEALREIIDESDSHQLAILHDIKLRLREETF
                     TRQSIFEVIKSFPHIVRLLYARFSHTHYSQQTHMTNDEPTSAHYKLMSEKPLSEQELY
                     DTIIESASNSHERQVLLALLAFNKSVLKTNFYTPTKVALSFRLDPSFLPKSEYPIPPF
                     GVIFVVGSDFRGFHVRFRDVARGGIRIVRSRNKENYSINQRTLFDENYDLARTQHLKN
                     KDIPEGGAKGTILPNLGADPSRCFEKYVDSVLDLLIKDTSGIKEPIVDLVGSEEILFF
                     GPDEGTANMMDWGAEHARLRGAPWWKSFTTGKTASTLGGVPHDEFGMTTLSIRQYIHG
                     IINFLGLKEEDVTKVQTGGPDGDLGSNEILQSKDKTVAIIDGSGVLHDPIGLDRGELV
                     RLAKERRMISHFDVSKLSPEGYRVLVEDRNVTLPSGQVITDGFAFRNRAHLLFKADLF
                     VPCGGRPESINISNVNELIKDGDKCNYKYIVEGANLFITRQARLELEKHGVILYPDAS
                     ANKGGVTSSSLEVLVGLSLSDEEYISNMLFVDGKPTQFYMDYVRDIQMNIARNAYSEF
                     EAIWREHKDTGKPRSLISTDMSNALNRLSLQIENTNLFDQEVLRSKILKLVFPETLVN
                     KVGLDVLVKRVPKSYLKSAFAAQVAAGFIYAKGPRASYVDFYDYVSALLQSS"
     gene            complement(<212173..>214788)
                     /locus_tag="MRET_2958"
                     /note="MRES_09870"
                     /db_xref="GeneID:38739724"
     mRNA            complement(<212173..>214788)
                     /locus_tag="MRET_2958"
                     /product="nucleolar protein 4"
                     /transcript_id="XM_027629585.1"
                     /db_xref="GeneID:38739724"
     CDS             complement(212173..214788)
                     /locus_tag="MRET_2958"
                     /codon_start=1
                     /product="nucleolar protein 4"
                     /protein_id="XP_027485328.1"
                     /db_xref="GeneID:38739724"
                     /translation="MTSSTNEARRGNTLFVTRIPYHVTNTDLETFFSDIGPLRRAFVV
                     TDKETHKSKGVGYVTYTDTEDAEKALEKLQGASLDGSKRHVQLQWADRKSDLKSGKSA
                     ELKSTPTQATSRHVVLPDRDPDAVRTIVISGLAGCKPAADEKTIYKRVRKIGDVEQVK
                     FAEHEGSESNDVAFVRFRTPNHAINAINKLHAHQFKGSLLSVELKKRTDGALRREMHM
                     RDDTRKKQHSIQEQIEQFSGKTLPVNQNHLDHASRLIVRNLPFDMSMEDLRAVFLPYG
                     ALYNVSLPTDESSGKGRGFAFIWYVSKSDAAKAMEAINGVSLRHGAAEQARLKKAQGK
                     NGREAAKEALAEVHKTAQPARPVAVDWSLSQKDWMSQAEESDEQPSPKRKRMDLSDEE
                     DGNEESEDDDTEAKERPMLAPPEAGTTLFIRNLPYQATEQELKDLFRSFGPLRYARIT
                     MDPVTNRSRGTGFICFWKRESADALLRDAEIVHQETSAPDAHTKSNPFKVPSVITADP
                     SAPLVARFSLHGRVLHVVRAVTRETASSLEATARKEREKGDKRNTFLLREGVPFPNTQ
                     LAASLSDAERERRMRSFSIRRAQLGANPSLHISKTRLAVHQLPLFVTNKMLKRIALHA
                     VRAFNDEVKEGKRVDLDKDEKDDKTLSVNAKQPTEAKHRPPPSVVVQSKVVLQSERVD
                     PLTGQGRSRGYGFLEMRSFAHALKVLRWANANKNLGSLLVHWWREELEALRAKLIRDD
                     SNEAQLRIKRIDQALNNMETSSKSEARGVLRIEFSIENITTVRKRVLRQEQARDKASK
                     RQKKEDDTVQETMEESESDQDADDESQHLPSQRTAKLHRKSGSEKIQREMKNRSLGSL
                     IGKKRAVRKRKHNSK"
     gene            <215030..>216454
                     /locus_tag="MRET_2959"
                     /db_xref="GeneID:38739725"
     mRNA            <215030..>216454
                     /locus_tag="MRET_2959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629586.1"
                     /db_xref="GeneID:38739725"
     CDS             215030..216454
                     /locus_tag="MRET_2959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485256.1"
                     /db_xref="GeneID:38739725"
                     /translation="MFWCRIQALLACLAVTSVMVAASPSFVLDQNLFRRINKNSKTSN
                     QDGDPGIFPGGKSSFLRDGWRVLPPIEGAYIDNSTFKVDDKGSFLTAYVTKDYNASKI
                     KRAVIQVHGMYRDSWNQFTYVSNSLKAAASRQVIQEDEALIITPMFFSIMDKGAYPVN
                     KNNVSSSKALVWDDHTWGDCQNAVLPSYNDDGELANPSYSAKRSDIPVDDLSEHVEGK
                     RALAETSRAKAKAKGPEASAPDALDSIIDFLSDEKKFPNLEKIVLSGFSLGAQLMNRY
                     LAMRPSSPQDSKLLFVISSPASLMYLTPHRPLKVPKDCPRYNNYKYGLDGHMPDYYKR
                     HKKDDSVNDMRKRYVERQQFYFVGMDDTTDTDTRCEARTQGHGHLERMDNWIKELSNL
                     LEYSDNQNLDDTVGYYPVKKVSHDINSILQTEQAQNVFFKFNSGKDMSIPGRHDKNEA
                     SCMSTHSMLMKVSILVSLFTIIFA"
     gene            complement(<216520..>216879)
                     /locus_tag="MRET_2960"
                     /db_xref="GeneID:38739726"
     mRNA            complement(<216520..>216879)
                     /locus_tag="MRET_2960"
                     /product="chromatin modification-related protein EAF6"
                     /transcript_id="XM_027629587.1"
                     /db_xref="GeneID:38739726"
     CDS             complement(216520..216879)
                     /locus_tag="MRET_2960"
                     /codon_start=1
                     /product="chromatin modification-related protein EAF6"
                     /protein_id="XP_027485666.1"
                     /db_xref="GeneID:38739726"
                     /translation="MEHKRQTDHDLTDLESQIYLYEGSYLNNTAMSGGNVIRGFDSYL
                     KAGSTPASVSRSSSQTISADDRMFSTSSATYQRSLALKFNEPAPEKADDAKISSQGSQ
                     ASGYKLKRKTDETTKRS"
     gene            <217233..>217935
                     /locus_tag="MRET_2961"
                     /db_xref="GeneID:38739727"
     mRNA            join(<217233..217250,217283..217557,217583..217676,
                     217708..>217935)
                     /locus_tag="MRET_2961"
                     /product="CTD kinase subunit gamma"
                     /transcript_id="XM_027629588.1"
                     /db_xref="GeneID:38739727"
     CDS             join(217233..217250,217283..217557,217583..217676,
                     217708..217935)
                     /locus_tag="MRET_2961"
                     /codon_start=1
                     /product="CTD kinase subunit gamma"
                     /protein_id="XP_027485667.1"
                     /db_xref="GeneID:38739727"
                     /translation="MTECAKESSNTRINMLFMLDVCLTDDSGTNPDGAAVYRELAVRD
                     LPALIDMIVPPKSWDAVINLGSVQQILLAWRSKRVFEPCLITTLLDTIEQRAASIRER
                     GPEESMLSMAQVSRSDILRRIEEDRERHKHLRENSWKLPQMSYLHALDSKDTNPVQST
                     MGVISLEFEQQWETTSDINEDDWRKNEEDMTHWWGRPPLTSREA"
     gene            <218044..>219210
                     /locus_tag="MRET_2962"
                     /db_xref="GeneID:38739728"
     mRNA            join(<218044..219003,219034..>219210)
                     /locus_tag="MRET_2962"
                     /product="cytosolic iron-sulfur protein assembly protein
                     1"
                     /transcript_id="XM_027629589.1"
                     /db_xref="GeneID:38739728"
     CDS             join(218044..219003,219034..219210)
                     /locus_tag="MRET_2962"
                     /codon_start=1
                     /product="cytosolic iron-sulfur protein assembly protein
                     1"
                     /protein_id="XP_027485637.1"
                     /db_xref="GeneID:38739728"
                     /translation="MPAQPQTLRKLADLQGHAETVWNLAWNPKKSLLASCSTDKDVRL
                     YSYKKLSSGISGGSETVFRLEEVIPSGHKRTVRCVSWSPTGDILATSSFDSTVGLWEH
                     IPDDIRSSMSDGSPDWECFGTLEGHESECKSVSFSYNGNFLASCGRDKSVWIWEVHPD
                     ADFECAGVLIEHTQDVKTVKWHPKEEILASASYDNTIKLYIDDPYYDWVCYDTLEAHD
                     STVWSLSFSPCGRYLASASDDLSIWIWCRLNADDCKKRGIKPREKASNREGEGWYPSY
                     RIKGHFTRPIYSVSWAAGDASDPAQALGKIAAAGSDGKILIYYVSMSEHDPCDISVQI
                     GAQVEHAHGQADINCIEWAPADRDGAAPCMLASAGDDGEVRIWT"
     gene            <219280..>220133
                     /locus_tag="MRET_2963"
                     /db_xref="GeneID:38739729"
     mRNA            join(<219280..219618,219645..219806,219847..219898,
                     219930..220082,220108..>220133)
                     /locus_tag="MRET_2963"
                     /product="ubiquinone biosynthesis protein COQ9"
                     /transcript_id="XM_027629590.1"
                     /db_xref="GeneID:38739729"
     CDS             join(219280..219618,219645..219806,219847..219898,
                     219930..220082,220108..220133)
                     /locus_tag="MRET_2963"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein COQ9"
                     /protein_id="XP_027485668.1"
                     /db_xref="GeneID:38739729"
                     /translation="MIAGRQGVEAVLRASLVHVPENAFSLAAIRKTLLKQQQHNAADV
                     ERALSVLFPGPDPAPTSAPRRLFQAWDDRATMHVNGVFEEKEKNSMDVTVQWLCDRLA
                     YNDPVRPHLLPVLKLLTSDALFPNIPYFACLPLSFRLPNPGPVMARAAQIADDACNTT
                     GLVSAKGIEWYATRSRLAFAYVASELVYATQLDLSTESVADLLKRIVYTPGAYELGNH
                     GMRSIHQWAEWGGRGWLGILRSWNL"
     gene            <220574..>224599
                     /locus_tag="MRET_2964"
                     /note="MRES_09875"
                     /db_xref="GeneID:38739730"
     mRNA            <220574..>224599
                     /locus_tag="MRET_2964"
                     /product="Ca2+-transporting ATPase"
                     /transcript_id="XM_027629591.1"
                     /db_xref="GeneID:38739730"
     CDS             220574..224599
                     /locus_tag="MRET_2964"
                     /codon_start=1
                     /product="Ca2+-transporting ATPase"
                     /protein_id="XP_027485669.1"
                     /db_xref="GeneID:38739730"
                     /translation="MITHPYERIGDNAPSNPGGKCPPPIAVYDFDHVNRRHTRAQTSA
                     SSDQTQFATLENDSHEKTMEMKESVSQSSPNGRSDDLSHVTDSSNKQAYESSRMNCGE
                     YNPVLQNTDHGKGDDDGNSGCLSSFLSLFNGRKRKAAKAAQLKEELEKRLWSDPGPFR
                     FKPGELCSLIDPEDFSKLERMGGIDGLLEGLMTSSDNGICIDPAPSSDSSIAETGTIA
                     QRVQVYGANLLPERKSKSLLMLMWLALQDKILILLIIAAIVSLALGLYTDFTPPQEMQ
                     PCVHPEPGKRECPAPPVDWVEGVAILVAVIVVDLVGSLNDWQKERQFRVLDAKKESRP
                     ITVQRDGKKHLVDIHDVVVGDVVSLDPGEIVAFDGVILRSHNIKCDESSVTGESDMIQ
                     KISYQEFLSEKRHGSTNHKSVFMISGSKVLEGVGDFVVTAVGPLSMNGKLMMSLRDEP
                     EDTPLQTKLNQLAEMISKLGSAAGILMFIALMIRFFVRLGRDSHVDGKEYGESFIDIL
                     IISVTLVVVAVPEGLPLAVTLALAFATRRMSNRNLLVRILGSCETMANATCICTDKTG
                     TLTQNNMSVVAGCIGSEMPFHDEVKLEAENAKVSENGIGLGSLTNELPSSIRNVLVQS
                     ICINSTAFIPRSTDESDHFVTSTIKKPWWARLISRGSPSAALLKAAQGEVSFVGSKTE
                     SALLNLVRRMDWADYEQVRKAADVVQVFPFGSKRKGMGVAVRTDTGVRLYVKGASEIL
                     LESSTKLVSVAMSKASASQSIEVISMNEKCRQQLSDTITDYASQSLRTLGLCYRDFDV
                     WPPPGIQTNDLGETAYEDVAKDLTLLGVVAIEDPLRRGVTEAVRACGKAGVNVKMCTG
                     DNILTASSIGKQSGIYRPGGVAIEGPVFRQLSHADLVELAPHLHILARSSPEDKKTLT
                     NTLKDLGEIVAVTGDGTNDGPALKSANVGFSMGIAGSEVAKEASDIVLLDDNFSSIVN
                     AIMWGRCVNDAVRKFLQFQITVNIVAVVITFVSSVSDRDQNSVLTPVQLLWLNLIMDT
                     LAALALATDPADPKSLERKPDRSTAPLITPEMWKLITVQSIYQIILILVLKYRGMDIL
                     NSHSDNIAIDLVHNVELNTLIFNVFVWCQLFNQVNARRLDRHLNIFYNIHKNIWFLAI
                     LLFEIGCQILIIFVGGATFNVRRISGRDWGISIVAGLVSWPLGIVTRLIPTKPIEDLM
                     IRLKLMKDSKELPTKMAKTSTESLAAEWNEPAIGEIAKQIGTFSRIRGGRLRASNLVL
                     KSDAKFMRENDVHPQQIMAMVPALVGTSVGGMWKMSKQGANSYDEAQEKVPASLLFQQ
                     GKIVFHPDTPSDHPFLLRLQS"
     gene            complement(224743..224825)
                     /locus_tag="MRET_t0049"
                     /db_xref="GeneID:38741243"
     tRNA            complement(224743..224825)
                     /locus_tag="MRET_t0049"
                     /product="tRNA-Val"
                     /db_xref="GeneID:38741243"
     gene            complement(224898..224980)
                     /locus_tag="MRET_t0050"
                     /db_xref="GeneID:38741244"
     tRNA            complement(224898..224980)
                     /locus_tag="MRET_t0050"
                     /product="tRNA-Val"
                     /db_xref="GeneID:38741244"
     gene            <225036..>225887
                     /locus_tag="MRET_2965"
                     /db_xref="GeneID:38739731"
     mRNA            <225036..>225887
                     /locus_tag="MRET_2965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629592.1"
                     /db_xref="GeneID:38739731"
     CDS             225036..225887
                     /locus_tag="MRET_2965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485670.1"
                     /db_xref="GeneID:38739731"
                     /translation="MTSRRLLLLLDWDGTITQHDTLNLIAPALNEVKSDSPDFSVYQD
                     EYMRDYTEFKTMFGQITNREQMYDYLRSIRMVEERSLNRINCLFEGTNDAQRRSRIGK
                     ICYRKGWAAMQYWMAQRVASHTLAAYIVSVNWSRTFISDALKACAEQNGVEQVISYVY
                     ANELVTKPGSDECTGLIQGPGQRERILTGPDKVKMCEAIASKSAYDTSVYVGDSTTDI
                     PCLLWADMGILIGSGDQVRDMLHQAGMDSVLHTIDSWKQLDVMQQRASIVCASDWYAV
                     CDLLQLQ"
     gene            complement(<225881..>228589)
                     /locus_tag="MRET_2966"
                     /note="MRES_09880"
                     /db_xref="GeneID:38739732"
     mRNA            complement(<225881..>228589)
                     /locus_tag="MRET_2966"
                     /product="fungal specific transcription factor domain
                     protein"
                     /transcript_id="XM_027629593.1"
                     /db_xref="GeneID:38739732"
     CDS             complement(225881..228589)
                     /locus_tag="MRET_2966"
                     /codon_start=1
                     /product="fungal specific transcription factor domain
                     protein"
                     /protein_id="XP_027485671.1"
                     /db_xref="GeneID:38739732"
                     /translation="MDRAGAESLSSHTLPVPPEQTFSMSDHAATQHYHAVEALSSNVL
                     PSATRDRIAPPEPQAKPPSTKRRKINTCFPCKQRKVKCDRQHPYCGQCQKHRIPAERC
                     VWSSDMALAPDVHSAATSALSSYSKPDASHAPISLGTGDWGSSQGTELALDSDTRAVI
                     ERISHLEQRLATNTATQPTSHDLPTTSAGQTQIDPILLAGTGLSLGDVNADRSAATSL
                     SQDAAVAAELAFWRSKMEQHHRPAPSSDTAQMTQMQAEQNIAADALAMFARHSQQSSL
                     AGGDQTMGRPSTVASTGSADAMPRQSIVNALFDNATFAMNNSTVRIRAALELLPDTQQ
                     IDYLIKILQTVDLHISYGLSWRLIKTQLTALRTQLAGWNRMHTSIPEQLDLSFVALLL
                     VLLGVAAQFTEPRFFIEQGLCTSLDQIETYVDSWVDAAQSVLAIDDFVTRTNWNHLAA
                     LLLYVDHHAIRGRLPTALVAMATLLRLAEQQGYHTLGCATDDEQAWRDSPSSKLVRVS
                     PVCSTVRPGTWVRPSGTSTSLPDRSHLVREAARRLWFKIMCKDMALGTVVHRAIQMDP
                     RFVTTKAPLNVDEDDLPDGETHVLSSIKDSGRPTINSLMPFAYQIADLGRQWSVLVHS
                     RMLTYAHILDLDTKFRALLSSLPIFLRPDPTLEQLPEVRQEQAQRPYLAMHRLIVFEA
                     VNQRLLVLHRDDMCRGHHDEKFAYSTRVAVDAARTILSCRQQIDNVHPAVQKHAAFRH
                     HLFQAAIVLSIHLLELSHKAQGESQVAHQLRDDIALIMNYLYGSNNLRTSLPVPQKIA
                     LKLIEMLLAEAHERQNRDADKSMSGNTATAGAATAPSAALSTIGMDADSSNHLFQLAP
                     APASTPDPVTEAATAFSIQMLHPDFANKNGISEFFASLDELMVPIY"
     gene            complement(<228929..>231088)
                     /locus_tag="MRET_2967"
                     /note="MRES_09885"
                     /db_xref="GeneID:38739733"
     mRNA            complement(<228929..>231088)
                     /locus_tag="MRET_2967"
                     /product="signal recognition particle subunit SRP68"
                     /transcript_id="XM_027629594.1"
                     /db_xref="GeneID:38739733"
     CDS             complement(228929..231088)
                     /locus_tag="MRET_2967"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP68"
                     /protein_id="XP_027485672.1"
                     /db_xref="GeneID:38739733"
                     /translation="MNVALQDREPAELGELSFPLLKLIIEARNEHGMRQHDWERYRRY
                     CTTKTKRVRSALHLTHAPNKPATKVRRTKRSRRLTTEEQSVKDKKRDHTFERRDIVLD
                     QVTDTRPLELLLFESEHAWASAEELWAKQTEETRAKLRRSSLGRARRAMQYATKLNEL
                     ADALSSLDVHSRAQCLAYLGLVRSASAFIQENWESTLRATAATRRLLTITSECSPSSR
                     DEAVASSFLDTIDAQIRFATYSLGETDDAAERVCTPEACEEVLPGWARVTQALQAAHP
                     ASASSNEPFVLHWRSQTIPVHSLELYDAIQRVQAEEATLAQHVAPTNKSTPGKRAKLS
                     HAQRNAHRRHGMGRASDSYANRGELDPFDRVLAALSDAESIARVLVDDNTQALAKTHS
                     TRYEAAGLLLRRAHEWLAYRLLSVRIARNVRLWSDVQSRAAMREARAEALTQQRTHRR
                     TLPAMATGKRKRAARQYARSGTRARSQAQRQKHLKRVQDLCAQQSDRRRLRIVPGIAK
                     LLDSIDGCLLAMVGLDLVEGEPDVSSLLESKRFYYCSELLRQVASAFAQYNQCGESLV
                     LLQRADLYVRQAMQSLEFAQGAQDEDQHFAPQLLGPDDVLSRQTRHIQETRELTESRI
                     GAQGVLVSSAMQSTKGGQTLYYYAHRHVSLDEANLSEALAQVRSPVQQHDSDLEAFED
                     AENETDDMDEENEVYVDTEPAPAPSGRSSWWGRWLGR"
     gene            <231163..>231864
                     /locus_tag="MRET_2968"
                     /note="MRES_09890"
                     /db_xref="GeneID:38739734"
     mRNA            <231163..>231864
                     /locus_tag="MRET_2968"
                     /product="septum formation protein"
                     /transcript_id="XM_027629595.1"
                     /db_xref="GeneID:38739734"
     CDS             231163..231864
                     /locus_tag="MRET_2968"
                     /codon_start=1
                     /product="septum formation protein"
                     /protein_id="XP_027485673.1"
                     /db_xref="GeneID:38739734"
                     /translation="MAHDPISPDALRTPVFTRLKGKRVVLASSSPRRRDILATVGVHP
                     EIVPSTFKEDLPKSDFVGDIAHEYPVETATHKAKEVYIRLVMQDEHDPPDLVIAADTV
                     IVHQGKILEKPLDKTDNVRMLADMCGHSFHVVTGVAIVHPILQAPGYEVRTVCEQTRV
                     HFADVPGPLLQAYAESGEGLDRAGGFAIQGRGALFIRSIEGDYNNVVGFPLYSVFELL
                     HALVENEELDFEGTA"
     gene            complement(<231874..>232791)
                     /locus_tag="MRET_2969"
                     /db_xref="GeneID:38739735"
     mRNA            complement(<231874..>232791)
                     /locus_tag="MRET_2969"
                     /product="small subunit ribosomal protein S23"
                     /transcript_id="XM_027629596.1"
                     /db_xref="GeneID:38739735"
     CDS             complement(231874..232791)
                     /locus_tag="MRET_2969"
                     /codon_start=1
                     /product="small subunit ribosomal protein S23"
                     /protein_id="XP_027485674.1"
                     /db_xref="GeneID:38739735"
                     /translation="MPRHIPGQVTQSVSRLLEGQYIKSPPAWYDATLRHPPVYPPPLS
                     SRVRPDSDLPRSLQSEARKVPHLAANKAGRRSHLNSLKKLRSQLPPLRPQPIVYEGDR
                     IRRQFFRDHPWEAKRPRMLTETDYTLEEPISPTLSRGQVPELYMWSRINPSVEDVVQC
                     TLKTAECTDMSLSQAYRRTIASYHAIHAEREHRMRHAILEARSLGAEFGPTETERGFI
                     KESRELDKWAALNQGVQLEEATETPSKREHRVKRTDMAFTNGAAYMDSAQSLTSGQAV
                     LEQHTASEPTPQPAHTSSPDDYLGIASRG"
     gene            complement(<232882..>234319)
                     /locus_tag="MRET_2970"
                     /note="MRES_09895"
                     /db_xref="GeneID:38739736"
     mRNA            complement(join(<232882..232899,232925..>234319))
                     /locus_tag="MRET_2970"
                     /product="D-3-phosphoglycerate
                     dehydrogenase/2-oxoglutarate reductase"
                     /transcript_id="XM_027629597.1"
                     /db_xref="GeneID:38739736"
     CDS             complement(join(232882..232899,232925..234319))
                     /locus_tag="MRET_2970"
                     /codon_start=1
                     /product="D-3-phosphoglycerate
                     dehydrogenase/2-oxoglutarate reductase"
                     /protein_id="XP_027485646.1"
                     /db_xref="GeneID:38739736"
                     /translation="MTNATQAFTRSSQYFSAADAPLAQPSDPVIPPDGSRRRSMSNGM
                     LQQHARVLQQFNADSIKILLLENVSQGAVKILREQGFEVDFYTGAWSEDELVEKIGGY
                     HAIGIRSKTRLTQRVFDAAHQLLVVGCFCIGTNQVDLSAATKNGVAVFNSPFANSRSV
                     AELVIAEMVCLSRQLTDRAQEMRQGTWNKVSKRCFELRGKLLGIVGYGHIGSQLSVLA
                     ESMGMQVIYHDVVPLMPLGSARQADSLEELLSEADFVSIHVPELPETRGMIGERELSL
                     MKPGAYLINNARGTVVQIPALVEALKSQHIGGCALDVYPREPAKNGVNAFNNDLNEWA
                     SELQSQANVIMTPHIGGSTEEAQRAIGVEVSNALCRYLNFGVSTGAVNFPEVNLRPIT
                     EQEVRSIRLCYVHHNQPGALLAVNEIIGSHNVDKQITDSLKDIAYLLADISDVSESDI
                     QDIHMRLSKTPASILTRLLY"
     gene            <234520..>235648
                     /locus_tag="MRET_2971"
                     /note="MRES_09900"
                     /db_xref="GeneID:38739737"
     mRNA            join(<234520..234595,234642..>235648)
                     /locus_tag="MRET_2971"
                     /product="cell division control protein 11"
                     /transcript_id="XM_027629598.1"
                     /db_xref="GeneID:38739737"
     CDS             join(234520..234595,234642..235648)
                     /locus_tag="MRET_2971"
                     /codon_start=1
                     /product="cell division control protein 11"
                     /protein_id="XP_027485645.1"
                     /db_xref="GeneID:38739737"
                     /translation="MMESRRRPAKKGVSFCLMVVGASGTGKTTFVNTLCEQNVIEHKD
                     ADNAQTANVELGLQIQPVNLEVESEGLRIGLTIVDTPGFGDSIDNEYMFNEILGFIER
                     QYDDILSEESRIRRNPRFRDNRVHALVYFIAPTGHSLREMDIEFMRRLSPRVNVIPVI
                     GKSDTMTPSELFDFRKRVMEDIEYYGIPIYNFPYDVEEDHPDTIAENSELRSLLPFAV
                     VCSEENVSTPDGHLTLGRAYPWGAVEVYNPEHCDFLRLRNALFGTHLNDLKEITHDFL
                     YENYRTERLSRGMPADYAPDASLQSEDLVNQSVRLKEDQLRREEEKLREVELRIQREI
                     LEKRQELLAKEENLRSLESRVQYPAA"
     gene            <235898..>236938
                     /locus_tag="MRET_2972"
                     /note="MRES_09905"
                     /db_xref="GeneID:38739738"
     mRNA            <235898..>236938
                     /locus_tag="MRET_2972"
                     /product="chaperone"
                     /transcript_id="XM_027629599.1"
                     /db_xref="GeneID:38739738"
     CDS             235898..236938
                     /locus_tag="MRET_2972"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_027485644.1"
                     /db_xref="GeneID:38739738"
                     /translation="MNESFSFGNYDGVCNVIAMVSCPLLGPDGIGKAPQCYARNIDIN
                     NTIIFEPATCLIHMAAIIMTAIMLWHVHSKYTAVGRKEMLVFLYTYGVSEFLVMFLDS
                     AVIPTHIKAYLWFTAIYIGLKTALFWALMLIGFVGFQFAEDGTLVSLLMLCISSIVIW
                     VISFAVSAKTFLGGIEDQGGLWFFEFVFPIIMVLIYVVSQVILVIRTLDELWPINDIA
                     LGCLSFVAGLILQYGFNNQICENVKHYIDGTFFGTLCTLFAVMMMYKFWDSITKEDLE
                     FSVGSRHANWDAKDPSLGMDYDSSVQSRTNSRMFDNSRTPSPQDQKEAVQAGFAPGMT
                     RNSSGDSFVISR"
     gene            <237255..>238406
                     /locus_tag="MRET_2973"
                     /note="MRES_09910"
                     /db_xref="GeneID:38739739"
     mRNA            <237255..>238406
                     /locus_tag="MRET_2973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629600.1"
                     /db_xref="GeneID:38739739"
     CDS             237255..238406
                     /locus_tag="MRET_2973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485678.1"
                     /db_xref="GeneID:38739739"
                     /translation="MSHTVSDLTVDRRDSRTFTPSTTSVHDGPVPMSMPAILRNPRMS
                     RMAASPAARQTRDGFIRNSVGEAQGRFMSKRRERRSENGRFASNPHAVRPSPSDYFPD
                     QNPVHSTFSDSTLETLSKAYGCVEDASMPAQKASLFELDSAIKGQFTLSLRDAQDFLR
                     ARLGCAESMQAYMHALETQALLDYTAPLPCGSTFAESLIFAVEREILQWLRQTVHVPT
                     HDSLTSGRKIFVYNVDDRDRTVVELRRAPASLLWQVDDAFSRLAVHCVARTFQCPSFS
                     RDVLSPNGDMSRMTWILHPNPLLRSVPTRRLTMRRPLHRRNSSASTTASAASVMTAGN
                     EGPGPLTLGMLQHAVAGIDTPPSTEYELTDSTGEMTDDDSVVFASESEL"
     gene            complement(<238858..>239251)
                     /locus_tag="MRET_2974"
                     /db_xref="GeneID:38739740"
     mRNA            complement(join(<238858..238875,238933..239086,
                     239226..>239251))
                     /locus_tag="MRET_2974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629601.1"
                     /db_xref="GeneID:38739740"
     CDS             complement(join(238858..238875,238933..239086,
                     239226..239251))
                     /locus_tag="MRET_2974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485643.1"
                     /db_xref="GeneID:38739740"
                     /translation="MLDPIVYKNNNLLQRQRLLQADPRPVYQRMPRSGLYMGIFQFVF
                     WTGLLGTSIGFYNMAMGNKRQ"
     gene            complement(<239357..>240622)
                     /locus_tag="MRET_2975"
                     /note="MRES_09915"
                     /db_xref="GeneID:38739741"
     mRNA            complement(<239357..>240622)
                     /locus_tag="MRET_2975"
                     /product="NADH-dependent flavin oxidoreductase"
                     /transcript_id="XM_027629602.1"
                     /db_xref="GeneID:38739741"
     CDS             complement(239357..240622)
                     /locus_tag="MRET_2975"
                     /codon_start=1
                     /product="NADH-dependent flavin oxidoreductase"
                     /protein_id="XP_027485642.1"
                     /db_xref="GeneID:38739741"
                     /translation="MPGLAISQDYYAPRPEELLPAGAVSDKVAQDIGKPVPLLLQSTT
                     VPSGNKTITLKNRAIVSPMCMYSSRDGFPTPFHLVHYGQFALHGAGAIVVEATGVTPE
                     GRISDRDMGMYKEEHVDAHASLVSTVKSLAAGVKIGIQLAHAGRKASTWAMYDQKAWT
                     EPFLSTSEGGWEDSVIAPSAIPFGEGHIMPKEMTLQQIRDVEDDFVRAADRAFRAGYD
                     FVMIHSAHGYLISSFNSPLTNKRTDEYGGSFENRTRLLQNIVHRIRSQFPDKGVWVRL
                     NGTDGVEDGKEESWTDESTRALAPLLEQNGVDVLDISSRGTVGYAKVKMTPGYQVPAA
                     IAAKSSGLKRMLVSAVGTMHGGTQEEPDKYGLFAEKSLQEGSVDLVSLGRVMLHNPGW
                     VKDAAQNLMGADVVCALQYDYTLPSLRRR"
     gene            <241083..>242750
                     /locus_tag="MRET_2976"
                     /db_xref="GeneID:38739742"
     mRNA            <241083..>242750
                     /locus_tag="MRET_2976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629603.1"
                     /db_xref="GeneID:38739742"
     CDS             241083..242750
                     /locus_tag="MRET_2976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485641.1"
                     /db_xref="GeneID:38739742"
                     /translation="MSGQPSGGMERYEPRHSMPATMSNIHEPPTGKNGRRISGLGYIR
                     ESGTVHQKRSMSHHTKSNEANYALSMDWSSPELRSDPFWSHRYPVAGPLYGFTPVDTI
                     KANSSLRVPTLHRDTNVYSLPRCDRYESYALGHSMSPSSPPSSNSPLLSESVATTTSS
                     TETSQAHHFHPMHDPFDMSPLLQSIPTTSPSLTKSPTTQRRSQRLRTYGITDDIIRRS
                     HSRSFSSDEHASPSVHGGLDRWFPGLMYAFDTQESPNTATRSENEESELGPDDSVDNF
                     AIPIAKPHSPPLRSLQLVSKYFGEELEEDSLVSMHAVHDDGRPVSPGEMHGLGVSFSH
                     PLSRDMPTQTPQQNASRLRPLHLAERYGLEGSPPLRECSENEDESTDSLSPSGPHTRV
                     PFSVLHPPAEKSTPDPDAVRLYWFGFLGMPWLWLLGSWCIDDHGVLLSPWSPPSFISY
                     RAGLHPYGPPFALSMHAHSQFLQRRVQQTTQVPHMITQEPHVFGEDHRGVRFLSQYPP
                     DSVPLQKLYQWQHTESFVLLNRMAAVLSSFALFACWTNGVWPIMAHF"
     gene            <243021..>244475
                     /locus_tag="MRET_2977"
                     /note="MRES_09920"
                     /db_xref="GeneID:38739743"
     mRNA            join(<243021..244239,244265..244341,244374..>244475)
                     /locus_tag="MRET_2977"
                     /product="parafibromin"
                     /transcript_id="XM_027629604.1"
                     /db_xref="GeneID:38739743"
     CDS             join(243021..244239,244265..244341,244374..244475)
                     /locus_tag="MRET_2977"
                     /codon_start=1
                     /product="parafibromin"
                     /protein_id="XP_027485640.1"
                     /db_xref="GeneID:38739743"
                     /translation="MQSGERGLDPLLCLRTAVIAGENDPLKYVHLHDASGAVTEIVKQ
                     ATSIVLSHIDTSSMQYAQGSPDTVLPAVSVTRVLRSRDTRNSDGRAPSPETEPDAFVP
                     LAALVFAIQQREERAGAYLRNATLAEIVPLPALERSAVLDYLLGKRDSWEGIVPSSDA
                     LDEASATKTQGEADAQVEHVPASKPKRVYVPDPQDAEFVRRIRSKYEIVLLDRDDALR
                     GKLMEEMEDGVPGMRASSDLLALRTIVRPRIEEAKRRSAVPSKVTSSSRTASSKPAGH
                     GARKSRAQDPIILLSNSPTALVNMFNVKALLQDGIFIHPEEARQQAGGIPELVVTIRA
                     PSADENVTSAGSGTLSRRILVVDNADAVNRLGNGLPGSDQDPWSRVIAVFTTGQAWQF
                     KSYRWTDPRDLFRNAMGVYIRWNNEVSTSQAKEWNVTHLQVDRTKRHTDKQLVAFFWR
                     SLESWVQRKKPRLLS"
     gene            complement(<244507..>244938)
                     /locus_tag="MRET_2978"
                     /note="MRES_09925"
                     /db_xref="GeneID:38739744"
     mRNA            complement(<244507..>244938)
                     /locus_tag="MRET_2978"
                     /product="histone H3-like centromeric protein A"
                     /transcript_id="XM_027629605.1"
                     /db_xref="GeneID:38739744"
     CDS             complement(244507..244938)
                     /locus_tag="MRET_2978"
                     /codon_start=1
                     /product="histone H3-like centromeric protein A"
                     /protein_id="XP_027485639.1"
                     /db_xref="GeneID:38739744"
                     /translation="MSLRQHIQQEFMSEYRPVYNDAHTVYYPPQEKKRRYKPGTVALR
                     EIRKYQRSTDLLISKLPFARVVREVADEFIEANYDSSASAVGLRWQSSAILALQEATE
                     AYLVHLFEDANLCAIHAKRVTIMQRDIQLARRIRGVWGGIG"
     gene            complement(<245283..>246722)
                     /locus_tag="MRET_2979"
                     /db_xref="GeneID:38739745"
     mRNA            complement(<245283..>246722)
                     /locus_tag="MRET_2979"
                     /product="GTI1/PAC2 family transcription factor"
                     /transcript_id="XM_027629606.1"
                     /db_xref="GeneID:38739745"
     CDS             complement(245283..246722)
                     /locus_tag="MRET_2979"
                     /codon_start=1
                     /product="GTI1/PAC2 family transcription factor"
                     /protein_id="XP_027485638.1"
                     /db_xref="GeneID:38739745"
                     /translation="MSIHAALLASPKSNQSHEEVDFPRNDSLPSEPRGAEKEVEEVKW
                     TAKNMSQPRGMNDVTSSNERRPTYIGYIKTPADAILLLAACDLPDNVANPKLGPPPRR
                     ISRRLLDDERAAFIRSGAIFVWDEREAGMRRWTDGRCWSASRVSGCFLTYRELEMRKK
                     TSDSLGKDAPRSNLYKSDGLVKQSFSIRTSSNRKLHVISYYNKDDIKMGYLQRVSKDP
                     RIMGTGPDSWNVQIDENEYGELLSREASYVTKRLMSPQVPAEMPMEKVPVKRRASEKE
                     ALIVSERDMPPSPEFSRAHYPPRLTYPPPSDYHYGRPHLAHTYLDESSKRCRYEKPSL
                     SSHSYYHVPRGWISPYDTPLCLSPVTPPTMDSKNFFANVHNTHCPPVSYVNRADRFID
                     RPILPAIQSSVPRASEAERGTLEALASLRADTKVPPVSTLDRSANYHLTMPSFPASRL
                     RARPAPAPVADRHTLQKTSVPLHVGNALI"
     gene            <247429..>248376
                     /locus_tag="MRET_2980"
                     /note="MRES_09930"
                     /db_xref="GeneID:38739746"
     mRNA            <247429..>248376
                     /locus_tag="MRET_2980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629607.1"
                     /db_xref="GeneID:38739746"
     CDS             247429..248376
                     /locus_tag="MRET_2980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485407.1"
                     /db_xref="GeneID:38739746"
                     /translation="MNRILSWVLSLAVLGVCSVLAAPAGSDEGRDSVAVPAGYVMVIP
                     PSSLHSQDEKDVDRPDYAGKSFRVDNNHYFFQAFPNSKVPTSSVVCIVIPFFVVFSMS
                     AIYLLMRLIWSPLFKSRNGTLSDREKAFSNLRIVGLLNQASEDTEKGIASPEHEPSSG
                     SATDPDSKDSDLGHLDRGIPASESTKSKGKDMNEIAGPIVPVLRNDLDGEYSEEASDA
                     EEEELEDELGTFNRSSQVPSDDAPAYDAAPPVAYANTLPNTSMTAESAMTSNNNSKAD
                     PAHVGNNSLPSHSDVTNAQPNASTLVDTAEHPEQKSLFP"
     gene            <248644..>248995
                     /locus_tag="MRET_2981"
                     /db_xref="GeneID:38739747"
     mRNA            join(<248644..248923,248955..>248995)
                     /locus_tag="MRET_2981"
                     /product="mitochondrial ribosomal subunit S27"
                     /transcript_id="XM_027629608.1"
                     /db_xref="GeneID:38739747"
     CDS             join(248644..248923,248955..248995)
                     /locus_tag="MRET_2981"
                     /codon_start=1
                     /product="mitochondrial ribosomal subunit S27"
                     /protein_id="XP_027485411.1"
                     /db_xref="GeneID:38739747"
                     /translation="MSGVPARSLAALNALRCQVFGTSYNPNNIRTGAKYLKKSLVGSS
                     MLNYYPPQLHLSSLSIEGENFAKLIHPNESQRWKDVARKRLIGKGPPKKGDGRRATMK
                     GKKK"
     gene            complement(<249050..>250323)
                     /locus_tag="MRET_2982"
                     /note="MRES_09935"
                     /db_xref="GeneID:38739748"
     mRNA            complement(join(<249050..249326,249355..249662,
                     249691..>250323))
                     /locus_tag="MRET_2982"
                     /product="chorismate synthase"
                     /transcript_id="XM_027629609.1"
                     /db_xref="GeneID:38739748"
     CDS             complement(join(249050..249326,249355..249662,
                     249691..250323))
                     /locus_tag="MRET_2982"
                     /codon_start=1
                     /product="chorismate synthase"
                     /protein_id="XP_027485663.1"
                     /db_xref="GeneID:38739748"
                     /translation="MSTFGINYRVSTFGESHCKAVGCIVEGMPPGVSLNESDIQVQLN
                     RRRPGQSSLTTPRDEKDKVEILSGTEKGVTLGTPIAMMVRNNDQRPHDYTDEKLDAIP
                     RPSHADFTYLEKYNIKASSGGGRSSARETIGRVAAGALAEKYLKETLNIDIVAFVSSV
                     GHVEIPSYDTNNEEMPLRTEYLNLLNSVTREIVDKENVRCPDADVAEKMRERIMAAKA
                     KNDSIGGTVTCVIRNVPVGLGEPCFDKMESKIAQAMMSIPATKGIEIGSGFRGTCIPG
                     SKHNDPFVRKQDGTLGTSTNWSGGIQGGITNGENIYFRIAFKPPATISQEQVTARYDG
                     EQAVLENRGRHDPCVVPRAVPIVESMAAIVLMDMFLTQSGRKAAADRVDPAAVQALPN
                     SMKKRKYSSTQSA"
     gene            complement(<250416..>251861)
                     /locus_tag="MRET_2983"
                     /note="MRES_09940"
                     /db_xref="GeneID:38739749"
     mRNA            complement(<250416..>251861)
                     /locus_tag="MRET_2983"
                     /product="ADP-ribosylation factor GTPase-activating
                     protein 2/3"
                     /transcript_id="XM_027629610.1"
                     /db_xref="GeneID:38739749"
     CDS             complement(250416..251861)
                     /locus_tag="MRET_2983"
                     /codon_start=1
                     /product="ADP-ribosylation factor GTPase-activating
                     protein 2/3"
                     /protein_id="XP_027485664.1"
                     /db_xref="GeneID:38739749"
                     /translation="MAATGPPKEQIAEIFKSFKNSHKLNKVCFDCGAKNPTWASATFA
                     VYICLDCSSVHRNMGVHITFVRSTNLDSWSWPQLRLMKVGGNGAASDFFAAHGGNALL
                     VPSTEGKVKYTSAVAQRYKEELNRRAVQDAGALGIRAPFSVSGTASGSTAKSATASKS
                     ADDMDFFDEWDSTIPSNESVPEPTPSMAETKSAHATDYTPPEPTHAPAPAPMAPRPVS
                     SAGLRAKTRPTGTLGAVRGTSSTSARPTKLGLGVRKAAAPLNFDEAERRMKLEQEKAM
                     QAAKEAQEQAATAELQADVSEDPAVLETPKETTAAVPRSPVGAKSKIKSNAGVDRLGM
                     GFTRLGIAQARNNASMQNKSAANVSSTTEANESNYARQNFASQKSISSDQYFQRGGYD
                     PNLSDETKARLASFQGQTSISSNQYFGREEDEEDDEPVETDDFSDFEASARAYYRKIM
                     SNPDVQNGIDKIRSGALKLSQYLEDLSRNGA"
     gene            <252037..>253539
                     /locus_tag="MRET_2984"
                     /note="MRES_09945"
                     /db_xref="GeneID:38739750"
     mRNA            <252037..>253539
                     /locus_tag="MRET_2984"
                     /product="CCR4-NOT transcription complex subunit 2"
                     /transcript_id="XM_027629611.1"
                     /db_xref="GeneID:38739750"
     CDS             252037..253539
                     /locus_tag="MRET_2984"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 2"
                     /protein_id="XP_027485393.1"
                     /db_xref="GeneID:38739750"
                     /translation="MPLRSTHGATSGVMGSSRPASEAPTQSMGFASAASLSATHPGYA
                     SAAMSNAPGLDLADFPALGSQAPQSSTTNSSNASGMFSTYASHAGTGASSSPMMMSRG
                     GAPFSQEDFPTLHRAHAAAAAAAQDSRSTHTGMSYGPEQSAPSWQQDPQSGASLAQDL
                     RKQGLHAPSPANQSTASMVTAGAPNTAQSQGMWMQSYGSQPQFNRINLARMPHDNATG
                     ADGSHAAVLSALNSNHDAMQRTKVSNSAYGTESAHLPIHQVLTSPVDRFGLVGLVGLI
                     KTQNPDVAMLSMGSNLQSLGMKLDASDSLSASFVTPWSHDPAAASSQVEPAYQLPACY
                     NVQPPPAQTKVASFSDESLFFIFYSTPRDALQEVAAAELYARNWRYHKGLHLWLTKDP
                     NMEPLQKTPTYERGTYVFFDPGSWDKVSKNFVLMYEMLEEKPTSQNILTAASVHGTAA
                     ARSAPTPTPTTVAVAAAHAAVAPHGTQAVAPTHGSPMPSSNQASPQPSFS"
     gene            complement(<253595..>254047)
                     /locus_tag="MRET_2985"
                     /db_xref="GeneID:38739751"
     mRNA            complement(<253595..>254047)
                     /locus_tag="MRET_2985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629612.1"
                     /db_xref="GeneID:38739751"
     CDS             complement(253595..254047)
                     /locus_tag="MRET_2985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485662.1"
                     /db_xref="GeneID:38739751"
                     /translation="MLALVRAAVLVGHALLIAQAGSADVTPISSVSNDYFTPAKTFTP
                     ATTFSSVVDGQVTTISDQGPTQLPGSYTFTYTKPNSTVSAPENSALMKSLSEKGNVPE
                     ASQLQADPGALQTAQGVGLGDDGIVSKSLPLTGVLVVLIAVCSGAILL"
     gene            complement(<254182..>256008)
                     /locus_tag="MRET_2986"
                     /note="MRES_09950"
                     /db_xref="GeneID:38739752"
     mRNA            complement(<254182..>256008)
                     /locus_tag="MRET_2986"
                     /product="serum/glucocorticoid-regulated kinase 2"
                     /transcript_id="XM_027629613.1"
                     /db_xref="GeneID:38739752"
     CDS             complement(254182..256008)
                     /locus_tag="MRET_2986"
                     /codon_start=1
                     /product="serum/glucocorticoid-regulated kinase 2"
                     /protein_id="XP_027485384.1"
                     /db_xref="GeneID:38739752"
                     /translation="MSWRLGKKLKEGGVFPFNLASSLSSHQDEKGKGSLPASSPTSGT
                     APSTPRADDEFPPVAASPTKSATISTMSHSKKVLPVTVAGMNASRSDMLTVSVVNARG
                     LSLPPGRMMLPVHERQTTQGTKAHASLRSPQISLPYVVLEFDKNEVLILASGGDLASP
                     QWQFTANFDVSRKVEVTLHLYLRAEMVEPADKMHHAMRSLSLHPDKSGAYTKPDPMML
                     MGGNDVYLGMAKLVPSFDQTRPLDTWLPLQGGTGEIRVQMAFKSQVGTSLNIESFELL
                     KVIGKGSFGKVMQVRKRDTSRIYALKIIRKAHIISRSEVTHTLAERTVLAKVNCPFIV
                     PLKFSFQSPDKLYLGLAFVNGGELFLHLQREGRFSEERSRFYAAELFCALEHLHSFNV
                     IYRDLKPENILLDYTGHIALCDFGLCKLNMGDKETTHTFCGTPEYLAPELLLGRGYTK
                     AVDWWTLGVLLYEMLTGLPPFYSEDVNEMYRKILYDPLVFLPDVRPDARDLLRRLLER
                     DASKRLGSPPGGAMEIKNHPFFTKHIDWSMLLAKKVRPPFKPGVASAFDTSNFDPEFT
                     SEPAMDSVVDDSHMISEAVQEQFAGFSYTAAPEMASSDGLWQ"
     gene            <256180..>256934
                     /locus_tag="MRET_2987"
                     /db_xref="GeneID:38739753"
     mRNA            join(<256180..256227,256258..256355,256523..256549,
                     256577..256626,256765..>256934)
                     /locus_tag="MRET_2987"
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC2"
                     /transcript_id="XM_027629614.1"
                     /db_xref="GeneID:38739753"
     CDS             join(256180..256227,256258..256355,256523..256549,
                     256577..256626,256765..256934)
                     /locus_tag="MRET_2987"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC2"
                     /protein_id="XP_027485661.1"
                     /db_xref="GeneID:38739753"
                     /translation="MADELDASAVRGKITLLPGYDTELSAVTFCIMDEDHTMGNALRY
                     MLMKDPRVEFCGYTLPHPSENKIHMRVQMLENSSTSAVTAMRDALDNLDQLFATIDAT
                     YNTSLTTSGIEREAAPVPRVPLRNEFSA"
     gene            complement(<256951..>258063)
                     /locus_tag="MRET_2988"
                     /note="MRES_09955"
                     /db_xref="GeneID:38739754"
     mRNA            complement(<256951..>258063)
                     /locus_tag="MRET_2988"
                     /product="quinone oxidoreductase"
                     /transcript_id="XM_027629615.1"
                     /db_xref="GeneID:38739754"
     CDS             complement(256951..258063)
                     /locus_tag="MRET_2988"
                     /codon_start=1
                     /product="quinone oxidoreductase"
                     /protein_id="XP_027485659.1"
                     /db_xref="GeneID:38739754"
                     /translation="MFRAAATRSGLFRMYSTSSAITVPSVMRAVTIENGKGPSSALRI
                     EQVPTPTLSAEDTTPYVLVKVRAFGLNRMDLMQREGQYPIPPGASPIMGVEFSGEVAA
                     LAQHGAPDLNLGDAVFGLAHGGAYAEYIRVPASMIWKKDAVMSWEQAAAVPEAYITAL
                     QALHTLSNLNKGEDVLIHAGASGVGLAAIQLAKYLGARNVYVTAGTTEKIARCKQLGA
                     TDGFNYKTQDWAAELKRVTEGKGVDVIMDFIGAAYFNNNLASLRLDGRMTMQAFLGGI
                     KLPEGVNIAPMLTRRLRIEGSTLRSRTVEYQAQQAHAFERLGCIDALLRGVRGDTSHN
                     ALQIILHKVWDWHEIKEAHDYMAANQNIGKMVAVIS"
     gene            complement(<258125..>259786)
                     /locus_tag="MRET_2989"
                     /note="MRES_09960"
                     /db_xref="GeneID:38739755"
     mRNA            complement(<258125..>259786)
                     /locus_tag="MRET_2989"
                     /product="phosphoglucomutase"
                     /transcript_id="XM_027629616.1"
                     /db_xref="GeneID:38739755"
     CDS             complement(258125..259786)
                     /locus_tag="MRET_2989"
                     /codon_start=1
                     /product="phosphoglucomutase"
                     /protein_id="XP_027485660.1"
                     /db_xref="GeneID:38739755"
                     /translation="MMSIQTVATKSFEGQKPGTSGLRKRVTVFEQEHYTENFVQCILS
                     AIPGGARGATLVVGGDGRYLSLPTVQKIVRLAAGNGVAKLIIGQNGILSTPAASHVIR
                     LRKATGGILLTASHNPGGPNADFGIKYNVQNGGPAPEAVTNKIYEFTTKIDHYLLQQG
                     DDVDLSQVGAASFGDLQIDVIDPIKDYVDYLATIFDFDLIKSFLSSGQFKVRFDALHG
                     VTGPYARALLVERFGLPDDAVQNWVPKPDFGGGHPDPNLTYAKSLVDAMKSEGLNFGA
                     ASDGDGDRNMILGKDAFVNPSDSVAIIADWAERAIPYFKSGVRGVARSMPTSGAIDRV
                     AKARGYEFFEVPTGWKFFGNLMDAGRLSICGEESFGTGSDHIREKDGLWAIVAWLNIL
                     AFANKEHAGTSVADVLQAHYKQYGRNFFSRYDYEEVESAGAQTMMSELRAKVTDPAFL
                     GSTQGSFKVAEAGDFSYTDPIDHSVSKNQGLYVRMEDGSRIVFRLSGTGSAGATIRLY
                     VEKYSSMAAEYAADVQEALRPIIDVALQLSALQRHTGRKEPTVIT"
     gene            complement(<259897..>260929)
                     /locus_tag="MRET_2990"
                     /db_xref="GeneID:38739756"
     mRNA            complement(join(<259897..260822,260848..>260929))
                     /locus_tag="MRET_2990"
                     /product="tRNA-splicing endonuclease subunit Sen34"
                     /transcript_id="XM_027629617.1"
                     /db_xref="GeneID:38739756"
     CDS             complement(join(259897..260822,260848..260929))
                     /locus_tag="MRET_2990"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit Sen34"
                     /protein_id="XP_027485299.1"
                     /db_xref="GeneID:38739756"
                     /translation="MERLRERYPDRIPIHLCQGVPLLLEVADVECARTEHHICGLLTG
                     TLPLIPQQNVFLGLPLRLLAEEVVYLLRKGVAVLIDETRAYMPPTADERETFLEQEQQ
                     QIQAQKERTLQHQDEQRRVIEAKLQTEEAAALERRRARQASKDSSSHDGVSAQDALKR
                     MPYVHYTQGESASIPGYVPCTQAMLSDAPAGAQVNAYTTLGEAMQAGVWTYPRTLEQR
                     ARCAVFEDLHEQGYFLSTGLRFGGDFVVYPGDPLRYHSHYTATILAAPEQAVPAFHII
                     ASGRLGTAVKKSHLLCQSNTFVRDDTQAEDRRRRGDDDTLQKPWGQVQYWSLAWAGFG
                     T"
     gene            complement(<260952..>263372)
                     /locus_tag="MRET_2991"
                     /note="MRES_09965"
                     /db_xref="GeneID:38739757"
     mRNA            complement(<260952..>263372)
                     /locus_tag="MRET_2991"
                     /product="phosphatidylinositol 3-kinase"
                     /transcript_id="XM_027629618.1"
                     /db_xref="GeneID:38739757"
     CDS             complement(260952..263372)
                     /locus_tag="MRET_2991"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase"
                     /protein_id="XP_027485427.1"
                     /db_xref="GeneID:38739757"
                     /translation="MDADVYSFVKACDVHENVSLRILRLGGEVGTSASMCVRCELYAG
                     NMPLLPPEYTSLSEGPDPRSWDEWITFPYDICDLPLDAQISLTVLDVGNVPLGGIVLP
                     LFGKRAALRRGTKCLALWRGVPADPRAPSSTPYRYDDAPISKLWKRHQRGMIPSDEWL
                     DQQTLSWVEKARTKHVDESHALILIIELPDFELPVVYGEPEPDLRTRHTNTGSWTNAT
                     APVASWIRPHMLALSDPEALCENVIETKHRRLVRGRHSATLDRERKPTASVRDTLHQI
                     LMYPPTRVLTSEEMDLVWTFRFFLTRYPEALTKFVKSVVWTDAEEARQATDELLPMWA
                     EPRLADTLELLGPSFQHLQVRAYAVRQLHRASNDQLELYLLQLVQALKFEDTAWNAAS
                     DEQRQVASTRLVDLLCERSTQSHTLGTKLYWYVSVERIDGRYRELFARVDRQLQASLE
                     ESNRDLLVMLKRQRHFVHTLTTHNAELRVSRDARPKKIEKLQDLLADRRKGLCSLVPP
                     LSLPLDPDVYICGVIPDKSTVFKSNLFPWRLEFAVDGTSSTYAVIVKNGDDLRQDQLV
                     LQLFALMDRLLRDENLDVRITPYHVLATSPQDGLVQFIPSMTVAAAVAQYGDLLSYLR
                     FHYPDHENAATFHVQAQVLDTFVRSCAGYSVITYLLGVGDRHLDNLLVAPDGHFFHVD
                     FGYILGRDPKPFPPPVKVCKEMVDAMGGASSVYYMRFKKLSYTTFACLRKNANLILNL
                     ISLMVEANIPDIRAEPDKAVLKVQDKFMLGVSEEQAVRHLEALFNETSYLSSMFDRLH
                     NVAQYFRQ"
     gene            <263490..>265127
                     /locus_tag="MRET_2992"
                     /note="MRES_09970"
                     /db_xref="GeneID:38739758"
     mRNA            <263490..>265127
                     /locus_tag="MRET_2992"
                     /product="alpha-1,2-mannosyltransferase"
                     /transcript_id="XM_027629619.1"
                     /db_xref="GeneID:38739758"
     CDS             263490..265127
                     /locus_tag="MRET_2992"
                     /codon_start=1
                     /product="alpha-1,2-mannosyltransferase"
                     /protein_id="XP_027485414.1"
                     /db_xref="GeneID:38739758"
                     /translation="MDDVSPPWFPWLPWYGRIALIFAGCLLGMYYISTFAWRSALRDV
                     NGNKRLRMLRELGLPTGSVRYMFVGFFHPHSHGGGGGERVLYEAIRHHQVSDPSIVCV
                     VYTGDIEPLDHGVTKEVMLDKVKSLFGIELDPRRITFVPLRNVHLVRDNYWPAFTLAG
                     QAFGANRLAYEAISKLVPDVFIDTAGHAFAYRAVKYFDKRVRVGAYVHYPTISTDMLQ
                     RVQQRRSGHTNPSWIAQSMPFTLAKYVYYRIFAAAYGSALRSADAIVCNGNWTRSHIQ
                     ELIQYRMWRPWNTPLLPPVQVVYPPCQTTQLRALPLENREVRSLLSIAQFRPEKEHEM
                     QLRIVHGLLQKYPKLKSATSSARALRLTLIGSCRNDADRERVASLRMLAKELSIENHI
                     EWCIDAPYELMLDKLSSANIGLSTMIDEHFGISVVEYMAAGLLTLSHASAGPLMDIAV
                     PVNGSETGFHAHTLDEYVDTAYRLIMMPTQSTLRIRQMARERVATMFSDEAFHRRWRE
                     HLWNELVPPQLVAERERRRAERTAAIAAAPSGRAQDR"
     gene            complement(<265200..>266006)
                     /locus_tag="MRET_2993"
                     /note="MRES_09975"
                     /db_xref="GeneID:38739759"
     mRNA            complement(<265200..>266006)
                     /locus_tag="MRET_2993"
                     /product="electron transfer flavoprotein beta subunit"
                     /transcript_id="XM_027629620.1"
                     /db_xref="GeneID:38739759"
     CDS             complement(265200..266006)
                     /locus_tag="MRET_2993"
                     /codon_start=1
                     /product="electron transfer flavoprotein beta subunit"
                     /protein_id="XP_027485412.1"
                     /db_xref="GeneID:38739759"
                     /translation="MRASLVNQLRVLVPVKRSIDYAVKIRVASDGKGVDTNVQHSMNP
                     FDEIAVEEAVRMRERNKDAIKRITAVTAGPAKSQDVLRTALAMGADDAIHVEVPGPIE
                     PLAVSKILRAIVDKEASSDEIGLVLLGKQAIDDDASQTGQMLAGLLKWPQATFASKVE
                     LEGKGDKGDKVTVTREVDGGLAVVETHVPLVLTTDLRLNEPRYASLPNIMKAKKKKVV
                     KYSVADLGLEKDIEPRLETLKVSEPPQRQGGAKVENVDELISKLKEAGRI"
     gene            <266180..>268354
                     /locus_tag="MRET_2994"
                     /note="MRES_09980"
                     /db_xref="GeneID:38739760"
     mRNA            <266180..>268354
                     /locus_tag="MRET_2994"
                     /product="DNA polymerase alpha-associated DNA helicase A"
                     /transcript_id="XM_027629621.1"
                     /db_xref="GeneID:38739760"
     CDS             266180..268354
                     /locus_tag="MRET_2994"
                     /codon_start=1
                     /product="DNA polymerase alpha-associated DNA helicase A"
                     /protein_id="XP_027485409.1"
                     /db_xref="GeneID:38739760"
                     /translation="MPTAVVVRTPPAPTAADVHAWFCRQHVLLEHERGEERAQNALLL
                     SQCAPRVLARHGLALLGLSVSRTFTGEGGKILVELQNSTAMHSTSALSQHTFRPGDLC
                     ALEEHDAKKQAQDMVRGVVYRVNETSLTVALDERSGSQEDNDAGLMPLLRVVKLANEA
                     TYDRLSQTLKKLVELVGVPPLFSQERPTDFVGTPPEIVRVLLGLRPPSWKAEAPAWTP
                     IHPRLNDTQRAAISFALRAEHLALIHGPPGTGKTTAVTELIVQLATLYPQARILVCGA
                     SNLAVDNLLERVLAPEYKDALARIDAHVTRIGHPARVLPTLTRATLDVQSRHSSEGQL
                     AREVAQEIDDLMQVLSPPRGAPRAGNKSARKAPRVKGEERRRMWEQVRELRKEFRKRD
                     RALASTVLKRSRIVMSTCHGAGGRQLDDLSFDFCIIDEACQALDMSCWVPVLRLAPHG
                     RVFLSGDHLQLPPTVMAEPPRPPVSRSATLPPSASLQVTMFDRILSMYGEASKAFLSV
                     QYRMNHEIMAFPNAQLYDGKLSAHDSCAHIRLTDLGIEGNDENDAHCAPLVLYDTTGL
                     DMYEREDDAVLSTHSRINENEASLVMRHIELLVQHGVPTASIAVLSPYAAQVHLLSQH
                     IRTMYDMSIEVGTVDGMQGREKDVVILSLVRSNDEQQVGFLHDSRRLNVAMTRAKRQL
                     AVIGDADTVGGEKARHDTTASRQFLRAWIEHLHSNALIEIAA"
     gene            complement(<268484..>269083)
                     /locus_tag="MRET_2995"
                     /note="MRES_09985"
                     /db_xref="GeneID:38739761"
     mRNA            complement(join(<268484..268992,269020..>269083))
                     /locus_tag="MRET_2995"
                     /product="neuronal calcium sensor 1"
                     /transcript_id="XM_027629622.1"
                     /db_xref="GeneID:38739761"
     CDS             complement(join(268484..268992,269020..269083))
                     /locus_tag="MRET_2995"
                     /codon_start=1
                     /product="neuronal calcium sensor 1"
                     /protein_id="XP_027485408.1"
                     /db_xref="GeneID:38739761"
                     /translation="MGKTQSKLTSEQLNELQNITYFDRKELQQWYKGFMNDCPPGVLD
                     KAEFSRMYKQFFPFGDPAPLAEYVFNVFDENKNGYIDFKEFICALSVTGRGRLDEKLR
                     WAFKLYDINDDGTITYNEMLTIVRAIYKMTGQMVKLPEDEDTPEKRVNKIFALMDLDK
                     NAELSFEEFKEGSKQDPSIVQALSLYDGLV"
     gene            <269316..>270557
                     /locus_tag="MRET_2996"
                     /note="MRES_09990"
                     /db_xref="GeneID:38739762"
     mRNA            <269316..>270557
                     /locus_tag="MRET_2996"
                     /product="anthranilate phosphoribosyltransferase"
                     /transcript_id="XM_027629623.1"
                     /db_xref="GeneID:38739762"
     CDS             269316..270557
                     /locus_tag="MRET_2996"
                     /codon_start=1
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="XP_027485465.1"
                     /db_xref="GeneID:38739762"
                     /translation="MQPHSLATFKPLLSQLVQSLPVPPPPTGQLRDPAEPLSQEQLEA
                     LLEHLSDVTFTQDPANSAAIGSALTALRLSGLDMRPSTLAFMRQKFIEQIQPFDVPVL
                     EDSPSTDYRGWVDIVGTGGDGKDTFNVSTTAMFIAGGVNGMHVAKHGGKASTSPSGSG
                     ELLMSLGLPLLQVPSDEMVKSLFHCSCTFLFAPMFHRAMMPLAPIRASLGFPTLFNIL
                     GPLINPKSTCRGLYGVHSSGLGRIYAETLYMSGLEYFWVVCGEEGLDELSPAGPSYVW
                     EVSTRGKIDHFTVTPADFGLPSHTLEEVRSGTPSQNAAMLAYMFLHPDKIEDAPLKEP
                     LHVECDIAHVQLEPIPAGTNLKAIYDYSVLQAAALLYIAGHGQGDLKECTHIAQASIQ
                     DGRALAAWRRLHEFMHSVKSL"
     gene            complement(<270624..>271739)
                     /locus_tag="MRET_2997"
                     /note="MRES_09995"
                     /db_xref="GeneID:38739763"
     mRNA            complement(<270624..>271739)
                     /locus_tag="MRET_2997"
                     /product="secretory pathway protein Ssp120"
                     /transcript_id="XM_027629624.1"
                     /db_xref="GeneID:38739763"
     CDS             complement(270624..271739)
                     /locus_tag="MRET_2997"
                     /codon_start=1
                     /product="secretory pathway protein Ssp120"
                     /protein_id="XP_027485283.1"
                     /db_xref="GeneID:38739763"
                     /translation="MRHLFEVTLLLALVSASFAVRTGKRTAPKGPVYTDKDPGNYMQE
                     HMASEHHIGAFDLASFFALHDLDRNGILERPEIEAIYGVHHSLSRKHSPNAEVHDGKA
                     DTIVREVLRRLDFNKDGVITRAEFLRGGKAGLPQFPEFGAHALGHHYDEESEYFVHHE
                     SLYHNRPEDQTAEAYKHKEDLEHFDHHAAIEREEEERERLAEGMPSIEEDMRRKQAAA
                     AKGETYDSAYEKQFSPEMMENAKDYEAMSELGAAGRDLLSAQHIFKTPDGIKKVEATK
                     DNVIMPKGDLGNEDAPPVFAVGDSAARAPADHIDGETELGRKIRLDRARREANGRPRF
                     GMGMNGFAKPRNDADRLRAGMPYKYRMKQNQGFLREM"
     gene            complement(<271952..>276517)
                     /locus_tag="MRET_2998"
                     /note="MRES_10000"
                     /db_xref="GeneID:38739764"
     mRNA            complement(<271952..>276517)
                     /locus_tag="MRET_2998"
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 1"
                     /transcript_id="XM_027629625.1"
                     /db_xref="GeneID:38739764"
     CDS             complement(271952..276517)
                     /locus_tag="MRET_2998"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 1"
                     /protein_id="XP_027485429.1"
                     /db_xref="GeneID:38739764"
                     /translation="MGSESNSPKIVWGKASSADNGDSDTLSYYHDGRSVSPPDSELGH
                     GLANVQATPAWYRNMDYLSPNVMSDTFDSFRHASNDEIGLLSPADIAARSPPLLMPVP
                     SWDDLPYDRPPNHMISGNKWDEYHDDTIAPETPKFAHPLWASSPTFSPQPGSLQPANA
                     WHGTFGHPNIFDSPGKPWESDDFTSQTRQIRHSQGPDTSSKEHVIYRHASSKKGSSLA
                     QESHQQNTKHSRRRWGKADKARKPSPTVSPSPTGTKPVKFNALFRYATPLERFLNLIG
                     IICGAASGTAQPLMTILFGNLANKFLASSNPSLTDQQKIDYFLAAAHMVNDDAIYLVI
                     IGIASFVVIYVYMAIFVYTGEVITQRIRKEYLRAILRQDIAYFDSLGAGEITTRIQSD
                     IQLIQDGISDKLPLNVAFISTFITGFIIAYVRNWKLALVMTCILPCIVGSAIVMNKFV
                     SSYQQVELEHVAKAASIAEEGISTVRTVKAFGMNAHLAKLYESRNATAFTASRRRAVA
                     SGMGIGAFFFCIYCAYALAFYFGSKLVANGEVQGGIVMNVIFSVLIGAFSMAMLAPNL
                     QSMSFAQAAGGKVFETIDRPSKIDSFSSEGLRPATCLGHLSAQNVTFAYPSRPDVRIL
                     KDFNLEFPHGQVTALVGQSGSGKSTIISLVERFYDPLEGDILLDGVPIRELNIRWLRS
                     QIGLVSQEPTLFSTSVWENIAFGLLHTEYDNYSEEEKDKLIVHAAHLANAHAFITQLP
                     QGYQTQVGERAALLSGGQKQRISIARAVVKNPRILLLDEATSALDTASEGIVQDALDR
                     ASHGRTTITIAHRLSTIKNANNIVVMKGGAIMEQGRHDALLENPKGIYAGLVATQDIH
                     NNNAQALLSVPVAATNTSAVENDTLARMPSKMSMKSTDSTLDDVMKMQGLKIGQYDQA
                     KPTKPISLPGLLRRLSYVGRDLITPYFLPGLLCACATGAAYPCFSILFGLALNNYGQC
                     QNDEGDPCPEPIRDQMRHTANHHALYFFVIAILSTVATVFQNALIQQGSAALMQRLRA
                     LMFRAYMRADVAYFDEDGHSSGTLTSSLAENTLKVNSFVGVSMGAIAQSLSTLIIGSI
                     ISLIYGWKLALVVMACVPFTLSAGFVRLKLVVQKDVKVRQVHLATSHMACESASAIRT
                     VAALTREEDCLKRYDAALKEASKVAKRAALWGNIFYAFSQSTAYFVIALGFWYGYRLV
                     MRMEYTSSQFFTIFTAIVFGSIQAGNVFNFVPDISNASNAGTSMFALLDQKPQIDIQS
                     NEGTVLHECQGHVQFENVGFEYPTRPGAPVLRGINMDIPPGSYCALVGSSGCGKSTTI
                     QLMERFYDVSSGRILLDGHDIRTLNLASLRKHIALVSQEPTLYDGTIEFNLRLGALEN
                     PDDVTETQLKEAARSANILDFIEGLPEGFRTQVGSKGTQLSGGQKQRLAIARALIRNP
                     KILLLDEATSALDSDSEKIVQKALDAAATGRTTIAIAHRLATIAHADCIFAFHQGVIS
                     EAGNHQTLLQQNGIYANLVTLQALEKH"
     gene            complement(<276577..>278679)
                     /locus_tag="MRET_2999"
                     /db_xref="GeneID:38739765"
     mRNA            complement(<276577..>278679)
                     /locus_tag="MRET_2999"
                     /product="phosphoribosylglycinamide formyltransferase"
                     /transcript_id="XM_027629626.1"
                     /db_xref="GeneID:38739765"
     CDS             complement(276577..278679)
                     /locus_tag="MRET_2999"
                     /codon_start=1
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="XP_027485425.1"
                     /db_xref="GeneID:38739765"
                     /translation="MSESDTNLASMRSRAEALLARYGGQNGPTGHAAVDGSGEPQSLS
                     SFIGGKAKAPRLGKLTGDGRTSSYHESDAVPYKELPGLAQPGSMASFMEQRERAMFPE
                     VAEAKDKARAVQSDASMETTFPKRSTSGKQIVVLISGSGSNFQAILDATCGDAPAIPN
                     AQIVRVISNRMKAYGLQRAKNVDPPIPTSVHSLKTYQTRNPGKTRDDYDLVLADRVLG
                     DEGHVPDLVVLAGFMHIVSETFLSAMGHATSLAAPPAFAKRPHEPVPIINLHPALPGA
                     FDGANAIERAYEAFQAGEIEHTGVMVHEVVAEVDRGAPILVRRVPIYKGESLDALETR
                     MHSVEHELIVEAAAKVLSGEHTITAPCTPTSFLRLAHGSWDAVPRPLVLHDTDVLWVN
                     GPSPFVWLGRAAPATWKGQLTDEMRSQHARMEYQGRESTDFFNAIGKILVTMHSTSTP
                     QRLFLVRLDQDALCIDEVAFEARSLCSAYTAVALNPQGIWIWHGIGSDDAQRRHAEEW
                     SRSLGPTYKLVDTSELLSLFKDKEFADGWHHRRRPSLPVALRSAQLYSPASVEVPSRF
                     HLADIKTTTVSLVDAYLEMYVIIGAYARGDKDAIEAALSRAERMAAREDPSQMTPPIH
                     VIVLPSIVPLDLLSLARDTWNADVFTEGMETGDDTSPLLMNLHALSEAQRQLAQAPQT
                     STHPTNQNFLPVGAPSCR"
     gene            complement(<278807..>281194)
                     /locus_tag="MRET_3000"
                     /note="MRES_10005"
                     /db_xref="GeneID:38739766"
     mRNA            complement(<278807..>281194)
                     /locus_tag="MRET_3000"
                     /product="mitofusin 2"
                     /transcript_id="XM_027629627.1"
                     /db_xref="GeneID:38739766"
     CDS             complement(278807..281194)
                     /locus_tag="MRET_3000"
                     /codon_start=1
                     /product="mitofusin 2"
                     /protein_id="XP_027485452.1"
                     /db_xref="GeneID:38739766"
                     /translation="MSSIQVEPAMDPKPSASEVSFKETRPEQLSAASADLSEEKFVYG
                     RDKLVASINATGEVLQQLRAFNKDQWILRYPEQQDGQEEAKLPLSVLRVDLKLGATQN
                     ASTLVNSMEKSSVGRLLDERMSRSDHHLQNLRMRIIDTQSKVLVTGDLNAGKSTFINA
                     LMRRELVPTDQQPCTSMFCEIRDANQENDGREEVHVIYDLASYDPKDSSTFTRRDLSD
                     LEGIFVEQEEKQDEMISVLKCFCVDSHTTHESLLHNGAVDIALIDAPGLNQDSVKTTA
                     LFAREEEIDVIVFVVSAENHFTLSAREFLQNASNDKAYVFVVVNKYDQIRNKEKCHRR
                     VLEQIRELSPRTFEEADELVHFVDSRTVCDAANTESMNEYVEHFSAMENNLRQFVLRR
                     RAKSKLLPAKTYMERLLSDVLFLVRLNQNAAQDDLVSARRELSKSRPALAACEANALK
                     AQRMVEGEEDRVVSSITQSSEEVLTKALETVGNGESAHSSVKLPAYPGLLNLWQYAQD
                     VREALVSSLHAVVRDCESMARNSTTQAVEKIGHAGEQFLPKDIDVPKRIFMPEAMFSH
                     KHEGTVFAGLGVSLDIVNVRLTDLFDVPHHFSFVMGRFSPKSSPDDSNDKALTTPSFT
                     VGLGALSLLGGHALNAKTIAEAFVRFTDILGSRVVRRWAAPVLLLLGAGAVAWIVTDL
                     PNAVPRNVGRNLQRELKGGHGVVQLPGNSPMLLRNSSNLFATMHSMRTMREVRKVLRL
                     ASWDIQEKFRVAISQHRANVSKAEAQEKLADKAVEWLSQTAARSAAIQSEVACLL"
     gene            <281387..>283084
                     /locus_tag="MRET_3001"
                     /note="MRES_10010"
                     /db_xref="GeneID:38739767"
     mRNA            join(<281387..282904,282931..282991,283017..>283084)
                     /locus_tag="MRET_3001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629628.1"
                     /db_xref="GeneID:38739767"
     CDS             join(281387..282904,282931..282991,283017..283084)
                     /locus_tag="MRET_3001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485453.1"
                     /db_xref="GeneID:38739767"
                     /translation="MLGGLLSTVHRTVLPPTFRFKLECDDLNKNPLVSLIREHCPSIS
                     GARTAKQTRWLPSGHLQTLYTSASNAMQVEDVDFKRKVFLAPDGGTISMDIAPISMSK
                     PSESDTTPTVVILHGLSGGSSETYVMNAVVQLTKSREEGGEGVRCVVVNFRGCAKTML
                     TSAQLYSACKVTDLESALLLLSHMFPRSPMLGLGYSLGGAVLARYMGISGKDTPFIGA
                     ITVGAPYSLDKTNTTLESSYLTLAYAHVLGVSLRGLLQQHVDTLVLSPALWEPIELIL
                     RTKMDPDESKPVAKPTFTSPQYCTVRYVDHTMTRLIGGYPTPYGEFPFASAMDYYKRS
                     SPVVTLANVSRPLLALSADDDPIVPWSTLDDLMDCIKTNPNVVLAHTQSGGHLGWFAG
                     PLAQRWIKHPIAEFVHALVDAYGAKPEESVSTGLGSGGPQVSPWKTRSIDKRSVQVEV
                     LAKAHLPSVSGVRTDNEQDVAWLRTQILPHIPLVHPKDSPVRTHEIPTGRMLSLTLYC
                     DALRPEVGFIELPEDVHASGNGYFVHAQQLVQSLPARSDT"
     gene            complement(<283222..>283778)
                     /locus_tag="MRET_3002"
                     /note="MRES_10015"
                     /db_xref="GeneID:38739768"
     mRNA            complement(join(<283222..283661,283763..>283778))
                     /locus_tag="MRET_3002"
                     /product="large subunit ribosomal protein L23Ae"
                     /transcript_id="XM_027629629.1"
                     /db_xref="GeneID:38739768"
     CDS             complement(join(283222..283661,283763..283778))
                     /locus_tag="MRET_3002"
                     /codon_start=1
                     /product="large subunit ribosomal protein L23Ae"
                     /protein_id="XP_027485454.1"
                     /db_xref="GeneID:38739768"
                     /translation="MSQVQDKKNLATRKAHVAKKVVQKGSSGQTRVRKVRTSPSFYRP
                     KTLRLARNPKYPRKSAPHLPRSDACKTLLYPLTTESAMKKIEDVNTLVFIVDRNTNKR
                     QIKAALEKAYDVKAARVNTLIRPDGKKKAFIRLTPDQDALDVSNRIGFI"
     gene            complement(<283951..>285320)
                     /locus_tag="MRET_3003"
                     /db_xref="GeneID:38739769"
     mRNA            complement(join(<283951..284187,284213..285245,
                     285271..>285320))
                     /locus_tag="MRET_3003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629630.1"
                     /db_xref="GeneID:38739769"
     CDS             complement(join(283951..284187,284213..285245,
                     285271..285320))
                     /locus_tag="MRET_3003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485287.1"
                     /db_xref="GeneID:38739769"
                     /translation="MSQPPPFDLPGFVWDPEKQRFFKQQKARHSNQTRFPSPPPEPRI
                     ETPRRAPLGHVTGHVRYASTSKYCQYLMTRAVQHMKLSRTYSTQAWVLNHTAPIELIP
                     CNSSTQFYSYALATCDGRVFCILGTSLQDEPSCLSTGPYFSRSQILPQDNDYEHLVLL
                     SSASQTWYTCASASQLLVEVSMHKRWALSLTSTCDSPYRVQVSFRDPSRKPQGDLRCI
                     DAVDLDASRVLIAIGAGRHVHLVQVRIMAENQADWHMYTKEYPSDVMCVSIRSSGASA
                     CADVLCGLRSGSIHTIRSGPDYTWLPGTTFSFVSKGALCHIQCIHDTLFVAAYTNGDL
                     VMGDIARMRDAPLRFFKGHVNQFMQGLGFDVDPIHHMLACSGSDQRVRIWSLDHTDPV
                     CILSPPGDHDQFPQHVQSLAWSRASERPLTLAVACGHDVHIFACGPT"
     gene            complement(<285492..>286787)
                     /locus_tag="MRET_3004"
                     /note="MRES_10020"
                     /db_xref="GeneID:38739770"
     mRNA            complement(<285492..>286787)
                     /locus_tag="MRET_3004"
                     /product="transcription factor"
                     /transcript_id="XM_027629631.1"
                     /db_xref="GeneID:38739770"
     CDS             complement(285492..286787)
                     /locus_tag="MRET_3004"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027485455.1"
                     /db_xref="GeneID:38739770"
                     /translation="MQWTSQQDRRNGAVRMDAERSSVTPHHGSSNDVHQEISTRHPAT
                     SAPSGSAPPYHLPPIGMTCPSPRPSMSSSRMPLFRANTVHTVTPRDYFNHFYHYKDYA
                     SPISSTPRASTSHLHRSLLDSPGSFARDHCARFRSKPIRSQTLPTFQDLTSRRVHPYA
                     SHAERKAWDASRSRLPHMDARDKYESLQSPTMHSTRMENRECAISPTEYGFMNMRHYY
                     PDMRYPHVPGRVSASHTAGAHSPKVLDHYLEDEYYHNNGKPTGYVYPSPRYRPVPNLS
                     RSHEKFHGSYGSPQRLYQHPSKDEDEYPTSYAMVTMPHSHWSEDDASSSDMLEKQEFE
                     KMTNTRSTPAQAPPKRGGKLPKHITDTLKAWLLEHADHPYPTEDEKRAFCDYTGLDIC
                     QISNWFVNARRRILAPAGARATNATGTTATNAAAPPATT"
     gene            complement(<287479..>290130)
                     /locus_tag="MRET_3005"
                     /note="MRES_10025"
                     /db_xref="GeneID:38739771"
     mRNA            complement(<287479..>290130)
                     /locus_tag="MRET_3005"
                     /product="activating transcription factor 7 interacting
                     protein"
                     /transcript_id="XM_027629632.1"
                     /db_xref="GeneID:38739771"
     CDS             complement(287479..290130)
                     /locus_tag="MRET_3005"
                     /codon_start=1
                     /product="activating transcription factor 7 interacting
                     protein"
                     /protein_id="XP_027485456.1"
                     /db_xref="GeneID:38739771"
                     /translation="MGDVQPRGSLQLLSDSGDIEVARFQIKKETTTLGRALNNDVRLL
                     LEDVSRKHCTIQFDSENRAVLHVMGSGGVWHNNVHVKPHANDTQIKLKDGDKLQISKH
                     TLTFSYVTAAPASPRKRKPQMAAPESPATPRRQSARIKARASMPCFRTAWTPERAMRP
                     IPLTQQTAPSEPAQSNSNNVAVEQPKMPQAPSMILADLNVWQRTSLDTNVPETHQDVN
                     PGAESDLPNDTAMVNEAANTSQRRDFLECNQPEPEATEPEFVEPVATDPQVPESGPVD
                     LEPMDPNPLEQELEANNSDASVQRVSESDPVDLTSVDPNSVELEPVEPKPADPAAIQS
                     TLSELAQVGQEPLNPHPVDPESTESHPNSPGPTESRPADPNPIKLNANDAQSTHIDPT
                     EFEATEPEKQGRDDAELEPKIDQPLDSQPTVPAEAHEFIEALDDHVWQADTKASLAEE
                     KENEHRDTSDLTLCLEELEEQEVVDANRLLSAATPMTPRFPPTTPLRWSPAKSRKVSL
                     RTATLLKRSAQLPIVPLVDREPPCAQTPPPSINSHIPTSTDSKDMELSAISSDEEDEE
                     EVDSSLELQCASSPLPPRPLHSFMTPQTKRQEKPMVRRMSCSEMDQPTLRRQPSWQWL
                     KSLFSPSRKTAPEPSKEQEPVPLGSERASTEVREQDEQESFFDASGDMDMTSMHHVTT
                     PKANEKNLAPTPDMHVLKHVFAEPKQAVSPEATMHHFRHMMSEPKQTSAMDLSMSSAW
                     TAMEEQVRDVPQEASVPAQPLQVLTPETDQLTKHRATRTVPKKEPYVPVRRQLPPRNA
                     VKMSRIGSLSTSTTRTASEQQAAQTTCAVPPDTRLRRSGMASSLPVARAGTTIRTRAT
                     KESITNDREDATLNKRVTRGASKTRKN"
     gene            <290262..>291251
                     /locus_tag="MRET_3006"
                     /note="MRES_10030"
                     /db_xref="GeneID:38739772"
     mRNA            <290262..>291251
                     /locus_tag="MRET_3006"
                     /product="exosome complex component RRP42"
                     /transcript_id="XM_027629633.1"
                     /db_xref="GeneID:38739772"
     CDS             290262..291251
                     /locus_tag="MRET_3006"
                     /codon_start=1
                     /product="exosome complex component RRP42"
                     /protein_id="XP_027485457.1"
                     /db_xref="GeneID:38739772"
                     /translation="MPPATLSRTEQSYLLDGLRSKPAERADRRGLHEYRMMQVDTDLS
                     LQADGSARVVLGSTEVHCGVKAEIESYDAPHVNVLPDVDFAPWLPPSPRVQVMVEYSP
                     ALLHEHNATELAMITDTVQDMLQACYALTGNSIGPLDARQFIVVPYARYWVLHLDVYV
                     MSWSGGNVLDAVFAAAFCAMYQARIPGTKILSLDKAAARQDDEVDQDDPAGIKFITRG
                     RKPSSSAAIDDAVDFTLENEWDHGHLLAGREDVPVCITIYPFEDTYLLDPTLEEETAL
                     SSGIAVLASARGQIYGIRQRGSGELTLDAIHKAADVGTSYAKQLAQTLQARFV"
     gene            complement(<291255..>293549)
                     /locus_tag="MRET_3007"
                     /note="MRES_10035"
                     /db_xref="GeneID:38739773"
     mRNA            complement(<291255..>293549)
                     /locus_tag="MRET_3007"
                     /product="3-isopropylmalate dehydratase"
                     /transcript_id="XM_027629634.1"
                     /db_xref="GeneID:38739773"
     CDS             complement(291255..293549)
