GenomeNet

Database: RefSeq
Entry: NC_040198
LinkDB: NC_040198
Original site: NC_040198 
LOCUS       NC_040198             677500 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome VI, complete sequence.
ACCESSION   NC_040198
VERSION     NC_040198.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 677500)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 677500)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 677500)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030256.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..677500
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="VI"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            complement(<355..>864)
                     /locus_tag="MRET_3360"
                     /db_xref="GeneID:38740126"
     mRNA            complement(<355..>864)
                     /locus_tag="MRET_3360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629987.1"
                     /db_xref="GeneID:38740126"
     CDS             complement(355..864)
                     /locus_tag="MRET_3360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486127.1"
                     /db_xref="GeneID:38740126"
                     /translation="MNLNSLILTTLALAIQANAYSKRVDVYGSCEGDKYSIKMHYHRP
                     PTMTSQDQEVLNKCNNDSPGLHGWECELSCGKGPELCEEIYEMVEKKGPAINHCKKAG
                     EAGSAKTKEESGTKTKTVVSTQSGSTAGSDDRDEMNTKEDGDSAASVKAGVMTALFGT
                     AAMFGLLII"
     gene            <4532..>4867
                     /locus_tag="MRET_3361"
                     /db_xref="GeneID:38740127"
     mRNA            <4532..>4867
                     /locus_tag="MRET_3361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629988.1"
                     /db_xref="GeneID:38740127"
     CDS             4532..4867
                     /locus_tag="MRET_3361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486126.1"
                     /db_xref="GeneID:38740127"
                     /translation="MKFIAILLAAIGAAAARPVACPSGSSKGASCAVGEPEINSKPTF
                     TTVACPPGSPKDAVCAVDIPEYRTLPEGKDKRTMSTVYVTSTTGTVTIHKPSTTEDVT
                     KTVVVTQTA"
     gene            complement(<4886..>5851)
                     /locus_tag="MRET_3362"
                     /db_xref="GeneID:38740128"
     mRNA            complement(<4886..>5851)
                     /locus_tag="MRET_3362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629989.1"
                     /db_xref="GeneID:38740128"
     CDS             complement(4886..5851)
                     /locus_tag="MRET_3362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486129.1"
                     /db_xref="GeneID:38740128"
                     /translation="MGESNTPLVDGLFPICTKDVFDAYHDPSVHIFLSIVFGIFGLVF
                     LYYAIARRPRFEYFLLFAVCALQVGAFILRIYSDITDAFIALMVYSAAIAVAVGVMYS
                     MLVRWTWIADRYYGKRVFDRGYGNNVVIGVVSVVLAGLLVAGIWVASTIWVVYLALIL
                     VMWLTSNVYLGIHRRMKPSMEERAIVMSTMESRLGYAPLVTSHKQLDNMLVFMIVLLT
                     VELVKTIFLTVCFVLIPLFFITPLYYIFSIIPDLAYVVLLANSETMPLFEHGRHVPEV
                     RAEVFSQTQHSQPLDSAMVQSYPTGSVPQSHFRTSEPMSVTVIPQ"
     gene            complement(<5933..>7354)
                     /locus_tag="MRET_3363"
                     /note="MRES_13575"
                     /db_xref="GeneID:38740129"
     mRNA            complement(join(<5933..5955,5985..6007,6041..7276,
                     7311..>7354))
                     /locus_tag="MRET_3363"
                     /product="sporulation protein RMD1"
                     /transcript_id="XM_027629990.1"
                     /db_xref="GeneID:38740129"
     CDS             complement(join(5933..5955,5985..6007,6041..7276,
                     7311..7354))
                     /locus_tag="MRET_3363"
                     /codon_start=1
                     /product="sporulation protein RMD1"
                     /protein_id="XP_027486128.1"
                     /db_xref="GeneID:38740129"
                     /translation="MTLDPTFAGKAGPQRTTKGSLKHKILPEEPERNPEAAVPEMEDT
                     PAVLYWDDDGDINNEDMSHLHHIPEGNMRRDALRLTRKARSRLPRVTAYSTATSYKLP
                     ELIRWLQTRKASHETNVIRFDECVYTTYTYQHVDEARGLPSTSPWVLERGRPPFRLDH
                     SRTPTGDLLGVPELHQDSPALDHGLQTITEEGEGGSERPKQETTPPAQSLVRKPVHYV
                     PEVFFMEYGTVVIWGMSLTEEKRMLRELRKFEVERLAAEDVECEDLSWYLADYSRIYN
                     DVITLRRGSSYMTKLSLSHALAQSTKISFFESVIEATIDTTKDIPRSIAESGKVGMPP
                     IDIMKNIGHLFILRMNIHLVGSVVDSPEIFWSQPDLEPLYAAARSYLEIQPRIDLLNI
                     RVEVLQDMLQLLKDQATSSHSEWLEIIVIILIVLEIILGVATMLVDLYA"
     gene            complement(<7449..>8396)
                     /locus_tag="MRET_3364"
                     /db_xref="GeneID:38740130"
     mRNA            complement(join(<7449..8334,8374..>8396))
                     /locus_tag="MRET_3364"
                     /product="GTP-binding protein"
                     /transcript_id="XM_027629991.1"
                     /db_xref="GeneID:38740130"
     CDS             complement(join(7449..8334,8374..8396))
                     /locus_tag="MRET_3364"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_027486131.1"
                     /db_xref="GeneID:38740130"
                     /translation="MFGSEQSRNGSLWCASNMMGHGDKSDEPIRGCPNALSMLTKNEE
                     TRIEYLSSLEPEEDGTGNVEYKFQILPSSADRFDRLVTQLNWRLTEGDGLCMYEVGVL
                     DDGTLAGIPREDMRKSLANLCAMAQVLDAKPEICRLMMIRTGEDDGPTVHILSDDDEA
                     RVHLGIEAGLPDAEVVGVQIPRDTPLIRLAPPLHRDVFRLRPYQQGENDDGRFMSDPT
                     TVTSPNIPTDARIEQRRSKVNQRRVLRLERFEAAIERGAGKEISVQSLSNCRGGMPSR
                     EVAECLYMAEVVIRLQNDFYIDYTSL"
     gene            <8487..>9755
                     /locus_tag="MRET_3365"
                     /db_xref="GeneID:38740131"
     mRNA            join(<8487..9580,9611..>9755)
                     /locus_tag="MRET_3365"
                     /product="alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_027629992.1"
                     /db_xref="GeneID:38740131"
     CDS             join(8487..9580,9611..9755)
                     /locus_tag="MRET_3365"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_027486130.1"
                     /db_xref="GeneID:38740131"
                     /translation="MTHKRARYSATLLHHLHALFIAHTGYVPLTFLVCTIDCLLTASI
                     IRFVPYTEIDFQTYLQQAQLFLDGERTYTYIDPPNGTGPCVYPAGHLYAYAILDHLTD
                     HGAYLLPAQVTFGILYISTLFLVSQLYRLAKAPPILILFLAFSKRLHSIYLLRLFNDP
                     LSIFFMYLCMYLLCCRRWKAACISYSLALSIKMNALLYLPGLLVILFRAIGATSTMLH
                     VGVIVGGTQGILGLPFILRDPQAYVSNAFDFSRMFLFKWTVNWRFLGEKIFSHPATSK
                     VLLGLHVFILCVFGVHQWTNISKEGWKWVSSRWKGDSHPMTASFIVRVLCTSNLIGMT
                     FARSLHYQFYSWYAFQLPLLTWSTTWSLPLRIAIPVIIEWSWNVFPSTTLSSISLFLA
                     HTMLLIGLWTRRARTPMHIN"
     gene            complement(<9760..>11001)
                     /locus_tag="MRET_3366"
                     /db_xref="GeneID:38740132"
     mRNA            complement(<9760..>11001)
                     /locus_tag="MRET_3366"
                     /product="DUF218 domain protein"
                     /transcript_id="XM_027629993.1"
                     /db_xref="GeneID:38740132"
     CDS             complement(9760..11001)
                     /locus_tag="MRET_3366"
                     /codon_start=1
                     /product="DUF218 domain protein"
                     /protein_id="XP_027486133.1"
                     /db_xref="GeneID:38740132"
                     /translation="MSLPQHWSDIQRHVLDRGVWTRMHARMSARSRVTNLGVALLTCA
                     LIISLLFNTRSRKVYVPVVSNVQSADEHPAFNIHLRDSVPAYPGAQESPLTHLVIVAG
                     HAIWKGDDPALIMNDTSWLLEDYQRGGSVKTFVKHIEEGLKIAVEDKSSLLVFSGGQT
                     RRQSWKTEAESYYHLALTMSKGLPFFSDSQEDPSQSRLPFEPLDKSETARASRYMSTN
                     EHFDLGRLRMTTEDYALDSFQNFLFSIARFYEFTGTYPQKITVVSYEFKKRRFVDLHA
                     HALRWPSNKLIPGGTQRLNYVGIDDEPNSPSIPKLHDSAYDLFEVDMYGCYGRLLEKR
                     RKRNSGRRLPPYSSTAPELAGLVDWCPAINSRLRGLYPGWLPWDPRASTGLGRGAQVI
                     LEQNGGKFVKAEYLPDGKKIV"
     gene            <11210..>12113
                     /locus_tag="MRET_3367"
                     /note="MRES_13580"
                     /db_xref="GeneID:38740133"
     mRNA            join(<11210..11212,11251..11533,11569..>12113)
                     /locus_tag="MRET_3367"
                     /product="transmembrane protein 33"
                     /transcript_id="XM_027629994.1"
                     /db_xref="GeneID:38740133"
     CDS             join(11210..11212,11251..11533,11569..12113)
                     /locus_tag="MRET_3367"
                     /codon_start=1
                     /product="transmembrane protein 33"
                     /protein_id="XP_027486132.1"
                     /db_xref="GeneID:38740133"
                     /translation="MLKASAPHLVWAAGHFLTFFAGMRYWLAVAAFSWTGYDLWYRLA
                     YLGAIVSYGVVIYKSFGVPRTEKSYLQRALMDENVQYLVIAMYWCWIKPISLTLIPYI
                     TFSLFHLLTFTRTTILPSMVPAARNADGTSSPAGGDLSKSIQTWVKQNYDLAMRFVSY
                     SEVIIFIRVLFGAILFRNSLLAPLLYAHFLRLRFYMSSFTRAAMQHVRAELDKMTQHP
                     SCPPALRKGYLMLTDLVTRYACTVLSISRNQPEPANTANRTAAASASSPADPTKLKTR
                     "
     gene            complement(<12200..>13619)
                     /locus_tag="MRET_3368"
                     /db_xref="GeneID:38740134"
     mRNA            complement(join(<12200..13527,13553..>13619))
                     /locus_tag="MRET_3368"
                     /product="RAD51-like protein"
                     /transcript_id="XM_027629995.1"
                     /db_xref="GeneID:38740134"
     CDS             complement(join(12200..13527,13553..13619))
                     /locus_tag="MRET_3368"
                     /codon_start=1
                     /product="RAD51-like protein"
                     /protein_id="XP_027486124.1"
                     /db_xref="GeneID:38740134"
                     /translation="MHPLVITDISELSARDKALCRRAGYDGVERILSDSVASLAKNLN
                     ATETHARHIRMTVERAVAPVQCSIWNLLDGFEDSVVLGTPGEDEESKDVSFGMQSVRE
                     NQPGVVSSGVLTLDACLNGGFARGMVSEVVGESSVGKTQLCLYVAVCTALGLHTTMHR
                     PAAHSVISGGSGRTVALIATKGRSAAQHMVNRMAEMAREILGEWYEKQGTYPADYIHN
                     RVEDGVRLVLENVYLACAFTFDTAEHLLRYTLPGLITRKRHTSNPVELVVVDSIPPLL
                     QEDFHETALPETSASFHSVRAFRLHELASLLKRLAVGTIAVIVTNHVNDAFAQDAALV
                     QRALADDEIPWSKADLEIPYRKWQQTISFPLNYTLQAAHFSGLLAYVPRKENCDITMT
                     TFLAERDSKVAQLGLVWTNCINARFLLTHDRNKSRNDHGIRRFRVVFSPLCTESNGEV
                     YIRITRQGIQASFK"
     gene            complement(<13730..>19279)
                     /locus_tag="MRET_3369"
                     /note="MRES_13585"
                     /db_xref="GeneID:38740135"
     mRNA            complement(join(<13730..18829,18871..19140,19193..>19279))
                     /locus_tag="MRET_3369"
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /transcript_id="XM_027629996.1"
                     /db_xref="GeneID:38740135"
     CDS             complement(join(13730..18829,18871..19140,19193..19279))
                     /locus_tag="MRET_3369"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /protein_id="XP_027486123.1"
                     /db_xref="GeneID:38740135"
                     /translation="MIGHQFAPSVAPVRPVKEVQFGILSPEEIRAFSVCKVEFPEVKD
                     DATGKYRVGGLSDPRLGTIDRNYKCQTCGEGMAECPGHFGHIDLARPVFHVGFLGKVK
                     KLLECVCVHCGKLKADPISDPVFKSLLQSTRVNRKRRFQRVWEYCSKISICEADEGKD
                     EDEFGEVTQPKIGHGGCGRQQPAIRKEALKLFTAWRQSKDEDGDEIGRIAQTEKRPLP
                     ASEVHTILKKVSPEDVVTLGLSEDFAQPDWMVLTVLPVPPPQVRPGVTEFGSGLGQDD
                     LTYKLADIIKASANLRRMEQEGAPAHILNDFADLLQYHSATYMDNDIAGLPQSLQSSG
                     RPVKALRARLKGKEGRLRGNLMGKRVDFSARTVITGDPNIELDQVGVPKSIARNLTYP
                     ERVTPYNRAYLSELVRNGPNEYPGARYVIRDTGERIDLKYNRRGDIALQAGWIVERHL
                     KDGDYVLFNRQPSLHKMSMMAHRVKLMDYSTFRLNLSVTPPYNADFDGDEMNLHVPQS
                     EEARAELAQIAWVPRQIVSPQANKPVMGIVQDTLCGIRKFTVRDCLMDYDQVQNILMW
                     LPDWDGIVPQPCILKPKPFWSGKQLLSLCIPKGINVFLGDAKAANNNFLKDDGVHIEN
                     GEIMYGVINKKVVGSSAGGLIHIIFRERGPVVCRDFFGGVQRVVNYWLLHNGFSIGIG
                     DTVADKATTANINETIARAKAGVMDLIQAARHDWLKADPGMTLRESFEANVNRILNKA
                     RDDVGSHAEQNLPDWNNVKQMVIAGSKGSFINISQMSACVGQQSVEGKRIPFGFRHRS
                     LPHFTKDDFTPESRGFVENSYLRGLTAHEFFFHAMAGREGLIDTAVKTAETGYIQRRL
                     VKALEDVTICYDGTVRNSTNNVIEFAYGEDGIDGAMVERQKLITHGLNDKEFRRRFKV
                     DLSHGGFKKGTLRAGLGDWSPELEQLLEEEFEQLAKDRKTLRTEIFPTDRVDTYLPLN
                     IARLVLNAQQIFHIDPRRSSDLSPFEIVDGLKRVLANLLVVRGDDRISRTMQENATLL
                     FKIHLRSFLCTKQVIEVHHLTREAWEWILGEIEGQFARSVAQPGEMCGTLAAQSIGEP
                     ATQMTLNTFHYAGVSSKNVTLGVPRLKEIINCAENIKTPSVTVYLHPKYSASSESAKI
                     IQTALAYTTLQTVTSAVEVFYDPDPSSTVIPEDRDFVDAFFAIPDEEVEASLERQSPW
                     LLRLVLDRAQMLDKNLTMAEVASKIGAMFGKDIFVTHSEDNAEELVLRIRIVDNDPDK
                     EVQGEEDVFLKSLAQQMLTDIALKGVPGISKVFIVKQDKSTRRFDPETGEWDTLKEYV
                     LETDGTNLKDVLAVDGVDVSRTLSNNCVEVFRVFGIEAARGSLLKEIRNVIEFDGSYV
                     NYRHLALLVDIMTSQGTLMAITRHGINRTNQGALMRCTFEETVEILMEAASMGDMDDC
                     KGVGQNVLLGQMAPMGTGSFELNLDVDMLKDVVVNRDQSYANLWASRLGMDNDDMGSR
                     TPGGMTPYDAGSPNIDDGFSVQQQASFSPLVQVGGDEGSYGDYLSMGQSPMRTPLGAQ
                     SPGYGLAPTSPGYVPTSPAYNATSPALGAMSPWVGAAGATSPAYSPTSPQIFAGATSP
                     AYSPASPSYSPSSPMIGAGNVRSTYTSRMSPASPNYSPTSPVYSPTSPAYSPTSPQYS
                     PTSPAGTRGRRSGASGPKYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTS
                     PQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQ
                     YSPSSPQYSPTGSGAAGAASPRRSRMTSKPTWQR"
     gene            <19712..>21308
                     /locus_tag="MRET_3370"
                     /db_xref="GeneID:38740136"
     mRNA            join(<19712..19915,19956..>21308)
                     /locus_tag="MRET_3370"
                     /product="ubiquitin binding protein"
                     /transcript_id="XM_027629997.1"