                     /locus_tag="MRET_3007"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="XP_027485458.1"
                     /db_xref="GeneID:38739773"
                     /translation="MTTPQAKPPRTIYQKIFDAHLISEEEDGTCLIYIDRHLVHEVTS
                     PQAFEGLRLAGRPVRRTDCTLATVDHNIPTVSRDHFKNTETFVQESDSRLQCITLEQN
                     VKEFGLTFFGLTDSRQGIVHVIGPEQGFTVPGATLVCGDSHTSTHGAFGVLAFGIGTS
                     EVEHVLATQTLLQKRMKNILIEVNGDLPEGVTSKDIMLHIIGLIGTAGGTGGVLEFAG
                     STIRRLSMEARMSMCNMSIEAGARAGLVAPDEMTLDYLRGRPLVPKGEEWDRAAAHWL
                     SLASDPGAQYDKVVKIDAQDIPPTVTWGTSPQDTVSITGQVPDPAKAPSEELASEWTH
                     SLKYMGLEPNTPIEQIKIDKVFIGSCTNSRIEDLRAAARILHGRKVAPHVQAMLVPGS
                     GLVKRQAEAEGLDAVFKSAGFDWREAGCSMCLGMNPDQLSPGERCASTSNRNFEGRQG
                     AGGRTHLMSPAMAAAAAVTGYLTDVRKLMKGQLPGFPATSSQFDATPKDPRAFIEEGI
                     LHAPVVSAPPPVMHHAPVASAATAKHPDASAQGMPAFRVLKGIAAPMERSNVNTDVII
                     PKQFLKTIKRTGLGSALFWPLRYDVQTNEPNHDFVLNKEPYTHAKILVVAGSNFGCGS
                     SREHAPWSLLDFGIRAVIAESFADIFRNNMTKNGQLPVVLEPEQIQRVLKDAQAGKEV
                     TVDLEQQKVICEDGTAFGFQVAPFTRHCLLHGLDDIALTLQKEKDISAFEQQRHDTPW
                     LNGVVYGKGISAAEARMAKSTTDW"
     gene            <293788..>294396
                     /locus_tag="MRET_3008"
                     /note="MRES_10040"
                     /db_xref="GeneID:38739774"
     mRNA            join(<293788..293875,293916..294034,294066..294350,
                     294379..>294396)
                     /locus_tag="MRET_3008"
                     /product="V-type H+-transporting ATPase 16kDa proteolipid
                     subunit"
                     /transcript_id="XM_027629635.1"
                     /db_xref="GeneID:38739774"
     CDS             join(293788..293875,293916..294034,294066..294350,
                     294379..294396)
                     /locus_tag="MRET_3008"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase 16kDa proteolipid
                     subunit"
                     /protein_id="XP_027485459.1"
                     /db_xref="GeneID:38739774"
                     /translation="MSESINMEMCPVYAPFFGAMGVTAAIVFTCLGASYGTAKSGVGI
                     SAMGVLRPDLLIRCIIPVVMAGIIAIYGLVVSVLISGDLKSPMTLYAGFIQLGAGLSV
                     GLAGLAAGFAIGIVGDAGVRGTAQQPRLYIGMILILIFAEVLGLYGLIVALILNTRSQ
                     DAPQCMIRA"
     gene            complement(<294506..>295954)
                     /locus_tag="MRET_3009"
                     /note="MRES_10045"
                     /db_xref="GeneID:38739775"
     mRNA            complement(join(<294506..295659,295693..>295954))
                     /locus_tag="MRET_3009"
                     /product="mitochondrial-processing peptidase subunit beta"
                     /transcript_id="XM_027629636.1"
                     /db_xref="GeneID:38739775"
     CDS             complement(join(294506..295659,295693..295954))
                     /locus_tag="MRET_3009"
                     /codon_start=1
                     /product="mitochondrial-processing peptidase subunit beta"
                     /protein_id="XP_027485460.1"
                     /db_xref="GeneID:38739775"
                     /translation="MSARLFLANPIKGNMRLSMPAARSLATAAIRQPLTQVTMLPNGL
                     TVATESNPSAQTATVGAWIDAGSRSETQRNNGTAHFLEHMAFKGTNNRTQHGLELEVE
                     NLGAHLNAYTSREQTVFYAKAFRQDVGKAVDIVSDILQNSKLDASAIERERDVILREQ
                     EEVEKQAEEVVFDHLHEVAFQDQALGRTILGPKENILSISRDDLTNYIQSKYTADRMV
                     LVGAGGVEHEELVKLAEKHFSHLPVAQNPIRLGENQYEPSRFVGSEVRVRDDTSSTCN
                     IAIAVEGASWKSPDYYPMLVLQSIFGNWDRSLGSSPLMSSRLSHIVSTNNLANSFMHF
                     STSYSDTGLWGVYMVSENHMNLDDMVHFTLKEWQRASTGPSPAEVERAKSQLKASLLL
                     GLDGTTAIAEDIGRQLITTGKRATPQEIEVAINSVTPAEIQRVAQKYIWDKDIAIAAT
                     GRVEGLLDYNRIRADMSTLIY"
     gene            <296290..>297042
                     /locus_tag="MRET_3010"
                     /db_xref="GeneID:38739776"
     mRNA            <296290..>297042
                     /locus_tag="MRET_3010"
                     /product="zinc finger protein, C3HC4 type (RING finger)"
                     /transcript_id="XM_027629637.1"
                     /db_xref="GeneID:38739776"
     CDS             296290..297042
                     /locus_tag="MRET_3010"
                     /codon_start=1
                     /product="zinc finger protein, C3HC4 type (RING finger)"
                     /protein_id="XP_027485403.1"
                     /db_xref="GeneID:38739776"
                     /translation="MLRETAYTNELNTDLDGASNPSEPILLSSDDEDPSEGEWQVQSV
                     RRLSPNELRRQRMNAAREALRRAAHVPPRPTASHTLLSSYKCPICLCPPTNISVTPCG
                     HIFCGSCLYDSLSTNLRQEFDTVGRESGYGESPFTPFGSGGALALANAAGASVHGTRG
                     LFHELVHQRHRQAQDQRPSATQATSATRMRASNGTERIKGVCPVCRGPIKGGFTGLGR
                     KGILGLDIMLGTPKTDDTPHDDASIPQKRQRN"
     gene            complement(<297048..>297632)
                     /locus_tag="MRET_3011"
                     /note="MRES_10050"
                     /db_xref="GeneID:38739777"
     mRNA            complement(<297048..>297632)
                     /locus_tag="MRET_3011"
                     /product="mediator of RNA polymerase II transcription
                     subunit 6"
                     /transcript_id="XM_027629638.1"
                     /db_xref="GeneID:38739777"
     CDS             complement(297048..297632)
                     /locus_tag="MRET_3011"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 6"
                     /protein_id="XP_027485402.1"
                     /db_xref="GeneID:38739777"
                     /translation="MASTEPFDVNLLHVQWKNPEYLAFLSAQKGGVNAGQSVLDASNV
                     MEYFSTSPFYDRRSNNEHVRMQSAVLVNQALMSAHQSGIDAMQNVANMLETELKRFTG
                     LEFALVHARPPVCFVIHKRWRHSPDKVDKPLASYYIINDCIYQAPDIYTILSTRLQSS
                     IKGLHSTLREQREHRSTFSPRRGHYGRFLTMDPT"
     gene            <297732..>298505
                     /locus_tag="MRET_3012"
                     /note="MRES_10055"
                     /db_xref="GeneID:38739778"
     mRNA            <297732..>298505
                     /locus_tag="MRET_3012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629639.1"
                     /db_xref="GeneID:38739778"
     CDS             297732..298505
                     /locus_tag="MRET_3012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485401.1"
                     /db_xref="GeneID:38739778"
                     /translation="MSSSQPLDRKHQPGAHDELLSQYDDLHAMDDAEQEQVIEQIRHD
                     NHKANYIYRVGILVIYGLIFFLYATPIPTYLMGNHPKSHMTLYFHGQGKIGTDEDLTY
                     LPAFPIYVAVTSILAFFMYLAAYECAMRAGFVKLKPVAYPNQPHPYGSAPQWIVPVLR
                     DLRLQPSSNVRADPTKQSQKVELIKVLPPQIVYLGFLWVCTWPVPLITFGAGAFDDAA
                     WWSFPFLALSIHLLVEWWMYKAERDTLGLNGLKYNYKGA"
     gene            complement(<298509..>299441)
                     /locus_tag="MRET_3013"
                     /note="MRES_10060"
                     /db_xref="GeneID:38739779"
     mRNA            complement(<298509..>299441)
                     /locus_tag="MRET_3013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629640.1"
                     /db_xref="GeneID:38739779"
     CDS             complement(298509..299441)
                     /locus_tag="MRET_3013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485400.1"
                     /db_xref="GeneID:38739779"
                     /translation="MATRPRPRPRVRRADTEDRPNQSSDDAFFFAKRARTADAQDTSG
                     GMVEEADVSGPSRRNRKALSYDWVAHGPKKEAVEPLPSTNTIPEESAPHDRSVSLSPP
                     PPELEQEAQTYARQAIEQVTNTQRDRLRALEATSSLVDEPSSDVSLELDADLAQFYRG
                     HDAHRLRERAIEREMERQRSAQEEREWVPDEDGGEPVQVFEVLDSSDDDRVLAKPTPS
                     MPPSSPPPDAEDTAGTRLLMLRGARHLEVQVRVRPTTQVHTMLAHFLQTHAHALSQEE
                     KASIYMTFEGERLDPHTSVEDLDVEDDDLLDVMW"
     gene            <299555..>300037
                     /locus_tag="MRET_3014"
                     /note="MRES_10065"
                     /db_xref="GeneID:38739780"
     mRNA            <299555..>300037
                     /locus_tag="MRET_3014"
                     /product="signal peptidase I"
                     /transcript_id="XM_027629641.1"
                     /db_xref="GeneID:38739780"
     CDS             299555..300037
                     /locus_tag="MRET_3014"
                     /codon_start=1
                     /product="signal peptidase I"
                     /protein_id="XP_027485399.1"
                     /db_xref="GeneID:38739780"
                     /translation="MLSGVADTMRASSWRRQMAQFVQMLHVIAMALAVWKGLGIVTNS
                     ESPVVVVLSGSMEPAFHRGDLLFLTMGSKPIEVGEITVYSVPGTEIPIVHRVTETRPN
                     PKKKHGQLLLTKGDNNHGDDIMLYKGPRWIRDDQIVGRVQGYVDMSLTVTDSFPMLAT
                     "
     gene            complement(<300065..>302161)
                     /locus_tag="MRET_3015"
                     /note="MRES_10070"
                     /db_xref="GeneID:38739781"
     mRNA            complement(<300065..>302161)
                     /locus_tag="MRET_3015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629642.1"
                     /db_xref="GeneID:38739781"
     CDS             complement(300065..302161)
                     /locus_tag="MRET_3015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485398.1"
                     /db_xref="GeneID:38739781"
                     /translation="MSRLGAWLVWFTTLVLVVSATADSLNGTKESLTSKPKSLKKHMS
                     RFAPTRSTTSKTPVPSSSNSTAQTLVSTAWPSTTKSLLHTSTSGPFSLTRKASHSVSL
                     SSTLVPSKHASPSSSSVTSSSKGHASSTHGRGYISASKAFSNAEETISSHLSPFISPS
                     SRENLSRSLHASPLSTRRPSSLRHVASPHDSFSSLTGHARSETTSTSRDTWRSTSTKP
                     KNTSTRRTSLETDSSKAASMRSRAQTSHIWSPLPHFSLDPATLSVPRSMSFRSQPRWS
                     RSPGAGSPFLISTMATASQGSQSHQASRPGASSEGMGGMRVSKRPLKTPPGTRYAFLN
                     TNSLLLPETTRITSFEGATLTSTKSTVTSSIPSTMPLTIDPENKQAAKPRNNMLISIL
                     FQPSLSWTWLSVQRGTSAQVFTYMPEIVAHALSINESDVKTIQLRRYEQQGNKTVQRT
                     LYLAYIPARYGIQLQHLIADRTSKFYHPTGDKVSRELAREVDPASDLFLFATQPDDGM
                     DSSMPTVTRNALLGSFVGLGGAATLGVLIWLLQRHLKKKGSGSSWKVRRSDSILSFGN
                     DSPDPYLDAIPSRHRPTTGGSFFAGDAAGSSTDVFQRQQGVTGIIDVHHPDKLHPLCR
                     THSCDMDSLNESERKRSVPASPLPEHVFFKERRIPSVSVYAMDVDGRASPSKSNGDTI
                     RARTREKDLTSQAQHT"
     gene            complement(<302459..>304298)
                     /locus_tag="MRET_3016"
                     /note="MRES_10075"
                     /db_xref="GeneID:38739782"
     mRNA            complement(join(<302459..302551,302577..302655,
                     302680..>304298))
                     /locus_tag="MRET_3016"
                     /product="poly(A) polymerase"
                     /transcript_id="XM_027629643.1"
                     /db_xref="GeneID:38739782"
     CDS             complement(join(302459..302551,302577..302655,
                     302680..304298))
                     /locus_tag="MRET_3016"
                     /codon_start=1
                     /product="poly(A) polymerase"
                     /protein_id="XP_027485397.1"
                     /db_xref="GeneID:38739782"
                     /translation="MTAPTAFSHPRGRQVERMSTGVQMWGVTPPISLSGPTEKDLEIT
                     QALEEELRANNVFESSEEAKLREVVLGRVDALVKEFVYRASIQHGLSENAARASGGKI
                     FTFGSYRLGVHGPGSDIDTLCVAPKHVQREDFFEIFEALLKERDDVTEVAAVPEAYVP
                     LIKTKFMGISIDFLFARIPLPRIDDALELRDDNLLKNLDERDVRSLGGSRVTDEILRL
                     VPNVHVFRLALRCIKLWAGRRAIYANVLGFLGGVAWAMLVARICQLYPNEVAGAIVSR
                     FFLILLQWKWPQPVLLKPIEDGPLPIRVWNPRLYPTDRLHRMPIITPAYPSMCATHNV
                     TQSTQMVMTQEFQRGSEIVDRIFLGKATWKELFEKHDFFHRYKYYLQVIASSGSADLQ
                     LKWEGTVESKLRQLIMKLELVPSLLIAHPFVDGFNHECVCYTDEEVRQVATGEMPPEV
                     AARSKLQDLPPEGEAAKVKDQETQDNASDRRTVYTTTFYIGLKVEPRQAHETSVRRFD
                     ISYPTLDFTQRVKQWDQYDESAMGIVVRHIKGSHLPDYVFEGDPRPRKGPSSKRAKNK
                     HSDSATEDAAKKIKVSEAVPSTTPESGSTS"
     gene            <304338..>305756
                     /locus_tag="MRET_3017"
                     /note="MRES_10080"
                     /db_xref="GeneID:38739783"
     mRNA            <304338..>305756
                     /locus_tag="MRET_3017"
                     /product="S2P endopeptidase"
                     /transcript_id="XM_027629644.1"
                     /db_xref="GeneID:38739783"
     CDS             304338..305756
                     /locus_tag="MRET_3017"
                     /codon_start=1
                     /product="S2P endopeptidase"
                     /protein_id="XP_027485396.1"
                     /db_xref="GeneID:38739783"
                     /translation="MLPWLAWAACVWALGYAARRTVRRSQVQVAPGVVHYDTVALNEW
                     PAAIVRPCMYGRAYRAVLALYDVGVVVAGLAMVASLAVVLVTCCQLFLRVSPRLAKRD
                     AIPDAAPLWLTPLVPGVNLPLRHAAALVPVGLVSQMLHEAGHAVAAALHHVEPLSIGL
                     YVFFPAIPVAYVQLPEQLRGQRARLQVVSAGVWHNAMLVLCFVLASSLASVFWTDAQS
                     LRVSAPGPLRADVPRNSRITALNDVPVSAMPPTERLHAWTRLVHDTPWPAEPGWCIPP
                     ATWTQASDACCHEPSDSLACFSSASEQRCMLPLDIFVHSTRCHDTCSQGFCAAPQDPL
                     ARLYLDDDLVVLRGPFRGLSQTMRISTKQLRFPWIYLVPEVWADTLAHYGAYLYQLVF
                     MVNVALLLINMLPIPALDGSAYLQHAMGLPVPFHEAYDLEDPAAMPRPTGQRLLLVIQ
                     GTTCILTGLALVGSIWVSALPT"
     gene            complement(<305758..>307050)
                     /locus_tag="MRET_3018"
                     /note="MRES_10085"
                     /db_xref="GeneID:38739784"
     mRNA            complement(join(<305758..306823,306853..306978,
                     307005..307018,307048..>307050))
                     /locus_tag="MRET_3018"
                     /product="epsin"
                     /transcript_id="XM_027629645.1"
                     /db_xref="GeneID:38739784"
     CDS             complement(join(305758..306823,306853..306978,
                     307005..307018,307048..307050))
                     /locus_tag="MRET_3018"
                     /codon_start=1
                     /product="epsin"
                     /protein_id="XP_027485395.1"
                     /db_xref="GeneID:38739784"
                     /translation="MDLEEIGNKLSNLTFYDIKKMYTQAKNYALNISEIEAKVREATN
                     DDPWGASSTLMQEIAQATFNYHDFNEIMPTIFRRFVEKEAHDWRQIYKALQLLEYIVK
                     NGSERVVDEARAHLSTIKILRNFHYIDEQGKDQGVNIRARAKELAALLSDFDTIRAER
                     RKARANRAKYQGVGSSDFVPGSGSGRYGGFSSDAYYASGGASGVYGTGAAGSSSAEPD
                     FEEYHAGDDEDTAPAPQTSGPPVADLFSFDDEPPAVSKPAASKPATADDDFDDFQTAA
                     PPKPPTPVKSATAPAPRGGDLFDLLDDVPSKPVAKPAQQPAATPARKSTHHPPPVKPS
                     AAPAASASSASLFDDLWTESRGKSSTTTQQGPKSMAQLAQDQSSSSVWGESRTRSTPP
                     TTSKDLFDLL"
     gene            <307203..>307955
                     /locus_tag="MRET_3019"
                     /note="MRES_10090"
                     /db_xref="GeneID:38739785"
     mRNA            <307203..>307955
                     /locus_tag="MRET_3019"
                     /product="20S proteasome subunit alpha 5"
                     /transcript_id="XM_027629646.1"
                     /db_xref="GeneID:38739785"
     CDS             307203..307955
                     /locus_tag="MRET_3019"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 5"
                     /protein_id="XP_027485394.1"
                     /db_xref="GeneID:38739785"
                     /translation="MFLTRSEYDRGVNTFSPEGRLFQVEYALEAIKLGSTTVGIATRE
                     GAVLGVEKRVQSSLLESSSIEKIMEIDSHLGAAMSGLTADARTMIDHARVTSQNHRFV
                     YDEEIKVESVAQAVCDLALRFGENTEDDDALMSRPFGVALLIIGIDENGPQLFHADPS
                     GTYVRYDAKAIGSGSEGAQGELQEKYAKDMSLHDASLLTLRVLKQVMEEKLDENNIQL
                     AQVTPATSKDGRPTGVFQLLDKAQLKALVDAM"
     gene            <308041..>311778
                     /locus_tag="MRET_3020"
                     /note="MRES_10095"
                     /db_xref="GeneID:38739786"
     mRNA            <308041..>311778
                     /locus_tag="MRET_3020"
                     /product="trafficking protein particle complex subunit 10"
                     /transcript_id="XM_027629647.1"
                     /db_xref="GeneID:38739786"
     CDS             308041..311778
                     /locus_tag="MRET_3020"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 10"
                     /protein_id="XP_027485362.1"
                     /db_xref="GeneID:38739786"
                     /translation="MASATEAAVPVTYASNATSQASAQLAHVIPLLAEQMPLRNLHWR
                     PSSSMQTLKPVTKPGGPSTVPALRTILHLPVDLVPLASHVPNSSSVPVLKRLPMVHLF
                     FVVCDDSDVYRAQVRNEIRHWLATIRQHSPTDFDDVPVDERASAGLLPPEHLIVLVPS
                     APVGTFATSSSSGTSKGGMGRFYTMNKGTVLEKLRADFNSNTKEHVVALSKLPTSSKD
                     NDPAIWIDLMARIKECTLASVGRLMELQDRMVSLYDTTKYAVHWSLSGSMLRREQMVQ
                     TLEGLGLVPDALHVYDTIEQLLSYALASGRTRFTMGGTEVGDDSTMLLGPLRKPYMTL
                     MAQNKLSLFDMHCYLYARRSLLLAAMGHIVPVMQHTLAFIATVTGMMRPHRHLLARGF
                     LESWSFSVALDAVEQCQRWFRELYGDSPDAVAERGFHAATAELLEVGVRQLVRLGVQV
                     GHVPREEPFNFIESGAVSLFSPELRISRSEMAASLSDELVFDQHLRHVMHRTLQAASL
                     CEQTARTLRIKYLWAHWLMHRGAMTSARALWDELLAAPSLVHTSSYMYGAVHAARLAC
                     IEAQNEAHGDAWIQALTDAIQARCERRVQPMPALDEMKLLSMLVTAAEAQDRDATLVG
                     YNGLGVHVCSDHAHRDGDAVYVDVEVRSLLPTALAVDSVHIWLANYRQTQLACSSGAC
                     TLEPGVNRLRLVCSASAVGSFHLQATQVRIQRIMLESITQSAPTVSTLSEAQQQEYMR
                     PRVCIAADGEALYIDLRAPRETRLEARRSVWLHMESGRSALDSASMVLRPCGDVSLDD
                     EAAPTIVRAPPETQVSRAPTGSLVLQRLPAHSTCVVSLPIKHAPRAVAAVQVYASCQY
                     CSRTQHGTFHKTLHAPLSLPFSINIQDHFRLDTLLSKLALEAQGGMHVRVCAPQVSAS
                     SDSLVRVRVPEKAVPLPLGPRETATYLLHFEQTQPHRHRSVDTTFTLTITYRTAADEA
                     QGLALYVLATHLADSAPAWAEGDQALLERALCACVSDATFSPLTFDATYWHHVLHRWG
                     WRHDSERARQVLQLVQRVLADLADPSLDAMQLPSEPDAAPPRPVQPRAWAASRACLAW
                     RILTLPLDVPFVDTVNAVRIRPPVASHVALGEPMRVTFDTTVSFAWAKEHADDHEPLL
                     LQYHILGDYDNWLVWGTKKGTWSIESRTQHSHYTIQATLVPVRPGWLLFPRLRITPIG
                     PAMRPFRCETYMRHAGQGIHVVAPPQPETYWVDLRPSESLP"
     gene            <311815..>315333
                     /locus_tag="MRET_3021"
                     /note="MRES_10100"
                     /db_xref="GeneID:38739787"
     mRNA            <311815..>315333
                     /locus_tag="MRET_3021"
                     /product="RNA polymerase II-associated protein 1"
                     /transcript_id="XM_027629648.1"
                     /db_xref="GeneID:38739787"
     CDS             311815..315333
                     /locus_tag="MRET_3021"
                     /codon_start=1
                     /product="RNA polymerase II-associated protein 1"
                     /protein_id="XP_027485363.1"
                     /db_xref="GeneID:38739787"
                     /translation="MSHHEQIRPRVADMRDMDGDQPWVDWPPAARAVRTKPPAVSRPG
                     ETPREEAAAPRPIMGEIRERDSSSGHSHPAPPGKRISAFRRSRMERAAAPHTPQVAHP
                     VPPCPRDPSRDPGGGAAPEAMTSLLQDISHENEERIASMSYETRAEELRDAEAFFGQD
                     TLAKLAERMEQSMPTNRGWPALERRAVDLDAPPPAMQKKEHDERDAWESFRRQYFPDE
                     PDAVPPALAWTVTASAPSGDSVRFDFEGRVTTDTAQRDAEAPDETYLAGLHHHGQEQN
                     VPGYTLEELLHLARSSVASQRVLALQVLQRICTAPSSPSADRVLTADGSAMRGRIVLS
                     AVWLLHDRHKSVRTAAGQCLDAACKALSVVPHDVFVAAAMPTSADAELDMLWHDAAWT
                     PYARAPHFHAQDASHLELAQRHWPHALRQSHVLRALDMWLEDHAADTIVSLLHALVMH
                     DATSAKDLVQYPRLLHVVVQLGATKRPWPLVDAPYPSCEALLVLWRVIQSDRRTAQSL
                     WEQGAVDPLLRYVLMPPCDSTSSSPDAREHEQALLYLTLRILTSLGRYGVGSTSVREV
                     APAIPRLAQWSISAASALPMNDAAWHTIRALYEMLEVWTRAAHKGSHHGDLGLNEPIV
                     HAWAPYPQALLERLPPTPLSPVCLSAYGAAILHLAAWTQSASQWRHQARVQVTVSERL
                     VQEVSTQVTRVSSLLTTAQVREVRRASSDLAYIASVLGGLVRLAPSASLDTWCERVLD
                     LPLGVMATPAVRADGLSMPQLLHVLAMCSCSAAPAVQVRLLSWLPPCEVAYAERCLES
                     LVRALDASAWTVLMPFFRDALRYDQRPPSMIEAEAHAETLCMPHVLPPQDVSDPQTGA
                     TLRSSPVSGLPLRRDWPLLVLDDLLHSSDARALNAPDALPASWDFTEMDMVRAALQLA
                     VPIASLRAAPSAFWWLGIYKVFLLEQAAPATDEASGAVTGRDLYMDATVAHALRALMD
                     KADDMSHSAEPTLEEATSVTHAGSMPFYQVYTDLMGLYDAVSMHHPLFARALIPPLAM
                     VYAPDYRRLLWNDYAALLRGITIDTHDVPVVRGQRLEAYLWPCESDEIVLVRYVDALV
                     QRLVTPAQPFLYAVALHHISAAFWSAHEDGWGDVSIPPALAQSMARRVFTAEAGNHVL
                     TYAPHDAHVYSPDTRQAMRAQWLDTK"
     gene            complement(<315326..>315904)
                     /locus_tag="MRET_3022"
                     /note="MRES_10105"
                     /db_xref="GeneID:38739788"
     mRNA            complement(<315326..>315904)
                     /locus_tag="MRET_3022"
                     /product="transcription initiation factor TFIID subunit
                     13"
                     /transcript_id="XM_027629649.1"
                     /db_xref="GeneID:38739788"
     CDS             complement(315326..315904)
                     /locus_tag="MRET_3022"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     13"
                     /protein_id="XP_027485361.1"
                     /db_xref="GeneID:38739788"
                     /translation="MPPSTPYKSYGQARSTPYDDAHRGNMESELSRQDVLARGRRPFQ
                     QPGLFHKDLRLLMYAYGDVPNPAPESVAVLEEMTVDFLTDLCLRAEPSVYALGLTQSH
                     LAASATDMNNGEPASSTALRGHPSAIQTYRQRAKMEDFKHALRNDRKKLGRLEQLLYA
                     DKMVQEARRIGGVEDVAASAGALGHGDGKGPT"
     gene            <315991..>317580
                     /locus_tag="MRET_3023"
                     /note="MRES_10110"
                     /db_xref="GeneID:38739789"
     mRNA            <315991..>317580
                     /locus_tag="MRET_3023"
                     /product="glutathione reductase (NADPH)"
                     /transcript_id="XM_027629650.1"
                     /db_xref="GeneID:38739789"
     CDS             315991..317580
                     /locus_tag="MRET_3023"
                     /codon_start=1
                     /product="glutathione reductase (NADPH)"
                     /protein_id="XP_027485771.1"
                     /db_xref="GeneID:38739789"
                     /translation="MFQASFSATASSLRRATVLVGIIPRPTSRLQQIQQHVTSKFHSS
                     APFAMPPVTPPTSEHYDLLVIGGGSGGMGASRRAASYGKKVAVIEEAGKLGGTCVNVG
                     CVPKKLMWHASDIQDKLKEAHEYGFTDAGRSFSVPSVDWHTLAEKRDAYIRRLNGIYD
                     NNLQKDHVAYISGHGRLLGDGRVQVTPGVDGALKKEVTLSADHIVVATGGRPSIPSDD
                     DIPGASLGTDSDGFFAWREQPKRVAVVGAGYIAVELAGVLHSLNSETHLLIRHDSFLR
                     NFDPIISDTLMQYMGNTGLHVHKSTNVKRVEGERGGPLTLHLDTGDTLEVDALVWAIG
                     RYPNTNNLGLKEAGVETDKGGNIVVDKYQNTSAKGVYAVGDIQGKALLTPVAIAAGRR
                     LSNRLFGGPKFHDDHLDYDNIPTAIFSHPAAGTVGLSEPEARQKYEGQKITIYRTRFT
                     PMYYGLLSKKGPAAYKIVCVGEEEKVVGVHMVGMGSDESIQTVGIAVKMGATKRDFDN
                     TVAVHPTSAEELVTTYVPVQD"
     gene            complement(<317577..>318578)
                     /locus_tag="MRET_3024"
                     /note="MRES_10115"
                     /db_xref="GeneID:38739790"
     mRNA            complement(<317577..>318578)
                     /locus_tag="MRET_3024"
                     /product="Indole-diterpene biosynthesis protein PaxU"
                     /transcript_id="XM_027629651.1"
                     /db_xref="GeneID:38739790"
     CDS             complement(317577..318578)
                     /locus_tag="MRET_3024"
                     /codon_start=1
                     /product="Indole-diterpene biosynthesis protein PaxU"
                     /protein_id="XP_027485366.1"
                     /db_xref="GeneID:38739790"
                     /translation="MSANEAEQLKLEQYAPLIYVAHPDYHAAPVITPAPSVILICGWM
                     DAQLRHVYKYVEPYRRLFPHVPVIVMLSTVDSCFRSSTKEWKKNAEIVQRILREAGKL
                     AYEKAPNEPQTVFIHGFSNGGLISLDSLMEHMDDPSPTFPQPVGSVLDSLPGYDSARV
                     TLSAVIAGIHGDDLKARLTRAYTQATMTVLHYVRQVTSFMGGRAPNINFAKAYINKPQ
                     SWAWRKGTAPLKCPPRLYLHTRADEYISPDAVDEHAVEVQRVNQEEPAMVVEAENLKN
                     SVISWPPLHVIRTRRMVWNTPKHVQIARMHPTLYWSAIETFVRDTMSMIPSPIKSRL"
     gene            complement(<318653..>319975)
                     /locus_tag="MRET_3025"
                     /note="MRES_10120"
                     /db_xref="GeneID:38739791"
     mRNA            complement(<318653..>319975)
                     /locus_tag="MRET_3025"
                     /product="WD repeat protein"
                     /transcript_id="XM_027629652.1"
                     /db_xref="GeneID:38739791"
     CDS             complement(318653..319975)
                     /locus_tag="MRET_3025"
                     /codon_start=1
                     /product="WD repeat protein"
                     /protein_id="XP_027485787.1"
                     /db_xref="GeneID:38739791"
                     /translation="MALHVSDHVVCPAHAMDGYFSSDDRVPYITQIMTPSASAQHLLA
                     LCDDARILLFDKTQLAAPYDTIRAPEEEAFTALSNIESNNNAWMGTSVSGYVAVWDAR
                     APTMEPQMRLTGPSKSPYLSVASNGMYVATGTELKGSDAMIDVWDLRQTSTPVHTYSE
                     VHSDDITSLVFHPDRTQHANILLSGGMDGLICATDTSIKTEEDAVVSVGNTNASLARV
                     GWAAYPTSYCFTPSVPVTDVDMDDHDQQLVNNERWHHLGPVYAISNMQTLSLWDADKF
                     DCIKEGVEVRKPTSFRPPWVTDYVIDACASGPLSQRPAQGPSMHMYMGDQEGGMALVS
                     AEAQDHDGIVMEWTMHARLPSTENHPKAHADIVRCVEWDEASRRLYTGGEDGRLLAWS
                     FETSDSPVTPQAVMNTSTSSIETPPAKPARRPRPTGHDTLKRRYSPYA"
     gene            <320361..>320842
                     /locus_tag="MRET_3026"
                     /db_xref="GeneID:38739792"
     mRNA            join(<320361..320479,320506..>320842)
                     /locus_tag="MRET_3026"
                     /product="dephospho-CoA kinase"
                     /transcript_id="XM_027629653.1"
                     /db_xref="GeneID:38739792"
     CDS             join(320361..320479,320506..320842)
                     /locus_tag="MRET_3026"
                     /codon_start=1
                     /product="dephospho-CoA kinase"
                     /protein_id="XP_027485364.1"
                     /db_xref="GeneID:38739792"
                     /translation="MAWRLLCLWLTGCKRVVVDTPLLIEAGLYKWCAEVVIVWCDDKQ
                     QLKRMLLRDQAKGLTMDDAKARLNAQMPLAKKIPFADVVIDNSIDAAESSPPRLRAEV
                     ARVISRWRRESRRPMFVLLWLLCWLVPPVGLLWGLFVTWLRARKQAKRT"
     gene            complement(<320851..>322703)
                     /locus_tag="MRET_3027"
                     /note="MRES_10125"
                     /db_xref="GeneID:38739793"
     mRNA            complement(join(<320851..322470,322497..>322703))
                     /locus_tag="MRET_3027"
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /transcript_id="XM_027629654.1"
                     /db_xref="GeneID:38739793"
     CDS             complement(join(320851..322470,322497..322703))
                     /locus_tag="MRET_3027"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /protein_id="XP_027485365.1"
                     /db_xref="GeneID:38739793"
                     /translation="MGSNGPPGNGGLPPTQPNIGMQGRPQQVNPGMQMNALQGLQPML
                     VNNPEFLAIVNAARQGRVSEEQLQQIRSIIAQQQRQNAVQQMNVARPVQPQMYGTDAS
                     AVAQQNATFMQQQQAQAKPSGMPSMPNQPQLPRHEATLMENFNRVMSPLMLNISQLEA
                     SLQNPAVSAQEKQQQQNLYNELKSKQLSLARQVAMAREQARAKDQQQFQLLLQQKQQQ
                     AQQVKQSQPQQAQNQSLAQQISQQQLHQHQQQQQQKQHPSIPLQQAQQPALAQQKQGQ
                     TQTPILTQNPVASQSTSRPVNPNLQSISAAQEKGQGSLPSTPQSQHKSVSDSTTRNAS
                     QQDTPTTIANAQAAAVMRPTGSHGSWSNGTSAAAITPTSSLLPNGQNPVSTSSSLASV
                     IAQQTATPQPYPNASGPRPTLMQGLGSSPVTNTPPVLVRPNPLGRGNGLNKSISSSNP
                     GRSNNLDDILGVSDQGNADENLQLGLESETISTQLADLLGTSSSSLSPSGAAGTNRLL
                     TKRKVQELVSEIDPSEQLEGDVEDLLLEIADEFIESVTSFACRLAKHRKSDRLEVKDI
                     QLHLERNWNLRVPFPGSMPIPPTRFKAPTTSKSNNAGGGSTT"
     gene            <322828..>323516
                     /locus_tag="MRET_3028"
                     /db_xref="GeneID:38739794"
     mRNA            join(<322828..322982,323012..>323516)
                     /locus_tag="MRET_3028"
                     /product="release factor glutamine methyltransferase"
                     /transcript_id="XM_027629655.1"
                     /db_xref="GeneID:38739794"
     CDS             join(322828..322982,323012..323516)
                     /locus_tag="MRET_3028"
                     /codon_start=1
                     /product="release factor glutamine methyltransferase"
                     /protein_id="XP_027485360.1"
                     /db_xref="GeneID:38739794"
                     /translation="MIPTPDIGHLRQPKYRDNVYDPAEDTFALMDALEQDIDTLKALD
                     ASLCVEIGTGSGCVSAFVSQILGTSAAYICTDINARATECTIETGARNKVSLQPVLTS
                     SVEALRPRVDGAVDLLIFNPPYVVTTEEEEEAGQVRAGLDGAWAGGASGTKILDTLIQ
                     NHTIPQLLRRGGRFYVVAIRQNDPPSLVRAMQSIGLEASIVLQRRANREQLFIIRAIR
                     P"
     gene            complement(<323517..>325556)
                     /locus_tag="MRET_3029"
                     /note="MRES_10130"
                     /db_xref="GeneID:38739795"
     mRNA            complement(<323517..>325556)
                     /locus_tag="MRET_3029"
                     /product="U3 small nucleolar RNA-associated protein 19"
                     /transcript_id="XM_027629656.1"
                     /db_xref="GeneID:38739795"
     CDS             complement(323517..325556)
                     /locus_tag="MRET_3029"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 19"
                     /protein_id="XP_027485769.1"
                     /db_xref="GeneID:38739795"
                     /translation="MVRTAREVAPLERVQALQSHLASSTDLNSITELIKQIEELHTQL
                     EEVDDQRSHIKALTLATRVVSQALVTLSDKGTFDTDLTDADGRLVLQEASDAKAKVSR
                     WLRQQWNTFVSLILDELLYSEFAPIRQAALEVCMALQTASSEALHKHGTIKSGRWSVT
                     PFRPLVQTVLWRQVPDDVLETLAEEYLEVYDDVRFFFCKEVSRVLRNVPDASIKNERV
                     RSHARALLSRITAIPTEPSHLNNFLIPHLSHAPKKKKSNKKPKLTVSQDGDDDDGIIE
                     AEPTLSESDEEKEDEDSGSRKRRRSRHGLVTDALHTLGSQRQVFAAAWLSLLLPSTHV
                     DVNGQRIVHGGKLSTAETHDILVRLHAQILPHLPNPSMLHDFLVDCLDTKGTTALLAL
                     NGLFTLIVHHNLDYPDFYTRLYALLDASVLHTRYRSRFMRMLDTFLSSMLLPVAIVAS
                     FAKRLSRLSLRATPAALVEIIPFIWNMLKHHPSCMQMIHRDWDGDHLALGPSGVQDPF
                     DSHEPNPLFTHALESSLWEISTFGAYHLSQSSQHGKSATDGGDTHYLGSVTSFASIFA
                     EPFTQQRYELEDFLDTTYSTMFENETRKTLKRRNSSNKPVVPPALNSLDLTLTVPPIL
                     AEKSGHHDAAVRREIRKRLQMYAFPSTDPPQGDTPLEQDRRALRLDDCARLWNIF"
     gene            <325662..>327524
                     /locus_tag="MRET_3030"
                     /note="MRES_10135"
                     /db_xref="GeneID:38739796"
     mRNA            <325662..>327524
                     /locus_tag="MRET_3030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629657.1"
                     /db_xref="GeneID:38739796"
     CDS             325662..327524
                     /locus_tag="MRET_3030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485322.1"
                     /db_xref="GeneID:38739796"
                     /translation="MLWCLVWLLVSASYAYQGAHLSHHGIYSNLPYDTPLVLYIHPDE
                     LVVENSMLSLSAITRRSWPEVQQCTQAAFPLGMQSMEACEEYDVENEAVSYQILHDAD
                     LHGDLSIPIRPNPLPDLRSIGNDTALHSVTVTLHTVSSDGKPRIYRWWIAHFSQPPMQ
                     RARWPIAPGEYVSRAGEANHVRPTSWDGFDAPRLSGLMHDPFMTVSRNEQSASGHSWS
                     RGVSIRVRTNGTSVPVRSSVAGTVVWSGYLHRAMPPFDGRERGLNDQYLLTIMIRDSW
                     GFVHQFVGLEVAQVAVHEAVAEGTVLGYLPSTPLSPWPRSTASLVDIPKHNKEEGYES
                     FPYRFRHLEIRVARPHSAWTSYKDPNAKGWLYYNPLLLYVPGRVPLPMIAPFVDPSSF
                     AFRTTNVASIPHALSMQHGSPSIPNQVELFVSFQPFIESPGDPADAMDPVSVYALDWA
                     VEPVTKRPLCSSRHTYWRRSFEHSRLASETELDDPAFLHAHYVPHISIRSRLGLQFSF
                     QRYSQFDEKDRALYYAVTRQILGLPDVRGVWDTTREKRFGPFRVAVRARSLTSAYSCV
                     EAKVHVPHERPSSRYLRMLRAVFTPSLHTLPSFRLLWIADLVRHSLRVFRDMLR"
     gene            complement(<327526..>329160)
                     /locus_tag="MRET_3031"
                     /note="MRES_10140"
                     /db_xref="GeneID:38739797"
     mRNA            complement(<327526..>329160)
                     /locus_tag="MRET_3031"
                     /product="U3 small nucleolar RNA-associated protein 18"
                     /transcript_id="XM_027629658.1"
                     /db_xref="GeneID:38739797"
     CDS             complement(327526..329160)
                     /locus_tag="MRET_3031"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 18"
                     /protein_id="XP_027485321.1"
                     /db_xref="GeneID:38739797"
                     /translation="MAVEREQELTQRLFGGTKRPADEEAGITTLEDSALFTFDTGDDS
                     AVAADATEQVLDEAQPPAALWKDEDDERITVPLAGPQARASDGSVLGTKRLRKLRTSP
                     GETTISGVEYQRRLRKQYERMHPRPAWASASQQKDQSESPWNASLLRDLLSTDQGLVE
                     SKRHSRRLPSDRLDVERLRDANEAQGRVSEPAAIEQLQFHPSPHTHVLLTASRDRRVR
                     LFQIDGKTNPMLESLHVPDLPVKTAIFHPAGTSVLIAGPRPYLYAYDIRSGKTLCSSP
                     WRGAGRVVSSAVGTEADAGAERDLSFVRFQPGASSRLVAVGGRRGQVHLLDWGAGAAG
                     QMGGQRIGELRMNAPLAGMAWAGETEHRLLTLSTEGRIHVWDLRSRSCPVTAYDTGLF
                     GAKGLEVTMPHSMVPPYWAIGSSNGIVNMYGGQSTDSATTSTQLEELLAAPTSASVMD
                     DVRLTARKSLGNLTTATTSMRFSHDAQLLALASRNKKDALRVVHVPSLQAYSNWPTSG
                     TPLGHVTSIDFSSHSEYLAIGNSRGRVLLYSLRSYL"
     gene            <329268..>330815
                     /locus_tag="MRET_3032"
                     /note="MRES_10145"
                     /db_xref="GeneID:38739798"
     mRNA            <329268..>330815
                     /locus_tag="MRET_3032"
                     /product="hydroxymethylbilane synthase"
                     /transcript_id="XM_027629659.1"
                     /db_xref="GeneID:38739798"
     CDS             329268..330815
                     /locus_tag="MRET_3032"
                     /codon_start=1
                     /product="hydroxymethylbilane synthase"
                     /protein_id="XP_027485324.1"
                     /db_xref="GeneID:38739798"
                     /translation="MEDGRAESGELRCPVPHAENTPLPPGHPSVPNANPSTLQPPSGE
                     HCIFLRQSDDAPTVPSADTSRPVVVPPPITSPEDAKYVLVLSSRKSELAVRQASLVQS
                     LLEQQFGQAALASPAESEVRQFLQSFAPSSGIRPIDFPVRTMSTLGDLNLKAPLCVIG
                     GEGRAIWTKELEVALMAGAVDAIVHSLKDVPTTMPEGTELAAILEREDPRDALVVKQG
                     LPYKSLDEMPKGSVIGTSSVRRVALLRRSYPHLMFSDVRGNINTRLAKLDANDGPYTA
                     LVLAAAGLKRMELDHRITAYVAEPVLLHAVGQGSLAIEIRTPRDASAERDQRIRHMIR
                     SISNWRASWRCAAERALMHRMEGGCSIPLGVATRFDDHSDIEGQLNERLETPQEMLHA
                     GVSRPSIQVAATPPEEGCRLTMSAVIVSLDGSQQCQHTESLVCRSIQDAEQLGIQVAE
                     DLEHKKNARVILAEVEHHRQLAAAADEKRRAATAAGNKPQASSQAAEMDRRGLPRDDG
                     APKAWEV"
     gene            complement(<330841..>337695)
                     /locus_tag="MRET_3033"
                     /note="MRES_10150"
                     /db_xref="GeneID:38739799"
     mRNA            complement(<330841..>337695)
                     /locus_tag="MRET_3033"
                     /product="serine/threonine-protein kinase ATR"
                     /transcript_id="XM_027629660.1"
                     /db_xref="GeneID:38739799"
     CDS             complement(330841..337695)
                     /locus_tag="MRET_3033"
                     /codon_start=1
                     /product="serine/threonine-protein kinase ATR"
                     /protein_id="XP_027485323.1"
                     /db_xref="GeneID:38739799"
                     /translation="MPSDTHAWPSWVRECGFLDPLVPDDKNSAMYMVMQRCAERYIEP
                     VAAASTPDALHRGLASPPSYNVVLSSMYEWIASSPRVLELAFLRAPTAASALEDPTLD
                     LYLLPRLLASLTVLCTYEKQGLDVGHALGETMRLTGTILHMSLASSHHQTHARFVLFD
                     AMRCGVRGMVASGRLAPDYMALVGASQPQDELLLCANDPVPEPFTIRHHHRTDAVTQT
                     WLVREAATFRVAPPPSIAADVFEILVLLCTRIAAELGAVFPFAMQDMVELGVRIMLGP
                     EGARWTHVHYDAFIAALPHLGLYFYPVAHACMLSVSQAHSADERTCVQLTQVLRMIYE
                     RVRRDASPETACLVGDPRSLIPTHVAQILQTQQDTLRACYVAYLCILFAMLDEAPLDD
                     AWLCLHDVDDPAWQHEYHRFQNTPTSLPPPPAKRARTEAEPCETWPCPVCDAAQLDMT
                     VNMPRTDATLPHDLAYAPLSDPRQALLVLQALLRFFVHAHDDAIMSCDMASVKKALQC
                     TMSHIHRGVRVRTGRVLYACVWRCSHMCRAQRSPSLVSSLMAIATDGASAPSDSKMQE
                     TCVLALALLGRIPHEDCSSLVVSALIRCLFAPHVFIRALVCAETIQLAVYRRCTTFQL
                     FAQHLHIVCHVAIHASRGMMHALSDIARLVNMPGPTFLQATLGYTLPLLLERMALGQA
                     TAQAEMEAMAATVGQSVPAICLAHVSDVFQHAFLQPSDVRDASLQMLMSLLGSKSVTI
                     SSLLRSRLHDVLGWLVEHLGTSAYHGRAYEALGFVHETVATSAKWRGMDLTAFLQEEV
                     LAILTWINDELSGVHGKLRNERRVMAVRSIGALVQKIGNVAARVAPQVLASLTSTLQD
                     PSLAMPTLESWLDVVKALRGADLGVLVGPTAAALLAAWSRFDTDERHVAAQVLRYAVM
                     ERTSDPIYLNDVPSLDAIADDVPDVAQRIRSMRLSWEDEVQFVHILDRVSNDSAAICM
                     QSLGELRIFLQERRACIATWTSGNVFHTLIGRCVRVLMAVAARSELGDVVPALCLECL
                     GLLGAVDPDRLDMPPDEPILILLSDFENEDENMAFAQRILVDVVVPAFRATHDTKHQA
                     ALAYAIQELLKYCKFTPALLEASAPTRVPEKVRQRWSTLPEMLLPTLLPLLNSRYVVQ
                     QTEPRPREMPLYAHSTSYRDWVQAWTLWLIRSSRPGDAASLFHIFTSVVRDHDVGIAQ
                     YLLPHLVLHILISGSSQQRRTVLGESLAVLADQAHPALGYEPERRRLTAQTLFHVLDH
                     VGHWMRRMRLVPLRMARRSRWRDALSDVQAIMDELSPDLLAQASLQCDAYARALLHFE
                     YRIRAMRPQPSETLQPYYETMHEIYASLDDPDGMEGISTMVLAPSLEHQIREHESTGR
                     WTNAQSCWEVELQQRPDDVRLHVGLLRCLRNLGHYDTLRTHIRGVLAVHPTWQMHLAP
                     FQIEGACILADWDAARQLVLHAPKVPELGMARALLAMRDHDEEAFSTAVSDARQQLGR
                     RILGPARVSYPHAYDAVMQLHMLCELELIFYGRDDLKANLDARFAATLPSFRTREPVL
                     SLRRSAFQACRAPVTDLGACWILSAKTARKAGHTQSAYSAILQAIQSGAPYAFVQKAK
                     LLAHGDQVQAAIQTLNNALQTESEASGDHRELAKAHLLRARLVEETARFQQNDIIQHY
                     KTCTSLDADSEKIWYYLGHFYDAPGSGAVGNQMLLQLSVCRFYMKSAQHGTKFLYRTL
                     PRMLTIWLDAGNELADPEEAPPSEEDAHQAQQQFDKINEMMLRSVRHLARYQWFAVLP
                     QLVARIVHKNEAVWKVLLEIIVAVVVAYPQQGMWAILAGSHSKDKRRKQRYECIVERI
                     SSVADRAYRDVVPIVEAAERVSTELLHLCEYQVHRETKLRMPQHFPALIAAVQRTPLI
                     LPLQSSVNVILPPNNQVNQTHRPFPSHAPTILGFDDTIEIMNSLQKPRKIVIQASDGL
                     RYPFLCKPRDDLRKDARLMEFDSMINKLLQSNSDSRRRRLYIRTYAVIILNEECGLIE
                     WVPNTVAFRQILAKHYASMDVPLYTPDLKTLLDEARASPKNAAALFEQRILPRYPPVF
                     HAWFLETFPEPSAWFKARSAYARTAAVMSMVGFVLGLGDRHGDNILFDAGSGDTVHVD
                     LNCLFEKGMLFEIPERVPFRLTHNMTDALGVAGVEGAFRKTAEITMSILRDNRDSLMS
                     VLQAMVHDPLGEWVATERRARHRHGGSNKPWLGGAGGARKALKSVSDKLDGRLRRPGL
                     SDDVRHTTKNLVHMLICDATSTHNLSQMYVGWAPYL"
     gene            complement(<337784..>338935)
                     /locus_tag="MRET_3034"
                     /note="MRES_10155"
                     /db_xref="GeneID:38739800"
     mRNA            complement(<337784..>338935)
                     /locus_tag="MRET_3034"
                     /product="oxysterol-binding protein-related protein
                     9/10/11"
                     /transcript_id="XM_027629661.1"
                     /db_xref="GeneID:38739800"
     CDS             complement(337784..338935)
                     /locus_tag="MRET_3034"
                     /codon_start=1
                     /product="oxysterol-binding protein-related protein
                     9/10/11"
                     /protein_id="XP_027485704.1"
                     /db_xref="GeneID:38739800"
                     /translation="MTQTEQGEALPAEHRGGWMHFLKAIASMSGDLSKMTAPSFILSP
                     VSLTEYPSYWGEHPASFVDVQNGATPEERMIAVLRWFIGTLKGQYTSRNTSMGSEKKP
                     LNPVLGELFYGNWPAQGELGETTLVSEQVSHHPPITAYFLENAKAGVSVEGHSGQKTS
                     FTGRSIRVVQVGHAFMRLQRPEGVETYLITLPTLSIDGLWFGSPYIELTDSSYIYSSS
                     GLTAKIHYSGRGYFTGKPHSFTATVTPSSSPLSKPIFQASGIWSGKSTVDESTVVPAQ
                     GEFWDADAHAREEVHVKPLEQQGEYESRRLWQTVSRGIKSGDYDIASKDKSRIENEQR
                     ALRKKREQDGTKHVPKHFALVENDPEYARLVVPSKHVPAEQDSFRFQRT"
     gene            <339096..>341912
                     /locus_tag="MRET_3035"
                     /note="MRES_10160"
                     /db_xref="GeneID:38739801"
     mRNA            <339096..>341912
                     /locus_tag="MRET_3035"
                     /product="U3 small nucleolar RNA-associated protein 12"
                     /transcript_id="XM_027629662.1"
                     /db_xref="GeneID:38739801"
     CDS             339096..341912
                     /locus_tag="MRET_3035"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 12"
                     /protein_id="XP_027485325.1"
                     /db_xref="GeneID:38739801"
                     /translation="MVRSYERHEATAAFALIGSNAANALLDADGKTAFLPALEDVLVW
                     DVKRGEQRAMWHQLGFRLAVTAIARAPYPQESRFAVGYADGSIRLWDAETSTVLLTFH
                     GHQRAVTTLAFDPKALFLASGSQDTSVIVWDVVAESGLFRLKSHHDAITGVAFVPRQH
                     DTYYLVSTAKDGFLKLWDLQLQHCIETVVSGDEQLWSLAVHDSLDDTLVLTGGSNGHV
                     RLWRASHDVLQRGLQTSADDTSRRFFESHGTLELPSGHRVAQLAVYASYMAAASGDRA
                     VHVYRIRTLEEAQKKQQRRVKRAREKGDDSVDAAMPMTWLTRLEPYVIVRPTIGRIRS
                     FAFPSGHTQPTPDVAVPILCALTTNSAEIHSIPSPPRTKAEKQSVAIEASVSHVLELP
                     GHRSDIRAVALSSDDTLLASVCGSGQLKIWNVRTGRCIRTLAVSAFALCVTWLPGDRY
                     VLVGCKDGSLHTFDVPAAMPVETLEAHSGPLWSCAIHPSGLSAVTGSADKQVKFWDLE
                     MAPAEDGAPPQLSLVHVRTLQLTDDVLCVRYSPDGRLLAVSLLDHTVKVFYADTLKFF
                     LSLYGHKLPVLALDISDDSKLCVTCSADKNVKIWGLDFGDCHRSLFAHDDSIMAVSFE
                     HGMQGGGLMGGREGASHRFWTAGKDAKVKYWDGDRFVGVQTMEGHHGEVWALATGHHG
                     RVVVTAGADRSIRVWEKTDEPLFLEEEREKELEQMYESAAPPQEDTADAEATSVSKAT
                     TESLMAGERILESLHTADADIEQREQAQRLGQDVPVHPLVQAMFSEMETPDTYKYVLR
                     VVEKIPPTHMEDALLVLPFDKVVSLFRYIDVWITREWNVSLSARILFFLMRTHHAQIV
                     SNRVMRTTLVRLRTHVKNVLAKQKTLVGFNLAALRYLQQQHLSRRTTELFERPETQLH
                     ELDEAAVHAKLHENAKRKRKLVVR"
     gene            complement(<341924..>342937)
                     /locus_tag="MRET_3036"
                     /note="MRES_10165"
                     /db_xref="GeneID:38739802"
     mRNA            complement(<341924..>342937)
                     /locus_tag="MRET_3036"
                     /product="tubulin-tyrosine ligase family protein"
                     /transcript_id="XM_027629663.1"
                     /db_xref="GeneID:38739802"
     CDS             complement(341924..342937)
                     /locus_tag="MRET_3036"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase family protein"
                     /protein_id="XP_027485327.1"
                     /db_xref="GeneID:38739802"
                     /translation="MPPHALIVNDDGPPSATSPYVLDLYQKLVARGWNVRVVLPSSQK
                     SWSGTNYSVTSSRVRYWYYYPLRDNFLGTHPDTHLCWSHVRRKINTERGEIGEWVLVD
                     GVPSTCTNIGLYTGEALLGGDAGPIDLVLSGPNFGRNTGTAFSISSGTLGGALSGSLC
                     DVRSIAISFCHFMQDPPTLDKSRASGPALAPDAFDAMARLACEHTARLCEKLYDAWDT
                     DTNVESYSINVPIAETLTQPSVYWTRIWSSRHEQLYPLPSDRDNEERVKPLGIDPKEP
                     VDEDPACSYLAFRPNLSRAMCPSDPQPGTDAWAIHHGYISISRLVARFEHVEPGTRPP
                     PQL"
     gene            complement(<343242..>343865)
                     /locus_tag="MRET_3037"
                     /note="MRES_10170"
                     /db_xref="GeneID:38739803"
     mRNA            complement(<343242..>343865)
                     /locus_tag="MRET_3037"
                     /product="small subunit ribosomal protein S8e"
                     /transcript_id="XM_027629664.1"
                     /db_xref="GeneID:38739803"
     CDS             complement(343242..343865)
                     /locus_tag="MRET_3037"
                     /codon_start=1
                     /product="small subunit ribosomal protein S8e"
                     /protein_id="XP_027485326.1"
                     /db_xref="GeneID:38739803"
                     /translation="MGITRDSRHKRSATGARHAYYRKKRQFELGRQAANTRIGPKRIH
                     DVRVRGGNIKPRALRLDSGNFAWGSEHITAKTRILGVVYNASNNELVRTNTLVKGAVI
                     QIDATPFRMAYEKHYGQPVTKRRMPGTAPTEENVKKSNHVERKLAERRKDGKVEPLVE
                     QQFSAGRLYAVIASRPGQSGRADGYILEGSELEFYIRRLRSAKSKHA"
     gene            complement(<344175..>345535)
                     /locus_tag="MRET_3038"
                     /db_xref="GeneID:38739804"
     mRNA            complement(join(<344175..344816,344864..>345535))
                     /locus_tag="MRET_3038"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027629665.1"
                     /db_xref="GeneID:38739804"
     CDS             complement(join(344175..344816,344864..345535))
                     /locus_tag="MRET_3038"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027485694.1"
                     /db_xref="GeneID:38739804"
                     /translation="MPSTMSAEMTTVIDPTLLVCTESGSNGSLSPSSVSSSVSSPALP
                     SSSKRPAEALPSSYMPACKGRKSTEDEKLARRLARQQRNRKSAQVSREKKKAYMDQIE
                     YELATLRADKQASMQREHAASLRCAQLESKVEELSKRLRQFESIVGDWVKSHPGATDV
                     SSSMASMRDMKLQSVDHGVNGGGTNVSESDVARANAAPAAAPTEAGPSSPIAHETTDS
                     TCLPAAGATGSVRLEREGDQDQVTLSAHAAANGSSVASGCASERRGLFTPPNSSLDAM
                     LPSISVLASDDGKNDDSMHLPTTPSWNFDAISCTPSSSQDSSAQNGFGSSQVCETPSD
                     RLSMTPAPSDLSLLVSSFTPSTDVFDVNEDFSHTSVTIPSDGLAFYEPVLPSMLSSNA
                     QEASPFSLSPTFNYLDVDIPLETLPSDVSASWPLTSTYDSFVPCK"
     gene            <345735..>347983
                     /locus_tag="MRET_3039"
                     /note="MRES_10175"
                     /db_xref="GeneID:38739805"
     mRNA            join(<345735..346206,346239..>347983)
                     /locus_tag="MRET_3039"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_027629666.1"
                     /db_xref="GeneID:38739805"
     CDS             join(345735..346206,346239..347983)
                     /locus_tag="MRET_3039"
                     /codon_start=1
                     /product="GTPase-activating protein"
                     /protein_id="XP_027485320.1"
                     /db_xref="GeneID:38739805"
                     /translation="MPRKKAAAPQKERKSSLVVTEDEDTSTVADNEMEEFIDSESKSG
                     APTESEVTESEVTTSSETTEDEDEVSVDDEGEEDEEEESENDSDEEDDADEEEEEEDE
                     TDDDNEAEETDDDSDEEETESDTDKEEEQITRDNDNKEVKKKKKETEGKNRVNSNTPD
                     ANSALAIEEHQKSAKPFASALRESRAGTLDLKNEPMDIDSARAFMSSLKIDPMSPSVG
                     AASMIEPEHFIENPFAEPEEKENAVTQDARKKRPLPMASTSANTDKYRTAAENANKVN
                     EAEYDLILARMVSQNRKLNLDPRSMRRNAVGMGKLQESFERLQREYHSRNEANAEGLG
                     VRSKEFGLSDDDQDAEHIDWELWGGLIKNFSTVLATSPIELSKAIYAGVPHSLRGMLW
                     QLLSSSKDEELETQYKRYLNQPCSYDSAIRRDLNRTFPTQEFFRDAKGMGQGSLYHVV
                     KAYALYDPECGYCQGMQFIVGPLLLNMPEEEAFCVLVHLMENYDLRGHFIPNMPSLQL
                     RLFQFDRLVEDMLPMLHAHFLRCGIKSTMYASQWFMTLFSYRFPMEIVYRILDAVFSE
                     GIDAVFRFAIALLRKNEDKLLTLDFENCLDFVKLNLTRVYFDISDDGKHKHSQISELV
                     RDAFQVRITQFTLDTYANEFYDQVNAANRKELEMDSLRLLNRNLRLRVQSLEEQLSHL
                     NTEHVQLVKRVVTEKLSHEEIAEELVRYKIMYAEAVLQNDKGRRPTQASTPTIPTP"
     gene            <348160..>350336
                     /locus_tag="MRET_3040"
                     /note="MRES_10180"
                     /db_xref="GeneID:38739806"
     mRNA            join(<348160..348229,348258..348383,348411..348446,
                     348472..>350336)
                     /locus_tag="MRET_3040"
                     /product="oxysterol-binding protein-related protein 3/6/7"
                     /transcript_id="XM_027629667.1"
                     /db_xref="GeneID:38739806"
     CDS             join(348160..348229,348258..348383,348411..348446,
                     348472..350336)
                     /locus_tag="MRET_3040"
                     /codon_start=1
                     /product="oxysterol-binding protein-related protein 3/6/7"
                     /protein_id="XP_027485617.1"
                     /db_xref="GeneID:38739806"
                     /translation="MDASTAPVMHSGWVLKKKKKKMQGYAKRWLIIFEDGTLSYSIKP
                     ESESRGIIEVPHASVSSDIRHGTIHVDSGSNVFHFKMLNEKDFSVWRMELRKFLYHWQ
                     GEVLLPPKLLTGSLGSSMERADELLNSSIRSLELINASSASIDIKNVLVALGQVQEQH
                     ALMRQHLARRPRSETSRTTTPVNNSRSRPGHSHLATASPNGAAGTSASVASFLNVDAD
                     TALDSTPSSVISADEGDFDFYDADDMVNGVEYEMNECDNDDYGCVAEVEQDDADDDED
                     DYAFEESNADVLSPHVSTAITPMNTTQNQITYRKTLPAPVTGEEMSLFSILKKNVGKD
                     LSTISFPVTFNAPLSILQAVAEEYEYAPSLLERAAQTRDPAERIALVGAFAVSGYAST
                     SVRSSRKPFNPLLGETYECVRTDRRLHFLAEKVVHRPPVTASYAYGAGWKVSAAGTVK
                     NKFWGKSLELIAEGAEIVELDTGDKYSIVKPSSFMRNLLAGTKYLEHVGEMSVTNLST
                     NESLVIRFKEGSMFGGVANRNHIEGVVYDANKSKVGEMKGRWDERIFLTNNNATTSVL
                     WQSEKIPPDASDYYGFTYFAMSLNEITDDIRSILPPTDSRLRPDQRALEDGDADKAEA
                     LKLELEGHQRERRKKMEAAGETYHPQWFHPSNNGVGWAYGGPDGREYFTIREQIKQSQ
                     SQWNVPMAQIFEVHRP"
     gene            350391..350475
                     /locus_tag="MRET_t0051"
                     /db_xref="GeneID:38741245"
     tRNA            350391..350475
                     /locus_tag="MRET_t0051"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741245"
     gene            complement(<350596..>355464)
                     /locus_tag="MRET_3041"
                     /note="MRES_10185"
                     /db_xref="GeneID:38739807"
     mRNA            complement(<350596..>355464)
                     /locus_tag="MRET_3041"
                     /product="cellular morphogenesis regulator DopA"
                     /transcript_id="XM_027629668.1"
                     /db_xref="GeneID:38739807"
     CDS             complement(350596..355464)
                     /locus_tag="MRET_3041"
                     /codon_start=1
                     /product="cellular morphogenesis regulator DopA"
                     /protein_id="XP_027485675.1"
                     /db_xref="GeneID:38739807"
                     /translation="MTAFHPDALVTRQMPTNATTGAGEEEAHDLWRSAEAKYEQKRWA
                     EQSEKALYQDVAFKRYQASVDKALAKFENVAEWADFISFLTRLLKALQTSSASYHVIP
                     TKLVVAKRLSQCLNPALPSGVHTRALEVYMYIFTAIGVDGLRRDLQVWTPGLLPFFPH
                     AATSVRPLVLDIYERFYLPLHTDLRPMTRALLLSLLPGVEEESSEFFDRVITLLDRLA
                     ASVQWPFFIRTMWKVMITSPTVRLSAFHYLARRMPKIEEPRELDVPLLGCAISHALRD
                     QALLVRRQALDFLVTRVALDTPVFEQVPDKIRLLDAALDTVLRRDISLNRRLFSWLLG
                     SDESDAAQQTYFETHARSHVAHMLLSAMQQKNQAQRAFKMYVSLMDKRAMAQPLLRTT
                     VLDVFQTCQIHHDEELYPTAQTLFMAMDDYMLYQSLYRGIKDKKTVRLFQYILRQFRP
                     HEPEALHVHLPVVALAIPQLVKDASPELAGALLELLQDLMGVLDIHAFAQHTNTSAPL
                     DEPAEQWFSDAPPERVPTLQDTSMCTAWLEAILSVAMSQPPATVTCCAVLVSAMDKLV
                     EAGCSVRMHVQNEALFAYIAHTRTFEQLEAVLHMAVHITKSSAVDASFLFRGAHLETV
                     VQKLLEYLQPHAFQHHAAAVELFWSVCALAQGERGAAVVCAELSGTGRERAMHAVGTL
                     WRCTTQQTATHIPACVLLILDRLHSHDMLEQHESHVWLQTYVRTYDAILCMLSRLLRR
                     VPMQRTHVGVAVAGRMIDAYTYHMPWDRAYTQYYLRMLAALLHIAGKECVHVAWDGTD
                     EEQGGSLIDVLKDDVMLLLRSGGPHDRDASTVSLGLEVLDAILSMEPGAAWCTDVEKS
                     LVDVLLLSIDARDATRQIMVLGVFARVLRDVTLSDEECAVYADLVRRGMTHAPNDTAL
                     LAWTDFVHAVLPAMQDIQAFLLPLCHVLREMLVCTIRPFSAQHALEPDVSITLDRVPR
                     TEAEVEALMRLLETALASAFSRAYHARPRQDDATPPSSILGNISSVFQAETASGPTTQ
                     ETTVRRHAVLALQAVAYVWFVGRDCACLPQSIAGSAAVLERFWAMDTSMTLDAVIEHW
                     WRCSTRDMHRSYVDDATLALLEHLTSSAQLIFSSVCDAISSKVPKNRSGRVSTSILSE
                     PVLFRLLELYATKLDAGSIAQVWPIMSLLARTMAQTTSPYVVYHALRLTTVMGTKLTD
                     SNLFNEQRTRRDVQDAFVRLCELTISLYGRSLDISSGRDSDAPSVASDRGETPSDVVS
                     PTSVVQTLCSMVLPAFTTLRVDQDKIQSVSASLAYYILAPGFRARQGSWEPEPLLFEV
                     LESLTQLPATSKTWRSYVLDTFFDVRFFAQSLDMGKQWAPMIAALFRSERDRLSDVIG
                     RISTASSNLFTSRDSDLFARVGAIRRLSYVVYTSETNAFLAQLPLIQEKVVDILRSSP
                     ADLVHAEVYLCMRVFLCRFASQHLTGFWPIILTEMVRILAQAKVDLPADKSDRLQLVF
                     SVVKLADFLITLQTDDFQIHQWLLITDTPDATNPASSYMADSLLDCLAKFVSECQREL
                     VFDANDSLERAQQRRPLLQMSSVATISTLQPFFATASRAFYQCDFHATLDWDNINACL
                     LHDLFEPIHTNT"
     gene            <355570..>357585
                     /locus_tag="MRET_3042"
                     /note="MRES_10190"
                     /db_xref="GeneID:38739808"
     mRNA            <355570..>357585
                     /locus_tag="MRET_3042"
                     /product="exocyst complex component 8"
                     /transcript_id="XM_027629669.1"
                     /db_xref="GeneID:38739808"
     CDS             355570..357585
                     /locus_tag="MRET_3042"
                     /codon_start=1
                     /product="exocyst complex component 8"
                     /protein_id="XP_027485618.1"
                     /db_xref="GeneID:38739808"
                     /translation="MSMPTSRSLRTRPATLYARDGLSPNLPQTPAWRKASRESEKEDK
                     VRNRLSTRYASGAVAPGLSYMSGLNTLAPIVGSEEEKDQAVPPLPPAIDTQVAGSSQT
                     ATATTPAGTSGVALAADVFSDENFDARTFASEQMQQLNEPGLQNLRTSLGTLQSMTQK
                     QLKEQVFKNYAEFITISREIATFENDMLEFKEILGEWKQLPQQLQMEDPLSETALDGS
                     AGSGIAGGVPRRSRNSMIDLEQIYKAQLTSLWENIEGSQKFVPLVPGRHLVAETSQFV
                     EINAATYKPKQAVALFLLDDLLLIAVQRKRHYGNRIHLVAECCFNLSEIVVVDLKDTK
                     DVRNAIKIKHGRESFVYRSERAQDKRALLRAFRGVGEELAAKLKKQRKARTQSKHMGS
                     DNMLYGSESMDPASQDLGLSDQAPAAPTSTNDVEWLGPWLNGVIDELAVHIALREWEE
                     AVALVEEGKKRLASRPISEGPLYLLVESFNSCASELVQAISAELVSPYQRKSMVVRDA
                     ALLVRLDKGREARDLLLEARTDLLQRRMRQIKYEGDVSLYISELAMLYFTLIKNTGDW
                     YMAAFKDYRMASGFVQWASDQVKAYAETFRRQVYGVDQDPRVVDEALDITRRCAQLLN
                     EVGLGLGFLLDDLLKPGVEGTPLGTWQDPALSARDPRQYQWHSTVPA"
     gene            complement(<357586..>360024)
                     /locus_tag="MRET_3043"
                     /note="MRES_10195"
                     /db_xref="GeneID:38739809"
     mRNA            complement(<357586..>360024)
                     /locus_tag="MRET_3043"
                     /product="signal transduction protein Syg1"
                     /transcript_id="XM_027629670.1"
                     /db_xref="GeneID:38739809"
     CDS             complement(357586..360024)
                     /locus_tag="MRET_3043"
                     /codon_start=1
                     /product="signal transduction protein Syg1"
                     /protein_id="XP_027485619.1"
                     /db_xref="GeneID:38739809"
                     /translation="MKFARYLEENAVDEWRKAYLNYAGLKKLIKRVKQHYDARKTGRV
                     PVSESSSHPAARLLRGGPSYLARGQRTVPKYGALGDPEEQDPLPSVTLDGTGLEAEVL
                     LAEPVRTDSKMVDTGLDATISRHFDEQERLFFYALDYEVDRMVEFYDARELEAVERLS
                     TLVSQLIELAEHRRAYKTQTKRIDGGHLKNIWSKVPRRLDTEELHRLRLSAQGRELQP
                     SSREPTSSDEDVGQQRREHALEQVHHLNLVDVDETPKEPRHYDPVHYKTARKKLRSAV
                     VENYRGLEILNNYAILNRTGLNKILKKFDKTFQVHLWDRYYEERIQQRSLVVSTTVPQ
                     MLHALEDIFANYFEHGDKKRARDILRLGVTHALLPHETGHHRSTFVTGLYIGIALCLV
                     IEAFDHVMHKSTRALIPMWPQLLITYAVFFLPTLFAVLFGLNLIAWQHVRINAVFIFE
                     FDATTAIDPSQYFELPSLCLWLLALCFYQSFTAMPDDERYVSATTWPLLWLCAVVLLL
                     CNPLPIMHRSGRAWFLRSCARVLTGGLIGSIEFRDFFLGDEMNSIAYSVSNLWLVQCE
                     YRSAWQSTCNPSATYWTPVLSSLPAFLRLMQCIRRHYDCKGTTHVHLVNAAKYASTIC
                     HAFAYFAFRTTGSQSSVRFVWWILLATINACFTSSWDILMDWNLLHREARYPFLRMHL
                     SFDDIWPMYYVAMVTNVLIRFVWVIYLFGSPSTLPLRAFIAAVLEVFRRWLWNFIRLE
                     NEHIGNADTYKIVRELPLPYPVKRQAVDKDGELLDSSHAPTPTKAQPYHEDQVLASLA
                     RTRQRLAQHRGPDN"
     gene            <360508..>361455
                     /locus_tag="MRET_3044"
                     /note="MRES_10200"
                     /db_xref="GeneID:38739810"
     mRNA            <360508..>361455
                     /locus_tag="MRET_3044"
                     /product="small subunit ribosomal protein S15"
                     /transcript_id="XM_027629671.1"
                     /db_xref="GeneID:38739810"
     CDS             360508..361455
                     /locus_tag="MRET_3044"
                     /codon_start=1
                     /product="small subunit ribosomal protein S15"
                     /protein_id="XP_027485613.1"
                     /db_xref="GeneID:38739810"
                     /translation="MWLAKWCAPTARAYVRDAGAAFSLPAASIHTSAPLLESKRKRVA
                     RLRRQKNLAQQNIKQRMFEMSKPDPVLAHRLNEQGHATWANSELAKLILSKTEVWGLV
                     EDRRGRLQTVSPLPREEDAEVDTVVEEFGGPRRLNFGLDTRDRRTLFQSLPRVMTTDR
                     AMDLTDSVQGGSDAFAVDLKQLEEEQAQSAETLSRILDLRNASGRGIQVENTRRIIAH
                     FGRSTESGGADTGSPEVQAALLTYRIRNLAEHLQTARHDNSNRRSMRHMVHQRAKILR
                     YLKSRDPIHYQKFLPRIGVEARGVEGEIVVPGKPKVRRM"
     gene            complement(<361458..>362866)
                     /locus_tag="MRET_3045"
                     /note="MRES_10205"
                     /db_xref="GeneID:38739811"
     mRNA            complement(join(<361458..361961,362177..>362866))
                     /locus_tag="MRET_3045"
                     /product="ubiquitin-protein ligase E3 D"
                     /transcript_id="XM_027629672.1"
                     /db_xref="GeneID:38739811"
     CDS             complement(join(361458..361961,362177..362866))
                     /locus_tag="MRET_3045"
                     /codon_start=1
                     /product="ubiquitin-protein ligase E3 D"
                     /protein_id="XP_027485614.1"
                     /db_xref="GeneID:38739811"
                     /translation="MSTTSGAPKRRRSVATDTGLKTQRRYSDLRELHVALEFQRHIHR
                     VTVLAQAPATCSSNTPLQCTVKALNDKALLQFAHAALPPVCVQVPWPVVPGSYAASFS
                     DGYVFTIPTQPMGRTCQPPPSSPWHEFTQKDIDALQCARCAQTLVQFTPRAHLRALPS
                     EHWEELVDAWMCHGDQRLNASVTQGRRDVDVHRVPRDDELWVSSLWLKTSSASITSGV
                     CIRGEAQDNFSETHAFPVQCTQCHAVLGAAVEPVNAGDHATSVQWLQCSVMPAHVPTD
                     LGFLGLVLSNYLVEQTERQAVHRFVVCAMQASEPAPRLVLWVFQPLITLSIPPLERPC
                     DACKLLYKPGATQPDMAQHIPLVLPAEVCDALHDALQDSAQIYPASRRVLGDWHVGWL
                     PRRWI"
     gene            complement(<362900..>364135)
                     /locus_tag="MRET_3046"
                     /note="MRES_10210"
                     /db_xref="GeneID:38739812"
     mRNA            complement(<362900..>364135)
                     /locus_tag="MRET_3046"
                     /product="protein SHQ1"
                     /transcript_id="XM_027629673.1"
                     /db_xref="GeneID:38739812"
     CDS             complement(362900..364135)
                     /locus_tag="MRET_3046"
                     /codon_start=1
                     /product="protein SHQ1"
                     /protein_id="XP_027485615.1"
                     /db_xref="GeneID:38739812"
                     /translation="MQLVTPSFHVEQDASFVHVSISCVDAKVAEVRIVAEERTFGCFV
                     DPVYLPLNLPCAVESMSETCALTSSPHGTYDPKTQTFTVHIKKRVHGEHFPGLEALRP
                     QILSDNEMAQLEEASRQQSEHPYGLMSSYVPLSHAYADMMRNGRVPILDIVDPTVVPL
                     AERSMRAEELEIQKWDEGMYLDSYVDVDGDVAAAMHVVPALLRKDVPQGTQPAWAGPL
                     PPTEQAQACLVQVVFAYLYEMHVSSNEASTESAWTICKLCRSLTCFSEPLPPGTDVQD
                     VLRWSFRRALTYPLYRSWALCERICSDAHELFNLPDAKARILHMLRDMDAIFALAPTG
                     TGLAEPMELALQLVWDAWLAPLESWIHAASDDDIKAMASIWNARMSKDAVGTPGEWDL
                     EAWEAAAREAQEHGEGGFV"
     gene            <364165..>365781
                     /locus_tag="MRET_3047"
                     /note="MRES_10215"
                     /db_xref="GeneID:38739813"
     mRNA            <364165..>365781
                     /locus_tag="MRET_3047"
                     /product="WD repeat protein"
                     /transcript_id="XM_027629674.1"
                     /db_xref="GeneID:38739813"
     CDS             364165..365781
                     /locus_tag="MRET_3047"
                     /codon_start=1
                     /product="WD repeat protein"
                     /protein_id="XP_027485616.1"
                     /db_xref="GeneID:38739813"
                     /translation="MLDEETLRSMLPGRFGQQGKNELPTAQEPNEASQEEEKEEKAPV
                     PDTLDVLKEYAGLPLTRSIQLKDHTKSVCALGIDRSGARVASGSTDYDVKLWDFGGMA
                     SNLRPFKTFEPAENYPVIQLAFAPQSKNLLCLNAAPQPRVYDYDGNELAVYKKGDVFM
                     RDMRHTTGHISDITCGMWHPLDDTHFMTGGSDSTIRLWDVNHKASQKTVIVLRSKNRG
                     TKTQVSAATYTPDARAIVATGQDGAMYMWATNGNYARPSATVQGAHTASQSATSLAAS
                     SDGYTLASRGADDSLKLWDLRQLRSPLAEKQELPNGSDHTDVLFSPDGRQVMTGLASV
                     PGGSMRTSDPLSQWGQLAVFTSDTLHQQLVYPVAQSSVIRIAWHARLDQVFASTRDGS
                     VHVFYDEHASQLGALLSVNKRARTRTNPFADDGSQTDPYADVPIIIPEETDHDDWLDP
                     VYKKPQFPRNPKNARVPERPLEGRGKGGRIGRSALQPLMKDLVESDLRSEDPREALLK
                     YADKAQKDPRWTAAYANTQPKAIFDEEKDT"
     gene            complement(<365778..>366965)
                     /locus_tag="MRET_3048"
                     /note="MRES_10220"
                     /db_xref="GeneID:38739814"
     mRNA            complement(<365778..>366965)
                     /locus_tag="MRET_3048"
                     /product="chitinase"
                     /transcript_id="XM_027629675.1"
                     /db_xref="GeneID:38739814"
     CDS             complement(365778..366965)
                     /locus_tag="MRET_3048"
                     /codon_start=1
                     /product="chitinase"
                     /protein_id="XP_027485611.1"
                     /db_xref="GeneID:38739814"
                     /translation="MPFHLRSKLANVFHTSSHGGPDRQVQVAYFPNWSIYQKGYKPEH
                     VPVQHLTHILYAFANIKDSGEVVLSDEWADRQIKYDGDQEHDGAMFGNLNQFLQLKKQ
                     HRHLKTLLSIGGWSYSGSFCGMNDAAKRQTFIESAVKLLADCGFDGLDIDWEYPQSDM
                     EAQAYVQLLSGLRRALDEYGQRATPNDPHYLLTIAAPCSPQKYQILKLKDMDKYLDFW
                     NLMAYDFSGSWDQVANHQANLYGGAISVSKAVDDYKHRGVPLNKMVLGIPAYGRGFVG
                     TGGPGQPYRHASETEGGTYLYKNLPRQNAQEHFDKRAGASWSHDGNELISYDSPEAVH
                     AKAEYIKNKGMLGAMFWELSGDVPADQDRSLVRTMALALGDLDQSQNHIAYPESVHPN
                     VRA"
     gene            complement(<367065..>370184)
                     /locus_tag="MRET_3049"
                     /note="MRES_10225"
                     /db_xref="GeneID:38739815"
     mRNA            complement(<367065..>370184)
                     /locus_tag="MRET_3049"
                     /product="putative integral membrane protein that
                     interacts with Rpp0p"
                     /transcript_id="XM_027629676.1"
                     /db_xref="GeneID:38739815"
     CDS             complement(367065..370184)
                     /locus_tag="MRET_3049"
                     /codon_start=1
                     /product="putative integral membrane protein that
                     interacts with Rpp0p"
                     /protein_id="XP_027485612.1"
                     /db_xref="GeneID:38739815"
                     /translation="MLNASGLDDSDDEWQDMPIEHVGPWSPSSANTNSDSDSESDNER
                     SPKSKRVAREAKLMRQRRAHMRGRGTSAQGGTSNTAGRHLDVHDVRGYDWRTRPDEQV
                     ADSQALGSEGVGYTKLRLDDADEDAELEAATDYLFQEDLNRLDDADDPSAAPISQLAL
                     TKRLLSDVQKLAYVGLCSTLCSQIVKELEQLGAKDDRPAIQSAKEWGLRVMIRLYQHL
                     DVEPAEQSMIESLSLHGILPSDLAPSLIATQTIPNPAYDPALAKQEASQPKPPALPQT
                     PKVKQAATSTPETAESPSILTDPNTASQVTEHASALSGEATRVPEASLKAPHTSSHAH
                     ASVTTLDGVTTEVNAANKTITLDLRWTVLCDLFLVLTADSVYDARSRVLLERLAELIG
                     LSWMDVTKFEKRITDSLEIEEDVQTLDDKSITQHHDSASRHKRLMMMGLATVGGGLVI
                     GLSAGLLAPVIGAGIGAALGAVGISGTSAFFSGVGGAAIITTTGTISGAAMGGKGMRR
                     RVKSVQIFEFRPLHYHKRVNCIITVPGFLKGAEDDPTLPYSVIDPIMGDVFSIMWEPQ
                     MMQEMGNAMSILWNETLVQGVQQVLAATVAGAMFSALAWPLWLTKLNYLIDNPWSNAT
                     ERARAAGLILADVLIHRQMGVRPITLVGYSLGARMIFYALLELARKKAFGIVQNVFLM
                     GAPVPSRENEWKTARTVVSGRFVNAFARSDWILAYLHRATSGGVRNIAGLYPVEFGCG
                     IENIDVTNIVPGHLAYRALTPLLLGELGFQTTADYFDEPESLDHVPERTVEKESPQKQ
                     HSTATQSLKNFIWGKKEKSPDTVPPPPQLVYDAMEDEVKKPQTSSLESMPVVPTDVVH
                     APRSDAPQDIPKPIPDDGAELGESSPPMEHQSDDKNSRSPSNEHVAGSDAKEEEAPAS
                     KDHEKIPDQQSQHEEPHDVGHQETLRALEAHDHDRHEHHLSDEESEHVASNIPVPEEE
                     SPAYASYGLAADEAAQLAAQFNSGLKPTSPIHVPNEEWETSPDHVLLTSPKRSSDLPA
                     WAAENPWDA"
     gene            <370344..>370927
                     /locus_tag="MRET_3050"
                     /db_xref="GeneID:38739816"
     mRNA            join(<370344..370364,370390..370462,370490..370578,
                     370608..370785,370821..>370927)
                     /locus_tag="MRET_3050"
                     /product="signal recognition particle subunit SRP14"
                     /transcript_id="XM_027629677.1"
                     /db_xref="GeneID:38739816"
     CDS             join(370344..370364,370390..370462,370490..370578,
                     370608..370785,370821..370927)
                     /locus_tag="MRET_3050"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP14"
                     /protein_id="XP_027485432.1"
                     /db_xref="GeneID:38739816"
                     /translation="MRVDAKEFVVRLEELFARTKDARSVHISSKKQPYEDGSVTHAIL
                     FRVTDGGSKERAKFSTLVPPSDILAFQDTYLTTLRTHLAENLKKRDKAKERRVDKTLA
                     ASRKKLEENDGKVKILGAKRGKGRRQRMRALRRARILRQARAQAQHPPSATQA"
     gene            <371106..>372548
                     /locus_tag="MRET_3051"
                     /note="MRES_10230"
                     /db_xref="GeneID:38739817"
     mRNA            <371106..>372548
                     /locus_tag="MRET_3051"
                     /product="auxin efflux carrier"
                     /transcript_id="XM_027629678.1"
                     /db_xref="GeneID:38739817"
     CDS             371106..372548
                     /locus_tag="MRET_3051"
                     /codon_start=1
                     /product="auxin efflux carrier"
                     /protein_id="XP_027485559.1"
                     /db_xref="GeneID:38739817"
                     /translation="MNLLPELGPVGRLVIVTLSCILQIVAVSGMGYIMARVGVLDRRM
                     QSKLNKLNVSVLTPALLFGKIAFYLTPQRLTELAIVPAGFLCVSVISALAAALTSRLL
                     RVLPGQRNFVMACSITPNSNTLPVALISSLVYSVPELHWVENGQDSDQPELMFGRALT
                     YLVMFSTLGTVQRWSIAAKLLEGVKGISNFYYGSDHPSRSGFRDDVTDPLIDEHHRSQ
                     FADRNSILLHAPATSSPLRSELLADEAQEADTPSVPAPPSHGWAYAVTRPMIRFWHAF
                     LNFMTVPLWAALLSFIIVLLPKVQNFVKSVDPFVDAVEQLGQCSVPMSILVLGSYFHD
                     SDEDESNVTNHGSMMSAREDAPDAHEHAAEAAWEKRMTWRTIVAASASRMIVTPLLML
                     PLVAYVCLTNDTEVVGDPVFIACACLVIGSPPALTLAQISRQRGDPSSNLEALISGTI
                     FVSYIFLTGPVTVLLVFFALYIDKMQALFL"
     gene            complement(<372559..>374847)
                     /locus_tag="MRET_3052"
                     /note="MRES_10235"
                     /db_xref="GeneID:38739818"
     mRNA            complement(<372559..>374847)
                     /locus_tag="MRET_3052"
                     /product="AP-2 complex-associated kinase"
                     /transcript_id="XM_027629679.1"
                     /db_xref="GeneID:38739818"
     CDS             complement(372559..374847)
                     /locus_tag="MRET_3052"
                     /codon_start=1
                     /product="AP-2 complex-associated kinase"
                     /protein_id="XP_027485558.1"
                     /db_xref="GeneID:38739818"
                     /translation="MATAPVPVIGPFQGQRTLQPGMRVRIGAHLVTVSRFLSSGGFAQ
                     VYLVEADVPVPIPGHEHRDTTLVLKHMCVWNKDALASVRGEVEYHRGLRGHESIVHFV
                     EASAASLVGDGWEIFILMEYCAGGGLIDFLNTRLQHRLREDEVLRIFRDVCEAVLIMH
                     HQDPVLVHRDIKIENVLRTTSSPPRFKLCDFGSCFPLLSRRAAKSAEEIQRCERELNQ
                     HTTMQYRAPEMIDLGMHVPITEKADIWALGVFLYKLCYYTTPFEAPGAGPAAILQARF
                     EYPDKPLYSSALRALIQSMLQVDAEARPSIDSILESVELQLLSLTTPTPPETVARAKT
                     PTPRPPSIRPVASRSSLRPRSVARPSRVTTPPATQSKAARSSERPDSLILNVSLDDVV
                     ARYPSLQELDQAEQVPRQSVKAMVQQLDTESPPRAVSIPMEKSTSASMRDKPAHTLVD
                     VDLSSSDEEHEAPEDVNVRVRPNSSHPHRRPQVLSPAESVHTLLEENSHMEKNTASLP
                     PPSSAPSGDHDDELARLAEHEKALQQLLGEHRPTPAAAPRRASVVPPPPKAKPASLSR
                     RQSTAHEPRVGQLVPLSHKPTPSPPSNTPKDHTQPPTPHASMNEVRNMFEQVSVSAAR
                     PATPAPKRTSLVRASSEMRRSSTWDAAKSPHRTYVHQGTSPGLPSTPVSENPIMLAGT
                     NANVATSDAAARVSTMLAQQRDGGVRLTKPVTREAPTYPATRQRAFPVPKPEPDTSPL
                     DTEPEQAFTGVSALIHKWQTHA"
     gene            <375014..>377287
                     /locus_tag="MRET_3053"
                     /note="MRES_10240"
                     /db_xref="GeneID:38739819"
     mRNA            <375014..>377287
                     /locus_tag="MRET_3053"
                     /product="ribosomal large subunit biogenesis"
                     /transcript_id="XM_027629680.1"
                     /db_xref="GeneID:38739819"
     CDS             375014..377287
                     /locus_tag="MRET_3053"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis"
                     /protein_id="XP_027485557.1"
                     /db_xref="GeneID:38739819"
                     /translation="MPKARPDLGRRLQRARRRNPIRRPEPRATEVTPLMTTAEEVVPV
                     LAKLGMDATAPPIETGDKVWALASIATLLSDDAQHRQLLLSHQVIPRILYALKSDTNL
                     EVRREASGALRNLCLCDDDTQSIFDEMDRHGIVDVVLSVLKWAALGLQSHERRLERAQ
                     APLIQERERLMSKPLDQMNRKERRHMAKLAQGRLPSATAGATAEFGNDAHDALDMHAW
                     GSDAPASLQAMDSAAAQCLVEMCENLVTIISCLCASSEKLGVQVLQWSWTSDSTGREG
                     LAAWLCEALSLGIRACDAEHDAELAKLPECAAALVSLGLASAQALWVLTDPSLGYEDM
                     PSAVSGTDNDRSRGLRRLDILVRASACLATHAAPRPAMLGAAATGALMNVLAVVEVEA
                     LASFVQQDVPTRVTHLLAEANADALKEDARSALEACLDMVSDMARVLPQEEPLSMVSS
                     PLVEALLRLATPSQESSQDNVTASARRGIETRALTALNQVLWHTALHAPPPPSEWPTD
                     DEEALAEIHAWRTHTGSLYLEGGQPCSTPTYEALWHIWQRVFETASFWAGLDSVANAA
                     PEAPLPMSSVAGDGLAQVSTSIGCLWSTARLLEGQLPLVQDDAPAPPVTALTAAYLSA
                     HDASVRVKVLGTLACLARSQFYCREPGSSTPPPAYAQVYLHLASFWADVAGHISDAET
                     LAAFVHAIVDTYADEQAPWDAAYRDSHLHERLCTLVPQYMGVAKRVHRRTDPMLHKAV
                     HESVDTLRAFLSYRQEL"
     gene            complement(<377284..>378417)
                     /locus_tag="MRET_3054"
                     /note="MRES_10245"
                     /db_xref="GeneID:38739820"
     mRNA            complement(<377284..>378417)
                     /locus_tag="MRET_3054"
                     /product="structure-specific endonuclease subunit SLX1"
                     /transcript_id="XM_027629681.1"
                     /db_xref="GeneID:38739820"
     CDS             complement(377284..378417)
                     /locus_tag="MRET_3054"
                     /codon_start=1
                     /product="structure-specific endonuclease subunit SLX1"
                     /protein_id="XP_027485563.1"
                     /db_xref="GeneID:38739820"
                     /translation="MRGSSVAQHRIPRVYACYLLRSLSKPNQTYVGSTPDPARRLRQH
                     NGLVKNGAFYTRMARPWTMDVVVYGFPSKLAALQFEWSWQSPHLSRHLRVCDQPGGSL
                     ATYAGRSAEPLFPATRRTSKSRSGHTRVRQRSTSEPEHKFAVLRALLASEPFCCWDLH
                     VALYSEYAFGVWRYMERAHPDRYQLSRITRRPLPAAYPSLSCDFRGVLGDRAPLTYDE
                     RAAWPRLPEAGVRSVTQKRAGAKGAVKEYVWDEPTPPARDAETMGLSWDEWRAAPTGS
                     ASPVQLDDAARTIEAQAQQACTTTSCGVCHESTENQTYAYCPHACGAVFHLSCLARHS
                     LEREAAARSVRGRIYCLPMTATCPVCHRPPVPWAQVVRRLFSR"
     gene            complement(<378661..>379107)
                     /locus_tag="MRET_3055"
                     /db_xref="GeneID:38739821"
     mRNA            complement(join(<378661..378711,378741..378782,
                     378822..378912,378952..378967,379013..379061,
                     379105..>379107))
                     /locus_tag="MRET_3055"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629682.1"
                     /db_xref="GeneID:38739821"
     CDS             complement(join(378661..378711,378741..378782,
                     378822..378912,378952..378967,379013..379061,
                     379105..379107))
                     /locus_tag="MRET_3055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485562.1"
                     /db_xref="GeneID:38739821"
                     /translation="MGAGPRYPYPKEVWSPSGGWWSRPKNWATNTLVVASGLAVISYG
                     IFKFGAEREWRHQPPIHPIPSQLWARQFREGELKVKSEE"
     gene            <379263..>380256
                     /locus_tag="MRET_3056"
                     /db_xref="GeneID:38739822"
     mRNA            join(<379263..379324,379353..379503,379534..>380256)
                     /locus_tag="MRET_3056"
                     /product="ER membrane protein complex subunit 2"
                     /transcript_id="XM_027629683.1"
                     /db_xref="GeneID:38739822"
     CDS             join(379263..379324,379353..379503,379534..380256)
                     /locus_tag="MRET_3056"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 2"
                     /protein_id="XP_027485561.1"
                     /db_xref="GeneID:38739822"
                     /translation="MSQSAKISVDDAIAWLKQQRITQERNPYEVVRFGEWMLEHNLLG
                     SLGVDVWPFLEQLGMAAAELGNQDLAELCLSRLQARFADSSRVAILKGVIEESYGHLN
                     EAQKLYEDLLTKEPSNVFLLKRRIACIKTKPEGIPRATEALAEFVDIFPTDQESWLEL
                     ASLYLHQNKYPQAAFALEELLLLAPQNAFYLLKYAEVLYTMGELVKAYKLYLRILELG
                     NGNLSPSSTRVVDRVQGPWVRALWGLKMCASKLLSSKAMATSDDSSIKAERVEELDTL
                     ATKLLLESVYAPDAQYPTPESVRSATRSVLTPSSS"
     gene            <380764..>381810
                     /locus_tag="MRET_3057"
                     /note="MRES_10250"
                     /db_xref="GeneID:38739823"
     mRNA            join(<380764..380824,380873..>381810)
                     /locus_tag="MRET_3057"
                     /product="serine/threonine-protein phosphatase PP1
                     catalytic subunit"
                     /transcript_id="XM_027629684.1"
                     /db_xref="GeneID:38739823"
     CDS             join(380764..380824,380873..381810)
                     /locus_tag="MRET_3057"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1
                     catalytic subunit"
                     /protein_id="XP_027485560.1"
                     /db_xref="GeneID:38739823"
                     /translation="MGDNPSTEVDVDNIIDRLLEVRGSRPGKPVHLEEYEIKYLCLTA
                     RDIFINQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQS
                     LETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNC
                     LPIAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDISGW
                     SENDRGVSFTFGPDVVSRFLAKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCG
                     EFDNAGAMMSVDETLLCSFQILKPAEKKQKYAYGGINMGRPVTPPRKQKKKSDRMT"
     gene            <382137..>382789
                     /locus_tag="MRET_3058"
                     /note="MRES_10255"
                     /db_xref="GeneID:38739824"
     mRNA            join(<382137..382240,382270..>382789)
                     /locus_tag="MRET_3058"
                     /product="Wwm1-ww domain containing protein interacting
                     with metacaspase"
                     /transcript_id="XM_027629685.1"
                     /db_xref="GeneID:38739824"
     CDS             join(382137..382240,382270..382789)
                     /locus_tag="MRET_3058"
                     /codon_start=1
                     /product="Wwm1-ww domain containing protein interacting
                     with metacaspase"
                     /protein_id="XP_027485556.1"
                     /db_xref="GeneID:38739824"
                     /translation="MSEKQDNPPSYDASTNKNEDTRPLPDGWVKQFDNNYKQHFYVDT
                     RANPPRSTWIHPIDEQGSSYQPPSGPPPGQSGQRFQQPYPQHQPYPQHQPYPQQMYSQ
                     QPPQVHIHQQAPMMGGGMGGYGGYGGMGGFGRPMGGMGGGLGPGLLGGGVGLLGGMAL
                     ADGMHDMQHDAYMDGYHDGDMNGDMGGGDMGGDMGGGDMGGDMGGDF"
     gene            complement(<382803..>384602)
                     /locus_tag="MRET_3059"
                     /note="MRES_10260"
                     /db_xref="GeneID:38739825"
     mRNA            complement(join(<382803..382826,382855..382939,
                     382969..>384602))
                     /locus_tag="MRET_3059"
                     /product="polyribonucleotide 5'-hydroxyl-kinase"
                     /transcript_id="XM_027629686.1"
                     /db_xref="GeneID:38739825"
     CDS             complement(join(382803..382826,382855..382939,
                     382969..384602))
                     /locus_tag="MRET_3059"
                     /codon_start=1
                     /product="polyribonucleotide 5'-hydroxyl-kinase"
                     /protein_id="XP_027485555.1"
                     /db_xref="GeneID:38739825"
                     /translation="MDEAGTRRVQLPPRSEYRIELDAGEYVAIRFVSDPISGHYGDAE
                     VFGAPIVAGSNERWYTFGNEAKFAITSWGGADLEIYGAASTEYMADEPSHTYTYYANL
                     HLNLERARIRAREQLRTDPSLLQTLDAVDVSEPTKPMSYEEGAESGTDLYRAAGQGPR
                     VMVVGPESAGKTSLIKYLANYAMRSPAVASVREGESKREKTDESDEDGETKAMSEITG
                     WWPMIVTLDPAEGAVPVPGCISAIPLTPTPITWLPSPSPALPYGVTPQTTGALPPSVS
                     TVHSVMPMTLWAGKENMRENERHSRRLVDWLVYYVEKRLVKDLRARMSGLLLDMPGII
                     TADARTRYEFIQYCVRAFKIDTIIVLGHEKLNLELTRIYANDTSGHAPSIVKVPRSGG
                     AVEVDEVYKQKLHDLQIRSYFYGMSPVVPQEPEKNAPAGLDEPLGGVPVLNPYSFTIP
                     FDLLSIYRVGQDRVAPSSALPIGAERTLSEMQVVKLDPVNSPSDLSLLLHSVLALIEP
                     PAALEHHEENAASEETPAKEYNDDELLGSTLLGFIHIADIDMTRKKLTVLSPKPGKLP
                     STTALIGNLQWQDM"
     gene            <384656..>385924
                     /locus_tag="MRET_3060"
                     /note="MRES_10265"
                     /db_xref="GeneID:38739826"
     mRNA            <384656..>385924
                     /locus_tag="MRET_3060"
                     /product="CD2 antigen cytoplasmic tail-binding protein 2"
                     /transcript_id="XM_027629687.1"
                     /db_xref="GeneID:38739826"
     CDS             384656..385924
                     /locus_tag="MRET_3060"
                     /codon_start=1
                     /product="CD2 antigen cytoplasmic tail-binding protein 2"
                     /protein_id="XP_027485765.1"
                     /db_xref="GeneID:38739826"
                     /translation="MKRKANEGALRASEKRAHLDENILGDLDMEAHAARQQKLRRGGV
                     VTQGYESDESDNDSGVPHRRAKQETEDEENDDDDDDMFAEPKEESSRKEKRFLKLSDI
                     EGQEFGAGTHMDGDDDDEGEEDSGLIHDQDPEYELEQALKSTQHEDANADAERTPPGS
                     PGKDAQRVKKQGMGFRMESFNMKAEMESGQFDEDGNYIRNERDQFSQNDRWLEGNYSK
                     KSIRAAHEAQRRREQAEIEREKQQDAEFPTMEHAMKQLAECLMPGESVLDALQRLGAA
                     SKRSTGETKAIAQFETLTHVSGTLMSHFGQMNIYDEVYESLVRLVRRAKIVAEDWDPS
                     RMLNEEHEAPSAHTGSLWEYKWTPAYLGLMAKAHDQSVDPETRIFGPFSQTELTEWAQ
                     QGYFGANKENISVRKIHTHDWSTWHDAGLP"
     gene            <386008..>386535
                     /locus_tag="MRET_3061"
                     /note="MRES_10270"
                     /db_xref="GeneID:38739827"
     mRNA            <386008..>386535
                     /locus_tag="MRET_3061"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 2"
                     /transcript_id="XM_027629688.1"
                     /db_xref="GeneID:38739827"
     CDS             386008..386535
                     /locus_tag="MRET_3061"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 2"
                     /protein_id="XP_027485525.1"
                     /db_xref="GeneID:38739827"
                     /translation="MVSEVWRTLSRIFRIGRARFIVGYDLNKNVYYELPSLHGDPKRT
                     RRLIQWNKAIAYPSDFNPKDIPIQWDAWMRHTRKYPPTIEELVRDRERQMIVQHNARV
                     LEMRYEAERAQLESERESDHAEAIRAQTEREMHRIESIRAMETFTSDQDVDSPPSEKS
                     GIQSATIQPSRRRGG"
     gene            complement(<386605..>388702)
                     /locus_tag="MRET_3062"
                     /note="MRES_10275"
                     /db_xref="GeneID:38739828"
     mRNA            complement(join(<386605..388622,388654..>388702))
                     /locus_tag="MRET_3062"
                     /product="transketolase"
                     /transcript_id="XM_027629689.1"
                     /db_xref="GeneID:38739828"
     CDS             complement(join(386605..388622,388654..388702))
                     /locus_tag="MRET_3062"
                     /codon_start=1
                     /product="transketolase"
                     /protein_id="XP_027485523.1"
                     /db_xref="GeneID:38739828"
                     /translation="MSFNPTDLDTKSIATIRTLSADVVANAKSGHPGAPMGLAPLAHL
                     LWSRVMTADPKDSRWINRDRFVLSNGHACALLYIMLHLMGYKLSMDDLKAFRQLDSLT
                     PGHPEANHTDGVEVTTGPLGQGFANAVGLAMAQANAAAAFNKDGFELFNNRTYVFLGD
                     GCMQEGVASEAASMAGHLGLKNLIAFYDDNHITIDGDTNCAFTEDVGKRFESYNWNVL
                     TVKNGDEDLSALWDAIVKAQQEKERPTLVCVQTTIGFGSLNQGKASVHGAPLKEDDIA
                     QLKTKFGFNPEEKFVVPHDVRDAYKSYADRGAAKHAEWLKLFEEYGKKYSKEYEEINR
                     RIAQKLPEGWEKALPTYTPNDKPMATRKLSEIAITSIAAQLPEMLGGSADLTGSNLTR
                     WSDATDFQNPTLEIGQYSGRYIRYGVREHGMGAIMNGLHAYGMHIPTAGTFLNFVTYA
                     WGAVRLSSLSQFQVIWVATHDSIGLGEDGPTHQPIETAAALRALPNMDFWRPADGNEV
                     SAAYKIALESRKTPSVISLTRQNLPQLEGSSIEKASRGGYVLVENTDADITLVSTGSE
                     VSICCDAVAKLAERGIKARIVSVPCFRVFDLQPYDYRISVLPSGNPIMSVEAYSTFGW
                     GVYSHVHHGINTFGVSAPYQKAYEKFQLTDHDVADKAQKVVEYYKKLGQVPSPIAIQA
                     ALELQQ"
     gene            <388991..>390808
                     /locus_tag="MRET_3063"
                     /note="MRES_10280"
                     /db_xref="GeneID:38739829"
     mRNA            <388991..>390808
                     /locus_tag="MRET_3063"
                     /product="2-isopropylmalate synthase"
                     /transcript_id="XM_027629690.1"
                     /db_xref="GeneID:38739829"
     CDS             388991..390808
                     /locus_tag="MRET_3063"
                     /codon_start=1
                     /product="2-isopropylmalate synthase"
                     /protein_id="XP_027485524.1"
                     /db_xref="GeneID:38739829"
                     /translation="MDPGSKYQPYTPVHLPDRQWPSKIQRTAPIWTSVDLRDGNQALA
                     SPMNEEQKIIFFKTLVKCGFKEIEVAFPSASDTDFGFVRRIIEDGLIPDDVYIQVLSP
                     AREELIRRTFEAVKGAKNVVFHMYNAASPLFREVVFNNDQARTVDLAVRHTKLVRELM
                     EHYSKPENGGTNFRYEYSPETFSQTEPDFAIQLCDAVREAWGLASPGNKIIFNLPNTV
                     EMSPPNHYADLIEYFCRNIKHRDSVIVSLHPHNDRGCGVAAAELGMLAGAERVEGCLF
                     GNGERTGNVDLVTLALNLFTQGVQPGPLMFTDLPSVIEVVTGCNDIPVHPRHPYAGEL
                     VMTAFSGSHQDAIKKGFAAQEKRWNAGDKQWLMPYLPVDPADLGLTYEAVIRVNSQSG
                     KGGIAYLLTQALGVELPRRMQVAFYQVIQAVADQTSKEISTDDIVQAFSKHYHVPIAG
                     VPKTDGRFKLHSFRLYDGDESTEAEPLNGTSTPRVRKLVGKIVHNGETVDVTGTGNGP
                     ISALMDAIEKHFNIFVNVREYSEHAITRPGALDLGSAATSSHSQTRAQAASYVELVKS
                     EDTRQFGEQKAKGFWGAGVDVDITSAGLKAVLSALSTVD"
     gene            <390920..>391708
                     /locus_tag="MRET_3064"
                     /note="MRES_10285"
                     /db_xref="GeneID:38739830"
     mRNA            <390920..>391708
                     /locus_tag="MRET_3064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629691.1"
                     /db_xref="GeneID:38739830"
     CDS             390920..391708
                     /locus_tag="MRET_3064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485521.1"
                     /db_xref="GeneID:38739830"
                     /translation="MLSKDVIEEWVTPYAEALGLPYFPRHVVTIFRSMMLWWSIQLLS
                     HGVSPYLFPKAFANMPARKRTSWDVHIVSLVHSSIVAPLLLYYWLNIDENTDRLYGYR
                     FQVGQLYSLSFGYFVWDVIVSLRYEGLDFIIHGLLGLSGNIFVFKPLLMFGGMGIIMW
                     ELSTPFLNIHWLLDKLGLTGSLLQFVNAMCLLLSYVTVRMIIGVSESYKIVTLLWSPA
                     ADTLALPYKLYYTLGLLVLNALNYIWFFKMLHAMRKRFLPAKKE"
     gene            complement(<391715..>393189)
                     /locus_tag="MRET_3065"
                     /note="MRES_10290"
                     /db_xref="GeneID:38739831"
     mRNA            complement(join(<391715..393010,393039..393073,
                     393102..>393189))
                     /locus_tag="MRET_3065"
                     /product="SET domain protein"
                     /transcript_id="XM_027629692.1"
                     /db_xref="GeneID:38739831"
     CDS             complement(join(391715..393010,393039..393073,
                     393102..393189))
                     /locus_tag="MRET_3065"
                     /codon_start=1
                     /product="SET domain protein"
                     /protein_id="XP_027485522.1"
                     /db_xref="GeneID:38739831"
                     /translation="MDAALHAYIAQASPHHAAHSKVAVSSSVEAGRGLVATCSYKPGE
                     KVLVVPPRALLNPVQLTRGRRVSWTPLQAADSRRNAAPLSTHQLLACVLAMWHAQHQH
                     VSSISPMDAFLLSLPTQFDTTPLTWALDGKASLLDALPPSATHKHRMVQARYEADWAR
                     VRALDKVTLASIWSCISFIPEPPPIDEHDFIWGWLCVNSRCVYMDLHYAKHEDNFTLA
                     PLLDMANHTKHPKKECRVRFSSMDGLELYAPLEASLQEGEEVCITYGLHDNATLLTEY
                     GFVLPHHVGEDDRQKQANHWHGNPHAGVWLDEAVEHMVQSQGEAGAWKRSLLQQAGYW
                     GDYTIHPCPAPAHPSHRLHTALRLLCMDVDFHAQEHGGLHARLSTNPRTQSAYTPQDA
                     ERVWRLVMQGRREQVSASNEQSVRDMVISLCDDITSGHATRLDNLKGADNVSASMVRA
                     LLEEECHIASLVKASTERADPW"
     gene            <393296..>394303
                     /locus_tag="MRET_3066"
                     /note="MRES_10295"
                     /db_xref="GeneID:38739832"
     mRNA            join(<393296..393344,393372..>394303)
                     /locus_tag="MRET_3066"
                     /product="peroxin-19"
                     /transcript_id="XM_027629693.1"
                     /db_xref="GeneID:38739832"
     CDS             join(393296..393344,393372..394303)
                     /locus_tag="MRET_3066"
                     /codon_start=1
                     /product="peroxin-19"
                     /protein_id="XP_027485519.1"
                     /db_xref="GeneID:38739832"
                     /translation="MSEPRATTADDVDDLDDVLDEFDAVTKSEVPDGAETSMSESLDK
                     DKGGAEESAEDPLSDEFVEELTKNMESFMEHLGKHMSDGKEPKLPPRPPSTSHTETSG
                     GVPPAEDELMKQFEKLLSGNMEGLDKGASDDTSAQQTEPPSEKSFQDAVQATMNKLRQ
                     SNASANTQSKGADDPFAALGLDGNADISKMLEALSQPGEDGEASLSKVLAQMMEELMN
                     KDVLYEPLKDMHSRFPSYLASSAAGSIDTETREKYVSQQTIMGDILAVFESPQYSDSN
                     VELRKKVSDLVSRLQDLGTPPQELLGDMPPELAGINNMLGDGGDENCVLM"
     gene            complement(<394296..>395684)
                     /locus_tag="MRET_3067"
                     /note="MRES_10300"
                     /db_xref="GeneID:38739833"
     mRNA            complement(<394296..>395684)
                     /locus_tag="MRET_3067"
                     /product="palmitoyltransferase ZDHHC6"
                     /transcript_id="XM_027629694.1"
                     /db_xref="GeneID:38739833"
     CDS             complement(394296..395684)
                     /locus_tag="MRET_3067"
                     /codon_start=1
                     /product="palmitoyltransferase ZDHHC6"
                     /protein_id="XP_027485520.1"
                     /db_xref="GeneID:38739833"
                     /translation="MAQDATHDAPSDQRGEDEKDAAEQASWLASGSPALARPKAPPET
                     MDIVWVTGVVLLMMFLHISPQVFIIWPYFERTETFTALQLAQLLVIFNLLILYMYYTY
                     YCCVVSDAGGVPMGWRAPDGCTYTRYCFKCHAYKPPRSHHCRVCKRCVLRMDHHCPWI
                     GNCVGHGTYAYFLQYTTAVVIATTYHLTMITMRVFDAWNKYWYVSYPTTTEAVMLVLN
                     YLFCIPVFLLVTFLTLYHYYLVSTNTTSIETWEKDRVYRQIRRGYIPYTSFPYDVGCW
                     SNVASVMGPSIWLWAWPKSQTGDGLTYPVHTQQDPFAQYAWPPKDPHARRAIKSHRPT
                     HPTGRTGTHADQWLRHRNHVSPDVVYDSYSSEGEEEDDDKLEYAPSTHARIRRGSEGY
                     EVMPPHYSRALWADQGAAAFPPGTTPPPELQAQERPYTDYPHGTFVDYGMHAYDDDVP
                     LATLQDTPPVAT"
     gene            complement(<395718..>399476)
                     /locus_tag="MRET_3068"
                     /note="MRES_10305"
                     /db_xref="GeneID:38739834"
     mRNA            complement(<395718..>399476)
                     /locus_tag="MRET_3068"
                     /product="myosin I"
                     /transcript_id="XM_027629695.1"
                     /db_xref="GeneID:38739834"
     CDS             complement(395718..399476)
                     /locus_tag="MRET_3068"
                     /codon_start=1
                     /product="myosin I"
                     /protein_id="XP_027485526.1"
                     /db_xref="GeneID:38739834"
                     /translation="MVISKRAGGRKHATSGPPPVVNRGIAKADWREGFKKPQAGVSDM
                     TLLTQITNEAINGNLQVRFANAEIYTYIGNVLISVNPFRDLGIYTDDILRSYRGKNRL
                     EMPPHVYAIAESAYYNMLAYKENQCVIISGESGAGKTEAAKRIMQYIAAVSGNSTASA
                     GIHNIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIMFDTQGSPVGAQITNYLLE
                     KGRVVGQVRNERNFHIFYQLTKAATPQQREAFGLQGPEAYAYTAHSQCLDVPGIDDHA
                     DFAAAFQAMQTIGLSEDEQMSIVRMLASILWLGNVYFAENAQGDADIGNADVTDFCAY
                     LLGVDPTAVQRALTQRIMETQRGGRRGSVYEVPLNPTQAAAVRDALSKAIYNNLFEWI
                     VSRVNQSLQAHGQASTVIGVLDIYGFEIFENNSFEQLCINYVNEKLQQIFIELTLKKE
                     QEEYAQEQIQWTPIKYFNNKIVCDLIESKRPPGIFSTLNDAVVTAHADSAAADNSFMQ
                     RTSMLASNPHFEARGSKFLIRHYAGDVMYNVQGMTEKNKDALLKDILNLVDSSSNAFL
                     VGLFPDRPDPDSKKRPPSAGDRIKTSANLLVDNLMQAQPSYIRTIKPNQNKSPSEYDT
                     QAILHQIKYLGLQENIRVRRAGFAYRNTFEKIVQRFYLLSPATSYAGDYIWQGDARSG
                     CERIFIDTGIARDEWQLGVSKGFIKNPETLFALETMRDRYWHNMAMRIQRAWRAYLWR
                     REESARRIQRAWRRSREGYEFLEMRDYGHQLLSGRKERRRFSLVSMRRFMGDYLDVNG
                     SSAEGRMLRACAHLSAGEHVVFSARAQLLVSRLGRTSVPSPRFLLLTPRGVYLLVTHL
                     VNKRPQTTCERMIPLSTIQDVSLSHLRDDWIVLKTGMDEGDPLLHCDFKTEFVAWLLQ
                     QSGGRTHVTIAPQIDYLRKGRKKAHVSFRKDESLVSGDVYKSSVVSVGSGEPPNSVSR
                     PPAKKLPRSTQAASTRRPGTRAIPARRPVPVARVPVPTPAAAPAPLPAKRTVPAPPPA
                     QDGLPAYLQAPPAPAARSSSGVPSYLSPTSQSAVAPPMPSYLSGAAPALAPPVTQLGS
                     LSQATPSAPPAAPTPAAPAPSMPARPAPVSRLPRYRALYDFETVEPGEMPLTKGDIVE
                     LEDKEGHGWWLVKKNGVEGWSPADYLELVPEATKSRPPPPPAKPPVSAKPATAPKSTT
                     QPVPSWSPADAHAAPMAVMPGMGDPGGFAAVLARKKAERAAAEAQPPP"
     gene            <399590..>400306
                     /locus_tag="MRET_3069"
                     /note="MRES_10310"
                     /db_xref="GeneID:38739835"
     mRNA            <399590..>400306
                     /locus_tag="MRET_3069"
                     /product="acyl-protein thioesterase responsible for
                     depalmitoylation of Gpa1p"
                     /transcript_id="XM_027629696.1"
                     /db_xref="GeneID:38739835"
     CDS             399590..400306
                     /locus_tag="MRET_3069"
                     /codon_start=1
                     /product="acyl-protein thioesterase responsible for
                     depalmitoylation of Gpa1p"
                     /protein_id="XP_027485527.1"
                     /db_xref="GeneID:38739835"
                     /translation="MAMSALRTVVVPPTGGGFPSATVFLLHGLGDSAQGWLDVARMLG
                     RNQALQHVRFVLPTAPTQPVTVNMGMSMTSWFDLYSLTDLEQGEDEAGMLSSVSSVMK
                     LVEQETDGSAPGLNGHRVPMSRIVLAGFSQGGAIAQLLGLTSKERPAGVAALSTWLPL
                     HKKISSLRASQQTYPFFQAHGTADPMVDYEFGRRSFEAVQNDLGFGHQAEWHEYQMPH
                     SACPAEITDLAAWLERVLGL"
     gene            complement(<400315..>403647)
                     /locus_tag="MRET_3070"
                     /note="MRES_10315"
                     /db_xref="GeneID:38739836"
     mRNA            complement(<400315..>403647)
                     /locus_tag="MRET_3070"
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /transcript_id="XM_027629697.1"
                     /db_xref="GeneID:38739836"
     CDS             complement(400315..403647)
                     /locus_tag="MRET_3070"
                     /codon_start=1
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /protein_id="XP_027485536.1"
                     /db_xref="GeneID:38739836"
                     /translation="MIFEPHEGVDGVSLSVPELRHDSSAELLGTSQSGPLEDSMYEGG
                     MSPTSHKRPADVAVSDVLPTKAARDTVPTKQKSTRGARACTNCHRLKMKCEVKNDGGP
                     CLRCARSGHECIFLESNRGRKSDKHRKTASMQQTVKKMEQVVESVLETLHETNSSSPE
                     TDAAYAVPLGSVGEAATQVGLSPAVVDMLVVRVRDLIYSTSGTIKYTHSRSAIAGETV
                     KFMQQMGMLEGTKNTTQWLDSSQDGFIARIIRAATLGMRPSTYAMMEDAAPPKRGAES
                     IKATHLPPLPDNSLNPLGLFAEASLHNWRMQQQAGSTCDGSQASTSRASAHGGNPGPR
                     SLADKNAAPEEEHARKRRSVQFGVANDTYFHRSSMSAPRASENGADAPPELLREGIVS
                     SEEALELFRIFFHHCSLHIYLLDPEWHTPTAVCSRSPFLFTCVCAVASKFYLRRPDLY
                     VSCQRRAIKGAFDVLSRGYKSPEIVQGFLLLTLYNQPVERYEEDRTWLFAGIAIRMAQ
                     ELNMHRKCVMPPEARADEATMRHVLNCERTWYICFCVDRTLSAQMGKPYSIREDYLIR
                     HAPDWCVQELSRPWDLGICALVDLLRVQTRQLDFLYSSTLTPSGLHVGLNYPAILPTF
                     NEQLSETMQFWYRQGLDSFTGTFPLPSRPHDAATVAPPQHAGSETQAQAAMAPRAEHD
                     MHGKVPASDAADKHGPCAPTFLPTLNHAITNLDRAGTADAPRVSAWMALHETSPPAEN
                     ADLATRSMYYIARQAPLRYNYAVLVLNSFGLQYALERPSDFASADKPQYLARCVHAAK
                     EIISTVMYGMREILRYAPDPTFVTVAYACVFLLKLIQPMFARYIHEDEILVLVTHTIE
                     VLEEAAVDPSHTPALYASFLRMLIQSRLEQRSREGTERSSVPDMQHANLPEHHQLNSA
                     LPSSSAGVRDPTLVPPNEPSMTVNPHQVNPVAAELASREKVASPATPAHLRRTSPSVD
                     VSKRAAATPSNQPPFRHENAALAAPAPVPGDLPPKGADIPSATHEPFAEHGWDAAQYA
                     KAQGVEVNRVLDDSFWTSLLPPGYGGGGSMGHSGAGSAGIFELSRDSDLFKPSSQWGS
                     GRTALTPGATRASSPTLLHMPF"
     gene            <404069..>404359
                     /locus_tag="MRET_3071"
                     /db_xref="GeneID:38739837"
     mRNA            <404069..>404359
                     /locus_tag="MRET_3071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629698.1"
                     /db_xref="GeneID:38739837"
     CDS             404069..404359
                     /locus_tag="MRET_3071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485491.1"
                     /db_xref="GeneID:38739837"
                     /translation="MAMRPVDLLAEFVLTLRTQTIESQLRWFSNGRRSRFGGCTFAYG
                     TSTVRYWRYTVYIPTLHHTRPTHIQSMLAERPYTRGERKDYFADMCPSRKAW"
     gene            complement(<404371..>404758)
                     /locus_tag="MRET_3072"
                     /note="MRES_10320"
                     /db_xref="GeneID:38739838"
     mRNA            complement(join(<404371..404452,404496..>404758))
                     /locus_tag="MRET_3072"
                     /product="large subunit ribosomal protein L34e"
                     /transcript_id="XM_027629699.1"
                     /db_xref="GeneID:38739838"
     CDS             complement(join(404371..404452,404496..404758))
                     /locus_tag="MRET_3072"
                     /codon_start=1
                     /product="large subunit ribosomal protein L34e"
                     /protein_id="XP_027485494.1"
                     /db_xref="GeneID:38739838"
                     /translation="MAQRLTLRKRNPYNTRSNRRRVVKTPNGEHRYLHLKKLPTAPKC
                     GDCHMKLQGVKSLRPRAYATVSKREKSVQRAYGGSRCAECVRTRVVRAFLVEESKIVK
                     NVLKSQQAKASQ"
     gene            <405129..>405938
                     /locus_tag="MRET_3073"
                     /note="MRES_10325"
                     /db_xref="GeneID:38739839"
     mRNA            <405129..>405938
                     /locus_tag="MRET_3073"
                     /product="large subunit ribosomal protein L6"
                     /transcript_id="XM_027629700.1"
                     /db_xref="GeneID:38739839"
     CDS             405129..405938
                     /locus_tag="MRET_3073"
                     /codon_start=1
                     /product="large subunit ribosomal protein L6"
                     /protein_id="XP_027485493.1"
                     /db_xref="GeneID:38739839"
                     /translation="MIPMRRFSCDTSMRYYTGFRCFFRSIHTRREPVRLPETTTLSIL
                     DFPPQPRPTRPLSSLMRKAKTLVFNGPKGEVVVPLHYFVNMSWGAVPDSKIRTITFSV
                     EDENARVQRSIWGLTRALCANAIKGVEEGHVVTLRLVGVGYRASVEPDPLPRKHPFEV
                     ELERSRGHWYAPEQKQTEMDRIKRLIESSGANERLHMRLGFSHPVLVPIPYGIKAVCE
                     TPTLIKLQSVDKQLLGQFAQSVRQIRKPEPYKGKGVFLNDEQIKLKTPKKK"
     gene            complement(<406006..>407695)
                     /locus_tag="MRET_3074"
                     /note="MRES_10330"
                     /db_xref="GeneID:38739840"
     mRNA            complement(join(<406006..407385,407411..407503,
                     407531..>407695))
                     /locus_tag="MRET_3074"
                     /product="E3 ubiquitin-protein ligase synoviolin"
                     /transcript_id="XM_027629701.1"
                     /db_xref="GeneID:38739840"
     CDS             complement(join(406006..407385,407411..407503,
                     407531..407695))
                     /locus_tag="MRET_3074"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase synoviolin"
                     /protein_id="XP_027485488.1"
                     /db_xref="GeneID:38739840"
                     /translation="MPRFEAASLLSTPVLIAYGICSAIAFVAMLYKARREQLDIFMAS
                     AWIYQSNGCLLILSNFICFSLVLMMRIMQKLFLGPLGRQEVQSVRESVTMHVFDLFIT
                     TSAGMFSSNLLCFYFGCLIFVVSLLQTLCRVRIETIGQMTALPRLAHARMIGLFVCLQ
                     LMEFILIPSVILLLPQDLGPVGIMTQYFILLCASQVNLWALVALYHCEARARQMGDAW
                     EEKSLYVFYIEFARDIFMLLVYPICVVFSLFYVPQTGIIFVPFGTIRQFIMLAYSVYK
                     NATKYMRFSAATRDMDSKYPPLSKEEIDQLRDKTCIICREEFDAETQNQADTPRKLPC
                     HHVFHFRCLHSWLERQQNCPTCRRDVFRAPPQAEQPQERVARIRSQGSPAELDDANDS
                     ATLSSLLARFTQPAEGAASSSHDTPAPPPAATQDPREAMRQAVLKRFDQKPQPPSTQP
                     PVLIPLFDPQSVPDFRTRVEPNLPHTLVDWAKSVSSTPTLDEEQLSHVTDAQLRKRLQ
                     LLQETQQTLQNAIAQIQEALAPPVPEEKGKAPARSHE"
     gene            <407901..>409826
                     /locus_tag="MRET_3075"
                     /note="MRES_10335"
                     /db_xref="GeneID:38739841"
     mRNA            <407901..>409826
                     /locus_tag="MRET_3075"
                     /product="NAD+ kinase"
                     /transcript_id="XM_027629702.1"
                     /db_xref="GeneID:38739841"
     CDS             407901..409826
                     /locus_tag="MRET_3075"
                     /codon_start=1
                     /product="NAD+ kinase"
                     /protein_id="XP_027485487.1"
                     /db_xref="GeneID:38739841"
                     /translation="MSEVKYTSNNPPSITGIMRRGEKDFHRDFPDACAQYERDQNMID
                     IHPHDGDRLQYLSQRLAQTSISVREMYKQLYHARVQSSAQSILIITKARDNHLVLLTR
                     ELSIWLMNYKKQGSKRGLVVYVDEQLRHSKRFDVVGIERDYPHFFLPTRDDTSIPKHQ
                     CLDSDEGQLRFWKSDMCSSSPALFDLVITLGGDGTVLLASWLFQSSVPPVIPFSLGSL
                     GFLTPFRFEDYESIMRSALSNGVRLSVRMRFRATVYRAIDHVNPELGAKRRRALQSDN
                     AETMLHNIKTCGWYCVEMEPGSDGMEEAPVFHDQQVHTFRTRPVESFEFLNDLVVDRG
                     PSPYVTMLEVFADDTHLTTAYADGLCISTPTGSTAYSLSAGGSLVHPQIPAMLITPIC
                     PHTLSFRPMLVPDSLELRIAVPHNSRSNAWASFDGRGRVEIARGDHIKITASPYPFLS
                     VLPEDKNESWFDSVSRTLNWNQRKHQMGFMVYDGQASSSKAPQELSPKVTPSMLAQQD
                     QVTYDVLRDSRELNEHVAEDDEEDDEEIFDIDDTATPSTADSSHRASWESSSFGVSRP
                     LLSVPVSESQPDLSPQAPLPIPSRDQPRSSGFGWIRSPDRYGPSGPPPAPAPLNERYL
                     ATVDFRLQNRSLKGPGP"
     gene            <410170..>411345
                     /locus_tag="MRET_3076"
                     /db_xref="GeneID:38739842"
     mRNA            <410170..>411345
                     /locus_tag="MRET_3076"
                     /product="zinc finger protein"
                     /transcript_id="XM_027629703.1"
                     /db_xref="GeneID:38739842"
     CDS             410170..411345
                     /locus_tag="MRET_3076"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027485490.1"
                     /db_xref="GeneID:38739842"
                     /translation="MSPPHIIGVPSPSQCDPTYGSARPVSLPGIRDVLGNELCLDDIP
                     SKPHNGFFVSDTRLNVSNRPISSSHFHTYSHVTPNIQDKSPRLATPKMTSARDDPFLG
                     SSSNSMANLPTILQRMRMEDDHYDHKDVWLHHHAPEYFYRPSMPKSWDICMHGTQMKR
                     VSSNDRMVTSRRLSGRSRDIYSRSMPRLGALNLSESQASTPINIPGTKEESYHPRTLT
                     RSFSSYSTASGTSEGFPYTPKMGMSDVLTGDGRELGTEMTPSKPSNHIPQLILTENGA
                     SERQDLTPHVFFKNGHASPDQRSQDSPFGPLMNISVTKQKSPSAHLGKFQCNYCMKRF
                     SRPSSLRTHIHSHTGEKPFRCDVPGCGRCFSVHSNLRRHQKSHSTSMLPTPSNDLPA"
     gene            <411560..>412543
                     /locus_tag="MRET_3077"
                     /db_xref="GeneID:38739843"
     mRNA            <411560..>412543
                     /locus_tag="MRET_3077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629704.1"
                     /db_xref="GeneID:38739843"
     CDS             411560..412543
                     /locus_tag="MRET_3077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485489.1"
                     /db_xref="GeneID:38739843"
                     /translation="MSHDAVKPTKSLFPSKSHVLRRKDATTVVKQTKSIQGPDKTVVV
                     NQTSTSYATPSNLPSTHPSVNESNDSGTPAGPVAGGVVGGVVGLALLLAAAWFLYQHI
                     KKKRNTRALDDMYAETGMGGGGVDRNARMRGNQDTMPVSHSWETGAPIHTEEDLYYAP
                     SAMPQDVSQTAFASPVHVNQLNTDAGKPTVVSFPPSASMYEAVQTHSASAMPEDMYIN
                     ADEPSSVMPAYVQEAEQAVEENPQRSALVSETTNQPMTSRLAPGSLSVNTSHLEGQTN
                     LTEDDKSPLSMYMWLPSHKVAGITSPNQSIRTSPAGTSAPDDFVPASEHPS"
     gene            <413069..>415036
                     /locus_tag="MRET_3078"
                     /note="MRES_10340"
                     /db_xref="GeneID:38739844"
     mRNA            <413069..>415036
                     /locus_tag="MRET_3078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629705.1"
                     /db_xref="GeneID:38739844"
     CDS             413069..415036
                     /locus_tag="MRET_3078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485497.1"
                     /db_xref="GeneID:38739844"
                     /translation="MMWPEPGYKFLSSLAAVAHKHGITVEDSDSLELVLRAMGDELRS
                     ARLRKELVRSPLPALLLQILQKANLSERTEALRVAANLCIDNSESRLILLEVDIIPTI
                     VRGLTESLSESTPILQQIRWTLVTIGAMLNMQMDCVPVKHALLDCGTIPQTFNALARI
                     LALDLKDPETHAVSVQAMEWGLRLLDDILTDEEAHTYAWTPHDAEVLFRVLQVWSELD
                     SRYLLDTEGMEHRISIIESGCSILDHETKNSTFCTAVVDCENLDILRLLLHMVHETVV
                     PHQDSSDLTDNEEPHVSSTHHVFGHLKKAATHTIVALAGEDANIDRLCPLSDGRLTHP
                     NFFLETLYAWTSDVHGDSKKAVCAVLALGNLARGHTRSVELASQPHLLYHMLQQMILH
                     PNDMHIVYAVIRAAGNFAIPDQNKSILVSSDIVTHACAYLAPEHDVKSPIQSGVLVLL
                     KNLISSSSKPFVALELLGCLSDTSKNVLEPLEDLWHRTDDTTTQLRIARIYVALLRSV
                     FGSDKGEESMHRLAEESAMLSTKLDAAYKHAEGKLCCPSVVKALCHLLCHSQQHTVLQ
                     NEGLLGLIFLIRSTYADAFIAETIFQVSSSPPGGMFACVMEALLYIFRTAPAQVASNA
                     YVLWLLLEKDERASEWRARIEDAWSKCAHQM"
     gene            complement(<415238..>416044)
                     /locus_tag="MRET_3079"
                     /note="MRES_10345"
                     /db_xref="GeneID:38739845"
     mRNA            complement(<415238..>416044)
                     /locus_tag="MRET_3079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629706.1"
                     /db_xref="GeneID:38739845"
     CDS             complement(415238..416044)
                     /locus_tag="MRET_3079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485496.1"
                     /db_xref="GeneID:38739845"
                     /translation="MSALMQVHTFKPESLGTIEIFGTSLSTKTQALLIALAECNVKFI
                     HHPSLPNSPEIAYFSPFGTIPVLVHRPNGMYSTRDAVVLFDMMAICQYLSELLCSMDT
                     QKTFCLMPKVENEHSRNFADSVVLRSTVIQLNNIVSSFIQTVVEDRYVKPYFALRNNG
                     ASQEDISMALSENFYNAMDALIQLENMIKKTQERLQITPETHFILGKEPTWVAVFLFP
                     ILRDFRATNPKTVLTGGSQERLPLLANFLQAFEIRHSAVSTFRGSFAASV"
     gene            <416385..>417230
                     /locus_tag="MRET_3080"
                     /note="MRES_10350"
                     /db_xref="GeneID:38739846"
     mRNA            join(<416385..416413,416452..417035,417064..>417230)
                     /locus_tag="MRET_3080"
                     /product="phosducin family"
                     /transcript_id="XM_027629707.1"
                     /db_xref="GeneID:38739846"
     CDS             join(416385..416413,416452..417035,417064..417230)
                     /locus_tag="MRET_3080"
                     /codon_start=1
                     /product="phosducin family"
                     /protein_id="XP_027485444.1"
                     /db_xref="GeneID:38739846"
                     /translation="MSHASQDTEFNDALRAHGIIPPKKPSRSPSPDVPTESERRERSR
                     MQATVADLDEELETADDDEERILFRLRQQRMQELSSSAKMARFGRVYPISRPDYTREV
                     TDASKEDISPAGTDDSRKGTGVVCFLYHPSMDTSKLLAGYLDTLAAKHPATKFVSIVG
                     SQCIPNYPDHNLPTLLIYRNGELRRQIVGLRPEIGLDGLRTTLADIELLLTAVGAIDK
                     PASGEQNSRSKHSDEEGEEEKHARSNTRGQDDDDDDDLDWD"
     gene            complement(<418121..>420098)
                     /locus_tag="MRET_3081"
                     /db_xref="GeneID:38739847"
     mRNA            complement(join(<418121..418138,418165..418296,
                     418323..>420098))
                     /locus_tag="MRET_3081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629708.1"
                     /db_xref="GeneID:38739847"
     CDS             complement(join(418121..418138,418165..418296,
                     418323..420098))
                     /locus_tag="MRET_3081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485759.1"
                     /db_xref="GeneID:38739847"
                     /translation="MPAHSSSRQASLSEHDRLLPSEDFNDVAADLLAFESSSGSEYDD
                     VDIDGEAERALDHHRIPWILQQNQMPPSPQLDSRQEYQSWPEQDAPSKPALRLPFSWN
                     PEWFLSSGNVFWGFHRQRRRPASRYGTLNHSLSWPSPAHFAQQRDTSRPLRPVGFRSQ
                     GMLRPAQSQDSLQQARPLSPALSRPRAALEHAFRPTSKVIDDLLNHGPRRVLVLTWIP
                     VLLVLCWCGVPFPAHGNEPMKNDAAFWFFLVWYFGIYVAVALVFITQLFTLYRLNWWP
                     RAIGARVSYAFFWVMSLFCGYIIHKCTPSRPQDDPSSIARPDNQEWQLKTEWVLLTFA
                     TMSMPALVCLMGLRRSGRQHYRPAMTDVQKPFASIAETAWRIPSSYRRFLWFMCSLGL
                     SLVTLLAGQVYTIVFMRTLPHSGADGTLYVAFWMLTVHILSALVQWIMSEKVRSRALL
                     FAFKFYYFLVYFIFYRNLFARLRSFDQFALVQLLSSTWVCLWYPFCMSQTWLRTLNLS
                     SSRPISHDMHVKKISLYFYLRTVAQHTTMLAFLGWLSLLHFGINQPLYPFFAFDDDDS
                     YNYRLTIIGSLAIWASEMASNFLTTLLCRAVYRVHMADLGLTEMRLYPELVPTLVWIS
                     LHVLMNMLFFLIKLDVT"
     gene            complement(<420214..>421761)
                     /locus_tag="MRET_3082"
                     /note="MRES_10355"
                     /db_xref="GeneID:38739848"
     mRNA            complement(<420214..>421761)
                     /locus_tag="MRET_3082"
                     /product="glucan synthesis regulatory protein"
                     /transcript_id="XM_027629709.1"
                     /db_xref="GeneID:38739848"
     CDS             complement(420214..421761)
                     /locus_tag="MRET_3082"
                     /codon_start=1
                     /product="glucan synthesis regulatory protein"
                     /protein_id="XP_027485760.1"
                     /db_xref="GeneID:38739848"
                     /translation="MVRQFLATLKEFFGPDPRILAASQRDEILGNDTPISALHGTQSV
                     SQLSHGAATESRVSLPVFNSGVRQGSQVVRAWQRIQLFCEEQYEELRDTLNWPAKAET
                     LNALQHGIGRALPQAVCEWLLCCDGQEIESYASCSDGLFFGLPFLGSDAILREWRFWR
                     LVDKDERTVNNPDLNKRMASCPPGWVRKRYSCPDWIPLISDGLGNYIGVDLSPDPNGE
                     GKPGQVILFGRDFDTKMVLYGCDGPDGWAKFLVIFADELERGTSFVLGEVHDEGSGED
                     GIGYESYFASSGDRAGEGSVQFRLKGLYAGWPVMESWFDRSARAWERIGYPISRSASV
                     HHAITEDAGDISTSSTHDPMDPLHSKSPIRKRLPRASPATSMPRESSWPEIKKQNSLS
                     PTPVRVRRSVVPKPAPLTDLPTIDDVRAAEASEMSQRAHGLSRFGSFRKSSRRTSAYM
                     NMPAPATTVDMEEPMEMSLRPVASSLDVSMAEAPSATIDMSGDISTQLNQAPNMQRST
                     AQLLNTS"
     gene            <422043..>424343
                     /locus_tag="MRET_3083"
                     /note="MRES_10360"
                     /db_xref="GeneID:38739849"
     mRNA            <422043..>424343
                     /locus_tag="MRET_3083"
                     /product="mannosyl-oligosaccharide glucosidase"
                     /transcript_id="XM_027629710.1"
                     /db_xref="GeneID:38739849"
     CDS             422043..424343
                     /locus_tag="MRET_3083"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide glucosidase"
                     /protein_id="XP_027485545.1"
                     /db_xref="GeneID:38739849"
                     /translation="MVLSSWLWACLMLATVFAIVTHAESTLWGTYRPQLLFGLRPRMP
                     QTLLTGFMYYSPTSIQGGAPTRHLASVNPGPDYFRWKYHDGRNFGIQEIVDHEHNYLL
                     ETSFVKSGHQDGAPGHWGIRIRGTVLDDSKPANIVTYYYMGSENSRFPFYVTEQGEAR
                     CSVLGGVSMRTQDAPENRPLEGFERMAYAALSVDVRETWRGQDIILEEHIRQKQESLK
                     RPTDALDHHMVFSNRTESNTTFFAVQKAFEGNFSYDIFLDSGSSSPDAKLHPENLTHL
                     LASYKKEHDEHFESRFGLIKSGMHANHVEAAREITSQLIGGIGYYYGESLVDRRPLND
                     SGMYLHDMHGAMPKPEGPHSLLTATPSRSFFPRGFYWDEGFHLLHIGAWDAELASMIF
                     GSWTHLMDKNGWVAREQILGEEARSQVPREFQTQYPQHANPPTLIFGLNSMLDEYHSR
                     VKEAQEDLEGVNYIQRADLGDMDRMHKKLESLYPHWKRHYEWFRRTQRGQIRQWGREA
                     TSRYEAYRWRGRSPTHVLTSGLDDYPRASTPHIGELHVDLLSWMGLFASSMAQFAETL
                     GNDDDALEYRQQAEDIAANVIDLHWNDEERLFCDASVGHDDESYFECHPGYVSLFPFL
                     TQLLKPESEQLSATLDLLSDHDALWSPHGLRSLSKAHPLFGEDEDYWRGAIWLPINYM
                     ALRALHHYSQGSGKNADRCAILYTDLRLNIIHTVLDEYERTGYTWEQYDEETGHGRRN
                     HPFTGWTSLVVLIMAEKYHTTYPTLS"
     gene            complement(<424300..>425334)
                     /locus_tag="MRET_3084"
                     /note="MRES_10365"
                     /db_xref="GeneID:38739850"
     mRNA            complement(<424300..>425334)
                     /locus_tag="MRET_3084"
                     /product="dynamitin"
                     /transcript_id="XM_027629711.1"
                     /db_xref="GeneID:38739850"
     CDS             complement(424300..425334)
                     /locus_tag="MRET_3084"
                     /codon_start=1
                     /product="dynamitin"
                     /protein_id="XP_027485761.1"
                     /db_xref="GeneID:38739850"
                     /translation="MSKYTGLPDIDTAPDVYETHPQKEGARFMSDDDDDRESNTDAAT
                     TSDAIDTHSVNATQAAEKFRSTYLTPESYELHGTAGGTESTLARYMRLEHEVRELERI
                     LTARQGDTSTTPSMLAQLQTLERRIQRMRDDARHADPRDLTQAMIDALQQVPEPVSAQ
                     SAPSATHMSAWDERLTALESRLGVQALQSDVPLADTIHRLEQQMQLLTQPRHLDTIIA
                     RAKAVCSELEHVDERRRHFANDDDEALAQVRELYALQSRIEPLEPLAPALLARLQTLA
                     PLHSAASEFHTSLSQVEARQTTLQARHADLHTLLQKLEQSMQENQAIMQRNLQSLMTR
                     LDTLCGTSPP"
     gene            complement(<425400..>427043)
                     /locus_tag="MRET_3085"
                     /note="MRES_10370"
                     /db_xref="GeneID:38739851"
     mRNA            complement(<425400..>427043)
                     /locus_tag="MRET_3085"
                     /product="RNA-binding protein"
                     /transcript_id="XM_027629712.1"
                     /db_xref="GeneID:38739851"
     CDS             complement(425400..427043)
                     /locus_tag="MRET_3085"
                     /codon_start=1
                     /product="RNA-binding protein"
                     /protein_id="XP_027485762.1"
                     /db_xref="GeneID:38739851"
                     /translation="MSARVELYAWGHSDSDERSRSPSPVLSMQDTSSSTPPSSRSSID
                     ERGHRDLMRWNDRFPVTTQPSRDVILLGLDADVNADMMRTLVTALANMVDARLAPPPQ
                     DVTVIRDRNNGTSKGFGFVKFSTLEDAKRFVYLHAPFISNPDTWLGPVKQTGLRRKRI
                     KIDFSNSERPQGGLSYYEQHNAPDSKDQLKKARARRAKLMAGAVPAHQQMDLANENAG
                     LRDASAFPTDMLLLTNVRLSETASSIGAVLCQASSAMEQVLLLRSRSTKESTGRVFVV
                     LRDSDAAKAMLVTLRDRQKGYLSLLGDSVKTSYADAIVMEEADPFDPTNAAHVFEDRC
                     GRTWRYEDESLGLDLWKPEDMLPTSAPSSTSSSVSEAHTPPPAHGPLVSHAPPVATAA
                     PEPIMSHGTSYYMPQPAMIAPKPPPMSQHAVLRMLNFSDASRRICVLCQRQFRSMDML
                     HRHTEESALHQANLNDEAACRAGAARMLSMPSNVKENVTATPLPPPTMMLPTFEKNEA
                     KVLGMRPALQQVGWNASPTQAWTMPSFSIPLVASSWPAM"
     gene            <427273..>428697
                     /locus_tag="MRET_3086"
                     /note="MRES_10375"
                     /db_xref="GeneID:38739852"
     mRNA            <427273..>428697
                     /locus_tag="MRET_3086"
                     /product="RAM signaling pathway protein domain protein"
                     /transcript_id="XM_027629713.1"
                     /db_xref="GeneID:38739852"
     CDS             427273..428697
                     /locus_tag="MRET_3086"
                     /codon_start=1
                     /product="RAM signaling pathway protein domain protein"
                     /protein_id="XP_027485763.1"
                     /db_xref="GeneID:38739852"
                     /translation="MSETRARRVPVPTLTDTPRTNGLKKLNLPTVGATQAAADAAAAA
                     MSSPPSLSRSDRSVSIADSETADAERTRYFRRYSSLPSVPSMPKPVLKFVDASRGVLF
                     ALSQMYSAITQYTSVSTDERLVAHFSRMLSMSVKSMSVLINALDRLDAVSCAGMPEPV
                     LVRHVLQACHDALRTFRRAVTMLHIQLPQLGQTVDPRFSRTLLLLLYGSVAELRNSAM
                     LMAPHVRDVVPFLDKHVSYATVDASTSVSSHRTARQPSQADVSFEETAEISQPASSTP
                     LKKCPQRLGLPTNSVRSPGVSPREIPKPDASARGPLSPGTVSSASTRMRMLSSNTSGG
                     EDGLLQLLLQVTDNAMQIWSELGDYVQAGMEQGHEEEQDATRIKRLRDVNESCASMMD
                     MTKRLQWTRDRASDANLRTSQADMHDLWEQCNQFVRATIHISTLVRAVSVTYPFPRDL
                     MRAMGDLNQGCAALAVHLHQLSPS"
     gene            <428835..>433328
                     /locus_tag="MRET_3087"
                     /note="MRES_10380"
                     /db_xref="GeneID:38739853"
     mRNA            <428835..>433328
                     /locus_tag="MRET_3087"
                     /product="transcription elongation factor SPT6"
                     /transcript_id="XM_027629714.1"
                     /db_xref="GeneID:38739853"
     CDS             428835..433328
                     /locus_tag="MRET_3087"
                     /codon_start=1
                     /product="transcription elongation factor SPT6"
                     /protein_id="XP_027485764.1"
                     /db_xref="GeneID:38739853"
                     /translation="MAEEARERTPADERVAPHSDEEGEDLMKESGNIVGMDSSDDEDD
                     DDDEEEQRRVAEGFIVDENEEDEEEGGESTHKRKRRHRHRELDEELDEDDLALLSENT
                     RPEGARHKRARPAGEEERTNELAHIFDDEDDGAQQADYFDDGLDDFIEDDEEDAEMSG
                     LNEEEREARRREKREDRRRARMSGARVDPRKAGMDLEAWDEVHDIFGNGEDYAWALEA
                     DDEHAEEAKARMDYKDIFEPAQIRERLLTEEDDRIRQVDVPERLQLLIPGQEGLALLE
                     RKLTDAELDDAAHWASTRISPRCTAEFLEDYAPHARLRAEWFACVRQMLAYMLNDMLE
                     VSFLTQHRLDELEYTPMDAVQKTTTTLLVRQELLTLYTLGIKFKLLLARKDSLRQTFA
                     ELSAAAFAGPDVDMSEVHATVEELLAQASTLEEVTDISEWLAMRFGERFREATVLAKG
                     HEGHTLKRPTVLSEYEQRKSTPLAQLAQRLGLSSSQLADNVASGVRQHVPEDESRLPL
                     EVADEYAGLAPGAGNASTAMALARSILAHEISKEPALRREVRTLFRLSALLDVEPNER
                     GMTRIDEAHPYYNFKFLRGKPVSAVLQNASQFLQMVHAEEERLVHVTLRLPTDTASKL
                     EQRLQEQYVSDGVSALSQAWNEERRAVVEEVCASFLLPLGRAWAREWLVEECRESLLR
                     HCEQRLTQRVEGGPVQSAGMLSRQRDPNWDEHVSRVPRVLAVSHGSGDPRTSQIVAVS
                     LDEDGHLIERATFDSLRAPLVQDEEADDPRAGFVELIKRRHPDVVVVNGFSARSQDLK
                     MTVKSLVDAAFDERVREEGLEGLAAQHLRMDVVSVYDDVARLYQHSARAADEFPELSV
                     LARYCVGLARYAQSPVNEFAALGADVTAVQFDPAQRLLPADRLRASLERAIVMLVNDI
                     GLDLQTALTNTYVQHMLPFIAGLGPRKAQALLNGIRTRLDGIVVNREVLVRRGILTFV
                     VWNNAASFLRIDQDAAADAADEDAQPDVLDATRIHPEDYDFPRQMARDALNKHEEDLE
                     GEHPSVACAEIMEDARPSEKLAALDLDNYAAMLWERRGLRKRLTLLTCKQELIRPYDD
                     WRPPQLLPTAEELFMMFTGETRRSLAEGYVVPVVVTRIEEGRDIEGLLRVRLEAGMDG
                     VIAGRDIMPGYNSRDVRLRRLFRSGQALNAVVVHLDIQRMRAELSLRAEAFEHVNPAQ
                     GRTPVDAMYFDHERAQMAIDAAEERARRRHQNRIGRRVIDHPNFHNFNAIQAQNFLAT
                     QPRGSVVVRPSSRGMDHLAVTWKVDDGVYQHIDVLELDKENDYALGRILRVADMGSYA
                     DLDDLIVNHVRPMASMVEMMMNHEKYKGADEQALHTYLTNVSLANPTRSVYAFGLNKQ
                     HPGYFDLAFKANSQAPIQTWPVKVLPGAFKLGQATQLADVAALTNAFKTQYMAQTSGG
                     RGDRTSAPHGGMTPGYYYGGRTPGRGGTTPGYYGGATPSYGTMPAYGHPPPPRGPPGA
                     SRW"
     gene            <433680..>435605
                     /locus_tag="MRET_3088"
                     /note="MRES_10385"
                     /db_xref="GeneID:38739854"
     mRNA            <433680..>435605
                     /locus_tag="MRET_3088"
                     /product="phospholipase C"
                     /transcript_id="XM_027629715.1"
                     /db_xref="GeneID:38739854"
     CDS             433680..435605
                     /locus_tag="MRET_3088"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027485757.1"
                     /db_xref="GeneID:38739854"
                     /translation="MFITKAFAALAAFVAVAVADEYSLKDIKHIVLFMQENRAFDHYF
                     GTMAGVRGFKDPNVHISNNTGKSVFHQPVDAKKIKASSRPTDDTSELMPWHLNWQGGD
                     WKNRTQCMLTGSNSWKANHAAWNHGQIDQWVNANTPYSIGYYRREDVPVHFALAESFV
                     VGDAYYESAIASTHPNRAIHLTGSLNSNGSAVGGNPQELGGPVVDNTATPGCLYSSDG
                     VPYSCRPLKWKTLPEYLLEAGISFMAYQDFDNFGEDTLVSFTQYQDAAQRKQKLAKVG
                     VSFPGLEKFYKDAEEGNLPEVSIIFVPEYLSEHPPYMPDDGAWLHRKVTESLMHGKHW
                     NNTALIVSYDETGGWADHVLGPIASRDTPGEWMKDPFTPSNGLQPIGPGFRVPFYIAS
                     PFTRKGGVFTEHAAHESQTLFIEEWAKANGKPFHVKEMNHWRRQQLSNLVNAFDFSKI
                     DTSIPNIPSVRTPSKDPIRDQYNGAFVCQLKYRNTIQPHVPYGKQKEEDALKVERGYK
                     PVRGHLSEGRYLRFEADHGHVLSWKDENKLTTKKSDSKYDEDTLFVLSWLGSEPKDNR
                     FNVANMKRDKFFTSDLKLTSDRRSAAKFALVDQGNGKGHSIVEEQSKKHISVDKNGEI
                     SLKDGDATMFKTFSVTL"
     gene            complement(<435653..>437870)
                     /locus_tag="MRET_3089"
                     /note="MRES_10390"
                     /db_xref="GeneID:38739855"
     mRNA            complement(join(<435653..437552,437577..437639,
                     437671..>437870))
                     /locus_tag="MRET_3089"
                     /product="histone-lysine N-methyltransferase SUV420H"
                     /transcript_id="XM_027629716.1"
                     /db_xref="GeneID:38739855"
     CDS             complement(join(435653..437552,437577..437639,
                     437671..437870))
                     /locus_tag="MRET_3089"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase SUV420H"
                     /protein_id="XP_027485758.1"
                     /db_xref="GeneID:38739855"
                     /translation="MEEITADDDLLSCMLVDSLEFEPDIVTHKMNPAFRPMRFDRHAV
                     KKIVQQNVIWEQNVSKGMEKFCELPIVRKHMCLKTPAQKRVFENHIQRYLQTYLPDAG
                     FEYAITYRYRTARLERVKALEKVSDEGRYNAYLSPNRTDLCVMALRPYHPDEIITYCT
                     AALKDLTPEDDQALRDEAAEARDKDVRDGHARPPRDFSVIRSSRRKCSQLLLGPARFI
                     NHDCRPNAEFRRTGQTLTIRCIRNIQCNEEITTYYGDNYFEAGNKECMCTTCERLGRG
                     FFRCTGANDEQECRESDETKASQKDTRKLRSSSARAAAEQAAISEPDHIMAFQVNPDA
                     NGPNCECLTCHSAFRAPEKWWTPDECARCERHYKLFKCDWPYRSPKENPADQTSRSRT
                     RIRPPRPSKKPQPAPAISSPVKLSPVREKPCYDSSSSESGSPRLEQRCRKPSDTSHEL
                     HKAPRILGQGASTDVLASYWGAPEGERRRRRTNLSMDKHSDVTRQNTTSKKQKTSVTC
                     GKDSSDDKMMQNNTSDAEVSCVSKRGCRPPFREASDMQDKFSRPESPVKPVIATHGPE
                     RTSVSNLALFWSGGVEGRTRRQARLAQQASVTPPRIRKTADEAAEARKPEVKPEPSPI
                     QPTVKREHTLEALTVQQHSLGTPVSIPANCHPTVVPPGVPVRQPLRRNLRWGSGKVST
                     SRETSHTPPVRVSWPSTMKHESASPITTASPSTSPSPS"
     gene            complement(<438123..>439352)
                     /locus_tag="MRET_3090"
                     /note="MRES_10395"
                     /db_xref="GeneID:38739856"
     mRNA            complement(<438123..>439352)
                     /locus_tag="MRET_3090"
                     /product="26S proteasome regulatory subunit T3"
                     /transcript_id="XM_027629717.1"
                     /db_xref="GeneID:38739856"
     CDS             complement(438123..439352)
                     /locus_tag="MRET_3090"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit T3"
                     /protein_id="XP_027485714.1"
                     /db_xref="GeneID:38739856"
                     /translation="MEEIGIVPADTHASSSNSRGSFSASKPKDVYYHYKKLQQQLEFL
                     TTMEEYVKDEQRNLKRELVRAQEEVKRIQSVPLVIGQFLEPIDQTTGIVGSTTGSNYV
                     VRILSTIDRELLRPGSSVALHRHSNSLVEVLPPESDSSIVMMSQSERPTETYQDIGGL
                     DVQKQEIREAVELPLVQADLYHQIGIDPPQGVLLYGPPGTGKTMLVKAVANATTASFI
                     RVVGSEFVQKYLGEGPRMVRDVFRLARENAPSIIFIDEIDAIATKRFDAQTGADREVQ
                     RILLELLTQMDGFDQGSNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPNRREKRLI
                     FQTICGRMNLSPDVDLEDYVSRPDKLSCAEIASVCQAAGLQAVRKNRYVVLPGDFDEA
                     FKQISKKGDDNRLDFYQ"
     gene            <439807..>440739
                     /locus_tag="MRET_3091"
                     /note="MRES_10400"
                     /db_xref="GeneID:38739857"
     mRNA            <439807..>440739
                     /locus_tag="MRET_3091"
                     /product="pyrroline-5-carboxylate reductase"
                     /transcript_id="XM_027629718.1"
                     /db_xref="GeneID:38739857"
     CDS             439807..440739
                     /locus_tag="MRET_3091"
                     /codon_start=1
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="XP_027485713.1"
                     /db_xref="GeneID:38739857"
                     /translation="MSHPQRESSEMTMAVLACGTMGTAILSGVLDFQLSMENGDNSKD
                     LAATSQHGESFERVPLPKKYIATVGRDSTAKRLASTFSEAGHSNVEVFQQRNVEAVRR
                     SDIVLLCTKPQRVSEFMSEPGMKEALENKILVSIAAGTTINTIQKVVPPSTKVVRAMP
                     NTPCRIREGMTVISDVTWLTHLERDLIATIFSAVGKCNFLDEKYFDAATALAGSGPAF
                     VTLFLEAMTDGGVMMGLPRAEALELAAQTMQGAARMVLESGTHPAAIKDSVTTPGGCT
                     IAGLLQMEDGRVRSTVARTIQTAAEHAAGLGKSS"
     gene            complement(<440766..>442202)
                     /locus_tag="MRET_3092"
                     /note="MRES_10405"
                     /db_xref="GeneID:38739858"
     mRNA            complement(<440766..>442202)
                     /locus_tag="MRET_3092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629719.1"
                     /db_xref="GeneID:38739858"
     CDS             complement(440766..442202)
                     /locus_tag="MRET_3092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485712.1"
                     /db_xref="GeneID:38739858"
                     /translation="MSRCDEGVVRTLFDEHGGDTLTAKDILDVMDSYTAKCGAPIVDG
                     EVALQITTFARENSSLAIGVDEFLSMIRSLENETDSSTDDGSNASLFEGKQGSATPDT
                     TLDSVAPESPAKHRSAFAPRTPMPLPASTSRIISKVPVTSSEPDVAGITARSALIRKL
                     ARVNEQLDRLHSDHQILSHEKKLSDATCTSLQREIYGLRRDLEQAHSHGFTLESRVHE
                     LEASITQIKEDRDTQRRSARQLDTHLQQQMASFSDLEKQEAEHVAQLTSLQATCQAYV
                     TDLHGLRATCDAQREAISGLEGIIHALERVHSDAEQLQQEVDHSRKIHEQLEQELRAL
                     HDVSEQPGPVLAEDLAPFGEWTSSPEEPVSDVHDHVAPTPSTAPAPDSPTGTLTHAAE
                     AQTAHNSTHDTPPARLLWSLMVHLLLVTTGIWLGLWIYHFSMLIMPAHVYQQLLDKRW
                     FEANMLDDALQTPLSTTLWQEHYVSRFS"
     gene            <442308..>446660
                     /locus_tag="MRET_3093"
                     /note="MRES_10410"
                     /db_xref="GeneID:38739859"
     mRNA            <442308..>446660
                     /locus_tag="MRET_3093"
                     /product="endosomal peripheral membrane protein"
                     /transcript_id="XM_027629720.1"
                     /db_xref="GeneID:38739859"
     CDS             442308..446660
                     /locus_tag="MRET_3093"
                     /codon_start=1
                     /product="endosomal peripheral membrane protein"
                     /protein_id="XP_027485711.1"
                     /db_xref="GeneID:38739859"
                     /translation="MPQRIALELQALVAETRRKYPDVRQSADHLLAQWQADADRTVSE
                     LQSCKDPSSHALLQMIVLACETRSPKVIQLALSLLQSSIPLRILPDTSLATVIDTLHT
                     LLSAPGRTDVDVQLKILQIVSSLLVTYANVTSELLSRALMLCFTLYEHSRVVVVSSTA
                     AAMLRQNVMVVFEKVQSEDQSFDAIQNEDAAVNAPLPVGTAELPSGPVTLFPCAADVY
                     HLLNDLCALADGQPAQFLPLDTLSKPFVLELLESVLTTQSSLFQRHPELVYILRSAAC
                     PFLLKALSKPPASFSVYIRVMRLVALLLCEYHKEIVLEVEMLLRALLDTLDEKHALWQ
                     RVLAWETMRSLSADSAFLTFLWDQFDGQAEPICVLGRLVECVQQFSRRLRSTLVVDDA
                     LAAALEQRPDVPHTPTMHSTHTMYDVAMAGMRSAAEGLLSSKAEMLVETSEPHVPLLD
                     QLDKTDAPVPGSSALPTTYLPCLVLQSLVRLSHNLAEAQQAAIFAAYTRPINEGLTVF
                     LTVQGADLFFEQTLDALVHMACAAGVAQCATERDLILATLCDLAVPSAAYSGQALGTR
                     NLGAQAALAYVCASLGQHLGSRWRALLQCVCQALVCLRKGDDETVHTPAETLRWPDDK
                     PSWLAPSTIESLGRLLRGVFVSAANLDHEGMDTFAGIFTQLIADRSRGTHDATSHMML
                     IEWERFVRAAAPRIVERMPEGPWSSMHVLMRLLWDERMTPVRRIDIAQVCDACIYTLW
                     CTPLMDNGEQPQEMLRALARQGILERRTGSTDVSVRNAALSTLHRILESQVHMLRRTS
                     YGWEHVFAMCEAAAKDASAIRASGAAPMPLLRTAFACMQSVCASYLPMLNDAELVLCI
                     NALPSFSMQTEDVAMALQANGTLWDLTESIERRDREQAVELWLVLLQRLRDVAQVPQA
                     NMAECALANLFQVLLQYHLSFRAEDWIRVLSDVLLPLVEGEHAPARAFHGTARVVAMV
                     PALRTDPAWPAMWARWLHAMEETVAREPSDDVMRVMLEALHSVLHLQDDTQAWWHEAW
                     PTVLRLCDTQARMSMPDLGLLADMLYMLFVKRSRVDESASMLHALHSCMRRGLSVADA
                     LSLSHLRELVRHVQASFDFLATQTTVRPKVLDELVRCTDMAYAASLHAKHVRMQALYT
                     ELTGEWMAQWLRILEQEAGTPDACLASMLRVLVRPLKACPEPGVPSAWCVVCRALVRI
                     AEYGTEVETEEYWHTLFDAMATAMCADAHSMPTDEEDACALHLLACLEHVLPKAGAQQ
                     AAQPALTQFLPRALEATHLYAAWGTLTQPCQPTPRERMVYETWHVLFRQCSSTSTPGG
                     KAIAVRLLPMIVARCQCILQAFMDDARIRGSIPLPRVRVEEANFLLRALLTLRAPTHV
                     YQGHAYAADAHLFVLSHVLDDIATARADACLQIAHVGTSLPPIPPAIPANSPDTCPQA
                     LAAAGVARRTALLT"
     gene            <446805..>448469
                     /locus_tag="MRET_3094"
                     /note="MRES_10415"
                     /db_xref="GeneID:38739860"
     mRNA            <446805..>448469
                     /locus_tag="MRET_3094"
                     /product="cytochrome p450"
                     /transcript_id="XM_027629721.1"
                     /db_xref="GeneID:38739860"
     CDS             446805..448469
                     /locus_tag="MRET_3094"
                     /codon_start=1
                     /product="cytochrome p450"
                     /protein_id="XP_027485257.1"
                     /db_xref="GeneID:38739860"
                     /translation="MLWHICWLALAAPATVITVYVVCALTYTQIRWHQWLRDVPGPAR
                     ETWLMGNLRTFMYRDIGAVCRAWTQTFGGAVRFWGTFGEPRLMLMDPVAFDYVFRKRA
                     YAFPKMRISQRLIASFMGNGLIVSEGMDHRRQRRAIQPGFQARNIKRLAPVFQEHVYD
                     AMDYLDTCLQRSETALVDMYATMSAATLDALGDGALGVKFGTLASLRSDPNGAVCEAH
                     PLTAALERAQFIASHPGWFTVMVDILSMYFPALEHIPVGLSSRAFRRATRVLFDLAGK
                     VVDDAKARIKAGEPSPDILSALLRANANAERDAEEKRSILDRNVLTDAELHAQVSTFI
                     FAGHETTSTQLAWLFLFLAQDQTRQQTLRRAIVEKRASLGLAPQAGSTGDRALSEEEL
                     DDIPYLDWCIRECLRLQSAVHTTSRVATETEWIPLSNRKHVQVHPGMVLLFPLSAFMT
                     SEAYWGPEPDAFRPERWSEPLPGRSVIPAHHGLSFLMGPRACIGSSFAILEMKVFIAS
                     ILPSFHFEWDGRPIVPKMWPVARPLDAQRGVDACVLQIRRISRSGE"
     gene            <448491..>448892
                     /locus_tag="MRET_3095"
                     /db_xref="GeneID:38739861"
     mRNA            <448491..>448892
                     /locus_tag="MRET_3095"
                     /product="Yqey-like protein"
                     /transcript_id="XM_027629722.1"
                     /db_xref="GeneID:38739861"
     CDS             448491..448892
                     /locus_tag="MRET_3095"
                     /codon_start=1
                     /product="Yqey-like protein"
                     /protein_id="XP_027485508.1"
                     /db_xref="GeneID:38739861"
                     /translation="MFVQTLRTASWRRLLHTSRIALGDVPARPPSGPNPLDEPTLANV
                     KQKWKQARLAKDSELATLLGGILTDLQYAQKTKMQPNQKPPSIIKMLQKGIKKRTDAA
                     KVFRQAKPAPRVDLAEKEEHEVRILQDLLPK"
     gene            complement(<448923..>451473)
                     /locus_tag="MRET_3096"
                     /note="MRES_10420"
                     /db_xref="GeneID:38739862"
     mRNA            complement(join(<448923..450914,451132..>451473))
                     /locus_tag="MRET_3096"
                     /product="F-box and WD-40 domain protein MET30"
                     /transcript_id="XM_027629723.1"
                     /db_xref="GeneID:38739862"
     CDS             complement(join(448923..450914,451132..451473))
                     /locus_tag="MRET_3096"
                     /codon_start=1
                     /product="F-box and WD-40 domain protein MET30"
                     /protein_id="XP_027485709.1"
                     /db_xref="GeneID:38739862"
                     /translation="MDPQPTQHSALSKVNAGNPSVQGNVAVPQDAAAASQLEQDSCSC
                     SPKMMPTDMTNVPQRLYGYEMLDREASRENEKQADGSSSTDVVRLLSRSENLCVRHQR
                     MADEGANARLQKSIDGLSYDEKKAVNTVWSLFSSSPHSRRALILRGILTMCCFSQLSL
                     LSSELAMAIRIDPFTLFPADVSLRVLGYLDAISLGRAAQVSKLWRSLADNDLLWRNMC
                     EQHIERKCEKCGWGLPRLIDSHGHAENTESSRDDELRQAASTVSDGSLRRSITAAANA
                     AALERRKSYSDAAEHTHASSAVEGPRQKRARTETNQAHSRRWKAVYCERLAIERNWRY
                     GRYCVRVLRGHTEGIMCLAFREKVSHLPYPVMVTGSYDRTIRVWNLQTGETLRVLSGH
                     ARGVRCLQFDDSKVISGSMDRTLKIWNWRTGELLRTLEGHTEGIVSLTYNDRVLASGS
                     ADSSIRIWNCQTGECFPLNGHRDWVNALQLWTAPSHGSSNPSMFLYSASDDFTIRLWD
                     LQTRECLMVFQGHVGQVQSLKLVMMNQSTVQKLARGSMRVSGATEGGVVGSSYREDGD
                     ASTMPTSAQTSLGDSTSQASDRIPSRLLKAHERLCAANLVPPLPPYATLRDLEDGIFD
                     DVLDETEAGTQKTGCKSKRPVLVSGSLDNTLKLWDVRTGRCFHTLFGHVEGVWCVDCD
                     TLRIVSASHDRTIKVWDRDTAQCQITLVGHRRAVTTVALGDDKILSGSDDGDVRVWSF
                     CTPEDAKPMPTSTSTHIQPCTVVSPPPPIPPTMNAQM"
     gene            complement(<451822..>452503)
                     /locus_tag="MRET_3097"
                     /db_xref="GeneID:38739863"
     mRNA            complement(join(<451822..451876,451919..452130,
                     452390..>452503))
                     /locus_tag="MRET_3097"
                     /product="large subunit ribosomal protein L26e"
                     /transcript_id="XM_027629724.1"
                     /db_xref="GeneID:38739863"
     CDS             complement(join(451822..451876,451919..452130,
                     452390..452503))
                     /locus_tag="MRET_3097"
                     /codon_start=1
                     /product="large subunit ribosomal protein L26e"
                     /protein_id="XP_027485708.1"
                     /db_xref="GeneID:38739863"
                     /translation="MVSSLRRVNRKAHFDAPGHIRRKIMSAPLSKELRSQHGIRSIPI
                     RKDDEVTVVRGASRGSEGRIVQVYRAKWVVHIERLQKEKANGATVAVPVHPSNVVITK
                     IRMDKDRKNMLARKSGKSAEEIQA"
     gene            complement(<452766..>453591)
                     /locus_tag="MRET_3098"
                     /note="MRES_10425"
                     /db_xref="GeneID:38739864"
     mRNA            complement(join(<452766..452771,452810..453144,
                     453176..453241,453271..453331,453366..453424,
                     453477..453495,453568..>453591))
                     /locus_tag="MRET_3098"
                     /product="GTP-binding protein SAR1"
                     /transcript_id="XM_027629725.1"
                     /db_xref="GeneID:38739864"
     CDS             complement(join(452766..452771,452810..453144,
                     453176..453241,453271..453331,453366..453424,
                     453477..453495,453568..453591))
                     /locus_tag="MRET_3098"
                     /codon_start=1
                     /product="GTP-binding protein SAR1"
                     /protein_id="XP_027485260.1"
                     /db_xref="GeneID:38739864"
                     /translation="MFIINWFWDILAQLGLTHKNAKILFLGLDNAGKTTLLHMLKNDR
                     LATLQPTLHPTSEELAIGLVKFTTYDLGGHQQARRLWKDYFPEVDGIVFLVDSQDVER
                     FPEARAELDSLLSIEELSKVPFLVLGNKIDAPGAVSEEELRQVLGLFQTTGKGSVPLK
                     DVRPIELFMCSVVMRQGYGDGFRWLSNYI"
     gene            complement(<453761..>455068)
                     /locus_tag="MRET_3099"
                     /note="MRES_10430"
                     /db_xref="GeneID:38739865"
     mRNA            complement(join(<453761..454624,454651..454734,
                     454764..454999,455047..>455068))
                     /locus_tag="MRET_3099"
                     /product="glycogen synthase kinase 3 beta"
                     /transcript_id="XM_027629726.1"
                     /db_xref="GeneID:38739865"
     CDS             complement(join(453761..454624,454651..454734,
                     454764..454999,455047..455068))
                     /locus_tag="MRET_3099"
                     /codon_start=1
                     /product="glycogen synthase kinase 3 beta"
                     /protein_id="XP_027485715.1"
                     /db_xref="GeneID:38739865"
                     /translation="MNGIKIQGMDDPTKVVRVLASHGKTGEQQEIAYTSCRMIGNGSF
                     GVVFQARLVHYRPDGTEVPSSDIPEGQDNVAIKKVLQDKRFKNRELQIMRVLSHPNVV
                     DLRAFFYTSGEKKDEVYLNLVLEYVPETVYRATRHYTKVKQTMPMLLVKLYMYQIMRS
                     LAYIHSLGICHRDIKPQNLLLDPRTGVLKLCDFGSAKVLVPGEPNVSYICSRYYRAPE
                     LIFGATNYTTNIDIWSTGCVMAELMQGLPLFPGESGIDQLVEIIKVLGTPSREQIRTM
                     NPNYMEHKFPQIRPHPFPKIFRPHTPADAIDLITQLLQYTPQARLTAVEALCHPFFDE
                     LREEDVILSNGRPMPDLFNFTREELSVRPDLIKRLVPSRVEESLRQQGIDVNHFDPIP
                     LESLRVKLD"
     gene            <455321..>456385
                     /locus_tag="MRET_3100"
                     /note="MRES_10435"
                     /db_xref="GeneID:38739866"
     mRNA            <455321..>456385
                     /locus_tag="MRET_3100"
                     /product="urease accessory protein"
                     /transcript_id="XM_027629727.1"
                     /db_xref="GeneID:38739866"
     CDS             455321..456385
                     /locus_tag="MRET_3100"
                     /codon_start=1
                     /product="urease accessory protein"
                     /protein_id="XP_027485501.1"
                     /db_xref="GeneID:38739866"
                     /translation="MSQAHYAEGRAVLRRDVPLEELGAPQFSHLEFTFPLRLLAPRGA
                     SEDATVNAAKHDTTSPVKKCVGILFMVSFGGGLVSGDFVRLNVDVGEYTRLLMLTQGS
                     TKVYKERRGGDLPQQVLHVSGPKEVSRQCIHYTVRENATLVLLPAPVTCFARSRYAQV
                     QRFDLMSSATSSLVLLDWFTSGRLAVDHERVPEFWHFYLYHSRNEVSIDGHVIARDRQ
                     HLAQELPETLSETTDLARRCEPYTCFANVLLYGPECTALCAALTKEYSQIQQPQPFLR
                     SSGSRGQVTPPDVVWSLSPLCSGAPVPGCDYRADTFSDKGLVVRIAGTKTDIVRVWLY
                     EHLQLVRHMIGADMYRVALG"
     gene            complement(<456386..>456995)
                     /locus_tag="MRET_3101"
                     /note="MRES_10440"
                     /db_xref="GeneID:38739867"
     mRNA            complement(join(<456386..456899,456925..>456995))
                     /locus_tag="MRET_3101"
                     /product="U3 small nucleolar RNA-associated protein 24"
                     /transcript_id="XM_027629728.1"
                     /db_xref="GeneID:38739867"
     CDS             complement(join(456386..456899,456925..456995))
                     /locus_tag="MRET_3101"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 24"
                     /protein_id="XP_027485500.1"
                     /db_xref="GeneID:38739867"
                     /translation="MGKKKQVRKFGEVKRLLNPKDTRLKHNQKEQAVAQASKEESKKR
                     HKELAPSSMFFQHNAALGPPYRVLVDTNFINFSLQNKIELVQGMMDCLYAKTIPCITT
                     CVLSELEKLGPKYRIALRVARDPRFERLECTHKGTYADDCIIERIKSHKCYIVATCDR
                     ELRRRVRQVPGIPLMYIARHRYRIERLPDQGAPT"
     gene            complement(<457358..>457747)
                     /locus_tag="MRET_3102"