                     /db_xref="GeneID:38740136"
     CDS             join(19712..19915,19956..21308)
                     /locus_tag="MRET_3370"
                     /codon_start=1
                     /product="ubiquitin binding protein"
                     /protein_id="XP_027486165.1"
                     /db_xref="GeneID:38740136"
                     /translation="MVLSKSEFRELVQNATSPLIPSSHEDISAFCEISDAIRAKCVAP
                     QFAIQELKQRLTHTNPNVQIVALSLTDYCIKNGGIHFIREIAKPDFMESIISVLKERS
                     NLEISVKAKMLQYLQDWRHIAKSNKKELGFIIEAVEGLERDGFELPPPNPITAESGKA
                     FTEAPVAPEWSDNMVCTKCRSEFGTFLRKHHCRNCGRIFCYKCSTKTMPLPWYSVNDP
                     VRVCDGCFQRKCPVLKPSESDTDQVSPSKPSRAEDDELANVMALSLKEYNERQSASVT
                     VNNTSTQSRAPETTDAEDDPELAAAIAASLYELDKRKPKEIMQPEVPASKKIPNTPNA
                     LCGKSPAERALEVDVNDLDNILTFYDTVVLSNASWISKVPRSGIPQPVQNIQDKAAAS
                     RFNVAKKSDYGHRRLRELTNLHEKLSEVVKMYDTLLDKQFEGGVSSHIATRQPDLAPM
                     PTVHDFPSAPSDPFSEPFCASAPVIPESKYISSDPIMTSFELQKKDPGVTSNPAHDLT
                     PAPEPLLIDL"
     gene            complement(<21380..>24337)
                     /locus_tag="MRET_3371"
                     /db_xref="GeneID:38740137"
     mRNA            complement(<21380..>24337)
                     /locus_tag="MRET_3371"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629998.1"
                     /db_xref="GeneID:38740137"
     CDS             complement(21380..24337)
                     /locus_tag="MRET_3371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486166.1"
                     /db_xref="GeneID:38740137"
                     /translation="MWHVFGSSKPKEIFQNSRESGIPRLYTERHISTADYRYWVQFTT
                     LFSSAEDVFSSLKVQDVRKVVEDAPENIVTLVDVLTLHLESLVNDPSFSPLPPSSSGG
                     WNALFTTSATVPKAPDSRDRHQEALNCFRVLSRIIPIIYEAGSLDKCDTDITDLEHSA
                     LWSSKTRAMRMRANKNAQKSLVPADPKGIDDTSSTEGQFILTDGDDSLWDPLSDPVLD
                     ATESIPSTGHALIMTLMELLFHSGFTMPWTEEQFMESNNSDISRVHFTIWEAGIGSPV
                     DLENTTHEHILRRTEIMRLLLILLSKPMYVTKETLCMSSMQALEFMTCELERPVVLSF
                     LCSLLNTVANYRQAERWKILGADAVRDTYTSLCLEMLCVLLSYQPASKNSNLFLFYAR
                     KLYRESDFLFLMNGTGKIFRESMAVTSGAFEMNNGRSTFVKAPEEHVSEMLVVIWTLI
                     RTNSKLCETVTQSPRIAFDMLSWLLYVALSNKCSPATLGQAQLAIFMLQDLSSYKDFA
                     KFLSKPNSIESISIPVHLLRQQGTLALDVLIEGTYLLITGSSGHLTPLYSSILLILYN
                     TSPFWQGISAASASRLEQLLHQLASPKFLLSDPSHPYLLGLFLETLSRVVQYNYSSNV
                     HLVYILVRSAHIIERTHSFKLNSALSMIYFAREHAKNHVKLKDLPPTPSEETYHMNTK
                     SDHENTLSCQTEEGRVEHNGYSKETAESVNGSDKRNVESTENNLGKEEIASQGKNIGK
                     DRAANPENSDKVAKEVAQGEEKDQDMSKTDVPATEVPEQTAFMETETTETPALSSLLS
                     SGPLSKAELDHVALTIGKNGFVPTQEWIDTWLPTINFDVLDPLLEYLVPRVNEFCAAD
                     PSVSSGSFAHEQVLAFFLREQSPLHVIPPAPAPQICTFEWTKQSDVWLQSYIWGLIYA
                     VGVTPLAIWLHTRTHLFEVQVEQPAETAAGRAIQSFSTLTSSVLSQMSFFAKKPASVN
                     VEPLGADPQTQSL"
     gene            <24485..>24937
                     /locus_tag="MRET_3372"
                     /db_xref="GeneID:38740138"
     mRNA            join(<24485..24612,24648..24800,24832..24871,
                     24899..>24937)
                     /locus_tag="MRET_3372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629999.1"
                     /db_xref="GeneID:38740138"
     CDS             join(24485..24612,24648..24800,24832..24871,24899..24937)
                     /locus_tag="MRET_3372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486163.1"
                     /db_xref="GeneID:38740138"
                     /translation="MLERRVDKSNPKNAGVVKPFTTPNVWKEGSKVASYDAFLSTLTM
                     MASMAVISTVPDAAAISLICSSALLINAKPFAPMKEGGRDMNSNAYASFCFALFMNAF
                     LIARKLIVMPTQANSSQ"
     gene            <25123..>25644
                     /locus_tag="MRET_3373"
                     /note="MRES_13590"
                     /db_xref="GeneID:38740139"
     mRNA            join(<25123..25177,25211..>25644)
                     /locus_tag="MRET_3373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630000.1"
                     /db_xref="GeneID:38740139"
     CDS             join(25123..25177,25211..25644)
                     /locus_tag="MRET_3373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486164.1"
                     /db_xref="GeneID:38740139"
                     /translation="MAAITDNQSYLLAHRSLQGTQIAAVAATPFYLIQSIRTRRFSLR
                     GLARYNWLIPLLGAGIGAGAGWTESIQISAPLLSYRTAAIRADNERVRRDDFHLIGSV
                     VGALALPALFLRHVGLFNGLLGGAGLGGAVGILSYFGKQYSEDKLKELPIPGTEQKLP
                     LP"
     gene            complement(<25765..>28628)
                     /locus_tag="MRET_3374"
                     /note="MRES_13595"
                     /db_xref="GeneID:38740140"
     mRNA            complement(join(<25765..28497,28538..28561,28602..>28628))
                     /locus_tag="MRET_3374"
                     /product="protein of unknown function (DUF2424)"
                     /transcript_id="XM_027630001.1"
                     /db_xref="GeneID:38740140"
     CDS             complement(join(25765..28497,28538..28561,28602..28628))
                     /locus_tag="MRET_3374"
                     /codon_start=1
                     /product="protein of unknown function (DUF2424)"
                     /protein_id="XP_027486169.1"
                     /db_xref="GeneID:38740140"
                     /translation="MKTWGEVTSCIDEWLMLSLNESDTILAEFDKKYSMTEYVLEFDA
                     FSILRICVEKETGTRRAAKIIMRSSLHPEAQFTESKRKKGASIHDEITIMMRLDHPNI
                     NHLRDYYETDNAIILLMDFYLGGELLDDTLRNATYKECEIQCIVTQLLSGVQFLHSNG
                     IVHTNLRPDNIFVYDQKDAHKRVTISGFYLAQILPEEECLILVSTSPQYFAPEILMGQ
                     GYDESVDVWSCGVIAYTLLCGYTPFHGDSVQATLQNTVNVEYEFRKPDWILQSPFAMD
                     FIRQCLCPKHTRMTVHEALQHPWITQVLGSTEGEVPELTRIPKQSSSPQSKTELLKSQ
                     IQGLVALQSLRNQNQAGTNRGIPMLDNVIEQLQARVKKLDHSLSKEDTCSETRCANAP
                     TDKKACEKDENISKQSSYTGHFIRESTAESQQVSHSSDTIQVLNKLLEQYRTGKLPAY
                     SRVDPKAELQPKEDLTFKKAIRSVPAILNRGYSFGSALLSHLVYGPPKKSWGVEMSIL
                     TRMIREFAEENTDLASIQGLQQFVELVRFLPIPEDGLITPVTFRVKRRNLRGFLTEYD
                     EQETGKRELTGEWIVGKQTWRRLQSEWQSGNRSRSERVILYVHGGAYYIMSATTHRPL
                     TVAISKYCECRVFCVNYRLAPETIFPGALQDVVYSYLRLTDDLHIPANNIVLAADSAG
                     AGLGVALMMYLRDNDYPLPSGAMLMSPWVDLTLSCDSWETNKEFDYLPRPWRGNHMNP
                     INAYLGPNMDKYLMHPYVSPLFGEMKGLPPMLVQSGDAERLRDEGVLFCHKCALAGVP
                     VRHEIYEDCVHVFQFFLFLDASRKAFQSMRHFMRKVLDHRKKRKAFVVTEDVREQLDQ
                     EMSGTGSEEPVEPGSPSSHQRPAEEDRAGGIWQQTLEGLGPEGDEDMETWELDNDEEE
                     EEAQAQHNKSVSQ"
     gene            complement(<28859..>29500)
                     /locus_tag="MRET_3375"
                     /db_xref="GeneID:38740141"
     mRNA            complement(join(<28859..29036,29069..29196,29225..>29500))
                     /locus_tag="MRET_3375"
                     /product="iron-sulfur cluster assembly protein ISA2"
                     /transcript_id="XM_027630002.1"
                     /db_xref="GeneID:38740141"
     CDS             complement(join(28859..29036,29069..29196,29225..29500))
                     /locus_tag="MRET_3375"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly protein ISA2"
                     /protein_id="XP_027486170.1"
                     /db_xref="GeneID:38740141"
                     /translation="MFRAILYRLPRKQVICRYSSACTTFSARPNSLVGVGIATRALMH
                     GPHPSNKISPACSFRGFMSIARKPKNPEDPNALKGDMLGVSLTERAIEKLRTLSEHER
                     DPKLGLRVIVEPGGCHGYVYKLELSSEYEEDDFVFVESNARVIVDSVTLALIKGSTID
                     YVTELIGSQFAIVENPQAKGSGCGCGVSWEPIL"
     gene            <29731..>30391
                     /locus_tag="MRET_3376"
                     /note="MRES_13600"
                     /db_xref="GeneID:38740142"
     mRNA            join(<29731..29763,29815..29961,30008..>30391)
                     /locus_tag="MRET_3376"
                     /product="nascent polypeptide-associated complex subunit
                     alpha"
                     /transcript_id="XM_027630003.1"
                     /db_xref="GeneID:38740142"
     CDS             join(29731..29763,29815..29961,30008..30391)
                     /locus_tag="MRET_3376"
                     /codon_start=1
                     /product="nascent polypeptide-associated complex subunit
                     alpha"
                     /protein_id="XP_027486167.1"
                     /db_xref="GeneID:38740142"
                     /translation="MSASEVEAMKDLNLENQEVDANEPAAPQSRAERRSRKLMQGVGL
                     KKVEGIQRVTLRRPRGHLYVVAKPEVFKSAVSDCYVIFGEVKSEDMSAFAQAQAAQMA
                     QAQKSVSDDAGTASSAPSFNLNDLTSSKKVEDDEEEDENAPIDETGVDQKDIDLVMEQ
                     VSCSRRKAVKALKENDGDLINAIMSVS"
     gene            <30651..>31563
                     /locus_tag="MRET_3377"
                     /note="MRES_13605"
                     /db_xref="GeneID:38740143"
     mRNA            join(<30651..30672,30714..30737,30778..30784,
                     30825..>31563)
                     /locus_tag="MRET_3377"
                     /product="20S proteasome subunit alpha 4"
                     /transcript_id="XM_027630004.1"
                     /db_xref="GeneID:38740143"
     CDS             join(30651..30672,30714..30737,30778..30784,30825..31563)
                     /locus_tag="MRET_3377"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 4"
                     /protein_id="XP_027486168.1"
                     /db_xref="GeneID:38740143"
                     /translation="MSRSYDRALTVFSPDGHLFQVDYALEAVRKGTCAVGIRGKNVAV
                     LGVEKKSLQQLQDPRTVRKTVMLDEHICLTFAGLNADARILVDKARIECQSHRLTVED
                     PVTVDYITRHIAGIQQKYTQSGGMRPFGISTLLIGFNQNETEPRLFQTEPSGMFTAWK
                     ATAIGRSSKTVREFLEKNYKDDMSEEETTKLAIKSLLEVVQAGAKNIEIVVMTGHGHL
                     KALELPQIEEIVKQIEIEQEAEAERRRTRLAATASAEASMTGSSN"
     gene            complement(<31821..>33019)
                     /locus_tag="MRET_3378"
                     /db_xref="GeneID:38740144"
     mRNA            complement(join(<31821..32535,32565..>33019))
                     /locus_tag="MRET_3378"
                     /product="SNARE associated golgi protein"
                     /transcript_id="XM_027630005.1"
                     /db_xref="GeneID:38740144"
     CDS             complement(join(31821..32535,32565..33019))
                     /locus_tag="MRET_3378"
                     /codon_start=1
                     /product="SNARE associated golgi protein"
                     /protein_id="XP_027486161.1"
                     /db_xref="GeneID:38740144"
                     /translation="MSTLRGEAHQHLLPLRASQDESRTIIELQESSQNTENDDEIRFE
                     TPFLNSALAWQTMPLYNAADAPLPLNTAEKQALIFRTVVFLLGTLLGSVTLLFTILWA
                     SLPPIREEDQAFVHVPRSFQDLKVLCQFIANYNQEHYYRVMVVWLSVFLFIQTFSVPG
                     SMYLCILAGALWGVPVALPIVCISIATGASFCYMLSKHVGDCIRVMPRWQQRVDTWKA
                     TVQQYEGNLLSYLTILRMMPVPPHFVVNIIAPHLGVPLSTFWLSTLCGVFCTSLIYTA
                     IGKEIGQITSSDSFHIFTWQNMLLMTVVAMAFILPTLVKGRVQAPEQSPAHQGNIRLT
                     EDARGRTWRDRMDQLYQSLLALIHPALHARPVSVPRDSSLGASLDSDETEESIGA"
     gene            <33331..>35101
                     /locus_tag="MRET_3379"
                     /db_xref="GeneID:38740145"
     mRNA            join(<33331..33466,33499..33825,33856..35046,
                     35073..>35101)
                     /locus_tag="MRET_3379"
                     /product="pumilio-family RNA binding repeat protein"
                     /transcript_id="XM_027630006.1"
                     /db_xref="GeneID:38740145"
     CDS             join(33331..33466,33499..33825,33856..35046,35073..35101)
                     /locus_tag="MRET_3379"
                     /codon_start=1
                     /product="pumilio-family RNA binding repeat protein"
                     /protein_id="XP_027486162.1"
                     /db_xref="GeneID:38740145"
                     /translation="MACLSFCTRADLITMSETSSMCTSMQSMDDLIPCASTPQPQTRT
                     EVALFEQLQQVEEHLCGIEQRMQERLRILELRVMQMERQSWKRSFGTASHTLPITPSS
                     DPSLSSRSSSTGPLSTPKTQRGFDDGTFRSSSPDAFNPYWISPIMEEDSYVPGLHAFP
                     QALFYSRPDPFYACKKFGSKFETSYIRKLDLDMDVHCSTADAQCPSHQYHETPTSPEA
                     SLESPHHDLRDILVHHSQDASVRLQLQLKRGSTERREIILDAMKPLMVPLATDQYGQY
                     LVQRALSIQKEMTQYLCGAIVPLTLSPCGVHVIMRVLDGPEIWQSAVTKELLRDSLKT
                     TLTTQHSMCVWQKIFNVRWSNPEMRSEIRERIHDTLRGQWADIANTETGSVLFQHLLA
                     NMMLSETDDAIEEVFQRFHECICHPWGVWVIQHLIEYGSPAIRECIAQRLISSAATVS
                     LSSYGSKAVQCAQRHCGEVFQNKYADVLCRVTASHHETVRPKGPSRPLIIEVAAAQHG
                     LPILTQLLTSTTPARRTLIIDLVRMNAVFLKSNRSGARAFQLCERARAYAGY"
     gene            complement(<35098..>36000)
                     /locus_tag="MRET_3380"
                     /db_xref="GeneID:38740146"
     mRNA            complement(<35098..>36000)
                     /locus_tag="MRET_3380"
                     /product="exosome complex component RRP43"
                     /transcript_id="XM_027630007.1"
                     /db_xref="GeneID:38740146"
     CDS             complement(35098..36000)
                     /locus_tag="MRET_3380"
                     /codon_start=1
                     /product="exosome complex component RRP43"
                     /protein_id="XP_027486116.1"
                     /db_xref="GeneID:38740146"
                     /translation="MSAMQEKHEGLVEAHTAAPLTIFKKIYPTDYFRRHLEERIREDG
                     RSLDQFRSASLATGILSQPYGSALVRFGEGTLVTAAVHAEVTEPTLERPNEGFVIPNV
                     ELPALCSPQYKAGPPGDEAQIMTHYLQMFLNQSGILPCTSLCIETGSAVWVLHVDVVC
                     ISADGSVMDAAALAAVAALYDCRLPRVSRHMNSSQVICDTDATERLSLTCIPILTTIS
                     LYDWTYLLADATEFEQSLCAGSIQMGTLDDKPNGIFWTKVRGRCTAMQPHVLENESLI
                     EWCERTTQNRAQQLRSLLLDALRA"
     gene            <36115..>37827
                     /locus_tag="MRET_3381"
                     /db_xref="GeneID:38740147"
     mRNA            <36115..>37827