                     /note="MRES_10445"
                     /db_xref="GeneID:38739868"
     mRNA            complement(join(<457358..457539,457570..>457747))
                     /locus_tag="MRET_3102"
                     /product="translation initiation factor 1"
                     /transcript_id="XM_027629729.1"
                     /db_xref="GeneID:38739868"
     CDS             complement(join(457358..457539,457570..457747))
                     /locus_tag="MRET_3102"
                     /codon_start=1
                     /product="translation initiation factor 1"
                     /protein_id="XP_027485503.1"
                     /db_xref="GeneID:38739868"
                     /translation="MSIQNLASYDPFADVGDDPAPEDIVEEKKKTSQANSYVHIRIQQ
                     RNGRKTLTTLQGLPKEYDQKKLLKAFKKEFACNGTIVDDEELGQVIQLQGDQRQKISM
                     FLIEEGIPKQDVKVHGF"
     gene            <457894..>458418
                     /locus_tag="MRET_3103"
                     /note="MRES_10450"
                     /db_xref="GeneID:38739869"
     mRNA            <457894..>458418
                     /locus_tag="MRET_3103"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629730.1"
                     /db_xref="GeneID:38739869"
     CDS             457894..458418
                     /locus_tag="MRET_3103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485502.1"
                     /db_xref="GeneID:38739869"
                     /translation="MVRHDKRSVVKHRTRGSEPHKKGGFHVGATNVPNGAYIGRAKKH
                     KEALIHKAKVKKAYYKMLDREKGAAPVEASPIQDVGRFASESEQEESSATRVAADRAP
                     SQRKKKLPYFYTPPKQPREKAQPERTREQALDEREARRKLWNRKSPSRLGRERGQPDL
                     GARMQVMLDKIQRD"
     gene            complement(<458448..>459710)
                     /locus_tag="MRET_3104"
                     /note="MRES_10455"
                     /db_xref="GeneID:38739870"
     mRNA            complement(<458448..>459710)
                     /locus_tag="MRET_3104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629731.1"
                     /db_xref="GeneID:38739870"
     CDS             complement(458448..459710)
                     /locus_tag="MRET_3104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485505.1"
                     /db_xref="GeneID:38739870"
                     /translation="MRASSLEEQVRRTIENELDMPMRPPTHVASSSFLSSPHRRHRHR
                     RDAWALDSGESDSDDDVQPLYSPGHHRVFLATPNRRSHTQRPFARPPLSERAHAHLNI
                     SRLAGDATDAWDEKAGTPSYLYARRPSPVPRPPVPGSRHSSSETVVNHDDDKAPGLEA
                     QWADRQLEALTQCIHHMDKELQKIQKQGLSDDLSRVYARLDALEASVAQHSVLLSDLT
                     AKPPPASPPKHASSVDAAMQKMYAELRRLSRAIKDMHARPAPEPPLTPPHMSPPASAP
                     ISEPPTSVDTRYEKICQSVADALGVSTRKEKIHANLRQREADDAATESLLRRLQHTKS
                     PLLSMTEVRMLEHLFDQHTREFEHQKQLYCELADELKCMEPMMDSTKRRILAEHVHAS
                     IDSLEAEATRINGLHAHLVRHGRTVPLP"
     gene            <459827..>461401
                     /locus_tag="MRET_3105"
                     /note="MRES_10460"
                     /db_xref="GeneID:38739871"
     mRNA            <459827..>461401
                     /locus_tag="MRET_3105"
                     /product="alpha-1,3/alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_027629732.1"
                     /db_xref="GeneID:38739871"
     CDS             459827..461401
                     /locus_tag="MRET_3105"
                     /codon_start=1
                     /product="alpha-1,3/alpha-1,6-mannosyltransferase"
                     /protein_id="XP_027485504.1"
                     /db_xref="GeneID:38739871"
                     /translation="MTAGALRVAFVHPDLGIGGAERLVVDAALSLQERGHDVCVITSH
                     YDPSHAFEPTRNGALRVVHAQTRMPRSILHKFHLPMAILQQLSLVMQVVVATHGAGLA
                     RTYPALYRALTHIDPQACPDVFVLDQLPVAIPLLKLLCGRRVVYYCHFPDKEISAALA
                     RQRGDHGLRAMVRRLYRLPLDVLEEATTKAADRILVNSHFTAAHFRRVFPHIVCRPRV
                     VYPAVDELEYTPQQVQQALVEYERSCHDADALRRCSLVQQLVQVGDRPILLSINRFEA
                     KKNIVLALHTVAHLRHTRRDRVRLVCAGGYDARVQDNIATLAALQAQATRLGLSHTTL
                     WGRRPSSASPLHEPTTPEHVLGADVVLLPSLPGALLHALLHAPALRALLYTPTDEHFG
                     IVPLEAMVCGVPVLATDTGGPLETVVDAALDADGQPQARDATGFLCAPNAEQWASVCH
                     RVLDWDEDTRTRIASAARQRVQTHFSVRTMGAALDEHVRAVGAQAVPWSERAQIFGVV
                     LALLLMHAVAVYVVLG"
     gene            complement(<461409..>462938)
                     /locus_tag="MRET_3106"
                     /note="MRES_10465"
                     /db_xref="GeneID:38739872"
     mRNA            complement(<461409..>462938)
                     /locus_tag="MRET_3106"
                     /product="mitochondrial fusion and transport protein UGO1"
                     /transcript_id="XM_027629733.1"
                     /db_xref="GeneID:38739872"
     CDS             complement(461409..462938)
                     /locus_tag="MRET_3106"
                     /codon_start=1
                     /product="mitochondrial fusion and transport protein UGO1"
                     /protein_id="XP_027485507.1"
                     /db_xref="GeneID:38739872"
                     /translation="MDSGASQVLRPYQRPREDLSFIATAPHANATSASGGGSVYVPRT
                     PTNRYLSADADAALLTMQSNKTTVGAMVTGMLVSGALQYTSTCMAMPFEVGKLLLQVQ
                     WVPREDVWQRMRVPSTSLHKRRKRSQSEVEQDPWSEAPVDDEDDEPSKYFRDATDDAA
                     HEPRRRVDEGGYVVPERRDDTSTRPEFMMPVVVKGGVMEMIRAVVRGKEGWMGLWKGA
                     LTTFLLDLSTLVVQPILTGILSIFAPSALNPMPIAFSPQPIKTLTLLMTTRLLTGFLV
                     SPLDLVRTRLIAQSMLPQHRKYHGPIDALRTILREEGGWRTAYLHPNLLIPTLLDYFF
                     RPLFSLGAPLVIENVLHLDPSAFPISYALAEFVVSTLSLGITLPIETARRRLQLQYHE
                     PLRTDHVGGLLSAPNANTARRGLRTCVETRPVPYSGVAETIYRILTEETTTAPGKVAA
                     TDDGSDDEAPPLAAYTHSRLSGVRGLYRGLGMGFSANLLVFVLTLLTGERQTQSGWTE
                     L"
     gene            <463390..>465777
                     /locus_tag="MRET_3107"
                     /note="MRES_10470"
                     /db_xref="GeneID:38739873"
     mRNA            <463390..>465777
                     /locus_tag="MRET_3107"
                     /product="multisite-specific
                     tRNA:(cytosine-C5)-methyltransferase"
                     /transcript_id="XM_027629734.1"
                     /db_xref="GeneID:38739873"
     CDS             463390..465777
                     /locus_tag="MRET_3107"
                     /codon_start=1
                     /product="multisite-specific
                     tRNA:(cytosine-C5)-methyltransferase"
                     /protein_id="XP_027485506.1"
                     /db_xref="GeneID:38739873"
                     /translation="MGRGRAYRRGHGRGGRGGSKRSGERHGEYTSIEQTNPKFEAYYR
                     DQGIVPLDEWEAFVEAMRAPLPTTFRITSGKPTSRQLLDAMHTTFLPYLSNVTFEGEK
                     VTPPHQLEWYPEGLGWHLDVRKNVLRKSPEFKRFQQFLVHETEVGSISRQEAVSMLPP
                     LFLDVRPEHLVLDMCAAPGSKTAQLIEAIHSPLTSSPDAFDPMPLGVVVANDSDTKRA
                     HMLVHQSQRLPSPNLCVTNVDASNMPNIQVSWKGEQPSDPIEQRELKYDRILADVPCS
                     GDGTLRKNLAIWKDWTPMNGTGLHALQLRILIRGLMLLRPGGRLVYSTCSLNPIENEA
                     VVVAALRHFKGDVSIVDASGMLPALQRRPGMTSWKVAPGRGAHLFKGAEKTDESAIPW
                     IESWDALSGLDADLASRTPQSLWPQGDEETWHLDRCIRVYPHMQNTGAFFVTVLEKKS
                     AADAVSLAPGMARAMESMAAQHAEAPSAKRAADEEPEHEAKRVKQDETVPHIVPVDKH
                     RMDRDAKRRAQLADAPIGAGGMPYREDPFVYVHPSNAEVQSCVKWFGLHDFPVANLLV
                     RNSECVPLRSVYLTSNTVRAIVAGGGPGAGVHPAQNPLKIRLLNCGVKVFGRQESVSK
                     ATQAQLAASSDDASQRRENMSSTLACRWRVVSDSLHSMRPFLSDRVVLKATLSDLAFF
                     IREYYPVLDNIPGTVGEFLRTAEMGSYVLDIEPSEHEGHKLDVTLSYPIWRSMASANL
                     MLDKQEKSALSLRLFNTDVSNPEGQRHFSANPQERRQKEHEQEDDSSKESKQQIE"
     gene            complement(465872..465956)
                     /locus_tag="MRET_t0052"
                     /db_xref="GeneID:38741246"
     tRNA            complement(465872..465956)
                     /locus_tag="MRET_t0052"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:38741246"
     gene            complement(466032..466116)
                     /locus_tag="MRET_t0053"
                     /db_xref="GeneID:38741247"
     tRNA            complement(466032..466116)
                     /locus_tag="MRET_t0053"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:38741247"
     gene            complement(<466226..>467808)
                     /locus_tag="MRET_3108"
                     /note="MRES_10475"
                     /db_xref="GeneID:38739874"
     mRNA            complement(join(<466226..466290,466365..466501,
                     466529..>467808))
                     /locus_tag="MRET_3108"
                     /product="molecular chaperone DnaJ"
                     /transcript_id="XM_027629735.1"
                     /db_xref="GeneID:38739874"
     CDS             complement(join(466226..466290,466365..466501,
                     466529..467808))
                     /locus_tag="MRET_3108"
                     /codon_start=1
                     /product="molecular chaperone DnaJ"
                     /protein_id="XP_027485499.1"
                     /db_xref="GeneID:38739874"
                     /translation="MPTTGLGQLSSGFMCTAPGSLRLLPRAFQAKCSTMRRSLVTVSS
                     AGRRSVVMPRLAQTNATYMRGFHSTHTTASKDPYATLGVKRDASTKDIKSAYYQLAKK
                     YHPDTSKEPGAKERFVEIQAAYDILSDEQKRASYDQFGSADGPSMGGFDPFGGAAGAG
                     FGAAGFGGFHPGSAESIFESLFGSAFGGGRATRTGFGGETRGEDIEASITLSFEEACK
                     GTSRTVTINPIDRCGTCTGSGLKPQAKRTTCQVCHGTGTRTFVIQGGFQMASTCPACS
                     GTGSTIAAGDECSTCSGAGRVKSTRSVTVNIPAGVDDGYRIRQDGAGDVPLMGAGPPG
                     SLYVRIHVKPSKVWRRQGTNLFYPAVIPFYTAVLGGRVRVPTLDGTVDVRVPSGTQPG
                     EEMILRGRGVPRLGGRKTYENNGDLMVQFDVSIPRSLSKRQKELLQQFVDEYEGRVSS
                     KSEEPSNDTNQQDEQASSQNKNASKSTSIWHRWTDWFTGKSSK"
     gene            complement(<467942..>468589)
                     /locus_tag="MRET_3109"
                     /db_xref="GeneID:38739875"
     mRNA            complement(join(<467942..467996,468022..468065,
                     468094..468127,468158..468178,468206..468259,
                     468285..468386,468414..>468589))
                     /locus_tag="MRET_3109"
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /transcript_id="XM_027629736.1"
                     /db_xref="GeneID:38739875"
     CDS             complement(join(467942..467996,468022..468065,
                     468094..468127,468158..468178,468206..468259,
                     468285..468386,468414..468589))
                     /locus_tag="MRET_3109"
                     /codon_start=1
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /protein_id="XP_027485498.1"
                     /db_xref="GeneID:38739875"
                     /translation="MSPEPINVLFCCLGNICRSPMAEAVFRHAVQKQRADDHFGVIDS
                     CGTADYHEGEEPHSTTVKVCQENQVPINHIARAITRDDFYKFLYIFGMDTNNVKNLQR
                     MQPKDSKAQVKLFSAFDDNATVMDPYYIGTSAFYTVFEQCQRYSRAFLDTLQRGSNAQ
                     L"
     gene            complement(<468657..>470723)
                     /locus_tag="MRET_3110"
                     /note="MRES_10480"
                     /db_xref="GeneID:38739876"
     mRNA            complement(<468657..>470723)
                     /locus_tag="MRET_3110"
                     /product="Sec1 family domain protein 1"
                     /transcript_id="XM_027629737.1"
                     /db_xref="GeneID:38739876"
     CDS             complement(468657..470723)
                     /locus_tag="MRET_3110"
                     /codon_start=1
                     /product="Sec1 family domain protein 1"
                     /protein_id="XP_027485531.1"
                     /db_xref="GeneID:38739876"
                     /translation="MAAASSIAAPAGAGMQAAESSSLSSLRSAQVHSLLSMLNFNDPT
                     FSHTSGRSKQEDNAPAVTAPPVWKILIMDQTSTDILATSLRVQDLRENGVTLHLQLHA
                     DRPALPDVPAVYFVSPTQDNVARIAKDISNGLYESYYINFTSMVPRPVLEQLAQAVAR
                     TNGGAQIRQVYDQYLDYIVLQPRLFQLLPKMHTSGSANVPTTYEQLHNPQHGQEHVEA
                     ETDRIAAGLLSVFATMGTLPIIRAPRGSAAELVARKLEGKLREQSTSSRGVSGLFASS
                     SSSWNNERPVLILMDRNVDLIPMIAHSWTYQALVYDVLDAKLNRVIVQEPDKPPTAKK
                     SYDLDSKDYFWAKNADLPFPQVAEDIDAELNQYRQEANEIMRSTGISSMDEVGQLDAS
                     SNASHLKAAVTALPKLTARKRTIDAHMNIATALLQGIKTRGLDELYQMEETITRQSKT
                     AILEAIRNPAMQNPEDKLRLFLVYYLSMADAALSRKEVEDFEEALRTQGADMASLVYA
                     KKAREIMRFTLSTPTPAPTQSGHELFKGFSSLGSRLTDKLKDSRLENLVAGVKNFLPV
                     QKDFAVTRLVASIMDPASANTQALQVTDDYLCIDPRQPRGRASVMAAGGVKARQPFAH
                     AVVFVVGGGSYVEFANLQEYISRTTATSSSMASSSSNSKQITYGSTEILTPSAFVQSM
                     AALGRL"
     gene            <470894..>471991
                     /locus_tag="MRET_3111"
                     /db_xref="GeneID:38739877"
     mRNA            join(<470894..471109,471136..471144,471175..471915,
                     471944..>471991)
                     /locus_tag="MRET_3111"
                     /product="acyl-CoA thioesterase 8"
                     /transcript_id="XM_027629738.1"
                     /db_xref="GeneID:38739877"
     CDS             join(470894..471109,471136..471144,471175..471915,
                     471944..471991)
                     /locus_tag="MRET_3111"
                     /codon_start=1
                     /product="acyl-CoA thioesterase 8"
                     /protein_id="XP_027485532.1"
                     /db_xref="GeneID:38739877"
                     /translation="MSLLAGTNKTREEWDKLTTPFVQVRKKADGLYESWVKEHFVPVF
                     GKSIFGGSLIAQCILAAYDTVSEDMLLHEFHGKFVDRADVHEHIMYHVQKLRNGRSYM
                     TRRVDAKQGDTVLFSVSMSFQLREPNEPTYFVPSPKVVNLDDFQSLSKDLYDPYVSLR
                     QVVHPEQCMHAHMRYHNILHSMREDHPMYELLSQWTHDHTHVFPMQSRPAIPTMFDRD
                     GHMAPFSKTAYWLSSRGYCRGPQSLQQAMLGFHVDQFFLVNMNTDIPSYTTTMMASLD
                     HTMWFYNDFQMCDWLLFVLDNQALNNGRALITGRIYRLDGVLVAVVAQEGVHRFKPSQ
                     SHL"
     gene            <472033..>473365
                     /locus_tag="MRET_3112"
                     /db_xref="GeneID:38739878"
     mRNA            join(<472033..472077,472104..472428,472453..472608,
                     472632..>473365)
                     /locus_tag="MRET_3112"
                     /product="JmjC domain, hydroxylase"
                     /transcript_id="XM_027629739.1"
                     /db_xref="GeneID:38739878"
     CDS             join(472033..472077,472104..472428,472453..472608,
                     472632..473365)
                     /locus_tag="MRET_3112"
                     /codon_start=1
                     /product="JmjC domain, hydroxylase"
                     /protein_id="XP_027485529.1"
                     /db_xref="GeneID:38739878"
                     /translation="MISVLDYVPSYPEFCENYLQRNVPAIFPASMTSSWPAYRRYVHK
                     DGGVLWDALRADFGDHDVPVVIDNQERKTMRLEEAIDLITETKHAVYIKDWHLVRSAR
                     THSRDSHFFLPYSTPALFADDWMNNVTTLGNPSATYPNASDAWLASCHDAYDQDDFRF
                     CYAGTTGTITPLHRDVCMYCDTNADTSYSWSTNIAGRKRWRFVAPQDASLLRRFPDQR
                     TSELASTYDDMERRYANHELGAYKDGFSGWPGWAEVRSRVHVVYQEPGQTIFVPSNWY
                     HEVENLTDCLSLNHNWCNAYNLRSMYESMEHEVDDVTAALEDVRDMLQSQPANQCPWQ
                     AEFVAIVQDVVREDAGWAWDGFWRMVYHNVVHPPCDAMFRPPDVRPLIRELLSRFLLR
                     AETPWLASSSTTSWQRVADWLHVSPVG"
     gene            <473429..>475546
                     /locus_tag="MRET_3113"
                     /note="MRES_10485"
                     /db_xref="GeneID:38739879"
     mRNA            <473429..>475546
                     /locus_tag="MRET_3113"
                     /product="GYF domain protein"
                     /transcript_id="XM_027629740.1"
                     /db_xref="GeneID:38739879"
     CDS             473429..475546
                     /locus_tag="MRET_3113"
                     /codon_start=1
                     /product="GYF domain protein"
                     /protein_id="XP_027485530.1"
                     /db_xref="GeneID:38739879"
                     /translation="MYRPASQTYLSETMNAASWNPLNSQAPLAQGFQSPKLGSMSFDQ
                     DSGWPLPHTDPSPGLLPNPRWSAQTQMWYYLDTTNTVQGPFPATSMQMWFDQKYLFPE
                     LLIRAEEDATFRPLHVYMADSSDPLRFFLIPPKNFMMSASVTPTPPRIPSVIGSPHVS
                     AAPSPQLGTMPLSQREAGVRAAPDSMASNSKTSPLAASNLSADDILTSLRVMSQLQTL
                     LPNSTEAQTLQMLRTVLSSSVPHANEAGMQDILHAMQQQAHDDAMRATQAQAYADAGT
                     SVSTPEAAPVKSTPLDNKNTLWSYNKDLYSDEDDPFSPEPPRTDDLVSKHDDEQLEPS
                     LQPKPAPVESKPSPHEELPTKTSEAPPEPAKKAAPSTLPKSSTTGRPAPWAATTNKPS
                     NTSKPNMREILEAEQREHKAREARERANNSAMLAQAMASMHVSGQDASAQPSRPSRQS
                     SGSAWSVPKPVPTKSLSEIQQEESARTASEKAAQAARPSAYSNSVMRGSLGEAPSSLA
                     SDASDDGWVKIGANGKGQHPLPSKPVLTKSSVPPKPTSAVPLRTAALPTRPPALASPM
                     LSSGQSGPSVASEADEEGWVTMKPKHQVRRDALSQMNDAIPRPSAASVGVTSRPTVVP
                     STPQPPSPEFLRHCREQLKGLRANIDDFIEMLLSFPLNPSADVSDIIAEAVYANSSTL
                     DGRRFAADFISRRKADAYRAVTI"
     gene            complement(<475550..>477138)
                     /locus_tag="MRET_3114"
                     /note="MRES_10490"
                     /db_xref="GeneID:38739880"
     mRNA            complement(join(<475550..476857,476884..>477138))
                     /locus_tag="MRET_3114"
                     /product="histone deacetylase 1/2"
                     /transcript_id="XM_027629741.1"
                     /db_xref="GeneID:38739880"
     CDS             complement(join(475550..476857,476884..477138))
                     /locus_tag="MRET_3114"
                     /codon_start=1
                     /product="histone deacetylase 1/2"
                     /protein_id="XP_027485534.1"
                     /db_xref="GeneID:38739880"
                     /translation="MGTTTYLPPNSEGGSAGTLSYRAGDTPLMEPLQNASGQRSRVCY
                     FFDSDIGNFHYGPGHPMKPMRVRMCHSLVMNYGLYKKMEIFRAKPATKREMSQFHTDE
                     YVDFLYRVTPENVDAYVREQSKFNVGDDCPVFDGLFEYCSISAGGSMEGAARLSRDKC
                     DIAINWAGGLHHAKKGEASGFCYVNDIVLGILELLRYHARVLYIDIDVHHGDGVEEAF
                     YTTDRVMTCSFHKYGEFFPGTGELRDIGCGKGKHYACNVPLRDGITDETYQSVFRPVI
                     QRIMEQYQPTAVVLQCGSDSLAGDKLGCFNLSMRGHASCVEFVKSFGLPLLLVGGGGY
                     TMRNVSRAWAYETGLASGHQLSSVLPVNEYYEYFGPQYQLDVLPSNMENMNTREYLDK
                     VKEQVFENLRHVAHAPSVQGHVEPHLAHDTAMDDQDDDAEDPDVRVSQHVMDKRIQRD
                     TEFDDSDDEGEGGRRDQQSWKEQEGMDVEDEPPQEPVKAPTPPKTESDASLPTMGPSD
                     SNVLHTQTHTTA"
     gene            <477306..>477723
                     /locus_tag="MRET_3115"
                     /db_xref="GeneID:38739881"
     mRNA            join(<477306..477359,477387..477642,477671..>477723)
                     /locus_tag="MRET_3115"
                     /product="V-type H+-transporting ATPase subunit F"
                     /transcript_id="XM_027629742.1"
                     /db_xref="GeneID:38739881"
     CDS             join(477306..477359,477387..477642,477671..477723)
                     /locus_tag="MRET_3115"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit F"
                     /protein_id="XP_027485535.1"
                     /db_xref="GeneID:38739881"
                     /translation="MSSQQASGRSLIALIADEDSTTGFILAGIGDVNKDGERNFFVVD
                     NKTPTSDIEDAFNKFTKDRNDIAIVLINQHIADKIRPIVDKYMLAFPAVLEIPSKDHP
                     YDPSKDAVLKRVQKLFGE"
     gene            complement(<477790..>478935)
                     /locus_tag="MRET_3116"
                     /db_xref="GeneID:38739882"
     mRNA            complement(<477790..>478935)
                     /locus_tag="MRET_3116"
                     /product="ubiquitin C"
                     /transcript_id="XM_027629743.1"
                     /db_xref="GeneID:38739882"
     CDS             complement(477790..478935)
                     /locus_tag="MRET_3116"
                     /codon_start=1
                     /product="ubiquitin C"
                     /protein_id="XP_027485533.1"
                     /db_xref="GeneID:38739882"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGQ"
     gene            <479150..>479689
                     /locus_tag="MRET_3117"
                     /note="MRES_10495"
                     /db_xref="GeneID:38739883"
     mRNA            join(<479150..479559,479587..>479689)
                     /locus_tag="MRET_3117"
                     /product="peptidyl-tRNA hydrolase, PTH2 family"
                     /transcript_id="XM_027629744.1"
                     /db_xref="GeneID:38739883"
     CDS             join(479150..479559,479587..479689)
                     /locus_tag="MRET_3117"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase, PTH2 family"
                     /protein_id="XP_027485772.1"
                     /db_xref="GeneID:38739883"
                     /translation="MYALGATLFLAGFASGYIARWWRHGCMNGEDDDLSDIDENDAVH
                     EGDTSDALPEECKMVLGVRMDLKMDKGKIAAQCGHATLGSYRSALRLCPEYVRTWQKL
                     GQTKIAIKIPDEEHLLQVRDAARKLGIPAQIIQDAGRTQVAPGSKTVIGIGPAPNSLI
                     DQLTRSFKLL"
     gene            complement(<479724..>481477)
                     /locus_tag="MRET_3118"
                     /note="MRES_10500"
                     /db_xref="GeneID:38739884"
     mRNA            complement(join(<479724..481275,481305..>481477))
                     /locus_tag="MRET_3118"
                     /product="mRNA-decapping enzyme subunit 2"
                     /transcript_id="XM_027629745.1"
                     /db_xref="GeneID:38739884"
     CDS             complement(join(479724..481275,481305..481477))
                     /locus_tag="MRET_3118"
                     /codon_start=1
                     /product="mRNA-decapping enzyme subunit 2"
                     /protein_id="XP_027485770.1"
                     /db_xref="GeneID:38739884"
                     /translation="MEDQSIDIQPSAVEQQTVKQSHATFEEELENLACRFIVNLPANE
                     LASIERIGFQLELAHWFYLDFLCPQNSQLPTYNFKKFAQELLRVSASVVPLIQLYTSN
                     GSNSLNEAFNQFRQYKTRVPVCGAILLSEDWTECVLVKGWGKNASWTFPKGKINQDED
                     QRDCALRELLEETGFDASELLAKDSTDYFEHRDNEHRIRLYVVPGVPRNTPFEAQTRK
                     EISQIEWFKLGDLPTAKKPKTPSPKLGGRFYGVSPFMMRLRRWIQANKRTHPKRPTQP
                     EPKEKMTSVNMDAVFGIQKPGLIVLPPAAMRQISNKAKASQSAQSSPPTQPPPPPLND
                     HDSKKNLLLSLLHGSQPLPAPPPIVNEPRMDGSTALGNLVGVYKGNETSAHSDEKNKQ
                     KSLLAILQGSSKPLAEPPAVQPPPTNTPPVPGPWPVSSTSMPRPDEHRNQLLTSLMGS
                     APLSPMPTAQPSPGLSCPKPPVQGATPVLAVPPSAGPPPTDQQQTLLTLLSPSQPAVP
                     RPGHPPQMPTAPPSLAPSTIQSPPNAGNAVNLLSILNQAPAEKTSPAPESQETKSLLN
                     TLLQGRGA"
     gene            <481643..>482836
                     /locus_tag="MRET_3119"
                     /note="MRES_10505"
                     /db_xref="GeneID:38739885"
     mRNA            <481643..>482836
                     /locus_tag="MRET_3119"
                     /product="biotin synthase"
                     /transcript_id="XM_027629746.1"
                     /db_xref="GeneID:38739885"
     CDS             481643..482836
                     /locus_tag="MRET_3119"
                     /codon_start=1
                     /product="biotin synthase"
                     /protein_id="XP_027485747.1"
                     /db_xref="GeneID:38739885"
                     /translation="MSNTPMSMMRGVRVSVPMAWKRYKSTAVAHAASLTDYRVSDNKP
                     AAPRAWERSEVQALFDQPLLELVFQAASVHRQHHDPRRIQLCTLMNIKEGGCSENCAY
                     CSQSSRYETHSQAGKLEDLENVLVEARRAKENGSTRFCMGAAWREVGGRKRGFQRILD
                     MVREIRGMGMEVCTTLGMLNAEQAQLLKEAGLSAYNHNLDTSREYYGKVITSRTYEDR
                     LETIEHVRNAGIAVCSGGILGLGEDESDRVGLIWEMSRLPEPPESFPVNALIAIPGTP
                     MEGQPPVTFQEMLRTVATARIVLPTSIVRLAAGRHLFTESEQAMLFMAGANAIFTGHR
                     MLTTPTTSWNEDHAMLDRWGLSGMKSFETPRMAVDEHVSCDSSSSCGCARQQNRPAAE
                     HAEVP"
     gene            <482918..>484531
                     /locus_tag="MRET_3120"
                     /note="MRES_10510"
                     /db_xref="GeneID:38739886"
     mRNA            <482918..>484531
                     /locus_tag="MRET_3120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629747.1"
                     /db_xref="GeneID:38739886"
     CDS             482918..484531
                     /locus_tag="MRET_3120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485475.1"
                     /db_xref="GeneID:38739886"
                     /translation="MGWLDRRREQPQPPKLLAQVAVSLLWGIVPLSWIYAFMFVALRV
                     RQTRLLRLAGRGRKPTLFGRRPRLAALFNRRRLFVWSVVEVAFSLYYQYLVRRVQKRN
                     PILSRETVDPIMIRVMREAILDNLEDPARFVSNLDAHNDIPIPKASLPYDDPCAVAFR
                     REMSGWFMGMKPEHITRADVLDWLACFMFDKRYDEVLAHDTRDGAMQELLAEVLHTFE
                     ARRGLPFAESAPPGVERKRPMLLTLDPVHVHTRPLMLYVVVSAMNRVVEGYFRLHGVR
                     RCRYGSLSYLLYVPRGWRPEAVSAGKAYRPILFLHGLGLGLNEYALALRALLRPCGQP
                     APYPVVIPLQPWMSYEFFSPRFLRPWHHVEAPALLHGILTRHGFDKCHVSILSHSMGT
                     IVHAWLMRAWPKLIARSVFVDPVCFQLWEPHICYRFLYKPTESFVEFVLRYFAARELG
                     NANLLTRHFDWSSNVLLMHDVWKHHTPDDVRIYLAGDDTVLHAWRVLHLLKRCGLQDS
                     VHYAPALHHGELMMLPNHRVPEMIDVLIQ"
     gene            complement(<484532..>493360)
                     /locus_tag="MRET_3121"
                     /note="MRES_10515"
                     /db_xref="GeneID:38739887"
     mRNA            complement(<484532..>493360)
                     /locus_tag="MRET_3121"
                     /product="dynein heavy chain 1, cytosolic"
                     /transcript_id="XM_027629748.1"
                     /db_xref="GeneID:38739887"
     CDS             complement(484532..493360)
                     /locus_tag="MRET_3121"
                     /codon_start=1
                     /product="dynein heavy chain 1, cytosolic"
                     /protein_id="XP_027485579.1"
                     /db_xref="GeneID:38739887"
                     /translation="MADWDVAPVRAYLEALLPVVLNAQPENVRASLADNESWVDVAVS
                     FVQDASETVVFVDQTDPDTCTRYTLSKSPTWSQKCVSMLALVKRQAVLDLHAPLASQV
                     RVVTLQAPRPEHASSEDVAQMLETPYETMEHVVHNVMTPWIDAYVAGHADETNTKDEE
                     GKTGMLLIRRKLAELELSLRHAQQDVEIPHVVLSIHPAIRAACERDARGIEAIQPPSL
                     LEDDAFINQLHAEMNGWVRAVQTITKLDYNTAAGTTMQEINFWAAMEKALEDLERQLH
                     APEITLTLDVLTHAKRFHATVSFHADTGLKDCVEKVHGYNVLLKDLPIGELLAASSLD
                     ALAEAQRSVCTMMNKKLRLSTYPVRRALAFVDALGRDVHQCLLRILSTEPLMEQDYET
                     FAATHAAVEAVLDDWDEQVKEFVYVARDLTRKRAEKFIPIKVAAPHSALRTRLAYLGR
                     LRRAHEELVGMVDVGTVSDALDASSEQTAHEIRGAFAAFRGVDVLDVSEHGTAALALA
                     EKAYHERIAHVESRLIERLRLQIGQASSARERLRTLARFNKLFSRPRVRAAVQEYQAV
                     LLQSVRGDLDALRARFQAGYRDSNAHVAAQLRNEPEIVGAIIWVDELERQLHLYMQRV
                     QDALGEGWADHVDGQRLYEESQAFLPKLDTRPLVQAWAQDMSRRATLPAGAVLRVVRD
                     REKDTLRLMANYDAHTLALANEAHALAMRGIVVPQALASLAQDAQRISPFAMAVDSAL
                     HTLDKIHAQMTVHPFVARLLAKTQLHVRAQLQQVWSCQWERFLDGLSMQDNPQAEVVD
                     AFVRAVVQYETQAAHVAGGVDEQIETLLEQLHTCDYVDETIRGVLGSLQRLVDSLAQH
                     NYVNVDAFVRGLQERLDCILHRRVEDALASFTASLDSMHVDGDTPVVQVVLRAQTLQL
                     EPALDMARAHWFDAFGTCLDTVLLQPRLYVTQRTLELRERSVSTHRDLLRAIPPAALQ
                     APLRRIQAALAEAHVYAMQWLELQILWDAEPESAAPTDDLEAWLQLMERVRETRAFVS
                     AAPRRAFGLVHIDATPAQARVAARLDAWQAAFQTRWAEVVQAAMHEMHEHLARGRREL
                     EPLSATHSSTSHVVTLITRTAAWKHEMRACEARVQLLARSEQEWRAQRSPWPADWLYV
                     EQLQGAWTTLEQLLAYKQTAIEAQHESLQVRMASETRAVQEQMDALRTAWTTERPTSG
                     ALPVAEALRVLGDFALRMAALERTHHMLADARDAFGLEALDASVLTEMAEEMQGLESV
                     WKALAEIGSGLDELKATPWSHVQVRQVRQRLESLLRDCRGLPTRMRSYEAYEAVHDEL
                     QFLVAHVKVLGDLRSDAFQTRHWRALHARLHAPRYIPSSHTLGSVWALDWRAHLPLIR
                     AAIHDAQGEYALDVYLQQVREAWTGYALELVDYRHVCMLLRGWDALFLQANEHAGGLR
                     AMAASPHYRVFEEEAQMWEERLARIQTVFDLWADVQRQWVYLHGIFAGAGSEAMTHIL
                     PVESARFQSISSEFLALLKKVLKAPYVLDVIAVPGMRASLERLAELLHRIQTALGEYL
                     ERERGRFPRFYFVGDDDLLEMLGHGRDIPHVSRHLSKMFAGLATVHADGSLIRAVETT
                     AAERVELITPVVVRDGMPVHEWLDALQNAIRTTLAHMLPGVLAALESLVYDVPSVTSW
                     LESAPTQLLVLACQIHWARRVERAMSENRVSSVHASVRALLDVQSQVAIASPHVRRQA
                     EQLMLLLTHHEAVTQSALTEYAWEQQLRHYMEEGGRVVVRLAHASFDYGFEILGLQER
                     LVQTPLTAACFMTLTHALASRRGGAPFGPAGTGKTETVKALGAELGRFVLVFNCDSQF
                     DLSAMRRLFVGLCRVGAWGCFDEFNRLDEHVLSSVSQQIQAIQHALASSTEADLGPRV
                     PVQPSTGIFVTMNPSYAGRSHLPDNLVKLFGRVAMTQPDAEHIVHVLLRVHGFTTART
                     LARKMVLLFQLCTEQLSDAPHYDFGLRALKAVLVRAAHMQRGDDEATAIVQSVLETVP
                     PRLVAADAPLLTELVSDVFPDVRPAPPALDALTAAVEAECGAQHLTAGGAWLDKVLQL
                     HRILQVSHGVVLVGESGVGKTRAWRVLLQALARLESCDGVAHVLDPKVLSKEALYGTL
                     DATTREWTDGLFTHMLRRIVENERREREQRHWIVFDGDLDPEWVETLNSVLDDNRQLT
                     LPTGERLALPDNVRLLFEVDSVAHATRATITRCGMVWFPNDAVAMSMRYAHALAELRT
                     RPVVDDVPVAETVAAQHVADGIVHAISPYMAADALVDRVLAQAQAHTHCMTWSPVRAL
                     TALVALLRRAVRQVLAYNAHHPDFPLSADDTAMFARRSLVLSLVWAAAGDASHEVRAV
                     IADAVRQHADVHDVPDASLLDVHVEAAPNAPFHAWSARQVDVDARALSTSDAVVPTID
                     TVRHEDLLYAWLQDERPVVLCGPPGSGKTMVVLAALRRLPDVDVVTLNLSSQTTPRTL
                     LRTLEAHAVYENTPAGRRLVPRVPGRRLALFCDEINLPAPDRYATQHVLALVRQWVEQ
                     RGFWWHRTWIALERIQLVGACNPPTDAGRTPLPARLLRHVPVVWVPYPSDTALLQIYG
                     TLNRALLRRVPALVGYAEALAHGMLAFFRTTQQHFTPDQYAHYVYSPRELTRWVRGMH
                     TVMPEDASSLEELVRVWAHEAQRVFQDRLVTASDRAWSEAALDEAARTAFPGTDLTSA
                     LARPLLYSDWLTRDCRRVERAPLRRYAHARLHGFAEEALETELVLHDAVLDLALRCDR
                     VLQQPGGHLLLIGVAGSGRTTVARFCAWLRGLSLYSVPTSSTYDEARFDDDLRALLRR
                     VGVRGERVCWTLDESQVAVPARVEKLNTLLANAEVAGLFEGDEYASLLSQLRDTAQRE
                     GLVLDSDDELLALFRAHITTNLHVVLTMTPPRGDMAQRAAASPALLNRCTLVYCWT"
     gene            complement(<493464..>494710)
                     /locus_tag="MRET_3122"
                     /note="MRES_10520"
                     /db_xref="GeneID:38739888"
     mRNA            complement(join(<493464..494527,494569..>494710))
                     /locus_tag="MRET_3122"
                     /product="component of the septin ring that is required
                     for cytokinesis"
                     /transcript_id="XM_027629749.1"
                     /db_xref="GeneID:38739888"
     CDS             complement(join(493464..494527,494569..494710))
                     /locus_tag="MRET_3122"
                     /codon_start=1
                     /product="component of the septin ring that is required
                     for cytokinesis"
                     /protein_id="XP_027485578.1"
                     /db_xref="GeneID:38739888"
                     /translation="MASAPAVSPSAAAQRKKLTSYVGFANLPNQMHRAAVRKGFTFTA
                     MVVGETGLGKSTLINTLFNTNLVPSGEDRDMSQVPTQTVGIETISADIEENDVCLRLN
                     LIDTPGFGDFVNNENTWEPILQTIESRFESYLEQENRLSRSRIVDNRVHALLYFIQPT
                     GHGLRHIDLEFMTRLNNYATVIPIIAKSDTVSENELQQYKQRILRDLEFHGIDIVRLP
                     MSEEDDEETIAEVTEIQRRLPFAIVGSNNLVKTPDGRIVRGRAYPWGVIEVDNENHCD
                     FVKLRQMLIRSNMEDLRELTELRYEKYRSDKLRSLGVIQDDSVFTAINPTEKNAEARA
                     MHEAKLAKMENDMKAVFQRKVAEKEAKLKQSEEELYARHRQMRAALDQQRRELEERKR
                     RLQNMFRQM"
     gene            <494887..>495618
                     /locus_tag="MRET_3123"
                     /note="MRES_10525"
                     /db_xref="GeneID:38739889"
     mRNA            <494887..>495618
                     /locus_tag="MRET_3123"
                     /product="U2 small nuclear ribonucleoprotein A'"
                     /transcript_id="XM_027629750.1"
                     /db_xref="GeneID:38739889"
     CDS             494887..495618
                     /locus_tag="MRET_3123"
                     /codon_start=1
                     /product="U2 small nuclear ribonucleoprotein A'"
                     /protein_id="XP_027485577.1"
                     /db_xref="GeneID:38739889"
                     /translation="MKLTAELLTHCDSSINALKERELDLRGFKIPAIENMGASRDQND
                     TIDMTDNDVRFLGNFPRMLRLQHLTLSNNLVARVDASIHKQLPYLVSLILTNNAISDF
                     QEVSHLRRLRHMRYLCLMGNPVAREKHYREFVVWCMPHLRVLDYRRITERERAVARKA
                     FVAPDGQLNQLALSLMGSKERRASGGTAPSEPDAPLPTRRHQLTDSQRAAIAEAIDRS
                     ESMEEIRRLEEQLKLGYIPSSQTAP"
     gene            <495735..>500195
                     /locus_tag="MRET_3124"
                     /note="MRES_10530"
                     /db_xref="GeneID:38739890"
     mRNA            <495735..>500195
                     /locus_tag="MRET_3124"
                     /product="dynein heavy chain 1, cytosolic"
                     /transcript_id="XM_027629751.1"
                     /db_xref="GeneID:38739890"
     CDS             495735..500195
                     /locus_tag="MRET_3124"
                     /codon_start=1
                     /product="dynein heavy chain 1, cytosolic"
                     /protein_id="XP_027485576.1"
                     /db_xref="GeneID:38739890"
                     /translation="MGAPLRVRADTTGDWSEEACRTVAYELTSSLDLGEHRNALVDTM
                     VWIHMVAADLGERVRAWTGRQYHPSPQHLLSLLHSFSAIVREQHEQHEDQQRFRLMGL
                     DKLRATVEQIEEMQSLLSTKRKRLEDANSEANDRLHCMVEQQQVAESKREASLALQTE
                     LQRQEAAMAQQRASVLQELSEAEPALLDAQAAVSNIKKQHLSEVRSMTNPPSPVKLAM
                     ESVCILLGHRVDGWKSVQSLIRRDDFISTVVHLDTAHIPQALRERLQREYLDRPEYNI
                     DSIYRASSACGPLARWVLAQIHYAHILESVGPLRAQVQILEEQASLTRQEAIKADATV
                     AELEESIDSFKREYASLISETQALSNEMHTVEARVARSVRLLDGLSSERERWEHGREA
                     FDAQVKTLPGDALLCAAMITYAGFFDQACREALWYAWVARLGSCNVPVRAALSFADTL
                     STADERAVWQNLGLRSDSLSIENAVMLQRCTRVPLLIDPSGRAVSFAQGLFAHAQPAI
                     TSFLDGGFAQVLERALRFGMPLIITDAEYFDPILMPVLNAEKRRTGGRLLVRVGTSDV
                     DWAPSFRLILATRYAGLVLAPHVFARVQVINFTITRKSLEAQSLARILHHERADIEQQ
                     RVDLERMQSEFQRRLLRLEQSLLTALNEAQGHILDDDHVVSTLETLKAEADDVTQKVQ
                     ATGDIMTTVQQATEAYVPLASACSALYFLLEHMQELHPFYSFDMRLFERLLQDVLSHP
                     TATDSENDRCDALYDELFISTFFRAAPTLLHADALVLAVALAQVYCLAGRRAGELDGA
                     DFHALLYGTDTPTLRLVEHEKLTHPEAWHAWTMQVAPELADVPLTPLSSDTENLVRQA
                     LIVRTLRPDRLAPALTRLVHHIFGTPLLDAAPPTIHDIVEQVSSDSPLAMCGVAGYDA
                     SGIVEACAVSKQMTCAEVALGSPEAIGMADRAIISAARSGSWVLIKNAHLAPVWLAQL
                     PSRLTSQKPHERCRIFLTCELSPSVPPSFIRAARIVMHEPPAGCKAILLDALHALDSR
                     PASNTDKAPPERERVYFLVALLHAIVLERARHAPLGWSHAYEFYDTDLEAAYAIVDTC
                     MASAAQSRRNLAPEVIPWPALRALLAQNVYGSRMDSDADRHMLDALLAHLFIPAAFER
                     DFVIAPNDVQPLIAPEGLHREQLCAWASSLPEPQPVHWVLLAPEAERATAVQNATRIL
                     RHLQILRQLAGREQDIIVDHTRSDTAPAPPATSELAALVESHLSKVPRYTRTDTPSAT
                     DPLGRFWARERHMALSVSDTVYRDLERLADVLVHRAPRSSDVSDMLSCIEKDRVPAVW
                     CTSSVPYGTSLCGWLNDLGARTQHAMQETHERVELGRLWAASAFLTATRQMTARHRHQ
                     SLEQLELQWHLGSKSVPGQMIWEIGPVWIDGGVWSKGQLHLNNGSSTCVSTSTLEWTI
                     PADTIAQQLLHVPVFLDTQRQHLLCHAAIPIDSAAALDLAALRAVAIRLM"
     gene            complement(<500188..>500982)
                     /locus_tag="MRET_3125"
                     /db_xref="GeneID:38739891"
     mRNA            complement(<500188..>500982)
                     /locus_tag="MRET_3125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629752.1"
                     /db_xref="GeneID:38739891"
     CDS             complement(500188..500982)
                     /locus_tag="MRET_3125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485575.1"
                     /db_xref="GeneID:38739891"
                     /translation="MHVVFLSACVCFLTIILYQRSRSRKLHDEQQVSEEVLQRGVVRL
                     PYDLHCRILSHVVRSVDLTSDFPHQGLWRILSVSRDMYHKMIPVAYRALYLRSPVSVN
                     RLRYTLVVQCPSYATYVQHISICHCEDLAPLALEQLLLSTTRVSSMHLDVASAKAMCM
                     TQAGRLSKGAKPVILSWDFTTGALFFELDLLFSFDMWQRVESLYVRGDPRLAQVLSHG
                     LWPKLRQVRWFVPLTMMKDISTVVMAQAMQKWSNRGISLVWDNSAT"
     gene            complement(<501130..>502806)
                     /locus_tag="MRET_3126"
                     /db_xref="GeneID:38739892"
     mRNA            complement(join(<501130..502635,502678..>502806))
                     /locus_tag="MRET_3126"
                     /product="CCAAT-binding transcription factor subunit HAPB"
                     /transcript_id="XM_027629753.1"
                     /db_xref="GeneID:38739892"
     CDS             complement(join(501130..502635,502678..502806))
                     /locus_tag="MRET_3126"
                     /codon_start=1
                     /product="CCAAT-binding transcription factor subunit HAPB"
                     /protein_id="XP_027485473.1"
                     /db_xref="GeneID:38739892"
                     /translation="MSEGSGSNGLGAAPGLGSGFQLGPILGSGLGRQGETNPLYYAQS
                     PHAAYFGGHPSQTNSPPHRPPAGDSYANSHLVPYLNHHTPGEGAADIGSEAPPSLDAF
                     YIQQASGSFGVPLDVPEINAYDHAAAGSGLPSSTLPLRGPPNMVGWPPASRPSGTAGP
                     HDIQPHDESEVLHSAPHGYPTSLGAMPPLPGSTRNFPTSVYRPTDPTTHRHMMMDQDA
                     GRPPRPLQKRQRTSPVPFGESIDMQSRFRGAGPGPGRPRLPTRGISARRDIETGTHGD
                     GLTDFLPNTEAPAAPGSDLASWILGPDDVPQRPQAFPMDPSAYYRSGMAPPPASGIRL
                     DMPSLATAQPPMGVPKDLAPLRSQAPNSDDEPLYVNAKQYQRILKRRVARSRMEEKRR
                     HMFMMAIKQREEEKNGGPTEISEEWVSGLLALDEESKKPYLHESRHKHAMRRPRGPGG
                     RFLTTEEIRKRNEEIAAQKSNEEKAGDEGVPSASSATKEGTSDAPQQSAKPFASSLEY
                     SGPRTDEPKENPHNTVNVEPSSGAPDADAPPSTIAD"
     gene            complement(<503005..>512392)
                     /locus_tag="MRET_3127"
                     /note="MRES_10535"
                     /db_xref="GeneID:38739893"
     mRNA            complement(join(<503005..503213,503242..>512392))
                     /locus_tag="MRET_3127"
                     /product="vacuolar protein sorting-associated protein
                     13A/C"
                     /transcript_id="XM_027629754.1"
                     /db_xref="GeneID:38739893"
     CDS             complement(join(503005..503213,503242..512392))
                     /locus_tag="MRET_3127"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     13A/C"
                     /protein_id="XP_027485574.1"
                     /db_xref="GeneID:38739893"
                     /translation="MLEGVLASILNRFLASYVDGLNTNQLNVAIWSGDVKLRNLRLKR
                     SALDKLRLPIDVKEGYLGQLTLTIPWSNLKGKPVRMLIENVSLLAVPRDASMPIDEAE
                     EEERRQTLKQELLTRSELLNVATEEKSEEDTQKNDSFMSSLFTRIIDNVQVTVRNIHI
                     RYEDALSCPERPFSIGVTLAELSAVSTDANWEPTFVHNSALGIHKLARLDSLGIYWNT
                     GSDFLDATSPEELQEKLNLLIASKDYIPEHQYVLNPVSGVGKFVMRPKATKDEPKMDA
                     QLVFDQIGLTISNEQYSGGLSMINLFSFYARQAQYQAFRPTQQELETNGPLAKFRFAA
                     RVIVSEMHQRRRVWTWEYMRERRDLRLEYIRLFKEMVSKSPISDSSAPLPVPNKRLQE
                     LERKLEFRDIRFFRSIARRELREERLVANDSAAEATAHAPTASSGSWLSWMWGSSADA
                     KNVPGLLNNEQRKELCDAIEWDESTGQSLLAPLDDLPPDIVNLHVTAKLNHGFVHLHD
                     QSSDHNILSLMYDGLQGELTQRPHNFDLSVMLGALRVEDGTNLESQYRDIVQVKERAE
                     EDPTMPLFFVQYENKPLDGRADSALLLRMRSTEIVYHASYVESILRFFKPPETELELI
                     GALLDVASSTLEGLRRETRAGLENALENHKTIDVSIDVQSPIWILPEDLKDRQSNMMV
                     LDAGHLAMRSLLAEPQTMDMVRAKHFRQYTEEDFRQLEELMYDRYFIKLQDVQLVLGA
                     GYDACMRSLQILDERDYHLMERINLTFTLHNSILPRAPNLTKVKLTGNLPMLKVHFSD
                     NKYRLLLQLIQAAIPCGDSKPMPESSGNSSLHTRRQVLADHFRGTNDNLLITEEAAES
                     GSSHDDGDSDTYQDAQLSDTEHLSADEKLFEFDLVVDQLSGTVTKSGTSKQEDQQLAE
                     AVFQHFRLGVHIQKHKLQVDVHLGSLDLVDCLVDQAPMFRHMITSRPLEETTGRAERP
                     EAEAYDLIFVQYVQVSPSSPDFYEKHDGIESSTLVNLSTLNLMVTRITVLTVYDWIIQ
                     TFTSGSMETTEPASEASSEVDEPSSSESMTLEEKSSKTRVKVNLSSILLRLNDNGTLL
                     STLTLSTANIALLLRANSMRLAARIGSLSLLDEIVRERADLSFSKLLSIEGDELVDFA
                     LETFHPDDAQYPGYDTFVWLRSNTLKIVLVPEAYADILGFVTKFAKMKAVYDAAKTAA
                     SAQASQLQKTHGLTRFDVLVKTPILVMPYSLNSKDHMTGQLGELYAHNTFDTKDKVCL
                     STLQAGLRQIHFKSYFTSDKDEDVHELTMLDDVHISSEIVESMPIGSHDETEHSFEFS
                     ANMSDINVKLTKRQYVLLMTLFQRASILWKADTEVPLSEIAPDGDGDKAARALDAVET
                     QSPKTHAAILQVAGDFTLKKVCLDLYDETAVDAETLGEASLFCFTVDDTRLMVRQDPD
                     SGTELEVDVQAFSVIDTNKSRETHFREIIPATSHASHQFMLNYTVSPPPENHAMVVVT
                     IDNPVLIFSLDPLFSLISFLAAGFPESPTSDTSSKPDSPLSLPETSDSAATMHSSITA
                     RSPKTPRLPPPAPLASITSLRVNIVEPRIILLSSPKQSDSQAIVLLLRQIVLTKQSVM
                     ALSLTQLGVYVWRMNAPKDRQSLLNEVDVSLSMDAQMTPTGKITGIEIDMGRLLVRFT
                     RSDIELLSNVLSNAMALSRIESPKTSAEPAKPVVHAPSVLNKITDAHEDNGQVLFSRE
                     ELTVRGGGLQCVMISEVQMLPVLDMNVKPFTLLLNDWSADMRLNTELDLSFNNFNFAT
                     SNWEPLIEPWTVSLRYERNLSPESSTFTISSGKRLEINAAAQFVDTTTNLFTYLDKDN
                     RVKEEARHLAPFRIRNHTGYRISVYSESPLGSSNTRNHVHHLDNGYDMPWSFGDWHAI
                     REHATEMTYNRLAVQIEDMPWERVRHIAVDHEGEYVMTLRPKLENISHRLLCEVKLDN
                     NIKVITFQSTFRIENRALIPIEACMLDEQGNTTDHVLRIEPETYSALPICDAYSRQVK
                     VRPDPGLGYTWSNESVGWQDLLMTSSHSFVCPALDEGEAPFQFQAFAVHDTQHMSRRN
                     YPRLTLALRAPVEIENVLPYDIHYRLFDKNLNLNWSTFLRRGGISPIHVVAVQHLLLL
                     SIELEDSVYSPSEFAIIASDNPDDFQVENTLLLADESNLKLELQLHYHSYPNSGGAFK
                     VQIFSPYIFLNLSQLPVTIKTRPWAGHAKMVAGQESHDDDYDASEQRKPFLVSRIGES
                     NNRFLIRSRDSSWSKPLSFDVIGSEVGVVIPSSSGDRELHLGLDIQDGLSKFKLSKVV
                     KLAPRYLIHNKLSHAVLIAESMGGDPVRIGADERVPLHWFHVASNKHATLALEGSNLE
                     WTAPFSIDNIGNVYLRMVRDDEPQHLIQVDVQIQGPTIFVRLLPSEGAWPFLLRNETH
                     HTIVFMQTGSSTEAQLSSRDTNPKRYVLKPRSKMKYAWDYPADADKYIRLQINGSERV
                     INILEIGSLLPFKFAALDDLPAGVVSLDVRADETTQVLVISDYSESKSNFKVLRESGP
                     SANPDIKFKAVDVDTSILFAFNIELVGVGISFISHKVREIAYVTFRGLELSYSESQVT
                     TAVNVICKWIQIDNQTPRSIFPIVLYPTVVPKDGKELDVHPTLQASVIRKKDESHGVR
                     HIKYASILLQELTTELDEDFLFAIYDFVRASGVEVEKEHDETVYIENPNNLPEPPIQA
                     VGTDQVYIEILHLQPIALNLSFMSTDHDEADETESSRTLFFYIFNLLTMVLGNVNEAP
                     VRLNALVIENVRLSKQVLLNRVAYHYGQGVLFQVHRILGSADFLGNPVGLFNNVSSGV
                     ADIFYEPYYGLIMHGNRELGFGIARGASNFVKKTVFGVTDSVSKVTGSISKGLAAVTM
                     DRDFQSHWRSRHFRNKPKHALYGITVGANSLVTSVASGIEGLALRPLEGAEDGGASGF
                     MQGLGRGLVGVVTKPAAGLFDMASSITEGLRNTTQVFDQNTIDRVRLPRFIASDQLVR
                     PYSEREALGQMWLQTLDSGRLIRDQYVAHINTSGQHAGVTIMLSESRILYIRTARLKA
                     LWEVAWSDLSTISLENNGISLVLRGGVVGPFLTIQEESTRLWLFRKISGVVQKYNAAH
                     A"
     gene            complement(<512562..>513250)
                     /locus_tag="MRET_3128"
                     /db_xref="GeneID:38739894"
     mRNA            complement(join(<512562..512711,512744..>513250))
                     /locus_tag="MRET_3128"
                     /product="large subunit ribosomal protein L47"
                     /transcript_id="XM_027629755.1"
                     /db_xref="GeneID:38739894"
     CDS             complement(join(512562..512711,512744..513250))
                     /locus_tag="MRET_3128"
                     /codon_start=1
                     /product="large subunit ribosomal protein L47"
                     /protein_id="XP_027485573.1"
                     /db_xref="GeneID:38739894"
                     /translation="MLACCGLSISRHGRQALGLTRSIFTSAVAMQAPQPFRQIPKAHV
                     LAKTDTPKTLVDVAKAYPDHPLMQFFQMAPTEVPKEGSQGRHADERETIQVPQAVTEA
                     DLSHDHSSRAWLAPELRRKSSADLHTLWYVLLHERNKLATSWEELKRHSAQGAAHMLG
                     QSLSYRHHRVRKSMARIKFVLNERRLALIEAQSRAREEVDVPPLENEGDIFEESPQAS
                     "
     gene            <513474..>515342
                     /locus_tag="MRET_3129"
                     /note="MRES_10540"
                     /db_xref="GeneID:38739895"
     mRNA            <513474..>515342
                     /locus_tag="MRET_3129"
                     /product="metal iron transporter"
                     /transcript_id="XM_027629756.1"
                     /db_xref="GeneID:38739895"
     CDS             513474..515342
                     /locus_tag="MRET_3129"
                     /codon_start=1
                     /product="metal iron transporter"
                     /protein_id="XP_027485572.1"
                     /db_xref="GeneID:38739895"
                     /translation="MEIPQRPSHQRTWLESSGDTLMRHISFLGPGLIAAVAYCDPGNW
                     ATDMEAGSRFGYKLLFTVLLSGLFAVLLQVLCCRLGAVTGLDLSTQTRRLVLGLPAGA
                     GEIPPMNTMNMRLRYWGLLIPLYIINEVAIVATELAELIGSAIALNLLFPVIPLWAGV
                     LITTADVFLALFLFRPSSGVRLFEALIGVLVLIVLVCFCILLRRVLPDWGDVFHGFVP
                     TSTVVTSEGLYISISILGATIMPHSLILGSHFATIDRLDGELDPNNDVQEQLDLESED
                     PGARLSFWRRILPSNLSSIWRRMISSNIRVPEILQTDELPPHKPVSLQYLNVTLQHSS
                     WDIAICLVLFAITINSAILIVASAAFHYGNNSKGDREVVGDLFQAFALLKDTIGTSTA
                     ILFAVALLAAGESSSITVTLAGQIISEGFIRWRITPFMRRFLTRAIAVIPAMLVAAIA
                     GRNGLDTMLVASQVALSMALPFISFPLLVITCSPYRMTREILEDESAVIPSPNDMGGS
                     CYDAYQQQDPYNPDYSQSASTSFAAGHSSTPSSSKNVNLPKTDAEDASLWCRCLRRTT
                     EFCWPKRDYLDGASGKYFYQFHCAQPIAILSWSVFLVICIADVYVLQSSIRDPSKA"
     gene            <515813..>517744
                     /locus_tag="MRET_3130"
                     /note="MRES_10545"
                     /db_xref="GeneID:38739896"
     mRNA            <515813..>517744
                     /locus_tag="MRET_3130"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027629757.1"
                     /db_xref="GeneID:38739896"
     CDS             515813..517744
                     /locus_tag="MRET_3130"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027485628.1"
                     /db_xref="GeneID:38739896"
                     /translation="MRRQLRAQTNDETLRQPGYPRHRAQTAHDIGSGSEYIPRYESSF
                     YAGQPQSFSMPSLVRTVTASPQPLSRALTPTPQVVSVDPQRSASKQYAPSTSEGFMRR
                     MSRSRSASTLSFRKWRVKNKSTPNVISQPNDSRPNSPVWGPRVQSPMLMINREYMGPD
                     TSVSTAPSVNSFDLSLSPTSSHQLSSAMDQRSLVSPLQGGDITSDSFSSLLANDCDTP
                     HIPQSHAYVPFNDNSFSSRRPSEETNLLYPRETEHSSVNKSWFPEKQPDTTSDSHKRT
                     DVTWLHDTSADGSTANSLPLPTSDPTTWNHVTSQPSYDTQEVLDPLKKSQGMSPSPAL
                     RVVKLDQIAPPPSSVPEDSSTQSVPESPSIFHPKLNLSKPLPELETETPASETDTWPY
                     ETDKDVSIATSEVEEVHGDVFKALPTPAFNDSGSQSQSRLEPTLDPLVSIYSGVSSQS
                     SPNKSLSLASRLSDSNHTVGRKDSVEATTQCAPEGIDDMLLAALNIASETPSTSLPVS
                     FAPFERDTSSASTKELPDSASHGLPDSRNSTPAASSWDDPTNKMAPHVEEFQAQQASL
                     RGTIETSKAEILQLREKIRAFRVEVGGDSGSLNGSPLDLNMSSLSSTQKRRLRDSLAS
                     MDNLDQRLSEMLEHNASVN"
     gene            <518402..>526618
                     /locus_tag="MRET_3131"
                     /note="MRES_10550"
                     /db_xref="GeneID:38739897"
     mRNA            <518402..>526618
                     /locus_tag="MRET_3131"
                     /product="polyketide synthase"
                     /transcript_id="XM_027629758.1"
                     /db_xref="GeneID:38739897"
     CDS             518402..526618
                     /locus_tag="MRET_3131"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_027485629.1"
                     /db_xref="GeneID:38739897"
                     /translation="MTTQQLHENDRQPSLSVVGIGLRLPGARDKREFFELLKEGRSAI
                     SRVPDNRWNPDRMTAPGGIPGKVVTDLGGFVEPHTDIDLLEFGISPAEAKSLDPHQAM
                     LVEGVFQALEDSGVHYRGTNTGVFVTGSPDVHNLGNDMYNMGPYSATGAAFSMQANRL
                     SYMFDLRGPSVYLDTACSSSITCLHLARTAILRGDCDMAVVAAVNVILAPHASLSFST
                     LGTLSPTGICHTFDSSADGYSRGEGCTVIILQRTKDAIDRGSHIYAEITGTSINANGK
                     GKSITMPDGPQQKAATYAAYRDAGREPHEAAYVECHGTGTPVGDPIEANAVGEVFTPG
                     RADGDYLRIGSAKTNVGHLEPAAGLVGLIKNCYTLDMGLMLPHLHFKNPTPRIRWNEF
                     KIKVQTETEPLPPSKLTKEGKFIVSLSSFGFGGANSHTVMERVPNKEPGNKTVALTDK
                     DPMLISVGALSNRAVTKLSESLQEVWPGIKDPLKASLLARTMTERARGHPNTAFAVAS
                     MGEPLSFSDTMVTSTPDLNPIKAFVFCGQGPQHEHMGVHMYTRFAAFRNSVNASFEMV
                     AKFHKKNFQDEYGLFNPELNGKVAKTDKGDWKVECIVIAITIFQIALFDLWVDLGVQP
                     DVVLGHSVGEIAAMYASGALTHEKAIRTAIARSNALSLLDTIDGQMAALGMSRQEAEQ
                     LIQRIMKENGTDTGLWVSASNSTNAVAVSGKTSLLEQVVADCESKQTFARLLRVGGPY
                     HSPMVSPCGEPFLKEVSPVINNGENIPKTRFISTVEGRMHEPGRNLDAQYCWQNVSRP
                     VMFRESIEALNEYRKKEDRGLLIIEIAPHTVLGSYMDEILRAANAENTTIVASGRRPN
                     YKKGETGATKVEITQLLTAVGTSIQSGVRDLKVYKLYSDEFIDMPMGANATLDELPSY
                     PFLPLKKAPHETNIFEYVRCHPPVPPLATGMIRINAQTHSWTKGHKIRGTIVFPGAGY
                     AEAALENGARTITNMRILRAFVLEEEGAPKHAQFKLTGINNGWEFRSSGKGAFNDTGL
                     LYDQLHASGQMWPESTPIGPANIKELFGDNWIEDFDIIMDGETFYSRLRPNGSMHTGA
                     FGLINEVRGSTKREDDYLAFVDVPEDLWTSHEAYGMVFHPGLLDSAFLCTWIPALSFE
                     GQKLGVDAFLPNHLDILSVRGTVDEIHNAKRLVLHVQTLISNDTDIKHNVLMFDRDTG
                     KTLAFLKGLECKRIKDTGRVREGYTESWEPRAFDASPSLMEACTMETSVASKFLENMK
                     GDDQSGVVSEALKLGSVSGTPLQDALFDVPSVSLELNDGMVALVDRLIMSSVSKTPRR
                     VFRVLEMYARHRKVSMQPIVAMMERRGIYVDLVRLNVANDLRGSDEFLTGPYDISASV
                     EEFERAVPASFDVAIASDVLRVSSDIKSTMQSIEELLVPGGVAMYCEVTPSTPFGKLF
                     YSQAPAPLSSLSLQPFGASPLFSLGYVRRDEKAWPAIPAIPSKPSADESSLFSSLSDD
                     ELVYFHQLGTEYLLPQAVRDFYKTDTPVGKVWIVADDTVEGAAALGLAGTLTNEMLTV
                     KGIYIAVDPSMPRVQRAGLLDLLHDHEEEGSLEMFNAIRNGRLYGRRLVKQPEVQPAN
                     LGRRDWVLENIQGQTASIKTLAPHMHFVPNPSDHDVIVQTDAVALNFKNVLSAIGLLP
                     AEDCLSEFSGIVREVGPKVTRVRVGDRVMGTSGGVREGIVATASEFAMTKVPANMTPL
                     QAAAFPIAYGTVWHGLVQLAQIRPGETILIHAAAGGVGLCAIQIAQRHGLEVFCTVSS
                     KEKRDFIHNHLGVPYENMANSRSIGEWTQGGRDWLAKRGKTGFDVVLNSLQGLALQAG
                     IDVLGYLGRFVDISKRDHLAGNPMSMSSFLKAINYIAVELGLLGRHAPERMASLLDEV
                     AAVHAREPFKVMYNHVFEGAKGLIESYELMESGKHIGKIVTDLSACCQEQASEKLWDP
                     THIFDPRKSYVLVGGCGGLGPRLAGFLINYGARNIIMTGRRGHISRSDRLALERLVSD
                     PAFPHVTIKIMAADALKPEAMRDVFATANSLGPLGGIFLMSVVLRDDQFLNMDKEKFD
                     TVMNSKIGALNVIRNTIDIDALDFLFLFSSTSALFFNPGQINYNAAQTYFNRFACEHK
                     NVISYAVPAISDIGVYAELRSRSSSAAMKVMDALACPSRELCESVMHSLGRCMLGGSN
                     HAGYFIQTTQWDIMNEISLANAWSISHLLEHHDDDGDKQDESVEDADPVGVLVGKLLN
                     VDITTVDDTMFLSTLGLDSLSASKLSAILLAEFGTTFTQLQLLGPVSVSTLRQVVAET
                     QAAKEGDAAAPAKKGGAPSKSKQAKSKAKTPTDKGVDNSALLAFDYASQPDKLDDLRP
                     SLDGLVPFDPSVLSPDREPKVLVTGATGYMGATVLESVLEAFPLAKVYALVRGVSSAE
                     AGLTRIKEVATKRHLKTLNHIGRVTAVPGDASKPKLGISNAEYAVLASELDLIVHAAG
                     KADHLMGYQAIVNDNVLSTLEVLRLASEQKVKAVVNIGSTNMWLSFSNKEKNDEVIKE
                     DVDLDALSTGLFNGYSQSKWVSEQLCLRASKRGVPVITVRPGVLGGNARSKYVPNEDS
                     FMWRMFVGCQQLGYVPNLSSSAMTETPADWFSEIFGKLISSPRTWKSNYHAFHIRNER
                     PVEMDTMPTLAGHTRPKAVSHDAWVDAFNKEASNPHSTNLLTPLRHFVAKGELAHLPH
                     FDQSRTKEVLGDAWSECPPYQFDFAL"
     gene            <527056..>532614
                     /locus_tag="MRET_3132"
                     /note="MRES_10555"
                     /db_xref="GeneID:38739898"
     mRNA            <527056..>532614
                     /locus_tag="MRET_3132"
                     /product="nuclear pore complex protein Nup98-Nup96"
                     /transcript_id="XM_027629759.1"
                     /db_xref="GeneID:38739898"
     CDS             527056..532614
                     /locus_tag="MRET_3132"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup98-Nup96"
                     /protein_id="XP_027485630.1"
                     /db_xref="GeneID:38739898"
                     /translation="MFGASSFGGFGQQNQQGMSNPSQPGTGGGGMFGQPVNPTGSAFG
                     TPAFGQPAQTSATPAFGAATQTPAFGATPSVQQPQMSTPFSFNQSSSSTFGAPKPATT
                     GFGSFGAASTQPTTSFGFGGATSTPAQPPTTSAFGSMQPSTGFGQNNTTSFFGQQPTT
                     TFGGFGASTSMGGPQTVTQGSATVPYTPFREDMTPNEPKPHAKTFEVHQSLTSMPAYQ
                     NISPEELRLMDYNQGRGKGVTGPTPSVGAPSFGFGAQQGMGTSTPAFGQQPQQPATTN
                     VFGQPPSTGLFGQPNNNAMGTTSMFGGPSNTSTSTGGLFGANANKPSAFGASTSTPMF
                     GQANQNNNTSGGLFGNSTPAQPAAGGFTFGANNNQQQPSTGFSFGANNTQAQNNQPKP
                     LFGGFGSSTTQPSQPSTGFTFGSSTTQQPATTGFGAPSTGATGGGFSFGANNATSQAK
                     PGGLFGSSTTTQPSTFGSFGSTNTAASTQQNKPAFSFGNLGPNTGTTSTPAFGAPNNA
                     AGTGGGLFGAKPAGSTGTGTGFSFGQSNTSTQPPATTGFGAQNNTTGTGGGLFGAKPA
                     GSSLFGNPAPSTTQPSTTGSTSLFGQSTTQPAQPAAGGLFGSNAPKPAFSFGSSTAPA
                     TTGTTNTTTTGGGGLFGQSQPAPSTNTGTSLFGAPKPLGASLPAPSNVPALPAQPPTL
                     TTNPYGTDALLSSVSSTSAAANQAPLPFNVAPKNKPPLVSPFRSSPRNAVRVTRLRGS
                     TPGLDVSRSMREGTPSDRATPLRAGSVSLFHQPSDAATLSPQAFIPRSTSKRLVLDGD
                     TSISRSPSVLREGTPRASVAPRARFSPAVEKVVVGNTSQVGAGGDPDSSVVLPVREPS
                     FASTPPAPRAKSVRPTQHGDYYMEPSLATLRSMPFDELSCVAHFVVGRVGFGRVEFLE
                     PVDLTSVPNLSFVAGGVVQLRAKECFVYPQEEDLDTDTPLDGLLPNYTPVPKAALGTG
                     LNVPAVVSLEGCWPLDRATREPLRDESLPRVKQHITKLRNKKETTFVSYDAESGTWTF
                     EVQHFSRYGLDDSDEEDEPIEEEDDDVVPPPMKLGDESDSGSSAMRESELMSGEEEDA
                     PETDVWMPAVRDTTSPAARRSMTPFTASRLDTPNMPEARKVQVMRASFFGQAPPTPGP
                     VGGVTSIAGPPAPQLIEHKEEHEPMTEEVKDVEPEPVALTRVESGASVLNTALCADPG
                     LYLAPSFRVGWASMGATLAHNGSWHDLPRPSWTQVHIDRLPVYKTAEDRHATMQTARK
                     LLHIQLASTNITTSDAGVPCVAFEPHTTCARVAQHYAADDKQYAAQLWHLASVLFDPI
                     DLQLPDDASDAWVASVLQRRRKAAFSTWLEHAVSLSVQAEVRSHVAASRHTELIFSLL
                     SGHQIEQAADAALDAGHVRLATLVAQAGGALETRADIQDQLDTWHAEGADADMQHALL
                     RVYELLAGQVVSASVSGARARDKHTIAMARGLDWRRALGLHVWYGTPWESSLDASVRS
                     YEEALRTSAGETVPPLPRYQADAQLGVLKQRELAQRTGAPRDALYELLKLHVDASYPL
                     EHALDPRNVGPSALDHTHSWHLGMYLARALEVRTYQDARVMERLTTLYATQLEDAHDW
                     HWAAYVLLHLTDEGTRAEAVRALLARHVDDLDTHASFLTTTLHVDEAWLWQARALAAH
                     ARCDYYAEYECRRNAHDLSGAHAVAVRYLAAESFLRGDTQMLMDLFRPMAEEAESQGA
                     TAIRGWNEGGRVLLDFASLPHLLPPLLAKAQAGTLEASERHTLQQATVRTHELMDRVP
                     LLYPDTSDLMSTVARSEMLAVLQNLSRLLASEAGAPEPIRHWTPSHPPEVEQLQAAAR
                     DFSSSMLACL"
     gene            complement(<532586..>533797)
                     /locus_tag="MRET_3133"
                     /note="MRES_10560"
                     /db_xref="GeneID:38739899"
     mRNA            complement(<532586..>533797)
                     /locus_tag="MRET_3133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629760.1"
                     /db_xref="GeneID:38739899"
     CDS             complement(532586..533797)
                     /locus_tag="MRET_3133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485631.1"
                     /db_xref="GeneID:38739899"
                     /translation="MAHAVSSEASGSSCTHFQWAEDPAHALVCCVRHALELTPVSAST
                     SEGFVLRFYRHGRWPCMFVDVVATVVGVQLRHHYVEYSIDDGSGVIDVMCRGHISLSV
                     AEWSHESGIDACYLPPEPTLLHDEQHFALGDVVHVRGRVYEREDRPRALQAVAISRAA
                     DVNDEARHVLEALHVVHVYKSNVPPCDATWMQPASSMPPPPTLPPRKVIPSVPSPFKS
                     HSRRAFTYYVWMYMNAATEHALEHTSGLDVHNVPAFSVVTLARNMAHRAEEVVREKLR
                     KRATQDMAPDILRTHVYGLVNSALQSLVRLGRVIQSGAMYQVAHPHLLACYLMIVLRL
                     SDATGRRATIPRIHMRITSVRHRLQRYHDRFAHVSLASIEAALRVLYVYGKVHAIEDH
                     IVTIDTPTSTS"
     gene            <533889..>534629
                     /locus_tag="MRET_3134"
                     /note="MRES_10565"
                     /db_xref="GeneID:38739900"
     mRNA            <533889..>534629
                     /locus_tag="MRET_3134"
                     /product="molecular chaperone HscB"
                     /transcript_id="XM_027629761.1"
                     /db_xref="GeneID:38739900"
     CDS             533889..534629
                     /locus_tag="MRET_3134"
                     /codon_start=1
                     /product="molecular chaperone HscB"
                     /protein_id="XP_027485632.1"
                     /db_xref="GeneID:38739900"
                     /translation="MWSRSIRPRVARSPSASITLTRYNRLWYSALARSNTTNKLCAKC
                     GTPNHMASLQCKQCNTLQPLPTTVDYYDVLGMPFDTVPANGWRIDMLELKNLWRRTMA
                     ISHPDRLVHKVHDEQEIGSQQSAIVNKAYETLSSPLQRALYLLQRSGVESIEEGMAVE
                     DPSLLMEVMELQEALQDAENQEAVDQVGATNQMHIDRVLDALNKAFSDAHPNTNRIRQ
                     LAVELRYWTNIDKAVREWQPGQRVELHH"
     gene            complement(<534644..>535882)
                     /locus_tag="MRET_3135"
                     /note="MRES_10570"
                     /db_xref="GeneID:38739901"
     mRNA            complement(<534644..>535882)
                     /locus_tag="MRET_3135"
                     /product="protein phosphatase PTC7"
                     /transcript_id="XM_027629762.1"
                     /db_xref="GeneID:38739901"
     CDS             complement(534644..535882)
                     /locus_tag="MRET_3135"
                     /codon_start=1
                     /product="protein phosphatase PTC7"
                     /protein_id="XP_027485681.1"
                     /db_xref="GeneID:38739901"
                     /translation="MIPSSRTWRPSYATAGSLKRMVVPSTAARTPKPIPRMAVPARPL
                     HSAQTPTPTPTASTAPPEPKPIKIVTSYAFAAKPRDSEMEEEDMDTGNTDRLKKSRPR
                     ILRGGILPNSDLEKWRYSMLNGGDAGEDALMVSKSPDQSVVLLGVADGVGGWSESGID
                     PSHYSNALLYSAMKFAEAHTTYPFPKAVLQHAFEQVSKNPDIQAGSSTACLLRLDAVH
                     GKLSGVNLGDSGYVHLRPDPMSPEGRMLVINRSSPQLHGFNCPYQLAKVPSSMMQSGS
                     LTNYPDEAAVHEFDLQRGDIVLVMTDGFLDNVHCQLPPNEALTPDAPRRPELLQLIDM
                     LQDKHREHWAKTKKPGATLADEKQDFANIMASTLMQYARLCQMTEEKVSPFQLDAAQH
                     GIHYPGGKIDDIALICAAAV"
     gene            <535986..>537781
                     /locus_tag="MRET_3136"
                     /db_xref="GeneID:38739902"
     mRNA            join(<535986..536051,536078..>537781)
                     /locus_tag="MRET_3136"
                     /product="Kelch repeats protein"
                     /transcript_id="XM_027629763.1"
                     /db_xref="GeneID:38739902"
     CDS             join(535986..536051,536078..537781)
                     /locus_tag="MRET_3136"
                     /codon_start=1
                     /product="Kelch repeats protein"
                     /protein_id="XP_027485633.1"
                     /db_xref="GeneID:38739902"
                     /translation="MGKAKSAGKLAAKAAKKVKQEKLADRRATKQKKKGGSKNVDEVQ
                     EEDLDALLAQYRAEWEEKHTSTEEHTNIIPSRRANATLTPCPLGNDLWLYGGEYFDGE
                     RCLFYQDLFRYIPEKNEWRSYSSKIQPGPRSAHQMVASPAGGGQLWCFGGEFASTKQT
                     NFHHYRDLWVYSIAERTWEKVETKVRPNARSGHRMAMWKHFIVLFGGFVDTGARTTYL
                     QDLWVFDTYEYKWKEIKQNDLRRPSARSGFSFLSTPEGIVLYGGYCKKYVKGQRTQGL
                     ALEDAWFLQMDEDLSKIEWVKRKKIGYAPNPPRSGCTMALWANRNMGVLFGGVTDTEA
                     DEESMESTFWNDLYGYQLPGTGRWISLNMRKPKKKKNAEMNVDDDQETEDPATKLPLE
                     RYNSMIAVQRNTLYIYGGIYETGDREYTLDDFYTIDLSKMNKVVCLKECPIDNLEWHS
                     SDEEDEDEDEEDEDEREEDRDEEPEGVEDVPMEEEAEEDELSKVANLHLEDEELSEEA
                     KKELEKQLALRREASAFMGVVKDTHRSEADMLSTPEPGEVLKTFYERTKHYWAAIVHE
                     QAQGLSRGKQLRRDGFDVRISMC"
     gene            <538115..>539420
                     /locus_tag="MRET_3137"
                     /note="MRES_10575"
                     /db_xref="GeneID:38739903"
     mRNA            join(<538115..538156,538198..538224,538257..>539420)
                     /locus_tag="MRET_3137"
                     /product="endoplasmic reticulum-golgi intermediate
                     compartment protein 2"
                     /transcript_id="XM_027629764.1"
                     /db_xref="GeneID:38739903"
     CDS             join(538115..538156,538198..538224,538257..539420)
                     /locus_tag="MRET_3137"
                     /codon_start=1
                     /product="endoplasmic reticulum-golgi intermediate
                     compartment protein 2"
                     /protein_id="XP_027485634.1"
                     /db_xref="GeneID:38739903"
                     /translation="MSESLIDKFDRMPKLRQFDAFPKAQPMYQKKSAYGGFLTMAVFI
                     ATAVMIWYEVQHYMTLKPTYSFDIDSHVGHVMQVNLDLTVNTPCSRLTIDLRDASGDA
                     IHFSEDDIVKDPADFKAELRRARRRSHTKYFNKMLHSQNRGFTRKQRKNKKLVQGGPR
                     GKDSGFEKHKSVVDAENEAHACRVYGSINVKKVTGNLHISTYIPTFMASRDRGHDFGI
                     DMSHIIHEFSFGDYFPNIAEPLDSSLEETDDPAAVFQYFLSVVPTHYISKQYTLTTNQ
                     YSVNDYKRNRDGAAAFPGLYFKYDIEPLTMTVTKKTSSLVSFIIRMCSVLGGLWICTD
                     LGLRIFNRLTILARKSSIEMFSSSFDKEPMPSGQYNTPYFSGPMDPAQGYSAYGTTST
                     VNYLPHGPGETKYRVSSI"
     gene            complement(<539458..>539942)
                     /locus_tag="MRET_3138"
                     /note="MRES_10580"
                     /db_xref="GeneID:38739904"
     mRNA            complement(join(<539458..539482,539510..539693,
                     539721..539877,539910..>539942))
                     /locus_tag="MRET_3138"
                     /product="U6 snRNA-associated Sm-like protein LSm7"
                     /transcript_id="XM_027629765.1"
                     /db_xref="GeneID:38739904"
     CDS             complement(join(539458..539482,539510..539693,
                     539721..539877,539910..539942))
                     /locus_tag="MRET_3138"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm7"
                     /protein_id="XP_027485635.1"
                     /db_xref="GeneID:38739904"
                     /translation="MSVPIATMSDRAQGHRSGRGGGRGGHGGRGGGHVHDKPKKEAIL
                     NLAKYVDKQIRVKFMGNREVVGTLKGYDQLMNLVMDDVEELLHDPSSGSVTDERRTLG
                     LAVLRGTNLMLISPVDGFDIIENPFLQQDE"
     gene            <540049..>542652
                     /locus_tag="MRET_3139"
                     /note="MRES_10585"
                     /db_xref="GeneID:38739905"
     mRNA            <540049..>542652
                     /locus_tag="MRET_3139"
                     /product="protein transport protein DSL1/ZW10"
                     /transcript_id="XM_027629766.1"
                     /db_xref="GeneID:38739905"
     CDS             540049..542652
                     /locus_tag="MRET_3139"
                     /codon_start=1
                     /product="protein transport protein DSL1/ZW10"
                     /protein_id="XP_027485693.1"
                     /db_xref="GeneID:38739905"
                     /translation="MASSTQDVMQFLASVGSPLSDKSTNGPTKHLPSKDVLKLLDARI
                     DALAPSSSKTTSIRDEQNLADSAPYEVISTELYHALEKYAHATAVYTHTSSVTSILTD
                     VCRVLSHIRELQDALSSRNVENVHRLLVSVQEELMSIGIHVNWFDGCIEQDSASPVAD
                     FAVLGQILLVCERISKEILTMMNNETEEIIQVVSDSSGMTVNVHPPSKLTSVLRPVMK
                     EEQIQEVSRILLNQVFQPMLHTPRRWKILHRERCVALECLSEPVTLMHNATVPELVAV
                     LTLTKNALGPQETASLARHLIPSLLELFKPHLLRCIPSMQTPQDMLRLQESLKKCALG
                     FHNALVELGYVSDQMPRSKHMNGLPEPLSDLPMWSRSLDGVCRQHLLGSMVHQVRFLI
                     MESDEKCWDTELRPLHVAAPGPLPLSDEKPKPVPQPRYTSTSKPSPVSPPAPALGKPK
                     KPTLGSVKIGAKLPPEPKSTSPKPMDDWDWGDDETEADPTDVSSQEEGQNKDDWDWSD
                     EEEEAQSENMRTSPPPPPHMPAPAQDVSFDDAWDDWGEEIKSEPKITLPASQPLQESK
                     VTTTMLAVSKRTLQICHVLGMQWSQLDEHVPLRSFLAQAFYLSVQIFRSLMPIVHAKA
                     LENVPLLGMLHVNDCTYMSQQLRMFEADCSKWGAFRIATGQTLDAVLRTEADLLDDVG
                     DRWREMLLSIQLNALHECLDGADSFSRTDSDPRYEACVRCVEQIQHILTHLSSVWRHV
                     MSQEALKKALCDLVDAVFDRVLHEMEDLRDISEPESIRLAQVCRMLMDTAGAVLGGAE
                     ADVPTYFKFAYLPDILQGSLADIEYLLFDNESGSALADYSREEISMLVRALFADTPHR
                     RRLLDHIQQRS"
     gene            complement(<542782..>544293)
                     /locus_tag="MRET_3140"
                     /db_xref="GeneID:38739906"
     mRNA            complement(join(<542782..543902,543933..>544293))
                     /locus_tag="MRET_3140"
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit B"
                     /transcript_id="XM_027629767.1"
                     /db_xref="GeneID:38739906"
     CDS             complement(join(542782..543902,543933..544293))
                     /locus_tag="MRET_3140"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit B"
                     /protein_id="XP_027485654.1"
                     /db_xref="GeneID:38739906"
                     /translation="MDKEGSAGASPSSGWRFAQCFGDKGDIDDITEADIISTVEFDPT
                     GDYLATGDKGGRVVMFERANSSNGGSKQGCEYRFHTEFQSHEPEFDYLKSLEIEEKIN
                     QICWCKRQNAAHMLLSTNDKTIKLWKVFDKPLNAVAEGSLATGEDPAAMLISSNAHAE
                     SRPNGTLHSNLLKLGTPNAGLLRPTLSPAQSRLLRMPRLVYHDTIVAAVPRKIYANAH
                     AYHINSLSVNSDGETYISADDLRINLWNLGISDQSFNIVDIKPVNMEELTEVITAAQF
                     HPIHCNLLAYSSSKGTIKLADMRESALCDRHAKLFEEEEDQANRSFFSEIISSISDVR
                     FSHDGRYMLSRDYLSLKVWDVNMESRPLATIPIHDYLRPKLCDLYENDCIFDKFEGIW
                     GPTGSTILTGSYSNYFHLVDWERDSNIVLQADKTAFKSRKLAALHKPGARSMGMNHIN
                     TNHVDFNRKILHASYHPREDTIAIAATNNLFIFSANNPSAASA"
     gene            complement(<544700..>547291)
                     /locus_tag="MRET_3141"
                     /note="MRES_10590"
                     /db_xref="GeneID:38739907"
     mRNA            complement(<544700..>547291)
                     /locus_tag="MRET_3141"
                     /product="prolyl oligopeptidase"
                     /transcript_id="XM_027629768.1"
                     /db_xref="GeneID:38739907"
     CDS             complement(544700..547291)
                     /locus_tag="MRET_3141"
                     /codon_start=1
                     /product="prolyl oligopeptidase"
                     /protein_id="XP_027485653.1"
                     /db_xref="GeneID:38739907"
                     /translation="MHTVVAPYGRWTSPISSEVVSQSGLAIGDVSSHPSCPWIAYTIT
                     EPQHRGRSTLVYQSTSLHAPPTTLTQASHGTVRSFVHEYGGGACAMQSDTSIIFARCH
                     ERHFAVSRMNPHTQACEDIVPPCIDRRYADFAPHPSDSSLILAVEEEHASKDVYNRLV
                     CLFESQVHTLHQGHSFYAYPRISPCGSFVAWVTWDHPSMPFWSSQLWVASLLREPVPH
                     ISEPVLVAGGHDAVAQQPVWIPGTNTLLFTLSSVQEAGVYQVDVQRGDSLCHVSARLP
                     VGPAHASSLVEVQPPLWNLNVSSLVALDARFIVCVETSHGVDHLVLLDRQACTRTRIR
                     SEYTQLSQLRLSESKLVCLAASVYSSPALVAFDVPTILAQAETTGQILRASGAELVSD
                     EFISLPEPLSFPTQLPDGTASTAHALFYAPKNPHFQAPHGTLPPCRIVAHSGPTSRAT
                     ASLDMSIQYWTSRGWAVCAVNFGGSTGYGLEYMRRLNGHWGDVDVRDCVAAAAYLGGT
                     SAPWDRPALPSSSSMALSEEETYDGMRKITLTRSDSPSMILEGLVFVATSALVYSATW
                     QLWFWSIWPSIVAGMCMLLYRLLLRVQAESISVFPQLGAQLETTCGLYLPSCLRTSTQ
                     PFLPLQRQQTFLPQDTILDFFMMEAIQRWRIVDYAVLATKNTKRESLHVVFPHLLPPP
                     QAYIHMYRRLHDTLLHGQSYPSKARVDASRICITGRSSGGLTVLCALIQYPDIFCAAS
                     SSYGISDLKSLSQHTHKYELHYTTTLMGGTYEDLPGVYKARSALHHADKIRTPLLLLQ
                     GDQDRVVAPDQSRRMARAIESHAGKIKYIEFPSEGHGFRRSDTRQRALEEEFAWCNDA
                     ARIPEVC"
     gene            <547528..>548370
                     /locus_tag="MRET_3142"
                     /db_xref="GeneID:38739908"
     mRNA            <547528..>548370
                     /locus_tag="MRET_3142"
                     /product="solute carrier family 31 (copper transporter),
                     member 1"
                     /transcript_id="XM_027629769.1"
                     /db_xref="GeneID:38739908"
     CDS             547528..548370
                     /locus_tag="MRET_3142"
                     /codon_start=1
                     /product="solute carrier family 31 (copper transporter),
                     member 1"
                     /protein_id="XP_027485656.1"
                     /db_xref="GeneID:38739908"
                     /translation="MATAFTGARPSDLFGRADSMGDMGDMPGMDGMGDMGDMPGMDGM
                     DHGSHSGGGHDMGGMDMGHGPGCKLSMLGNWNTIGTCILTSSWYNDTHAKFAGTCIGV
                     ACWVILTEIVRRWSREFDRYIIAKATRNIVESQSTPTDRWITEKYKEDFDAEDHRAEV
                     DRQGPGTFPSNVLTSFFHPPGRLSARGIPIHPTLVQQLVRALFYAVQFTSAYLLMLIS
                     MSYNGYILLSMMLGALVGHFVSSWDTLGYLSPSILKKGGKSTQSYAAVGPADNQEDVF
                     MYMA"
     gene            <548456..>550222
                     /locus_tag="MRET_3143"
                     /note="MRES_10595"
                     /db_xref="GeneID:38739909"
     mRNA            <548456..>550222
                     /locus_tag="MRET_3143"
                     /product="F-box and WD-40 domain protein CDC4"
                     /transcript_id="XM_027629770.1"
                     /db_xref="GeneID:38739909"
     CDS             548456..550222
                     /locus_tag="MRET_3143"
                     /codon_start=1
                     /product="F-box and WD-40 domain protein CDC4"
                     /protein_id="XP_027485655.1"
                     /db_xref="GeneID:38739909"
                     /translation="MRPLVELLQSFAVATPSDRRDFLEALVRECHVRELSDLEAMLLP
                     RLKVDFLQRLPMDVALHILTFLDDPRALACTAAVSRTWHRLSMNEYLWSLMCVRQKYH
                     TPDRLRWLTHSLLGDAPSTSRAAAMDVDEGPARRRRRHSLFLQRVAGSPADGATVSLR
                     DYFRLAYAVDRNWRRGGRLLRSYETIELADADPDPNRRLALTCCAMDHEWTAVGMTSS
                     AIFVFSTRTGKLVRVLRGHESGVWCLMLATGPSSGYDGPYEPPATAGLVCAQADKRPG
                     ACLALQPSGGLAVCDAVHIAQEQCEQTDVACASTRGWDESGTRLVSAGSDRSLRVWNV
                     RTGECERVMHGHTSTIRCVHVVPHVPVAITGSRDGTLRVWDLAAGRVQHVLAGHQHSV
                     RCLAVHDKYVASGSYDFTCRVWDWTTGRCVHVLQGHQLQIYAIAFDGVHIATGSSDST
                     VRVWDSESGAPLAVFHGYTHIVAQLQLLDGILASGSSDGRVVVYSLRTMECLYRIVAH
                     ESGVTSLQMDAQHLVTAGSDGLVKLWDAQTGSYVRQMCAPCETVWNVRFLDDVCVILG
                     KRHGKCIVDMVSLRPAAESTYT"
     gene            complement(<550219..>551721)
                     /locus_tag="MRET_3144"
                     /note="MRES_10600"
                     /db_xref="GeneID:38739910"
     mRNA            complement(<550219..>551721)
                     /locus_tag="MRET_3144"
                     /product="DnaJ subfamily C member 7"
                     /transcript_id="XM_027629771.1"
                     /db_xref="GeneID:38739910"
     CDS             complement(550219..551721)
                     /locus_tag="MRET_3144"
                     /codon_start=1
                     /product="DnaJ subfamily C member 7"
                     /protein_id="XP_027485650.1"
                     /db_xref="GeneID:38739910"
                     /translation="MSAAEEAKQRGNDLFKRAKYSDAVQAYTESLSHEPESDVLLLNR
                     SAAYMALGQYGQALADCERAVQGREPSGKALLRMAKCQLGVGRPDAALYTLSPLLSQA
                     LGTSAEQAQARDVDAQAREMQRHLTTADAYSRERNWTLASIALDQAQGIMKLTDATSP
                     RAWQEKRVMLLLQRGHLGQAQSLAMDIYRADPSDTSAIMLGARIMLANNDVQKALQQS
                     QLALRLDPDMQAAKQFLRKCKALLTLKDDANAAFKANRSDDALAKYAELLSVADQNME
                     VDGDAKKFKAVIFSNRAILLSKLGRYDDAIRDCTQALQLDAAFTKPLKTRARAYQLNE
                     QHEEAVRDFKRALDASIGTPEQDTLRRETRRAEVELKRSKKVDYYKVLGVPKTATEAE
                     VKKAFRKESLKHHPDKGGDEEKFKLCNEAYGVLSDDQQRRRYDSGVDDMDDMDLGGAG
                     FGGMGGFGGMGGMGGVNLADLFGAQFANFDMGPGTGSTHFYGPGTSFRFG"
     gene            <551833..>553314
                     /locus_tag="MRET_3145"
                     /note="MRES_10605"
                     /db_xref="GeneID:38739911"
     mRNA            <551833..>553314
                     /locus_tag="MRET_3145"
                     /product="tRNA pseudouridine38-40 synthase"
                     /transcript_id="XM_027629772.1"
                     /db_xref="GeneID:38739911"
     CDS             551833..553314
                     /locus_tag="MRET_3145"
                     /codon_start=1
                     /product="tRNA pseudouridine38-40 synthase"
                     /protein_id="XP_027485649.1"
                     /db_xref="GeneID:38739911"
                     /translation="MTDAAAAVGEKRAAAPDADVRDTKVARTDDKDEEESTAPAARLA
                     KRKVAIFFGYCGTDYSGLQVNPGVKTIEGDIFDAFCRAGAVSKENAVNPNKVGLQRAA
                     RTDRGVHAAGNLLTLKVILEPPQLPAGKTLTSYVNSLLPDQIRIWGMRRVQSAFNART
                     SCDSRLYEYLLPTYVFLPPKPFSAMWRMLRRLNTGQEEAPRQEDGTPVAPWDDADVRE
                     SRLLNHAFWRSHGTGGDFATDMRAKRQWRMDRETLERVRRVFAEYTGSHNFHNYTVGK
                     EFRDRSAHRVMKKLTISDPCLIDGTEWVSVQFHGQSFMLHQIRKMIGLLVLIGRTNAP
                     TSLVAQTYGPARIHVPKAPGLGLLLVEPFFGGYNTKVSNNNERIERTIAMRTAAGKPL
                     PPDAESGKREHVDYAMYAHEMDAFKKERIYQQIYRTEEETSEFAKWLNYLDVFVGPDF
                     EFLNPSGTIPQCAILKVGEQRRAPGGQPKAHESDEEGAADDDA"
     gene            complement(<553311..>554768)
                     /locus_tag="MRET_3146"
                     /note="MRES_10610"
                     /db_xref="GeneID:38739912"
     mRNA            complement(<553311..>554768)
                     /locus_tag="MRET_3146"
                     /product="RNA polymerase-associated protein RTF1"
                     /transcript_id="XM_027629773.1"
                     /db_xref="GeneID:38739912"
     CDS             complement(553311..554768)
                     /locus_tag="MRET_3146"
                     /codon_start=1
                     /product="RNA polymerase-associated protein RTF1"
                     /protein_id="XP_027485652.1"
                     /db_xref="GeneID:38739912"
                     /translation="MSEDGLDDELIALVGEDALTQHDAPRSHDKRSALLSDLSDDEDA
                     EGEDDVQANPYPLEGIYKDEDDREWLLSMNEVEREDVLSQRRDEMSRKQQQIQLAAMV
                     RSQQAAAGKTRRSSADKAQRRRSDVRRELEDLADPFAESDEEDMFRESEEEEVRPRST
                     KADKLSELRRKRAERAGKAARDSDEDARPVRRRRRDLSEESESDYEPTYVPRKVREPT
                     PILAAHSAEPPSLALLNKVRLGRDELERLLFLPNGPDLVRGCFVRCSWGTREHRDGRK
                     EHIYRVHQILRVSEREKYYDVSHDHSGRWMNSYVTFKWGGKEHHVDVRPLSTQSISDS
                     ERQRWIAAAGPDAKFPSADAFETKHAQLASALSAPLTEDDIKKILERKRTLRAAAESR
                     GLDIVGGEQKDQHRMNEQAMAQINERNRRQDRERIQEAERRAALLKRKATAPPATAAT
                     TEATAPLATRVSDALASAPSGTGVVPTMDVDLGDF"
     gene            <554907..>556109
                     /locus_tag="MRET_3147"
                     /note="MRES_10615"
                     /db_xref="GeneID:38739913"
     mRNA            join(<554907..554948,554973..>556109)
                     /locus_tag="MRET_3147"
                     /product="actin-related protein 2"
                     /transcript_id="XM_027629774.1"
                     /db_xref="GeneID:38739913"
     CDS             join(554907..554948,554973..556109)
                     /locus_tag="MRET_3147"
                     /codon_start=1
                     /product="actin-related protein 2"
                     /protein_id="XP_027485651.1"
                     /db_xref="GeneID:38739913"
                     /translation="MADDIPLVVDNGTGFVKVGYAGSNFPEHVFPSIVGRPILRAEER
                     DAIAASGVEIKDLMVGTEAEAVRKYLQVSHPMEHGVVKDFDDMRHVWNYTFDEKLRID
                     PRGRKILLTEPPMNPKKNREEMCRIMFEEYGFDGVYVAIQAVLTLYSQGLQTGVVVDS
                     GDGVTHIVPVYEGYAMPHLTRRLDVAGRDVTRHLIKLLLLRGYAFNRTADFETVRRIK
                     EQLCYVSYDLDLDKRLADETTSLVESYTLPDGRVIKVGSERFEAPECLFQPHLIGLEQ
                     PGIAEMLFQTVQTAPVDVRPELYKHIVLSGGSSMYPGLPSRLEKEMKQLYLSRVLQGD
                     GSRLAHFKLRIEDPPRRKHMVFLGGAVLADIMKGRDSFWISRQAWYEQGPQALERLGR
                     "
     gene            <556160..>558415
                     /locus_tag="MRET_3148"
                     /note="MRES_10620"
                     /db_xref="GeneID:38739914"
     mRNA            join(<556160..557620,557647..557947,557976..>558415)
                     /locus_tag="MRET_3148"
                     /product="aarF domain kinase"
                     /transcript_id="XM_027629775.1"
                     /db_xref="GeneID:38739914"
     CDS             join(556160..557620,557647..557947,557976..558415)
                     /locus_tag="MRET_3148"
                     /codon_start=1
                     /product="aarF domain kinase"
                     /protein_id="XP_027485658.1"
                     /db_xref="GeneID:38739914"
                     /translation="MPRDAVSWADVALVWRAVLRLAGSNASSLRPAIRPWPTQLASDK
                     AGGVPSDMSGGVTSHMPSDRPTDDVAAATERVSVPEKELVLETAPDRVAPVSERVPES
                     TPASDAALVEPPATSPEYDAANERTKPLRAKRVPATRLGRLLHYGSLGAGLAWGSASE
                     YMRQTTRGSGGSSLFLSAANVERLVDKLSTMRGAALKLGQFLSIQDSHLLPPQVEEVL
                     LRVQNAAHYMPGWQLERVMTEELGEHWRAHFASFDERPFAAASIGQVHSAVMADPYPA
                     QPEMAGRRVAVKVQFPGIRDSIASDLSYVKWLLTATALLPKGLFLENSVQQLQQELQD
                     ECDYTREADMCRRFYEHVAHMEPHGLCFEVPRVVDSVSTTRVLTAEFLRGRPLTQAAH
                     MDQTTRDKIAHAIMELSLRELFDWHLMQTDPNWTNFLYHHERQSIQLIDFGATRDYSS
                     DFIALWLKLLRAAVSGDRAQCEHWSVQIGYLTGHESETMREAHVTSMLTLGEPFRHDA
                     PVPYPFANQTITDRVREQIPTMVRERLRPPPPETYSLNRKLSGAFLLCARLRARVNCR
                     DLFDQVTRSKGFHTWTPPSDMYRGEDMLERWSHLPTYKRRRAERHADAPEKEATVVQG
                     PPDTVRVRDVYVPTKPVPPGPEECCQSGCVNCVYVLYADNVNEHKQAMRDIRRKLRTY
                     DPPIREDEWDTTLLGPMPNAPDTQDDHVDEAAPADPSLAAFLELERKLKKK"
     gene            complement(<558445..>558897)
                     /locus_tag="MRET_3149"
                     /note="MRES_10625"
                     /db_xref="GeneID:38739915"
     mRNA            complement(join(<558445..558770,558801..>558897))
                     /locus_tag="MRET_3149"
                     /product="cytochrome c oxidase subunit 5a"
                     /transcript_id="XM_027629776.1"
                     /db_xref="GeneID:38739915"
     CDS             complement(join(558445..558770,558801..558897))
                     /locus_tag="MRET_3149"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 5a"
                     /protein_id="XP_027485657.1"
                     /db_xref="GeneID:38739915"
                     /translation="MSVLTGAIRVAAASSGARAMLMKRAAVPAAMQARSYSAHHETYE
                     EFNDRYVKFFEGVEDQFEAQRGLNNAFAQDLVPSPEVIESALKAARRVNDFSLAVRIF
                     EGIKAKTDNDSQYKQYLDVLKPLREELGVPLKEELYSS"
     gene            <559018..>563214
                     /locus_tag="MRET_3150"
                     /note="MRES_10630"
                     /db_xref="GeneID:38739916"
     mRNA            <559018..>563214
                     /locus_tag="MRET_3150"
                     /product="E3 ubiquitin-protein ligase SHPRH"
                     /transcript_id="XM_027629777.1"
                     /db_xref="GeneID:38739916"
     CDS             559018..563214
                     /locus_tag="MRET_3150"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase SHPRH"
                     /protein_id="XP_027485689.1"
                     /db_xref="GeneID:38739916"
                     /translation="MHPVHIVPGGVDNAPLATFAALDAPLDTRKRAHELVDAVLVCSD
                     TLHFRASVPRHWDTRVSLHRVSDWQTRMQPRVHVHPSHGALLDVCAGTETLVTIPLVA
                     SAWCLTALSLSILHVDAHLAWDDHDVRLRVDVFTTSACFRPQPPDIAEQLRAVVEHAN
                     KMDLPPVDEVGGAALVYESLCRREMRSETRMPPCEQPRALLAHLLPFQRRSVSFLLER
                     EAPAAERQSLRSECGPWWIRVHASLYFHVLTGAMTTEAALAAADPIRGAILAEEMGLG
                     KTIEVLALILEHTSRHRHELPSYWDAANEAQVQPVGTTLIVSPETLRRQWLDELAMYA
                     PSLRVYSYTGHKAAAEDAGSSWGDWASQWDVMVVSFETLARDLAASHAAPVRMLRQPS
                     KYERPRSPLVQLEFWRVVMDEAQLVGGNAARTMGMIRRQCSLAVSGTPVRRLADLRTS
                     LWFLGLAPAGPPRLWKRILSAAWAPYVGRVLYDVGIRHTKAQVAPEMVLPMQTRYLVP
                     VDFTHVETAFYRDVWHASLAALRLDADGAPQHDTWELDTSVLRAQLQRLRQACTHPNV
                     ALRGGHLLGSDAGTSVSINLRSIEQVLAQMIEATKQDLGAHKHALTSSRIYRASILLF
                     APSGELETTPSGASHPDQVALADAVQRQGRRSVARDLLETLLPHVEAQMEALEEEIRA
                     AQSQGPLYAFSAEELEYLARYHHDLPADAPHEKLRLRQQYTSALRSRQRHWLQVMHRI
                     QQFSGHCFFQLGESVKQEKSSEDVKPYAAMEEAAYQAAEQTRQRLLAEARGHVEQCVE
                     ALEQHRMDAQQLLSLAVPAAQGLAGRSVLDDVDVILDKLRLHAHVVLDWRSQIHARLE
                     KPVNREVSKERADDDVYAENLDAQIEAETLLEMYRPLLAQRDELLTGRIALGATARPQ
                     LFVELDRELRAARLRRFQQDEEEEEEDDDVRRVKRLQLQHFRSLEEARRPAMLPPDAE
                     PLGALLSSLKEARDAATHRDAQLLTTMCTALQHLLRDQLAVLDALRKEQALFQTLFNA
                     RALYFKQVQELSDQVQDPEMPQGAWPSLFASLAQERTARQKMGATEGRLRYLHHVKHM
                     HNESMSDTASEARHCYICTNIIETGILTNACGHLCCEACFQAWMGHGHRTCPMCKTRL
                     TPRDVHRVVYRTRQLSMAPTGLRPAESTSFRQLAPDTRHAIEAVGIEGGNGSKLDLLM
                     RHLLYLDRTTGEKSLVFSSFARGLDLVAESLTHHGLAYVRLEGSGGKRASAAIEAFQH
                     APDVRVLLLHSEAQSAGLNLLAATHLFLLEPLLNHAMELQAIGRVHRIGQTRPTHVYG
                     YMVHDTVEERIMALAAERSQSLYLDVPDKEQDSALVQAAQHVAAQDATRDTRRGDLVG
                     STSDLLACLFAQHIGSKRGT"
     gene            complement(<563256..>564611)
                     /locus_tag="MRET_3151"
                     /note="MRES_10635"
                     /db_xref="GeneID:38739917"
     mRNA            complement(<563256..>564611)
                     /locus_tag="MRET_3151"
                     /product="Myb-like DNA-binding domain protein"
                     /transcript_id="XM_027629778.1"
                     /db_xref="GeneID:38739917"
     CDS             complement(563256..564611)
                     /locus_tag="MRET_3151"
                     /codon_start=1
                     /product="Myb-like DNA-binding domain protein"
                     /protein_id="XP_027485690.1"
                     /db_xref="GeneID:38739917"
                     /translation="MADEHVIRTLGPKAGSGSGTLPIDQSDLFALLEPALGCVSMLPD
                     KPNVASSPPSQGSSGGACARPSSHWKSADQTTPPDSTASAPQQVSGPKAPDSSPYRVG
                     SAVPDTARPWSTSENFRVPLPDKSNTRARRVFTQEEDEALIRGFERLGSQWAQIARHP
                     AFKNRRSSTDVRDRFRNAFPEEYARAGYKPRVKSSKRLERNREAHRVTRSDATSHRQI
                     KPLRLNDTDTALFASNVASSSDANPRTPLNVTMEPSTLSPLSYDASPQGIPTVSSPTS
                     PMSESVMNMLALTPTAMIPSISPPSTPQVAPYSIPDLSMPTTAAVPIPTMSQSFHVQP
                     PFSIPMSVPTLHASGPHVPVPSSDAFVSPPLPGYFPDTTATSFSMPAPAPAFPQSLSP
                     TEPVSFAPSVSLPLSTGGGGPLPETASPPLSSADVSLLSLMMMQTPTHMMEPHSRAPP
                     S"
     gene            complement(<565107..>566320)
                     /locus_tag="MRET_3152"
                     /note="MRES_10640"
                     /db_xref="GeneID:38739918"
     mRNA            complement(join(<565107..565196,565223..>566320))
                     /locus_tag="MRET_3152"
                     /product="RNA recognition motif domain protein"
                     /transcript_id="XM_027629779.1"
                     /db_xref="GeneID:38739918"
     CDS             complement(join(565107..565196,565223..566320))
                     /locus_tag="MRET_3152"
                     /codon_start=1
                     /product="RNA recognition motif domain protein"
                     /protein_id="XP_027485687.1"
                     /db_xref="GeneID:38739918"
                     /translation="MPRQHPYGGYERGGKGPYREGRRFSRGRGRGGRGRQAHMPYPLS
                     YGEGLSMSGAPLPPWGAPFPMMPMPYAMPQMWYGMPNAALPPQPPPWDAMFPTYAARG
                     GGGARRAERKSQRPRFTRSIYQPDPEAERPEDSKPCRTLFVRNVAFEVNVNALRAEFA
                     SYGEIRTWFDLIQRRGMLFVTYYDTRAAERARAEMNKKVLVGRALDVHFSLPKDEDQE
                     QHCDRDKNQGTLFVVVHDAKDPVSDEVIRAHFEPFGDIRAIRTYKGQLHTRFIEYWDS
                     RACIQAHDTCQDTEFLGGKLQLKFAWDLSTVSLVNDARTRSEAKAAAEARATANQQDP
                     APLPEGEAAEIAPAWPANAPEERLEQAQKVQQLLASLGPHTAHQTPRASEDFEGIPPK
                     ILT"
     gene            <566508..>567137
                     /locus_tag="MRET_3153"
                     /note="MRES_10645"
                     /db_xref="GeneID:38739919"
     mRNA            <566508..>567137
                     /locus_tag="MRET_3153"
                     /product="Ras-related protein Rab-5C"
                     /transcript_id="XM_027629780.1"
                     /db_xref="GeneID:38739919"
     CDS             566508..567137
                     /locus_tag="MRET_3153"
                     /codon_start=1
                     /product="Ras-related protein Rab-5C"
                     /protein_id="XP_027485688.1"
                     /db_xref="GeneID:38739919"
                     /translation="MSGVVSFKLVLLGESSVGKSSIALRFVKDQFEDYRESTIGAAFL
                     TQTVSRDDGTTIKLEIWDTAGQERYKSLAPMYYRNAHCALVVYDITEQDSFENAKTWI
                     RELQRHADANITIALVGNKLDLADTRRAVPEEEARKYAEAEGLMFMEASAKTPTNVTE
                     LFTAVANKLPLDRGIGAKRPEAPAGGARPNAPVQLGAQPRPTNQDACTC"
     gene            complement(<567150..>568172)
                     /locus_tag="MRET_3154"
                     /note="MRES_10650"
                     /db_xref="GeneID:38739920"
     mRNA            complement(<567150..>568172)
                     /locus_tag="MRET_3154"
                     /product="pantoate--beta-alanine ligase"
                     /transcript_id="XM_027629781.1"
                     /db_xref="GeneID:38739920"
     CDS             complement(567150..568172)
                     /locus_tag="MRET_3154"
                     /codon_start=1
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="XP_027485685.1"
                     /db_xref="GeneID:38739920"
                     /translation="MSDRMSAHWAATPVRVFESVAPYRVWRQTIMHKGESVGFVPTMG
                     ALHEGHLQLVDASLRENDYTVVSIFVNPAQFAPHEDLSTYPRTIQSDLERLGTRATAA
                     QREGRMVALLPQVNDMYPFGITQHVPDQVGAFVEVQGLSHQMEGQTRPTFFRGVATVV
                     TKLFNIVLPDRAYFGQKDIQQSIVIRRLVDDLLFTFPHGSKNVRVMPTARDPIDGLAL
                     SSRNKYLDEHGRQAAPVLYAGLLQGSQTWSDLQAQGVPPADRVARTLDAVRSHIEQAT
                     PSHARIELDYVSLNDPETLVQLAPGHAAGDGVILSGAMYVYNRAHDPKPAARLIDNVL
                     IGFTLY"
     gene            <568207..>569317
                     /locus_tag="MRET_3155"
                     /note="MRES_10655"
                     /db_xref="GeneID:38739921"
     mRNA            join(<568207..568347,568373..568441,568469..568984,
                     569011..569037,569064..569071,569098..>569317)
                     /locus_tag="MRET_3155"
                     /product="methionyl aminopeptidase"
                     /transcript_id="XM_027629782.1"
                     /db_xref="GeneID:38739921"
     CDS             join(568207..568347,568373..568441,568469..568984,
                     569011..569037,569064..569071,569098..569317)
                     /locus_tag="MRET_3155"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_027485686.1"
                     /db_xref="GeneID:38739921"
                     /translation="MGTEAVYDPFEGVRGFRYSGDVHAQYPLSPKTKMPAHIRRPNYG
                     REALFPSRRIRVNNEEEQAGVRTAAKLARESLDLIAAMVRPGITTDQLDEALVQAATE
                     RKCYPSPLGYHGYPKSVCTSVNEVICHGIPDQRPLRDGDIINLDVTLYHNGFHGDLNA
                     TYPVGDKARSSEPLMRLIRTARECLDAAIAICGPGMPYAEIGRVIQPIAEANGCCVVK
                     GYTGHGIGRVFHGPPPVYHHPTKKSYGIMQPGHIFTIEPMLNLGTEWRDLEWPDRWTV
                     ATVDGAPSAAAEETLLITPTGVEILTAQGGARTLDTTEARQRHWDAQVVP"
     gene            <569432..>569641
                     /locus_tag="MRET_3156"
                     /db_xref="GeneID:38739922"
     mRNA            join(<569432..569564,569601..>569641)
                     /locus_tag="MRET_3156"
                     /product="cytochrome c oxidase subunit 7"
                     /transcript_id="XM_027629783.1"
                     /db_xref="GeneID:38739922"
     CDS             join(569432..569564,569601..569641)
                     /locus_tag="MRET_3156"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 7"
                     /protein_id="XP_027485683.1"
                     /db_xref="GeneID:38739922"
                     /translation="MAVVPPIKGMMRTRFYKTLTFSFAFGSSLAWGFWYFYHVPRVQI
                     RDAYYAKINANKE"
     gene            complement(<569682..>571472)
                     /locus_tag="MRET_3157"
                     /note="MRES_10660"
                     /db_xref="GeneID:38739923"
     mRNA            complement(<569682..>571472)
                     /locus_tag="MRET_3157"
                     /product="oxidoreductase which may be involved in DNA
                     replication (By similarity)"
                     /transcript_id="XM_027629784.1"
                     /db_xref="GeneID:38739923"
     CDS             complement(569682..571472)
                     /locus_tag="MRET_3157"
                     /codon_start=1
                     /product="oxidoreductase which may be involved in DNA
                     replication (By similarity)"
                     /protein_id="XP_027485684.1"
                     /db_xref="GeneID:38739923"
                     /translation="MSDDDGVIVLTILYGTETGNAEDVAYRIADVAQRHRVPTRIYNL
                     ADYDRTELICESHVIFVVSTTGQGEFPVSVRPLWRFLLRQGLPPDILSDLTFTTFGLG
                     DSTYARYCWASHMLHKRLLDLGASEWFKNGEADDQHELGIDGGVLPWLDTFVQRLRAD
                     LCEPSCVPISPDVLMPPRVHVHVSSDMGKPSIPCLDGAHMATVVRNERVTHQDHFQDV
                     RCIDLALDRATAPSYRAGDVVCLVPENKPEDVEALLQRLDWASVADKMLRLTQNDPHR
                     PWPPAIWHDMQQGSLTLRRLLTVHLDPFSVPRRSFFDLIRHFSPPDHREHEKLVEFLQ
                     PGEGTDDMYEYAQRVRRTMAEVLAEFKSVQVPPSYAMELFPLMRARQYSLASDPTTYP
                     DTLQLLVAVVKYKTRIQKPREGIASSWLARLEHGTRIPVRIQPGTLLPPAQSSTPIIA
                     IGPGTGMAPLRSLLRERLSKSVAVVGETLVFAGCRYRAKDCLYAAEWEAWAATPHAHL
                     TWIVAASRDQPHKIYVQDRLREWGARVWDILGPRRGIVYLCGTSGKMPQQVRQAAVDV
                     FCEHGHMSTEQAERYLAKLEAERRWQEECW"
     gene            complement(<571537..>572920)
                     /locus_tag="MRET_3158"
                     /note="MRES_10665"
                     /db_xref="GeneID:38739924"
     mRNA            complement(join(<571537..572531,572695..>572920))
                     /locus_tag="MRET_3158"
                     /product="elongation factor 1-gamma"
                     /transcript_id="XM_027629785.1"
                     /db_xref="GeneID:38739924"
     CDS             complement(join(571537..572531,572695..572920))
                     /locus_tag="MRET_3158"
                     /codon_start=1
                     /product="elongation factor 1-gamma"
                     /protein_id="XP_027485691.1"
                     /db_xref="GeneID:38739924"
                     /translation="MASIGKLYGIPLAPKVLRVRAAAKVNGLNLEVVETAAVKDSYKP
                     EFTSKFPLGQVPAFEGPDNFLLTESRAILRYVAKISDNNHLFGTDAKSEAHVDQWINF
                     TDEMLFGNAVQLFCIFNNILQYSKSIEQFCWARLEKGLTYLDNYLVKHTFLVGHRLTA
                     ADIAVAVELYDLFVRYLGPQARGKYTNVLRYYNTIVNQKALDGIIPVNAEFAKENAKF
                     VPPKKEEKPKKEAAAPAPAAAAAQPAKQEKPKNPLDELPKSSFVLEEWKRVYTNEDTR
                     SKALPWFYEHYDKDGYSIWRFDFKYNDELTQIFMSNNQIGGFFNRLEASRKYVMGTAG
                     VFGENGNNLISGVIILRGKEYEPVLSVAPDLESYAVTPLDLEKPEDKKFFEDMLAWEA
                     VIDGKSWADGKMLK"
     gene            <573393..>574166
                     /locus_tag="MRET_3159"
                     /note="MRES_10670"
                     /db_xref="GeneID:38739925"
     mRNA            <573393..>574166
                     /locus_tag="MRET_3159"
                     /product="20S proteasome subunit alpha 3"
                     /transcript_id="XM_027629786.1"
                     /db_xref="GeneID:38739925"
     CDS             573393..574166
                     /locus_tag="MRET_3159"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 3"
                     /protein_id="XP_027485692.1"
                     /db_xref="GeneID:38739925"
                     /translation="MSRRYDSRTTTFSPEGRLYQVEYAMEAISHAGTVLGILARDGVV
                     LAAEKKVTSKLLEQDKSSEKIFQLSENVLAGVAGMTADANSLVNYARNAAQKYLLSYD
                     DNIPVEQLVQRLCDLKQGYTQFGGLRPFGVSLLYAGFDAHHGFQLYQSDPSGNYSGWK
                     ATCIGMNNGTATSLLKQEYKDDMDVKQALGLAARVLSKTMDTTSMESDKLEFAVLKRH
                     ERTQEPQPYILEPSDIDRVLQLHNLAKVPEDASSMAVDA"
     gene            complement(<574184..>574567)
                     /locus_tag="MRET_3160"
                     /note="MRES_10675"
                     /db_xref="GeneID:38739926"
     mRNA            complement(<574184..>574567)
                     /locus_tag="MRET_3160"
                     /product="small nuclear ribonucleoprotein D3"
                     /transcript_id="XM_027629787.1"
                     /db_xref="GeneID:38739926"
     CDS             complement(574184..574567)
                     /locus_tag="MRET_3160"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein D3"
                     /protein_id="XP_027485723.1"
                     /db_xref="GeneID:38739926"
                     /translation="MGTVGIPVKLLHEAVGHTITIELKGGVTYRGRLFDAEDNFNISM
                     KDIAVTARDGKQTHLDSVYIRGNMVRFMVVPDMLQQAPMFKRVGPNAMKGRGIGSARG
                     RATIMRAQARRGRAPPGVRPPSAHR"
     gene            <574818..>575111
                     /locus_tag="MRET_3161"
                     /db_xref="GeneID:38739927"
     mRNA            <574818..>575111
                     /locus_tag="MRET_3161"
                     /product="high-mobility group non-histone chromatin
                     protein"
                     /transcript_id="XM_027629788.1"
                     /db_xref="GeneID:38739927"
     CDS             574818..575111
                     /locus_tag="MRET_3161"
                     /codon_start=1
                     /product="high-mobility group non-histone chromatin
                     protein"
                     /protein_id="XP_027485722.1"
                     /db_xref="GeneID:38739927"
                     /translation="MPKKPTQKATPTTTRRTKAKKDPAAPKRPLSAYMFFSQDWRERV
                     KAENPDAGFGDVGRLLGTKWKEMSEDEKKPYIEMANKDKERAETEKAAYANKA"
     gene            complement(<575262..>576170)
                     /locus_tag="MRET_3162"
                     /note="MRES_10685"
                     /db_xref="GeneID:38739928"
     mRNA            complement(<575262..>576170)
                     /locus_tag="MRET_3162"
                     /product="solute carrier family 25 (mitochondrial citrate
                     transporter), member 1"
                     /transcript_id="XM_027629789.1"
                     /db_xref="GeneID:38739928"
     CDS             complement(575262..576170)
                     /locus_tag="MRET_3162"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial citrate
                     transporter), member 1"
                     /protein_id="XP_027485721.1"
                     /db_xref="GeneID:38739928"
                     /translation="MAAARQDRAAPPKVHPLFSLGSGTFAGAIEGFATYPIEYTKTVS
                     QFTTKAGAKPPNPIVIARDTIAEYGVRGLYSGCGALVAGNALKAGVRFLSYDHFKSML
                     KDEHGKLTAPRSLLAGLGAGMMEAIFAVTPSETIKTKLIDDAKSETPRYPQSLVRGSI
                     AIVRDEGILGIYRGLVPVMLRQGANSAVRFGTYSTLRNFVQGSSRPGQPLPSGVTFGI
                     GAIAGIVTVYATMPLDVVKTRLQTLHGREQYKGTFDCMAKVLRHEGVLAFWRGATPRL
                     ARLMLSGGIVFTVYEKSMDVLQSVFA"
     gene            complement(<576252..>578186)
                     /locus_tag="MRET_3163"
                     /note="MRES_10690"
                     /db_xref="GeneID:38739929"
     mRNA            complement(<576252..>578186)
                     /locus_tag="MRET_3163"
                     /product="chloride channel"
                     /transcript_id="XM_027629790.1"
                     /db_xref="GeneID:38739929"
     CDS             complement(576252..578186)
                     /locus_tag="MRET_3163"
                     /codon_start=1
                     /product="chloride channel"
                     /protein_id="XP_027485720.1"
                     /db_xref="GeneID:38739929"
                     /translation="MEAGGLYTPRPKHLGILRSPHTPGTGSSVRFGMRSYEDGEESLL
                     TASVSSRTDESDARPPADTTLGGDSLDMSFTESFLRREVDGALAGLDLQDDPKTPFRH
                     PPDSEAPNTVKPLKPQDVEDSPPSPPSPEAPPSTSPLSSPTIRPSRRLPSAAPNTSAE
                     TSEAHPDPTSPPSETVAMPAAEASKDAESPEALPADEVSEETNPLASSISHTDTSYGS
                     SSWATPRSARSPHSPSQWPGMYEFSYLSDKEALDDVDTGPLVPFAAQELSSKLFSIET
                     LGTIDTRELFDMIAALDRTHTERTIFLQHRLARTHRLVQMLRAQLQQAHDRIHVFESH
                     IQAFVQPNDEKDGSAAWETLHALTERLEARLETMHRLPPSSPPSPSPRSPFDVDALRQ
                     ELDAERKQLENERRDLEIRRAEPGNNVQDEVQRAIEATREACRRDADVRVLVARQEAA
                     EALREVQARLTEAETRPTLDADLEQAHERIAELERHVARAEEQRSSEYHVLQTKGKQA
                     EARCNALYAELDRCQRERDEMEAGLKADMGTWQQRVRTLEHDVAHRDLQTVQLRKQCD
                     RLSQETHHFSLALAAKDQELSMLKRGTKGSAYWDLITQRTRRPERRALQNKTNLHARS
                     TQETVDMAQKVLRTHHMVAE"
     gene            <578465..>580924
                     /locus_tag="MRET_3164"
                     /note="MRES_10695"
                     /db_xref="GeneID:38739930"
     mRNA            join(<578465..579289,579443..>580924)
                     /locus_tag="MRET_3164"
                     /product="multiple RNA-binding domain protein 1"
                     /transcript_id="XM_027629791.1"
                     /db_xref="GeneID:38739930"
     CDS             join(578465..579289,579443..580924)
                     /locus_tag="MRET_3164"
                     /codon_start=1
                     /product="multiple RNA-binding domain protein 1"
                     /protein_id="XP_027485727.1"
                     /db_xref="GeneID:38739930"
                     /translation="MSRLIVKGLPTYLTDARLREHFAQKGTVTDVKLMRRPDGTSRRF
                     GFVGFRTEAEAEAARAYFDRTYMDTSRISVAMAKQIGDEELEAKKKAGKPDTPVAPPK
                     DTKKQPKENKGASFEEFMSVMAPKLKRKSWMNNEDLGAQAPKEPDAVPEPKKKRKQEQ
                     AVQAPTDGAAADEALSDLEYMRRRMRHKVAGDEPKAFEQSDEESESDDEDAEEAPAAE
                     EEAAARRRAQLEEKQRKDEENVDTIMESGRLFVRNLPFSATEDELAAMFESYGSVEQV
                     HIPVDAQTKTSKGLAFVKFADPAHALLAYRGRDGAIFQGRLLHVLPAVDLAPKPLASS
                     TLKQKRWEAKKAMAGKDFQWGMLYMNSDAVASSISDRFDVPKSVLLGTDDDGTGASPA
                     VRLALAETRIIQETKQFFADHGMHLDALERVKTRTDDTILVKNIPYGTGADEIRALFA
                     RYGDVARVLIPPSNTIAVVEMPVVNEARAAFRALAYKRFKDAVLYLEKAPTGFLPPRD
                     ASQPETVSGVQGKQAPDSSRALLETNEAAADGTLYIKNLSFATTSERLADAFRALDGF
                     VFARVQTKPDPKQPGHRLSMGYGFVGFTRAEHAQRAQEVMQAHVLDGHTLAVSLARRG
                     HDEAPIPRAPSAKMLVKNMPFEATKKDIRELFGAHGVLKSVRVPKQVHGRTRGFAFVE
                     FVSRREAENAMAALRHTHLLGRHLVLEWAGDADGTAGVEELRAKTRGAFVGEADKHRA
                     LGQRAKIRMGTEQVAEAAARERAEQSDD"
     gene            complement(<580921..>581463)
                     /locus_tag="MRET_3165"
                     /note="MRES_10700"
                     /db_xref="GeneID:38739931"
     mRNA            complement(join(<580921..581034,581062..>581463))
                     /locus_tag="MRET_3165"
                     /product="mediator of RNA polymerase II transcription
                     subunit 10"
                     /transcript_id="XM_027629792.1"
                     /db_xref="GeneID:38739931"
     CDS             complement(join(580921..581034,581062..581463))
                     /locus_tag="MRET_3165"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 10"
                     /protein_id="XP_027485726.1"
                     /db_xref="GeneID:38739931"
                     /translation="MDEGRRPPTPTSASLSPPRADMAHSAEVQAPRSVEEIVRRDLDV
                     RTHAVTDALYRLASHVALDQQAQSVGEMVNDVVRSLADVDVMRGHIHDHIPQEVVDLV
                     DAGRNPDSHTRSFMNRLASENQYSLGQYLSIKAFRDQLAPALSQAFPELETSLQHAMQ
                     QHADDTPYPTH"
     gene            complement(<581499..>583025)
                     /locus_tag="MRET_3166"
                     /note="MRES_10705"
                     /db_xref="GeneID:38739932"
     mRNA            complement(<581499..>583025)
                     /locus_tag="MRET_3166"
                     /product="26S proteasome regulatory subunit N3"
                     /transcript_id="XM_027629793.1"
                     /db_xref="GeneID:38739932"
     CDS             complement(581499..583025)
                     /locus_tag="MRET_3166"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N3"
                     /protein_id="XP_027485725.1"
                     /db_xref="GeneID:38739932"
                     /translation="MAPETKADEVAAPVHDKAQYLAILRHNTQLLQRSVAHVEQRYTA
                     RVVRSLPYMRRHAQAWADVLALLVNETFKGAHREELLVHLPPPYKPESAAEETQPEAM
                     DEDASTAPAADEAFPEVLAYVRLLVVVYLLSQPSSLAQATSLCSKAVDDVVQQNRRSL
                     DILGAKLVYFLTRCYELNKDDKLSSLRDRLLALQRTASLRHDSETNATVQNALLRMYM
                     VEDNLYDQAAKLVARAPFPRAKASNPQVARYDYYVGRIRAVELNYSDAHAHLQQAIRR
                     APQHGLVMKRDASTKPVAAGFHQTAYKLLIIVELLMGDLPERGIFRLPLLRRALASYL
                     PIVQAVRAGDLALFQATLQKHQALFLQDKTYSLILRLRHNVIKTGIRRISLAYARISL
                     ADITRKVHLESEEDAEYVIVKAIRDGVIDARVDHENAIMISNEAVDLYATNEPQAQLV
                     QRIDFCLQLHNDSVKAMRYSLDHHRAELDSASAAHARERELVKEIAEGDLGDSEDDWP
                     "
     gene            complement(<583103..>584860)
                     /locus_tag="MRET_3167"
                     /note="MRES_10710"
                     /db_xref="GeneID:38739933"
     mRNA            complement(<583103..>584860)
                     /locus_tag="MRET_3167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629794.1"
                     /db_xref="GeneID:38739933"
     CDS             complement(583103..584860)
                     /locus_tag="MRET_3167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485724.1"
                     /db_xref="GeneID:38739933"
                     /translation="MLSFMKSQLPPLRDTLAQMSLSEPSNRMPGGIPLDDVSSRKSLV
                     SEDAHEHDTNMEHGAHAASVHDHKEEEEEDSFTDTSVQSEVFLIVHANLKRKSSHPYD
                     LQVQLVRPKNRGRSTTTSSAGHHAATKDDHTQQGLSRRPSFQSFLSTQSGRSDSNEQS
                     LGRRMIPMYNLDYHHIRPKLVLDAGTDQVMAKFSKKGIELDGFGTLHSFEIGFIHEHH
                     TFVGLQDSDEESNYTKSLESMEQGAPTVTEQHRESRFKRQLRRFHKKFQSKSRSPPKT
                     TRLSPYLRNMPKLKRINSDETYQGMLRAMVAVQNPQATPGAGSANGKITTSYVWGIKE
                     YARRVTDEERLPHAEHPVLRGIYDGKDEAQSFKVTVADVIFERIWRQFSYYRRHNVKT
                     RHPSHEDDISVWFEWVRDWNGGADNEHNIYDPAIHGPLESYPSPDRSVHSSPSTSPAL
                     LPRSDHVMKGTAEIAATDLGVPHQMAALPASTHSQQHLSIPGESDLASFSWTCYLVLN
                     GDARIPIGQLIPAPHHPLIACELLLPSPLPGLRCLPIGSDRNGFSREELRDIVTITAL
                     HLTLREKLGCLIDTAGGCS"
     gene            complement(<585219..>585869)
                     /locus_tag="MRET_3168"
                     /db_xref="GeneID:38739934"
     mRNA            complement(join(<585219..585284,585313..585476,
                     585500..>585869))
                     /locus_tag="MRET_3168"
                     /product="cysteine and glycine-rich protein"
                     /transcript_id="XM_027629795.1"
                     /db_xref="GeneID:38739934"
     CDS             complement(join(585219..585284,585313..585476,
                     585500..585869))
                     /locus_tag="MRET_3168"
                     /codon_start=1
                     /product="cysteine and glycine-rich protein"
                     /protein_id="XP_027485719.1"
                     /db_xref="GeneID:38739934"
                     /translation="MYHRHCLKCVVCQRRLDSVSLLEHDGEPYCSNCHRTHLGQGKDS
                     FGTAVPVKPQHDPSTKSRSFKAVSDTDLHGRRPLPMAPSGSQEPLTVPASVSGQSGSS
                     IFPTPASTAGTPACARCHTPVYFAEQRLAVGRKWHRACLRCEGCRATLDTNRVEEGPM
                     DLWDQGCINTWCHMCYSKKFGPRGIGVAGMSYPTGSGRA"
     gene            <586127..>586858
                     /locus_tag="MRET_3169"
                     /note="MRES_10715"
                     /db_xref="GeneID:38739935"
     mRNA            <586127..>586858
                     /locus_tag="MRET_3169"
                     /product="choline-phosphate cytidylyltransferase"
                     /transcript_id="XM_027629796.1"
                     /db_xref="GeneID:38739935"
     CDS             586127..586858
                     /locus_tag="MRET_3169"
                     /codon_start=1
                     /product="choline-phosphate cytidylyltransferase"
                     /protein_id="XP_027485718.1"
                     /db_xref="GeneID:38739935"
                     /translation="MIPAPVSQGHGVRVTVPASALDTAPREASSISYAALMGTPARIE
                     PSIAPIQSAESIRAWVRDVIYKPNPERTYRIREPPADRPVRIYADGVYDLFHYAHALQ
                     LRQAKLSFPNVHLIVGVVSSSLCEQHKNRPLLESAERYEAVRNCRWVDEVVEDAPWVI
                     DEAFMNKLQIDYVAHDELPYAMATNDDVYDWIKKNGQFLPTRRTEGVSTSDLVARIVS
                     LYRGGELDAKLTKMGEEALTTSSPM"
     gene            <586972..>587428
                     /locus_tag="MRET_3170"
                     /note="MRES_10720"
                     /db_xref="GeneID:38739936"
     mRNA            join(<586972..587076,587112..587325,587352..>587428)
                     /locus_tag="MRET_3170"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 6"
                     /transcript_id="XM_027629797.1"
                     /db_xref="GeneID:38739936"
     CDS             join(586972..587076,587112..587325,587352..587428)
                     /locus_tag="MRET_3170"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 6"
                     /protein_id="XP_027485754.1"
                     /db_xref="GeneID:38739936"
                     /translation="MTTIPARLAKAAQVSHSLAHAQSRARSLYRSFYRSVPEICALYP
                     LDVPPALLRAKIRTKFERYRHVTDVAVLDILLHKGHTEYQETMNAWKQAPHVMQWFRE
                     EEAPAKPETFLGKFYATRDEGRGPTHEGL"
     gene            complement(<587477..>588439)
                     /locus_tag="MRET_3171"
                     /note="MRES_10725"
                     /db_xref="GeneID:38739937"
     mRNA            complement(<587477..>588439)
                     /locus_tag="MRET_3171"
                     /product="serine/threonine-protein phosphatase 6 catalytic
                     subunit"
                     /transcript_id="XM_027629798.1"
                     /db_xref="GeneID:38739937"
     CDS             complement(587477..588439)
                     /locus_tag="MRET_3171"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 6 catalytic
                     subunit"
                     /protein_id="XP_027485528.1"
                     /db_xref="GeneID:38739937"
                     /translation="MVGNPDTWIAQLRECKYLPEEDMMVLCDQVRTLLLEESNIQPVS
                     SPVTVCGDIHGQFWDLLELFRVGGDLPDTSYIFMGDFVDRGFFSLETFSLLMALKARY
                     PGRMTLLRGNHESRQITQVYGFYDECMQKYGSASVWKSCCQVFDYLNIAAIIDGRVLC
                     VHGGLSPELRSLDQIRTIMRMQEVPHEGPFCDLMWSDPEDIETWSVSPRGAGWLFGRM
                     VTKEFNHLNGLELIARAHQLVQEGYKLMHDHHIVTVWSAPNYCYRCGNVASVFQVDDL
                     LHTAHNKTDEAPSRFNASHFKIFDAVPDQDRMHPTRSTASQYFL"
     gene            <588744..>589155
                     /locus_tag="MRET_3172"
                     /note="MRES_10730"
                     /db_xref="GeneID:38739938"
     mRNA            join(<588744..588912,588936..588980,589004..>589155)
                     /locus_tag="MRET_3172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629799.1"
                     /db_xref="GeneID:38739938"
     CDS             join(588744..588912,588936..588980,589004..589155)
                     /locus_tag="MRET_3172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485755.1"
                     /db_xref="GeneID:38739938"
                     /translation="MRLTLCRWQRPDASRPVPRRSPSQRADKPEQLKEFAHRLDSWSE
                     SRSNKSIFESWMALSPRVRIAMGLAAIGFSVTGLYVADWLEKAYPNETARDVAPRPTM
                     THEAPQPRLFSISIVDRES"
     gene            <589245..>590753
                     /locus_tag="MRET_3173"
                     /note="MRES_10735"
                     /db_xref="GeneID:38739939"
     mRNA            <589245..>590753
                     /locus_tag="MRET_3173"
                     /product="dihydrolipoamide dehydrogenase"
                     /transcript_id="XM_027629800.1"
                     /db_xref="GeneID:38739939"
     CDS             589245..590753
                     /locus_tag="MRET_3173"
                     /codon_start=1
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="XP_027485756.1"
                     /db_xref="GeneID:38739939"
                     /translation="MLSALLSRRACVSVRAMQPMTLPRVVSARGLATGSEPYDVVVIG
                     GGPGGYVAAIKAGQLGLRAACIEKRGSLGGTCLNVGCIPSKAMLNNSHIYHDVAHGLK
                     KRGVDVEGVSLNLPSMMKAKDKAVTGLTKGVEMLLKKNKVDYIKGMGSFASPTTLDVE
                     LLDGGKTQVEAKNVIIATGSEVTPFPGVEIDEKQIVSSTGALSLEKVPEKLVVIGGGV
                     IGLELGSVWSRLGAQVTVVEFQDSIGGPGVDGELVATFKKILEKQGLKFELGTKVSTV
                     EKSGDKVTIKAEVKKDGQPKELEADVVLMSIGRRPVTSGLNLEAVGVEVDQRGRVVVD
                     DQYNTTCKGVKCIGDATFGPMLAHKAEEEGIAAVELIKNGFGHVNYDVIPSVIYTYPE
                     VAWVGKSEETLKEEGVAYKVGKFPFLANSRAKTNDETDGFVKFVVEKETDRVLGVHII
                     GPNAGEMIASACLAMEYSASAEDIARTCHAHPTLSEAFKEAALASYDKPINF"
     gene            complement(<590996..>592282)
                     /locus_tag="MRET_3174"
                     /note="MRES_10740"
                     /db_xref="GeneID:38739940"
     mRNA            complement(<590996..>592282)
                     /locus_tag="MRET_3174"
                     /product="mRNA m6A methyltransferase"
                     /transcript_id="XM_027629801.1"
                     /db_xref="GeneID:38739940"
     CDS             complement(590996..592282)
                     /locus_tag="MRET_3174"
                     /codon_start=1
                     /product="mRNA m6A methyltransferase"
                     /protein_id="XP_027485750.1"
                     /db_xref="GeneID:38739940"
                     /translation="MHHRRWRASLAARHGLADVDGDVSWHARDHPRWPLVREWRRDGS
                     SPPWGPNYAPDAHTVRNDYGARFVDSGLVTPPSAWVPTSDARAAEHPKRRRLLDLKAA
                     LVQASAIPRTYLCADLRAWLDPHASLGVLEAVGYDVILIDPPLFSYAWRAPHETRHAC
                     WTWDEVAQLPIPRLASRESFVFLWVGDGRDDGLERGRVCLQRWGFRRCEDIVWAQTES
                     CTQYAPASPSLLTPVVQHCLMGIRGTVVRSTDSFFVHCNIDTDVILWPGERPAPGMPI
                     SLERKPPHLYEIVEHFCLGTRRLELFGTNRNLRDGWLTVGWDVGPQAPSWPAHGALPL
                     DPAAYAAQFVLEPPHCPLYARSNLVPYSDECEQLRPRTPPPEDQRGRPRPAFRAQPPR
                     HQLLNQGAGGRSTVSTPSASEHLSGAQAQIQRRYQR"
     gene            complement(<592308..>592856)
                     /locus_tag="MRET_3175"
                     /note="MRES_10745"
                     /db_xref="GeneID:38739941"
     mRNA            complement(<592308..>592856)
                     /locus_tag="MRET_3175"
                     /product="BAP31 domain protein"
                     /transcript_id="XM_027629802.1"
                     /db_xref="GeneID:38739941"
     CDS             complement(592308..592856)
                     /locus_tag="MRET_3175"
                     /codon_start=1
                     /product="BAP31 domain protein"
                     /protein_id="XP_027485751.1"
                     /db_xref="GeneID:38739941"
                     /translation="MTLYYSIVFALLVLEMAMFMVLIVPLPFSARRKLFRFLATSEIV
                     SRINYCIRITFIFVAVLFIDAFQRMIKVSKETNLGDHHQGYHDLRNETNYHAKKFYAQ
                     RNVYLTGFTLFLSLILARTHSLVLDLINAQEELVSSTSGASHSDDIATMKKQMAQQQA
                     EYNRLTDELAQAKAAVSDKKAD"
     gene            <592996..>594486
                     /locus_tag="MRET_3176"
                     /note="MRES_10750"
                     /db_xref="GeneID:38739942"
     mRNA            <592996..>594486
                     /locus_tag="MRET_3176"
                     /product="DUF89 domain protein"
                     /transcript_id="XM_027629803.1"
                     /db_xref="GeneID:38739942"
     CDS             592996..594486
                     /locus_tag="MRET_3176"
                     /codon_start=1
                     /product="DUF89 domain protein"
                     /protein_id="XP_027485752.1"
                     /db_xref="GeneID:38739942"
                     /translation="MSDRSHASARPASKTLLNLGNLPPKPDYFATDEAASYPRSASLV
                     DPNNPPWPAYRGYHEYSFAHETMGKRLPTILGKAIEDVYKTLNQEWREEVIVDLLQCI
                     ERMTGLMRELQANEKLRPIVDDNEGDVTLWNKAIARYFRGADFMSAPWLFAEAYKYRR
                     LHECFSVSRYWMDYDVFFRQKCDTFGRSGTAVFELSTRFAVPYESNVPASTPEERHDR
                     MRKLFLELTQISLWGNATDLSLLINMTEEDIKKIQSTGGEHLASTEQNILGNDLGRLW
                     DLVSHMRGGRIDFVLDNAGFELYCDCVYADWLIQAGIANEVHFHGKRLPWFVSDVTRK
                     DWSWLLNTMTYGHLFEGATDKEIESLRTLGKRWKQYEKEGKWVYEQHPFWCTGYTFWE
                     LPAEAPDLFHYLCESDLVLFKGDLNHRKLTYDCQAPTSTPFAQAIGPMAQEPGAPPVA
                     SLRTIKSDVVVGVPLQVSERLDAEEPGWRISGKYAVVLLSDGSPVS"
     gene            complement(<594483..>595343)
                     /locus_tag="MRET_3177"
                     /note="MRES_10755"
                     /db_xref="GeneID:38739943"
     mRNA            complement(<594483..>595343)
                     /locus_tag="MRET_3177"
                     /product="NGG1 interacting factor"
                     /transcript_id="XM_027629804.1"
                     /db_xref="GeneID:38739943"
     CDS             complement(594483..595343)
                     /locus_tag="MRET_3177"
                     /codon_start=1
                     /product="NGG1 interacting factor"
                     /protein_id="XP_027485753.1"
                     /db_xref="GeneID:38739943"
                     /translation="MASADPTLTAVQSWFDEHAPTHLAGAWDNVGLIAQSPVPSEATG
                     VFLAVDLTPAVAEELLARGDIRVAVVYHPVIFGGVKALRMQNALQRSILRCIAAGIHL
                     YCPHTTLDACHGGINDWLMAGLSHAWETCAPGDLYSAVQHAKYEVIEPNDRDPSVGMG
                     RRLVWAQPVAWSTLVARTKALLRVPYVQVAPAPGVTEASAMQSLGVCAGSGSSILRQC
                     AVDVFVTGEMGHHDLLAANARGVSVIVANHTNTERQYLKDVLRPAMRASHPTLPVYVS
                     EHDADPLRVV"
     gene            <595421..>598828
                     /locus_tag="MRET_3178"
                     /note="MRES_10760"
                     /db_xref="GeneID:38739944"
     mRNA            <595421..>598828
                     /locus_tag="MRET_3178"
                     /product="DNA-directed RNA polymerase III subunit RPC2"
                     /transcript_id="XM_027629805.1"
                     /db_xref="GeneID:38739944"
     CDS             595421..598828
                     /locus_tag="MRET_3178"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC2"
                     /protein_id="XP_027485748.1"
                     /db_xref="GeneID:38739944"
                     /translation="MDEVMEAAAQAGKSLTEPVKAIEDKWLLLPAYLQVKGLVKQHID
                     SFNYFVDVDLKNILRANERVTSDIDPKFYLKYTDISVGRPERSDPDAIDRSITPHECR
                     LRDITYSAFIYVDIEYTRGGKIVRRKNVPIGRLPIMLRSNKCWLAGQDDAALARMNEC
                     PLDPGGYFVVKGTEKVILVQEQLSKNRIIVEADSRKGIVQASVTSSTHERKSKSYVLT
                     KHGLIYIKHNSLHEDIPIVIVFRALGIQSDKEILQLVAGQDEAYAELFAVNIEKAAKL
                     EVFSRRQALDYIGARVKVMRRGVGLRRSASDEALEVLATVIMAHVPVENGNFRNKTMY
                     IATMVRRVLVCMLDESKVDDRDYVGNKRLELAGQLLALLFEDLFKKFNFDLKTNIDKV
                     LKKPNRTAEFDAYNQFFYHGDYITAGFVRAISTGNWSLKRFKMERAGVTHVLSRLSYI
                     SALGMMMRISSQFEKTRKVSGPRALQSSQWGMLCPSDTPEGEACGLVKNLALMTHITT
                     DVDEAPIVRLCYTLGLEDINLLTGAELYQPDTFIVFLNGNVLGVTHAPHRFVAQFRRL
                     RRKGLMSEFVGIYTNMHHQTVHIASDGGRVCRPMIIVERGQPQVTSAHIRQLQAGAMS
                     FDDFLRHGLVEYLDVNEENDSNIALFEHNIKPSTTHLEIECFTLLGAVAGLVPYPHHN
                     QSPRNTYQCAMGKQAIGAIGYNQLNRIDTLLYLMVYPQKPIVSTKTIELIGYDKLPAG
                     QNAMVAVMSFSGYDIEDALVLNGASLDRGFGRCQVMRKQSTVLRKYANGTFDRLADAP
                     LNEHGEPLRRFECLEADGLAGAGERLEPGDVFVNKQMPINANDNSAGTMMNTAVAYKN
                     APLSYKAPVGGYVDQVLVSDTDSDQTLVKALIRQTRRPELGDKFSSRHGQKGVVGLIV
                     PQADMPFNDAGICPDIIMNPHGFPSRMTVGKMIELMSGKAGILRGTQEYGTAFGGSDV
                     YDMSRVLVEHGYNYGGKEYLTSGMTGEPLEAYVYFGPIYYQKLKHMVMDKMHARARGP
                     RAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGATQLLLERLMVSSDAFVVNACEQCGL
                     LGYNGYCGYCKSSKHVVKLTVPYATKLLFQELMAMQVVPRLVLEEAV"
     gene            <598878..>599423
                     /locus_tag="MRET_3179"
                     /note="MRES_10765"
                     /db_xref="GeneID:38739945"
     mRNA            join(<598878..599286,599422..>599423)
                     /locus_tag="MRET_3179"
                     /product="protein of unknown function (DUF3128)"
                     /transcript_id="XM_027629806.1"
                     /db_xref="GeneID:38739945"
     CDS             join(598878..599286,599422..599423)
                     /locus_tag="MRET_3179"
                     /codon_start=1
                     /product="protein of unknown function (DUF3128)"
                     /protein_id="XP_027485749.1"
                     /db_xref="GeneID:38739945"
                     /translation="MGSFVSRPSVGEARADMDTLRREELVLEAAANPRDEFPPSCLTL
                     FDRWLTCYALGPQFRSIYRYGTIADCAPRREDFKYCLTLRSLEPEERRAKWLERRAEA
                     KAHKRKGFRSSEAVWDMRREPLMDPALVDPAYPL"
     gene            complement(<599730..>600320)
                     /locus_tag="MRET_3180"
                     /note="MRES_10770"
                     /db_xref="GeneID:38739946"
     mRNA            complement(<599730..>600320)
                     /locus_tag="MRET_3180"
                     /product="Mago binding protein"
                     /transcript_id="XM_027629807.1"
                     /db_xref="GeneID:38739946"
     CDS             complement(599730..600320)
                     /locus_tag="MRET_3180"
                     /codon_start=1
                     /product="Mago binding protein"
                     /protein_id="XP_027485745.1"
                     /db_xref="GeneID:38739946"
                     /translation="MMTARPSGLVQDAQTGDCVIPASVRADGSIRKERRVRPGFLPLE
                     DVPRFRSRRLLERKEAERHEEPTRFERSKGEKSVPQDATKGSYKRPTEKAPAHTSSQS
                     ALPTEPKSRGARRVDVKSEARSKGARRDAPEDAPRDHRKAAPRKTKHDTPSQDAPETK
                     GSVEHTTDAPRTAEASSVDALEERFSSLSMQGISGR"
     gene            complement(<600399..>601050)
                     /locus_tag="MRET_3181"
                     /note="MRES_10775"
                     /db_xref="GeneID:38739947"
     mRNA            complement(join(<600399..600514,600684..600763,
                     600797..>601050))
                     /locus_tag="MRET_3181"
                     /product="large subunit ribosomal protein L28e"
                     /transcript_id="XM_027629808.1"
                     /db_xref="GeneID:38739947"
     CDS             complement(join(600399..600514,600684..600763,
                     600797..601050))
                     /locus_tag="MRET_3181"
                     /codon_start=1
                     /product="large subunit ribosomal protein L28e"
                     /protein_id="XP_027485773.1"
                     /db_xref="GeneID:38739947"
                     /translation="MSTQDLHWLLVRKSNSFLVKQKGLGRVFSREPGNLAAFHSYKHS
                     GLVNDKSVGIVPAENRGVIVTTRKQKTSPRAIRGARASTTIKGGSRRVAGAVANVAAK
                     HGYRADLRKDAVARATAIVNSQVRKQRVPRTRAPRGAAARKLAAEQA"
     gene            <601198..>601786
                     /locus_tag="MRET_3182"
                     /note="MRES_10780"
                     /db_xref="GeneID:38739948"
     mRNA            join(<601198..601251,601277..601353,601378..>601786)
                     /locus_tag="MRET_3182"
                     /product="prefoldin subunit"
                     /transcript_id="XM_027629809.1"
                     /db_xref="GeneID:38739948"
     CDS             join(601198..601251,601277..601353,601378..601786)
                     /locus_tag="MRET_3182"
                     /codon_start=1
                     /product="prefoldin subunit"
                     /protein_id="XP_027485774.1"
                     /db_xref="GeneID:38739948"
                     /translation="MAGETASDTRGIPTAPFVHDVAEFVGGADKDVGPTLQQFQEALS
                     KYKFMELSTAQRRKVLEQKIPDITKTLQMVEFLKTRKGCPEPTETTCELNDTLLCRAT
                     LDPIDKVHLWLGANVMLSYDIDEAIDMLRDKLETAKRSMDIANDDLGFLRDQITTMEV
                     NTARVHNWDVKRRREQRQT"
     gene            <601827..>604019
                     /locus_tag="MRET_3183"
                     /note="MRES_10785"
                     /db_xref="GeneID:38739949"
     mRNA            <601827..>604019
                     /locus_tag="MRET_3183"
                     /product="translation initiation factor IF-2"
                     /transcript_id="XM_027629810.1"
                     /db_xref="GeneID:38739949"
     CDS             601827..604019
                     /locus_tag="MRET_3183"
                     /codon_start=1
                     /product="translation initiation factor IF-2"
                     /protein_id="XP_027485746.1"
                     /db_xref="GeneID:38739949"
                     /translation="MWWRSTVRFVGLGARPMSSTPRWCAEARRDVRARSVPSAKNWYR
                     PQVRHAPPKKEARPQGGSAPPTQRKVSPPKQVTPLVSLPTIVSVHDLARILRVHMRKL
                     QFRMEQIGFDDTRPDRLLKLEDAELIAAEYNIMVATKQDSELDIYPRPAPTPEERATL
                     PLRPPVVTIMGHVDHGKTTLLDTLRSTSVAAGEAGGITQHIGAFSVPVKRPEGAISSV
                     TFLDTPGHAAFSTMRSRGSSVTDIVVMVVAADDSVMPQTREVISLVRGDDRHVPLVVA
                     ITKMDAPKADPQRVRYDLCAEGIDVEDLGGDVPCVEVSAKQGIGLDALDETLAVMAEM
                     AELRAETSGMAEGRILESRVEKGRGNVATVLVQRGSLALGDVIVCGTTWAKVKQLMQP
                     DGRATKQVLPGYAAQVAGWRELPKAGDQFIGAPDEARGKRAVEYRQRIVKEQALLLDA
                     EQIDEGRRRKAEADAQRERAEQLTRREMQRLQRAEEEGTMHAEAVAQAVRAQNVTEQE
                     ASETRAILPLILKADVSGTAEALAHTLAPIGNARAGVKIVSQGVGDLTESDVNVAHAV
                     GAHVIGFHVKASKAIQTLAARMQPPVAVHCDDVIYRLMDHVTDQVARLLPPRDEMRVV
                     GEAQVAQLFHIKQGSRRPPKCVAGCRVTNGVISRASEVRVLRGDDRHEVFRGKLDTLR
                     QVKKDVAEMRKGTECGMSFDGFDGLQVDDQIQCFTMVQVPASLHSSTS"
     gene            <604081..>604596
                     /locus_tag="MRET_3184"
                     /db_xref="GeneID:38739950"
     mRNA            <604081..>604596
                     /locus_tag="MRET_3184"
                     /product="ubiquitin-conjugating enzyme E2 G1"
                     /transcript_id="XM_027629811.1"
                     /db_xref="GeneID:38739950"
     CDS             604081..604596
                     /locus_tag="MRET_3184"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 G1"
                     /protein_id="XP_027485776.1"
                     /db_xref="GeneID:38739950"
                     /translation="MTTSGNALLLKKQLVELRKNPVDGFSAGLKDDSNLFEWDIMIIG
                     PNDTLYEGGFLRAELSFPQEYPLLPPKLTFKTPMWHPNIYQDGTLCISILHEPGTDEY
                     GYEDASERWLPVHTVESILVSVISLLSTDPPNTDSPANIDAAKQVREDLVGYRRKVRR
                     LVRQSSEEAFD"
     gene            complement(<604599..>605543)
                     /locus_tag="MRET_3185"
                     /note="MRES_10790"
                     /db_xref="GeneID:38739951"
     mRNA            complement(<604599..>605543)
                     /locus_tag="MRET_3185"
                     /product="CCR4-NOT transcription complex subunit 7/8"
                     /transcript_id="XM_027629812.1"
                     /db_xref="GeneID:38739951"
     CDS             complement(604599..605543)
                     /locus_tag="MRET_3185"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 7/8"
                     /protein_id="XP_027485775.1"
                     /db_xref="GeneID:38739951"
                     /translation="MSGRIRDVWADTFEAEMGHIRAVIRKYPYVAMDTEFPGIVARPI
                     GQFRGSTDYHYQTLRCNVDLLKMIQVGLTVCDEHGNLPPDTCTWQFNLRFDVQQDMCA
                     PDSLELLTAAGIDFERHLRFGIDQEWLGEMLVSSGLVLLPDVRWISFHSGYDFGYLLK
                     LVTCQSMPATEAEFFEMLHLWFPCVYDVKFLMRSCKTLKGGLQDLADDLQVSRMGQQH
                     QAGSDSLLTASTFFRLRDRFFEGVIDDAKHLGCLYGFANTMSATLTPAGTVVYQPVDA
                     VRTPVMPSMPTSVLPAGAGGAQPPMAAPATARSLYTTT"
     gene            <605660..>606745
                     /locus_tag="MRET_3186"
                     /note="MRES_10795"
                     /db_xref="GeneID:38739952"
     mRNA            <605660..>606745
                     /locus_tag="MRET_3186"
                     /product="26S proteasome regulatory subunit N10"
                     /transcript_id="XM_027629813.1"
                     /db_xref="GeneID:38739952"
     CDS             605660..606745
                     /locus_tag="MRET_3186"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N10"
                     /protein_id="XP_027485441.1"
                     /db_xref="GeneID:38739952"
                     /translation="MPLEATMLVLDNSEWMRNGDYTPSRWDSQSDAVNVLFDAKTNAH
                     PENMIGVLTMAGKSPAVLATLTQDISKVFAGIHSSKLSGRIGLATGINVAQLALKHRQ
                     NKNQRQRIIAFVGSPVADSEETLVQLAKKLKKNNVAVDIISFGEHEQNGAKLHKLIET
                     VNSHDNSHLVTVPADAGPLSDTLLSSQIVLDGDDDQAGPSGSSGPASRFQFGVDPNAD
                     PELALALRLSLEEEQARQRQTQENEGGAQEQQPPTAPETQHPAEGATGSLVPIDAPPL
                     SGTSGLDTDMARQADHDDKLLKQALALSQQLASKEEEDAPMESSEASSQRATVAGLHE
                     GDQDEEMTEEEAIARAIEMSMMDSHKS"
     gene            complement(<606874..>608069)
                     /locus_tag="MRET_3187"
                     /db_xref="GeneID:38739953"
     mRNA            complement(join(<606874..607036,607071..607830,
                     607868..>608069))
                     /locus_tag="MRET_3187"
                     /product="pheromone a factor receptor"
                     /transcript_id="XM_027629814.1"
                     /db_xref="GeneID:38739953"
     CDS             complement(join(606874..607036,607071..607830,
                     607868..608069))
                     /locus_tag="MRET_3187"
                     /codon_start=1
                     /product="pheromone a factor receptor"
                     /protein_id="XP_027485777.1"
                     /db_xref="GeneID:38739953"
                     /translation="MLNVALPVFEVISVVLAIFPIPSHWRAKNISMLMLVFWLILGNL
                     NNFINRVIWIKDADNKAPGWCDISVKIMSMVTMGIPCAALCISIKLCRIASMRFKPRT
                     MIERRNGALIDLAWMIFTPIAYALLTLINQGHRFNIVEGQGCQPAIYFTPVAAIVDYG
                     LPLGISFISILCSLMALGYFIVQKRNFEHVVSQSRCGLNTKRFIRMISFTIIDLMLTF
                     PTLLANLGLELAYTPMFTYKSWNIVHQRFDDVWKYTADLFETPQGKRYLILSLFSAWA
                     LCASGFMFYLVFGFSSDAFTDNSQPCVTFKSLFVKDIDPMEVPSNINVGTEYEKQEMT
                     FSGFLNIEASNDSIKCAQSDIESDMSDLSENSEHMNYPKE"
     gene            <609371..>610141
                     /locus_tag="MRET_3188"
                     /note="MRES_10800"
                     /db_xref="GeneID:38739954"
     mRNA            <609371..>610141
                     /locus_tag="MRET_3188"
                     /product="exosome complex component RRP41"
                     /transcript_id="XM_027629815.1"
                     /db_xref="GeneID:38739954"
     CDS             609371..610141
                     /locus_tag="MRET_3188"
                     /codon_start=1
                     /product="exosome complex component RRP41"
                     /protein_id="XP_027485779.1"
                     /db_xref="GeneID:38739954"
                     /translation="MDGRRPHEFRSMELTVSPHASATTSLVPTTASASVRPDGSAKVT
                     QGLTSVTACIYGPREPSRMARTPIVRPNRASIHAEIAMAPWGGQDWRHRSRNDRRIVE
                     WANALRSTFEPVVQLHLYPRAQIDMVLYVHQQDGGVLPAMIHACTLALMDAGVAMSDY
                     VTAMTCGLYGSTALLDLNVTEQMDLPYATVAILPRTGGVPLLQLDTRMHKDRFDTMMR
                     TCVEAADVLQSELDAAIRGRTAQLVEAAVASRPRPMDR"
     gene            <610346..>611356
                     /locus_tag="MRET_3189"
                     /note="MRES_10805"
                     /db_xref="GeneID:38739955"
     mRNA            <610346..>611356
                     /locus_tag="MRET_3189"
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /transcript_id="XM_027629816.1"
                     /db_xref="GeneID:38739955"
     CDS             610346..611356
                     /locus_tag="MRET_3189"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="XP_027485778.1"
                     /db_xref="GeneID:38739955"
                     /translation="MVNVGINGFGRIGRIVFRNSLNHADTDVVAVNDPFIDLDYMVYM
                     LKYDSTHGRFDGEVSARDGKLIVNGRAIHVYAEKDPSNIPWSESGALYVIDSTGVFKS
                     IEKASAHLKGGARKVVVSAPSEDAPMYVCGVNLDSYKTSDNIVSNASCTTNCLAPLAK
                     VVHDKFGIIEGLMSTVHATTATQKTVDGPSAKDWRGGRAAGANIIPSSTGAAKAVGKV
                     IPSLNGKLTGMAFRVPTIDVSVVDLTVRIEKGASYDEIKAEIKRASENELKGILGYTE
                     DDVVSQDFVGDNHSSIFDAKAGIALGPNFVKLVSWYDNEWGYSRRCLDLIAFMAKKDG
                     AN"
     gene            complement(<611368..>613959)
                     /locus_tag="MRET_3190"
                     /note="MRES_10810"
                     /db_xref="GeneID:38739956"
     mRNA            complement(<611368..>613959)
                     /locus_tag="MRET_3190"
                     /product="cell division control protein 24"
                     /transcript_id="XM_027629817.1"
                     /db_xref="GeneID:38739956"
     CDS             complement(611368..613959)
                     /locus_tag="MRET_3190"
                     /codon_start=1
                     /product="cell division control protein 24"
                     /protein_id="XP_027485265.1"
                     /db_xref="GeneID:38739956"
                     /translation="MHGLADAPPGTSPATASSVPMMPPSPAMSYPRHASAPPSGLFQT
                     CTQLAKRLGCVYGFEHELPRTWARPGTDAFDPVSDLWHFFRLGKPLCMLFNVYATYMR
                     WPLISYTTELRLSNANMCKALVMRFILALKERLGWDPDDTFTVSQLYLNDTNGFVRVV
                     RTVDRLVTLLEERGLVHLHTPHPYDTPEQFIRTAPPDQRELVSRELLESERKYVGDLE
                     ILQAYASALSQYDLVSQDTLHHIFGNLDQLVDAQRRFLICLEQNAQKPADKQLLSGIF
                     RALEDDFSVYDLFCANYAHALHHINDERSALAALAQIPAAQSRYLEPTYELPTYLIKP
                     VQRICKYPLLLEQLLKHTPELERADLIDALTIIRRITDRVNETRRAQENEQLVQNLES
                     RVEDWKGHSLQTFGPLLLCDSFIVSKGDSEREFCVYLFEHILLCCKDTSHAMPSRTRS
                     KSSTRLRPRGGSVSESSRRQERLSAPLQLKGRIFLSNMVGIQALGRQADAYILQVWWH
                     GELDIESFCLKCKNEEQLRIWHSTLQRQLDEIRQRRETVAARQRSAMTPMTPHLPADV
                     SSRAPCTASSLSIRTPSVSECDSPREMYVPDDISPSPHKVWRQMSLGHPPHMSPCTLP
                     MRSSSVSGQAHPEFLEKELEAMRIGRTPTRHRGLAAARGGPPPMHLDMTAMQRTASDS
                     MAMRSFMSPLGTATPADWHPTPVTLPNAPVSPKSEWNPYFGAAPEPSLRHTSISTAGS
                     RRSGEPTAPTSASPRHNSGSGASATSGSAWLRSAPHSPALGAPSVMVHVRRGTEHIDV
                     ALPSAVRFGELHAHVHRHMRLDPHARMYHIDEDGDRVMLLDDDDLATAMDHVHRHPDP
                     HLLLVIE"
     gene            <614182..>615690
                     /locus_tag="MRET_3191"
                     /note="MRES_10815"
                     /db_xref="GeneID:38739957"
     mRNA            <614182..>615690
                     /locus_tag="MRET_3191"
                     /product="protein disulfide-isomerase A1"
                     /transcript_id="XM_027629818.1"
                     /db_xref="GeneID:38739957"
     CDS             614182..615690
                     /locus_tag="MRET_3191"
                     /codon_start=1
                     /product="protein disulfide-isomerase A1"
                     /protein_id="XP_027485266.1"
                     /db_xref="GeneID:38739957"
                     /translation="MIMPGIRAWTLVALATLGVWASEGADGAADSKVVVLTKDSFPAF
                     VNEQALSLVEFYAPWCGHCQALAPQYEIAAKELVSENIKLAKVDCTQEEALCGEQGIS
                     GFPTLKVFRHGSATPYAGSRKSEGIVSYMVKQNMPAVSDVTAANLEDFTGKDKFVVVA
                     YLDKADTESHSELKRFAEEARDMFLVGVSTDKELAKAQGVKAPALVAYRAFDDPRVTH
                     QARGKSLTSDEIKSFVQVESLPLVSEISADNFLQYATSGLPLAYYFADPASSTLEDEV
                     KKLADVAREVRGKVNLVWIDATKYGSHGKALNLKGDAWPALAIQDMETGAKYPLNDLG
                     KDIAGSVRSFLSKYVAGKLTPSLKSAPVPKQTSALIDVVTDEFDKWVLDDSRDVLLEL
                     YAPWCGHCKRLAPTYEKLAELYAADAQASKQVRIAKMDGTENDLPPHADIQLTGFPTI
                     VLKPAGKHVREFIVYDGDRTLESLSDFVATQGKNKAKISVPAPEQPVKHDEL"
     gene            complement(<615697..>617556)
                     /locus_tag="MRET_3192"
                     /note="MRES_10820"
                     /db_xref="GeneID:38739958"
     mRNA            complement(<615697..>617556)
                     /locus_tag="MRET_3192"
                     /product="L-gulonolactone oxidase"
                     /transcript_id="XM_027629819.1"
                     /db_xref="GeneID:38739958"
     CDS             complement(615697..617556)
                     /locus_tag="MRET_3192"
                     /codon_start=1
                     /product="L-gulonolactone oxidase"
                     /protein_id="XP_027485263.1"
                     /db_xref="GeneID:38739958"
                     /translation="MKVAVHERQHPLGGMAQRFYRPPPEFAQASSNAVLEAIVEPVRV
                     DSASPSAHLTNWARTFATDDASTDDGAFSQVTRHVFAPSSIEHVVAIVELARRHAMPI
                     RAVGRRHSPSDLPFSLGWTVRTDELHGIVHLDTRKREVCVLAGTYIETLTASLAKHGF
                     GFSNLGSISQQTIAGLISTASHGSGIHFPAMSAYVRALDVVCPLASGTQVVHCDRDER
                     PDLFNASLCGLGATGVIVTVTLAIEPAFRLRQVCEDVPEDELLGAPDDASLLCAPDQL
                     SVEPYDTFIEHPSWLGTMLAHGVPLPSPPTLAQAPTSKGPAHVYPFEPASAAPPALIP
                     WHVASVQAHIESLVASAEHVRFLWSPHAHMITVDRASRTDERRTPTQTSLIAPPLIKA
                     LLFASRFHASLPAPVSRAAFALTHARAPPVPRNELDTPGGLRPVRTDTAISVRVDDAP
                     RVFNFDCLCEQYTTEYAVPFEYTGAALVAIRAWLQEEHARPDGERIHFPIEVRFVDAD
                     GIWLSPSYGRRTCYIGLVQYRPYRWPVRYRRLFARFEALMRQFDGRPHWAKTHTAYRP
                     ELLTLYPHLPDWLRTVATYDPQRLLVNPYVARHLLDEHAAGRQGTFRRRRCRL"
     gene            complement(<617583..>618740)
                     /locus_tag="MRET_3193"
                     /note="MRES_10825"
                     /db_xref="GeneID:38739959"
     mRNA            complement(<617583..>618740)
                     /locus_tag="MRET_3193"
                     /product="26S proteasome regulatory subunit N9"
                     /transcript_id="XM_027629820.1"
                     /db_xref="GeneID:38739959"
     CDS             complement(617583..618740)
                     /locus_tag="MRET_3193"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N9"
                     /protein_id="XP_027485264.1"
                     /db_xref="GeneID:38739959"
                     /translation="MDGRDYLTSVLSDDHVPQELRAYYESFRELRDQRLWYQLTLQVE
                     SFLRHPASQERPRHIDLYEHFIRTFARHINHLVLASMGVIVSRQYEHAADALAFLQRL
                     ATETDQPETQDAHVLLSMEAAHFQLLLGDLSGTRAAMDRCAKLLDSFDAVEPVVHASF
                     YRVCGNYHKAKAEYADYYRNYFLFLACIHVDAEMSKAEQVQCAHDLSISALLGDTIYN
                     FGELLLHPILASLQGSEYAWLADLLFAFNAGDMGRFEALLPRLASEPMLQAHVPFLRQ
                     KLCLMALIESLFHRSMYDRTLPFTTLASETRIPVDEVEHLVMKALCLGLVRGSIDQVA
                     QLVRITWVQPRVLDTDQMQALLRRLTDWSERVDRVATFVHQQSPDLFPHAL"
     gene            <618862..>619634
                     /locus_tag="MRET_3194"
                     /note="MRES_10830"
                     /db_xref="GeneID:38739960"
     mRNA            join(<618862..618962,618987..619027,619054..>619634)
                     /locus_tag="MRET_3194"
                     /product="phosphatidylethanolamine/phosphatidyl-N-
                     methylethanolamine N-methyltransferase"
                     /transcript_id="XM_027629821.1"
                     /db_xref="GeneID:38739960"
     CDS             join(618862..618962,618987..619027,619054..619634)
                     /locus_tag="MRET_3194"
                     /codon_start=1
                     /product="phosphatidylethanolamine/phosphatidyl-N-
                     methylethanolamine N-methyltransferase"
                     /protein_id="XP_027485269.1"
                     /db_xref="GeneID:38739960"
                     /translation="MADWWQTWLEPPAARRVGWVDVSRPSLWICVVSILFNPTFWNVV
                     AQHEYRHKTITRILGGRRYLGCYMLAATIFTLGIVRDHLYQLALLEQPVHPTLLHPAV
                     RVAAVLLFAVGTVLVVSSMWALGVTGTYLGDYFGILMDAMVTGFPFNVLSDPMYVGST
                     LNFVAVALWFARPAGLVLSALVWLTYRVALCFEGPFTARIYREAAEKKAAAAKKAAER
                     KAAATPSRAPYATRSQTRKRAL"
     gene            <619682..>620431
                     /locus_tag="MRET_3195"
                     /note="MRES_10835"
                     /db_xref="GeneID:38739961"
     mRNA            <619682..>620431
                     /locus_tag="MRET_3195"
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase"
                     /transcript_id="XM_027629822.1"
                     /db_xref="GeneID:38739961"
     CDS             619682..620431
                     /locus_tag="MRET_3195"
                     /codon_start=1
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase"
                     /protein_id="XP_027485270.1"
                     /db_xref="GeneID:38739961"
                     /translation="MRWRRCLLRGLRAVACVWCVCLVLQWSMAGTYHTAPWPRHALML
                     TAHPDDECMFFGPIIQSLVQHGVTVSALCLSEGNAEGLGRVRAHELTRSYSVLGVPRD
                     RVTCLDDAALQDGMDVSWSAAYIRRLLAQYVEDHAVDVVITFDERGVSLHPNHRAVYD
                     GARLWAETHPRRLWTLDTLTWRTKFAGPVSAVLQRWSASDWVVLASWRAYATSLAAMW
                     QHRTQLVWFRYLYMACSSYMQANRLTMVQGG"
     gene            complement(<620428..>621612)
                     /locus_tag="MRET_3196"
                     /note="MRES_10840"
                     /db_xref="GeneID:38739962"
     mRNA            complement(<620428..>621612)
                     /locus_tag="MRET_3196"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629823.1"
                     /db_xref="GeneID:38739962"
     CDS             complement(620428..621612)
                     /locus_tag="MRET_3196"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485267.1"
                     /db_xref="GeneID:38739962"
                     /translation="MAATTHRHWPGTLIADGRLELLSTLGLGAYGVVYLARGVHRPQY
                     YAVKCLNKVGLDQRQRAFQLREIFVHTMMSNHPNVVRLHGVLDHPGDASVYVVLEYCP