                     /locus_tag="MRET_3381"
                     /product="phosphomevalonate kinase"
                     /transcript_id="XM_027630008.1"
                     /db_xref="GeneID:38740147"
     CDS             36115..37827
                     /locus_tag="MRET_3381"
                     /codon_start=1
                     /product="phosphomevalonate kinase"
                     /protein_id="XP_027486115.1"
                     /db_xref="GeneID:38740147"
                     /translation="MVWDPAPTIVSAPGKVLIAGGYLVLDPAYPGIVLVTNARFYACV
                     SKRTESTIRVRSPQFQHAEWLYAYHLPKEDVKDAIQAANALRLIQCGDPNPFVALALL
                     YALHISFEYLGPTKARETLSCGLDIMIIGDNDFYSRRVNGQVPTIEELRALEPFTSHP
                     CTLGDVHKTGLGSSAAMTTSLVGALLLHLGVAQVESGQLTSTSLGLIHNVAQLAHCAA
                     QGKVGSGFDVSASVWGHQLYRRFDPDLIKSLIRHEIGSRIVTDQKTAVNDVTPEPLAL
                     LPTLDATNPLWVPAPPPSAASTAVEGLFSLHTSNSPQYKARPAPLSLPPGIQMCLADV
                     DTGSNTRTLVGKVSDWRAQHPDWAAQLYKIIASSNQSLADGLLQLHMAYANDQTAYTQ
                     VLETLSQRPSLDWDHYYKSHPSSTCALFLEVRNAMRSIRAGMRELGSRSGAPVEPPEM
                     TRLLDTTINTAPGIMGGGVPGAGGYDALFLLFLSPSSLHTHIPAPAPQSVCDIWQTYS
                     ELSVGPLLCSADCSDVPCRTNKSDGSNHVTQIAQAWAQASPAMRVVQDASTVPGLERW
                     LNSA"
     gene            <37892..>40201
                     /locus_tag="MRET_3382"
                     /note="MRES_13610"
                     /db_xref="GeneID:38740148"
     mRNA            <37892..>40201
                     /locus_tag="MRET_3382"
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /transcript_id="XM_027630009.1"
                     /db_xref="GeneID:38740148"
     CDS             37892..40201
                     /locus_tag="MRET_3382"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /protein_id="XP_027486114.1"
                     /db_xref="GeneID:38740148"
                     /translation="MAAAAILREALPSLDEPIVTYLDRYIYDAGEDPTVDVMEDVVRP
                     MLESAVICEPSDSPKRLALPTLFEKLGAIVAERAPKKSVESQRGLARLDKVVDMSTSE
                     ISSTITYDAGNDSMDLALGRSTRNRTTVDIKKLEKQEAKTRAKLAKRAQRDLYESSKL
                     VENAKKMASYEEMYMQVNPLESISSGAAKGKNKDIHLPNIDVSFGSHRILTNAELTMA
                     YGRRYGLIGRNGVGKSTLLRHMALRDVPIPTNVSLLYVEQEITGDDTSAIEAVLKADV
                     WREKLLAEERRLNFELQQLEDATHAAVAAADQNKDDDTEGLSKGSAVDLPTRQRENQR
                     DELLSRLGDVQAKLVDMEAETGPSRAATLLNGLGIVGDDQNKPTKAFSGGWRMRLALA
                     RALFCKPDLLMLDEPSNMLDLNAIAWLEDYLVKEWEGTLLVVSHDRAFLNQVSTDIVH
                     MHSERLDYYKGNFDQFYETRDERRRNQLREYEANKQKREHLQAFIDRWRYNAARAAQA
                     QSRIKELERLPVLEMPEKESGEHFTLPETDKISPPLLQLDNVTFGYSEDKILLRNVNF
                     DVTLDSRIALIGSNGAGKSTLIKLLINQLSPLSGDAKRNPRLRIGYFSQHHIDQLDLT
                     QSPVAFLASRFPGRTEQEYRQHLGSFGITGTTGLQKIATLSGGQKSRVAFAQLSLLKP
                     HVLLLDEPTNHLDIEALDALMEAINHWNGGVIVVSHDERFINGCLKEMWVCDNGTVYK
                     FYGNVSEYKRVIIESNKRKLEEAMRSSNT"
     gene            <40702..>41571
                     /locus_tag="MRET_3383"
                     /db_xref="GeneID:38740149"
     mRNA            <40702..>41571
                     /locus_tag="MRET_3383"
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /transcript_id="XM_027630010.1"
                     /db_xref="GeneID:38740149"
     CDS             40702..41571
                     /locus_tag="MRET_3383"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /protein_id="XP_027486113.1"
                     /db_xref="GeneID:38740149"
                     /translation="MYVDEPSNMLDLNAIAWLEDYLVKEWEGTLLVVSHDRAFLNQVS
                     TDIVHMHSERLDYYKGNFDQFYETRDERRRNQLREYEANKQKREHLQAFIDRWRYNAA
                     RAAQAQSRIKELERLPVLEMPEKESGEHFTLPETDKISPPLLQLDNVTFGYSEDKILL
                     RNVNFDVTLDSRIALIGSNGAGKSTLIKLLINQLSPLSGDAKRNPRLRIGYFSQHHID
                     QLDLTQSPVAFLASRFPGRTEQEYLAVSLLFAYYFIAASSRFSMSGSAFFFHLSHITV
                     VFSCVRAPLCLLL"
     gene            <41951..>42568
                     /locus_tag="MRET_3384"
                     /note="MRES_13615"
                     /db_xref="GeneID:38740150"
     mRNA            <41951..>42568
                     /locus_tag="MRET_3384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630011.1"
                     /db_xref="GeneID:38740150"
     CDS             41951..42568
                     /locus_tag="MRET_3384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486120.1"
                     /db_xref="GeneID:38740150"
                     /translation="MKVFSIAALSTLSIASVWAGMDCEKTSGPMSLQYTEIGWGTKYS
                     NHTGLAKKGSESNAFLRIQDESSHEQFEFFECKSPPEGFETSPADAKYGQIRSAKDHS
                     LCLTVQGIDNRPVYGYGDKEKGTKREYDRKNGYLTLEACSPHPRRQWWSDNISYVGMK
                     KDYKRNHCSVDDDGRLLMYRNHAASMMPHDGDSFGGFLTWESQEE"
     gene            complement(<43176..>44375)
                     /locus_tag="MRET_3385"
                     /db_xref="GeneID:38740151"
     mRNA            complement(<43176..>44375)
                     /locus_tag="MRET_3385"
                     /product="lactate 2-monooxygenase"
                     /transcript_id="XM_027630012.1"
                     /db_xref="GeneID:38740151"
     CDS             complement(43176..44375)
                     /locus_tag="MRET_3385"
                     /codon_start=1
                     /product="lactate 2-monooxygenase"
                     /protein_id="XP_027486119.1"
                     /db_xref="GeneID:38740151"
                     /translation="MEPAKLIAETFENGCHNEFTTFGFRFSQWEEKARQVLSANSYGY
                     VKGSAGDGYTDNQECQDFKKWQFVPRRLVPVSQCDVVPKYKVLGQNVPSPIAVAPIGV
                     NTIFHREGECGMSAAAKEAGVTYIMSSASSTSLEDVAKANGDGHRFFQLYWPPNESND
                     VTASILRRAKQAGFTALVVTLDTYTLGYRPSDLNHGFNPFLLPEITGCGLGLSDPVFQ
                     EKFKQKNGKTVMEDLATSAPEWASQMFCGAGHSWDDLKYLREYWDGPIVLKGIMDVED
                     AKLAVKHGMDGIVVSSHGGRQVNDSVSSIEVLPEIVDAVGDKLDVLFDSGVRSGTDIA
                     KALALGAKMVLIGRPCVYGLAMGGQKGAHHVLRCLLAELELSMRLSGVSSIEKEELNR
                     SRLRLIK"
     gene            <45849..>46718
                     /locus_tag="MRET_3386"
                     /db_xref="GeneID:38740152"
     mRNA            <45849..>46718
                     /locus_tag="MRET_3386"
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /transcript_id="XM_027630013.1"
                     /db_xref="GeneID:38740152"
     CDS             45849..46718
                     /locus_tag="MRET_3386"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily F, member 3"
                     /protein_id="XP_027486118.1"
                     /db_xref="GeneID:38740152"
                     /translation="MYVDEPSNMLDLNAIAWLEDYLVKEWEGTLLVVSHDRAFLNQVS
                     TDIVHMHSERLDYYKGNFDQFYETRDERRRNQLREYEANKQKREHLQAFIDRWRYNAA
                     RAAQAQSRIKELERLPVLEMPEKESGEHFTLPETDKISPPLLQLDNVTFGYSEDKILL
                     RNVNFDVTLDSRIALIGSNGAGKSTLIKLLINQLSPLSGDAKRNPRLRIGYFSQHHID
                     QLDLTQSPVAFLASRFPGRTEQEYLAVSLLFAYYFIAASSRFSMSGSAFFFHLSHITV
                     VFSCVRAPLCLLL"
     gene            <47185..>47715
                     /locus_tag="MRET_3387"
                     /db_xref="GeneID:38740153"
     mRNA            <47185..>47715
                     /locus_tag="MRET_3387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630014.1"
                     /db_xref="GeneID:38740153"
     CDS             47185..47715
                     /locus_tag="MRET_3387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486117.1"
                     /db_xref="GeneID:38740153"
                     /translation="MSLQYTEIGWGTKYSNHTGLAKKGSESNAFLRIQDESSHEQFEF
                     FECKSPPEGFETSPADAKYGQIRSAKDHSLCLTVQGIDNRPVYGYGDKEKGTKREYDR
                     KNGYLTLEACSPHPRRQWWSDNISYVGMKKDYKRNHCSVDDDGRLLMYRNHAASMMPH
                     DGDSFGGFLTWESQEE"
     gene            complement(<48323..>49522)
                     /locus_tag="MRET_3388"
                     /note="MRES_13620"
                     /db_xref="GeneID:38740154"
     mRNA            complement(<48323..>49522)
                     /locus_tag="MRET_3388"
                     /product="lactate 2-monooxygenase"
                     /transcript_id="XM_027630015.1"
                     /db_xref="GeneID:38740154"
     CDS             complement(48323..49522)
                     /locus_tag="MRET_3388"
                     /codon_start=1
                     /product="lactate 2-monooxygenase"
                     /protein_id="XP_027486122.1"
                     /db_xref="GeneID:38740154"
                     /translation="MEPAKLIAETFENGCHNEFTTFGFRFSQWEEKARQVLSANSYGY
                     VKGSAGDGYTDNQECQDFKKWQFVPRRLVPVSQCDVVPKYKVLGQNVPSPIAVAPIGV
                     NTIFHREGECGMSAAAKEAGVTYIMSSASSTSLEDVAKANGDGHRFFQLYWPPNESND
                     VTASILRRAKQAGFTALVVTLDTYTLGYRPSDLNHGFNPFLLPEITGCGLGLSDPVFQ
                     EKFKQKNGKTVMEDLATSAPEWASQMFCGAGHSWDDLKYLREYWDGPIVLKGIMDVED
                     AKLAVKHGMDGIVVSSHGGRQVNDSVSSIEVLPEIVDAVGDKLDVLFDSGVRSGTDIA
                     KALALGAKMVLIGRPCVYGLAMGGQKGAHHVLRCLLAELELSMRLSGVSSIEKEELNR
                     SRLRLIK"
     gene            complement(<50492..>52246)
                     /locus_tag="MRET_3389"
                     /note="MRES_13625"
                     /db_xref="GeneID:38740155"
     mRNA            complement(<50492..>52246)
                     /locus_tag="MRET_3389"
                     /product="transcription initiation factor TFIIH subunit 1"
                     /transcript_id="XM_027630016.1"
                     /db_xref="GeneID:38740155"
     CDS             complement(50492..52246)
                     /locus_tag="MRET_3389"
                     /codon_start=1
                     /product="transcription initiation factor TFIIH subunit 1"
                     /protein_id="XP_027486121.1"
                     /db_xref="GeneID:38740155"
                     /translation="MESSVAQTLYASVSYKKVPGTLTLKKDGVLEWRPSSSTASVHEF
                     QVSSTYLKGMQVSKPGAAQIALRLVAKDGKTINGDTSAFLVFNSDPDTAVSQREKFKE
                     RLAAAIAKARTEPMQQTSTRDFDTHDSLQRTAMASEVALRSQVLRSNPQLLSLHKEVV
                     GSGTLSDADFWAHPARVMLLRAEKARMEQKTGRRGQLADPHPTQNENNELKINITPQL
                     IRDLFEQYPVLTRAYDENVPNRLDENTFWARYFQSKLYHRLRTSLRSAASENQLPADD
                     IFDKYLEAEDNDLEPRQKHNPHDALLNLASTEEDHSATGNIQDWTMRPGFDRRTLSLV
                     RRFNKHAESLLTSSLGALDEKGARRVRRKVGGVDEEYDSQSKRKWESHYDKDIVIPDL
                     TERRSNSGRRLEIQDSHAYYGSDIHGETETVQGENRFDYARFRQDLAQWHLDLSKFSP
                     SGQIMSTTLHYMLKNMGQQKEQRYSTALDKLPADVNRQIVSCQAATSEFLQQFWQAAL
                     PSLEHTYQSVEQRIEKARSMISILQKTDTRIEHIATAADTALPNEGYDSVMEAFQATR
                     EAVQTALFYAHKSQRHTV"
     gene            <52376..>53863
                     /locus_tag="MRET_3390"
                     /note="MRES_13630"
                     /db_xref="GeneID:38740156"
     mRNA            <52376..>53863
                     /locus_tag="MRET_3390"
                     /product="cell division cycle protein 37"
                     /transcript_id="XM_027630017.1"
                     /db_xref="GeneID:38740156"
     CDS             52376..53863
                     /locus_tag="MRET_3390"
                     /codon_start=1
                     /product="cell division cycle protein 37"
                     /protein_id="XP_027486154.1"
                     /db_xref="GeneID:38740156"
                     /translation="MVSKLNYSKWDNLELSDDSDIEVHPNVDKRSFIRWKQRDIHEKR
                     EMRKIQRSHYEAEHRTNVAVAPILEELCKATEKEGSKFYSREVSRLSAGRQERGNKDG
                     PDGPTLDDIVLSLLLQINEEEDVAKARETPQLDQALANALKTHIYKLATRTKELETLL
                     KEMDDEDRRKITSESLRDGWNSSHVTKSDDLPPQTQQKPSGKTKVQHVETLNPGASSV
                     SQVATANDSEEEEEDSPSITPVMKAFASLPSALKSVPISMEKFPPGFNPATQLNLNAF
                     EKMFDFLSAHKELLRSEYGTSDALLLQAFESQMAGQKSLARMCTEKALLVQYCNQLGK
                     DGVNLFFQRMMQTDGRAAVVFLNDVLSTYTRISSRADVMKEKYKDEGEGVEQIQLMAE
                     DPNTVISFQIPEGPPPENIKLEGEGADKLDPSQVHEWLQRRWDIFVGFDEDFRRALET
                     KNLDTVNQALGRMPVEKAEMVVQDLDRAGILNFSSTEIRDETGKT"
     gene            <54021..>55551
                     /locus_tag="MRET_3391"
                     /note="MRES_13635"
                     /db_xref="GeneID:38740157"
     mRNA            join(<54021..54174,54200..54381,54547..>55551)
                     /locus_tag="MRET_3391"
                     /product="protein LSM14"
                     /transcript_id="XM_027630018.1"
                     /db_xref="GeneID:38740157"
     CDS             join(54021..54174,54200..54381,54547..55551)
                     /locus_tag="MRET_3391"
                     /codon_start=1
                     /product="protein LSM14"
                     /protein_id="XP_027486155.1"
                     /db_xref="GeneID:38740157"
                     /translation="MASAAAPTSGQDDSAASFIGALISLTSHSNIRYQGILSNIDAAQ
                     ATLSLENVHSWGTEGRCAAAGHPQDEVPKNDHVYGYIVFRAADVVDLRIDDPSPNKTG
                     GAAPESTMNKSETYPTISAGLPDPQYMMQYPYAPMGPYGPMYQPMPQMYGGFTQETYP
                     FHGGYMMPPYVNAPVYPINQDAGLDVPPHMQGIPSQPPVLGVQPKSPAPPSADTSMQQ
                     QIPVSNEVQKSSAYPGPDLESLTETSNATGPLSNRTTEKPLPTNRPSSINEDPSGPKD
                     TPETNDISKTNVSIDNTGSVSSQTKPVVQERKPKTVPGAAPGAVVASRDPSVPESDFD
                     FEKANSLFKKHSGPDAEEPSNNDRITSVPSAPSKSFYDRKTGFFDNISSEVKDRHEGG
                     KRSGREGLIAEEKERNVLTFGDQAANYRGSSRRGRGRGGRGRGRGRGEKQPAWA"
     gene            54401..54512
                     /locus_tag="MRET_nc0009"
                     /db_xref="GeneID:38741165"
     ncRNA           54401..54512
                     /ncRNA_class="snoRNA"
                     /locus_tag="MRET_nc0009"
                     /product="small nucleolar RNA Z13/snr52"
                     /transcript_id="XR_003525366.1"
                     /db_xref="GeneID:38741165"
     gene            complement(<55729..>58324)
                     /locus_tag="MRET_3392"
                     /db_xref="GeneID:38740158"
     mRNA            complement(join(<55729..57846,57875..>58324))
                     /locus_tag="MRET_3392"
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /transcript_id="XM_027630019.1"