                     DGDLFEMITEKQRYYLPPEPYVADPRASDGRPIPEHPSYTRARAEMDALIKDVFDQIL
                     SAVEYFHRVGVYHRDLKPENILCSDGGRRVKVADFGLATSDRMSSDFGCGSSFYMSPE
                     CQGGITTRLTEYSTAANDVWSLGIILINLICGRNPWKQATWQDDTFRQYLRDPDLLAK
                     ILPISDAVHAILRRIFTLSPETRCSVSDLRRWIRAVPRLQASNEELWRRYHFFDTPDS
                     PDASVDAVFSGLSLHDASSSSPEASTPASPLAPSPPPPPPPPWSACSLCCHTRDARAL
                     AI"
     gene            <621930..>623129
                     /locus_tag="MRET_3197"
                     /note="MRES_10845"
                     /db_xref="GeneID:38739963"
     mRNA            <621930..>623129
                     /locus_tag="MRET_3197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629824.1"
                     /db_xref="GeneID:38739963"
     CDS             621930..623129
                     /locus_tag="MRET_3197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485268.1"
                     /db_xref="GeneID:38739963"
                     /translation="MHRLWNRAKPPPAPQVVRDDDHVYPTYGGEVPALTERHARSRRE
                     ESAPWDDRPRPRFSFLRRHGEGEASDGGPSRALLHGVLATQKRTMRDTDAVAQDVMAF
                     CFAQPSYMDREYAYELLEMVDASDAHAKTAMAVLRRILTCGVWMAQCRAMRAWGMWTM
                     QSQGAWAAHAMQAKFFAAVEEVWDAAVPPLRRDLYRVLAAVVYEAPPDKSQRLAKLWA
                     RIRPAGRAEAGEPLDEPLFHDEPLLPRSLQAAPGQQRRGMPAAAQRDDERAPIPPEDR
                     QLECVAAHTCAVVLTDALRTDDRDDALIEALYEDAASLQAQLQSYARDDASQDAVLRA
                     LTHLNEALALHNDYKASQHDTRPGTPESELSDDGPAQPSEKALGKRRAIDEGKPPLPP
                     IPPSIVR"
     gene            complement(<623126..>623650)
                     /locus_tag="MRET_3198"
                     /note="MRES_10850"
                     /db_xref="GeneID:38739964"
     mRNA            complement(<623126..>623650)
                     /locus_tag="MRET_3198"
                     /product="cytochrome c oxidase subunit"
                     /transcript_id="XM_027629825.1"
                     /db_xref="GeneID:38739964"
     CDS             complement(623126..623650)
                     /locus_tag="MRET_3198"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit"
                     /protein_id="XP_027485271.1"
                     /db_xref="GeneID:38739964"
                     /translation="MDPTETGADRLWRRLREDPLTPIGSVLTAAALTYATVQLRRGNQ
                     KLFQRALRYRVAFQAVTVGTAAVGLLYFRTPKSRVPPPGPDGKPQKLEAWNPEKIERR
                     ERETDAEWHARMAGAQSRDDREMQAIERMVQEAIQRRKEREQQAPAHSDAPSDTPAPS
                     VLDRIGQDKRRFTF"
     gene            complement(<623676..>625592)
                     /locus_tag="MRET_3199"
                     /note="MRES_10855"
                     /db_xref="GeneID:38739965"
     mRNA            complement(<623676..>625592)
                     /locus_tag="MRET_3199"
                     /product="Fes/CIP4, and EFC/F-BAR homology domain protein"
                     /transcript_id="XM_027629826.1"
                     /db_xref="GeneID:38739965"
     CDS             complement(623676..625592)
                     /locus_tag="MRET_3199"
                     /codon_start=1
                     /product="Fes/CIP4, and EFC/F-BAR homology domain protein"
                     /protein_id="XP_027485272.1"
                     /db_xref="GeneID:38739965"
                     /translation="MTDVRERGVGYVPALAHKDPRSGFVALQQRLRHARVFHDHLADF
                     MAAQCEAEEAYIKHLQKAAKRFGDPAHIPIEYRPVYACLVDQFGQLAQLHTVFARQLQ
                     RQHDMLHTAPAHGAWSALARHDEGMAPSIRELQSLESHLAKDQRKVEQKRTPAAQSKL
                     DATQEALRRAQAAWQSRAPIALQAYEAADLERLTMLRDAAIHLAKDQSELARGLYDMA
                     RTTAQAAKAFDPRADMARFVGVQHAPHGIALPSEYMDASHRSQAAPAAIETPPQVGPR
                     EARPMPPPAPTAIETPPAPHARSQELPPAPPAPPQAMPQEVPSAPPSAPRASHLSFLP
                     PDDAAEMTRIREQLRQHARPSSSRRREFRASSYDVSEHAHHPIVSPIIGSPFTSPMTE
                     AWHESAPPTVPEREAAPAPVPIDIGVYERIHAVWRHGLLDQVRVVGEVRLAAPRPVRA
                     VLRLAGDAGAQIHAAAGVTCTAPHVYELDVGDDMCALEYEVPLDHGDQVVPLLLQTQW
                     RCEAQQSLVLVTHRPNPAVPPAVTAALQDVSFRISLPSDAHVTGGVMSEPIGDWDPAT
                     HTLSWHAHALEGRSAVRFPLATQGSPQDVHASWRLPAYTMSPLDVHVEAAGTPLAVAP
                     MQRLTLAGRYQVVS"
     gene            <625653..>626813
                     /locus_tag="MRET_3200"
                     /db_xref="GeneID:38739966"
     mRNA            <625653..>626813
                     /locus_tag="MRET_3200"
                     /product="p38 MAP kinase"
                     /transcript_id="XM_027629827.1"
                     /db_xref="GeneID:38739966"
     CDS             625653..626813
                     /locus_tag="MRET_3200"
                     /codon_start=1
                     /product="p38 MAP kinase"
                     /protein_id="XP_027485342.1"
                     /db_xref="GeneID:38739966"
                     /translation="MADFIKLSIFGTVFEITTRYENLQPVGMGAFGLVCSGHDKLTDT
                     SVAIKKVMKPFSTPVLAKRTYRELKLLKHIRHENIICLSDIFISPLEDLYFVTELLGT
                     DLHRLLTSRPLEKQFVQYFLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDF
                     GLARVQDPQMTGYVSTRYYRAPEIMLTWQKYDVAVDVWSAGCIFSEMLEGKPLFPGKD
                     HVHQFSIITELLGTPPEEVINTICSENTLRFVQSLPKRERVPFTQRFPHTDPEALDLL
                     ERMLVFDVNTRITAGDALTHPYLQPYHNPDDEPVADEVFDWSFNDADLPIDTWKVMMY
                     SEILDFHNIEDAPSDAAPAQASGAAPALPEADPTQQAEAQQAHDAQFADLAP"
     gene            <626836..>628857
                     /locus_tag="MRET_3201"
                     /note="MRES_10860"
                     /db_xref="GeneID:38739967"
     mRNA            <626836..>628857
                     /locus_tag="MRET_3201"
                     /product="calcium channel MID1"
                     /transcript_id="XM_027629828.1"
                     /db_xref="GeneID:38739967"
     CDS             626836..628857
                     /locus_tag="MRET_3201"
                     /codon_start=1
                     /product="calcium channel MID1"
                     /protein_id="XP_027485313.1"
                     /db_xref="GeneID:38739967"
                     /translation="MAGRRALGWLVAWLIGGAYAASSSHHSSSHTAYRLPTSAKTPYV
                     PLPKHSTNSNISASTGLASPAPVSSTIPKPDHPYLLQDATPIRSEVKLDATDGVFFQF
                     VAKPETKLWLSLSLCSGPGIEAYNTSDSDLLKQLDMSPSEAREATLVAMYVATDGRTK
                     NPGPDSGIDSSHTGHALGGWCEVVVESGSSGTTFIGIWPPKDTRGQTGTYTMQLIAST
                     VGSLESVATTPGLFFDDTDRRNALLTSFNYTSPAPNISLIVLPTVGPNSLSSINYFNS
                     SFCRIFDLWEHMGMRGIQPFMNSSETSRNTQPRFTRGPDNQPQSIPRPNWNGSVGQAP
                     PGAAIVEDVAMLETVHKLKANSTAWLQQVRKQFYVQDLEPGSNYTAYLVASEHVGAHV
                     RHTLYPSVKFVTKRTRNCRLLYNVDFCPELAYAVPYNPEQSQEHVLRVLHDMISANYG
                     NFSATLSTFPCESTKFGVYSSVATCDDCRRAYQNWLCAVAIPRCTDLVDPSKSAASQN
                     GSELQGLPMPPNTNMYPYIVNRVGPMRSRQSYIDELFAPGDYGEILPCLLTCEMVTRS
                     CPPTIRWQCPLWTVTAQRDYGTFADADSTGFGVGENGGAGPDHMRFGGAYSTYVAQDA
                     FGHVFCNSMQVDRLFRESSSGAHRRAVPLEAWVVLLGVGMYMWISAALG"
     gene            complement(<628838..>629473)
                     /locus_tag="MRET_3202"
                     /note="MRES_10865"
                     /db_xref="GeneID:38739968"
     mRNA            complement(<628838..>629473)
                     /locus_tag="MRET_3202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629829.1"
                     /db_xref="GeneID:38739968"
     CDS             complement(628838..629473)
                     /locus_tag="MRET_3202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485340.1"
                     /db_xref="GeneID:38739968"
                     /translation="MPPPPDAAPLSARRRVGLSLWPLPAFQLHAPEDGRPRSTNMSLV
                     HRVLPPGVRSRAPSAGTSAPVAALQVIPCLRVASIAVSVSFYTIVLGFVTYGRQGPDQ
                     ASLFRGPPGRPSSLSPATPGVHVQLRVPVAHTHIHPQMLWLLVSDVDAFFDDAAHKLE
                     VAVAPSHGYFPAHTFGEARIVTRPQTMPWGTRECRIIDPDGHTWVITQVQR"
     gene            <629515..>630738
                     /locus_tag="MRET_3203"
                     /note="MRES_10870"
                     /db_xref="GeneID:38739969"
     mRNA            <629515..>630738
                     /locus_tag="MRET_3203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629830.1"
                     /db_xref="GeneID:38739969"
     CDS             629515..630738
                     /locus_tag="MRET_3203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485341.1"
                     /db_xref="GeneID:38739969"
                     /translation="MLDRAFWAAAYYRPLGETLAAWEASVRVSERFAYVMEHWWAVLQ
                     DGLQDTSGRPQCLAPYDESDWFVQRLILLYVCHVPYVRQGAPEDAQPFLPLLRKYAAG
                     AVDAWMERHTDTSRLAWHSTLQSLLDPQKHGELCKSCPHLWVPGLTLFSYVDADDVTL
                     YEADVALRCLTQPGPLSVHQNQWVYDYVRTVPAHLAVYFAMRDGGPCQPGHVARVAVL
                     NTRTAYEWMLLSMRVESHVILTLLDVWGDALASMPPARVASVLVRLMDVDEMMQADLS
                     PTCALVRAGWLVQYFCMPKFVSLAATRVEYGSLTESDVMFLCGFAQKLVEDGRLTLRA
                     LTEADVRFTSGSPKQCAATRRGLHLLIQANLETVHILLNMVAVRQSRHTYGAALYRAL
                     TEGARRADAATESRA"
     gene            <630765..>632225
                     /locus_tag="MRET_3204"
                     /note="MRES_10875"
                     /db_xref="GeneID:38739970"
     mRNA            <630765..>632225
                     /locus_tag="MRET_3204"
                     /product="oligosaccharide translocation protein RFT1"
                     /transcript_id="XM_027629831.1"
                     /db_xref="GeneID:38739970"
     CDS             630765..632225
                     /locus_tag="MRET_3204"
                     /codon_start=1
                     /product="oligosaccharide translocation protein RFT1"
                     /protein_id="XP_027485345.1"
                     /db_xref="GeneID:38739970"
                     /translation="MPRAASGLLALQIGARLGTFVLNQVLVRTASPAVFGAANVQLEL
                     VLSTVLALSREGTRALMLRRQDALRRGDPMLHNLALVPVWIGSVLSVVVGWAYVTYLA
                     PAALWAQSGVAVPVSVALYGLGAWLELWAEPLHTCALGLDAYVSIRVAMEAGGLAAKA
                     VVTAVLLQPACLAAMQRCVAAYVALSSEACALLAFAWGRVAYGAMVLLVGAVCLRGHA
                     RRWWWPTSAAAVWGDAPTRAFLRVTTGQAALKLVLTEGEKLAAARLTTLDEQGAYALA
                     SNYGSLVARMLFQPLEESVRLRLSQGGEAAAWMRTLLRLHVLFGTGLVALAPPVAAPF
                     LRLVAGPAWAHAAPILGMYCWYVPVLGVNGVVEAFVQSVAPAHVLRVYSYVLVAASAV
                     MVGVLASPVAEARMVVANIASLSVRALASSAYVAHVSRRPWDGVVPHGWVWSVLVACG
                     AIVRAYPASWGVCAAACVAAVVVGERRALAQALWML"
     gene            complement(<632232..>635789)
                     /locus_tag="MRET_3205"
                     /note="MRES_10880"
                     /db_xref="GeneID:38739971"
     mRNA            complement(<632232..>635789)
                     /locus_tag="MRET_3205"
                     /product="C2 domain protein"
                     /transcript_id="XM_027629832.1"
                     /db_xref="GeneID:38739971"
     CDS             complement(632232..635789)
                     /locus_tag="MRET_3205"
                     /codon_start=1
                     /product="C2 domain protein"
                     /protein_id="XP_027485346.1"
                     /db_xref="GeneID:38739971"
                     /translation="MPPSGASSTYARKALTDGDVYVFTLQTAYLDDLLRHAPPRPEPI
                     APSRPSSERSERSALSDKLKDLRLHATSSGQAWRVPDKLVRKLSDQLGQIAMGRDPLY
                     QQPSFRQTMGAFYGMLQDDATAKRLRESRIETLLLEFTMFAQAQLRKRLPTEADVQAE
                     LDVETDLFVRVVHDVLRTIPGVSRDLTDYVSRYMARDVERPRSSAERRRTDTPDDVAT
                     SPLVAATGRLFHFSDAQVRLDVQTLSQTCTLSEAVIDVKRCIYHIHAQRAWPGCPDDF
                     STPEAYRQWRSSELMQLSKLVADICAVRPDLMKASVTSDSSSRRSLDMQDDVDDAFTY
                     IPPDPCAAYERLLDICMDFDLDAIQRKDAQDDVPLSVLAPEHEDLLRLCATRWRVSTA
                     LARIAHLRLCRNKYDAGHVPLECVAASLESLSVHMQQVPPALWRRADQARLAQHLGLL
                     ADSLVRSVHADLAQLETPSESVVALLDRVSRLAGDAHVVAAHVAPLRRAFGQAATRAY
                     AAKAEGVFRVQTNIVRGFAELLDWLERLIETHRRQLRPVPGLATSDELAKVCVPLFLA
                     DLASVKEAVVLQVRQSGDLERVNEALALCQRVRAWQRSCDDAFDACAYFRPCVVLWLE
                     LSEARTAEWIRSAVQHDALHVSDTTTHSTSVQDMLDALQQPLAFLESLAWADETDLAA
                     LLSLLAGSYERHIALYCHLMADRYMLDMRPPSLPEASSDAPLWVVRAKQAVLPSEQQM
                     RSAVRPFVLQPHSCVILNNMEAARQLLDTLYRRMEADTQAERLRGTTADVPRSMVFSV
                     KIVQAELPVLDVPRLDTLVTLSDARGTRLGKTRTLYDTRVPRWDEVVDIDCPTAQWIS
                     ATVWRRSLHGEPHLLGRASVYLDPRVFGDVPTHDVWLTLDRAGGKLLLRVSMDEAHDG
                     ILYTFGRAFRTVKRTEADMTRVLVDHISLYMRHVLSRPVLAALVRGRRVDRALRALHA
                     GARAPLTDHDMEEAIAPLFDYLDETLGTLHSSLSASQAQLVLSRVWKEVLVTLEGLLV
                     PPLSDAPTDMQQLSDKEVDVVFRWLSFLRNYFHAYDAETDTVHGLPLSSLQSTKYREL
                     VSYLLLHDQSTDALMIECVRGFQARLVKAPSRAKSVLYQRSLGTIGQHKRAKQQRASL
                     ADAGDGDACLMAMRILRMRPGTGDFLSQQLTSLHTLPSS"
     gene            <635919..>637320
                     /locus_tag="MRET_3206"
                     /note="MRES_10885"
                     /db_xref="GeneID:38739972"
     mRNA            join(<635919..636214,636372..>637320)
                     /locus_tag="MRET_3206"
                     /product="RNA-binding protein Musashi"
                     /transcript_id="XM_027629833.1"
                     /db_xref="GeneID:38739972"
     CDS             join(635919..636214,636372..637320)
                     /locus_tag="MRET_3206"
                     /codon_start=1
                     /product="RNA-binding protein Musashi"
                     /protein_id="XP_027485343.1"
                     /db_xref="GeneID:38739972"
                     /translation="MSEADDLYADLYGEEAEPSVSAPPAPKPEAAAPAAATPAPSTSV
                     PAATPAAAGAVPETSSAPSFIPGRPAPPPLDSAEARSAAAARGEHIAPQDLPDEGKMF
                     VGGLNWDTDEESLRRYFGQFGPVASCTVMRDGASGRSRGFAFVTFSDPKSVNAVMVRE
                     HFLDGKIIDPKRAIPRPEQSKTQKCFVGGLPQTVTQDSFKQLFQQFGHVLDSTVMMDK
                     DTGRPRGFGFVTFENDDGVENTLAHQPLLLDGKQIEVKRAQSRGQPQPNAAPNRFSSD
                     PARGSNAQAPLRMWGAGGGSANGGDKAPAQMPGFGAGGFDPQAMAKMYQQMGWGSSAW
                     NPQLMWQQMMAAYMSSAATGGMPGAPPGGRAQGAGRSGQDAGWGSRGDDARGRGAAGG
                     PAHQRERSPTRGSRSYDERSRF"
     gene            complement(637412..637515)
                     /locus_tag="MRET_t0054"
                     /db_xref="GeneID:38741248"
     tRNA            complement(637412..637515)
                     /locus_tag="MRET_t0054"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:38741248"
     gene            complement(<637739..>638203)
                     /locus_tag="MRET_3207"
                     /note="MRES_10890"
                     /db_xref="GeneID:38739973"
     mRNA            complement(<637739..>638203)
                     /locus_tag="MRET_3207"
                     /product="DNA-directed RNA polymerase II subunit RPB11"
                     /transcript_id="XM_027629834.1"
                     /db_xref="GeneID:38739973"
     CDS             complement(637739..638203)
                     /locus_tag="MRET_3207"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB11"
                     /protein_id="XP_027485344.1"
                     /db_xref="GeneID:38739973"
                     /translation="MANAPDRYTLFLLQPGEQRIEVQEDMRIPNAATFVFNKEDHTLG
                     NMLRHAVLSMPGVLFCGYKVPHPLEPRVLVKIQTDGSQTPVEVLQQACTKLIVHIGSL
                     KQNWAKEVRLGTDSGSYGTQLWPSYEPGAPMAGSDYDADRAAGGALGGYVDM"
     gene            <638483..>639295
                     /locus_tag="MRET_3208"
                     /note="MRES_10895"
                     /db_xref="GeneID:38739974"
     mRNA            <638483..>639295
                     /locus_tag="MRET_3208"
                     /product="peroxin-14"
                     /transcript_id="XM_027629835.1"
                     /db_xref="GeneID:38739974"
     CDS             638483..639295
                     /locus_tag="MRET_3208"
                     /codon_start=1
                     /product="peroxin-14"
                     /protein_id="XP_027485347.1"
                     /db_xref="GeneID:38739974"
                     /translation="MSEPSERMGPSAPRADMVANAVSFLEDPNVQSSSMSQRISFLES
                     KGLTSQEIDRALSQVGRAPPPLPPSAPYPMMPAYPPARPQRDWRDWFIMAVVSGTVGY
                     GVVSLARRYLYPHLQPPNKTVLEEEREALEAKYDEVALHLEELDQTTEAMSQGLAAQQ
                     SAIQASVRGVNDLVAESRSREEQRDKDLEHMKSEMESMREEFASMLERSRASSITALT
                     DLQGELKSLRSLLVSRGGLSTPSASAPAESSAPPPAKAAPQIPAWQLESHDE"
     gene            complement(<639305..>641149)
                     /locus_tag="MRET_3209"
                     /note="MRES_10900"
                     /db_xref="GeneID:38739975"
     mRNA            complement(<639305..>641149)
                     /locus_tag="MRET_3209"
                     /product="vacuolar protein sorting-associated protein 45"
                     /transcript_id="XM_027629836.1"
                     /db_xref="GeneID:38739975"
     CDS             complement(639305..641149)
                     /locus_tag="MRET_3209"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 45"
                     /protein_id="XP_027485348.1"
                     /db_xref="GeneID:38739975"
                     /translation="MDVCQAVSAYVERMVKEVRGMKMLLLDDHTTPTMSATFTQSALL
                     EHEVYLTDKLSHRPRERMHHLQCLVYVRPCPASIHALCQELLSPKYGAYWLYFSNVVA
                     KHDIEALAEADQHQLVQAVQEFFSDYVPVTASHFTLQYDVPPHRLWGSHLVQWDPDAF
                     EHHTSALLSLLLSLKKKPVVRYERMSALARKLADELVTRMNDSHASLFDFRRTDVPPL
                     LLVLDRRNDPVTPLLTQWTYQAMVHELLGIHNGRTVMHTEHGPQEIVLSVDHDPFFAA
                     NLYDNLGDLGASIKDYVVQFQAQSASNSSIETVQDMKRFIEQYPEFQRLRGNVSKHVA
                     LLGELSQLVDTHHLLEVSELEQSLASNENHTTDLRNVQTLIGSERIRPDAKLRLAMLY
                     ALRYQKWSGNRIDAVVQQLIDAGVQDVALVYVMLNLCGAEQRQDDLFANENILARGKS
                     ALKGLKGVDNVYTQHTPHLVKTLDHLLRGKLRTSSYPFAGTDAPDAPATVYPGGPPTR
                     PQDVIVFVIGGTTYEEARMMALLHVPGTHFVLGGTTIHRSQSFLHMMQHTAQHLPASV
                     TQPPPSMAQSMPHLRLGPVQLAVPQEGDLEQVAMGAMDMLGRVIRPGP"
     gene            complement(<641195..>642703)
                     /locus_tag="MRET_3210"
                     /db_xref="GeneID:38739976"
     mRNA            complement(<641195..>642703)
                     /locus_tag="MRET_3210"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629837.1"
                     /db_xref="GeneID:38739976"
     CDS             complement(641195..642703)
                     /locus_tag="MRET_3210"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485301.1"
                     /db_xref="GeneID:38739976"
                     /translation="MDALEPCPAPGQKRTALSYLFPNNDQVLSRRAKFTDDIDTATAS
                     TPPPVVAADDHEKPKIEEGLIEQINGPYTGEEPKALPRTLGRFGAFFNMIAFSFALGV
                     LSIPMAVATIGIVPFILQCLFFGFLSWYTGYQYWRIAMMYPGIHNLQQVGELMYGPSC
                     AVAFAVIQAVFGIFVQGSHALLGGYAFYYLGWHGCMVGMAAVFAVISWIVTLPRSYKL
                     FSMFAATSFTSIITVIIIAMIASGVTGPVNKDPSDPPREILAFGATKQIPHSFLDGML
                     YTSNVFVSFGATTSYLPIIAEMHHPRQFLTSLNMLVIISIVLYIIVGCIMNYNLGQYT
                     ISPSLGSLSPIMVKVSYGLSLPTILVAGCCSAQVTGKMFLLNFFSKSRRRFLENKWIL
                     WSVWITINFLSWVAAYVLAELIPFFNSFLGIMSSVFWSTFLFLACWFYIWRHQHDYHR
                     TWRNRLGLVVALLIIGIAGFFLIAGTWAVAVSIRDLYNAGKVGGPFECSMPV"
     gene            <642810..>643703
                     /locus_tag="MRET_3211"
                     /note="MRES_10905"
                     /db_xref="GeneID:38739977"
     mRNA            <642810..>643703
                     /locus_tag="MRET_3211"
                     /product="solute carrier family 25 (mitochondrial
                     2-oxodicarboxylate transporter), member 21"
                     /transcript_id="XM_027629838.1"
                     /db_xref="GeneID:38739977"
     CDS             642810..643703
                     /locus_tag="MRET_3211"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     2-oxodicarboxylate transporter), member 21"
                     /protein_id="XP_027485300.1"
                     /db_xref="GeneID:38739977"
                     /translation="MTTTATPPPVPLPTYYTLGAGAVAGIFELACLYPLDVVKTRLQL
                     QRQARSDAPRGIARMLVSIVRHEGLATLYRGIAPLLVLEAPKRALKFGANDAWGKAMR
                     PVVRHQRVRAVVTGCLAGATESLMVVPFELVKVRLQDRAQRSLYRGPMDVVRHIVRQD
                     GYAGLYRGLPATMIRHVMWNGGYFGSIPAIQARLPRATSKSERLRNSLVSGTLGGFIG
                     TVLNTPLDVVKTRIQNASTYSGGTFAQLGHILRHEGAGALYKGFWPKVVRLAPGGGLM
                     LLVVDAITSYVRVWLGPPYYT"
     gene            complement(<643694..>646297)
                     /locus_tag="MRET_3212"
                     /note="MRES_10910"
                     /db_xref="GeneID:38739978"
     mRNA            complement(<643694..>646297)
                     /locus_tag="MRET_3212"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629839.1"
                     /db_xref="GeneID:38739978"
     CDS             complement(643694..646297)
                     /locus_tag="MRET_3212"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485303.1"
                     /db_xref="GeneID:38739978"
                     /translation="MSVADPVVCESTVAMHDEPTIAAMDLPIASPAAQQYFAAHPRRP
                     HVYFGDYLLLQTLGEGEFGKVKLGVHRHFGEETAIKLIKREMVAAAEEHQADGSKMSK
                     VEREISVLRLLRHPNIVHLYEVIESERYIGIVLEYGAGGELFDYILAQKCLKEREACR
                     LFAQLVSGVSYLHRKKIIHRDLKLENLLLDRHRNVIITDFGFANNFSARSNDLMATSC
                     GSPCYAAPELVVQDGMYVGAAVDVWSCGVILYAMLAGYLPFDDDPANPDGDNINMLYK
                     YIMATPLSFPDYITAEPRSLLLRMLVPDPAKRATLDEVMAHPWLAPYRDLFHFSVEEL
                     ESAAVEQQAQKRQAFRDQMVQPSKSAMPPSLSLPAVPAREPDAVPVSATLPALPTAPA
                     VPTEAPKRKSEADEPKARTKPRVSDAERPWSWHAPPKSAPRPESRLAPPLSYQHGGMT
                     MLAPVSVPRRDGPTSFGQEPPSLTSFLPPMWNDKRPRKASLPKDEAAPPVAAPDAAAP
                     PRARPTSLPMPPPVPPVPAAPAVAAPPLVFPPQTRPTSMPVPAPATEPLAPAAPPAPA
                     APLAPAPAVSFARTSLDTSRETPVRRTTWWPRLPGAAPEERPRPKSMDVERPLSLEEE
                     RVQWQRREAERLESERAERQRRDAVREEQAELDQGYRQARDRLEGQYQRQRQVSILEV
                     AGAMEKRLSAHVGTVDPAALTTRHPDEVFAEILDVLHRMGIAVRRTRGELVVECLRPK
                     RLNALERLFASRRQEQARQKWVKGGAPAPPRVSDVERGMHRLSVSGLPASHTAQSLDA
                     FAAPSTAPEYGSAASSDGGHEVRFAVGITRIPRLQGLYSVDIRRLKGNAWSYKFVYDT
                     LLQRLDLGSHV"
     gene            <646540..>647994
                     /locus_tag="MRET_3213"
                     /note="MRES_10920"
                     /db_xref="GeneID:38739979"
     mRNA            <646540..>647994
                     /locus_tag="MRET_3213"
                     /product="cytoplasmic tRNA 2-thiolation protein 2"
                     /transcript_id="XM_027629840.1"
                     /db_xref="GeneID:38739979"
     CDS             646540..647994
                     /locus_tag="MRET_3213"
                     /codon_start=1
                     /product="cytoplasmic tRNA 2-thiolation protein 2"
                     /protein_id="XP_027485302.1"
                     /db_xref="GeneID:38739979"
                     /translation="MPPPRGCIRCRRDECVLTVREASYCAPCYARVFDEKMRASLDHT
                     RGAILRQSVVRSAETASPAYAIVCDGSVASYVLVHAMYRLLYVPDAHPSPARAPERAR
                     LDVLYIDDGGHADDVRAHIARLAPDAVFVACQLSDVYQRGQGVVCTRQPPWTMGELTE
                     AHETAAHDLLAAMRLRHGTPSAGATRTEDMHRLLSRRVLHDTACARQCAALLFPQDAT
                     QTAAYVLDALAKGAGHKLPVEGAASLWVQDVLHLHPLRAFLPHECAYYARVHGLAAPA
                     EAPAAADMSYESISDKSSMGHLAQSLITALQHGVSSTSSTVIGTASKLVLQDTPKLWP
                     TVPADMCPGIGAKGAALVRSVQALPRWDWDECRACPLCRWPAQEGAAQWTSQRSIRHA
                     AFAAHDLDAHLCYACLQVLDIPTGTRVLLPPDVHDLVRRPERPAASVRVVAPAVQDDS
                     MRDALAQPHAPRTSHAPTRVAPDAMRDQVASYLL"
     gene            <648053..>649657
                     /locus_tag="MRET_3214"
                     /note="MRES_10925"
                     /db_xref="GeneID:38739980"
     mRNA            <648053..>649657
                     /locus_tag="MRET_3214"
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit 3"
                     /transcript_id="XM_027629841.1"
                     /db_xref="GeneID:38739980"
     CDS             648053..649657
                     /locus_tag="MRET_3214"
                     /codon_start=1
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit 3"
                     /protein_id="XP_027485305.1"
                     /db_xref="GeneID:38739980"
                     /translation="MSNEAPRREGTSLSNALSHSQASLATISFQPRSAAPSLTTKVAE
                     APVFVPRSAHASTTPVAPYAYTYEEPRPVRHPLQYHLYAPPFPHVSNVHPTHHAAMSF
                     FMDPHLHEELHRKQEALYATANEPVAGVPESLHVYHSLVPLEPSAAAAVPSSLVDPRC
                     RAQGSLTGASGDPSRVFGRCSHIYKATCALDGKCYVLRRFEHVRLHHPAAISAAERWR
                     KIRHPNLVAVREAFTTRAFGDDSVVFVYDFHPLATTLYMEHMTVKPLVPDRRTGRLQP
                     VSMYVPERVLWSYACQLASLLRAVHAAGLAARCMEPSKVLRTAHHRLRLTGCAILDVL
                     AYQPPSSDDRALLEAQQRDDLAALGRLLLCTGCNNVAAAADPHSSAAFERSYSTELHT
                     FVQDLMRGAYARISDVLPALTLHMADEFGCAQHHADLLEADLLRELENGRLVRLLCKL
                     ATLREETTDDVSGEQYVIQLFRDMVFHATDEHGRPTMDLSHILVHLNKLDAGIDEKVL
                     LTSRDELSCLVVSYADLKQFIETALA"
     gene            complement(<649681..>651261)
                     /locus_tag="MRET_3215"
                     /note="MRES_10930"
                     /db_xref="GeneID:38739981"
     mRNA            complement(<649681..>651261)
                     /locus_tag="MRET_3215"
                     /product="terminal uridylyltransferase"
                     /transcript_id="XM_027629842.1"
                     /db_xref="GeneID:38739981"
     CDS             complement(649681..651261)
                     /locus_tag="MRET_3215"
                     /codon_start=1
                     /product="terminal uridylyltransferase"
                     /protein_id="XP_027485304.1"
                     /db_xref="GeneID:38739981"
                     /translation="MNRRARSTEAPVRVPYHVRAAPGGKGAPSEAAPDRASRYGAASK
                     GSAGASSSVPYSYERHTSELSRAIIEYLAPILPTEDEYRTKEGIRRELMRIASKLHPK
                     ATLLAFGSMANGFALKNSDMDLCCLVPRDDGEDSAALPSPSELVEQLSELIRQDTDFH
                     VLPLPKARIPIIKISHSATPKMPYDISCDIGFNNQLALENTRLLLSYAMLDPPRLRAL
                     VLFIKVWTKRRKLNSPYTGTLSSYGYALLVLFFLIHVKKPAVLPNLQRIPAGRELSQH
                     DIMLEGHSIYFYDDMEALRRQWHSDNTDSVGELLLDFFRYFSRDFNYTKDAIAMRTEG
                     GLVTKESRRWTHDLLCIEDPFQAGYNVARTVTKDGLYTIRGEFMRASRLLANRTIRVP
                     QLLHELCMEREDGLTRAPDFPQRHHDHHRFRGRAFDDMSRAFVPHGISYPPPPPMMPP
                     PFVPAMPIPSWAPFPTPFGTPPTWIPGAQRRDDDDKSGSIIRGTHLPHEHRAWSSGSR
                     EPDDDDDDDDGVFGMSPT"
     gene            complement(<651397..>651682)
                     /locus_tag="MRET_3216"
                     /db_xref="GeneID:38739982"
     mRNA            complement(join(<651397..651447,651473..>651682))
                     /locus_tag="MRET_3216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629843.1"
                     /db_xref="GeneID:38739982"
     CDS             complement(join(651397..651447,651473..651682))
                     /locus_tag="MRET_3216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485307.1"
                     /db_xref="GeneID:38739982"
                     /translation="MHATAARLLRIQPVPASTMPRAVAAGSSSGRPMPRADAAPSVAD
                     QLLAMPHRPPNLRMEPFVHGKSRYWKVSAKERDMLRAQRREA"
     gene            <651783..>656432
                     /locus_tag="MRET_3217"
                     /note="MRES_10935"
                     /db_xref="GeneID:38739983"
     mRNA            <651783..>656432
                     /locus_tag="MRET_3217"
                     /product="oxalate---CoA ligase"
                     /transcript_id="XM_027629844.1"
                     /db_xref="GeneID:38739983"
     CDS             651783..656432
                     /locus_tag="MRET_3217"
                     /codon_start=1
                     /product="oxalate---CoA ligase"
                     /protein_id="XP_027485306.1"
                     /db_xref="GeneID:38739983"
                     /translation="MLTRLLQHCVREVALDGEEGSDVERLFSFVEAFCAHLPEDARPV
                     LDGAYRAFVWRTLLHDARVHVGVAVRKGTSRGQQRSSILAKGREASSAPTPIKSGALE
                     ALVEAHGDALRVYVDAELVRRTLTGTEAPFASAAAYVALQHVYRARERGVTVVDLGAR
                     THYDPKTVYYLVKLLLERELVAKFTARETGEVSNYVVGRPFLAHNALWQAQQRAAGPS
                     DVGTPTWVDLDTIASEWDDAPMTGEADEDEAGALAMPPLDPHDGDVLAYPMLSDEQSA
                     VWLHSRQDLLSERLARMLRMSPSHMTPRRYLPTRLGLRRVPTLRRGFLAFLHHHLSAG
                     HIERVRVQFAHATPLYVRATDAWLGGGGGARAAAAPASAAAARVPLRYDATLEYQLLT
                     LIDAYGAHGCTMHELAQRLGCSSEVKRMVEQILSRQVVRTPPPYAALAVCAPFEQSGR
                     ERRIRYYTARGFAARCEADGLSMSTALGVGDASAPAAPVPPVPDTLPSECTFPDAATL
                     AATLPTVGVSTGFFRDVPGPVVLRGAKRTAPTDPATGRAKRGRPRKGEVRPKPIKSEA
                     ASPLPPAPAPAPRAPEPRSNLSVFQRVKLLTQVLAQAGGALDEVEIPRRTRMYLDAGP
                     AASAAGGDLSDRTTRTKTIEEAQRRGVVRTIKVPRTDDAQRPRTLLHLTHLSPDALQE
                     ALRSATSTPETRGVVAYADVKAEHAGLSTTEATAPWLDTTPVTYGHDDPLDDASTQRA
                     FARHSHLLRQYYGFPHGSAARLQLFDEAAQTAAGEDRVFSLAYFVHEAPLRTLVALVP
                     VRLTTPAVVRAVTAATSARVDAVPAPVARRLGLGRQRAHRQRLATYAAQLIELGLAES
                     VGDDRYRLTTRAPVPRWPPSESDVRDVSTPAQRQAYWAAVRSAVDASDPKRVPSYLAA
                     PHAWRDSFALRGVQKAFLRRYAWPLPPDALERLAAAVFAPRAAVEAFFVSRTSRAHST
                     AASMAHKVAARQAQRTHEWDAALADVRQHGPPEAGEPRALAQLAHKYIHGRETVTPAA
                     LRQRIAAALGMHRRVRTSTTRGRRRSRAFVWTPEHQATLRDAHVILTHRQRAWRAMHG
                     AAALADDWSALHQLFSPDAPPSEAAAWRARRRQLTAAPHEQVGLMLVERAWHDVAARG
                     RADGTLPDPAWPHPSSVDLRAHIAYLRQHMDRAQLLQAHAEEAARTVLPRRLTAQDVA
                     AWTPVVPRRPSLVDDTSAPMVHRLQQMRTTARSVRAIEQPVGAEASCALATMLVPTHV
                     SRAELATWTELVGAERLERAIALAVERRILQHADGTLTYTDERQRALSTSVPAVHAAY
                     RRAQAAGRVQVHPAATESETAAWLSLLETRRVHASLDMAPLAALRRRPKLNARTLDDV
                     ETECRLTLTWDALPPLPDVRPPDALVLGVSSALAAALERAGPSGMPASDAPLDAGAHR
                     AFIVEGPRLVHERFAASWQVPTLRGPPVWPRAWLDVHGDTHWPVWHARVAHVLARVSA
                     RPGTSVEALVADADRLEVYDVVRACADAGCIAIRGAAPFLRPRDAYVVPCSPWFM"
     gene            complement(<656441..>658165)
                     /locus_tag="MRET_3218"
                     /note="MRES_10945"
                     /db_xref="GeneID:38739984"
     mRNA            complement(<656441..>658165)
                     /locus_tag="MRET_3218"
                     /product="dual specificity phosphatase"
                     /transcript_id="XM_027629845.1"
                     /db_xref="GeneID:38739984"
     CDS             complement(656441..658165)
                     /locus_tag="MRET_3218"
                     /codon_start=1
                     /product="dual specificity phosphatase"
                     /protein_id="XP_027485309.1"
                     /db_xref="GeneID:38739984"
                     /translation="MLYQDPPQGVAAIRPDELMERLLSTLRGKRVKRPSPCDACSAYC
                     GRPVPHAAHVPSMHLVHSLPDDAAVTEGPYDPSWVDAPPPAQGHAPEAGGSLSAPSSP
                     VMSARRIQSKAEELTRVPFQSRSTVPVLLLDTRPAHIFQGCMDTSDMLDGSDDVRTGH
                     LKGAINVQIPTLLFRRTQRALTSSPALLDSIDIASYIQSEAGRRKLRSMCWAQELPPV
                     SKAVDPAVLNELIRVFWFMDIVVLYEDRASSFAAYLLLRTIAAIRARASERVPPELTS
                     RRCGLYHVLGGVRGLRENPAWLPFFEVGDSYVEQEDRETAPIEELALPGSGCDARARR
                     PPLPRLNTSVSDVAPAPSLSSGTEGALSRPLTAGLYVMTDRAEPLWDAPRTAREPEEA
                     TDFEVSTIVPGQLYLGSHIQTPADARQLEALGIRAVLNTAAELPLSQEDPHSPMSVLR
                     DTSIRDYLHIPMRDVVEAVGVQQQLRDACRFLERMRACGRPTFVHCRAGKSRSATCVM
                     AYLIQTRRWTLKQAYAFVSAQRPRTSPNIGLMAELMHFERAVLGSSLSMCVSPQRGDA
                     PRTPDSVR"
     gene            <658505..>660709
                     /locus_tag="MRET_3219"
                     /note="MRES_10950"
                     /db_xref="GeneID:38739985"
     mRNA            <658505..>660709
                     /locus_tag="MRET_3219"
                     /product="CUE domain protein"
                     /transcript_id="XM_027629846.1"
                     /db_xref="GeneID:38739985"
     CDS             658505..660709
                     /locus_tag="MRET_3219"
                     /codon_start=1
                     /product="CUE domain protein"
                     /protein_id="XP_027485308.1"
                     /db_xref="GeneID:38739985"
                     /translation="MSTPSSGNTMPRRSANSRRRGGQRQRHANAAAGAEDDTEEVRTL
                     RATYPTQLAMLSELFPTWTDEDLLFVILESNGEVEIAVGRISEGHAEQFSSVKSKKTQ
                     RKEAAAHSAAALASSQATESTTPAAAPASTLTQAAPPSTSQTASAAAPTDGSRRSTRG
                     GERASRGRGAPAARAGRGGFRGVARGGAASASAPSAQSQAMPVTTTPAAFSHKPKPTE
                     TKPRTTTMSWAQIARPQEPPKPSLEHEAAPVETPAPQHDTDTAPAVAPPTTETIPVTQ
                     TSASAPAETPLPAAVSTRPARAQRPRQDAAVVMPDGASLDQLDVKFGTLTFMANDGAE
                     AAEPSLGSTGSAAGLNVDTKQDPTPVHEFDGFKSSGFGVNGAYGLAGTRPVNQDSSAT
                     PAAEEASGTLSYGSGTPGQAYASSIYGFDSNQRSSHPYATGLRATTDERASQPAAPTG
                     PAGPVAGGYDVGVMPYVQQPQGPPQLPQHQTQTQQQSQQQPQAQQPFPNVMPYYYPYY
                     MPNQFQHFSPAAGFGQYPLYGAQPQPPSKLDVPAPSLAAYTQHDPMGTPYSTHTPPQP
                     YQAAPSVSMPTYESQGFSQRLGGSGSASANADFKLQGGSATSDANHSLPGLSFLGGGV
                     PQGAPAAPVRAGSTSSVPATSTPLDYRAFDATNSPATRSAAASGSSAAATPSVGATTG
                     MPPPPPQGMPSHQAAAPMAQQHPAYYQHYAAGLGHANAYDGYHQYGRQPYWV"
     gene            <661113..>662972
                     /locus_tag="MRET_3220"
                     /note="MRES_10955"
                     /db_xref="GeneID:38739986"
     mRNA            <661113..>662972
                     /locus_tag="MRET_3220"
                     /product="transcription factor"
                     /transcript_id="XM_027629847.1"
                     /db_xref="GeneID:38739986"
     CDS             661113..662972
                     /locus_tag="MRET_3220"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027485445.1"
                     /db_xref="GeneID:38739986"
                     /translation="MPRGTETAAADHSTSPHEFKVPPSSDSLLSDASISPAAPFDPSL
                     PSSVFGPEAEAPFTPSGLLGSHVKQNVSWDASHEPLTIDLNRVSSLTLSTPHSRSSHA
                     ELPTQSPEKQPALLPSYDSVYTTPFTDSPIPQTPSAPQRLNSTQSSHASSTDDLGQAF
                     DIPPQASPAAAPLPAPMTPRIQSDPAMRHAASVSTSSCASVATPEFNLPVQPRFSMPD
                     IYSPPCGTPDRGISVPQQHLAFESSPTPRKSSTIPIYMDQPPLPLPPPMPLHDMTDAS
                     LVHPAFTSPLSSSVAPSPALGPVPGHFPGPPTTPGPHLLDDPFVPTPYYSPMPHPEIP
                     SMPIEAGPPPSLPVMSRVFSAPMPSTMVQEPTQPSVPFTPVQRRPSVPASPVPASSYS
                     LPVNHASMARKCYTPYSKTPNPAPSWTYQDADYMSSPMTASKSMGCLASPLPASPATP
                     SGLPRRGSRMSHSISMPGDHISALLDFEGPSPTRMRGRSSGPPPLVVSSADKLHACHC
                     GRRFKRLEHLKRHMRTHTQERPHKCPIASCGKSFGRTDNLSQHLKTHFRPAGLGGRTN
                     ELVHTKDEVPRATNTRNDPFAAAAAAAAAAAAVHGQAHMHMVPPEHAPIHPEG"
     gene            complement(<663026..>664568)
                     /locus_tag="MRET_3221"
                     /note="MRES_10960"
                     /db_xref="GeneID:38739987"
     mRNA            complement(join(<663026..664492,664518..>664568))
                     /locus_tag="MRET_3221"
                     /product="ubiquitin carboxyl-terminal hydrolase 14"
                     /transcript_id="XM_027629848.1"
                     /db_xref="GeneID:38739987"
     CDS             complement(join(663026..664492,664518..664568))
                     /locus_tag="MRET_3221"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 14"
                     /protein_id="XP_027485446.1"
                     /db_xref="GeneID:38739987"
                     /translation="MGKMTTIPVKVKHNGKNYDVSMNLEGTGLDFKRAIADVTHVPPE
                     RQKVLIKGGLLKDDTPLGKVGARAGQQFMVLGAVGELPKAPEKPVQFLEDLPEDELSK
                     AKDLRVGLVNLGNTCYLNATLQLLRAIPQLEDALNSFPGRIGSNQGDASFTAALRDLF
                     QDMRKTTEPVPPLVLLSTLRKIAPQFAEMSSTSGGFAQQDAEEAWLQIIQALASSRVA
                     VTPSEPLVAQYLTGHMSIERRCKEAPNETPAQLDEPFQILQCTISSQTNDMESGILDS
                     FSQKLEKHSEQLQRTAVYDETRRITRLSEYLFVHFVRFYWRRDINKKTKIMRKVKFPK
                     ELDASSLVTPELARRLSPVSAKIRAVEKERADRAKIRARAKERHLELGAVEGGALTDE
                     QEREQRSKEAADIQATIDPDLSSDHGCNVSGLYDLVGIVTHKGAAADAGHYMSWVRKS
                     AVDPPSDSLDAPSQDWYKFDDDKVTIVPPEKIEMLYGGGEDSVAYILLYRAKSLS"
     gene            <664698..>666659
                     /locus_tag="MRET_3222"
                     /note="MRES_10965"
                     /db_xref="GeneID:38739988"
     mRNA            <664698..>666659
                     /locus_tag="MRET_3222"
                     /product="nucleolar complex protein 2"
                     /transcript_id="XM_027629849.1"
                     /db_xref="GeneID:38739988"
     CDS             664698..666659
                     /locus_tag="MRET_3222"
                     /codon_start=1
                     /product="nucleolar complex protein 2"
                     /protein_id="XP_027485447.1"
                     /db_xref="GeneID:38739988"
                     /translation="MAKLTKRTKKFMKNKLDQTLKQRQDAKKKQKYTQNKGKRVNDEP
                     TEEKEEEPEVVESQAPAMSVDDFLSGGFREGMEGEDEEEEAEEDDDDLDEVDDIEDAE
                     AHAQDLAQLAEKDPEFYKYLQENDQELLHFGQGEDEEEEEDEEKEEEEDERLLTMDML
                     QQWQKSLLRHRSPRALRRLLLAFRSVLSSHDDEVQHAFHVQDSRVFSKLIITTLKYMP
                     MVMEYHVPYKKTADGRFKVQTHTQKWHILHRPVRSYFMSVIKLLQTLPEADMVYVALN
                     ESAKMVPYLHQDRRVARDYVRALLGQWSSGEDRIRLAAFSCLYVTTASALDDDMVDFC
                     LKSTYHTLIRNTRNTKPHTLEHIALMKNTACELFTLHADASYQQAFGFIRQLAISLRN
                     CLKLKTQEQFQTVLQWPYLHCLDFWSLVLAKTCHVDREQGVPSHMRPLIYPLVQVSLG
                     VGRLVPMSRYFPLRLHVIESMLRLIQATHVYVPLAPLIIEVLESAEFQRRGKGATLKP
                     LDLETTFRAPAAYVRTRIYADQLADEFAYVLLEFLATQARHIAFPELVIPITVQLRRA
                     LKTSPCVRLNEAVRPLLDKIRMNATWIEQRRSQVEFAPNDQSQVDAFLQNEASDAPLQ
                     QAVRLARKVREQKRRLLEKTAHVVEDDEA"
     gene            complement(<666664..>669282)
                     /locus_tag="MRET_3223"
                     /note="MRES_10970"
                     /db_xref="GeneID:38739989"
     mRNA            complement(<666664..>669282)
                     /locus_tag="MRET_3223"
                     /product="WD repeat protein"
                     /transcript_id="XM_027629850.1"
                     /db_xref="GeneID:38739989"
     CDS             complement(666664..669282)
                     /locus_tag="MRET_3223"
                     /codon_start=1
                     /product="WD repeat protein"
                     /protein_id="XP_027485448.1"
                     /db_xref="GeneID:38739989"
                     /translation="MNVPDCASITPLDLDTSFRHCTLPPRDESPDHALPTDPTPSSVV
                     DVSQLTPQTIARIFAFLDPISIVRCGSTCRAWRAIASLDTTWRAAFMVASGLEEREHT
                     LHEHINDPAWSALRVAPALRRMEPSWRGEYVARSALLRRWRKSRTPTVLTDPRIGTLS
                     VLALSASRRFVLSLSNDFSVASRSNTHTGKVAKDFLDAHGFSARTPNGHPNIDLSPTT
                     TAQATDAYASQIVWGLASGDISLTTLDWRGQSARGTIHNRAFPAGYAHSAPVTAIGMT
                     CAPGHGGVYSDERHRQQLSMLGELYVTFATAAADGSVNVWHPKHMEPLWSGTAAHHVT
                     HLAYAPAHGILAAARLDGTIIVWQNVCVRDMLAERHNYPGPQRIVILSGRTPVSDMVL
                     DASGLSLLVHHKDARVFLRHTIGSQVCTAVFGAPTLSAITCLRCDFDIRAKPPPLPTA
                     LVARMQASRLQEHKFVCAGTASGCIGVWEWDDDGEVYDEQAQVAWQGAEPAVAERQVR
                     PALVIEAHHTAITALAFSPLLLFAGCEDGTIKALDALTGSLVRVFNERAARRHPARML
                     AAGELTQEEAARFRVTHMMAADDMFVAAIGMHILSWHTDSEPVSQAPRTAPRRSKASV
                     PERTRLKADFVQDVEEGQHQVRMERDKRASSQAQRAALESSVHGALDEDVALDYALML
                     SQQEASGVDDDWSPELMYDLETHEGDSDATPLSPPLVPVRDMAPTSRAWDILCTAGRS
                     ASTTTSGDSHPSSWSKLQTVAVPRHARFGSPEGSLSSMSSSLTGSLCDWPDMRAENTR
                     PSRSPHSLGAWAKPSPTLRAVDSVQAQSARRAGKSALVAERTDSRRVPPLDDDMDDDT
                     RLALELSLAEYRSLHE"
     gene            complement(<669438..>671261)
                     /locus_tag="MRET_3224"
                     /note="MRES_10975"
                     /db_xref="GeneID:38739990"
     mRNA            complement(<669438..>671261)
                     /locus_tag="MRET_3224"
                     /product="drebrin-like protein"
                     /transcript_id="XM_027629851.1"
                     /db_xref="GeneID:38739990"
     CDS             complement(669438..671261)
                     /locus_tag="MRET_3224"
                     /codon_start=1
                     /product="drebrin-like protein"
                     /protein_id="XP_027485449.1"
                     /db_xref="GeneID:38739990"
                     /translation="MSLQVNLSSPAIRTAYEKVLDGVIDYVVLSYKKLSNDLDVTAAA
                     KGSLDDLVEEFSDGKVQYALARVSDPNTHLPKFVLINWCGEGVPENRKGLFPPHSATV
                     ADYFKVYHVSIQARTEDDILPDAILRKVMDSSGSKYGTASSRAPEPIAPVGTTHKPVG
                     TPDIRGMQAKAPKSHETPGPVGTNYTPAREELKQLREGKLSNPAPPSAPKPAVPQPAV
                     PQRSVPQPSSAPKPAPEPAPEPAPPKPAEEDKIQPVGTSYTPVSLPKPGKLSLDRTMP
                     FSQAHAPTGPAPPGRRTAAPGKLTWSQRQEKARQEREAEEAPAESAPSVDHVVSQMNR
                     ASVNEEPPAPSAPPAPPAPPAPPVPEPTASAEPPALDAPASGGQRATVLYDYDAQEDN
                     ELTLREGEILTAIDQVDEGWWSATGPSGATGLFPANYVELLEEAEPEAETTSAPPPPP
                     APPAPPAPEPPAVEQIPPPPPPPPTPPAPPAPEPPAVEQVPPPPPPPPAPPAPPAPEP
                     PTEEQVPPPPPPPPAPPAPPAPEPEAVAPPPPPPPAPPAAAPQAVALYDYEMDEDNEI
                     TLAEGDQIVDIEFASEDWWSGTNARTGAMGLFPANYVERLS"
     gene            <671399..>674548
                     /locus_tag="MRET_3225"
                     /note="MRES_10980"
                     /db_xref="GeneID:38739991"
     mRNA            <671399..>674548
                     /locus_tag="MRET_3225"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629852.1"
                     /db_xref="GeneID:38739991"
     CDS             671399..674548
                     /locus_tag="MRET_3225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485450.1"
                     /db_xref="GeneID:38739991"
                     /translation="MLARLVPVLVCLAVLLSLVPEQSSANAFLSFLSPRKQAPPTVAH
                     RSLYMGVPVTESTATMRLLHPRMQRFIRDTQDVNEKSSTAMISLTDTGVLAGLNPRNG
                     AMAWRRFIENETVHGLFSIDEDMLMVSSQNNDTLIARMLVGDRGVIDWEHTLNDTAVD
                     GLPVYATSWDTGETDALIVAGGMLHYFTSKKLAWKWEPNGGAVVQFVTPYNDRLQVVS
                     HVPQGDEGSALRFTELTIDGDTSADYTMSYTIKDPRSIVFLPYRPRRHINEAYHANEQ
                     SGPHVAWLDDDGVVRAQRIINGDVVLSELRSIGAPFTRLQDVGLGNRGVFLAHHADGA
                     VEIVYVSPTGDGMNVIGSFSELDRDAVLDGGLDLDGKAYVLRMNYDPSMHMLVQEVFR
                     VDEVVDEQMGTMSSMMFQYDFAQYGPLRAVLSEFRVLESGHLAVRCVLLSQSGSVHML
                     VDGVQEWVVEHGLSKPQRTLLVPLADQLLGQAAVSSHAMPAWPLSIEALENESLVDRW
                     LRHARQLCHLHTHLHRFARGPLRRALLSLGRQIEAMLGHKPDTYVEKPIAGGPRLDSL
                     PDADQTAPREATPSDMAKLYHDRFGFDHVAVAASRYGKLYGIKVTLDGSYLLWARPVV
                     PYEQGAHVNVTHLIQTRASNTLAFDRPMAPVMGVVAEVHTDEGLDTHVYYVNPLTGEH
                     VGQPSDALLCTGRASDVLVHDGLVHAVCASGHVEVNAALHVVRTDDDGLQGLLTTPSG
                     MAVQTWRMPLSDRVVAMRDASREPVARYGRVRGDRSVLYKYLNAHARVIVTYNDVLRM
                     AHVYVIDKVSGDMVYHLEVPNVASDAIHVTFTEHWITLVYTSTQAEAPHALVSIELYE
                     REARGAQGLASSSLVRAGTNGTLAASAPPVAYAQVFALPMAVRAVGTTRTGLGVALRS
                     LVLATNASELVLVPRRLVDPRRPLGKPTPAEAEERLMPYNGGLLSNESLPRITGLYED
                     AAFVDRITTSPALLESSSMVLATGVDWVYALASPSGQFDRLHASFNKTQLVLTIAALV
                     IGIAITRPLVRMRALHIRW"
     gene            complement(<674549..>675748)
                     /locus_tag="MRET_3226"
                     /note="MRES_10985"
                     /db_xref="GeneID:38739992"
     mRNA            complement(<674549..>675748)
                     /locus_tag="MRET_3226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629853.1"
                     /db_xref="GeneID:38739992"
     CDS             complement(674549..675748)
                     /locus_tag="MRET_3226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485451.1"
                     /db_xref="GeneID:38739992"
                     /translation="MNPWQWMQMVSGAPTDAACAPRPEVGMSLLSTPPAPVPAAALKH
                     DMDPTTTAMLVPPYDAASLELQVMGDEPCDTESVMMRPRHATTIEIPLRLAWPLIEAP
                     TNPYVDLPRHLRHYGLEAEALEFARSHATCDFVLEAFLTMHKLPRQEASGASLVSQAG
                     EELLHALEQALRAREPSVQEQLACTAMAVAAVPPEHVALPPSVCLPWTNGMRSLPMPA
                     MPTHILAVCASTMSTEFGHWASTPCTLVPVHWIVYVLQCTQLPAVPAQAAAAAASQGQ
                     VPLVPLAVPYPQHWAILHRWLYTRDMAKLLASLVPLSAVLQYVHGHGTEGLGASAPLD
                     ALACVSLSVLVRLALRIRATWHNAQSVGIIAEAFWTTLARAWDMVVHAMVLRKARVPP
                     RVVPASA"
     gene            complement(<675853..>677286)
                     /locus_tag="MRET_3227"
                     /note="MRES_10990"
                     /db_xref="GeneID:38739993"
     mRNA            complement(<675853..>677286)
                     /locus_tag="MRET_3227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629854.1"
                     /db_xref="GeneID:38739993"
     CDS             complement(675853..677286)
                     /locus_tag="MRET_3227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485284.1"
                     /db_xref="GeneID:38739993"
                     /translation="MPVLHATHETKKEQAQLLDQLTRLSRTHPDMTATALVQWYLERV
                     KESRSRLASGSADSPAAVAMLMRYATRRRDIDTLRRLRAPARHWTRQCGNSRHLQKPS
                     LSTKLHSTLFGLAAQHDHWPVMYRLVQDKSPRDRWTPFMCLALLRAKSTTDMIQARDP
                     TGPDAEAKRALWGLFLHEFGHYLAMVRHNSTTTAPPWILMALMELYARCGNDAHVWQL
                     LHMYVASIRRPEMRQEGPLVLRNAPCRLLPQPTSYIPGPRLLHAVMRAYARRGDTAAT
                     LSAFARLTSTSVPDTFTTCEIPWHATDVVLEPSNTSIILAMDAMLQQRGVVASTVPQL
                     LHFLKQVDRSWGSWRARHEPAARPMFINLRTMRHVLTWCLHANAHDEVRHVLRFQQGL
                     LRRELRWHTSPHARPVWLQDPNEWASLRRWRHTLQQLVQRRWISERQERALYVKALHV
                     VRHRVMGTARKMAHTLHRHIIPSSGTS"
     gene            <677518..>678364
                     /locus_tag="MRET_3228"
                     /note="MRES_10995"
                     /db_xref="GeneID:38739994"
     mRNA            join(<677518..677566,677592..677663,677688..>678364)
                     /locus_tag="MRET_3228"
                     /product="chromatin modification-related protein YNG2"
                     /transcript_id="XM_027629855.1"
                     /db_xref="GeneID:38739994"
     CDS             join(677518..677566,677592..677663,677688..678364)
                     /locus_tag="MRET_3228"
                     /codon_start=1
                     /product="chromatin modification-related protein YNG2"
                     /protein_id="XP_027485442.1"
                     /db_xref="GeneID:38739994"
                     /translation="MEDPAEIAVLTSEYISSLDNLPQEVSHILREIEIKDGKVQEWLS
                     RISSKESQMRDMFGTYMDKTNENSEAVRTKLDKMAARVAADYTRVEEWSAQKRELAHV
                     LWRKVYAHHQRLVEDLQLINSDLVASVSSSVPKLPQLTDPAQLPAQLLQAGIGEAETE
                     GHEGRVRKKRGLATTGRGRSVHSPPTAVETESRGVSEAAALDGEEERDENLYCFCQRP
                     SFGEMIGCDSDDCKFEWFHIGCVGVSKPLPQMWVCSDCLAKKKRRRT"
     gene            complement(<678382..>679818)
                     /locus_tag="MRET_3229"
                     /note="MRES_11000"
                     /db_xref="GeneID:38739995"
     mRNA            complement(<678382..>679818)
                     /locus_tag="MRET_3229"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629856.1"
                     /db_xref="GeneID:38739995"
     CDS             complement(678382..679818)
                     /locus_tag="MRET_3229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485443.1"
                     /db_xref="GeneID:38739995"
                     /translation="MTTKEATPIRVAVVGSGLAGLATAYFLTRNTRGVDVTLYERHAA
                     LGMDAESVTVEHEGEHQRIDVPMRAFSAAYYPNLVALYKHLRIGFDPQSFSFSFAHKT
                     NDAHGGPVPDFLYRGRRNKGPRCIRRGSMARPLFWVSTVWSYLVMVILAWLYTVCGYT
                     PHRRTFGEWCDSIWMAQSFVDELLYPMFSSIMTADMAAVRAMPTREVLEYVAHTFLYR
                     HYRVRGGVSQVVHALTDHLPADRVRVGATITDVFPVDTHRIGLRYKASDGSQAEAVYD
                     HLIFGSQATQTAIMLQWYHDHTQPSSRAIFCAQQLAQLRALHYKKSTVVCHTDTGILP
                     PDEADWRDLNFVTPACKGAHDAYTMATHVIHRSPAQVVMQTTNPLPQLFPAADKTIRQ
                     STFDRFVLTPEGRQAREHFFQRRGKRRTLGPLQGSPDGGGGGVWFTGSWSYGVPLLEG
                     CVTSARLVAERILQQHDLDASHIASILD"
     gene            <680160..>682301
                     /locus_tag="MRET_3230"
                     /note="MRES_11005"
                     /db_xref="GeneID:38739996"
     mRNA            <680160..>682301
                     /locus_tag="MRET_3230"
                     /product="FAD binding domain protein"
                     /transcript_id="XM_027629857.1"
                     /db_xref="GeneID:38739996"
     CDS             680160..682301
                     /locus_tag="MRET_3230"
                     /codon_start=1
                     /product="FAD binding domain protein"
                     /protein_id="XP_027485374.1"
                     /db_xref="GeneID:38739996"
                     /translation="MPLSQHRITTSLVTSESEYPIEPLLDAHGRPLRVRDRAYFDLVV
                     IGSGPAALTFVTRWLEERPAALYLEDERQHLHWLKRQTHAAPVLETRKPTKSSDRIIK
                     TNQKNEWHMRKSSLRVLIVDKLGDGWLGQWHRNFGSYEIPFLRSPMFFHPDPSDLDGL
                     LEYAVQTERASTGPYTYVCDMLTGRQSQSKSRSRSAKKGALQRPDLLEVPGVVGREVS
                     KHKWKQSKHRRQAQMFSALGPVVNERDRRDYQNPSTPLFRDFTNHLVDRYHLHPQKGK
                     DGKVRPLSEWLASDDEHQMPAMLLRAEVIDMDYGRLEKERADGSLDEEEGFSLHMADG
                     SCIGAKYVVSAIGYGGRPCVPTWLATASKKSQTTKRDFVDRVTEADSDNASVASSSTE
                     PSTAESESEESDKYEHPPPNSMGDGWAHSSAIAAPSYSVPPPHIAARIASGRPTTAII
                     IGGGLTSAQLTDQCVRRGFSRVILVMRGFFKVKPFDFSVDWVGKYANAQKMQFWQSDD
                     AKDRMNMINEGRDGGSINPVYAKVLLQHAQDGRVELRTHTEIEDAEWDAQTQKWSLML
                     HRKDHARADSQYMNNAQQPGTSVPVIADYIVSSTGSDVSFRKLPFMHTLAEKMQIPEV
                     SGVPIVNEDLQYGSIPLYCIGAYSAVQIGPTAFNLGGIREGADRVAAHIRDKTEEHDE
                     ATLGTKADSDEPSLGHFAHFLYHHLQLDAAD"
     gene            <682370..>683455
                     /locus_tag="MRET_3231"
                     /db_xref="GeneID:38739997"
     mRNA            join(<682370..683058,683083..>683455)
                     /locus_tag="MRET_3231"
                     /product="purine nucleoside permease"
                     /transcript_id="XM_027629858.1"
                     /db_xref="GeneID:38739997"
     CDS             join(682370..683058,683083..683455)
                     /locus_tag="MRET_3231"
                     /codon_start=1
                     /product="purine nucleoside permease"
                     /protein_id="XP_027485373.1"
                     /db_xref="GeneID:38739997"
                     /translation="MRLGLFVGCVFLGLATLCSASSVVAPKVLVITMFEPEREAWLSK
                     MPLTRNITVGGLSPLYPHVSCDHDAEVCLITTGEGEINAASTVSALMSSIRFDLRSTY
                     ILVNGIAGVNPDVATMGSVGFARFAVQVGLQYSIDAREAPKDWNYTFWNYGTSKPGQY
                     PQVLYGTEVFEINTHLRDRVFELVKHLRLKDNASVKKQRATYPQVKAKAPPVVFQGDI
                     TTSDMYFTGKTFGHMASNLTSVLTNGTGTYALTAQEDNAVLEVLVRAHKAKSADYGRV
                     ILFRAASNFDRAPPHQDDLTHFLHVSTQTELIKPALANLFVVGEPIVKAITGNWTQWK
                     DGVQHPCSPSYGDVFGTIL"
     gene            <683488..>684242
                     /locus_tag="MRET_3232"
                     /db_xref="GeneID:38739998"
     mRNA            join(<683488..683716,683741..684133,684157..>684242)
                     /locus_tag="MRET_3232"
                     /product="ADP-ribose pyrophosphatase"
                     /transcript_id="XM_027629859.1"
                     /db_xref="GeneID:38739998"
     CDS             join(683488..683716,683741..684133,684157..684242)
                     /locus_tag="MRET_3232"
                     /codon_start=1
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="XP_027485372.1"
                     /db_xref="GeneID:38739998"
                     /translation="MALRPSLLARSARPLRWVHTMLAHFDPRTSRIVQSRPLANDQAK
                     WIGLRAIEWVDPSGKTRWWESADRTTRRGPVDAVAIIAIIQRPSKEPHILLVSQFRPP
                     VGACVVELPAGLIDAGESDQSGAQRAALRELAEETGYGAQSGQVSVRQTSAVMYNDPG
                     MSGANMKLCTIDIALSDDAPEPLAHPDEGEYIEKHLVPLTSLAANLNDFAAQGYAIDA
                     RLMHLATGLALGLAKPW"
     gene            <684333..>685934
                     /locus_tag="MRET_3233"
                     /note="MRES_11010"
                     /db_xref="GeneID:38739999"
     mRNA            <684333..>685934
                     /locus_tag="MRET_3233"
                     /product="sterol 14-demethylase"
                     /transcript_id="XM_027629860.1"
                     /db_xref="GeneID:38739999"
     CDS             684333..685934
                     /locus_tag="MRET_3233"
                     /codon_start=1
                     /product="sterol 14-demethylase"
                     /protein_id="XP_027485371.1"
                     /db_xref="GeneID:38739999"
                     /translation="MASLLASFEAMPMWQLVLVLTVGTIVLSIVLNVLYQVCVPQNKS
                     LPPRVFHWVPVVGSAVSYGMNPYRFFFECREKYGDVFTFTLFGRNMTVALGPKGSNLV
                     FNGRLSQVSAEDAYTSLTTPVFGKGVVYDVPNAVLMEQKRFVKSGLSVENFRVYVTQI
                     TDEVKDFVQHDAAFAPLQKGAKSVTVDIFDVFSEITILTASRTLQGKEVRENLDKSFA
                     KLYHDLDAGFTPINFVLPNLPLPNNFRRDRAQRMMSDFYMGIIKKRREGKTDGTGHDM
                     ISALMEQSYKGGRDINDREIAHMMIALLMAGQHTSSATGSWAMLRLASRPEIIEELYE
                     EQVRVYSDGAGGFAPLDYDTQKSSVPVLDAVIRETLRMHPPIHSLMRRVKSDMVVPPT
                     LAAPKTGKGQSTDTYVIPKGHYLVAAPGVSQIDPHVWCDADKFDPHRWLGDKTLMDQT
                     DDAQEDFGWGLVSTGANSAYLPFGAGRHRCIGEQFAYLQLGTIISNFVRMFHWRLEDK
                     LPAPDYTSMVVLPTQPANIVFTSRT"
     gene            complement(<685944..>687053)
                     /locus_tag="MRET_3234"
                     /note="MRES_11015"
                     /db_xref="GeneID:38740000"
     mRNA            complement(<685944..>687053)
                     /locus_tag="MRET_3234"
                     /product="homoserine dehydrogenase"
                     /transcript_id="XM_027629861.1"
                     /db_xref="GeneID:38740000"
     CDS             complement(685944..687053)
                     /locus_tag="MRET_3234"
                     /codon_start=1
                     /product="homoserine dehydrogenase"
                     /protein_id="XP_027485370.1"
                     /db_xref="GeneID:38740000"
                     /translation="MSSAIDVAVIGVGLVGSAVLKQLATVPSLSVLKVVALQNSRKTL
                     LAAPGQHLALDHWQAQLETSSSPALSLEQLVSELQAIQAKNRRHIAVVDNTSNDTVAG
                     FYPSFLRAGFSVVTPNKKAFSGSVDLFSAMEEAKENDARPLVYQESTVGAGLPVISTL
                     KDLVATGDRIHKIEGVLSGTMSYIFNEFSPASGSTTKFSEIVSVARQNGYTEPHPGDD
                     LSGSDVARKLTILSRLIPNLAYALPKGYESVDTQSLTPAGLANESNADVYVQRLPEFD
                     AEFDEMRAQAQAKHCVLRYVGLIDVEKKIIKAGLEAYPADHPFATSLGGSDNILSFTT
                     ERYPRPLLVQGAGAGADVTAMGVVADLVRVAERRG"
     gene            <687192..>688022
                     /locus_tag="MRET_3235"
                     /note="MRES_11020"
                     /db_xref="GeneID:38740001"
     mRNA            <687192..>688022
                     /locus_tag="MRET_3235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629862.1"
                     /db_xref="GeneID:38740001"
     CDS             687192..688022
                     /locus_tag="MRET_3235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485369.1"
                     /db_xref="GeneID:38740001"
                     /translation="MSGAQPPPYQELQPPSWTSSLPRPEPSQERYEDWLAYTSLRPSF
                     LLAHGVATIVGIVLAAVQWYIVGYEREGPEALAIASATLFTVFFVFEACGFVAGCMSH
                     TKLIWGFARFSILSYVLVVVAEVIALVNTYANKDKIKRHCVEDQTQNWNSSSNIYEHE
                     APPQDYCDSRWGTTAAWDVVWLILLVIFGAFFYAFTMRFQLRLQQDTRPHRAHEPVER
                     QDGYPMQRFSTMHSDDMDAHDDAFGDIKSEIGSLAYSEPDTLARPAQAAGQPLSPRIV
                     "
     gene            complement(<688047..>688892)
                     /locus_tag="MRET_3236"
                     /note="MRES_11025"
                     /db_xref="GeneID:38740002"
     mRNA            complement(<688047..>688892)
                     /locus_tag="MRET_3236"
                     /product="20S proteasome subunit beta 5"
                     /transcript_id="XM_027629863.1"
                     /db_xref="GeneID:38740002"
     CDS             complement(688047..688892)
                     /locus_tag="MRET_3236"
                     /codon_start=1
                     /product="20S proteasome subunit beta 5"
                     /protein_id="XP_027485368.1"
                     /db_xref="GeneID:38740002"
                     /translation="MQSVLAKFSDVPTLKRDDEHEFALPASDPSRFLAQYTDVDSTHT
                     DARIKLQHGTTTLAFRYRGGVVVAVDSRASAGSYIASGSVKKVIEINPYLLGTMAGGA
                     ADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGMGLSMGTMICGWDKT
                     GPAIFYVDSDGARMKGDMFSVGSGSTFAYGVLDQGYHWDLTDEQALDLGRRSIYAATH
                     RDAYSGNTINLYHMGPNGWTFIANYDVMQLHYDGVPEQVPGTPAGGYGYDVRTQGLSS
                     RDNAA"
     gene            complement(<688955..>691999)
                     /locus_tag="MRET_3237"
                     /note="MRES_11030"
                     /db_xref="GeneID:38740003"
     mRNA            complement(<688955..>691999)
                     /locus_tag="MRET_3237"
                     /product="polyphosphoinositide phosphatase"
                     /transcript_id="XM_027629864.1"
                     /db_xref="GeneID:38740003"
     CDS             complement(688955..691999)
                     /locus_tag="MRET_3237"
                     /codon_start=1
                     /product="polyphosphoinositide phosphatase"
                     /protein_id="XP_027485367.1"
                     /db_xref="GeneID:38740003"
                     /translation="MSHEDVWSERPGDLTRCTLYKSRDYMYLVYVSADQTRHRILRIL
                     RVPPILAQDKTSVADEPPKSPPKETAAETPAASPPGTPTHYERSSSSVVLSIADDDEH
                     APQAVPPTSGTLSSEITELASSLVPEHATSIPGAPENANGKYLGLYDADVLHLRLTAE
                     WKQYTGATDEPRAEAPERTVRPISDLGRTPEPAHTPPPPPPPPPSSAPSEAPSELPES
                     SSDSAWALRVTAYSSEHTPPNELHDVLAAIYDGAGHDGPCKEVGRYFGLVGFVRFTAG
                     YYMVLISKRSVVSLVGGHYIYHCDETQVVPLCSSSALYTALGRNKTRDASESSLLRSF
                     NQVDLSKNFYFSYTYDITRTLQENMTGPRAHAQLFVAKAWGYKEKFLWNYQLLEPAFG
                     DCRDSAPDDARRHWIIPLVHGFVDQAKLNVLGTAIYVSLIARRSRHFAGARFYKRGIN
                     VDGYVANDVETEQIVSKPVTTPFYWPASRFDASTLRASPHFASYVMMRGSIPVFWTQD
                     SNNMSPRPPIEISVVDPYYTAAMRHFRELFSAYGTPVIVLNLVKSKERQPRESKLLRA
                     FTECIEHLNGFLPSDDDGKDHRIRYIPWDMSRASKSRNENVIEFLEELAEEALEATQY
                     FHSGPLPETFCRITDPSNDPILLQHGIVRVNCVDCLDRTNAAQFVLGKVALAHQLHAL
                     GLLKHPHLSFDSDAVDMLTEMYHDLGDTIALQYGGSALAHTTDTYRKINHWSSHSRDM
                     LEGIRRYYANSFADAEKQASIDLFLGQEPSESRAMLHEHAGQEERTMRLTTYTDAAEH
                     MNAKLRYLQHFVHTERCFWDGYYRPTLFTDLQRLHAYKMTAVHLDRADVDDPMPMLNE
                     SEAPSLEHVPKHMRTPTTSSLHRSILGGMRQWIKPSVAPFDSRDKSQDTPSTHDAAST
                     HAPAHAPEPVAPHPLEAVVHRTMHPSLSRQEAREYLAYCTQFDALPFRLTDHTTDTDL
                     HIYEQATSMHLHGFIHTRTEAPDAVYAAFTQPPLVRFAAARV"
     gene            complement(<692040..>693635)
                     /locus_tag="MRET_3238"
                     /note="MRES_11035"
                     /db_xref="GeneID:38740004"
     mRNA            complement(<692040..>693635)
                     /locus_tag="MRET_3238"
                     /product="delta24(24(1))-sterol reductase"
                     /transcript_id="XM_027629865.1"
                     /db_xref="GeneID:38740004"
     CDS             complement(692040..693635)
                     /locus_tag="MRET_3238"
                     /codon_start=1
                     /product="delta24(24(1))-sterol reductase"
                     /protein_id="XP_027485568.1"
                     /db_xref="GeneID:38740004"
                     /translation="MAATPIREGVRTRRAAAQAAEQERLQQQQQQQQQQQQQQPPQRS
                     DDTYHHTYAHPDLRDPQIMGGVKERAVAVPTPGIKITEKGRERDRLMDTHQSWEFGGP
                     WGVTAMITLFPVLMYYLWICLWFYDGQFAHPTSLADIVPFFQRMGRHVYEDAFPTPRA
                     LIGYGGLMVVEFVLAWIVPGYMQEGLPVPSLNYKTLMYKCNALGCLYCTLIIAAALHF
                     SGVYRLTQIIEHFGEYMTVSMIAGFAVSFATYFHAVFTHTTHRMSGNFMYDFFMGAAL
                     NPRIGPIDLKMWAEVRIPWVLLFMISVSGACQQYEQYGYVTPNMAFMVLATGLYLNAC
                     AKGEECIPQTWDMFHEKWGFMVIFWNFAGVPFTYCYSIVYMAAHPPEYYRFSTPTYVF
                     MYALLLFAHFVFDSSMAQKSRFRMQLQGTLKVRWSFPQWPWSTLSNPRYLQTEHGNAL
                     LIDGWWQFLRKPNYTADWTQAFLWGAIAGTRSVIPYYYSVFFLAVLTHRCSRDFERCA
                     RKYGKDWDKYCRIVPYRFIPFVY"
     gene            <693763..>694296
                     /locus_tag="MRET_3239"
                     /note="MRES_11040"
                     /db_xref="GeneID:38740005"
     mRNA            <693763..>694296
                     /locus_tag="MRET_3239"
                     /product="large subunit ribosomal protein L7/L12"
                     /transcript_id="XM_027629866.1"
                     /db_xref="GeneID:38740005"
     CDS             693763..694296
                     /locus_tag="MRET_3239"
                     /codon_start=1
                     /product="large subunit ribosomal protein L7/L12"
                     /protein_id="XP_027485376.1"
                     /db_xref="GeneID:38740005"
                     /translation="MMMKPAAAAARRVALALPRARAMPVRMLSQSVRVCEEASAPSPK
                     ITEIVDRIEKLTLLEASELVQELKTRLNITDIAMPAAAAPAAPAAAAPSDEAPAEEKP
                     KEKTLFTIKFLGLGSDSAKAKVIKEVKAINTSMNLVEAKKFVESAPQTLKENVTKEDA
                     EKIKEAVEKAGGKIELA"
     gene            complement(<694293..>695597)
                     /locus_tag="MRET_3240"
                     /note="MRES_11045"
                     /db_xref="GeneID:38740006"
     mRNA            complement(<694293..>695597)
                     /locus_tag="MRET_3240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629867.1"
                     /db_xref="GeneID:38740006"
     CDS             complement(694293..695597)
                     /locus_tag="MRET_3240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485517.1"
                     /db_xref="GeneID:38740006"
                     /translation="MAPPVPSSDPIDDEVGGLQDDGMRRAYAEPAVLSWDDDSDDELL
                     LDADLPLRRQPRRAAARTAPYTFRPSLVREEPDTRFSIEALCREKKRPRRRVDVDVAV
                     ELPNTEAPDSVWQLLARDAQERKPKTSTYWDHEMNPATDVHTGASLAQHIDTLAPLDL
                     IQVALADDEYAARAARNRLAHVEQVWMYVPVILASLGHGASEGILGWAPPRERRVHRL
                     WHMLQCLPDPCDAQTWTMLLHLGTAPPMQAFPYERASLLRPLLSHMDLDELGACIVDL
                     GKTLEAEDRVALVRAIPGLGDVRALVAYHLLLSLSWPSPLDIPRLSAWLATTHTPGDY
                     ASATAHMELLSLALSNAPALLAARGSDALCELCPLVQRVWTLCRAWYDPRGHTDKMAA
                     RDVAQRLGWRLSYQARNYVEKSHEQAWSLQPLLDGIMPSSVY"
     gene            <695655..>698390
                     /locus_tag="MRET_3241"
                     /note="MRES_11050"
                     /db_xref="GeneID:38740007"
     mRNA            <695655..>698390
                     /locus_tag="MRET_3241"
                     /product="Cu+-exporting ATPase"
                     /transcript_id="XM_027629868.1"
                     /db_xref="GeneID:38740007"
     CDS             695655..698390
                     /locus_tag="MRET_3241"
                     /codon_start=1
                     /product="Cu+-exporting ATPase"
                     /protein_id="XP_027485518.1"
                     /db_xref="GeneID:38740007"
                     /translation="MSDAEKKGETHKFHVSGMTCGACVSSIEKMLGKQEGILDVTVAL
                     LAERATVTYDASCGWTPEKVVEAIDDIGFDAEVVVEPKEDDVVLSIFGMTCSSCTSSL
                     ERVLRAEPGVVSCEVSLATQRAHIRFDHHRTNVRALVEAVEKAGFDALLYDDRDAAQI
                     DSLTHVREMHDWWHAFLFSLAFAVPNFFLCMVLMHVQFLRPILMAQLLPGLYVQDVLG
                     LLLTLPVQFGVGQRFFRAAYKAIRHGSMTMDTLVIVGTMAAWTFSVAAMLVSLGCTGP
                     GCEKPKTFFDTSTMLITFVALGRYLENSAKGHTGEALTRLMQLAPQKATILSGDSERV
                     IPAELLQVGDMVKLVPGEKIAADGIVRHGSSTVDESMVTGEHVPVPKSVGAQVLGGTV
                     NGHGTLDFEVTRAGRDTSLNRIVQLVQDAQVSKAPIQDYADRVAGVFVPCIIALSLFT
                     LVLWLTVACVFPPAWQPRMLRDAGSHKFMECLKLCISVVVVACPCALGLSTPTAVMVG
                     TGVGAENGILIKNAPSLEAACAVRHVVFDKTGTLTKGQLSVTDQMHVGPFPLEHMLAL
                     VQSVESRSEHVLARALIAHCAATPLPPAHTDSFDMVQGAGVRATAECEGSVYDVVIGN
                     ATLHGERPVPMEAFAQGWEARGCTVVYVSLNGALTAAFALSDVLKEHAADSVQWLHDM
                     GMQCSIMTGDTSASAGAVAQAVGVFPDHVHAGLSPNGKLTLLRECRTPRPQAHTLLER
                     VCEALIPTQKYGLAMVGDGVNDSPALAVADVGVAMSSGSDIAMGAASIVLMRNDLMDV
                     PTAFMLCQRIFWQIRLNFLWAMTYNMIMVPLAMGLLLPWGIYLHPMMAGLAMACSSVS
                     VVLSSLSLRRWKRPTLSDAPPSAGPTWPRRLVRMLSHMSRSAPPEPEYTALNEVV"
     gene            complement(<698387..>699712)
                     /locus_tag="MRET_3242"
                     /note="MRES_11055"
                     /db_xref="GeneID:38740008"
     mRNA            complement(<698387..>699712)
                     /locus_tag="MRET_3242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629869.1"
                     /db_xref="GeneID:38740008"
     CDS             complement(698387..699712)
                     /locus_tag="MRET_3242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485515.1"
                     /db_xref="GeneID:38740008"
                     /translation="MPVAPDVLPDVLRHLAWRVRDLAACCRVCRLWHAVATPLLYERI
                     WLRNQTRLVRVFATLAQTPSLAAFVRILEVRVFPFGMPAEALEALEAHIVQALQSMTH
                     LRELRWTRTGSLSDRVLLHMFDATHHLQTLELTGDSRTWSPRLLAERIPRSVTTLSFL
                     LPDATVVRHLPDIVAQLEGRLASLQLLCMHSSVVTDDILRTLAPLAPRLQRLALIGCK
                     HVYGPGIEALATVRHLCLEAVGLSPSALGRVVPQHVQSLVLTLPRHDVPSFLDEVSAV
                     LASCDALQHLTLYACGGRAAIVDAHAPHMTDACLRRLGATPLRTLRLYGLGLSLAQLN
                     ALSYAKIAHTLRDLVVHLYEGITDTLFGSIARFAHLVSVHILSDTNSDATLTDEDAQQ
                     LVSQAGEHLQQVGFRNRVMRVCVTKEGRALTTWDAHSETFPDVMLVVRS"
     gene            <699821..>700564
                     /locus_tag="MRET_3243"
                     /note="MRES_11060"
                     /db_xref="GeneID:38740009"
     mRNA            <699821..>700564
                     /locus_tag="MRET_3243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629870.1"
                     /db_xref="GeneID:38740009"
     CDS             699821..700564
                     /locus_tag="MRET_3243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485516.1"
                     /db_xref="GeneID:38740009"
                     /translation="MVWTQRVRDALVRTYATTTKIPKHFAYQDKRKGFSERKTFLFNK
                     YQRMMRENELVVLFHAENLNVKLLSEIRRQVSHIKVPDADLARLEALNHGAPWTWPAS
                     AFTMARTGLLRPVCRRDTAESIQALEPYLHGQMAMLTCPVLSPEYVGKVLRAIERPVT
                     AAANDVDPKSEKKAPLLRPLVAVAERARVIDAKSLPAFTQLPNLATLRAQLVGLLSAP
                     GTQLAGILSQAGGGELAATLEARRRDLEA"
     gene            complement(<700580..>701299)
                     /locus_tag="MRET_3244"
                     /db_xref="GeneID:38740010"
     mRNA            complement(<700580..>701299)
                     /locus_tag="MRET_3244"
                     /product="MSF1 domain protein"
                     /transcript_id="XM_027629871.1"
                     /db_xref="GeneID:38740010"
     CDS             complement(700580..701299)
                     /locus_tag="MRET_3244"
                     /codon_start=1
                     /product="MSF1 domain protein"
                     /protein_id="XP_027485513.1"
                     /db_xref="GeneID:38740010"
                     /translation="MVQTVASDAQLAFPWRECVQGFFLRYPNPQASHVLSVDVVARRI
                     EERAPPEPGPLPRLVLCTSRLILKSGSLPSWVPRNIIQQTTSWVLEDSEVDLSAEAPR
                     VMSIWTRNLDHTSVLAVTEALTLREDGASTRMHIDADVRSGVSFRLLRRRIEKFGHKR
                     YLSHMESSRHGLIWAILRIAPHLVHTPQPQAPVPYRQRLLHALRPPFLDGYPLTPWQW
                     LKKQGRRLRDKFRQRPTDTQT"
     gene            complement(<701361..>703052)
                     /locus_tag="MRET_3245"
                     /note="MRES_11065"
                     /db_xref="GeneID:38740011"
     mRNA            complement(<701361..>703052)
                     /locus_tag="MRET_3245"
                     /product="signal recognition particle subunit SRP54"
                     /transcript_id="XM_027629872.1"
                     /db_xref="GeneID:38740011"
     CDS             complement(701361..703052)
                     /locus_tag="MRET_3245"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP54"
                     /protein_id="XP_027485514.1"
                     /db_xref="GeneID:38740011"
                     /translation="MVLADLGRRLHQAFSDLQRQPTVDDASIDQLLKDVCAALLASDV
                     NVRLVQKLRQDVKDEVRALLNDKGKAETYSDAQRKNQVQRIIFDYLVQLVDPGEGSTK
                     HRLDKGQQSVIMFVGLQGSGKTTSCTKLALWYQKRGYRTGLVCADTFRAGAFDQLKQN
                     AAKARIPFYGSYTETDPVAIASAGVASFKKNRFDVIIVDTSGRHKQEKDLFDEMIDIS