                     /db_xref="GeneID:38740158"
     CDS             complement(join(55729..57846,57875..58324))
                     /locus_tag="MRET_3392"
                     /codon_start=1
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /protein_id="XP_027486156.1"
                     /db_xref="GeneID:38740158"
                     /translation="MQWQSLYEGLGNESFQEPSSFFGDMDLNGPSTEQNPIFNPVFSI
                     NGMNSSSDSVPSSRLAELTPNVSTEEMFPIPGISAMVPSFVATDIHRSTSQPAKTRRN
                     FSPGDFSMSHNSRDTLYAHEFLKAFRARAPESNDRQAACDYCRKRKIKCDRKKPTCGN
                     CAQARRVCTSDDILRKRGPPSKKERALMSNAGIIFRSRNSRIEKQNNRRLNQDKETND
                     SSALPQNVQNQIPLNSNPLSSMVSTPPTAIEWSTDAWLAPSTEYSALQPESTRAIFDV
                     SNIIPAPSADALSAHSESIIPSNFKSTQDVHPSSGSATTVNLPDMSLLNEALVNTHLP
                     DFNAFGSHKMQLDDTMPYSDARQDLSLLTKPISLQEQAPSNDSGSLNNLLGYFEPPNF
                     DETKFSVQEILTSSLVTDLSTRKMLEFCTAHDMGKVTPLPPRITTIAPPTQAELGDVN
                     DILCLCVLDNSGNVVYRLKKDYYSSLQKLYNDPSQMLELPGGVHVPMQNGKDDLLELK
                     NLFPSHDRFWHDSDYFRLKCEASTLLQNPAALTLIRTALKDLEQSLPFFQAFEIEEYV
                     SQLIPLQSMCTWTPIQVRQRTSLLLLLSALGSSLTMSVCLSLDSQGKIGTALPWEFGY
                     RCYQLARGLLCPAQKALAPTEMTMEMLQCLILINMYMNRCGDRNGSWLPLTYGNFVVK
                     HILKMLKLHQEESLPTQSMLQWEMLKRCICIFFMLEVISRINGYMILPQCIWTCSPLS
                     MEMPVYLHGIFSPHGRVDDVFSSHTFSRFIFHIELCQIFVRIVQLKLDDTIDLKQNLA
                     KVASVRDQLTQWMMHSPCLQRSMGGSQLHSGKWTGSEALDGTSVFLACTYLLNQASR"
     gene            <58683..>59514
                     /locus_tag="MRET_3393"
                     /db_xref="GeneID:38740159"
     mRNA            join(<58683..58701,58750..58808,58845..58961,58996..59380,
                     59408..>59514)
                     /locus_tag="MRET_3393"
                     /product="vacuolar protein sorting-associated protein 29"
                     /transcript_id="XM_027630020.1"
                     /db_xref="GeneID:38740159"
     CDS             join(58683..58701,58750..58808,58845..58961,58996..59380,
                     59408..59514)
                     /locus_tag="MRET_3393"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 29"
                     /protein_id="XP_027486157.1"
                     /db_xref="GeneID:38740159"
                     /translation="MLVLVIGDLNLPHKAINIPSKFRKLLVPGRIQQVICTGNVCDKQ
                     TYEYLRSLVNEIHIVKGDFDENRHFPSSLVLNYSPVKIGVIHGHQIIPANDRLSLLFC
                     AQSMDVDILLSGNTSKFEAYKFGERFFLNPGSATGTWSMSTCSETNKETIGEKNSAQS
                     EASHENRQESGKCTSKAITTLNDPKHQNNPSFALLDIQGHHVVIYIYQLINDEVRVEK
                     MEYKKILPSE"
     gene            complement(<61120..>61672)
                     /locus_tag="MRET_3394"
                     /db_xref="GeneID:38740160"
     mRNA            complement(join(<61120..61389,61418..>61672))
                     /locus_tag="MRET_3394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630021.1"
                     /db_xref="GeneID:38740160"
     CDS             complement(join(61120..61389,61418..61672))
                     /locus_tag="MRET_3394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486150.1"
                     /db_xref="GeneID:38740160"
                     /translation="MTPLPISRSLTASRLLRFASFHSNVPRLAESIRKVEKARHTYFD
                     QVSGNSAGFRRARKPYQLGNFLLLLSLFAFTGGVYAYSICMVEQDDFSDLENFRVEPL
                     GAGNDAMGTVLPEENQNHTDNKSSNVRSGLIESLRNRLSWSMSSNDVSPRYPAKVDNP
                     TNPATGPTMNKKDI"
     gene            complement(<61775..>62692)
                     /locus_tag="MRET_3395"
                     /db_xref="GeneID:38740161"
     mRNA            complement(join(<61775..62254,62282..>62692))
                     /locus_tag="MRET_3395"
                     /product="lipoyl(octanoyl) transferase"
                     /transcript_id="XM_027630022.1"
                     /db_xref="GeneID:38740161"
     CDS             complement(join(61775..62254,62282..62692))
                     /locus_tag="MRET_3395"
                     /codon_start=1
                     /product="lipoyl(octanoyl) transferase"
                     /protein_id="XP_027486151.1"
                     /db_xref="GeneID:38740161"
                     /translation="MTSSAPLVSTALRPLRVCNIPYYVPYKVGIQLQESMIERRANAR
                     SILRQNGIPHTASSLGVPPGFQKYLDIAQTDFLLLLQHTPVYTLGRRNDDAALSAALT
                     SPNVDIVKTRRGGLLTYHGPGQLVGYPILDLGLMNLSTRCYIARLQDILRKSLSHDEI
                     QLQTINSPADDSKYTGVWSDPTHKIASIGVQVQHRVTSHGFALNVHTNALDGFRKIVA
                     CGLPDVSLTCIDEQLSWHGKKSQITLIQVANIIANEFGKNLNRDVDLIDDMSFVTSTK
                     FDGTQVLKQIVLDGECIPTN"
     gene            complement(<62882..>70561)
                     /locus_tag="MRET_3396"
                     /note="MRES_13640"
                     /db_xref="GeneID:38740162"
     mRNA            complement(<62882..>70561)
                     /locus_tag="MRET_3396"
                     /product="protein of unknown function (DUF3712)"
                     /transcript_id="XM_027630023.1"
                     /db_xref="GeneID:38740162"
     CDS             complement(62882..70561)
                     /locus_tag="MRET_3396"
                     /codon_start=1
                     /product="protein of unknown function (DUF3712)"
                     /protein_id="XP_027486152.1"
                     /db_xref="GeneID:38740162"
                     /translation="MEKEAWEGGVRRRLPAYDAGVGGASSPAGHMHQPGKPIGFLAAR
                     KTPYAKKLLSKRLILFTVVILPFLIIFNLFLICVPILWGVANHTLAVSVMHIYASNLT
                     NIKEDNFELTIEGQVKKAGVFPAHIFFREPVHVTWNTVPSDDRPMREVQLGHFPLERI
                     GVAAGHGRIKQITRFNITDVPSFTEFTKFLIQTKEFTWRLTCNNVHIEAFSFLPTFKN
                     LKLTKDVVFNGINNFEDVKILDFKLPAADPQGGISYEAYTSVYNPSPFGVQLGRLSLD
                     LYAYGMHLGPGYSPNINITRGINYVKLTGRILPKTDSRDLSKMSEIFTKYINHEVTPT
                     VAVGKDITNVDYEVPSWLREAIKVLRLQVPFQSPEPINPIKQVTIMQFNLTYPPGGDA
                     YGPMASSDSLSAQLAVPFGFPLRVVSAKNEITIVNEKNGKPIIMVNGVNSAAETSLDV
                     ISAGQTEGTIYLTLKPSPMSLPSQSDDARKEFEDFQKEFTFAKEDIKYFNGTSKALTE
                     TPVGTVLLNGIKFSVESGLLGLQGLNHYPTLVLGLDVIGGTRDNINIKVNTSIFNPSN
                     VNLDVGTTTLLMIKEIVVGSVTLPDLKLAIGNNTLEIDAKFNPNAGPQGLEMLNRFIS
                     GINTKFNISGYEDSTSIASLKPAFSAVRINSTLPGLQQKLVQSTKLKVLDSTGNKDDV
                     AQAVVSLSNPFTSSLSITHIISNVTSHGLFIASLDTDTQFNAGGKKVSQSPLLDLHLN
                     LYPPDIFALVRDYALDAGLDVMQLDAIVKIGGYTYSDTTNANSLKKHKNGKRHVLDGG
                     TLRSEDSGNSFRAGHELEKRKTNMFTNFNIVDFTDKAFSKAQVNLNILSTCNIGDYQT
                     ELQFVQSNVPLQTDDTLHKLLPVLAKPIVQKIIDGAILTIESVTILDPKPKSFVTSLK
                     GSITHSGPFDASISFPDGLQVSWNGKVLGQLKMPDIKLAADEGAQLDLNAEFAVADVD
                     GLTEFTKFLLTKPSFIWNIQGKNLRVSALGIEVGGLDISKTIILTGFNGLKNKVRITD
                     YDLPSNDPAGGIHLTAESDITSPSQVGVRLSRFGVSVWSNGTNLGPTAAESEFTLNPL
                     SSTNLPLAGRLKHQSDDGDLEVLSNIFTNVVHGETIPLTIQGEYAGPSEVTWLNEGIK
                     SLKVNTILPAKHFSVIKAIDINQLTLMFSKKAPWEPKASSNNTQAPFYLPFGFPINIK
                     QTGGGFIENYKSTDIAVLNIPYSPAQTQVRARILTLEFKNSPMSAYSSKHAQFSQFIA
                     DTTKQDCVKFQLHGKANAKADTAAGYVTVSDISFSVETSLLGIQNLNARPVFVANLDV
                     KHGFKDYLLITVNSFMYNPSHISVGTGDVSFNLEFQNHMIGTVDIHDLVLEPGLNKKF
                     TNVKYHPHGAANIAAGQTMLENYVQGIESTTKIHGTKDTTDIASLKQAMSGIDLMVKI
                     PPLHKLIILEDRLVIPKNIDKTHIAQASFQLANPFTASINLIKVDAKASYKGIFLGQI
                     NDDLSKNPIRANGHQTITSRTLPIKMDLNPKNLIRFIKQAAADTGTDLGPLEHEFDLV
                     MAMKNTETSIKAMPDSSPPNCHSGHQFDVFGAVFSLLKGLKVTLDIKSTVKIDDYKTD
                     LNFKQEPVPTDTDDTALYLIGPVGKPIVQRIVNEAVLAFSVANATNLRNDGFDVSLRG
                     KLVNTGPFDAQIEFPEGVSVTWSGKDIAKVYLPPVCAKADEGVPNYNTKGQLKIIDHK
                     AFTEFSTHILHNRQFKWTIHSNKLRVRALNIIFSDVHISKDLTFDAFNGLPGVKITNF
                     DIPGETKDSLKITSGTMIPSPASLGIQLDTANFLIFYKNRLQGPIHSNNLFIGAHTTT
                     SATLHGFITRKDSDADRDITGDLFSNYLQGKNKTLSIKGDSVVTRANGNKPVKWLTAA
                     FKSLTLKVVLPGKIYDIVKSAQIIDIFVTMMEQRDTWSPRIASNMTLAQYANPLHFSL
                     KPMKISLSGILSFEGADAARLELPLLRASAGISHGPEDQQPLALSFKNQRLQAMDHGA
                     FANFLGKIAYTSRVSFQVRGSVGIIGHMVIGDIPVKGIPFSGITSSLAGFNSFTGEAD
                     TYKADVKGATPQYLDMSVRMRMKNPSNITLKTTGMKLPSFHEGTYFGRALLDDKTIVP
                     GINDIDAIARYQPNDPNNTVAQSVVQKFLQPKEHQPKEIRYIVPIEIQGKGFENANPP
                     LSPFASLVPGLAQVHAKSSFPGMGSRSLEYVDNYIDLLGLFAGPDLRPFARVRLHFKN
                     DAPSPLEIITIQSDARVAGESESVEKIATFFVDFHYLLRTDPRCKSPCYMRAAKATKV
                     DPGRHTCCMVPNVLLYQGLLPTYKLLGNKVDVYNQLRVQVGGKNGIILPSIHFNEFYV
                     PTTYQISIGETPVLNITNAAQFIGGLTKALSMMNRQEKLRLAQGIKKAGRNHIATLVD
                     NGMKDLICGVEDLIPLDFLDLAGCKKKGKMTSNASQKSTSGGLKVSDASSRSSKAQSS
                     PTPKGGKTSDTHQSMNSQNQKTTSTAGNKSSDDDDHNGKNSNSGNQDGGDKHTSSGQI
                     LDSGQSSKGNNKGEGLGNLFG"
     gene            <70896..>73149
                     /locus_tag="MRET_3397"
                     /note="MRES_13645"
                     /db_xref="GeneID:38740163"
     mRNA            join(<70896..71028,71066..>73149)
                     /locus_tag="MRET_3397"
                     /product="actin-related protein 5"
                     /transcript_id="XM_027630024.1"
                     /db_xref="GeneID:38740163"
     CDS             join(70896..71028,71066..73149)
                     /locus_tag="MRET_3397"
                     /codon_start=1
                     /product="actin-related protein 5"
                     /protein_id="XP_027486153.1"
                     /db_xref="GeneID:38740163"
                     /translation="MSASTASDSILSVREWPFVHSITPKRRYRDTVHWSQKAPLLIDN
                     GSSELRAGFSSNESDSPMYTCENIVSRFRDRKRSANMVLCGTDCYADAQSRGNIKSPF
                     DGNVVCGFDTMEYMLDNTFSKLGIDTDRVDHPLLLTEPLCNPEYSRGQMNELLFEAYR
                     VQSVNYGLDALFSAYANNVRDNGLVVSAGRTTTAIVPLVQGRGYLENAKRLSWGGLLA
                     SDFLLRLLQLKYPNCPQRITPYETQCMLEELCYTSLDYDAELRSFQDPDVLAKVDRVV
                     QLPYSAPEYKEKTKEELDQIAERKRAAGRRLQEQTRIMRLEKAQRNENDLKYYTLLSE
                     WKEKESPEEYQARLEADGFETEQEFDRTLKRLDTAVRKFRAEEQGEEFEEEKKEPEFP
                     LVDVPDNELDEEGIKEKRRQRLLKAGHEARLRARAEKEKEKRLQAEEEERETRERTEN
                     LAAWLSKMRTQHQESIARIEERKRLREMLPNRKSAAAQQRMRNITALASEQDASSSDS
                     HRRRKRGDDEDTFGANDNDWSVYRTINDATNEEEEAQDYVTLAEIEQKLLQFDDAFTD
                     ESTYEALQARKTRLTQTFLYGQPSRLDMDDPIQYHQLHLNVERIRVPEISWQPLIAGV
                     DQAGVAELGRHVLFSVDQTIRDRMIRNVFVTGRYSSLPGFDARLSNSLQSYLPPNAPL
                     SVRRAQCPRFDPWRGMREWVTEQSDLFRASSVTRAEYEEKGSGWFKEHALSSCWQA"
     gene            complement(<73236..>74879)
                     /locus_tag="MRET_3398"
                     /note="MRES_13650"
                     /db_xref="GeneID:38740164"
     mRNA            complement(<73236..>74879)
                     /locus_tag="MRET_3398"
                     /product="myo-inositol-1-phosphate synthase"
                     /transcript_id="XM_027630025.1"
                     /db_xref="GeneID:38740164"
     CDS             complement(73236..74879)
                     /locus_tag="MRET_3398"
                     /codon_start=1
                     /product="myo-inositol-1-phosphate synthase"
                     /protein_id="XP_027486158.1"
                     /db_xref="GeneID:38740164"
                     /translation="MAPVTASAALDPTAARHEESQTIKIASDRLNYTSEFITAQYEYQ
                     NTHIERVAGPDGKEELIAKPFKQEFEFRTSRAVPKTGLMLVGIGGNNGTTITATILAN
                     RHQIQWHNKEGLQTPNYYGSLVRASTIRLGSDAKTGKDVWVPFSNVLPMVHPNDLVIG
                     GWDINSAPLDKAMTRAKVIDYDLQRQLAPKMAEIKPLPSVYYPDFIASNQEDRADNVI
                     PGQDKQAHVEHLRKDIREFKKQHGLDQVVVVWTANTERYSNIVPGVNDTADNLLRAVQ
                     ANHEEVSPSTIFAIACILENVPYINGAPQNTFVPGAIQLAERHKAFIGGDDLKTGQTK
                     VKSVLAEYLVNAGIKPLSIASYNHLGNNDGYNLSSQRQFRSKEISKSSVVDDCCEANH
                     LLYRPSEFSQGGEMHAKGERPDHCIVIKYIPAVGDQKVAMDDYTSELCLGGRNRLYVT
                     NLCEDSLLASPLLIDLAIMAELMTRITYRVPGSEESSWQSMYSILSLLSYSLKSPLVK
                     PGTDVVNSLNRQRAAVTNFLRACLSLAPESDMLLETRLW"
     gene            complement(<75135..>77530)
                     /locus_tag="MRET_3399"
                     /db_xref="GeneID:38740165"
     mRNA            complement(join(<75135..75175,75217..>77530))
                     /locus_tag="MRET_3399"
                     /product="PLP dependent protein"
                     /transcript_id="XM_027630026.1"
                     /db_xref="GeneID:38740165"
     CDS             complement(join(75135..75175,75217..77530))
                     /locus_tag="MRET_3399"
                     /codon_start=1
                     /product="PLP dependent protein"
                     /protein_id="XP_027486159.1"
                     /db_xref="GeneID:38740165"
                     /translation="MPTTEVARYSAALKNSFAYKTTIQRWPTILTQVVDGLFQQCHAL
                     SVHGTASHTKVEEAKSIIEQISQLKYELTHNKALTPIGVRSDNAPRIGSFHAPATEPY
                     DDIIRRSDLTWFQSDWLFAECYLYRRLRHFFEISNEWKEHDPFISLKNDAFRASGRGV
                     GACATWMDNILSKSETHNTASPDTKSIFQDMVYSSLWGNAMDLSLLLNITDDELQKRQ
                     SASEKERSDKIQHIIVNDMDALWNKVRGITEGRVDFVLDNAGFELVTDFMLADFMLSL
                     RGPFARASEERANDIERRIHHVLQRVSEASKVANREENPSLLVVSKLHPPSDVMAAYH
                     RTGQRHFGENYVQELVDKASVLPDDIHWHFIGGLQSNKAKLLATVPNLYAVESIDSDK
                     LATALEKSLAKPENTALRAYPLHVYIQVNTSGEEGKSGLPAMLAPWKNDDAQPPLLAL
                     AQRIMLECPHMRLQGLMTIGSMSNSQASQESNENPDFATLVSSRQHLMNALTQDANFL
                     AKLSKATWWTPNGNATNVYDDLMKNQDLGLSMGMSADMQAAISMGSTNVRIGSDCFGR
                     RTSNNEAADIRSAELGEWSKRPLVKEVVFHPKNMPWFVSDTCVPDIWRMLDQLSQPDF
                     FSCAQDLAMEPIYRMAKRWRSHFEEGRFRLAMPDDSPLGASAGALSDYWTWPDSYETM
                     PERAPELFSRLKTSDLVLFKGDLNYRKLTQDAQWPSSTSFSQTLGPLAGEVALVALRT
                     CKAEVCVGLPEAQEAKLYECDDSWRTNGKWAVIQYAACTQSSRV"
     gene            <77580..>78495
                     /locus_tag="MRET_3400"
                     /note="MRES_13655"
                     /db_xref="GeneID:38740166"
     mRNA            join(<77580..77641,77670..77680,77715..77730,
                     77760..>78495)
                     /locus_tag="MRET_3400"
                     /product="ribosome maturation protein SDO1"
                     /transcript_id="XM_027630027.1"
                     /db_xref="GeneID:38740166"
     CDS             join(77580..77641,77670..77680,77715..77730,77760..78495)
                     /locus_tag="MRET_3400"
                     /codon_start=1
                     /product="ribosome maturation protein SDO1"
                     /protein_id="XP_027485797.1"
                     /db_xref="GeneID:38740166"
                     /translation="MGYFFSLQQQCLCQPLSISMPINLPSNNFKLTNVSIIRLRRGGK
                     RFEIACYKNKVREWRSGVEKDLDEVVQIENVFLNVSKGQVASKDDLQKAFGTSDVTEV
                     LLEILKKGELQVGDKERSHELSTLWVEIASIVAQMCVDPNSQKPYTVGIIEKAMKDVH
                     YSVKPTKSAKTQALDVIKLLQSKSIIPIERAQMRICATMPAKEGKRLKDKLIAMFTKI
                     EEEDWSDVWEVVGTIDPGSLRQINVLFENEVKGEGGVETLAFSTVDQGDDEEGEDW"
     gene            complement(<78507..>81602)
                     /locus_tag="MRET_3401"
                     /note="MRES_13660"
                     /db_xref="GeneID:38740167"
     mRNA            complement(<78507..>81602)
                     /locus_tag="MRET_3401"
                     /product="sulfate permease, SulP family"
                     /transcript_id="XM_027630028.1"
                     /db_xref="GeneID:38740167"
     CDS             complement(78507..81602)
                     /locus_tag="MRET_3401"
                     /codon_start=1
                     /product="sulfate permease, SulP family"
                     /protein_id="XP_027485798.1"
                     /db_xref="GeneID:38740167"
                     /translation="MVDHPKTASLRSSQTYTDMDDVESGSRTYHPGSSFFSIHTDAAC
                     SALDGRSYRFGGVLNGTRPRHEEANLSTYSATKDHIRHETAELADIGVNDENLSGYSG
                     ATLSRAGHAAVPKTGLAEPRFHSDMGELNERTCLFRGCSTPYSAIPDTRNLSYGTEAM
                     ETWDTQGSSLPSERHPRFSSLSQDNHAYRLTHVCHSTWRDVGHVLMEPVRTLPAVILG
                     LFLNILDGVSYGMITFPTSLPIFSTFGGDGVSMFFVTCVVSQLVYTLGGSIFKGGNGS
                     MMIEVVPFYHLIVKDILRVVGEDNPSSLIATTMVAFALSSVLTGLLFWLQGVFHLGVL
                     ISYFPRHILVGCIGGVGVFLVETGIAVTAGLESESGVQYNWATVLQLASSTETVFQWL
                     LPLVQAVLLNVISSRCHSPLLIPMYFLVVLALFYVISLGILGLDMPTLWDRGWVFDVR
                     EAANAPFYRYLTYFDITQINWTALWSTLQTQMALVFFGILHVPLNVPALGVTIGEDNV
                     DLDKELRAHGVSNVAAGLLGTVPNYLCYVNSVMFYRVGGGSRLSGIMLAAGTTMVLLI
                     GPSPIGYLPIMVVGALIFVLGIDLVREALWDTWGRVNRLEYITILIIVVAMTLTDFVI
                     GCLVGLALACIFFVMQTSRRNAVRSALSGAAARSTVRRHLTQRRFLDDVAKQTKILKL
                     QGSLFFGTINSVESLVRKMLDLDEWHKNPISFLVMDFGLVQSVDFSAMEAMLRIRRML
                     RTRDVHLVFCGLSLDGDVAHSLQKADLWTDRANGLDVFATLNEALEWTENEYIRGLYM
                     FNLSMTAGALRPSSIAGQSTFRSIHPKPKPTVTYDEVDENPPRYEQLREAARRVTQNL
                     QKGFAFMPGISYENGASQQDTSAASISLLSITLGPYMDHSQKSEHLFQLISKELKEMV
                     IPKDTLLWDWNEQPDALYFIESGILKARYAFPQDDYEISEAMLAGTIAGELTFLAQQP
                     RDTMVRTEVDTKVWRLDGQSVKNIVHQDTQAYTMLVQLLLRITADEQNCLRSYLVSQM
                     S"
     gene            <81728..>82825
                     /locus_tag="MRET_3402"
                     /db_xref="GeneID:38740168"
     mRNA            <81728..>82825
                     /locus_tag="MRET_3402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630029.1"
                     /db_xref="GeneID:38740168"
     CDS             81728..82825
                     /locus_tag="MRET_3402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485799.1"
                     /db_xref="GeneID:38740168"
                     /translation="MAEENMDLGTSEASTNDVDVPKKIMYAVPEEMQRKIDENEYERD
                     SLHAPTKEAPDVGTPPAAPPIEYGDSIRPVALHLEGELITQLSTSRLMAFVAYSGAQA
                     KGVEWINDTRCVLVFESPERALEGLKHLCYDAVEDDVIREPNFEDPESPLLRARLVMA
                     FPRKLYNTIEQQAAAELPDVLSKLAEEHSKSTSSTEPVPEIYREMELEELERQMLSED
                     HRRVRQLRQGPWIRFALHNYDTKSPRSASKSNWYKQHGRGAGKEIVTRLLDVGEPTSQ
                     RRHRRSRRERRERDSRKENSEQMDEEYTPLSLRDRIGGRRGRDWDKDDDLHHARERSM
                     SPVSEGGAIRIRGRGSVRAPNAESTEYSNQN"
     gene            <83192..>84480
                     /locus_tag="MRET_3403"
                     /note="MRES_13665"
                     /db_xref="GeneID:38740169"
     mRNA            join(<83192..83199,83237..83371,83415..>84480)
                     /locus_tag="MRET_3403"
                     /product="translation initiation factor 4A"
                     /transcript_id="XM_027630030.1"
                     /db_xref="GeneID:38740169"
     CDS             join(83192..83199,83237..83371,83415..84480)
                     /locus_tag="MRET_3403"
                     /codon_start=1
                     /product="translation initiation factor 4A"
                     /protein_id="XP_027485800.1"
                     /db_xref="GeneID:38740169"
                     /translation="MSMPEETPVATDMQITDGEIQSNWDDVCDNFDNMNLAPELLRGV
                     FAYGFERPSAIQSRAIVPVIKGHDVIAQAQSGTGKTATFSIAILQRIDPNLKAVQALV
                     LAPTRELAQQIQNVVVALGDYMNIQCHACIGGTNVREDMARLGDGAQVVVGTPGRVYD
                     MINRGAFRTDKLKMFCLDEADEMLSRGFKDQMYEVFQLLPQDTQVVLLSATMPEDVLA
                     VTKKFMRDPVRILVKRDELTLEGIKQFYIGVEKEEWKFETLTDLYETVTITQAVIFCN
                     TRRKVDWLTEQLHSQEFTVSAMHGDMDQQQREVIMREFRSGSSRVLITTDLLARGIDV
                     QQVSLVINYDMPANRENYIHRIGRGGRFGRKGVAINFVTEDDVRMLRDIEQFYNTHIE
                     EMPMNVADLI"
     gene            complement(<85771..>87183)
                     /locus_tag="MRET_3404"
                     /db_xref="GeneID:38740170"
     mRNA            complement(join(<85771..85909,85937..>87183))
                     /locus_tag="MRET_3404"
                     /product="plasma membrane sulfite pump involved in sulfite
                     metabolism"
                     /transcript_id="XM_027630031.1"
                     /db_xref="GeneID:38740170"
     CDS             complement(join(85771..85909,85937..87183))
                     /locus_tag="MRET_3404"
                     /codon_start=1
                     /product="plasma membrane sulfite pump involved in sulfite
                     metabolism"
                     /protein_id="XP_027485794.1"
                     /db_xref="GeneID:38740170"
                     /translation="MNSLTDETDADLDLSPTTASECEEGASSVALDAAVQIRPPQSFF
                     AFLLWYFRMFLLHLSPIWFAMSMGTGITAVILQLLPYRFHGLETIALVFFAITLFFYL
                     FFLFLSVIRFLLWPQVFWLLLFHSTHSDFLGCVSMSLSVIINFCVAHFIKEREGSFRY
                     FVWALWWLNASFTTILCFGLTFLKTTRHAQYLNSITGIWLLPMVALIVVASAGGVVSD
                     TLPIHYAKMTIILSYMMLGTGWSLTFFTLTLYYARLIFHKVPPAAIIITVFIPLGPCA
                     QACFGFLRLASAIQNVYKNSGQSIFGAGLVSPENARLMDLAIQACSALLAVSMWGFAF
                     FWLCMALTIWVDTWMATKLKFNLGWWGACFPMGVYALATIEMGTALDSGSFKVLGVVL
                     TLATIAIWLFLVSLSLFYVARGKLFYEPYLGEVSQPPKSVESKRQYDFVPRNKIPRIW
                     RYLNKFTGLKW"
     gene            <87492..>90059
                     /locus_tag="MRET_3405"
                     /note="MRES_13670"
                     /db_xref="GeneID:38740171"
     mRNA            <87492..>90059
                     /locus_tag="MRET_3405"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /transcript_id="XM_027630032.1"
                     /db_xref="GeneID:38740171"
     CDS             87492..90059
                     /locus_tag="MRET_3405"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="XP_027485968.1"
                     /db_xref="GeneID:38740171"
                     /translation="MSTGDSNYLLGRSDSLNLVARNKRNSVPDIEGATTTRSSDEPII
                     HSEPQSSGAILPTHTNTKSAMGLSLTWNEDSPRARLLAPGTVRPKQKDTRSSKLSKYA
                     EAMPSVQPPMPLFEQVKLAFQNDTYMIMLYTILSIITRLYRIGANDHVVWDEAHFGKF
                     GSYYIRHLFYFDVHPPIGKILVAVAGWLSGFDGNFEFESGDQYPRQVPFVSMRIIMSL
                     YGIAMVPIAYMTAQSLNWNWRSKHLFAIMILLDNGLLTISRFILLDSMLLVFTVSTVL
                     GLVRFHRMQKQPFTFWWWFWLMYTGVSLGCVTGVKLVGLFVTALVGLYTIEDLWNKLG
                     DLKMPVRTYLRHWCARITALIMVPVAIYVIGFKLHFMILYKSGSGDAQMSSLFQSHLE
                     GSDLSNFPLEVAYGSKVTLKNQAYGGGLLHSHIQTYPGGSEEHQVTCYHHKDDNNNFI
                     ITPIYEEPQLPSPDAQDTTPPRMLRNGDVVRLVHEQLNTNLRSQATPGFISKDKYEVS
                     SRPMDKGQDSSEYWVVEVLKDVNYGPGKAGMPIRTLSTTLRFRHRDMGCYLRSGGDSL
                     PDWGWKQLEVTCDPQNYPRDMTTHWNVENHWNERLPITKSHQRARSPFFKDFLHLNVA
                     MMISNNALVPDHDKFDTLASAPSEWPFLYRGMRMNGWGADDRKFYLVGNPIIWWGSSC
                     SLIAAVFVLTWYLLRRQRRIHDMPPAAWDDFLFGLKVGWIGWFLQYFPFLLMGRVTYL
                     HHYLPTLYFAVLVLVHLLDHFLWNDVTARTSMDWSIFLRTGRVVSTKLNPFVHDTAAT
                     VPGKPLSPQIKNVTFAAIAAVVTMVFFWFSGASFGMVGDISTWKYMQWRKHWDIYSQ"
     gene            complement(<90068..>91159)
                     /locus_tag="MRET_3406"
                     /note="MRES_13675"
                     /db_xref="GeneID:38740172"
     mRNA            complement(<90068..>91159)
                     /locus_tag="MRET_3406"
                     /product="target of rapamycin complex subunit LST8"
                     /transcript_id="XM_027630033.1"
                     /db_xref="GeneID:38740172"
     CDS             complement(90068..91159)
                     /locus_tag="MRET_3406"
                     /codon_start=1
                     /product="target of rapamycin complex subunit LST8"
                     /protein_id="XP_027485795.1"
                     /db_xref="GeneID:38740172"
                     /translation="MAATDATGHSGEHKAKPPSSMTQIPSSSKSIEQDALSVVLVTAG
                     YDHTIRFWEAWSGLCSQTIQYSDSQVNRLAISPNKRIVAVAGNGTVRLYECSPAAAMM
                     SHSDTPSRGASVSPISSFDGHYGNVTSIAWHCDGKWLVSGGEDGTIKIWDTRTSRPQR
                     VYDHKSPVNDVVIHPNQGELASCDQSGSVKIWDLGENKCSHELIPEEDVPMRSVSIAS
                     DGSCLVAANNKGRVYVWKMRSGVAEDDQHEHTELEPVTKFQAHDTYITRCALSPDARY
                     LATCSADTTVKLWSTSQYRFALNKVLQGHQRWVWDVSFSADSAYLVSASSDHVARLWE
                     LSSGKTMRQYNGHHRAAVCVALNDTSLEP"
     gene            <91340..>92524
                     /locus_tag="MRET_3407"
                     /note="MRES_13680"
                     /db_xref="GeneID:38740173"
     mRNA            <91340..>92524
                     /locus_tag="MRET_3407"
                     /product="large subunit ribosomal protein L44"
                     /transcript_id="XM_027630034.1"
                     /db_xref="GeneID:38740173"
     CDS             91340..92524
                     /locus_tag="MRET_3407"
                     /codon_start=1
                     /product="large subunit ribosomal protein L44"
                     /protein_id="XP_027485796.1"
                     /db_xref="GeneID:38740173"
                     /translation="MMATRAFAVVAAARSLVLRRSFHTSRGVNHATPVSVVNLDRDAP
                     RGHLPSFVRLHPALWASLKSQTPSAIAALGSRFHLITPNMPEDEFDRRVALLRVACTH
                     PSVLSVQETAFSLPMSVQERKQVPELHENIEHNAQLATLGNSLLGMISAEFFHLKFPH
                     LPTRVLKAFVSAFVGPSTLADVGSEMGILSQGVQRWDRTGSSSLVRRTPRGGTTTVPL
                     LSKDVAAQSVRALVAVMFQELGMAATRGFIHSYLLSRRLDLALLLKFHDPKRVLSATC
                     KKYGKPVPQSRMIAETGRLSINPVFVVGVYSGAVKLGEGTGSSIRMAEYRAAEDALRR
                     LYLSEKPDDSFTLPSTTLDDTFSGQAPLPHSLKMAASRTMAPVHVPQPLGRSEVLHES
                     RG"
     gene            complement(<92575..>94584)
                     /locus_tag="MRET_3408"
                     /note="MRES_13685"
                     /db_xref="GeneID:38740174"
     mRNA            complement(join(<92575..92709,92746..94329,94355..94527,
                     94554..>94584))
                     /locus_tag="MRET_3408"
                     /product="signal recognition particle receptor subunit
                     alpha"
                     /transcript_id="XM_027630035.1"
                     /db_xref="GeneID:38740174"
     CDS             complement(join(92575..92709,92746..94329,94355..94527,
                     94554..94584))
                     /locus_tag="MRET_3408"
                     /codon_start=1
                     /product="signal recognition particle receptor subunit
                     alpha"
                     /protein_id="XP_027485801.1"
                     /db_xref="GeneID:38740174"
                     /translation="MLDQFVILSKTGAILWSKDFLPNVRNAQILPRVIESAFFEEHTA
                     SSRLDLDKFTVRWSMSNEHELIFIAINQRILTLNYVESFLLTVQRLFTRRYGDMIESL
                     KTYSTSRQTLLAYAEDIKLWDKEFMTLLRQHEKSRAGIKPAEPSPSSPPSEPLPCMNE
                     NEILKPTNTDAPKSVMAASAGGRRVVSAKSKKKGKDATSLSPSTAKLQPQSKKAAGTK
                     SQRKWDENGIATEHDMASLDFSQGDSGGKANLSHWIDESKLGKTRSDGVYELADDDDN
                     STTGQSQGLFGFLSSGPTSSLISRITGAKRSLTKQDLAPILHKMQMQMQSKNVANDVA
                     SLICEGVEKRLIGERMGSFGSVKAEVRASLEESITRILTPSTSTDILLEIASRKQRRQ
                     EILAKQPSQAMAHQDLPELNPYSIGFVGVNGVGKSTNLAKVCFWLLQNQYRVLIAACD
                     TFRSGAVEQLRTHVRNLGELEINGHRVADGLPDSGAAILDLYERGYGKDAAGIARDAL
                     TYARSQGFDVVLIDTAGRMQDNEPLMRALAKLIAVNNPDKVLFVGEALVGNEAVDQLT
                     KFNRALKDYSGMSNPRGLDGCLLTKWDTVDDKVGTALTSTWATGLPIYFVGTGQTYTD
                     LRQLRVALVVNALLRE"
     gene            complement(<94643..>95139)
                     /locus_tag="MRET_3409"
                     /db_xref="GeneID:38740175"
     mRNA            complement(join(<94643..94732,94758..95028,95057..>95139))
                     /locus_tag="MRET_3409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630036.1"
                     /db_xref="GeneID:38740175"
     CDS             complement(join(94643..94732,94758..95028,95057..95139))
                     /locus_tag="MRET_3409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485802.1"
                     /db_xref="GeneID:38740175"
                     /translation="MPVGQGELQRKLTALEHACTVKRSILSCIESSLETVQELHGSQE
                     NDGIRAQLRERDELAIRLLHTLSQLDSECSQNNACLSKIAQIGSELKAHTVEEIPKLS
                     QDESLCKLRLLKGVILHVAKECDMPWWQDETLAEFMLSMDDDEAP"
     gene            <95221..>97116
                     /locus_tag="MRET_3410"
                     /note="MRES_13690"