                     RAVKPKQTIMVLDASIGQAAEAQCRAFKEAADYGALFVTKLDGHAKGGGAISAVASSQ
                     TPILFIGTGEHIHDLEPFRARPFISKLLGMGDLSGLMDKMEEMHMNEDVQQRQRDMMK
                     KIQEGGTLTIRDWREQITSIMSMGPMSKIAGMIPGMGQMMGGEGPNDQTANQKFKTML
                     YIIDSMTPDELDSDGSCFTKPIHPGTKTPVRLTARALRVARGSGTSVRDVEEFLMQYR
                     TMAHMVKKVGGKTNWMQQMKGGAPMMPPGMTREQMHKMQQSLPADIKAQLRQPGGREQ
                     LMRQLQSGQVPPSLAAMGGLGGMPGMGGMPDLSQMQNMMQGGLGGLMQKMMGGAS"
     gene            <703091..>704314
                     /locus_tag="MRET_3246"
                     /note="MRES_11070"
                     /db_xref="GeneID:38740012"
     mRNA            <703091..>704314
                     /locus_tag="MRET_3246"
                     /product="phosphatidylinositol glycan, class V"
                     /transcript_id="XM_027629873.1"
                     /db_xref="GeneID:38740012"
     CDS             703091..704314
                     /locus_tag="MRET_3246"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class V"
                     /protein_id="XP_027485742.1"
                     /db_xref="GeneID:38740012"
                     /translation="MPPSTTRVLLASVLWRVVCVCLLLVSTHAQPAFDTSGELVRLTL
                     RPGAWDAYWDAWAAPFVRWDTVYFVAMAERGYVYEQMLAFQPGIVHVLRVMGSVPRVW
                     GAPWSPTCAVLGGAIAANLASILAPVLLYRLLRTLTRSDAVAERAALLSVLAPASGTS
                     LSAPTPEPFYSVLALSGLLLLTHTHTAYQWGAAVCFALATWFRANGVLLCGFLVWHGL
                     YKPVLESWPTRRTSHAISGIASALVSVSPFVAQQWWAYTRLCPGRPWCDARLPLAYTF
                     VQRAYWDVGFLRYWTVAQVPNFVLAMPVLAVAAYACRPLVSSSVLVVLAPWRARQAPG
                     DVYVYACHTLVLVCILLLASHVQIALRMATPGGMPLVWWACAALYERHRGVLVYLLCY
                     STAAIVLYAGFYPPA"
     gene            complement(<704311..>705126)
                     /locus_tag="MRET_3247"
                     /note="MRES_11075"
                     /db_xref="GeneID:38740013"
     mRNA            complement(<704311..>705126)
                     /locus_tag="MRET_3247"
                     /product="protein SYS1"
                     /transcript_id="XM_027629874.1"
                     /db_xref="GeneID:38740013"
     CDS             complement(704311..705126)
                     /locus_tag="MRET_3247"
                     /codon_start=1
                     /product="protein SYS1"
                     /protein_id="XP_027485512.1"
                     /db_xref="GeneID:38740013"
                     /translation="MPWPVQLPTALHGWDPWRILAQICVLQCVHYILLATFVPPLLSI
                     FTEPAALRFEGGPAQVGMMLDWREVASKPTWDWTHLMDLVGWKPSDEAPAVPWTPTEQ
                     AALSDWTAGSIWLQGSNASGPVEPTVVAPSRFRWNDTSPTLTNDVPPPPTDSVEQQLE
                     AWEYRRTHDKRRGWAISAAWMLTVFFDVQVLYYLVRKPTHVLDFVSTMHFTHLLITTW
                     VAGAVPYALYWWALMIVHASLCIILAERFAIQREMRMGFTDHAVLDDMEMHRR"
     gene            <705120..>705602
                     /locus_tag="MRET_3248"
                     /note="MRES_11080"
                     /db_xref="GeneID:38740014"
     mRNA            <705120..>705602
                     /locus_tag="MRET_3248"
                     /product="AP-2 complex subunit sigma-1"
                     /transcript_id="XM_027629875.1"
                     /db_xref="GeneID:38740014"
     CDS             705120..705602
                     /locus_tag="MRET_3248"
                     /codon_start=1
                     /product="AP-2 complex subunit sigma-1"
                     /protein_id="XP_027485510.1"
                     /db_xref="GeneID:38740014"
                     /translation="MACRGVETGEAWRVVFMLHFVLVQNQQGKARLAKYYVRYDDAEK
                     KQLPGEVYRIVAQRNPRSQSNFVEFRHGTKIVYQRYAGLYFSVCVDMHDNELMYLEAI
                     HLFVEILNAYFTNVCERDLVLHFYKVYAVLDEVFLAGVVADTSAAQVLQRLELLDRLG
                     "
     gene            complement(<705599..>706636)
                     /locus_tag="MRET_3249"
                     /note="MRES_11085"
                     /db_xref="GeneID:38740015"
     mRNA            complement(<705599..>706636)
                     /locus_tag="MRET_3249"
                     /product="required for respiratory growth protein 9,
                     mitochondrial"
                     /transcript_id="XM_027629876.1"
                     /db_xref="GeneID:38740015"
     CDS             complement(705599..706636)
                     /locus_tag="MRET_3249"
                     /codon_start=1
                     /product="required for respiratory growth protein 9,
                     mitochondrial"
                     /protein_id="XP_027485511.1"
                     /db_xref="GeneID:38740015"
                     /translation="MWRRCALRSLHTSARAALPRVRRPTAPTAPTTKPAPARLPWFMD
                     EHIVEAKAPPPEPSPDVLPPVVWMPAYIPTSGHVPQQLSTLVDMCTTGALHPLVARPA
                     EPDDIDVDDWSERVRGSPITVIRPTATSEAVVDQVQDWIVIVQVRGTNVGTVRRVAQE
                     LVQYLKHTPPPTTLPAKDAALDAVLGPAHIIQQATSEHPESWSPKRKLSREAIEGVRL
                     LHAKDPAHFSVKTLSERFGVSVEGMRRILHSSWQPSPEAAQRQNARAHSQRNAREAEE
                     MDALLPTTYPVRVEGLVSSADLAKEGRRAKSVASRGSGDWCLIDAGWCVVHVMTSDAR
                     ERYRIEELWKA"
     gene            <706767..>707248
                     /locus_tag="MRET_3250"
                     /note="MRES_11090"
                     /db_xref="GeneID:38740016"
     mRNA            join(<706767..706770,706797..>707248)
                     /locus_tag="MRET_3250"
                     /product="NADH-ubiquinone oxidoreductase 21 kDa subunit"
                     /transcript_id="XM_027629877.1"
                     /db_xref="GeneID:38740016"
     CDS             join(706767..706770,706797..707248)
                     /locus_tag="MRET_3250"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 21 kDa subunit"
                     /protein_id="XP_027485581.1"
                     /db_xref="GeneID:38740016"
                     /translation="MLQKQLESEFPLIDSDPHFRRVVRYFRPSDYYYMAGSTLAFPGA
                     LWLMESASPARGKGKLSAAMKLSAALGLCGGFLYAYQRSTFRFWGWSENEREQQRARE
                     EAQSGTVIGQGESSLSDEMQGVAHRNSVFSQLNLAVLPWFNVVNHKYHS"
     gene            complement(<707267..>707893)
                     /locus_tag="MRET_3251"
                     /note="MRES_11095"
                     /db_xref="GeneID:38740017"
     mRNA            complement(<707267..>707893)
                     /locus_tag="MRET_3251"
                     /product="translocation protein SEC72"
                     /transcript_id="XM_027629878.1"
                     /db_xref="GeneID:38740017"
     CDS             complement(707267..707893)
                     /locus_tag="MRET_3251"
                     /codon_start=1
                     /product="translocation protein SEC72"
                     /protein_id="XP_027485484.1"
                     /db_xref="GeneID:38740017"
                     /translation="MSGVPQAVPPETATDAQGNPLLVAVDRDELFSFSVDATTKRVHT
                     DAQDVHLLNLIVNWLRMLPPQAPCPPPPNILQKELSEGIAEEKAKGNAAYRKKDYETA
                     IKHYTLGIALITSRPMWESSSIIADELTVMLANRSAAMLACEAHIEALCDADAAVKIK
                     GAWGKGHFRKGKALAALQRYEEARAAFELGHQCEPDNEDFLQAIAALP"
     gene            <708027..>708923
                     /locus_tag="MRET_3252"
                     /note="MRES_11100"
                     /db_xref="GeneID:38740018"
     mRNA            <708027..>708923
                     /locus_tag="MRET_3252"
                     /product="ATP synthase mitochondrial F1 complex assembly
                     factor 2"
                     /transcript_id="XM_027629879.1"
                     /db_xref="GeneID:38740018"
     CDS             708027..708923
                     /locus_tag="MRET_3252"
                     /codon_start=1
                     /product="ATP synthase mitochondrial F1 complex assembly
                     factor 2"
                     /protein_id="XP_027485486.1"
                     /db_xref="GeneID:38740018"
                     /translation="MLLRGLRSVCAVPRQVRAVHACAVRLNAGADRAEQSMQRFWKDV
                     HLAFETPSNGDDEHFVVQLDRRNLRTPGGAKLAIPADRPLLACLIAQEWDEQTQLIKP
                     HSLPLTSLMSRAIDALQDDERGRKEVQDYLMRYLDTDTVCFFDKEPARLVQLQKERWT
                     PLLEWTRRLLDADVHTATGTLVCRQPDATRAKVERLVAGLPPLDLASLERAVMVSKSM
                     IIGLALIHRYIEAEQAALAAEVETASQVATWGVIDDSHDVDHAELRRQLASVACAQVS
                     TEPELVEKFLQVLKKHDGAFRT"
     gene            complement(<708928..>710484)
                     /locus_tag="MRET_3253"
                     /note="MRES_11105"
                     /db_xref="GeneID:38740019"
     mRNA            complement(<708928..>710484)
                     /locus_tag="MRET_3253"
                     /product="integral peroxisomal membrane peroxin"
                     /transcript_id="XM_027629880.1"
                     /db_xref="GeneID:38740019"
     CDS             complement(708928..710484)
                     /locus_tag="MRET_3253"
                     /codon_start=1
                     /product="integral peroxisomal membrane peroxin"
                     /protein_id="XP_027485485.1"
                     /db_xref="GeneID:38740019"
                     /translation="MSPSSAVKPARTLSFVDIVERMPPSMIQLLTVLAPAIHVMHHAL
                     LLVTWRGGYAMRVQSWILLVAYVQLCLYGYEVLRYAPQLLVLALLGYTWLHRSCARIT
                     GHRRASDERGSPEQLRRALVELADVSDFAVAMHECFVQPVYDVLTWQVPGYGPVHLVL
                     FLLVTWPVWLLCMLPSHMWLTHIYATRANLVEWLGGAPTAWAHRAWAASLALWDARIA
                     PHVPSACFTAAAWLQTHVVPHLVRAAAWLTSSPTYVSLQLWPPFPIASLSVRHVLLFV
                     GVLVLSWCSPWATLLRMALWRSAFVRHSVMWLVHALSGSETLAASLPTPKAALAPRPR
                     TTQHETPFVFEIYENQRWWIGLDWTAALLPQERPSWSDSDNAAVAPPASFALPRSTSV
                     LLPSSHTTGKSDRRTSEWRWVDTEWRVAGVVGVSSSTYTPAASTTATEAQREEASQRE
                     HVEVPDEVRRYARPADMPSASMDVDAEGWQYGDNAWDKFSKQNGMGRYTRRRRWLRKA
                     VLVQTVEYGV"
     gene            <710602..>711954
                     /locus_tag="MRET_3254"
                     /note="MRES_11110"
                     /db_xref="GeneID:38740020"
     mRNA            <710602..>711954
                     /locus_tag="MRET_3254"
                     /product="phosphatidylinositol glycan, class S"
                     /transcript_id="XM_027629881.1"
                     /db_xref="GeneID:38740020"
     CDS             710602..711954
                     /locus_tag="MRET_3254"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class S"
                     /protein_id="XP_027485481.1"
                     /db_xref="GeneID:38740020"
                     /translation="MGGAADASFQRTSLHVRILASIVCVIAACVPAWWMLTKIERLPL
                     PAEAVRALEARGACPIRTAWAVVVPTNECESVRQELQRHSLCVDWRVEGTHCVAGAAS
                     ATSTYRVPDANVSAHLAPLLRRAESDSVSVPYARKIRVVFSLLQEDASVGRALHGWDL
                     THALHNISAYEALAPLARTVRALERVYDIQLESQVQWYAPLELEPQRHGAGQDAFYTV
                     SMQDARVFVNAEQWRLDSYGTADLSPATEVRTLQFVLFVPSVHAPLYLDAETLHQQPA
                     WLLPQWGGVVVWNGAHESEHVSLEALQEPMSRFAEQLRALLGLERGPDVGMAVEGLVW
                     RRTLEMARSAVETLGSIVRLVTKIPNLGVNAQVRDATLAAIEALAACDPQHADAALHH
                     ATQAHTHASRAFYDPSMLATLYFPSEHTFAVYTPLFGPLFMPLALGALREWRRRRHRR
                     "
     gene            <711992..>712408
                     /locus_tag="MRET_3255"
                     /note="MRES_11115"
                     /db_xref="GeneID:38740021"
     mRNA            <711992..>712408
                     /locus_tag="MRET_3255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629882.1"
                     /db_xref="GeneID:38740021"
     CDS             711992..712408
                     /locus_tag="MRET_3255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485480.1"
                     /db_xref="GeneID:38740021"
                     /translation="MSRRREAHDLERVLALSQAEAQRASQTDTAPSPPETETSSKGGA
                     QAVAPHASEPGKAHARKRFFGKPLRTLLVSDKTSRMPGLGRRVRLPPLHPHRRLPPPK
                     RPRLPTKDAPPPKEGSDAEEEENGEPEPDYENEGFL"
     gene            complement(<712422..>713085)
                     /locus_tag="MRET_3256"
                     /note="MRES_11120"
                     /db_xref="GeneID:38740022"
     mRNA            complement(join(<712422..712912,712938..>713085))
                     /locus_tag="MRET_3256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629883.1"
                     /db_xref="GeneID:38740022"
     CDS             complement(join(712422..712912,712938..713085))
                     /locus_tag="MRET_3256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485483.1"
                     /db_xref="GeneID:38740022"
                     /translation="MMNKRAVSAHDVGLHGAPSTGLSRVSSQYDSIPMDVQNRLQSMG
                     WRIRSNVSRGYRHGGSSSGASALDTVQQVRQSSHQWGRTASVPHGALRGMAPPMPTGA
                     ADEAPSPFSLKRGTAEDDSDAVLADAFGDDDGCEMDALPVSEPMSCDVDVAHAPSERP
                     MRPLPARQGLRATQSMPPSAPAWRDLAAESHRDADAFRLIDFSAFATHADHF"
     gene            complement(<713202..>713561)
                     /locus_tag="MRET_3257"
                     /db_xref="GeneID:38740023"
     mRNA            complement(join(<713202..713230,713257..713291,
                     713317..>713561))
                     /locus_tag="MRET_3257"
                     /product="stress responsive A/B barrel domain protein"
                     /transcript_id="XM_027629884.1"
                     /db_xref="GeneID:38740023"
     CDS             complement(join(713202..713230,713257..713291,
                     713317..713561))
                     /locus_tag="MRET_3257"
                     /codon_start=1
                     /product="stress responsive A/B barrel domain protein"
                     /protein_id="XP_027485482.1"
                     /db_xref="GeneID:38740023"
                     /translation="MPLVHIVLFKVKSQVLSNGWEEFQARAETIRDLAVVKDVCQDMR
                     LGPPVWDTRSHGFNYGLYSVFATMDDLVRYKEDNDHKEFIKMNLLPNIDDLLAYDFEL
                     "
     gene            complement(<713592..>714428)
                     /locus_tag="MRET_3258"
                     /note="MRES_11125"
                     /db_xref="GeneID:38740024"
     mRNA            complement(<713592..>714428)
                     /locus_tag="MRET_3258"
                     /product="gem associated protein 2"
                     /transcript_id="XM_027629885.1"
                     /db_xref="GeneID:38740024"
     CDS             complement(713592..714428)
                     /locus_tag="MRET_3258"
                     /codon_start=1
                     /product="gem associated protein 2"
                     /protein_id="XP_027485479.1"
                     /db_xref="GeneID:38740024"
                     /translation="MPRAPEGGQPSLPVGTLPVDGIPRDGEEYLAMVRAEAQNAPSIL
                     VHAMEEAPLATPAPQPEGDARMPTHAWCTVFVERFKRLRYSVRVLRPTGTVRARIPGV
                     HEESRWYAYVHGRAAPTEDERQRMLVSGAGSDSESEVSELLDAHDLTAHGYRFREPSL
                     AVLAQLDTREAVALTKLFRKWMQHAQFTQGDAVLHPVHARWLFGLLACLDDDVSGEDM
                     ASLRVLARACIKCLVRARQQSTQHEGGAWMILVVLAGVCGQRDLWDEAQARLGPGGGG
                     PA"
     gene            <714514..>715515
                     /locus_tag="MRET_3259"
                     /note="MRES_11130"
                     /db_xref="GeneID:38740025"
     mRNA            <714514..>715515
                     /locus_tag="MRET_3259"
                     /product="ribosomal RNA-processing protein 1"
                     /transcript_id="XM_027629886.1"
                     /db_xref="GeneID:38740025"
     CDS             714514..715515
                     /locus_tag="MRET_3259"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 1"
                     /protein_id="XP_027485478.1"
                     /db_xref="GeneID:38740025"
                     /translation="MGPRSQAQPRGRAEPVEAEMPLGRYLASTEKRVRDRAIRSLAAF
                     VLMRAQEGGLSMSPAELSKLWKGLFYCFWMSDKPLVQQQLAQELSELVLMVAGIDTRS
                     DEAQVASLRHALAALDFYQGFWHTMQAEWLGVDKFRIDKYYLLMRRFLQAGCQLLLVY
                     GCDALLVERYVHIMRGTDGPLSSNNVHVPDSITYHICDAFLAELDAAVAAHAEASPAV
                     PTIELLAPFMDLAATSTSKQVHERVMSRVIDPFLAACQRRLAQSTDEAHASEEHEPLE
                     ALLSHTRLDTGVASCSDVYSAALQRLMRAASAPDTYAPSRRHLYARWHEAAQATDLD"
     gene            <715543..>716394
                     /locus_tag="MRET_3260"
                     /note="MRES_11135"
                     /db_xref="GeneID:38740026"
     mRNA            <715543..>716394
                     /locus_tag="MRET_3260"
                     /product="solute carrier family 25 (mitochondrial
                     S-adenosylmethionine transporter), member 26"
                     /transcript_id="XM_027629887.1"
                     /db_xref="GeneID:38740026"
     CDS             715543..716394
                     /locus_tag="MRET_3260"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     S-adenosylmethionine transporter), member 26"
                     /protein_id="XP_027485605.1"
                     /db_xref="GeneID:38740026"
                     /translation="MDVIEVERPTPGFVTSLASGAAAGLSVDLLFYPIDTIKTRLQSA
                     QGFWRSGGLRGVYRGMGSVAVGSAPGASIFFVTYETCKDRIARLLYPESSAAAMASAP
                     SVHMAAGTLGEMAACLVRVPTDVVKSRQQTSAYGRISSYAALRQVVATEGVRGLYRGY
                     GSTIFREIPFTCIQFPLYEYLKRQLGERTWWHAAGAGSIAGAVAACCTTPLDVIKTRI
                     MLAKVSPTPGASTRIGPTLLHLVRNEGVGALLAGVVPRTLWIGLGGAVFLGTFDAAAG
                     VLAPQLG"
     gene            complement(<716374..>717696)
                     /locus_tag="MRET_3261"
                     /note="MRES_11140"
                     /db_xref="GeneID:38740027"
     mRNA            complement(<716374..>717696)
                     /locus_tag="MRET_3261"
                     /product="aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln)
                     amidotransferase subunit A"
                     /transcript_id="XM_027629888.1"
                     /db_xref="GeneID:38740027"
     CDS             complement(716374..717696)
                     /locus_tag="MRET_3261"
                     /codon_start=1
                     /product="aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln)
                     amidotransferase subunit A"
                     /protein_id="XP_027485606.1"
                     /db_xref="GeneID:38740027"
                     /translation="MTWPRRVPRVVRGFHSGPHDPYNALTQVFERPPLRAGPLHDWSV
                     SIKENIAMQGVRTTCASRMLAEYRAPFDATVVERLRDAGAWISSRNNCDEFAMGALNT
                     HSMYGPVANPAYPLHAPRAPGGSSGGAAAAVAAGLCRLALGTDTGGSVRIPASYCGVY
                     GFKPSYGMLSRWGVVSYADSLDTVGLLARELPDIARAFDVLAAEDPRDATCVPNDVRQ
                     RLSHVATPSLPGLRVGVVQELFPAEVDARTLDAVDGVLASMAAQGAAIVPTSVPPVTS
                     AAAVYYLLSLAEASSNLARYDGIRFGVPVQRTSTFFDDVTRHRSRHLGAEVQRRLLLG
                     TYAVSSEARRSHYTRALRLRQALRAAYDACFRDVDVLVYPTTLGAAPRLDEPVEEYAS
                     DVLAVSANLAGFPAISVPVRRRDPIGVSFAMPWGHDRALLSLLAQLRR"
     gene            <717753..>718415
                     /locus_tag="MRET_3262"
                     /note="MRES_11145"
                     /db_xref="GeneID:38740028"
     mRNA            <717753..>718415
                     /locus_tag="MRET_3262"
                     /product="SDE2 telomere maintenance"
                     /transcript_id="XM_027629889.1"
                     /db_xref="GeneID:38740028"
     CDS             717753..718415
                     /locus_tag="MRET_3262"
                     /codon_start=1
                     /product="SDE2 telomere maintenance"
                     /protein_id="XP_027485423.1"
                     /db_xref="GeneID:38740028"
                     /translation="MSLWVRLCAPWEATVAVRVSSEARGADVRAALTPWLGHADVRLT
                     TRGGQPVYAHAHVVADMDLVVRARFCGGKGGFGNMLRAQGGRMSARGKHESQDSCRDL
                     QGRRVGSVKQAQLLAEYVAQASERQAAWDEAQKRKYAKLERMLGRAPKSMADYETAAE
                     KLDEAGETLEEEAAQPSTSKRERLDDHDYVEQSREIVDHVRGAVASAMRKKRRKGKER
                     AA"
     gene            complement(<718412..>719344)
                     /locus_tag="MRET_3263"
                     /note="MRES_11150"
                     /db_xref="GeneID:38740029"
     mRNA            complement(<718412..>719344)
                     /locus_tag="MRET_3263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629890.1"
                     /db_xref="GeneID:38740029"
     CDS             complement(718412..719344)
                     /locus_tag="MRET_3263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485608.1"
                     /db_xref="GeneID:38740029"
                     /translation="MTPGAQLILPKRARPSLSCAAFEELRAEFGHAPGAQDDAPSAPP
                     RQTCPFCHASIERPSRVLRDMLSFWEQRKKAGHVLRPTDTLAVCEQHRNERDVIPHGA
                     SRGWPMSIDFRQLRRRITSPDARYLRILHDCIEHPDHSVWFRTAKAQRAAQGRKVCDL
                     NTFDERLCGYYGERGWELLHEILYAVYVQDPLLPTLDLTRDDVQRHFAPLNTSQFLDN
                     VLLPELVCLLIQDDLGGVPYDEAMRVQRESQKFGMAMYASDAPPPKRMRLVQQTLPVR
                     RTSRPTTPATYHEASSDEERPVWHQQRLLQPPRR"
     gene            <719437..>720094
                     /locus_tag="MRET_3264"
                     /note="MRES_11155"
                     /db_xref="GeneID:38740030"
     mRNA            join(<719437..719737,719763..719901,719926..719993,
                     720018..>720094)
                     /locus_tag="MRET_3264"
                     /product="tetratricopeptide repeat domain protein"
                     /transcript_id="XM_027629891.1"
                     /db_xref="GeneID:38740030"
     CDS             join(719437..719737,719763..719901,719926..719993,
                     720018..720094)
                     /locus_tag="MRET_3264"
                     /codon_start=1
                     /product="tetratricopeptide repeat domain protein"
                     /protein_id="XP_027485601.1"
                     /db_xref="GeneID:38740030"
                     /translation="MSWLVRAGRYAMPMLAARARAPVVRVARLHVTRVPLAVEQSQGV
                     SLDDPAEGEAQKLLDSGTHALEMGDLERAKGAYRKSVEVHENASAYYNLGICQYQEHD
                     LPGAIESWTHALRLAPDSPDAHTNLASAYIMSKPPQADKALEHLTLAATQSPDDGEIH
                     FNLGTVLEACEQLEPAIKAYRKAKECGIDVRTRD"
     gene            complement(<720172..>720394)
                     /locus_tag="MRET_3265"
                     /db_xref="GeneID:38740031"
     mRNA            complement(join(<720172..720204,720230..>720394))
                     /locus_tag="MRET_3265"
                     /product="TFIIH basal transcription factor complex TTD-A
                     subunit"
                     /transcript_id="XM_027629892.1"
                     /db_xref="GeneID:38740031"
     CDS             complement(join(720172..720204,720230..720394))
                     /locus_tag="MRET_3265"
                     /codon_start=1
                     /product="TFIIH basal transcription factor complex TTD-A
                     subunit"
                     /protein_id="XP_027485602.1"
                     /db_xref="GeneID:38740031"
                     /translation="MRALAGTLLTCDVAVKQMILAIDERMPCIIMDLDDTHMLVNSKM
                     VEQLRTMLEAEFEKNTYTLDI"
     gene            <720416..>721165
                     /locus_tag="MRET_3266"
                     /note="MRES_11160"
                     /db_xref="GeneID:38740032"
     mRNA            <720416..>721165
                     /locus_tag="MRET_3266"
                     /product="thiamine pyrophosphokinase"
                     /transcript_id="XM_027629893.1"
                     /db_xref="GeneID:38740032"
     CDS             720416..721165
                     /locus_tag="MRET_3266"
                     /codon_start=1
                     /product="thiamine pyrophosphokinase"
                     /protein_id="XP_027485603.1"
                     /db_xref="GeneID:38740032"
                     /translation="MWQWHRFVDGQALCPGAYAIVLLNTPITQAPLFQRLWNEAAIRV
                     AADGGANQLRTQSSCAWPTLICGDLDSITDDTQAYFREHDVPIEHIASQCSTDLQKSI
                     QAVEHLEPETLPLVIYGGIGSRLDHSMHTLHVLSQLAFPTHDVYADAHLRLRPHVLLV
                     TGEGMTCLVTPGTHLLRHDRRIHGKSCGLLPLGVAAAHIHTQGLEWNLQGEACSLGGF
                     LSTSNHLVHPDGDVHLTTDAPIYWTIELQSR"
     gene            <721208..>722644
                     /locus_tag="MRET_3267"
                     /note="MRES_11165"
                     /db_xref="GeneID:38740033"
     mRNA            <721208..>722644
                     /locus_tag="MRET_3267"
                     /product="Cys-Gly metallodipeptidase DUG1"
                     /transcript_id="XM_027629894.1"
                     /db_xref="GeneID:38740033"
     CDS             721208..722644
                     /locus_tag="MRET_3267"
                     /codon_start=1
                     /product="Cys-Gly metallodipeptidase DUG1"
                     /protein_id="XP_027485604.1"
                     /db_xref="GeneID:38740033"
                     /translation="MSDPCAQFVEYAEAHQAKWIANLAEAVEIPSVSGDASFRAEVYK
                     MGAWLKNKLAEVGCDVSSHDLGMQTLDGQEVQLPPVIVGEYGRDPSKKTVLVYGHYDV
                     QPALKSDGWGTEPFELVHDTPTDRLIGRGSTDDKGPIMGWINVLEAHKALGLDVPVNL
                     KFCFEGMEESGSVGLDEFVVEHKDKLFQHIDAVCISDNYWLGTKKPCVTHGLRGVAYY
                     KLTISGPAHDLHSGVFGGMMHEPMTDLVQIMSTLVSPQAKILIPGLYDQVAPLTDEER
                     QVYEDMEFEVADVDQCTGSSTTVSDSKTDVLMGRMRYPSLSLHGIEGAFAEPGSKTVI
                     PHKVTGKFSIRLVPDMDPAKVTDAVQKHIEAEFAKLKTKNTMHLEEDHPGKPWVADTK
                     HWNYEAAIAATEAVYGVRPDLTREGGSIPITLTFADALNANVLLLPMGRSDDGAHSTN
                     EKLDLSNYIKGTQLLGTYLYKVASAAAS"
     gene            <722783..>723463
                     /locus_tag="MRET_3268"
                     /db_xref="GeneID:38740034"
     mRNA            <722783..>723463
                     /locus_tag="MRET_3268"
                     /product="proline-rich, actin-associated protein Vrp1"
                     /transcript_id="XM_027629895.1"
                     /db_xref="GeneID:38740034"
     CDS             722783..723463
                     /locus_tag="MRET_3268"
                     /codon_start=1
                     /product="proline-rich, actin-associated protein Vrp1"
                     /protein_id="XP_027485609.1"
                     /db_xref="GeneID:38740034"
                     /translation="MSVVRIVHSSVHTKHKPLRPPMLVLRPCEVEDVSTHSSSEHSVP
                     AAVLGHGGEVERYVYVARTLSPGRRAIQQGDGDVPRELWTRPLPLEPEAPPLRRSCSH
                     GTLAAASHAPSERVRTPSSQDVLDEWRKAFSAYTPPPPVAPAPPTRAPPSAPPSPVAV
                     PPTPPPRAPRLFRPRPSQPPEASVRDPGSWWQRPWSQRLRRHISSIHLGFGGQGRPAS
                     NGSHHAER"
     gene            <723450..>724904
                     /locus_tag="MRET_3269"
                     /note="MRES_11170"
                     /db_xref="GeneID:38740035"
     mRNA            <723450..>724904
                     /locus_tag="MRET_3269"
                     /product="dolichyldiphosphatase"
                     /transcript_id="XM_027629896.1"
                     /db_xref="GeneID:38740035"
     CDS             723450..724904
                     /locus_tag="MRET_3269"
                     /codon_start=1
                     /product="dolichyldiphosphatase"
                     /protein_id="XP_027485610.1"
                     /db_xref="GeneID:38740035"
                     /translation="MRSDDLAHLLTLDLTHVQYSARDPWGAYWALVTLSPVLILAVYV
                     AAFLHRRDLIFVRVLLGHIGCEALNGRLKREIQEPRPTSVLGMGYGMPSSHAQFSGFF
                     CAFWCWHIVAHWPRRDPSLVRGVWLRRAEQGASLLLVLACTALTCYSRVHLMYHTADQ
                     VKVGVALGGAMGLVYYALTEWPVRRSRALRRLRVRALTLWPSRALRLKDEYVAWRSPM
                     EHSYTQWMQAVSEAPASVPPRFDASHPAHLRMMLLALQEADRADAVPTAFSVGCVLAV
                     NGHALCRTPPLGRMEPLRLTTGYSRELPGNTHAEECAMEKLLRYCARTPHAEAEARRR
                     EPLSLIMYTTMEPCSARLSGLMPCAKRILAFNERAPLTSAAWLAGMAQDTYGAVMHTD
                     LDTTVRPLRISVVVQGVGEPDDFVKCEASRLLRSSGVAVHVAVPTASPAELGLTCPPL
                     RAVPLRVSPDAPCAWLQDACLRMARKGHASATTW"
     gene            complement(<724894..>726210)
                     /locus_tag="MRET_3270"
                     /note="MRES_11175"
                     /db_xref="GeneID:38740036"
     mRNA            complement(<724894..>726210)
                     /locus_tag="MRET_3270"
                     /product="membrane associated protein-like protein"
                     /transcript_id="XM_027629897.1"
                     /db_xref="GeneID:38740036"
     CDS             complement(724894..726210)
                     /locus_tag="MRET_3270"
                     /codon_start=1
                     /product="membrane associated protein-like protein"
                     /protein_id="XP_027485420.1"
                     /db_xref="GeneID:38740036"
                     /translation="MPKYRGAGQRLAPRGQGPCPRGLHRHPHVYDARHDDAPRLATMG
                     CRICLDAYTPDERPAALPCGHVFHHACLQDWLTTRTHGAVPSGCPLCKAPAALTDLVP
                     LWASDTDLKQYVAAHPPDGRLSSMHAWVRHLHDYAIATHQLCPPAMSRAAAALPSALP
                     DEARHALQDAMHALHDAVVHTDRLSRDLAQRMHTLDERTRHVLAREERCRRDEQRLAR
                     DREHAEREHAALRHRQKHLAHVKDRLETQQHALDARARQLDEAHEAQTTRLHDSIAAA
                     KSQCAESIRRAALAEEAATARCTDAERQVREAHEHVSDMTRALHETRTKNQRMADQLR
                     ELRAALEASKAKRRAERAASQHLYEQLRHQEQEPPIESASSSPPPVPTPTSTAQLLYD
                     LDDTHFPMPGGTWSRPTKRPAREDAWPAALPRGARTVLGPRRRPTK"
     gene            <726219..>727238
                     /locus_tag="MRET_3271"
                     /note="MRES_11180"
                     /db_xref="GeneID:38740037"
     mRNA            <726219..>727238
                     /locus_tag="MRET_3271"
                     /product="solute carrier family 25 (mitochondrial carrier
                     protein), member 16"
                     /transcript_id="XM_027629898.1"
                     /db_xref="GeneID:38740037"
     CDS             726219..727238
                     /locus_tag="MRET_3271"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial carrier
                     protein), member 16"
                     /protein_id="XP_027485548.1"
                     /db_xref="GeneID:38740037"
                     /translation="MQQQSGAKAQRRAPHRRSWDYVLRSGLAGGIAGCAAKTAIAPLD
                     RVKILFQASNPDYQKYSGRWLGVVDAMRRIVDQQGLMGLFHGHSATILRIFPYAAVKY
                     MAYDVLHLALMPTPQDETGLRLFLAGSMSGVLSVFLTYPLELIRVRLAFDTKSKPQPG
                     SLRHIITKIYHEGAPEGEGGAPQRALLHQFPILKFYRGFTSTILGMVPYAGTSFLVFE
                     RTKAWLYGLLLNRDSRGAPLSDRPPLLELSRTVVDLASGALAGAISQTASYPFEVIRR
                     RQQVGGLLHPSRMQQISETIRWIYATRGLGGFYIGLGIGYFKVVPMTAISFAVWSEMK
                     RVLGI"
     gene            complement(<727248..>729242)
                     /locus_tag="MRET_3272"
                     /note="MRES_11185"
                     /db_xref="GeneID:38740038"
     mRNA            complement(<727248..>729242)
                     /locus_tag="MRET_3272"
                     /product="DNA helicase II/ATP-dependent DNA helicase PcrA"
                     /transcript_id="XM_027629899.1"
                     /db_xref="GeneID:38740038"
     CDS             complement(727248..729242)
                     /locus_tag="MRET_3272"
                     /codon_start=1
                     /product="DNA helicase II/ATP-dependent DNA helicase PcrA"
                     /protein_id="XP_027485547.1"
                     /db_xref="GeneID:38740038"
                     /translation="MLSAAQHEAVTSEAARPLQILAGPGSGKTRVLTSRVAHLVRDSA
                     APIAPERCVVVTFTNRAANEMRARLETMIGADRTRRLVLGTFHAVCVRFLRRWGTRLG
                     LDPRFTIADTDDARRLLRDVDRDAPVDATLAAISRAKAHGWTPDELRASAQHAPGSPA
                     HTEHLALCRTYAAYQQQLRTSHALDFDDLLLLGVRLFREHPELTTHIDHVLVDEFQDT
                     NAVQYELLRRLSRHVSVVGDPDQSIYSWRHADVRHIERMHLDFPGLHRVLLEENYRST
                     PQILEAALRVMQQDPHRLPKGLYTALASGPPVSVVACHDADDEALFVAREIRQHARTT
                     PYAHMSVLLRLTAHSRAFESIFHRLNIPYRLLGGVRFFDRAEVRDLLAYLTLADNPAY
                     TPAVLRVLNVPKRGIGPQSAQQLANAAQHAQVPLLTHLAHAHALRPALLRAVRSFVDV
                     VHELHAQRHAPVADLLHRVLHLTRYEEHLRQTSDADARWDHVQELIHLATASDDLSSF
                     LESSALASDVASDTPCVTISTCHAAKGLEWPIVFLPAIEHGIFPFYRCTTPDEHREER
                     RLLYVAMTRAQRQLYVSWAHRRLVLSEWSDRSPSPFLAPLVDRAPPTPAQPRKSPAPS
                     PPASPAASPPPKRPRPPPLASRPTPGPARRKTLGVRRRRS"
     gene            <729291..>731456
                     /locus_tag="MRET_3273"
                     /note="MRES_11190"
                     /db_xref="GeneID:38740039"
     mRNA            <729291..>731456
                     /locus_tag="MRET_3273"
                     /product="glycerol-3-phosphate
                     O-acyltransferase/dihydroxyacetone phosphate
                     acyltransferase"
                     /transcript_id="XM_027629900.1"
                     /db_xref="GeneID:38740039"
     CDS             729291..731456
                     /locus_tag="MRET_3273"
                     /codon_start=1
                     /product="glycerol-3-phosphate
                     O-acyltransferase/dihydroxyacetone phosphate
                     acyltransferase"
                     /protein_id="XP_027485546.1"
                     /db_xref="GeneID:38740039"
                     /translation="MTTDRTPAEALSYVEADFRRMLSSLPIPLHDVMPRVVVRLASRM
                     LLRARVLGTEVLYDVTLNMLRLIVVLFFREIQPRSSWRIPREGPIIFVGAPHHNQFLD
                     PLLLASEVRHAGRRVSFLIAHKSTKRPFIGRMSRMLNSIPVRRAADDAKRGLGTVSAH
                     AADPTRVLGFGTQFTSQAQVRGNLVLPKSTDYAMGEITEIVSDTELRIKTPFSGAALE
                     ALEAGVTYTLQPYVNQAHMYESVYKQLSDGGCLCIFPEGGSHDRTDLLPLKAGVVIMA
                     LGAMANDPSLNVHIVPVGLSYFHPHKFRSRAVIEFGMPLHAPPELVELFKLGGAEKRQ
                     AIASMLDIVFDGLKSVTVRAPDYETLMVIQASRRLMSLPGQHLSLSDKVEQNRKLVMG
                     YMQFRDHPKILALRQSVLTYNRHLKQVGIRDHQVERANRSVLRSLALLCYRLGLLVGW
                     TSCALPGTILNMPVILLAKIISKRKAKEALAASQVKLYGRDVLATWKVLVSLVVTPVL
                     YVSYAALATALAYRSSLSLAHKRLMPLYVMVGLPVVTYGTIKMSEVGIDVYKSLPPLV
                     ASLLPGRRRVIEQIQRERVNLTAQLHQTIEELKPEGWNYTDIGRGSYTAKPPPLPEEM
                     EHMLYNGRPLDSSGGRSLSHPMNVMDEWLFGWSTSRRHGDWAAHRAEVVDNDLGADYE
                     DALHVYEHQADDAHRAAPRQRTKRPRSHDFRATHPSVAP"
     gene            complement(<731458..>731778)
                     /locus_tag="MRET_3274"
                     /db_xref="GeneID:38740040"
     mRNA            complement(join(<731458..731723,731754..>731778))
                     /locus_tag="MRET_3274"
                     /product="acylphosphatase"
                     /transcript_id="XM_027629901.1"
                     /db_xref="GeneID:38740040"
     CDS             complement(join(731458..731723,731754..731778))
                     /locus_tag="MRET_3274"
                     /codon_start=1
                     /product="acylphosphatase"
                     /protein_id="XP_027485552.1"
                     /db_xref="GeneID:38740040"
                     /translation="MSSYLYFRVTGLVQGVFFRKSTLQQAHDLQLRGWVRNEPDGSVC
                     GEAAGPTEHVQRLRDYLHIGPREARVDNVDVMFIKHHDISTSTLPIPFEIRS"
     gene            <731853..>732599
                     /locus_tag="MRET_3275"
                     /note="MRES_11195"
                     /db_xref="GeneID:38740041"
     mRNA            <731853..>732599
                     /locus_tag="MRET_3275"
                     /product="DASH complex subunit DAM1"
                     /transcript_id="XM_027629902.1"
                     /db_xref="GeneID:38740041"
     CDS             731853..732599
                     /locus_tag="MRET_3275"
                     /codon_start=1
                     /product="DASH complex subunit DAM1"
                     /protein_id="XP_027485551.1"
                     /db_xref="GeneID:38740041"
                     /translation="MSTPRRTMTPIRGASGSLRPRSADTPLTFLQDEALPILAEETTA
                     LQDNLAQIAEIQQALSTFNENFAAFLYGIKMNAFCVEWPEAPTEASLRALSRSAPPPI
                     EADQTYMTDAPTPPRPAPPSPSPPPPPPPTSRPAQRPASQATARRVPPAVQKKRAAFA
                     DRIVDTMPLEYRQGDPKLRALLHHIIYALLQSNDKGVRVADIAAKTPAWPAGKINKAL
                     IALLAANHVVRVSDQGVVYRWNTQRHPVRP"
     gene            complement(<732600..>733451)
                     /locus_tag="MRET_3276"
                     /note="MRES_11200"
                     /db_xref="GeneID:38740042"
     mRNA            complement(<732600..>733451)
                     /locus_tag="MRET_3276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629903.1"
                     /db_xref="GeneID:38740042"
     CDS             complement(732600..733451)
                     /locus_tag="MRET_3276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485550.1"
                     /db_xref="GeneID:38740042"
                     /translation="MPRIARRARRPFCRRRGPGTKNAEQRRTDRAVRRTSTCRPAFIM
                     VLSRVPWWRLSLLRVPRTPKVMRPLSTSASVGFSLMSLFSMKSVTDVLGTSESASVLR
                     EASPAAPTKQPYTLVFVHSSAWGVSRQAWQSWIMYFREAGYDCLDVQVELPAKPADGA
                     SRDDALAEQISSQVRQSALQREPVLFVRDGADETVPSYLGHGGLFSNTRGPMSGLVLL
                     HPRSPEMLKKADWPSGTPVLVIPAKDAEAWEGAVPSRHVKVLGDRWSEKEGLLKEVES
                     WMRYVGL"
     gene            <733450..>734430
                     /locus_tag="MRET_3277"
                     /note="MRES_11205"
                     /db_xref="GeneID:38740043"
     mRNA            <733450..>734430
                     /locus_tag="MRET_3277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629904.1"
                     /db_xref="GeneID:38740043"
     CDS             733450..734430
                     /locus_tag="MRET_3277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485549.1"
                     /db_xref="GeneID:38740043"
                     /translation="MFLKHIVPSIAQALGLMLVIMSFVSPVPFHDSDISLVYIGPNVL
                     DYPAAPNASAVPPKTVVAAEMSKASETNVRYRMGLLGSCFTNAQRDMFCTPSSMHPRH
                     NTTWLATEPGVHWRTSSLPTSWTTYPSLVLFSWFLVLATTPIVFRRLYLWMRPQTPKL
                     RLATLRLLWWALYVQDVGAWLLLACMISLRVRIARVVDTFNTDNDGRVLEGPAISMLM
                     DGAPPLGLRADPGTGFSCMTVAAILFLGMTWLERFRLYREEAAPDAQGDDPEAAVTTS
                     AWRRLWRTPVSEPPKPMDISAPLPARSDASDDTWSVDKAAAPGQGSSVDA"
     gene            <734451..>735242
                     /locus_tag="MRET_3278"
                     /db_xref="GeneID:38740044"
     mRNA            <734451..>735242
                     /locus_tag="MRET_3278"
                     /product="short-chain dehydrogenase"
                     /transcript_id="XM_027629905.1"
                     /db_xref="GeneID:38740044"
     CDS             734451..735242
                     /locus_tag="MRET_3278"
                     /codon_start=1
                     /product="short-chain dehydrogenase"
                     /protein_id="XP_027485554.1"
                     /db_xref="GeneID:38740044"
                     /translation="MDRKVVLVTGASRGIGLWTVRHLLRASRVVALSRSRTPELEALA
                     QAQPDDVAIVQGDVTKGADNQAACDEALRRWGRLDALVLNAGIVDHQLCADVTPERFS
                     HVLNVNVVSVTQTVRVALPALRAAHGAVVIVSSAAATSNIASWAAYNASKAAVNAYAR
                     TLANEERDIACFPIHPGIVDTDMQVQIRANDQMPAAQREWIASLHRDGKLVPPEKPAE
                     VLAALALRGTRTAPVLDDGTAVGADGTFLSWDEAVLTAWRTGERV"
     gene            <735263..>736279
                     /locus_tag="MRET_3279"
                     /db_xref="GeneID:38740045"
     mRNA            <735263..>736279
                     /locus_tag="MRET_3279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629906.1"
                     /db_xref="GeneID:38740045"
     CDS             735263..736279
                     /locus_tag="MRET_3279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485553.1"
                     /db_xref="GeneID:38740045"
                     /translation="MIASLYRTWRQQARALAAVWRCPQLYEAHARLARRHMDAWPASD
                     SRCAVWERRARKRVRQLMQANAGFPPAVRRAIDEAYGRRGPFRHVLLGALRAPRVTPH
                     KAELRYPPELRVPTVSPALRALLVSQHAHRGSAPRAASLACPPKLHVAIETVERIPGR
                     RVGRRRVVRAHRQWLATQLKRLRAPLCVRVEADEASEDVRAWNDYYAQLYTQLETLAR
                     STPPRRELPRYVAAARAAAVQAQPRQVLRRCVSFGERGRRRMWAAVLASAPVLTLRAR
                     DMPAPSARARSAMDAAVEGLGAAARCAVRVAVSPWALYGGKGPRLCRAWATPAEAAYL
                     RHVP"
     gene            <736300..>737439
                     /locus_tag="MRET_3280"
                     /note="MRES_11210"
                     /db_xref="GeneID:38740046"
     mRNA            <736300..>737439
                     /locus_tag="MRET_3280"
                     /product="protoheme IX farnesyltransferase, mitochondrial"
                     /transcript_id="XM_027629907.1"
                     /db_xref="GeneID:38740046"
     CDS             736300..737439
                     /locus_tag="MRET_3280"
                     /codon_start=1
                     /product="protoheme IX farnesyltransferase, mitochondrial"
                     /protein_id="XP_027485622.1"
                     /db_xref="GeneID:38740046"
                     /translation="MHQQRLWLGCVLRGVHTRRAPRMPFFSCNRVDPNALARVVAEAY
                     RPSASDPRSALAGPDEAARVAGRVPAGYVEQRRRTPVQWLRVYRQLSKSRLTFLVVLS
                     GMMGYSLCPAAYAATTALPSVVRLLALAGGITLCSTAANTLNQVVEAPYDAQMARTRA
                     RPLPRRAIAPAHAFGLATCSAAGGVAVLGALTNPLTAALGALNVALYAFVYTPMKRHS
                     IANTWVGAVVGALPPLMGWASCTGTLMQPTDAAGWILAGILFAWQFPHFNALAHAMGN
                     EYARGGYRMMSVTNPALNRRVAARYALALVPLCGVALPLTGTVLPVTYAALSLVPNAA
                     FAYYALRFWRVPSERSARQCFWMSLFHLPAVMLLAMACKADMWTT"
     gene            complement(<737432..>738551)
                     /locus_tag="MRET_3281"
                     /note="MRES_11215"
                     /db_xref="GeneID:38740047"
     mRNA            complement(join(<737432..738090,738114..738429,
                     738453..>738551))
                     /locus_tag="MRET_3281"
                     /product="RNA polymerase II transcription factor B subunit
                     3"
                     /transcript_id="XM_027629908.1"
                     /db_xref="GeneID:38740047"
     CDS             complement(join(737432..738090,738114..738429,
                     738453..738551))
                     /locus_tag="MRET_3281"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     3"
                     /protein_id="XP_027485623.1"
                     /db_xref="GeneID:38740047"
                     /translation="MVAKPRAQVPTTSLGRVGQAQVRDRSGRITEYASSDDQCPICKT
                     DRYLSPRLRLLVSPCYHKMCESCIDRLFSLGPAACPVCGQIVRKQQFSAQIFEDLQVE
                     EEVHIRQRVARLFHRQPEDFPTLRAYNDYLEEFEDITFHLVHKIDVEHTLARLAHYEA
                     LNKAHIAQHQQQREQESAQQDEADAVARHERMRRAQQVREEQEREQLEQDADEKALVA
                     ALEEGRDIDDAMREREARREARVAAAQQRELAAAARQQHDAVPTAPRVLSAEAQAYAH
                     EVGQSDYVGAFATLHDGTQLCDARGAPPSAGGLGGSGYVDPWWRTDAALGAQFRAGGY
                     DWQHEVWQRGLASLCDGVSLRPM"
     gene            <738587..>739348
                     /locus_tag="MRET_3282"
                     /note="MRES_11220"
                     /db_xref="GeneID:38740048"
     mRNA            <738587..>739348
                     /locus_tag="MRET_3282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629909.1"
                     /db_xref="GeneID:38740048"
     CDS             738587..739348
                     /locus_tag="MRET_3282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485621.1"
                     /db_xref="GeneID:38740048"
                     /translation="MGLESLTESAQPRATRPAKKRAAPTYTRPSRQKQTVVFDEDARR
                     EYLTGFSKRKTQRRQAAHAHVQHLIRDEIRQARLAAAEARKRQAAENVRAEQLAYGAA
                     DDRAPQDDDDDDDQEEMERDFESDEHRAHVTVQTLELDEDAPRPAPRAAPAPPPPPPR
                     KTTAPPTVAAPSGSLTGILEPDVAHAAMSDHVFPTVAARTERERPTTYTSKAERMQER
                     QRQRARHHAQAEKRRAQQRAQHTSKKTKTTKPRRS"
     gene            <739503..>739693
                     /locus_tag="MRET_3283"
                     /note="MRES_11225"
                     /db_xref="GeneID:38740049"
     mRNA            join(<739503..739580,739607..>739693)
                     /locus_tag="MRET_3283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629910.1"
                     /db_xref="GeneID:38740049"
     CDS             join(739503..739580,739607..739693)
                     /locus_tag="MRET_3283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485679.1"
                     /db_xref="GeneID:38740049"
                     /translation="MVTDTTLSYLSNALGSSALVLIIAYHILAVSTKRQVDSLSDASV
                     QAQKSPATAH"
     gene            <739901..>741752
                     /locus_tag="MRET_3284"
                     /note="MRES_11230"
                     /db_xref="GeneID:38740050"
     mRNA            join(<739901..739999,740025..>741752)
                     /locus_tag="MRET_3284"
                     /product="coronin-1B/1C/6"
                     /transcript_id="XM_027629911.1"
                     /db_xref="GeneID:38740050"
     CDS             join(739901..739999,740025..741752)
                     /locus_tag="MRET_3284"
                     /codon_start=1
                     /product="coronin-1B/1C/6"
                     /protein_id="XP_027485626.1"
                     /db_xref="GeneID:38740050"
                     /translation="MSGRFVRSSKYRHVYGNPAKKEVSYDNVKVSNNAWDTNLLSASG
                     EYLSLNWNVSGGGAFALIPLAQPGKLPDVYPLCRGHTSAVLDTAFSPFDDRVVVSGGD
                     DAHVSVWNVAPEDIRGCLEAAKVSGSMDDIKPRATFLGGKRRVGHVEFHPTAAHVVAA
                     ATGDHAIKLFDIEKQAPRVELHGFGDAIQSMAFDQTGSTIVATCRDRKLRMFDVRAPD
                     AVQVTDGHGGIKGARAIWCGDKPRIITTGFSKMSERQMFLWDVTQLTKPIKTVSLDSS
                     NGIIMPFWSDNNIVFLAGKGDGNIRYYELESDELHYLAEYKSIEPQSGMAFLPRRALN
                     VDDNEIARAYKVSPPTIHPVSFYVPRKSEAFQADIFPPARSAEPSLTADEFFVDKKTL
                     TPHLYHFETRTIIKGESATPLSTHAKEAPRDAPKESPKESPKESPKEAPQEAKDTSTE
                     AAQASNGAPTDPPTDASHEAPDEAPKDDPKTSAPETSKEDPKESPSDAPHEARNEAPK
                     KVSETTAPEAPAAPTPVPAASAHETQDSLPAAPQAAKGAPTTESSPSGIEAEDIASLR
                     SQVQDLLAQVAERDTHIRELEMENIKLRANQQRVRDVLLTST"
     gene            <741803..>742651
                     /locus_tag="MRET_3285"
                     /note="MRES_11235"
                     /db_xref="GeneID:38740051"
     mRNA            <741803..>742651
                     /locus_tag="MRET_3285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629912.1"
                     /db_xref="GeneID:38740051"
     CDS             741803..742651
                     /locus_tag="MRET_3285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485682.1"
                     /db_xref="GeneID:38740051"
                     /translation="MQVLRGAYRHLLRAALPAVRHSRTAARSVRQLLRADAEQAMHVP
                     AAAWQPYAERTMALFVLTSLSRRPVHGPEARGSSVWRPSSTSRAATLARRTLYHLVSL
                     AYHHVSPHTLMQPRRGGGSSADTMPKAPSVLQDKEADVPDIAPVYPHVLRVPPKPVRG
                     PLHHRPPYWDGQRPEKHMRDASTTTNELQERLTQLGQEWEHLSQSLGAEHKHAQAVRH
                     KYIHLRGTLKTMRRAAEQQREQDTLRQCPVDMLHDVVSAAADSETLWLGTPRWTRWRR
                     GEFLPP"
     gene            complement(<742648..>743670)
                     /locus_tag="MRET_3286"
                     /note="MRES_11240"
                     /db_xref="GeneID:38740052"
     mRNA            complement(<742648..>743670)
                     /locus_tag="MRET_3286"
                     /product="diphthine methyl ester synthase"
                     /transcript_id="XM_027629913.1"
                     /db_xref="GeneID:38740052"
     CDS             complement(742648..743670)
                     /locus_tag="MRET_3286"
                     /codon_start=1
                     /product="diphthine methyl ester synthase"
                     /protein_id="XP_027485624.1"
                     /db_xref="GeneID:38740052"
                     /translation="MVLYLIGLGLADERDITLKGLEAVRSCSKVYLESYTSILHVDDA
                     VARMEALYGRPITLAHRETVELEADDILTAASTGHVAFLVVGDPLSATTHSDLIIRAR
                     TFRTPVPVRIIHNASITTALGSSGLAGYNFGQTVSIPFWTEDWKPDSWLFRIGENSHI
                     GLHTLCLSDIKVREQSIEDMSRGVLRYQPPRYMLIPQLISQLLAAAQTHRVDYLDPDK
                     TLAIALCRMGADDAPHRRGEKIVAGTLAELLQCTEPDAAQQAQYEKDDAQYEEENPMA
                     SEKDMEARREARFVQRALDYWGEPLHSLILVGRRLHPMEVEYGRALALPGSRWADVAQ
                     QVYGAH"
     gene            <743735..>745486
                     /locus_tag="MRET_3287"
                     /note="MRES_11245"
                     /db_xref="GeneID:38740053"
     mRNA            <743735..>745486
                     /locus_tag="MRET_3287"
                     /product="G patch domain protein 1"
                     /transcript_id="XM_027629914.1"
                     /db_xref="GeneID:38740053"
     CDS             743735..745486
                     /locus_tag="MRET_3287"
                     /codon_start=1
                     /product="G patch domain protein 1"
                     /protein_id="XP_027485625.1"
                     /db_xref="GeneID:38740053"
                     /translation="MATTLRHRLERDGVPRGVNLTESFCLYGTPLPSLTKKDRNEYKP
                     PWEQEVYDEKGRRRFHGAFTGGWSAGYFNTVGSKEGWTPSSFRSSRTSRASATASRPE
                     DFMDAEDLAEYGIQTRDAYASTHEEPADPFMRMAVPEASVSRMGQSLLQRMGWKPGQG
                     IGPLVTYDQRQYLDRLLARLHLAPRGTLDDDDEARRHKFPPPDTQPLRPPAPARANAL
                     QAALDRYHAPVIGAAGLDSDEEDHVYGEAPPTVLGDVPPPAAARTSAASHEGRATWSD
                     GRPLPPGFVLAPPVSGPAAAVAWPQVDVPPDWTPDPRRVWTADEPQDAKGPLGAEDRR
                     AMLGEAQHPGPPPALSAYLPGRARLVVHALDRATAQRALAAFRPTGADRAKDERYRAY
                     VCSFLDGPAYVPPNVPRGAQQDEVDEFFQSACRHRPVHGDMAHRFTTGSSLDSTLTEA
                     PAVPDAVQYARRGEFGPHTRHVERFDPPQLLCKRHGVPYPHPEKDGEEIPDELASPSP
                     PSSPVELPEAEGEPIPPRPPKDLFQAVFGDEEEEDDPAPVTTTMPTAPHTKRPQKKRQ
                     RRMGPLTFRMDDDDDDP"
     gene            <745518..>746414
                     /locus_tag="MRET_3288"
                     /note="MRES_11250"
                     /db_xref="GeneID:38740054"
     mRNA            <745518..>746414
                     /locus_tag="MRET_3288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629915.1"
                     /db_xref="GeneID:38740054"
     CDS             745518..746414
                     /locus_tag="MRET_3288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485620.1"
                     /db_xref="GeneID:38740054"
                     /translation="MGDDSRAWLAMQGKAPQGPAGPSREAMESATMRLGPSHARRSHA
                     PQSGDLAYEAFQQANADPAQLERAWQHHQQTTRDVDTRASASFLEALAAAEKEEHATA
                     QPAMPLMAALDDEWRPPSPSQGARMTREQYRMHVELARAQAGLCDDQPFRRAELVEPP
                     PDDAALEEGVYARTPEAALESVWDAQRARATRVAHFRETTAGSVPTSTYTQVRGQAIV
                     DRLRGWLVRAGYTDDVYGLPPLTAQMFGEATMAGDDAETEARRATAIRRLDALCRHLS
                     TSDTKDASQMEAWLEAHSENRR"
     gene            complement(<746415..>747431)
                     /locus_tag="MRET_3289"
                     /note="MRES_11255"
                     /db_xref="GeneID:38740055"
     mRNA            complement(<746415..>747431)
                     /locus_tag="MRET_3289"
                     /product="UPF0160 domain protein MYG1"
                     /transcript_id="XM_027629916.1"
                     /db_xref="GeneID:38740055"
     CDS             complement(746415..747431)
                     /locus_tag="MRET_3289"
                     /codon_start=1
                     /product="UPF0160 domain protein MYG1"
                     /protein_id="XP_027485677.1"
                     /db_xref="GeneID:38740055"
                     /translation="MSDAKRIKLEGRERPVIVTHSGTFHADEALAVHLLTKLPALADA
                     ELVRTRDPAEIAKGTVVVDVGAEYRPSAHRYDHHQRGFFETFDAEHKTKLSSAGLVWK
                     HFGKDILAAHMQCADSDERIPTLYRKMYDDFVEAIDGHDNGIPLYPGISDPPAYRSRT
                     DLSSRISFMNPRWNETWDDADLLARFRRASKLAGTEFFERVDDAVESWLPARQLVVDA
                     LRARTSFEGADPAGRIVLFERAVVWKSHIFELEEELGITEKPLYVVYPDEANKWRVQA
                     VPVNPESFESRRALPEAWRGIRDEQLSELSGIPQCVFVHQSGFIGGNHTREGALRMAT
                     QALA"
     gene            <747580..>748983
                     /locus_tag="MRET_3290"
                     /note="MRES_11260"
                     /db_xref="GeneID:38740056"
     mRNA            <747580..>748983
                     /locus_tag="MRET_3290"
                     /product="zinc finger protein"
                     /transcript_id="XM_027629917.1"
                     /db_xref="GeneID:38740056"
     CDS             747580..748983
                     /locus_tag="MRET_3290"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027485566.1"
                     /db_xref="GeneID:38740056"
                     /translation="MSDDTHFRPIGEQVHDATQEARPVHEIESLCMECHKQGITRLLP
                     TYIPYFREVIVMSFSCPHCGNRNSEVQMAGEIQPKGCIYTVHVTTKQDMNRQIVKSEF
                     CSVTVPELQLQIPARRGQITTIEGILQDTVRDLEMGQPVRKHMQPDVYEKIEALCERI
                     RGLLGEETDASHPVQPFKVVLDDPSGNSFVEYTGSIESSGGADAKWSKRDYPRTKEQN
                     VALGLMGDAAAENGGGFSKDEGETEFENEEIYSFPGTCSSCNAPVSTNMKKVNIPYFK
                     DILIMSTSCDHCGYRDNEVKSGSAISAHGRKLTLHVQDSEDLSRDILKSESAGLSIPE
                     IDLYLAPGTLGGRFTTLEGLLQNVYDELYEKVLMRGDSAAKDDVNKFESFLGKLKRAI
                     SAEACPYTVILDDPLANSYIQNPYAPDPDEQLESETYERSWEQNEVLGLNDMKIENYE
                     EATPASKKPRTDEHPST"
     gene            <749021..>749851
                     /locus_tag="MRET_3291"
                     /note="MRES_11265"
                     /db_xref="GeneID:38740057"
     mRNA            <749021..>749851
                     /locus_tag="MRET_3291"
                     /product="urease accessory protein"
                     /transcript_id="XM_027629918.1"
                     /db_xref="GeneID:38740057"
     CDS             749021..749851
                     /locus_tag="MRET_3291"
                     /codon_start=1
                     /product="urease accessory protein"
                     /protein_id="XP_027485565.1"
                     /db_xref="GeneID:38740057"
                     /translation="MATESYLVQLLSDSNLPTGGFIASGGLESYHAHGLLPPHDTVST
                     TLSFVEHTLGNYAASVLPYMCAAYRLSRSYIEGHDDALDALCRLDWHHHTLLLNHVSR
                     RASLIQGIALLTLYVRSFSSALQDDSARADALVEELRRRIRRGGARLAGGALALPSDE
                     LAGHLAVCTGVFSCCVGLSLERMIHHHVFLQARNLMSCSIRLNTIGPYLAHRLLASDL
                     RPLVERIAASVSCEAGDKLIAENGDDDDEDLDLVCTTWPLGEIIQARHDQLHSRLFNS
                     "
     gene            complement(<749837..>751463)
                     /locus_tag="MRET_3292"
                     /note="MRES_11270"
                     /db_xref="GeneID:38740058"
     mRNA            complement(join(<749837..750044,750076..>751463))
                     /locus_tag="MRET_3292"
                     /product="MFS transporter"
                     /transcript_id="XM_027629919.1"
                     /db_xref="GeneID:38740058"
     CDS             complement(join(749837..750044,750076..751463))
                     /locus_tag="MRET_3292"
                     /codon_start=1
                     /product="MFS transporter"
                     /protein_id="XP_027485461.1"
                     /db_xref="GeneID:38740058"
                     /translation="MSDRRRVVSLLGSVLIALSAGSTYVFSTYAPQLQDALHLSSTQL
                     NVLGLAGNLGMYMSGPIWGRWIDRSGPYGAITSGAFLVLIGYGMLSRAYKYGWTNVPV
                     VVLALFCLLTGLGNSAGNNAAINVQARSWNEQQRASAMALVLSAFGLSAFVYSTLSHA
                     FFTDNVTGYLDLLALGSFTCFLTGMALIKTVPPQPVYLPEHPIAEEETRPVTSQREMR
                     RSTSGTSARVIAWIQDVHESEYHVPEAQQEDAAGNDEVDEAPLNITGLALLRNTDFLL
                     LFTVIGLLSGSGLLLINNVGIMTRALWDYAEKQHKNPLESTQLAAMTGVTVELLKKKG
                     RKMAMQKVQALQVSCLSVGNATGRILIGFTSDVLVHMTRKSSHRTFLLLPIVLLAIVS
                     QGLAAWPNVITTVHRLLFVSGITGLMYGFLFGLGPVLVFEWFGMSSFSQNWGWMSFAP
                     VIVGNVYNIMFGSVYDAHVPKSGTHSHRCKLGEDCYRSVFKVTSVGCMIALVVCTVLI
                     FRRVHGLRARLATLFGRRRLAVE"
     gene            <751553..>753253
                     /locus_tag="MRET_3293"
                     /note="MRES_11275"
                     /db_xref="GeneID:38740059"
     mRNA            <751553..>753253
                     /locus_tag="MRET_3293"
                     /product="vacuole protein"
                     /transcript_id="XM_027629920.1"
                     /db_xref="GeneID:38740059"
     CDS             751553..753253
                     /locus_tag="MRET_3293"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_027485567.1"
                     /db_xref="GeneID:38740059"
                     /translation="MPPASLAVLRCLGIGVRGRVRSEFQPDPWWKRYAYTSIVAVCVL
                     WTCAMYLWRVCYPMIVQKPRALGSRAEGIGLLVGFLVIWCIFLWCFTTVVLSHPGYVH
                     DLTKDVPTPPPQFASSAPIDIERAPPAHSDEPVHSVQNTQLFSPPEERERRWRDLEAG
                     LDMSPIDGGAHSQGKDTSSSVPLSTMPPSTGPSSLGEDEPFSTPAEEVPPPPPLPTHT
                     PFGTSPTAHDAATAELAPPIDPRLPKPYRLPSDMPLYSPAYLYCTHCQRPRPPRAHHC
                     RRCGACVLRMDHHCPWIGGCVGAHNYHFYFSTVLWGLILSLYVVVSMAPLFARGVRSH
                     SSSSSWSDIIHDWAVDGFMISLFVIGFFFFLFTCSLVFVHVQMSGHNLTSIEQRAINA
                     FRSREGYTLHRYFSASGQGGTLGTGPMAAWRRFRARRQMLHEWNYEWGDPHRDGNPWW
                     IANMDELEYATASLSANEREAFLEKMLGMSSTQNSNTSYGACTSMQPKLIPSAWTWLT
                     RPPFLLNMQLSLGPPHGWVLPIVCRASTGVHFPLNPRYTRDGLWRPRPYWPTLSQTRT
                     "
     gene            <753296..>753619
                     /locus_tag="MRET_3294"
                     /db_xref="GeneID:38740060"
     mRNA            <753296..>753619
                     /locus_tag="MRET_3294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629921.1"
                     /db_xref="GeneID:38740060"
     CDS             753296..753619
                     /locus_tag="MRET_3294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485462.1"
                     /db_xref="GeneID:38740060"
                     /translation="MSRSTSHRFGHEQELQRSFREPVSIWKKEWVVPSAIERPVAPGQ
                     SMTERLGPDAEAMRSSSPFRILKWVRTEQVAQFETEESTPHPEHTSNAENLKAAEEAV
                     PEVSS"
     gene            complement(<753616..>754639)
                     /locus_tag="MRET_3295"
                     /note="MRES_11280"
                     /db_xref="GeneID:38740061"
     mRNA            complement(join(<753616..754502,754527..754553,
                     754579..>754639))
                     /locus_tag="MRET_3295"
                     /product="mitotic spindle assembly checkpoint protein
                     MAD2B"
                     /transcript_id="XM_027629922.1"
                     /db_xref="GeneID:38740061"
     CDS             complement(join(753616..754502,754527..754553,
                     754579..754639))
                     /locus_tag="MRET_3295"
                     /codon_start=1
                     /product="mitotic spindle assembly checkpoint protein
                     MAD2B"
                     /protein_id="XP_027485569.1"
                     /db_xref="GeneID:38740061"
                     /translation="MMNASRVDRDRVRDGPMTYHETVDMITELLECAFHTILCVRRVY
                     PTNAFVRRRMYDTPVYESRHPGLSEYIYSVVQAIGRELEESTVRQVILAIYNEDAPDE
                     ALEEFVFVLTFLLSDADKRDRDLVIRGNISRATAELVARQFLLQILTCESRLEPMASD
                     RPRTFRILLDVAEGCAPSGGIDEPTFGAWVPASGIPFKANAQDDGIATVSTTAHNSVE
                     SMPLIHPLHILESGIIHMALHVEESRERKEYTKAYVPSAFTSSQHSSTPAASLPRDLD
                     DPAMDEYDPSQVPVRKRKLYAQVQGGNGPMSDESSESFSSDGGHSDTN"
     gene            complement(<754683..>755126)
                     /locus_tag="MRET_3296"
                     /db_xref="GeneID:38740062"
     mRNA            complement(join(<754683..755022,755047..>755126))
                     /locus_tag="MRET_3296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629923.1"
                     /db_xref="GeneID:38740062"
     CDS             complement(join(754683..755022,755047..755126))
                     /locus_tag="MRET_3296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485571.1"
                     /db_xref="GeneID:38740062"
                     /translation="MDHAAAMPVSDLVFPGDLNKKIRTVGFCVAYNHNNAHVVLEHEH
                     AYLLADISLLVDEGLLSLPTYSKLVCIGTLDRAHEDEIRSVDLTLDQARRNYASSPMI
                     LRVIFAKVDDDLDLRLWASSARKIQEAFPVKTGLRNG"
     gene            <755582..>756482
                     /locus_tag="MRET_3297"
                     /db_xref="GeneID:38740063"
     mRNA            join(<755582..756109,756147..>756482)
                     /locus_tag="MRET_3297"
                     /product="ubiquitin thioesterase protein OTUB1"
                     /transcript_id="XM_027629924.1"
                     /db_xref="GeneID:38740063"
     CDS             join(755582..756109,756147..756482)
                     /locus_tag="MRET_3297"
                     /codon_start=1
                     /product="ubiquitin thioesterase protein OTUB1"
                     /protein_id="XP_027485570.1"
                     /db_xref="GeneID:38740063"
                     /translation="MCDYRSLNDAQIHALNQDMMDESVSSSSSLVHDVEPVEVLAQEY
                     KHNPMFLGCIEWLSKMSTYKSLQRLKGDGNCFYRAFSYAFVNAIICTDDRSRREAICH
                     HVESTLELLKRTGVDEEIARDFFDPFQKLVKEATKLGPAYLQSRSKLLMRDFNDPETS
                     NSIVVYMRLIASAYLKLHQDDYFPFVVSENASVSSMEEFCLQEVEAFGKDADHVQIMA
                     LCSVLRANVKIIYLQGSTRSFNSTRNTDALNLAEAIEPQPCNITPFEIDGALIELSPL
                     LYRPGHFDLLW"
     gene            <756607..>757602
                     /locus_tag="MRET_3298"
                     /note="MRES_11285"
                     /db_xref="GeneID:38740064"
     mRNA            <756607..>757602
                     /locus_tag="MRET_3298"
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC1"
                     /transcript_id="XM_027629925.1"
                     /db_xref="GeneID:38740064"
     CDS             756607..757602
                     /locus_tag="MRET_3298"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC1"
                     /protein_id="XP_027485786.1"
                     /db_xref="GeneID:38740064"
                     /translation="MDRHNVVEILPERVGNVSSTSYPRHHPGVSGAWDYDEFKQHLRV
                     DVTRWTTELCEFDLVGVDASIANSIRRVLIAEVPTVAIEHVYIWNNTSIIQDEVLSHR
                     LGLIPLAIDPRKLSFKMDDEANDQNTVVFNLKAECKKRGASKDAGIEGRYVYSSQLEW
                     DPKGDQAETMADCPPRPVHSDIVIAKMALGQSMEMELHCEKGIGKDHAKFSPVATATY
                     RLLPLIEILKPIPEPLIPKFISCFPEGVMEQGGENGVRVVDTRKDTVSREVLRHPEFE
                     GFVRLGRIQDHFLFSVESTGIYEPEQLLPASIEVLRRKIALLKLALDAVPTGTQP"
     gene            complement(<757603..>759255)
                     /locus_tag="MRET_3299"
                     /note="MRES_11290"
                     /db_xref="GeneID:38740065"
     mRNA            complement(<757603..>759255)
                     /locus_tag="MRET_3299"
                     /product="minichromosome maintenance protein 10"
                     /transcript_id="XM_027629926.1"
                     /db_xref="GeneID:38740065"
     CDS             complement(757603..759255)
                     /locus_tag="MRET_3299"
                     /codon_start=1
                     /product="minichromosome maintenance protein 10"
                     /protein_id="XP_027485564.1"
                     /db_xref="GeneID:38740065"
                     /translation="MKTNHETSACVGRDVMSAAAKQGVKELREASWMHAQRRASALQR
                     AQSSSLGACAENVQGRDYAQRVRRESNDLLRSSRSSGFDQCAQTGRNERLELTEDMER
                     GPYTFEAPLDDATFERFEPHARTKLRKRYIPHASVNAHMNCRYAISPSTLYSLTGRSG
                     SSSEYVRDVSQPAMDGDFEVPLYGDWVLFAVMSEKSALKYTNKTPSDAAATKYFSCKL
                     LDLNTQYTNIYHELPGHCVMNMLAFESTRGTSAFDKLWKERDGVLLAILNPRIMRARK
                     GSNELTISPRSADSVLVLGLAEQYGRCEAHCRDGSRCTAFVLRHPKSQGVCAMHLEKA
                     IAGHQRSRMEFATAAASYIVPPPSKLHPTYSHRASKRVRSPMDGLHYVVPGLTPSNHD
                     PSSHMYDVSSQLGRGLEQKRQRKRRELEEAGQLSKLHAHGPEPRNRRMLDAQLLADMD
                     QNSSAAQALRTAQATLRGEDPKKQQVSHASTTSIPESASASRLLARHTASAASLPPAK
                     LHGTPFRSNVLERDNPAARHIELLKRKEPSTTDDDDLVIIAG"
     gene            <759446..>761039
                     /locus_tag="MRET_3300"
                     /note="MRES_11295"
                     /db_xref="GeneID:38740066"
     mRNA            join(<759446..760496,760531..>761039)
                     /locus_tag="MRET_3300"
                     /product="protein phosphatase type 1 complex subunit Hex2
                     Reg1"
                     /transcript_id="XM_027629927.1"
                     /db_xref="GeneID:38740066"
     CDS             join(759446..760496,760531..761039)
                     /locus_tag="MRET_3300"
                     /codon_start=1
                     /product="protein phosphatase type 1 complex subunit Hex2
                     Reg1"
                     /protein_id="XP_027485386.1"
                     /db_xref="GeneID:38740066"
                     /translation="MLSAPAPYPTVSTENPAPDDTQIESITPKVCVDYLSHDWKDEDV
                     WNSWKAMTKRKNEIANGVRLENASWRTWAKHRGKLKTVSPQTLNWLKESDVTWLYGPL
                     HGEAQATPPPKVASTAERLGIDVSSSERKPILKHRTLTDILQTPLNASHPKASNQASA
                     QTKFQPSLPGASTKGQHPRKKALKMGSLGHDHTLPSTRRKRHISFNTLVSQCIALDDE
                     SIGVSYPESESSDSEDEYEDQTQQHRYSGQNMPLTKRSDRHITIAMMPPTYLKMGHEC
                     MTSTDSEVSDEDDDMYGRHTSELDARYSVIDPIPGSHELDIDQDDGYEYYDYDVDDNE
                     DDNPTFLALLGSSGQQDTAQISTAPSTTRARGDPHDPPHPSSSMIPSIDSSDPAKPLT
                     MKLDDQLPHLTLNDTNGPIPHTDNEDAIRPPPIFVGPTPLNSPISPSTFHGSGHGAIQ
                     RNSQGHRNTGAVVAPSSYFPPVPLSEDYVEEHEGGLIASAVEIINTARDLFGVIIGSP
                     GRMGRSWYESH"
     gene            complement(<762055..>764184)
                     /locus_tag="MRET_3301"
                     /note="MRES_11300"
                     /db_xref="GeneID:38740067"
     mRNA            complement(<762055..>764184)
                     /locus_tag="MRET_3301"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629928.1"
                     /db_xref="GeneID:38740067"
     CDS             complement(762055..764184)
                     /locus_tag="MRET_3301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485385.1"
                     /db_xref="GeneID:38740067"
                     /translation="MRRASSATDAMQTCEREWHLLQSYISYHDIRAQHGLDDIAASMR
                     RLCETIIHDEAQAPSHALGTCSAYLVENNILNDLVSLCLPDEPLGILNEFLRMCTTLV
                     LHIHVPWFLANEGVAHALLQLLRSCNKKQQKPPDLVELVYALCARIHQQPDTLRVLVQ
                     LGAQLPKERPADRFPLMTCIVRHITMNGPPGRHMRTSLVWVMHALLTLGTNHGAAWPA
                     LYFDQATCFDLAKSLNEVVAHAFNHLPQHLDASGPRSQETWVYDRFDKNVQWYASTVD
                     IPCLGTFIDLLWLIQNLWRLGHAAKDGLIGDQVDQLLTEMTDQFKLRFVEACLEPAIH
                     ASLEEAPNEVSLYAMLCYLDVLLSIMEPCTPLSRCISLYSRSMFDLVTKGLQSPPPTV
                     FCALQMSKTLSRWILWHDTTLGTSMRTHHTSMAFPLIAMAETCQTPRFRAAFSHRFLQ
                     HLLTVEQAMRDDPVYHDIPSLFHQQHLVYKPIDIIQQSALPSEHSLRPLTYKLRHFFS
                     SSFEENLAVIETLGTLCRSPLLRLKGLIEGGHEEMDEDTLPIITFLLYTLYLQSRSLR
                     KQIPEFDLYLEHRKIECLGHPLQEPLYDEDHSACPLFHTKSPEQGIMILQNMFESGQW
                     IPNTNLRTENPSYILDGVSMEKAWSTMVPVCPCDAPTRGPWSDDTIYEPIDVSLLHVL
                     DNSIVLEEACLEMACILLLRDAWGIPS"
     gene            complement(<764212..>765891)
                     /locus_tag="MRET_3302"
                     /note="MRES_11305"
                     /db_xref="GeneID:38740068"
     mRNA            complement(<764212..>765891)
                     /locus_tag="MRET_3302"
                     /product="ATP-dependent RNA helicase DDX56/DBP9"
                     /transcript_id="XM_027629929.1"
                     /db_xref="GeneID:38740068"
     CDS             complement(764212..765891)
                     /locus_tag="MRET_3302"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX56/DBP9"
                     /protein_id="XP_027485298.1"
                     /db_xref="GeneID:38740068"
                     /translation="MPSDSGSGGFQAYAHLLDARILRALADNKFGTPTPVQRESLQYS
                     LGGAARDILARARTGSGKTLAYGLPILQKIVATKQGIPRSSTEYSATRALVLVPSREL
                     AEQATRQLNDVLTYCKDMVRVANLARPVKSSVQKLLLSERPDVVVATPSRALASMQAG
                     DLVVRDSLQSLVIDETDLVLSYGYGTDVKTILQEGFLSRTHQTFLMSATLDDDTEALR
                     ELMLKDPVVLRLENDTSLAENLSQYYVETSEDEKFLLVYVMLKLRLIRGKCLLFVNDI
                     DRCYRLKLFLEQFGLRTCVLNEELPVNSRFHIVEEFNKGKYDYIIATDANAAPESKKT
                     TSSQRGKEFNVSRGIDFVAVACVINFDLPTSTRAYTHRIGRTARAGNTGTALSFVVPR
                     REFGKKKALCCPSCKHDEQMWEQIVEDQKSSGMQIHPWTYDRTQVEAFRYRMEDALRS
                     VTKAAIKEARIQEIKQEILNSEALKAHFEENPRDLEYLRHDRALHPARVQAHMKHIPS
                     YLRPRIASLPGTAQSHVGYVPKNRPKVPQRGKKNTPRGKSKKKSDPLKSFT"
     gene            complement(<766029..>767945)
                     /locus_tag="MRET_3303"
                     /note="MRES_11310"
                     /db_xref="GeneID:38740069"
     mRNA            complement(<766029..>767945)
                     /locus_tag="MRET_3303"
                     /product="transmembrane component"
                     /transcript_id="XM_027629930.1"
                     /db_xref="GeneID:38740069"
     CDS             complement(766029..767945)
                     /locus_tag="MRET_3303"
                     /codon_start=1
                     /product="transmembrane component"
                     /protein_id="XP_027485383.1"