                     /db_xref="GeneID:38740176"
     mRNA            <95221..>97116
                     /locus_tag="MRET_3410"
                     /product="solute carrier family 9 (sodium/hydrogen
                     exchanger), member 6/7"
                     /transcript_id="XM_027630037.1"
                     /db_xref="GeneID:38740176"
     CDS             95221..97116
                     /locus_tag="MRET_3410"
                     /codon_start=1
                     /product="solute carrier family 9 (sodium/hydrogen
                     exchanger), member 6/7"
                     /protein_id="XP_027486183.1"
                     /db_xref="GeneID:38740176"
                     /translation="MAAPLDAEENERFSSLALFFVLFTLIISFLTSYYLKIKRITAVH
                     ETIVGLFAGMIVGVLLRLGPLKPVREMLRFSNTIMLNVLLPPIILSSGYELSQSKFFR
                     NFGTIITFAFFGTFISAMVIGAIIWTASSLYLLRPHLSLIECLIFGSTLSATDPVTIL
                     AIFNTYKVDPQLYNIIFGESILNDAVSIVMFETLNTLRGSKLTLSSLFSGTTIFAAVF
                     SLSMILGIMYGLACSLLLKHTKVGLFSDLESCIVMLVAYTSYFFSNSVGMSGIVSLLF
                     CGITLKHYAYHSMSRKTQRSTRFFFHTLSSLSENFIFIYLGLSLFTGDHLVYRPFLIL
                     FTIFAVIVSRYCAVFPIAWILNKISDMRAQHRHTSSSGFPQPPAFQIPRKYQLMLFWA
                     GLRGAVGFALSEGIDGPNAYPLQTSVLVAVVITVIVFGGTTAQMLDVLEIDTGIENQS
                     DASSDTEEDIDQLTWGGSAEEGQSRAWYRDTSVEPNDGPTTGVDTNEVIPGLDGTSSA
                     LPQAIVAGPGGLRNCTTDELDEQADVSVSDSNLSARDVIDRANLIFRDGEWFQRIDER
                     YLLPMFSNTVANRKHEQRKEYLTARRQSSRIASSNGSQALVVPHDTSADLEEQSGRIS
                     PGKNKLH"
     gene            complement(<97138..>98220)
                     /locus_tag="MRET_3411"
                     /note="MRES_13695"
                     /db_xref="GeneID:38740177"
     mRNA            complement(<97138..>98220)
                     /locus_tag="MRET_3411"
                     /product="proline iminopeptidase"
                     /transcript_id="XM_027630038.1"
                     /db_xref="GeneID:38740177"
     CDS             complement(97138..98220)
                     /locus_tag="MRET_3411"
                     /codon_start=1
                     /product="proline iminopeptidase"
                     /protein_id="XP_027486182.1"
                     /db_xref="GeneID:38740177"
                     /translation="MYVSKADGKDWKYPQTEPYASGFLDVENGTHRVFWSEYGNPCGE
                     PVICVHGGPGGGSDAFVARFFDPKRFRVLMFDQRGCGKSSPSASSNDVDAALKNNTTS
                     HLIDDMNKLRVHRKIDTPMHVFGGSWGSTLSLSYAIAYPSHVRSLILRGIFLCRKKDL
                     DFFYQGNAATFAQDRFDMSLPGAYMQYPEAWEKFVKVIPENERHDMIAAYDRLFSRSP
                     KTPTDIEYQNEAARAWSSWEGSTSYLAPHPDSLDEYEKLSFAKAFARIENHYFVNGAF
                     LGGKGRSNRSQNFILENVHRLLTIPIRIVHGRFDNVCPMFQADELVDALRRAGHESVE
                     LRRPPAGHSMTERENCLALTDIIEQL"
     gene            complement(<98328..>101384)
                     /locus_tag="MRET_3412"
                     /note="MRES_13700"
                     /db_xref="GeneID:38740178"
     mRNA            complement(<98328..>101384)
                     /locus_tag="MRET_3412"
                     /product="SWI/SNF related-matrix-associated
                     actin-dependent regulator of chromatin subfamily C"
                     /transcript_id="XM_027630039.1"
                     /db_xref="GeneID:38740178"
     CDS             complement(98328..101384)
                     /locus_tag="MRET_3412"
                     /codon_start=1
                     /product="SWI/SNF related-matrix-associated
                     actin-dependent regulator of chromatin subfamily C"
                     /protein_id="XP_027486181.1"
                     /db_xref="GeneID:38740178"
                     /translation="MSLNVNGYPDESLLSDANVFARLEPLVDPLTSALHEKSLNVPSK
                     GTLLNGQQLCEFLYELDTFQEDVLGYRSARPANPGAQLPSSRHPLRLPAALLQTFASY
                     TNFEPLSSDAPLFSIFLSCFTFLAEHHESTWDLKDKEKRNMYVEMIARVRAELRSKNL
                     IRPVRIAAASDVTQAEAAHFQSLAGSLGFEWVEDASQATHVLRPSTAEPAAPSSSDGP
                     PPESEYFRTLAHHDKKVLIHVWYRPDSYDTWMPDKDFSEPEPAPAPRTSAWYIDGRWL
                     RDSQLYNEIMNEEDYEAEEEAETSSGVVGSGKDESLANSAPSSEQKEDARRSKKHSLP
                     DTISDDTASKRIKILVGNRSVGAQAIDLSGSQPIPGKKYESEPIVSGTLGNLPTMEEV
                     TNTSSQSEHLPVRSANASDAVHDATHDEVLQTARKYLAEQTQEVIIPSYSTWFDMSTI
                     NAIEKRSLPEFFNNKNRSKTPTVYKEYRDFMINTYRLNPSEYLTFTACRRNLAGDVCA
                     IMRVHAFLEQWGLINYQIDPETRPASLGPPFTGHFRVLIDTPRGLSPMHPGTRPDAPI
                     KSETAATATSTVPMEGTSLELRKSIFQSTLKGSRPVDFAEAESLAAQAAQELDAQQDK
                     KPAYACDTCGADCTPSRYQSVRVKEFAVCPPCYLEGRFPTSMYSGDFVLLDHSAYKQA
                     GHAAGAGSVSGDDWTDEETLKLLEGLEMYEEDWSLVSLHVGTRSREQCITKFIQLPIQ
                     DPYLDGATQKDLGALQYAPRDPTSGQAVPLLPFAQADNPVMSVVALLASAVSPAVAAA
                     AAQSALGTLTDKVRKTIQDAAGQGAPSSEQGETGKDASLETKETLDNSGAPTEEMDED
                     TAAARSSSNDEKQNTGETIPKNEVERAASIALGASACKAYVLASHEERECQRLVQQVI
                     ELQMKKMHLKMSQFEELENLLEGERRSIEAARKQLYSDRLAVQRQLAAVNDLLRKAST
                     APQNVRPDELARASSSVNGVPQQGPVIRRAPGTNVPTDSNVARMDG"
     gene            <101578..>101921
                     /locus_tag="MRET_3413"
                     /db_xref="GeneID:38740179"
     mRNA            join(<101578..101724,101868..>101921)
                     /locus_tag="MRET_3413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630040.1"
                     /db_xref="GeneID:38740179"
     CDS             join(101578..101724,101868..101921)
                     /locus_tag="MRET_3413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486180.1"
                     /db_xref="GeneID:38740179"
                     /translation="MAGKGWFRPMFGFHPHRPMFRHRAAATLIGGMMWFWILVRMKED
                     GPVLLGWRHPWDHHGDHHDKHH"
     gene            <102390..>107486
                     /locus_tag="MRET_3414"
                     /note="MRES_13705"
                     /db_xref="GeneID:38740180"
     mRNA            <102390..>107486
                     /locus_tag="MRET_3414"
                     /product="Rho GTPase activating protein"
                     /transcript_id="XM_027630041.1"
                     /db_xref="GeneID:38740180"
     CDS             102390..107486
                     /locus_tag="MRET_3414"
                     /codon_start=1
                     /product="Rho GTPase activating protein"
                     /protein_id="XP_027486187.1"
                     /db_xref="GeneID:38740180"
                     /translation="MRTPSALSGIASSRDSNKRSSWDSSGSVLRSGHSSSYTGSILRF
                     MRSKDGHYMGATHAGISPPLMGDIVHRTSSREASISTPSSSQRSFSDSSARNGSRRRL
                     GRFWFSNPSRSNDEEGALMEGFIKRSTGLFSIAWFSDTVANTELKDPGRGWRPFKAVL
                     ISDTLMFYKVPTPMIPEVRRTFQIRSTQWPSTFHASDTISSSTVEPDDDDSVSQSTTI
                     PDSCTTLTVDDGETYTSWKSPNKHPELHLVNDDVFPSSWASRIDRGTPAALAHELVFG
                     TQRPSGGLLRQEADTKTFLHIVFYSLNTTHVPWHIFLNALSEYLGVCTATSSDVQRVA
                     QFVELLLWKRPLLHPGHDQHFFTAMESMITQLSQVESTPYAPMRQQLNEWWKQVQLGE
                     ACAPTDWLNEPLRVAGSLRTDLASLSRCWNVAVFVQQDPSEIARQIHSFHVDRLTSFL
                     RLPVTAYRLSSSVTETVLRSFRFDATRPHWLTHVIMRQLLVDEAPERQGDAMDVDRVT
                     VLQHWIKVGANLLHLGDLAGWVAVCAALCSRAVASLDILWRGLPAANRDLVTMQWSPK
                     LASFGWIEGVHAPVEPVWTVDGAGHVATTPGGIPYFGNAGILDASTTKSAANARVEVH
                     VASQEPEFHRVRTLAVRLGTLFENGMPIPMGPAPIYEYQALFQRLSTYEFVLQTGVTD
                     YMGSAVIVDGRVFRSTRVQNPADWPTKCVPDGDAFFMFPMVFPAIMPTRSVADTIMAR
                     RDVLMSSETDRAYASCGRCAARVAAQADEVPMSDELILYPMHPRLVGAKSVTTNNISS
                     EEYARKSARDISAQPEKRFSVEIRAATITRLLDILVLGTDHLVVRAPVEPRTEPITYQ
                     ILGVDLNISMFRDACLLSYRSWISASDLLESLMQRWHAAESACRELAYFARTNVPNQF
                     PSWKRSPNAQYAREPVDANRMTTIRLRVLESLHRWLELYPCEWIADLVLFDTLYKFLN
                     SILSECTAISSESPVLVDAIRELLNMLPTLPKDAIAALGLDCFANTGLAHNDHVSRAF
                     DWTLSATDLVVYLESMMALPYSLVSSHDLVLTALMFEQMHDDRQSWLEAASSDPDTCL
                     SMYRLLRRLPAVTHCSSGTTETKLWDILPRSVQELCKIHEVLRDWVEAQVTEPRIGLL
                     RRIARIHKFVDAVLLSRASMAHTMRRATTNDAGVRAPLPVTFLEYAVLEGLTSSRSQA
                     YRAAWEHVASERGVTAWLDLLATAPCTLPPDLPPCTPDIGWTITIFAHWAVRAKARSS
                     KTPLIEFNRYMSATDLVSDAIKLQQRCIPIEACLSVARLRLVWLRDFIDKASWPNTMV
                     LEDAALETSFGYMPSAAPVCLFSALEMEREQKRKTVKALLLKAIDLPDVSVEEQKDLP
                     TPPSDGLQNVSDTSVLDPFHYPDDSLLRAVPTTRASGSFCCTGALLVVWPYHKHPFVL
                     QMVSPNGQKCTLKLPNYDEFCRWLACLQALPHVRMSECFDAGAYAAHVAEYLGRASAS
                     CVFRVPLHELSIRNGGLPLPPAIERVLEEIEARGLHEQGIYRISGTRNAIDELQNQLD
                     TKSIHQISFSRIDVHVLSSVVKQWLRELPEPLVPYASYDMLIETERITQHEVRVKAMR
                     DLIRTFPKCHYLALQRVTYHLTLVAKSSKLNLMAAHNIGLVFGSTLLNPPAGAGSVAR
                     GLENLGRAAHVVKIAVLMHNEIFGSSKRKP"
     gene            <107871..>109859
                     /locus_tag="MRET_3415"
                     /note="MRES_13710"
                     /db_xref="GeneID:38740181"
     mRNA            <107871..>109859
                     /locus_tag="MRET_3415"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_027630042.1"
                     /db_xref="GeneID:38740181"
     CDS             107871..109859
                     /locus_tag="MRET_3415"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_027486186.1"
                     /db_xref="GeneID:38740181"
                     /translation="MQLTSTLLDFTKVASTLSLSVANYKPIPVLQTNDSSSHGRVGAV
                     SSHKSGTEDHSAASWGLPSILHVPESSSKGNNGRVASSHKDSSGKTVGAGCNVLDEYS
                     PKDSLNVEFPPYNQTRANIMRYRKQIGVNGGSWFVLENWMAPSMFDCAVDGKASEMDF
                     LNGYGGSEKGMKSAQARLEEHWDTWIQAKDFVEMKSLGLNTLRLPIGYWHLPGSNFTK
                     NSDFEPYGKVYVNAWKYIKRAIKYADDNDIGVLIDMHGAYGSQNGQPHSGVNNGKADF
                     FNDFNENKMTKLLVWLVQELEDVSNVIGIELLNEPHNTKRLWKWYSRTMDAMRKAQTK
                     SRDMPLYFHDAFSPSQGAEFVSKRDDFVVQDTHSYFVYTQQDRDMSASKHTSHIEGQV
                     QKSMSDLADKARGNMVVGEWSCALNPNSLRNSNNKRAATSDYCRAQTSTYLNATAGVM
                     FWSWNMEHCSSNAGWCFKSVLPRYMKNSYNAWGLDGQITNKTINTVTEKIISQELPSK
                     YRSDTKGKSLSVCNKDGGANQSSGSTKNSGRNAAVKKSQSHASKHDGSSKKNKHTLQH
                     RSESHEGALNRRGFHHHVLSDILGYGDGFNTAKFLAGMMSLSRLGFEQQYLSDTGEYY
                     KKHKIIDIGKHDSKSYKSHFKKGLNAMESKIIKIAEKA"
     gene            <110178..>111455
                     /locus_tag="MRET_3416"
                     /db_xref="GeneID:38740182"
     mRNA            <110178..>111455
                     /locus_tag="MRET_3416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630043.1"
                     /db_xref="GeneID:38740182"
     CDS             110178..111455
                     /locus_tag="MRET_3416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486185.1"
                     /db_xref="GeneID:38740182"
                     /translation="MSETSPVEVETGSVPDTYNSPSVSRMRRSTYHEAEVASLIKEGR
                     YHASPRNLYPRRSSQAETSASTAISSKKHDFDVKSALDSPSVAAKTWRDQHSTPPSSG
                     GPPDLGDEYIHRRTTNRRVPFSLPAKPHYMIPKRDIKTHRSASMNALTAHLSDAHLSS
                     PDAYMAQHQGGPPIPQSSTQTIFQQDSFSFKSQHTHNIRLALEQCQKLRERTNVVPNA
                     TTELVEQLETAAHLADTLNQKLHNVVHAQLNQRMEGERVLDGPYETIPARWHDAELSM
                     LLKYSDDLVRSLTDSILFILRGQRKPQRSSTSMSFTHTSPRQCISPHHATHRAATFQS
                     SDQNYALKNSSRSSHQYTSAIRSNGTSPHASMHNASQAVHSNSFMDSLHSPISRFGSF
                     WTDGASSVKSKSFYDLSSVTPRHRRFNERRDLV"
     gene            <111562..>113866
                     /locus_tag="MRET_3417"
                     /db_xref="GeneID:38740183"
     mRNA            join(<111562..111689,111715..112036,112061..>113866)
                     /locus_tag="MRET_3417"
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /transcript_id="XM_027630044.1"
                     /db_xref="GeneID:38740183"
     CDS             join(111562..111689,111715..112036,112061..113866)
                     /locus_tag="MRET_3417"
                     /codon_start=1
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /protein_id="XP_027486184.1"
                     /db_xref="GeneID:38740183"
                     /translation="MVAHDLSDASIGGTILLDGQYFRDAYGRVLLLRGVNVGGASKLP
                     SEPRNVLQTYADPEHLTFVNRPFSLEEAPEHCMRLRTWGLTLVRLLVTWEALSHEGPC
                     PEYPIDQAYVAYLRSLLGIFSDYGLKCIINAHQDVWSRLCGGSGAPGWTFSAASLNRN
                     HLEPTGAALVPGAGGIRMKSEPPTGKTEPTGPFNWPSGYQKMAPCTMNTLFWAGSVFA
                     PQMCLLRDTEGRILDEKDAINIQHFLQNAYVEAYGQLVDALASCPALIGIELMNEPHR
                     GYVNLYSFNRWNYLTDLHIGHYPSALQGLALGDGHSQMIPFYVKTWPVPSRLSHYTRV
                     DPQGLSAWYKSSDSQSFPNTRKQDGCLWREHGVWDWDEKKQKPIVLQADYFHVDPRPG
                     QQRRPVEWYRDFYAPFVQKFDQRVRRSSPSLFLLVEPIPNEFMPRWGHGKEPHPCTTQ
                     TILPQPRPSNFVYAPHFYDLNVLFFKSYRGMSVNVQGLGRGMFLLCALYFGTWGLFRN
                     YLHQITTLCRRGRDALGQVPILLGEVGIPYDVNESLIRNPGDYSVQVTLLDALISAME
                     KNWVSFTLWNYNPSNTVAHGDEWNMEDFSIINLELPAKDKQNTHYDKIEYQGGRALDA
                     IIRPYACKVAGIPQRTSWNRRTRTFTFTWRAMDTTSEDPKSAITEIFVPEYLTHGSVP
                     EIVVKHGEYEFHALNQTLYVKTTDEPGAMYSVTIRFGVRTKVQPVIGIGLAVLVLLFA
                     LLSHLYMKRMT"
     gene            complement(<113867..>114352)
                     /locus_tag="MRET_3418"
                     /db_xref="GeneID:38740184"
     mRNA            complement(<113867..>114352)
                     /locus_tag="MRET_3418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630045.1"
                     /db_xref="GeneID:38740184"
     CDS             complement(113867..114352)
                     /locus_tag="MRET_3418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486189.1"
                     /db_xref="GeneID:38740184"
                     /translation="MRESEIRDSRIPAHISDDALDDYITELIIEEARMKDPAYQREYQ
                     RSTAARLFARPREPSTRTNKRFLASMIRNADSHNQRRSAGGFKGEKERPQQRTSRWDL
                     APGSTRKRVHRDHDHTENASIPSRNRSRSPTYVKERPSEPEPRPSPKVRLWDLGKNVC
                     L"
     gene            <114502..>117528
                     /locus_tag="MRET_3419"
                     /note="MRES_13715"
                     /db_xref="GeneID:38740185"
     mRNA            <114502..>117528
                     /locus_tag="MRET_3419"
                     /product="pre-mRNA-splicing factor SYF1"
                     /transcript_id="XM_027630046.1"
                     /db_xref="GeneID:38740185"
     CDS             114502..117528
                     /locus_tag="MRET_3419"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SYF1"
                     /protein_id="XP_027486188.1"
                     /db_xref="GeneID:38740185"
                     /translation="MSTSTNSANNEVIDRIAENFPLTFPIPSPSTHEDLIPFDDLVFE
                     QELLRNPDNIRTWMDYISHVEETNYRKRPIPDPEMSSDGVKLLGFLSDKALRLALQRT
                     VGLYERALSVFPTSYKLWRRYLSARAFFVLGEPHDGSAGRRQRLLQTTNPSLEMGPAL
                     LDMRREEELQEYWHFALDGTLGWKEWRSLAAAYERALQWLPNMPRIWLDYLTLFVHPA
                     CSPILSKTHARRTFDRALRTLPGSLHLRVWKLYLRWAELCCGETARAVWRRYLSVDPS
                     LSEQYCTMLLEMPDEPCYSDGSKNALQSSSKSDDEDEDDDTLSPAKKSRVLEAAKLML
                     ILARKAWHGEYTSPNGKSSYHLILDWLELVERFPEAIGLSLQEEKALPRYDSEEAVTK
                     YDINVLDSSRLPIRQIVECDGLARFPDQAGRLWAGLATYYIKRGDLDTAWNIFEEGMK
                     KVLTVRDFTQIFDAYAESSENVISFMMEDLEDDEEDENAPPKEDQEAEIDQRMLEFEK
                     LMERRPFLVNDVMLRRNQDDVQEWEKRVVLWGENDEEIIATYKKALEIINPRKATANL
                     HRLYIHFAEFYEDGGSQGRKQPGSMERDVTSARQIFERAIKVPYKRVDDLAEVWCSWA
                     EMELRNGNYNEALRVMARATSSPSSQSKIQNVSYYDDSLSPQTRLFKSLKLWSFYTDL
                     EEAIGTLESAKHAFDRILELKIANAQTIINFAQFLEEQHYYEDAFRVYERGVELFTYP
                     VAFELWNVYLSKFVARYGGSKLERARDMFEQALDKCPANLCKPLYLKYGELEEKYGLV
                     RKAMSIYERAAHSVSEKDRYEMFLYYIAKAAANYGLVASRPIYEAAIEILPDRDAVSM
                     CLRFAVLESKLGEMDRARAIYAHASQFCNPKTQTEFWKVWNNFEIQNGTEDTFREMLR
                     IKRSVQAQYNTDMANVASSVMASALSSANAAPDDAASKVTPSDPMAMVEARNASAKAA
                     RPSAPAFVAASNLSRPSTETQNNTEEVGGDDDDELL"
     gene            complement(<117574..>119382)
                     /locus_tag="MRET_3420"
                     /db_xref="GeneID:38740186"
     mRNA            complement(<117574..>119382)
                     /locus_tag="MRET_3420"
                     /product="ubiquitin carboxyl-terminal hydrolase 10"
                     /transcript_id="XM_027630047.1"
                     /db_xref="GeneID:38740186"
     CDS             complement(117574..119382)
                     /locus_tag="MRET_3420"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 10"
                     /protein_id="XP_027486148.1"
                     /db_xref="GeneID:38740186"
                     /translation="MDVSAVKHYSGPEHYTDLCFEFNQASTANHNVQFVPVRRGRIKA
                     YSRRSTAGIVWKEAPFLVSTSAISTCIELSERAFLDARKNGVPMNDTRTQATSHYPIQ
                     FLMPSDLSPQRPTSLAWVQPRSWAEHAASPVQNKGRSALKLHSPGIIIHAPSSESSVS
                     HPSTPTRQYKPNIWSSPRSSLTVEQLYEKAHEFNRAPLTMPVGLVNQGNSCFASVILQ
                     MLVYCRPLYSFLTQLNAMVPQDLTNSTPLLEAIFQFYSEIPVLTNQNNMLNDDLDPIA
                     PDYIYDALRLHRRFDLFQLGHQEDAEEFFSLILNTLHEEVDLVYRRTVKKKQSTHKHS
                     TALEPVASKDPYAAYPPPSINDDSSDDEIDAREVQRPQSPDQNEWLEVGQKGKTSLTR
                     TSGNTDSESPITRMFDGKLRSTLSCPGTKTSIMLEPYRSLPLDIQPPHIHTIEDALRQ
                     ITEPEIISGVWSHQRNAPVDATKQVCIEALPPVLVLHLKRFVFDGTYGVQKSTKPIRF
                     GMTLDLPQDILSQPCRLVSAFNKYALFGVVYHHGRLATGGHYTVAVRRQDNSGWIHID
                     DTCVSPIPAEQVVSSALGNKLDMGQAYLLFYLRLEQ"
     gene            complement(<119604..>121676)
                     /locus_tag="MRET_3421"
                     /db_xref="GeneID:38740187"
     mRNA            complement(<119604..>121676)
                     /locus_tag="MRET_3421"
                     /product="R3H domain protein"
                     /transcript_id="XM_027630048.1"
                     /db_xref="GeneID:38740187"
     CDS             complement(119604..121676)
                     /locus_tag="MRET_3421"
                     /codon_start=1
                     /product="R3H domain protein"
                     /protein_id="XP_027486149.1"
                     /db_xref="GeneID:38740187"
                     /translation="MSDEGLSHALDTLSIRADIPAAKQVRGKSEGDIPSTYTSTPLDP
                     PSALYPFPFVNGNDKSSNPSQFPNLLLNESVSDANKPLYPQKRPSDPGFGGVSLVSTP
                     ANLPGNSVFSSPGLLNASGAQRPPPSFYTGPWGLPPQPGATMSISTDRSASPGNNTVL
                     SPTVPPTPAPLRFGNNVPTASTTSPSGEADIIPTAIVIKNIPFNIKREQLLHLIRDMG
                     IPVPYAFNYHFDQGIFRGLAFANFHSPSEANEVVAALNGLEVSGRKLRVEYKKVLRAG
                     EKERIEKEKALKRLNIPQATERDWKRDGKCLPSELSPFNGLNTLNPASAAIVTSGLPI
                     KDNHQKLTPEVSKPSFISRSPQGDSHDSSLDLNDAFTLEIYSRVLLFKDDRMRDELTF
                     SKSFTSAERRVVHLVSQKLGLHHSTVGSGDDCYVMVSKSGSLPQGSNIRDLPSVFVTD
                     RLSPRGTLSTKKSVPDMRRHTLQPDIQRTESPNSFSGLVPPSSNNLMPCRSNGSLHDV
                     YSLSPAPRFDGFSNFGSPLNSQNLFAYPVDASPVPYIMRPRSADIDALECAGLQGSSS
                     SSINRSRSPLHRPHSPLSQGAHSSPVTPLGNGVGPLDYAPPSIGAGILKGEPDLPVYP
                     SAQREGFSDFADAYPARFSSLSSDEYLKPDCDVVLPTHSAPSNEKEVNPLHLIPPTIT
                     TSSTSDDN"
     gene            122074..122178
                     /locus_tag="MRET_nc0008"
                     /db_xref="GeneID:38741164"
     ncRNA           122074..122178
                     /ncRNA_class="snRNA"
                     /locus_tag="MRET_nc0008"
                     /product="U6 small nuclear RNA"
                     /transcript_id="XR_003525365.1"
                     /db_xref="GeneID:38741164"
     gene            complement(<122283..>124235)
                     /locus_tag="MRET_3422"
                     /db_xref="GeneID:38740188"
     mRNA            complement(<122283..>124235)
                     /locus_tag="MRET_3422"
                     /product="WD repeat protein involved in ribosome
                     biogenesis"
                     /transcript_id="XM_027630049.1"
                     /db_xref="GeneID:38740188"
     CDS             complement(122283..124235)
                     /locus_tag="MRET_3422"
                     /codon_start=1
                     /product="WD repeat protein involved in ribosome
                     biogenesis"
                     /protein_id="XP_027486146.1"
                     /db_xref="GeneID:38740188"
                     /translation="MASYSASGATPGNGSAGSNGHDTSRGSVPDYSLSGVLHFLQSEW
                     RRYEHERNSWNIERAELRARIALLEGERRSVDNLKTDLLRRIKMLEFALRQERIRSSQ
                     NNSGSNSATVRNSNDRFSVGGGNASLNDDGHDMNKQLQFQSNGVKLPIGMKDSKGRAK
                     SRAYLQQCLQEIAYLTSNITLNPIMNQTNSSESEGQASQVSRPMFIVPDEPSAEIQND
                     GNMVKGSVPVQDTSTHDELEVKQASRPFPDKNAPESKSALATQEANPTSFSVAERNLT
                     SQNLANVPDVQLWNSRGTIDAHFDSINSLAYDSSGFGFFTASDDCTIKYWRLSSPEAP
                     NNSTEGANPKLLTTLRGHEAGVRCLVYSKKLNKLFSGSLDATIRQWTLPEETPMKDDP
                     ILDSLQSSVFTKNTHAVHDMSLFALNGKEDALLATVCADGTVKLWFTEDASTPTPFLS
                     WDYYGTDPDAEVKMERPSMASLPLPTSVTSCPADLRICAVSFSNGVLKLFDLTSGREL
                     KHFASPSSSLPINAVVGHPTLPLVATAHQDQYIHMHDINSSACTLSLHAHENGVVCLD
                     IDPSGLTLVSGSSDGKVRFWDLVKSNESEQMASDAAKQTYTAVCFQEVSAHQIKHGKG
                     VLTSLYHPTLPFIATAGADGTVHMFG"
     gene            <124450..>125568
                     /locus_tag="MRET_3423"
                     /note="MRES_13720"
                     /db_xref="GeneID:38740189"
     mRNA            join(<124450..124467,124501..>125568)
                     /locus_tag="MRET_3423"
                     /product="transcription factor SPN1"
                     /transcript_id="XM_027630050.1"
                     /db_xref="GeneID:38740189"
     CDS             join(124450..124467,124501..125568)
                     /locus_tag="MRET_3423"
                     /codon_start=1
                     /product="transcription factor SPN1"
                     /protein_id="XP_027486147.1"
                     /db_xref="GeneID:38740189"
                     /translation="MAARSTEHADIFGVDSDEEIENEVTQPVVESTQNAEPATEINDE
                     SGEDHLPHIPRREVTEDMIDPEPKRQKKKHSEPAQDDTEVRNDETNKDEEEPLSGKAQ
                     IRAQVEARIEAALNSNKRRNTRRRKTGDDDLELMADEEVSALRAEMLAAADEDEEANR
                     FRQPATAKLRLLPRVVSTLQKTHLQQAIMDNNLLEGVKRWLEPLPDRSLPALNIQKEL
                     FGVLENMSIDTISLKMSGLGRVVVFYTLCKRVEPSIHRVAEHLVEVWTRPVLKRSASY
                     RDRQVAQAEWHQNSPHNPSSQLHESAFATDKNRRHVGIPQSVTTGFQVAPRNRGSGGA
                     NEHEYQSRLAYNQRLNRFKSRLKEARQ"
     gene            complement(<125821..>126429)
                     /locus_tag="MRET_3424"
                     /note="MRES_13725"
                     /db_xref="GeneID:38740190"
     mRNA            complement(<125821..>126429)
                     /locus_tag="MRET_3424"
                     /product="small subunit ribosomal protein S9e"
                     /transcript_id="XM_027630051.1"
                     /db_xref="GeneID:38740190"
     CDS             complement(125821..126429)
                     /locus_tag="MRET_3424"
                     /codon_start=1
                     /product="small subunit ribosomal protein S9e"
                     /protein_id="XP_027485948.1"
                     /db_xref="GeneID:38740190"
                     /translation="MPTATRHCKGAPRNHSKTYKVPRRPFESPRLDAELKLAGEYGLK
                     NKKEIWRIALTLSKIRRAARELLKLDEKDPKRLFEGNAIIRRLIRIGVLDESRMKLDY
                     VLALQIEDFLERRLQTQVYKSGLARSIHHARVLITQRHIRVGKQIVTSPSFIVRLESQ
                     KHIDFALNSPYAGARPGRVKRKRMASANAAAGGEEEGGEEEE"
     gene            <126662..>127144
                     /locus_tag="MRET_3425"
                     /note="MRES_13730"
                     /db_xref="GeneID:38740191"
     mRNA            <126662..>127144
                     /locus_tag="MRET_3425"
                     /product="large subunit ribosomal protein L21e"
                     /transcript_id="XM_027630052.1"
                     /db_xref="GeneID:38740191"
     CDS             126662..127144
                     /locus_tag="MRET_3425"
                     /codon_start=1
                     /product="large subunit ribosomal protein L21e"
                     /protein_id="XP_027486145.1"
                     /db_xref="GeneID:38740191"
                     /translation="MPHSYGYRARTRHMFAKKFRKHGQVQLSRFLRPYHAGDIVDIVA
                     DSGEQKGMHHKYYQGRTGVVYGVFPRAVGVIVYKTVGNRKIEKRVSIRVDHVRHSKCR
                     DNFVNRVKANAAAKHAAKEKGEHVNLKRQPAQPREAHTIQVAQNKPVTLAPQPYDTLI
                     "
     gene            complement(<127319..>130189)
                     /locus_tag="MRET_3426"
                     /note="MRES_13735"
                     /db_xref="GeneID:38740192"
     mRNA            complement(<127319..>130189)
                     /locus_tag="MRET_3426"
                     /product="carbohydrate esterase family 9 protein"
                     /transcript_id="XM_027630053.1"
                     /db_xref="GeneID:38740192"
     CDS             complement(127319..130189)
                     /locus_tag="MRET_3426"
                     /codon_start=1
                     /product="carbohydrate esterase family 9 protein"
                     /protein_id="XP_027486143.1"
                     /db_xref="GeneID:38740192"
                     /translation="MSCSMCEKSFMDGRRGYSLWQNGLIVLVLLIMASFTVNPIHFLS
                     AHLRQTFSARIPPPHIKAAHQQCQFSRAPAGPPPHFSERTQNDRFALGTRATVIRNAT
                     VFDGHNMFVGKDVFVDQGLIVSLESTMAQIAAPSDAVEVEAWGRWLTPGIIDMHTHLG
                     VQGMPDLPTHSDTNSNLSPVRPMVRSVDGLNEHDISLRTTLAGGVTSALVLPGSLNNI
                     GGHAYPIKLGDLHGRPPSSRLIDPPRALTILGEADHGRDGLYSAASGMRRPDGSTSFR
                     QIKMACGENALQYGLVRPDEAWNFRSTFERAAKLREKQDDFCQRLDDGLLNNAPPEES
                     HFPNDLELDILVDVLRGRTKVHTHCYTMNDLDALVRHANEFAFSIAAFHHAHETYLVP
                     STLHAAPGRPPAAAIFSTNAYYKYESYFGTPFLAELLQSHNITPIFKSDHPVTDSRRL
                     VNQAAQAHHFGLDELEALKSVTSHPARVLGLDHRIGRIARGYDADLVLWDRHPLQLGA
                     TPVAVYVDGVSQLGKAYASGGEALKTRDAPPSADYSHEFQRVRNESDAIASGRARAFP
                     EPIFEASAVVLRNVSRVFQRANDSIHVLNLVSDGTLVYANGRVTCVDAYHVCHDQVPP
                     HALSVHLHGGTVLPGLTSYGSTLGLSDVPSESSASNGQDPSLLTRHLYLDTKRLVPRA
                     EDGLIFGGHALRRAHASGVTTAVNVPATIGMFGGVSTHFDTGARTVLDAHSVRTSEVA
                     LHVRLAYPIDDHEPSLATQLALLRSLLRNPPPGSVEWHRVSRGEWPLVVKTNAQDTVA
                     KLILLKRAFPQVHLIIDSAGALHEVAKDLAEAHIPVIVPAKVWEYGWEQRGRKEGPPL
                     TADTELGVLLRHGVEVGVRVQEAWEAANLLWETAWAAQEAHVSDATTILALVTTNLER
                     MLHLHVPSDVANFVAFDRDPFTYGAKVVAIGTPRSCELFSAS"
     gene            complement(<130305..>130952)
                     /locus_tag="MRET_3427"
                     /note="MRES_13740"
                     /db_xref="GeneID:38740193"
     mRNA            complement(<130305..>130952)
                     /locus_tag="MRET_3427"
                     /product="ankyrin repeat domain protein"
                     /transcript_id="XM_027630054.1"
                     /db_xref="GeneID:38740193"
     CDS             complement(130305..130952)
                     /locus_tag="MRET_3427"
                     /codon_start=1
                     /product="ankyrin repeat domain protein"
                     /protein_id="XP_027486144.1"
                     /db_xref="GeneID:38740193"
                     /translation="MSLTDTQVDDVLWAARTGDLEVWNILKKELDVTAALASSNDSGN
                     TALHYAAANGHLEFVRQVLPQANLEILLMQNESGNTPLHWAAFNGHLNVAEALVDRIE
                     ALEMQDEVTAKRLRAEEDQREHQRHAEKNLEEKDESEDARKAELAHHDEMQSERALWD
                     VRNKAGRGPMSEAQMTDREEVVQMLLSHLCDNARPSPQSTDDLTTRTDNLHVSEA"
     gene            <131188..>132984
                     /locus_tag="MRET_3428"
                     /note="MRES_13745"
                     /db_xref="GeneID:38740194"
     mRNA            <131188..>132984
                     /locus_tag="MRET_3428"
                     /product="Sds3-like protein"
                     /transcript_id="XM_027630055.1"
                     /db_xref="GeneID:38740194"
     CDS             131188..132984
                     /locus_tag="MRET_3428"
                     /codon_start=1
                     /product="Sds3-like protein"
                     /protein_id="XP_027485997.1"
                     /db_xref="GeneID:38740194"
                     /translation="MDMSASGTEEVEIHRTPTEPTEQATSPLTSDAETEPLSMDEEDG