                     /db_xref="GeneID:38740069"
                     /translation="MADLSPDTFHELHSHSDDPRWFQPSEEEKNLPDTLDPWSEQVRH
                     AKYMSYLFCALVIVGALIHGLRLARQVYPRVGLFVNKIPGVTFLAAVCRGVGYYKFRW
                     GKWQSPPGQYLVISAAFIIGVVVWAFALTPHYFPHNEDGSPPLAIRTGMMAIGMIPFI
                     FAMALKFNPISLLTGIPHSHMLFYHQVAAIVLLFLSIVHTVPFVWQALREEGYERLKY
                     IWSDSYSIYWSGTVAIFFLLWIVISSLGIFRWLSYEFFVVQHVISFTIMMACLFVHVQ
                     DLLNAHVWLWATVGIWIFSILSRSLMVLFSTEFFTSGRSEVEVSASVGHSHAVVQEEP
                     AKFIRMSFVTPLRWRPGQHVFVRFPGMAATQAHPFTCLSLPSYSPHLPNKLVLLARVR
                     KGITRHIHNYIMKHGVDETKYKDDEMSRVVSESSSNDVKKPISDRTLYGTEKDVSDIR
                     SMSLITALDGPYGYTYSLDIYQHSVLFAAGSGITFCLPQVTDLVRRAALGKTRCLTKS
                     VRLLWCIRTYDIIHWVRSELLELALLAEKVPFDVVVELYVTRELNEHVDPDFGKLMRV
                     YFGQRPDIKTVIGTEAQHAIKCESQSLSVSLCGPSSFSSEVARAASALNWSIAFGRSG
                     SLRDVHLISESYKM"
     gene            <768515..>769690
                     /locus_tag="MRET_3304"
                     /note="MRES_11315"
                     /db_xref="GeneID:38740070"
     mRNA            <768515..>769690
                     /locus_tag="MRET_3304"
                     /product="exopolyphosphatase"
                     /transcript_id="XM_027629931.1"
                     /db_xref="GeneID:38740070"
     CDS             768515..769690
                     /locus_tag="MRET_3304"
                     /codon_start=1
                     /product="exopolyphosphatase"
                     /protein_id="XP_027485390.1"
                     /db_xref="GeneID:38740070"
                     /translation="MARLGWMTPPSTCLFNTSTPRRWPRHVSPLSMTWDRFWATRQAS
                     NASSATHFVVGNEAADLDSVACAIAYAYFDMRHEWIPVIQARRCDLRLRRENVAYLEQ
                     CGIDMDKVCCLDDVPDMHRGMHVVLVDHNRATKAFESATIDAIWDHHVDEHAHPEARV
                     RVVCEPHDAGSCASVLVTHFRPSHMPGPVARLLYGAMLLDTLCWDEKAGKFHAIDRAA
                     QQHLAPFVACDDDAALYRELLRLRNDTSHLTVSDHLRRDYKHMTCPAPNGAWSIGMAS
                     VTQPLREMVSAPTFLDEVRTYARQQAVHVLMILAGYERDGTWHRELFFFAWHPSAKAL
                     ADALASLRTHYVDLTALPLALPEHDGYAVAWTQHDLRATRKQFVPAMKLACEHVACP"
     gene            complement(<769687..>771648)
                     /locus_tag="MRET_3305"
                     /note="MRES_11320"
                     /db_xref="GeneID:38740071"
     mRNA            complement(<769687..>771648)
                     /locus_tag="MRET_3305"
                     /product="peroxin-5"
                     /transcript_id="XM_027629932.1"
                     /db_xref="GeneID:38740071"
     CDS             complement(769687..771648)
                     /locus_tag="MRET_3305"
                     /codon_start=1
                     /product="peroxin-5"
                     /protein_id="XP_027485389.1"
                     /db_xref="GeneID:38740071"
                     /translation="MAFQSMLSGAECSASQNHLSQFLKHTQTDRSLQQDAVQTQPGMM
                     QRPGFRTRPGGVGGGAQDMDAFLRQPPATGALPFDMHAMRSEMEAMQMRAPPSSAWAQ
                     EMQQRPPAPAPGRPSAWTEQFHAQRPPPTAEEAAPMRLGMHAAGPGRFGGGVYAGLAS
                     YAPPAARTTLEPAAPRLAEWDDATWDEQFRRMEAEAASAPAATDKGKQRETQNDEDAE
                     LHELREMQARLRDEVHDSNPRFEELWNTLKDPSLLDKSDELAKWERELMEAVANEDPL
                     ASTHPGGGLGPGELGLSEEDGLGEAEARLRREWLGDVDEAGFPRLGTYEYEAHNPFAG
                     HATPYAEGMRLLENNGSLTEAARLFEVATQRDVESQQVSDEIDLSRAERSRAWQRLGE
                     CHAMNEHEEKAIQALEEAVRIDSSNLEALMSLAVSYINEGYDQAANVTLLRYLARSHP
                     HLAPSPEFPALPNEHTDPWARVNYVRDLFLQAARRDAARGTMSPDIQVGLGLLYYSTY
                     SYEQAKDCFQAALASRPNDCQLWNRLGATLANGGNSELATDAYHRALELRPSFTRAIY
                     NLSVSCMNLGAHHEAVEHLLSALALQRSQSMPDAPDSASMPLSHAKESEGLWNTLRST
                     LLVMNRADLVPSCRVGSDLDVFRQAGFDF"
     gene            complement(<771720..>773312)
                     /locus_tag="MRET_3306"
                     /note="MRES_11325"
                     /db_xref="GeneID:38740072"
     mRNA            complement(<771720..>773312)
                     /locus_tag="MRET_3306"
                     /product="peptidyl-prolyl cis-trans isomerase-like 2"
                     /transcript_id="XM_027629933.1"
                     /db_xref="GeneID:38740072"
     CDS             complement(771720..773312)
                     /locus_tag="MRET_3306"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase-like 2"
                     /protein_id="XP_027485388.1"
                     /db_xref="GeneID:38740072"
                     /translation="MGHGANDKLFITPSEYSGVYGQHGATKGAQREKPVIVPFHMCAI
                     TYQPWTQPACLVRDGLVCDKEALVAFVQHYGKSPASGEPATLDEMLDLHISRNERGQW
                     YDAVSMREFTDHSHMVAIRPSGHVYLFETVQQLNVKPKMMRDLATDVPFTKSDIITLQ
                     DPHDLGRRTMQQMYHVQHHLTLAPKPTSEDVNAAATGSTQSLLAQLRQHRQPKEQARD
                     TPREAQAARTTGTSTGRSAASFTSSSLTPRTRTEEIAVDEEAAMFEALSSRQTKNAVV
                     RLQTNFGALVLELFVHKAPRTCYNFVALCQRGTYHHTTFHRNVPGFMIQGGDPTGTGR
                     GGESIWGQPFEDELCLPGAHRHTSRGMVSMANKGVNTNGSQFFITYRATPHLDAKHTV
                     FGTLLGEDSFRVLDALERVPNVPDTTQPIRPIELIEAQVFEDPFATYIERRDAKARRE
                     HPNDEERARRELKRRKREDDRTTWLGTRLPTKDASSTDAPPSMTAPADEHGLASLSTR
                     QRRPSPPPRRARRSGFGDFQGW"
     gene            <773355..>774011
                     /locus_tag="MRET_3307"
                     /db_xref="GeneID:38740073"
     mRNA            join(<773355..773485,773513..773639,773664..>774011)
                     /locus_tag="MRET_3307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629934.1"
                     /db_xref="GeneID:38740073"
     CDS             join(773355..773485,773513..773639,773664..774011)
                     /locus_tag="MRET_3307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485387.1"
                     /db_xref="GeneID:38740073"
                     /translation="MRGCQGLGAAALLAAGALANTEMVRVDPSLCAPETNELVRQGPW
                     PVMQARSEPRRFELRRDEQGMWVALHMPAPGSYQLRLSAPAPVAASYSLEIHAPDEVL
                     THTARGTAPCAFALARVEAQAQGVPIPPATDAHADERGTHVAGEERASIPIDLVFERL
                     YLGFLPATALHMIVVMVLVVVPTVSLVLRPMQRVCGGVPRS"
     gene            <774033..>776483
                     /locus_tag="MRET_3308"
                     /note="MRES_11330"
                     /db_xref="GeneID:38740074"
     mRNA            <774033..>776483
                     /locus_tag="MRET_3308"
                     /product="beta receptor associated protein 1"
                     /transcript_id="XM_027629935.1"
                     /db_xref="GeneID:38740074"
     CDS             774033..776483
                     /locus_tag="MRET_3308"
                     /codon_start=1
                     /product="beta receptor associated protein 1"
                     /protein_id="XP_027485381.1"
                     /db_xref="GeneID:38740074"
                     /translation="MSTVLEALTPCVLPPTVSESCAARTASTDGERVYVGTTDGFVYG
                     WRATQPWTLRVRVSSAGRAVEKIVVLRDCGAIAVLCDHAVQFYTYPDMSSVHRAYSAI
                     RGVVQVAVDERDPSRASLCVIKRQNLWVVGLDDAGWFVRQDMPIPRDAFIAHRYGDVV
                     CLATRTAYALVHLPTGVCTPVGLPISQSTQEGSARTRPAIVPVPGDMPCFLITSHSEH
                     GTLGVFLRADGEPTARLVEWPSHPRAVVASPLHLVALLRNDTIHLHDLVSLRRVAILR
                     ADVDDRYLVRVAPPSPALLPRRPVPSAQVLPSRVYPAELPRGWLGWSPVSVLVGGRRG
                     LRALASPMSSSAALLDTGRADDEAAMQYLGVSHLREGRFACAAAYLRRFPPALLLTLW
                     PALYGGHRTYLCEAAAGVWARLPATIDEVISQHLAWNYVPAVDEHDASLVYLHAQLRR
                     RADDMLAWVLASQDAGSTARVQIALARDPHAPLTALPALASCDVPTIRGVAESLGRHD
                     LVLALYRAHQRYADAAQYACLHDDVPGVLEQVASLAPADLWVCWLWLVRRDVVPSVSL
                     PWDDLPHRDEAWQALCAIETPAALATMERVVLTASSHVDVSMQLDVLARVRDDVHKAC
                     LWLEYGPPALLAQTTRHPLEDAIVHAKHDRFVDALACLVRARAFEAADDLCMHGSPWP
                     VPRARSIARGPYTHLVPTKAARTWTRAQQAQLLYVLLDMYVDAHLDAPAQALLARHAA
                     SYDLVRVLAHVPPTWPVRAVAPYLVEVLRASSHARYRAGVTKSIAHKVRLDAADTLWR
                     HVRAQGGHVAPPPPPSFS"
     gene            <776499..>778274
                     /locus_tag="MRET_3309"
                     /note="MRES_11335"
                     /db_xref="GeneID:38740075"
     mRNA            <776499..>778274
                     /locus_tag="MRET_3309"
                     /product="tRNA nucleotidyltransferase"
                     /transcript_id="XM_027629936.1"
                     /db_xref="GeneID:38740075"
     CDS             776499..778274
                     /locus_tag="MRET_3309"
                     /codon_start=1
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="XP_027485380.1"
                     /db_xref="GeneID:38740075"
                     /translation="MWPTLRRLRMPPSVTLTREEGFLCTLLDDACRWMQTTNPSVDVD
                     GASRTYADLSHRPTATTPCEARIAGGWVRDKLLGLPSHDLDVSLSSMTGHHFALFLKA
                     YLESEVFPRTPLAREMQEAAPSHARISHIGKIAANPEQSKNLETATARVLGFDLDFVN
                     LRKEVYEGTHRIPIMSFGTPLEDAMRRDMTVNALFYNVHTAAIEDWTQHGLADLRDGI
                     VRTPMDPTATFTDDPLRILRCVRFGSRFGYAIHPDILAALAAPASPLHAALASKVSRE
                     RVGIEVDKMLSGRDPRYALQLLAQLQLYWVVFMPPPALSQRMGRSSDHGAHIDELVHD
                     APDERAALSLSDCFDSLLRGTSPLWSRLPTDWLARVRSPEWRAQRRLVWYAIALYPLR
                     DLYIQAKKQPAWAGAVTLSAGLKLGHRTTKDPVTSLVRAASLLTRPRLARFVPAPCLT
                     RRSTIGLLLRHHDVSQPKMDVALDNALLVALLYDLATHGLDTPEAAAIVDEHAAFWAY
                     VRDEHLAAYIHAKPLVDGRQVATALGCDVCLLSRILPYVTAWDMDHVDDEPDRPGRCL
                     AALQRAWADGHMVPVSERTTRAKSS"
     gene            complement(<778271..>779476)
                     /locus_tag="MRET_3310"
                     /note="MRES_11340"
                     /db_xref="GeneID:38740076"
     mRNA            complement(<778271..>779476)
                     /locus_tag="MRET_3310"
                     /product="mitogen-activated protein kinase 1/3"
                     /transcript_id="XM_027629937.1"
                     /db_xref="GeneID:38740076"
     CDS             complement(778271..779476)
                     /locus_tag="MRET_3310"
                     /codon_start=1
                     /product="mitogen-activated protein kinase 1/3"
                     /protein_id="XP_027485537.1"
                     /db_xref="GeneID:38740076"
                     /translation="MAAVQAVEDASRIPSHRMPGVRVQHLRELAQQTETRKEDRRAAV
                     IRKAREDVGRHYQVASIIGEGGYGVVFSAVHRRTGARVAIKRVAPFEHHLLAVRTLRE
                     LRLLRYFHEHSGCENIIKLLDVVVPGDRFSYQDMYFVQEMMDTDLYRVVRTQALSHDH
                     AQYFTYQILRGLKPIHAAGVLHRDIKPSNLLVNANCDLKICDFGLARSMARHTRRDLQ
                     LTEYVATRWYRAPEIMLSSRSYTKAVDIWSVGCTLFEMLTGEPLFPGKDYHHQMMLIL
                     EVLGSASIESISAQCAVRALDYVRSLPWCAGKSWASLLPHVPADALDFLARTVVMDPA
                     QRMTVEACLAHPFVAPYHDPSDEPGAPLLDAPLAAHFDAPPPSVQADVYRQALWDDGQ
                     YYQARTSRA"
     gene            complement(<779659..>780906)
                     /locus_tag="MRET_3311"
                     /note="MRES_11345"
                     /db_xref="GeneID:38740077"
     mRNA            complement(join(<779659..779811,779836..>780906))
                     /locus_tag="MRET_3311"
                     /product="solute carrier family 35 (UDP-galactose
                     transporter), member B1"
                     /transcript_id="XM_027629938.1"
                     /db_xref="GeneID:38740077"
     CDS             complement(join(779659..779811,779836..780906))
                     /locus_tag="MRET_3311"
                     /codon_start=1
                     /product="solute carrier family 35 (UDP-galactose
                     transporter), member B1"
                     /protein_id="XP_027485438.1"
                     /db_xref="GeneID:38740077"
                     /translation="MAAARNGVLQLALCALAIYTAFLVWGLLQEKITSTVYHTGDPLD
                     AFRVGERFEYGVLLNGVQALCSCVMAMAYLMYRRRGSTERGLLTRLGLDVLTPSGCDR
                     ALVARGKKQVPVRGVRRYVSPLLLQYLLVSALQSTASWLSIVALRHLSFPAITLAKSS
                     KLVPVLVMNVLLYRRHFAAYKYVVVALVTLGVWMFMALGSKTSPGGVRGNSVLGMVLL
                     AIHLLLDGTTNSTQDEVFATYGSYVSGTQMMLVMNAVSATYMLTALLVPAGAVSYLVA
                     HARLYVGSLLHPHWAAQLLMAGLQVPTLSLTPQLVSGVQFLVRHPDAARDVLAYAMAG
                     AAGQIAIFETLERFGSLTLVSITVTRKLFTMLLSIAVYQHQLRSLQWIGVAIVFVGLF
                     IEMRAKQRQAKAKQS"
     gene            complement(<780989..>782347)
                     /locus_tag="MRET_3312"
                     /note="MRES_11350"
                     /db_xref="GeneID:38740078"
     mRNA            complement(<780989..>782347)
                     /locus_tag="MRET_3312"
                     /product="small subunit ribosomal protein S29"
                     /transcript_id="XM_027629939.1"
                     /db_xref="GeneID:38740078"
     CDS             complement(780989..782347)
                     /locus_tag="MRET_3312"
                     /codon_start=1
                     /product="small subunit ribosomal protein S29"
                     /protein_id="XP_027485439.1"
                     /db_xref="GeneID:38740078"
                     /translation="MLRRVERVGWAPLRTFATTAAVRAAPKPAAPKKKVSVRRGQLTG
                     ERRTGGLRRGGVDTSSQLSKATTHYAQQPDMSDLPVLKGASALREGVPGDALAWSKRT
                     LAAFDAFGLPRELSRAQALQPKPRTIVREATKDVLQCGQGKHLLIGEPGCGKSTYLLQ
                     AVAQAVESESAVLYVPRSIALINSSSPYTYSPAFATYLQPEVATHLLQALLQVNGRIL
                     KRIEAPDAHVEGVRVPGGTLESMIRHALADENAHVRQLALEQVLRTLTQQTEVPFVVA
                     IDDVQAYFMTSSYRDPDYVPLEAYELAVPRALRDLVLTPRSQAVVLSALSSAHADFPA
                     PDALLVALREQCSAHGAPVPWSRVWATLSCRGSATRVREPHAYAQVNDTHLASARAAA
                     LSPLDVGAPLHRNEAASILDLLHRERVIWTTPNDEAFLAKLVESHGNVHTFTHSWRAT
                     LQ"
     gene            <782464..>783318
                     /locus_tag="MRET_3313"
                     /note="MRES_11355"
                     /db_xref="GeneID:38740079"
     mRNA            <782464..>783318
                     /locus_tag="MRET_3313"
                     /product="maintenance of ploidy protein MOB2"
                     /transcript_id="XM_027629940.1"
                     /db_xref="GeneID:38740079"
     CDS             782464..783318
                     /locus_tag="MRET_3313"
                     /codon_start=1
                     /product="maintenance of ploidy protein MOB2"
                     /protein_id="XP_027485440.1"
                     /db_xref="GeneID:38740079"
                     /translation="MSFFNQIGRSMGLPSRSAKPRAQPQPQPVVLERPWSDAPVPAPH
                     KPLYLCQPFERSTLIKGSFRTIVALPKYVHPYEWVAINLCDFFHNLNLFCGVLTEFMT
                     TQAQPTMSAGVGMHYTWVDIHRKPIHLPAAQYIDFVMTWIAQLLQDEAVFPTRPGRDF
                     PPTFPTTAKHMYKHMLRIFAHIYHAHFPELVHLSCEGHLNSLFAHFLVFGHEFQLFQF
                     AEFKGGPPACRGGVGGPEHPAMETPALRDVAAAPIGCTGEPQPYPGVCDLIERWVERD
                     ILPREVLG"
     gene            complement(<783319..>784962)
                     /locus_tag="MRET_3314"
                     /note="MRES_11360"
                     /db_xref="GeneID:38740080"
     mRNA            complement(<783319..>784962)
                     /locus_tag="MRET_3314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629941.1"
                     /db_xref="GeneID:38740080"
     CDS             complement(783319..784962)
                     /locus_tag="MRET_3314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485434.1"
                     /db_xref="GeneID:38740080"
                     /translation="MMVELMTSATRHASRVARRASFSFPPAMLSTHGGLATPAPSSEY
                     DVPSSPTHKGPQHRHDLATPPPSSPTAATKRALATTPSPVHAMGVSPTKRAPPPPVHR
                     LMPTSKISVSHDQSILLDYTHTFVVGRCRQLERTSWALRGMHTFMGTKPLALLSLPPS
                     AKHASRVHALVRWVPFSSPEEGGAPIGTFVLRVMGQNGLLIHDQRYRAGQVVRLEPGT
                     TCLDFFGMRMHVEAPIPTRPAPPARPRADGTSPTKAAPVDVPSSPPRWAPAWVAPTPS
                     EAPTTSEAPTTSEAPTTSEAPTTSEAPTASEAPMTSDAAPASPRKASPPSAVSPPSAV
                     SPLDTARRLVEKLAPTYDLAGLLAGAIVFHRTATISASEAVRSVLATNPSMLRGEAGA
                     CAVAFSPSKRRLLTEGRSVPAHGERIHGWHEASEHAWLAVARQAWYECLDRVLQRAPM
                     FGVIQRPGKDTRGNPLECWYYYDKEHDPDRERALNLGAFAKPMRNAVRSQKPIFWKKS
                     EYVRATSNGYTSDDDKIPYSPRSEEARPRKRRAKAEASP"
     gene            <784961..>785625
                     /locus_tag="MRET_3315"
                     /db_xref="GeneID:38740081"
     mRNA            join(<784961..785350,785377..>785625)
                     /locus_tag="MRET_3315"
                     /product="peptidyl-prolyl cis-trans isomerase-like 4"
                     /transcript_id="XM_027629942.1"
                     /db_xref="GeneID:38740081"
     CDS             join(784961..785350,785377..785625)
                     /locus_tag="MRET_3315"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase-like 4"
                     /protein_id="XP_027485435.1"
                     /db_xref="GeneID:38740081"
                     /translation="MTGSDGRGSRAERVETHDAAREQGQDAGSDARTAEGTKQARDKA
                     DGADADDPTRERAQDDEKEAIERRRNAEAAALTLEIVGDLPYADIKPPENVLFVCKLN
                     PVTRSEDLELIFSRFGEIRSCDVIRDKKTGDSLQYAFIEFEHRASAEQAYTKMQNVLI
                     DDRRIWVDFSQSVSRLQHVWRKRRAAALHRSRPDRSRDARPRRRSASPPPRR"
     gene            <785721..>787910
                     /locus_tag="MRET_3316"
                     /note="MRES_11365"
                     /db_xref="GeneID:38740082"
     mRNA            <785721..>787910
                     /locus_tag="MRET_3316"
                     /product="elongation factor G"
                     /transcript_id="XM_027629943.1"
                     /db_xref="GeneID:38740082"
     CDS             785721..787910
                     /locus_tag="MRET_3316"
                     /codon_start=1
                     /product="elongation factor G"
                     /protein_id="XP_027485436.1"
                     /db_xref="GeneID:38740082"
                     /translation="MRTLGIIAHIDAGKTTLTERILTLTQRGLEAPTHAAATYVAPGD
                     VDSGSTVTDFLEEERERGITIQSAAVGPIWWRDMAMTLVDTPGHIDFGIEVERAVRVV
                     DGTIVVLDGVEGVEPQSENVWRQAKRYGVDAHLFFVNKLDRPGACISRSVRSIIDAGL
                     HERPVLLQLPAYAADVGESDASGDRPLVGVVDLLSLHLWRFRGVAGERMEAVPLEASM
                     PVYERALLARQALIDTLGSLDDDLLEHIVMLDEGEAVDVSLVQAALRRLTLAGRVCPV
                     LCGAAAVNIGVQPLLDAVHRYLPSPADRPHVRGVLEPDTPRAREVDVALSDATPAALA
                     FKVVWDRRRGPITFVKVYAGTLHAAQSVINTTGRHKERLARLLLPYADEYVDVRALHA
                     GQIGVVLGLRDTRTGDTLVGSPAWRTLRLRRVHVPPPVFSASIEPRSKAEEGAVQDAL
                     QMLVRTDPSLHVTHGTQTVLSGMGELHLDIAHHRLTSEFGVQPRLGHVRVGYRETLTE
                     AVEATSDEPALSVRVALSPAAGEQQVAVDVGDMPEVDGVPVAHLVQQGIRAALARGPR
                     SGYPMHSVQGTVSVRAKDDDLPPAASIRQAVVQTIRRALGGKSGPTRLMEPMMHVTIE
                     APSTHAGALSTDISVEQHGSILDMQLEAQQDTPTYQVYLPPTDEAAQAQDQRMTIHAH
                     IPLARMVRYSSRLRALTGGAGSHTMALHGFDVVSPERERELLAELGR"
     gene            complement(<787907..>788434)
                     /locus_tag="MRET_3317"
                     /note="MRES_11370"
                     /db_xref="GeneID:38740083"
     mRNA            complement(<787907..>788434)
                     /locus_tag="MRET_3317"
                     /product="DUF866 domain protein"
                     /transcript_id="XM_027629944.1"
                     /db_xref="GeneID:38740083"
     CDS             complement(787907..788434)
                     /locus_tag="MRET_3317"
                     /codon_start=1
                     /product="DUF866 domain protein"
                     /protein_id="XP_027485538.1"
                     /db_xref="GeneID:38740083"
                     /translation="MPSFALQFRGALTNVSGLVPAEGVDAALLIPIECTSCHEEHPNA
                     VALEPSNVDEMQKSRGVANLVMHCPGCRRENAATFVVSKAEKLGEVSPWSAIDTDGDW
                     ATLCTIEFRGMQPRTPTIHGLLTDSSSWTCRGTESGTPFTDVQFEEDGEWHDYDDKAG
                     DEVSITDVELRWHKV"
     gene            complement(<788490..>789401)
                     /locus_tag="MRET_3318"
                     /note="MRES_11375"
                     /db_xref="GeneID:38740084"
     mRNA            complement(<788490..>789401)
                     /locus_tag="MRET_3318"
                     /product="CDP-diacylglycerol---serine
                     O-phosphatidyltransferase"
                     /transcript_id="XM_027629945.1"
                     /db_xref="GeneID:38740084"
     CDS             complement(788490..789401)
                     /locus_tag="MRET_3318"
                     /codon_start=1
                     /product="CDP-diacylglycerol---serine
                     O-phosphatidyltransferase"
                     /protein_id="XP_027485433.1"
                     /db_xref="GeneID:38740084"
                     /translation="MSAEEPQLRQRKHSDRKEVIGDLRADAEVQLKRFIETNGHFSLV
                     RNFHLADAFTVMNGFCGAQSLYMSARFLVTSHPRYMWYALWLPVAGALFDYLDGKIAR
                     WRRSSSMLGQELDSLADLVSFGVAPTVAAFALGMREPLDTLVMTVFVCAGIARLARYN
                     ITAANIPKDVHGKQRYFEGMPIPSSLLLLVLLGVCLLTGRFDAPQGGAWTPPTDGTAY
                     AYTGRWYSSLAEHQGFLFGSATLDVSSALYALFQLGGGVLPRLVQPSLLASIANGVGR
                     ITIHKMSFIWLLWSMAMLSKTLRIPKP"
     gene            complement(<789484..>790619)
                     /locus_tag="MRET_3319"
                     /note="MRES_11380"
                     /db_xref="GeneID:38740085"
     mRNA            complement(join(<789484..790581,790611..>790619))
                     /locus_tag="MRET_3319"
                     /product="VHS domain protein"
                     /transcript_id="XM_027629946.1"
                     /db_xref="GeneID:38740085"
     CDS             complement(join(789484..790581,790611..790619))
                     /locus_tag="MRET_3319"
                     /codon_start=1
                     /product="VHS domain protein"
                     /protein_id="XP_027485258.1"
                     /db_xref="GeneID:38740085"
                     /translation="MTEEKHQPHHHLHMPHFHSHASEIETAIDELCSDKYAETSYDGM
                     GELSDLIASKRHPEWDVTRAISHHLQGDSVPAQKRALTVLEGLVEMGEPAFQRSFATP
                     DLVRTLRSISSSYGTDNGVRRKLMLMLLSWHKHFMRDPEMAHVSSLYGLCGGVEREHL
                     MVPKAEPPRPRHEAVDLLHSSGSSVEGTLEASNRETEALWQAVMAASQSNTPVMESED
                     VKTHAMLVLELQKEVVQYIHTVGDADYIGTLIDANDKIVDVLQRLQDAAAGMPVQTHA
                     PGTLPSSKEELIMNASRRLSLPDAVHSPANELLRDIDHSLMVHSGFTTAAPSRSAMEP
                     AEHADPNEIDMSVVERNTQQVQGSVSGLPTAPPA"
     gene            complement(<790663..>791634)
                     /locus_tag="MRET_3320"
                     /db_xref="GeneID:38740086"
     mRNA            complement(join(<790663..790711,790738..791589,
                     791615..>791634))
                     /locus_tag="MRET_3320"
                     /product="serine/threonine-protein phosphatase 4 catalytic
                     subunit"
                     /transcript_id="XM_027629947.1"
                     /db_xref="GeneID:38740086"
     CDS             complement(join(790663..790711,790738..791589,
                     791615..791634))
                     /locus_tag="MRET_3320"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 4 catalytic
                     subunit"
                     /protein_id="XP_027485315.1"
                     /db_xref="GeneID:38740086"
                     /translation="MQGHLDQHIEQLIRCEALSEAQVKELCDRARELLIEEGNVQHVD
                     APVTICGDIHGQFYDLLELFRVGGPCPDTKYLFMGDFVDRGLYSVETFLLLLALKVRY
                     PDRIILIRGNHESRQITQVYGFYDECSRKYGSVNVWRYCCEVFDYLSLGAIIDGRVFC
                     VHGGLSPHIQKLDQIRTIDRKQEVPQDGAMCDLLWSDPDDITGWGISPRGAGCLFGGD
                     VVKSFIHTNGLDLVARAHQLILEGYKHMFDATIVTVWSAPNYCYRCGNVASILQLDDA
                     LNQKYQTFDAAEQAITPGFPAKRPAPDYFL"
     gene            <791736..>793326
                     /locus_tag="MRET_3321"
                     /note="MRES_11385"
                     /db_xref="GeneID:38740087"
     mRNA            join(<791736..793283,793309..>793326)
                     /locus_tag="MRET_3321"
                     /product="(R)-2-hydroxyglutarate---pyruvate
                     transhydrogenase"
                     /transcript_id="XM_027629948.1"
                     /db_xref="GeneID:38740087"
     CDS             join(791736..793283,793309..793326)
                     /locus_tag="MRET_3321"
                     /codon_start=1
                     /product="(R)-2-hydroxyglutarate---pyruvate
                     transhydrogenase"
                     /protein_id="XP_027485314.1"
                     /db_xref="GeneID:38740087"
                     /translation="MWLARWGCVTRPAFAAARRAYSSTPARNPAYASLTPSILKQFAS
                     VLSTPQSSLLSTIPSETQQWRVVDDTDLEAYNKDWMGKYIGRSACVLRPKSTEEVSSI
                     MKICAEHGLAVVPQGGSTGLVGGNVPVHDEVVLNLGSMNRVRSFDEATGTLVCDAGCV
                     LQTLDDYLAERGYMMPLDLGAKGSCQIGGNVSTNAGGLRFLRYGSLHGSVLGLEVVLA
                     NGEILPLLQTLRKDNTGIDLKQLFIGSEGSLGIVTGVAISTPKLPNSVNVAMFGVESF
                     DHVCQTARHVRKHCAEILSALEFMDQDSFDRVMHNPSHSFRDPFEKRYPMYVLIETSG
                     SNQDHDQAKLQDLVEDVLENGIVADGVVAQGEKQAQELWSMRELVPESLTAQGKVYKY
                     DVSLPLEHMYELVEVVERRMVDTGMKPALKQPGFVKAVCGYGHVGDCNLHLNVVADQY
                     SNKVEAALEPFIYEQVQAMHGSISAEHGLGVMKADKIGYTKHATAVKYMEEVKRLFDP
                     QRLLNPYKFLPTR"
     gene            <793400..>794124
                     /locus_tag="MRET_3322"
                     /note="MRES_11390"
                     /db_xref="GeneID:38740088"
     mRNA            join(<793400..793452,793482..>794124)
                     /locus_tag="MRET_3322"
                     /product="mitochondrial hypoxia responsive domain protein"
                     /transcript_id="XM_027629949.1"
                     /db_xref="GeneID:38740088"
     CDS             join(793400..793452,793482..794124)
                     /locus_tag="MRET_3322"
                     /codon_start=1
                     /product="mitochondrial hypoxia responsive domain protein"
                     /protein_id="XP_027485317.1"
                     /db_xref="GeneID:38740088"
                     /translation="MSYGTHRDDVGDVAHREAQYNYAIRAGAQGFAGGLAGAFGLGWY
                     LQRTFRHVRQLPMSLKAGCVFLTATGVGVIYADKASIKFDQMHYKDSSAYVDRRSSSE
                     AQAAWSKLSTFDKSLTWAKDHKFSVVLGSWLGSMGLSWLYIQTQPLSFAQKLVQARVW
                     AQGLTVASMIGMAALLQIPSEGDKLLEKTHSADDTSWEKRLKAAQLQAQKRPPPVHLT
                     STKQGESHEESES"
     gene            complement(<794121..>794756)
                     /locus_tag="MRET_3323"
                     /note="MRES_11395"
                     /db_xref="GeneID:38740089"
     mRNA            complement(<794121..>794756)
                     /locus_tag="MRET_3323"
                     /product="phosphodiesterase"
                     /transcript_id="XM_027629950.1"
                     /db_xref="GeneID:38740089"
     CDS             complement(794121..794756)
                     /locus_tag="MRET_3323"
                     /codon_start=1
                     /product="phosphodiesterase"
                     /protein_id="XP_027485316.1"
                     /db_xref="GeneID:38740089"
                     /translation="MSLVAYSDSEEDAAPGKLPPVALESDGYRNEWLSYVYIPVSLDL
                     EDLWRRVETPKAALLELIDHLHISLTRPLVLRKHEQGPFYAQVRQATACVHPFSVGFA
                     RFVCLPSDTSERVFMALEVSAGWHELTELVRALNERLSRLLHVRQYYDEARFHASVAY
                     LHGAPPAQLVQEGERLARAWNHCLCVTDIGPVTVRAIYTKVGQHIECAAFP"
     gene            <794826..>796139
                     /locus_tag="MRET_3324"
                     /note="MRES_11400"
                     /db_xref="GeneID:38740090"
     mRNA            <794826..>796139
                     /locus_tag="MRET_3324"
                     /product="nucleolar protein 53"
                     /transcript_id="XM_027629951.1"
                     /db_xref="GeneID:38740090"
     CDS             794826..796139
                     /locus_tag="MRET_3324"
                     /codon_start=1
                     /product="nucleolar protein 53"
                     /protein_id="XP_027485311.1"
                     /db_xref="GeneID:38740090"
                     /translation="MSQVTDGLGRPAQYRQASRKGKKAWRKNIDLIATEAALEDLREQ
                     ERAEGVPAHKRSNAELFMEDRSGQETTLARQAREKRKLKSQEILAHRSAVPAMQQKAR
                     SSFQLPDDSSAAKAAAAGLPPKFKKRLRMLASRPHEGVEGETERGRAGRLQSDAVLAE
                     KHDLWGEAPKTRQNDWIAPAAKDPVHRPRSMQHEPYAAARSMPAVSVPHPGTSYNPDF
                     DSHEALVQTAYEKAMAAELDEQQAQELHAKWKGVTQGVPLPLDLPLDVPEEGGEDGED
                     DEEVQDEGAAPKMPARKTAAQRRREARAKEQYTLAQQRRKERRIQGMISELPNQMKQA
                     KRDAQTRAELVQQRRQQKEERLQSQGIAGTRIGKYAVPSQRVDVQTGDELSDSLRRLR
                     PEGNLFWDRFQSLQARGLAEARKPVLPMRQRRKLKTYDRHSFKRD"
     gene            complement(<796141..>797094)
                     /locus_tag="MRET_3325"
                     /note="MRES_11405"
                     /db_xref="GeneID:38740091"
     mRNA            complement(<796141..>797094)
                     /locus_tag="MRET_3325"
                     /product="oligosaccharyltransferase complex subunit gamma"
                     /transcript_id="XM_027629952.1"
                     /db_xref="GeneID:38740091"
     CDS             complement(796141..797094)
                     /locus_tag="MRET_3325"
                     /codon_start=1
                     /product="oligosaccharyltransferase complex subunit gamma"
                     /protein_id="XP_027485310.1"
                     /db_xref="GeneID:38740091"
                     /translation="MKIGAWLVCVLVTACVSVHAALTASQSSLLAEARKSPHGILKLD
                     ERKYHELLQGPRDYGVFVQMTALHPRFRCGACALLNDPFEQVARGWKSTKRRNDLVFA
                     TIDANDGMELFRRMGMTYVPVMNYFPPHVDLPEEYDLTLNGYGADDIAEFVSARIGVP
                     FRPKKPLMPKQTAVYFIPVAFAVALASMIMRQRSWQEGVKTLGLMACVSLVLTFTSGY
                     MWTRIQGAPFMSFEPTGAPIYITAGFQAQYGVESLLLIALYASFVASILVLTRFAPKI
                     ESPILQRVVVVAGALALVLQYGLFALMFSYKNPGYPFRLLL"
     gene            <797173..>797433
                     /locus_tag="MRET_3326"
                     /db_xref="GeneID:38740092"
     mRNA            <797173..>797433
                     /locus_tag="MRET_3326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629953.1"
                     /db_xref="GeneID:38740092"
     CDS             797173..797433
                     /locus_tag="MRET_3326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485676.1"
                     /db_xref="GeneID:38740092"
                     /translation="MTHVAFSWAFDTHDATTEHRAYPAQGEGSVPQQDHTLEGLATSL
                     DDAREKLNDIVTCWKDAVGPEQDSHMGRSNAAHAQDDDEDEE"
     gene            complement(<797456..>798061)
                     /locus_tag="MRET_3327"
                     /note="MRES_11410"
                     /db_xref="GeneID:38740093"
     mRNA            complement(<797456..>798061)
                     /locus_tag="MRET_3327"
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /transcript_id="XM_027629954.1"
                     /db_xref="GeneID:38740093"
     CDS             complement(797456..798061)
                     /locus_tag="MRET_3327"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /protein_id="XP_027485312.1"
                     /db_xref="GeneID:38740093"
                     /translation="MSLGAFLSSARASLGALGVPSSWRAPGQVRFSSNLGPRRTRYRK
                     SQKGRVSFPIGGSVKGTTVTQGVYGLRTLEPCRITATQLTAAETALKRKLKVVRGSQV
                     FMRVFPDVPVCVKGNETRMGKGKGSFEYWACRVPMGRVLFEIGGHVEIRPEVAKDALR
                     LAAAKLPTRTEFITTSTPPRLGREVSHDLSQLASQLRDVRS"
     gene            <798177..>798531
                     /locus_tag="MRET_3328"
                     /note="MRES_11415"
                     /db_xref="GeneID:38740094"
     mRNA            join(<798177..798263,798291..798353,798379..>798531)
                     /locus_tag="MRET_3328"
                     /product="golgi vesicular membrane trafficking protein"
                     /transcript_id="XM_027629955.1"
                     /db_xref="GeneID:38740094"
     CDS             join(798177..798263,798291..798353,798379..798531)
                     /locus_tag="MRET_3328"
                     /codon_start=1
                     /product="golgi vesicular membrane trafficking protein"
                     /protein_id="XP_027485319.1"
                     /db_xref="GeneID:38740094"
                     /translation="MSSSYSNQHTHEQQNDDSLNRLFNKVHSLREITLHIHNDAEQQH
                     SLLQDTSSAFDQVRLQVSSSARQFADKIAQYTGSHRITAAIVGGFVGLWALWFFFL"
     gene            complement(798623..798695)
                     /locus_tag="MRET_t0055"
                     /db_xref="GeneID:38741249"
     tRNA            complement(798623..798695)
                     /locus_tag="MRET_t0055"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:38741249"
     gene            complement(<798852..>799523)
                     /locus_tag="MRET_3329"
                     /note="MRES_11420"
                     /db_xref="GeneID:38740095"
     mRNA            complement(<798852..>799523)
                     /locus_tag="MRET_3329"
                     /product="orotate phosphoribosyltransferase"
                     /transcript_id="XM_027629956.1"
                     /db_xref="GeneID:38740095"
     CDS             complement(798852..799523)
                     /locus_tag="MRET_3329"
                     /codon_start=1
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="XP_027485318.1"
                     /db_xref="GeneID:38740095"
                     /translation="MTSLVPYQAEYIDLALQWNILRFGGPYTLKSGRQSPYFFNAGLF
                     NSGMKLQKMAECYANRIVDSGVEFDVLFGPAYKGIPLVAATALALSKNHGRDVNFCFN
                     RKEAKTHGEGGNLIGAPLKGRVLVIDDVITAGTAINEAVDIINAQEDAKLVGVVIALD
                     RQERASDDTTESAITQVEKRLGIKVYSVVTLEQIIKHMESTRGDAARADIESMRAYRE
                     RYGSS"
     gene            <799622..>801634
                     /locus_tag="MRET_3330"
                     /note="MRES_11425"
                     /db_xref="GeneID:38740096"
     mRNA            <799622..>801634
                     /locus_tag="MRET_3330"
                     /product="NACHT domain protein"
                     /transcript_id="XM_027629957.1"
                     /db_xref="GeneID:38740096"
     CDS             799622..801634
                     /locus_tag="MRET_3330"
                     /codon_start=1
                     /product="NACHT domain protein"
                     /protein_id="XP_027485356.1"
                     /db_xref="GeneID:38740096"
                     /translation="MAEPPEASREDSILSEIHSLAPYFPYDAQTKSGRTDIKSQDAEQ
                     APHPQPHHGLQESIMQWEQRRKEILSEADDQIVVNRQHRRVTPHLMDTNARLTSSMTN
                     IGSSVLADMTTSENLNNAVIMPWASASIKEDIVRIITQWLADEGFGATRQALLEEANL
                     KVREHDDEIDERHKLRMFLLEGNWAEVEKMSTKPFLQSHKAFLYAIFRQQFLEFIENR
                     EFQKAFTFLIKRLKPLEHYQPHAAEFGDLCYLLSAKSVTDAPSFRMWEGIQPGREALV
                     AEFASFLEPGRLDREELLLSEKEEKAATRDTAYIPPHRLLTLLHQAMAYQVEFARYQK
                     RTVPVVSTLLHDYAGFVVPNRCRMSLRGHTQNVKCVRFVGDDGRKLVSGSSDCTVRLW
                     DTNTGACDAVLEGHGSRIWDVDASHTGAWIASASSDSTVRLWNVESKLPHLTLRCGFG
                     DVYCCRFSPDQGQLVTGGYDKLVRLYDLASGTVTRMFPGHQLGVSSAVFSPQGSLIAT
                     GAKDTSVRFWDTLSGVCVRTLPGHLGEVTSVEMSDDGRQLLTSSKDNSHRLWDMRMLR
                     PLQRFKGHQNTSKNFIRCTFAHPSLIVSGSEDGLVYMWGQESSLALQTLKGHGTDSHP
                     AAATVGGRKQVVVYSAAWNKVQGLLASCADDGTVRLWDWTPPHDAP"
     gene            <801736..>801975
                     /locus_tag="MRET_3331"
                     /db_xref="GeneID:38740097"
     mRNA            <801736..>801975
                     /locus_tag="MRET_3331"
                     /product="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit"
                     /transcript_id="XM_027629958.1"
                     /db_xref="GeneID:38740097"
     CDS             801736..801975
                     /locus_tag="MRET_3331"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit"
                     /protein_id="XP_027485357.1"
                     /db_xref="GeneID:38740097"
                     /translation="MAAFLRRDVYIELDDGRRAIRGVLVCVDREGNAILQEATEHVVG
                     AAQPGPRAERIMPLVMIPGRHIVRVATKEVSSLYT"
     gene            complement(<801983..>802450)
                     /locus_tag="MRET_3332"
                     /note="MRES_11430"
                     /db_xref="GeneID:38740098"
     mRNA            complement(join(<801983..802018,802044..802129,
                     802156..>802450))
                     /locus_tag="MRET_3332"
                     /product="HIT family protein 1"
                     /transcript_id="XM_027629959.1"
                     /db_xref="GeneID:38740098"
     CDS             complement(join(801983..802018,802044..802129,
                     802156..802450))
                     /locus_tag="MRET_3332"
                     /codon_start=1
                     /product="HIT family protein 1"
                     /protein_id="XP_027485354.1"
                     /db_xref="GeneID:38740098"
                     /translation="MSHDANCIFCKIVDGKIPSMKLYETDKSYAFLDIGPCSPGHSLV
                     IPKYHAAKMHELPDEYLQDILPIAKKVAIATGAPEYNILQNNGRLAHQVVDHVHFHVI
                     PKPSSEQGLVVGWPSTQPPKEELQAVYERLQKNMRQ"
     gene            <802603..>803271
                     /locus_tag="MRET_3333"
                     /note="MRES_11435"
                     /db_xref="GeneID:38740099"
     mRNA            <802603..>803271
                     /locus_tag="MRET_3333"
                     /product="caffeine-induced death protein 2"
                     /transcript_id="XM_027629960.1"
                     /db_xref="GeneID:38740099"
     CDS             802603..803271
                     /locus_tag="MRET_3333"
                     /codon_start=1
                     /product="caffeine-induced death protein 2"
                     /protein_id="XP_027485355.1"
                     /db_xref="GeneID:38740099"
                     /translation="MAPTVYWTPPMRTDVASEPERAGEPHVVPTPASVPDVTPSICLS
                     LVEFKDMLRQFRAVDDGVTLRLNRAFAQSRDTGSSAPPSLLQRHDKSFSSSSATDLGR
                     TTYASVPDTMCAAIWTELVQLWTRREDTIKYCIDVNAKHMPRPLSRDDRLDLDRAPAA
                     ASVPATAVSRGESDAEFTMRQLRNELAIEAIVRRRSLDVFKSRCRLFSPAHTEREQAY
                     WRGY"
     gene            complement(<803282..>804325)
                     /locus_tag="MRET_3334"
                     /note="MRES_11440"
                     /db_xref="GeneID:38740100"
     mRNA            complement(<803282..>804325)
                     /locus_tag="MRET_3334"
                     /product="glycerol-3-phosphate dehydrogenase (NAD+)"
                     /transcript_id="XM_027629961.1"
                     /db_xref="GeneID:38740100"
     CDS             complement(803282..804325)
                     /locus_tag="MRET_3334"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase (NAD+)"
                     /protein_id="XP_027485352.1"
                     /db_xref="GeneID:38740100"
                     /translation="MVLQKQRVAIIGSGNWGSAIATIAGYNTMRHKDVFEPTVNMYVY
                     EEIINGEKLTDIINREHVNTKYLPHARLPDNVVAVPKAEEAARDATLLVFVLPHQFIL
                     NVCKSLKDAIAPGAHAISMIKGVDVANHQISIYADVIEKSLGIPCAALSGANIANEVA
                     QGLFSETTIGYRASQRGLVDYYQKLFDTPKFRVGAIEDVSGVSLCGALKNVVAVGAGF
                     VDGLEWGGNAKAAIMRIGLMEMRNFALEFFDGVKPETFTETSAGVADLITTCYGGRNR
                     KCAEAFVRTRKPFHVLEAELLNGQKLQGTETTKDVIEFLESHGKVDKYPLFKTIYDIC
                     YNGLDPQQLTERL"
     gene            complement(<804564..>805232)
                     /locus_tag="MRET_3335"
                     /note="MRES_11445"
                     /db_xref="GeneID:38740101"
     mRNA            complement(<804564..>805232)
                     /locus_tag="MRET_3335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629962.1"
                     /db_xref="GeneID:38740101"
     CDS             complement(804564..805232)
                     /locus_tag="MRET_3335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485353.1"
                     /db_xref="GeneID:38740101"
                     /translation="MPRELPRVDLEHPSDLDFIVQAVHSYARDVGAERLRTRGRAAAA
                     LQDTLDQALARWVYAARTRLIPNVLVNGLTLAEYAKQETAMEPFDEALSQRVQTLSDT
                     MDEQTERVVDYRKSVPTAYAHAVARRAAARRALADAKEDQRQRRLRTSKRHAAAPYPA
                     IARGQPLHLDADAKARTQATLTNVYATLRRLHTSLPARQESALEQERLVRHLRRHDDA
                     TRPV"
     gene            <805380..>806744
                     /locus_tag="MRET_3336"
                     /note="MRES_11450"
                     /db_xref="GeneID:38740102"
     mRNA            <805380..>806744
                     /locus_tag="MRET_3336"
                     /product="etoposide-induced 2.4 mRNA"
                     /transcript_id="XM_027629963.1"
                     /db_xref="GeneID:38740102"
     CDS             805380..806744
                     /locus_tag="MRET_3336"
                     /codon_start=1
                     /product="etoposide-induced 2.4 mRNA"
                     /protein_id="XP_027485350.1"
                     /db_xref="GeneID:38740102"
                     /translation="MSHRPRSALQSVDFDTDDSVPVQLDVNYDDGLGVLGRRGVWSSK
                     GPSVDDTSRLSVLATLYLHVRWAWSGLADAARCKRALHLVQASRELRVGLLKGLALSG
                     AVSVVIYTFVSLLPRPSLPEEDHFWPDMSGERRASAAPSWFSSPHHVFWLYPVMAASY
                     FIASTWSVGVAEAAFTAHHIQPLRPPAEHVWWCEYAVRAMLIVNYSIPCLLLQNLPWV
                     GHVLSFLVMSFVDGFFCFEQVWSVRGWPLEKRLRFAESHWSFLMGFGVPSTLVSFFHP
                     SGLLNLMLFMLVFPICTLLAFLAVPQPHSAALGAQTAMLPSTVHGAGNAQNTPLAWCL
                     PARIPLFWPTVRFRRWVSTRMATEMPPLIPRKPMSAPSTDPRRSVSTMAPSMSPATPR
                     RSAASFVGGAWSMHPRGRMVSAPLAGSPDHVAEPPSSWRASAVSIPMSSETLGPRKMP
                     KQAS"
     gene            <806846..>807109
                     /locus_tag="MRET_3337"
                     /db_xref="GeneID:38740103"
     mRNA            join(<806846..806877,806904..806920,806946..>807109)
                     /locus_tag="MRET_3337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629964.1"
                     /db_xref="GeneID:38740103"
     CDS             join(806846..806877,806904..806920,806946..807109)
                     /locus_tag="MRET_3337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485351.1"
                     /db_xref="GeneID:38740103"
                     /translation="MSSQEGTAHIQPHPARDNHPAPTGLDRASGAVQAPPGLQTLDAT
                     TASQLEQPLSDEELKKRSEALNATNL"
     gene            complement(<807104..>808474)
                     /locus_tag="MRET_3338"
                     /note="MRES_11455"
                     /db_xref="GeneID:38740104"
     mRNA            complement(<807104..>808474)
                     /locus_tag="MRET_3338"
                     /product="nudix family hydrolase"
                     /transcript_id="XM_027629965.1"
                     /db_xref="GeneID:38740104"
     CDS             complement(807104..808474)
                     /locus_tag="MRET_3338"
                     /codon_start=1
                     /product="nudix family hydrolase"
                     /protein_id="XP_027485359.1"
                     /db_xref="GeneID:38740104"
                     /translation="MSASLLAHLQHGLTRIAKISPRVLESPPTQPRRASVALILHVRP
                     AEEDEAWLRSKWRHGQVKDEDDAYLFPSTMQQDANGTMGVEARLRQFFALPWVQRGTP
                     ELLLIKRAVRANDNWSSHVAFPGGRRDEEDENGLYTSMRETWEEVGIDLAEKEFLHVG
                     HLEDREITSSLGKRLLMILSPYIFLHLSPFSPTPSLQPSEVSSLHWVPLSQLFTPTPR
                     WGTLHMDVARHMPQNSYMRSMLSMLIGQITFRSIQLPNTPTAITMAMARDHFAHLAKP
                     PPAKEAEEEEDTFLLNAEQQAYLGQVTPRLQLWGLTLGMTLDLLSHMSTYQREKPPPE
                     PPTIHALKSLFSILPSSRLFGDAYSAPAKAPSVVEVFPRFGYPDINLWLWVFGWRYRA
                     ILRKWRQSIGTELERQAHWSGLAIAAFYSCVRRALIVALVLRAMGLVSLVSLGGYLGW
                     RRLYRL"
     gene            <808588..>808983
                     /locus_tag="MRET_3339"
                     /note="MRES_11460"
                     /db_xref="GeneID:38740105"
     mRNA            <808588..>808983
                     /locus_tag="MRET_3339"
                     /product="U1 small nuclear ribonucleoprotein C"
                     /transcript_id="XM_027629966.1"
                     /db_xref="GeneID:38740105"
     CDS             808588..808983
                     /locus_tag="MRET_3339"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein C"
                     /protein_id="XP_027485349.1"
                     /db_xref="GeneID:38740105"
                     /translation="MGKHYCDYCDVFLTHDSTSVRKAHNCGRNHLQNVREYYASLPPA
                     ELQMMADTILREYQARQLPPPMELVAPQLAYRLPPPSHMPNGRAPFMGGMALRPPPGM
                     PPPDFSRPPPSLPPPDFSKPPPTMRGAPP"
     gene            complement(<808992..>810386)
                     /locus_tag="MRET_3340"
                     /note="MRES_11465"
                     /db_xref="GeneID:38740106"
     mRNA            complement(<808992..>810386)
                     /locus_tag="MRET_3340"
                     /product="ATP-dependent RNA helicase DDX49/DBP8"
                     /transcript_id="XM_027629967.1"
                     /db_xref="GeneID:38740106"
     CDS             complement(808992..810386)
                     /locus_tag="MRET_3340"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX49/DBP8"
                     /protein_id="XP_027485768.1"
                     /db_xref="GeneID:38740106"
                     /translation="MSARAEHFHALGISMPLVRALKMLAITVPTPIQSACIPAILEGR
                     DVIGGAETGSGKTLAFALPILQHLYKDMIGGYAVILTPTRELGVQLHEQFLAVGQGSR
                     MGLKCALVLGGMDMTKQANELGEQRPHIIVATPGRLVDLLTSGAAHEWGLERCRFVVL
                     DEADRLLSPTFAPALAYLFSVLPPAHLRQTLLFTATLTPEIERLTQKTPEPGKLPPLL
                     RKIEMDTSTPASLTQLYTLVPSHMREPYLVHLLHHPPCQKVEVRTDLSDVYRTHKPKL
                     PREEAPAYPLSIIFVARCKSAELLSRMLTELGVPNVSLHSMLPQSTRLHNLHMFRARR
                     VPILISTDVGSRGLDVPDVELVVNWDVPAAWEDYVHRVGRTARKGRPGWAVSFVTEHD
                     VELVQTIEDKIHKTLTEWDMPESQVLERLSHVSAAKRVASMALHDEKFGEQRERNKRK
                     AQASQPRSKKHHVQ"
     gene            <810468..>810934
                     /locus_tag="MRET_3341"
                     /db_xref="GeneID:38740107"
     mRNA            join(<810468..810490,810515..810525,810550..810652,
                     810682..>810934)
                     /locus_tag="MRET_3341"
                     /product="cell wall biogenesis protein"
                     /transcript_id="XM_027629968.1"
                     /db_xref="GeneID:38740107"
     CDS             join(810468..810490,810515..810525,810550..810652,
                     810682..810934)
                     /locus_tag="MRET_3341"
                     /codon_start=1
                     /product="cell wall biogenesis protein"
                     /protein_id="XP_027485785.1"
                     /db_xref="GeneID:38740107"
                     /translation="MTELYAAADFCLIPMGTPTTSVGAYVAECQRVLASMADDGIRYE
                     LHGYGTNVEGPISSVWRALQRCHEAVHAMGVERIATDIRLGTRTDKHTESPAWSQGLS
                     ENERKRESVRRRLAGLGESCPPAASST"
     gene            <810953..>812311
                     /locus_tag="MRET_3342"
                     /note="MRES_11470"
                     /db_xref="GeneID:38740108"
     mRNA            <810953..>812311
                     /locus_tag="MRET_3342"
                     /product="acetylornithine aminotransferase"
                     /transcript_id="XM_027629969.1"
                     /db_xref="GeneID:38740108"
     CDS             810953..812311
                     /locus_tag="MRET_3342"
                     /codon_start=1
                     /product="acetylornithine aminotransferase"
                     /protein_id="XP_027485784.1"
                     /db_xref="GeneID:38740108"
                     /translation="MWRPLYQRGVRFSSSYAPCTKYMRATHVEPSVKLDDAVHRYRET
                     TLGTYVRPPIVFSHGRGLDLFATVPGEAQSRRYLDFTGGIAVNALGHADPQVAAIAAE
                     QAAQLVHCSNLYYNTWSGELAHRLASMTREHGGLGLAPQSPPAASGQDVRAFIANSGT
                     EANEAALKFARKAAKGTALVCFQHAFHGRTMGALSVTPNAKYQAPFLPLVGDVRVGTL
                     NDMAQLESLVTEDVAGVIVEPIQGEGGILPAQVEWLTALRQRCTAVGAALIYDEIQCG
                     LFRTGHMWCHSAMPVEAHPDMVTMAKPLANGFPIGAVLMRPHIAHAIAAGDHGTTFGG
                     GPLTCRIAHHVLGRLGEPRMKEHIDSVSTYLFERLERISEAFSDMVSAPRGRGLIVGI
                     SMRSAPWAGEVVRLARERGVLFLTAGSDAVRFVPSLIVERAHIDEAMDVLESVLLVLR
                     ST"
     gene            complement(<812304..>813012)
                     /locus_tag="MRET_3343"
                     /note="MRES_11475"
                     /db_xref="GeneID:38740109"
     mRNA            complement(join(<812304..812892,812918..812980,
                     813005..>813012))
                     /locus_tag="MRET_3343"
                     /product="MOB kinase activator 1"
                     /transcript_id="XM_027629970.1"
                     /db_xref="GeneID:38740109"
     CDS             complement(join(812304..812892,812918..812980,
                     813005..813012))
                     /locus_tag="MRET_3343"
                     /codon_start=1
                     /product="MOB kinase activator 1"
                     /protein_id="XP_027485783.1"
                     /db_xref="GeneID:38740109"
                     /translation="MLGVPRPPPQAYMPNRTTEGSRAFQLRRLAESTLGSGNLRVAVR
                     VPDGELLEEWLALHTVDFFNHLNILYGTLTEFCTSRECPVMCAGPRFEYHWQDSSSVK
                     YRRSTRLSAPDYIECLLNWTQAQIDDETLFPTALDASFPPNFVDRIKAMLRRLFRIYA
                     HIYNHHFAQVCALRLEVHLNTSYRHFFLFVSEYQLIDPKEMIPLAEINEAITEENARS
                     M"
     gene            <813115..>814866
                     /locus_tag="MRET_3344"
                     /note="MRES_11480"
                     /db_xref="GeneID:38740110"
     mRNA            <813115..>814866
                     /locus_tag="MRET_3344"
                     /product="acid phosphatase"
                     /transcript_id="XM_027629971.1"
                     /db_xref="GeneID:38740110"
     CDS             813115..814866
                     /locus_tag="MRET_3344"
                     /codon_start=1
                     /product="acid phosphatase"
                     /protein_id="XP_027485782.1"
                     /db_xref="GeneID:38740110"
                     /translation="MPHPRAKDDDVLDQIEQARLISHHLDADDEGRPIEHSEPGVSVP
                     VAPSPAAAPRIDTDIDHTGRPAWLIRLERLPTAQRRLLQVAGLVVVAVVLAAVFSFAL
                     GPPPPTALPVIHPQAVGKSFPTYIGYPGSYATGAPASLVDEWKPAPSPTRGVDAIHTA
                     LPHFDRFRPFEHMGSLSPYFSAQHGSIDNAKYQSTPVMENETCRLSQVHILHRHGSRY
                     PTGGAPTKWVEHFLRSKPPGTFTGPLAFLNDYKYRLGEELLVPLGREQLHMSGTKAAM
                     DYGRLAEQDLAQGKHLFVRTGSQQRIVDSALAWATGFWGHAWTNKTDFEVQIEAPGFN
                     TTLAPNFACRAAVEGFQVQNLIDSYLANATARLQAHVHGAQLTPKIVYGMQQLCSYDT
                     VAYGRSDFCPLFTEDEWRAYEYVWDQRFYYDYGAGNAVGAAMGLGWLNEFVSRLTRTP
                     WNARTQTSENATFNAQASTFPVDRSLYADFTHDSVLTSVLAALRLRDLQVAPKLEDAH
                     RAFRTSLLVPFAARMVFEVFDCAPESFVRMKLNDAIVPLGQLSKCEQRADGLCSLSRF
                     LASHADRNELGWWDRCA"
     gene            complement(<814878..>816488)
                     /locus_tag="MRET_3345"
                     /note="MRES_11485"
                     /db_xref="GeneID:38740111"
     mRNA            complement(<814878..>816488)
                     /locus_tag="MRET_3345"
                     /product="amidophosphoribosyltransferase"
                     /transcript_id="XM_027629972.1"
                     /db_xref="GeneID:38740111"
     CDS             complement(814878..816488)
                     /locus_tag="MRET_3345"
                     /codon_start=1
                     /product="amidophosphoribosyltransferase"
                     /protein_id="XP_027485781.1"
                     /db_xref="GeneID:38740111"
                     /translation="MCGIIAILLQEGHVATELHEGLGVLQHRGQDAAGIVTCGPKGRF
                     FQVKGNGMVRDVFDPSNVANLIGSMGVGHVRYPTAGSFAHAEAQPFYVNSPYGIVMAH
                     NGNTVNQTELRTMLDSEAHRHVNTDSDSELLLNVFANHLQRTGKFRINEEDLFTALEA
                     MMNETVGAYTCVAMLAGFGVMAFRDPHGIRPIGMCRRKSDCPQAGSHGYDYCFASESV
                     VADSLGFSEFEDIKPGEAVIVTPQNVTRRTLVTKPAPNTFTPDIFEYVYFARPDSVID
                     GVSVYRSRMAMGDRLAQQVQQELLSKGEQIDVVIPVPDTSRVAALQLAQTLHIPYREG
                     FVKNRYIGRTFIMPGQGMRRKNVRRKLNAMALEFAGKSVLLVDDSIVRGTTSREIIQM
                     ARDVGARKVFMASCAPPIRHSNVYGIDMPSRNELVAYNRSVEEVAATIQADAVIYQSL
                     EQLVDCVRSLNPAITKFDCSIFDGAYVTGGVDEAYLSSLEKARADNERSKKAASFLTP
                     HPAPESIVSCSGPMNGAEDIGLYNGRTR"
     gene            <816620..>817735
                     /locus_tag="MRET_3346"
                     /note="MRES_11490"
                     /db_xref="GeneID:38740112"
     mRNA            <816620..>817735
                     /locus_tag="MRET_3346"
                     /product="solute carrier family 25, member 33/36"
                     /transcript_id="XM_027629973.1"
                     /db_xref="GeneID:38740112"
     CDS             816620..817735
                     /locus_tag="MRET_3346"
                     /codon_start=1
                     /product="solute carrier family 25, member 33/36"
                     /protein_id="XP_027485767.1"
                     /db_xref="GeneID:38740112"
                     /translation="MSSATPPRTMQRRKAAEPPPWLHFAAGGIGGMCGAIITSPLDVV
                     KTRLQSDLYRHRATFRVPYRGALGMLANGAYQFVDTSRLLMEISVREGSSALFKGLGP
                     TLVGVIPARAINFYAYGNGKRFLTEYFGEESAFVHLTAAAQAGIITATATNPIWVVKT
                     RLQLESQLREAQTRKARAEAIGKVMPTSSRLPSHLPYRTISTSSRMRSQFFQSSPPPA
                     HPGTNALRMASHIVRKEGVAGLYRGLSASYLGVSESTIQWVLYERLKRIQRRPQERPT
                     WAQTIGSAGTAKLVATVITYPHEVIRTRLRQQPEHGVQKYRNLVQTFRVVLQEEGAMA
                     FYGGLSAHLMRVIPNAIVTFSIYEFVLLLGSQYRHVF"
     gene            complement(<817740..>818242)
                     /locus_tag="MRET_3347"
                     /note="MRES_11495"
                     /db_xref="GeneID:38740113"
     mRNA            complement(join(<817740..818070,818097..>818242))
                     /locus_tag="MRET_3347"
                     /product="tyrosine-protein phosphatase OCA1"
                     /transcript_id="XM_027629974.1"
                     /db_xref="GeneID:38740113"
     CDS             complement(join(817740..818070,818097..818242))
                     /locus_tag="MRET_3347"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase OCA1"
                     /protein_id="XP_027485780.1"
                     /db_xref="GeneID:38740113"
                     /translation="MLVPPPNFGMVEDSLYRSGQPDQLNFPFLEKLGLKSVIWLAPEE
                     PDIGFQHFCHDQNITMHHLGVLYSTNAWDPITEEIVLQALHLLVQPSTYPCLVMCNLG
                     RHRTGTVIGCLRKLQHWNLSAILEEYRRFAGPKVRVMNEQFIELFDEELVFGENQA"
     gene            complement(<818290..>819297)
                     /locus_tag="MRET_3348"
                     /note="MRES_11500"
                     /db_xref="GeneID:38740114"
     mRNA            complement(<818290..>819297)
                     /locus_tag="MRET_3348"
                     /product="aldo-keto reductase"
                     /transcript_id="XM_027629975.1"
                     /db_xref="GeneID:38740114"
     CDS             complement(818290..819297)
                     /locus_tag="MRET_3348"
                     /codon_start=1
                     /product="aldo-keto reductase"
                     /protein_id="XP_027485766.1"
                     /db_xref="GeneID:38740114"
                     /translation="MSTIPARPPAILYGTAWKAERTAELVHLAFLQGFRGIDTAAQRK
                     HYREDLVGLGVQSACKALGLSRKDIWLQTKFTPINGQDIQGPIPYDPEANVADQVCSS
                     FKHSLQHLHPAATLPDIRQLLVQYAVSAKNGSQHQEAPLQDVYIDSYLFHSPLSTLPA
                     TLEAWRVMEALVDAGLVRYIGFSNVYDPHIFSVLFEKARIKPYVLQNRWHASTGHDVS
                     LLAQLSPVLSPNMYPLSLDSIVDAPRGVTYQPFWTLTGNQRLLQSECVARLSSRKGLT
                     PAQVVYAFVSQGMGLLGLSTCVLSGTKDPAHMKEAVEAVQCEPWDDEELASIRRDVYG
                     E"
     gene            complement(<819375..>821912)
                     /locus_tag="MRET_3349"
                     /note="MRES_11505"
                     /db_xref="GeneID:38740115"
     mRNA            complement(<819375..>821912)
                     /locus_tag="MRET_3349"
                     /product="chitin synthase"
                     /transcript_id="XM_027629976.1"
                     /db_xref="GeneID:38740115"
     CDS             complement(819375..821912)
                     /locus_tag="MRET_3349"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027485665.1"
                     /db_xref="GeneID:38740115"
                     /translation="MSAPHELLEQHLLQPVRRYEPIHNDGAEYIWDAYDEPDYEDPSV
                     QSLRASSFDKGSLEQDDAELHLDMPPVDEDRWEARQQPPQHGRTRQVQLTAGNWIVDY
                     PVPTPVANAVLPAYREQGAPKEFTHMRYSAVTCDPDDFVLENGWGIRTRHEYERPTDI
                     LIALTYYNEDRNLLTRTMHSVMLNIRDMCRKWSKRYPHMDDGHPGWQRVVVSLVFDGI
                     DPCDKEALDVLATMGVYQDGVMKRQVNDKETVAHLFEYTTQVSVDSTPQLVQPSPTSH
                     DNLVPVQMIFCFKQRNAKKINSHRWVFHALGRMLQPDMVVLVDVGTKPGHLALYHLWQ
                     AFYHRPNLGGACGEIHAMIKHGIKLLNPLVAAQNFEYKISNILDKPLESLFGYVSVLP
                     GAFSAYRFQAVLGRPLDQYFHGDHTLAQRRGAGEMNIFQKNMFLAEDRILCFELVAKR
                     GERWTLTYIKPSKAETDVPEQPAELISQRRRWLNGSFAASLYALVHFYRFYGSGHSIF
                     RLLFFHLQACYNVFQLVYTWFSLGNLWLTFAIIIQYLPSVLLHGFSDAWLIAFHYVNL
                     VLMWVYAFFLALQFVLALGNRPKSESVAYKLSFGVFGTLGMYTLAISLWMTIRSLSHL
                     AEEKKSTIDIVLSNTTAVLIASLAAMYGLYLLASLLYMDPWHMFTSAPQYFFMAPSFV
                     NVINVYAFCNLHDVSWGTKGSDKIEALPSVQTKAQDQPDMVEEVAMDQGDIDMHFKKV
                     VDRAVAPFHHERERSEKTTDDSYKTFRTRLVAFWLLSNAILVAVIMNLYTYRPNEKLD
                     DEFSEGRDNQEIYFKVILWSTFGLAFFRFVGCVLFWIHHLAVRSRHL"
     gene            <822005..>823192
                     /locus_tag="MRET_3350"
                     /note="MRES_11510"
                     /db_xref="GeneID:38740116"
     mRNA            <822005..>823192
                     /locus_tag="MRET_3350"
                     /product="DASH complex subunit ASK1"
                     /transcript_id="XM_027629977.1"
                     /db_xref="GeneID:38740116"
     CDS             822005..823192
                     /locus_tag="MRET_3350"
                     /codon_start=1
                     /product="DASH complex subunit ASK1"
                     /protein_id="XP_027485273.1"
                     /db_xref="GeneID:38740116"
                     /translation="MAHTPADAMAAGEQLMQLDQAITLTLQEIDENFSQAHQIVTSRI
                     LPSIREYESSCSQTWQSARFWKQFFEASAQVSLSQQPLEEFEDTFGEQSEQPSARDDS
                     THATHDSDPMASPPRLSTSVYAQAHLETPFERLKRDVEASRMEDMSREASRKMADMSI
                     ATDPSLVVSDIPKSSSPAKGRRRSSARPRVSVASGAPNPFEKTWNGIADLRTTPLRPA
                     PRDDSDDMSLAMPEGMSPPVTMQFSMPQSKYLKTPAKEAARRVVNDLLKSVGGDDGDM
                     SLGDVSPSARRKSVVGTPLVKDTTRRRDSLPTPPTITKVYNRTSAASDDEDDSDESED
                     DASHAILPSQTPATTSRSIEDDTLFGLGPRRMPDSVDQSASRALSSAVRRSSDERRLL
                     GED"
     gene            complement(<823189..>823861)
                     /locus_tag="MRET_3351"
                     /db_xref="GeneID:38740117"
     mRNA            complement(join(<823189..823221,823253..>823861))
                     /locus_tag="MRET_3351"
                     /product="OTU domain protein 6"
                     /transcript_id="XM_027629978.1"
                     /db_xref="GeneID:38740117"
     CDS             complement(join(823189..823221,823253..823861))
                     /locus_tag="MRET_3351"
                     /codon_start=1
                     /product="OTU domain protein 6"
                     /protein_id="XP_027485274.1"
                     /db_xref="GeneID:38740117"
                     /translation="MSSEAPKKLSRQQRRQMAKDAREQERLDGIRADVEREMAESPQV
                     NQSEVEEKQLQELCEKLQLQVHEITPDGHCLYNAIADQLNTRYPTQEPYTYESMRRAA
                     ASYMRQHADDFMPFISDLDESAAGVAEAKDPLTKFLDYCDAMEKTSTWGGQPEILALS
                     KVLYTPIYVVQPGTPIIKIGDEEFADRSPLWIAYHVKMYGLGEHYNSLRPKTH"
     gene            complement(<823890..>825293)
                     /locus_tag="MRET_3352"
                     /note="MRES_11515"
                     /db_xref="GeneID:38740118"
     mRNA            complement(<823890..>825293)
                     /locus_tag="MRET_3352"
                     /product="chromatin modification-related protein"
                     /transcript_id="XM_027629979.1"
                     /db_xref="GeneID:38740118"
     CDS             complement(823890..825293)
                     /locus_tag="MRET_3352"
                     /codon_start=1
                     /product="chromatin modification-related protein"
                     /protein_id="XP_027485275.1"
                     /db_xref="GeneID:38740118"
                     /translation="MPGVYGGDEINAVVLDPGASVFRGGWAGEDAPRAMFPTHYGWLP
                     MSEEERATYTAPDMKQESSQGDVTMSEAQPAPPRGVSFDAARGRKRFVGDVGVSYWRR
                     GLEIDTPLDEHGIVQDFDAMQALSHHALDLLSSEPTENPLLFTEPATNPRSARARTVE
                     LAFEGLQVPAFYLANRSVLSAFASGRPTALVVDIGASQVSAIPVVDGFVLRKGIHTQP
                     NGGDAVSRALLWGLTNEMGDKNQSGWLADSIVPQYLVKSKQPCEPGMPAQATLRDDRL
                     HGTAPSFRMYHTMGVLNDLKEAVCQVLEAPWDEAQAAARPTKMYEFPDGSNDAYGTLR
                     FKAPEAILTPSLYADKSQVLPTRDAPYMGLTDLVLQATKEVDVDARASMFGNIVCVGG
                     GTLLPGFLDRLSYELSVAAPSQRIRIHSPGNYTERRHSTWLGGSILASLGTFHQLWIS
                     KQEYEEHGQAIVHVRCR"
     gene            <825409..>826080
                     /locus_tag="MRET_3353"
                     /note="MRES_11520"
                     /db_xref="GeneID:38740119"
     mRNA            <825409..>826080
                     /locus_tag="MRET_3353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629980.1"
                     /db_xref="GeneID:38740119"
     CDS             825409..826080
                     /locus_tag="MRET_3353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485276.1"
                     /db_xref="GeneID:38740119"
                     /translation="MNVLSRENDAMSRAMSPEKRFSPEKGSPSKHMSPFKKGGKATSS
                     RTGRSALTDKTNQSPAKAFQTPFRGQATSFVTPADNIGRAGQIKARLGEMYDAQRDTV
                     PDTSEPTDMEPVEEEWPEIEYMPSRTPTIPYDMPPILDGWPRAKEVAALLAGAPLLRQ
                     EPGSAIETRVKASDLALEAPHTGGRRAAGAPRPTPPVRSDALSRQVEKALHQPFPSKG
                     FVVTE"
     gene            complement(<826070..>826576)
                     /locus_tag="MRET_3354"
                     /db_xref="GeneID:38740120"
     mRNA            complement(<826070..>826576)
                     /locus_tag="MRET_3354"
                     /product="dynactin 6"
                     /transcript_id="XM_027629981.1"
                     /db_xref="GeneID:38740120"
     CDS             complement(826070..826576)
                     /locus_tag="MRET_3354"
                     /codon_start=1
                     /product="dynactin 6"
                     /protein_id="XP_027485277.1"
                     /db_xref="GeneID:38740120"
                     /translation="MATDSNVTVQQRVVIAADTVVSGHVVIKSGTVVHPHATLDASRG
                     PMVVGENCIVEEHVHLVSPPQGMTVGDGNVFRIGCHVSAPDIGNCNVFEPASRIATSI
                     TNFCVVGAGCTADGPALPERTVVYGAASEHRTWSGDGIGQQLALHAKHLVYLRDQISK
                     SHKLRVIR"
     gene            <826670..>827125
                     /locus_tag="MRET_3355"
                     /db_xref="GeneID:38740121"
     mRNA            <826670..>827125
                     /locus_tag="MRET_3355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629982.1"
                     /db_xref="GeneID:38740121"
     CDS             826670..827125
                     /locus_tag="MRET_3355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485278.1"
                     /db_xref="GeneID:38740121"
                     /translation="MSCEACSAIPACPPCQKHQVCRQLYPNQCHACPQNVCIDTHSAT
                     HVAPILGGTLSVVLGLAGLIAFGWWMRRGQTKQQALERAQDMADRCIEAHRTRCDEGM
                     IDAFPLSMLTEPVTHAPIRPRDLWRISEQTEPSSYSSKRETRTSNRLTE"
     gene            complement(<827115..>829046)
                     /locus_tag="MRET_3356"
                     /note="MRES_11525"
                     /db_xref="GeneID:38740122"
     mRNA            complement(<827115..>829046)
                     /locus_tag="MRET_3356"
                     /product="phospholipase C"
                     /transcript_id="XM_027629983.1"
                     /db_xref="GeneID:38740122"
     CDS             complement(827115..829046)
                     /locus_tag="MRET_3356"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027485279.1"
                     /db_xref="GeneID:38740122"
                     /translation="MRGVSALLLAAAAVVPAFAANQTNDGLKNVKHIVLFMQENRAFD
                     HYFGTMAGVRGFKDPNVHISKNTGKSVFHQPVNESMIKVADGPDTDYKPPKNVSELMP
                     FHLPYQGGDYKERVQCILCGSNSWQANHAAWNEGEIDRWAMNNTPYSLGYFQREDIPV
                     HFALAENFVVADAYYEGQIASTDPNRVTWFSTTINADGSAAGGNVSMGGTVLDNNRDP
                     KCIEGKNGDEYSCRPLYWKTVPEYMSDAKIDWKLYQDFDNFGDNTLVEWRQFQLAAKN
                     KTDLAKRGLSFSGIKSFLEDAKNGTLPEVSYIVGPQYLSEHAPYTPNDGAWLQREVAN
                     AVMNGKAWNSTVLMISYDETGGWADHVMSPHAKRGTPGEWIKDPFTADGKLAPTGPGF
                     RLPFYIISPFTRKGGVFTEPTSHESQTLFLEEWAKANGKPFHVSVMNKWRREQLSNLV
                     NALDFNSTDTSVPKIPEVAEPTKDPITDEYNGAWNCILKFKGDVQPKIPYGNQTEEKT
                     LFQEPGFKAVRGNLTEGRYLSFASGKQRLSIQSGKLGTEPHKGHFTEKQLFVLHWQGQ
                     EPKDNEFKVAAGDKYLTSDLSLTKNKSHGASFAIFDNGNGKGHSAQELKSGKFLTLKG
                     DNVTLEKKPSSLKVFAVTL"
     gene            <829499..>831517
                     /locus_tag="MRET_3357"
                     /note="MRES_11530"
                     /db_xref="GeneID:38740123"
     mRNA            <829499..>831517
                     /locus_tag="MRET_3357"
                     /product="multidrug transporter"
                     /transcript_id="XM_027629984.1"
                     /db_xref="GeneID:38740123"
     CDS             829499..831517
                     /locus_tag="MRET_3357"
                     /codon_start=1
                     /product="multidrug transporter"
                     /protein_id="XP_027485280.1"
                     /db_xref="GeneID:38740123"
                     /translation="MVEPTNHAGPQGPKRQPEVSEKDLKHQADMQGSKSQPEVSEKDP
                     DDGADTQGSKGQPEVSEKDSADGASKETPERPVTPNVLFYEDNGGQVHIVAEGDEAVA
                     EHDKSDEKRPDPRPKRPDGKVELTRDLAPECTAYEYPGWKKWYILCVVFLVQVSMNFN
                     TSVYPNATGMIPDDSRFEGVGDQGARASQMIFLVAYAFGSELWAPWSEEIGRWPIMQL
                     SLFLVNITQLWGVYANNYNTLLAARFFGGLFTAGGSVTLGMVADLYDAEDHQFAIAFI
                     VLSSVIGTSCGPIVGGFVQNANGESFNGVRWVFWLMLIFGGFTQLVHGLTVPETLCST
                     MLDREARRRRAAAKALVNGTDPKKELGLWDRLWYKPPMCKPRKRDVVLYGPHELTKDR
                     FHPKQIGKLWIRPFHMIATEPIVLFLSLLSGFSDALIFTFSMSFDYVYKDGWDFKPWA
                     VGLAFVPINLGYFFGFFSFFPTIIQQRKVRRMDPEALLPEVRLWWLLWVAPLEPIGLF
                     GFAWTSMGSAHGVHWIGTMIFSVMIAIANYAIYMATIDYMVEAYGEYSASATGGNALA
                     RDLLAGISAMYAVPMYKNISPSSYSYEWASTFLGFVSILVIAPIYLFYWKGPQIRERS
                     PFAQEILKQVRESRLRRKYPEAHPDDVREAIEKAENDEHAEQLVQEIA"
     gene            <833063..>833740
                     /locus_tag="MRET_3358"
                     /db_xref="GeneID:38740124"
     mRNA            <833063..>833740
                     /locus_tag="MRET_3358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629985.1"
                     /db_xref="GeneID:38740124"
     CDS             833063..833740
                     /locus_tag="MRET_3358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485281.1"
                     /db_xref="GeneID:38740124"
                     /translation="MKTSTIAILLAAAALNTANALKCHKNATGVLATWEDTEILDSHV
                     GFGWTQYYHMKDGKLAKSNLPGEEYDFYECEAPEKFGKGGGVVKTKDGKKCLTNSFIR
                     ERDMSPDGSLENRDKQVPENVEKKVTLEDCAEGGMELRKQWFELGLGDQERKGCSVPL
                     SKVGYEHDEIMDLSYGPDGVAFDTEGGLGYDKSDKVSYFHRSRSYLMTGNLDATCVYK
                     NPVEPGK"
     gene            <834409..>835017
                     /locus_tag="MRET_3359"
                     /note="MRES_11540"
                     /db_xref="GeneID:38740125"
     mRNA            <834409..>835017
                     /locus_tag="MRET_3359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629986.1"
                     /db_xref="GeneID:38740125"
     CDS             834409..835017
                     /locus_tag="MRET_3359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485282.1"
                     /db_xref="GeneID:38740125"
                     /translation="MKIAAATILSALAFSSLVSAVPAKRDGLKCQAKYAPGPLAARAH
                     FGSATERQYFAFRGVEGREGEVLATSDKPGQVVQFYECEKPAENYYPGKDDDDKSFGQ
                     LRLKEDPSLCVTVGADEALRLEKCEEGATKKMEGQWMAATNVGEGCASIVWHAPLQGQ
                     KLQGQVLFDHDVIQLDEVRRSNIKGAVAFKMDNGAFGGRCVG"
CONTIG      join(CP030255.1:1..836807)
//
DBGET integrated database retrieval system