                     MNVQKSVEDHVSMPQKEVHMEPSATSEQPAGQLGDESDLTDESDQAKPNPESIEHEPV
                     KEDEDSSLSEDVGDHTLKPGGNEAESQHSALDGLAVLAASETEGEKHEDVDAIAPSSS
                     VLTPEASQDEATEDMEADDEGEEDDEEEPIPNKGARKEPSLHRAVMAAVGKRRAAATG
                     GAPSLLVQPDADASNPPSASTSRQGSPVEDVQTKEETPAEEESAETGGQATEAAENED
                     EASDHRQEALEQLTRIELGFVMLRQRLYAERIEELEREANMIHQGTHPEIQMLHTLID
                     LRKEKRLRYLGMWLQCRLREHERRAQAEEKIAWVNWRDRAASLRRDMMGEMDRKRRKL
                     EREKRMLDAPQPMRRYQPFEAEFAHKPPSYSRWTRQRPDQYLPYGASLRDPRSFVAFP
                     DVRGLEEYDAWMDMEQMGIRPVPMPPPTYLRPDDMPPHEMYAAPSYAGGLPGSEPMGY
                     YGPPEAGPPYVEHSRPLPPVAAPYEGMYVEPMEMSSHPADLEGAPPAAAPPLPPSRGL
                     PAQLGPPPSAAGRPPFAAEQPMGIPISHVVRA"
     gene            complement(<132998..>134323)
                     /locus_tag="MRET_3429"
                     /note="MRES_13750"
                     /db_xref="GeneID:38740195"
     mRNA            complement(<132998..>134323)
                     /locus_tag="MRET_3429"
                     /product="pyruvate dehydrogenase kinase 2/3/4"
                     /transcript_id="XM_027630056.1"
                     /db_xref="GeneID:38740195"
     CDS             complement(132998..134323)
                     /locus_tag="MRET_3429"
                     /codon_start=1
                     /product="pyruvate dehydrogenase kinase 2/3/4"
                     /protein_id="XP_027486142.1"
                     /db_xref="GeneID:38740195"
                     /translation="MVIFGRNANPGTLYLAGSFLMDELPVRLAHRVKDLQELPDNMSD
                     MPSIIKVKNWYAQSFEELVSFPQPHLPESLQQKLYRASLQDMDTDQLPATPNPSLQEN
                     ASLDDGLSKAHLTVNSKRAENMNTRRRPMLSYGIQAQMDDVEWPLSLIEFNNSFTRCL
                     ERVKHRHDAVVVTLAQGILEYKRAKGGDEDKAGMQTFLDRFHMSRIGIRMLIGQHIAL
                     GRSCMAPKKGALNYLATQATKGAISDVSGTEPEKFVGIICTNTNVGAVAHEAIENARF
                     VCEEHYGLFRAPPVQLVCPPNLMFMYMPSHLNHMIFELMKNSLRAVVERYGVEREDHY
                     PPIKVIVVEGKEDITIKISDEGGGIPRSEVPLVWTYTYTTARPDDLDPDFQTSDFLAP
                     MAGFGYGLPLARLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLP"
     gene            <134644..>135557
                     /locus_tag="MRET_3430"
                     /note="MRES_13755"
                     /db_xref="GeneID:38740196"
     mRNA            join(<134644..134677,134705..134780,134849..134868,
                     134907..135491,135532..>135557)
                     /locus_tag="MRET_3430"
                     /product="F-type H+-transporting ATPase subunit b"
                     /transcript_id="XM_027630057.1"
                     /db_xref="GeneID:38740196"
     CDS             join(134644..134677,134705..134780,134849..134868,
                     134907..135491,135532..135557)
                     /locus_tag="MRET_3430"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit b"
                     /protein_id="XP_027485790.1"
                     /db_xref="GeneID:38740196"
                     /translation="MASRIASRSAQAATRRVLSASVPRQAVMPASMMTSTPTRFYSDK
                     PTPEAKATSIIDSLPGNSLISKTTWVTLGAGLTAFGVSNELYVANDETVILAGFLIFA
                     TLLGRSVAKPYTNWADSTIAKISGILNEARSGHTQAIQTRIDSVNEKKDVVDVTKGLY
                     DLAKETVQAEKEAFELKQKTQLAAEVKQVLDSWVRYEAQERDAEQRLLTETVIEKVTQ
                     TLRDDKTQKQILDGAVAEIEQLVKSKKI"
     gene            complement(<135602..>136711)
                     /locus_tag="MRET_3431"
                     /note="MRES_13760"
                     /db_xref="GeneID:38740197"
     mRNA            complement(<135602..>136711)
                     /locus_tag="MRET_3431"
                     /product="cyclin-dependent kinase 7"
                     /transcript_id="XM_027630058.1"
                     /db_xref="GeneID:38740197"
     CDS             complement(135602..136711)
                     /locus_tag="MRET_3431"
                     /codon_start=1
                     /product="cyclin-dependent kinase 7"
                     /protein_id="XP_027486108.1"
                     /db_xref="GeneID:38740197"
                     /translation="MASRETQELNDKVRSKYEKIDKIGEGTFASVFLARDAETGAKVA
                     IKKLKVAAAGTRDGIDITAMREFKFLKELQHPNIVALLDVFSSGASTQSINLVLEYLN
                     TDLEAIIKDRSLLFRESDIKSWMNMLCRGIEYCHRNWCLHRDLKPGNLLVSPSGELKI
                     ADFGLARECGDPGARMTSQVVTRWYRAPELLLGSRAYSAAVDMWAVGCIFAELMLRTP
                     YLPGESDAAQLTTIFRALGTPTSADWPQHQSLPLYRPFEQFPKQNLSLLFTAASPESL
                     DFLSQCLRYDPLRRLRSSEALQHDYFRTGVLPTSPVNLPRPASSIPTATEAKEETLPV
                     PQDAPTTGTTAGQKRTLTEEEIAKRRRLAHLVAFS"
     gene            <136817..>138532
                     /locus_tag="MRET_3432"
                     /note="MRES_13765"
                     /db_xref="GeneID:38740198"
     mRNA            <136817..>138532
                     /locus_tag="MRET_3432"
                     /product="Rab5 GDP/GTP exchange factor"
                     /transcript_id="XM_027630059.1"
                     /db_xref="GeneID:38740198"
     CDS             136817..138532
                     /locus_tag="MRET_3432"
                     /codon_start=1
                     /product="Rab5 GDP/GTP exchange factor"
                     /protein_id="XP_027486110.1"
                     /db_xref="GeneID:38740198"
                     /translation="MEREQDLQSEPVENEQVANEQKVSESVVGADHPGQLNDTTPNKP
                     EPREDTSSQETTPTARANDKGKERSIDPVPPEESNTYTSKRAQVPTEKPFDFNRFLEQ
                     MKHKSAVPVNEYVRSFFRGFTRRPYKPDEQAKLIFDFLDFIAARMLEATVFAELPPRE
                     FDQATEAMEKLVMNRLYTYTFPPAIAMEGRWTVQTDDLERDRVLSERIRLFAWVREEQ
                     LDVKKGQHSERFYIFAAQELNKVNHYKAPRDKMICILNCCKVIFGLIRHLGSDESADA
                     FMPLLILVVLRANPPNLISNWEYIQRFRSPPRRSSESEYYLSSLAGAIAFIEQMDHTT
                     LSHTTQLELDERIQREAARMEEEAAEKSESTSRPFSVTASMAAVSLADDTRAFIQRTG
                     EAARHGLNRLFTERPDMIGSEMQPMPSTRVASQPETPAPSTIPNSKPARGEAPNAPLR
                     GPVSSPMLPDSPASVSTPHTRTDAVPRWRSGLVPRFGEDEDDDLRDSPSHHVAAIRYA
                     EEDQSLVAGEEHQDEEEVSVDVSVAIQTLQSIFPQADSSVLQLVLEECGYHVETSIDR
                     LLEMT"
     gene            complement(<138543..>140351)
                     /locus_tag="MRET_3433"
                     /note="MRES_13770"
                     /db_xref="GeneID:38740199"
     mRNA            complement(<138543..>140351)
                     /locus_tag="MRET_3433"
                     /product="nucleolar protein 12"
                     /transcript_id="XM_027630060.1"
                     /db_xref="GeneID:38740199"
     CDS             complement(138543..140351)
                     /locus_tag="MRET_3433"
                     /codon_start=1
                     /product="nucleolar protein 12"
                     /protein_id="XP_027486109.1"
                     /db_xref="GeneID:38740199"
                     /translation="MPREGSTGASAPSTASKGSFDAELDAMFSAPPPAQKPLLHEHDD
                     HAEHGEEDHVDEDDDDDDEEGEDESIDDDKQEKSETLNQDANDEDNASSQEDGDWDEE
                     KTAEMVLSGALDKKRKKKPTLEDENDTEEARNKRTIFLGNVPISAMTSRAVRKELQRH
                     IVRVSPYPSCTEVVSLRFRSVSFRVPTSDMSGVSPGSAVGDKRRERARKFRELKGISE
                     KEAPPPLTSEQKRKIAYINLDLNERADSVNAYVRLGDPSLVHKHKQASNALEEKLTGP
                     ILTTLLARALDNTLFHERHLRADVVQSLDMHEIVDAELDKVMLPDGTPLSHRSASTID
                     PKRTIFVGNLDFEAHEEEVRGLFEKLMCEERGPPPEVTSHAVRLDGTPVHTEPLPGEW
                     VQSVRIVRDKATQLGKGFAYVKFVDPLCVDEMVALAEAEEAFVAAGRPQISRQGEVQS
                     AKKINLQEGQEFRRRIKLHKRALRVSRCKATTGDERKRRRPVSDAPKTPNKRSIPESL
                     ARSRSSGAPTPNGSSPTLARPGRAKAAYLATLSKEQRDLAKKSDPERQARRLQKKHEK
                     KQAHKLTSKVGQGRERVKLPQRGAAKKMTRAKGKAA"
     gene            complement(<140475..>141860)
                     /locus_tag="MRET_3434"
                     /note="MRES_13775"
                     /db_xref="GeneID:38740200"
     mRNA            complement(<140475..>141860)
                     /locus_tag="MRET_3434"
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /transcript_id="XM_027630061.1"
                     /db_xref="GeneID:38740200"
     CDS             complement(140475..141860)
                     /locus_tag="MRET_3434"
                     /codon_start=1
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="XP_027486105.1"
                     /db_xref="GeneID:38740200"
                     /translation="MERPTNIGIKAIEVYFPKRCISEDELEDFDGVSKGKYTIGFGQQ
                     YMAFTDDREDINSFALTTVSNLLEKYHIDPKSIGRIDVGTETIIDKSKSVKTVLMDLF
                     EKHGNTDIEGIDSKNACYGGTAALFNAVNWMESSSWDGRDALVFAGDIAIYAEGSARP
                     VGGAGSVAMLIGPDAPLVLEPIHGSHMSNMWDFYKPDLSSEYPQVDGPQTLYAYLGSI
                     DKAYDAFRLKYAKMAEKKGLPTFEKKSSDERTAFTMDQVDFAILHSPYAKLVQKGFAR
                     LFFNDYLVDAASEKYASIPQEFKEVDRHQSIMNKDLEKTFMAWSKSAMASKLEPGMTT
                     VRRCGNMYSGSLYGGLASLVSNVPDTDLQGKRVLMYSFGSGCAASIFTIRVAGSTENI
                     RQTLNLEARLQNMQIVSPSAYVDALQTREKTHNAVSYEPKGSLEDIWPHSYYLKNVDE
                     KFRRFYEKRSI"
     gene            complement(<142014..>143219)
                     /locus_tag="MRET_3435"
                     /note="MRES_13780"
                     /db_xref="GeneID:38740201"
     mRNA            complement(<142014..>143219)
                     /locus_tag="MRET_3435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630062.1"
                     /db_xref="GeneID:38740201"
     CDS             complement(142014..143219)
                     /locus_tag="MRET_3435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486104.1"
                     /db_xref="GeneID:38740201"
                     /translation="MLEAHLLPRRRGVEAANASQLAFPQLLQSLDPQSFNPITQHPFI
                     EDEPVPPTSLQDEVIQVPEHLLPATEDLHHDTLPVEQHPSYPLGNAYWIHHAPHTLQP
                     SGSSQPKLDPRICSHMSMRMLASSQKEALCSVATGSIHAKSALESHDEEPGPLPYSVD
                     ADGHVALAPHLQWRAQMQTTSAAPTWPFQRVGPGPCERSYASLFRVPEELSPDVSVWA
                     DLALEELVPRTRPDTYTFPSSLVHPYTQPDSGDRKRQRPSGIPPSLGIKTQVHDDEWF
                     ADDDPLHDAAELDADLLDDTSFEKELEDWVTEDMAIDPRTAPSRRVSSVWMREEHEFR
                     RAILSVFEQRGTLRKRPASMSPMPPTSSRKRRSLVPQMAETAPIATHTSTPPPWIWGQ
                     SRSLRDSAS"
     gene            complement(<143241..>145430)
                     /locus_tag="MRET_3436"
                     /note="MRES_13785"
                     /db_xref="GeneID:38740202"
     mRNA            complement(<143241..>145430)
                     /locus_tag="MRET_3436"
                     /product="AAA family ATPase"
                     /transcript_id="XM_027630063.1"
                     /db_xref="GeneID:38740202"
     CDS             complement(143241..145430)
                     /locus_tag="MRET_3436"
                     /codon_start=1
                     /product="AAA family ATPase"
                     /protein_id="XP_027486107.1"
                     /db_xref="GeneID:38740202"
                     /translation="MPPPSLQGTTEALPVHIRTASASAADDTRVLVRADALKRSGIPT
                     GAHVLLRSTHAPTPLWAGTVWPDFDAQAPGVSVSSLSADPLGRDVIVACVRDAPTVPR
                     LTVALDTAPTPLLHALLMHTLVDMGAVALDRAWRITLLGHVYEARPLRPSNATSDVVL
                     VTRDTHLTLEETAQAAPLVDASAYHALGGLDTQIAAIRTLIELPLTQPQLFAQYGLTP
                     PRGVLLYGPPGTGKTSLARTVAASLHAHVLTINGPELSSVYHGETESKLRAVFESAAS
                     HARSIIIMDEIDALAPRRDGDASLHAEGAGEVERRVVATLLTLLDGIESHHVVVIAAT
                     NRPNAVDPALRRPGRLDRDIEIGVPDSLARHAILQVMLKHVPHSLSEQDLNDLATRTH
                     GYVGADLAALVREAGMATIARRLHAPLADSLASLSLTHSPDKVCMSDFSAAQNIVRPS
                     AMREVFVETPKVTWDHIADDDDASIKRQVQECVEWPLKHAASFARLGIDPPRGALLYG
                     PPGCSKTLTAKALARESGLNFLAVRGPELVSKYVGESERAIRDVFRRARTAAPSIVFF
                     DELDAISGVRGMDQSAGSSDRMVASLLTEMDGIDAESHVVVVAATNRPECIDPALLRP
                     GRIDRLLYVGMPNATVRERILTMRTKRMALDEDVDLRVVAELAMGCSGAEVVAICQEA
                     GLCALKEDLSCTRISHRHFDKAARAMQRRITPSMLAHYEQWRQKMTL"
     gene            <145476..>147140
                     /locus_tag="MRET_3437"
                     /note="MRES_13790"
                     /db_xref="GeneID:38740203"
     mRNA            <145476..>147140
                     /locus_tag="MRET_3437"
                     /product="ubiquinone biosynthesis monooxygenase Coq6"
                     /transcript_id="XM_027630064.1"
                     /db_xref="GeneID:38740203"
     CDS             145476..147140
                     /locus_tag="MRET_3437"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase Coq6"
                     /protein_id="XP_027486106.1"
                     /db_xref="GeneID:38740203"
                     /translation="MLRLKVTGLLRRRCVHTAARQSDVVVIGAGVVGMAMLAGLVSSQ
                     RMAPMHVTMIDANQVHGYGGWMDRMRERTRAATDRHDGIPWENRVISMTAENLGWLRT
                     IGAEAYLDASRMRAVDRIRVWDGLTDAAAEFSNETTLSTMVELSNLQQALYRYVQDRL
                     PRSRLRLTIQDAARVARIEADTPDDWPRITFQDEAGEHVVRTRLLVGADGARSPVRTF
                     AGIESYGWSYGCKGLVATLRTGLHTRSAEPVVDTMAWQRFMPTGTLACLPLSPTAGTI
                     VWALPPELCDPIVAMHRAARVHCDGTSSVLATLISAAFRLPWALLEPILYGVSTTAPE
                     ALERRVLDVMASYEQSGAAPSAFTGAVPPWGDAVDARGVASFPLQLKHAGCYIGSRLQ
                     HPGPLSTALTAALTALSLTPGGAARGGGQGRTVLVGDAAHSTHPLAGQGLNMGLQDVR
                     ALCEALQDASLHGMDIGTHQALQPYERARYLPNQIMLSVTDHLHWLFATRPASPYTHP
                     MHPLQRSLREQALRALVWARSTGLDVVNELGPLKRLLTAGAGSARS"
     gene            complement(<147142..>150078)
                     /locus_tag="MRET_3438"
                     /note="MRES_13795"
                     /db_xref="GeneID:38740204"
     mRNA            complement(<147142..>150078)
                     /locus_tag="MRET_3438"
                     /product="DNA repair/transcription protein MET18/MMS19"
                     /transcript_id="XM_027630065.1"
                     /db_xref="GeneID:38740204"
     CDS             complement(147142..150078)
                     /locus_tag="MRET_3438"
                     /codon_start=1
                     /product="DNA repair/transcription protein MET18/MMS19"
                     /protein_id="XP_027486103.1"
                     /db_xref="GeneID:38740204"
                     /translation="MEAACDAYVRGAEVAVPSSVCEAVAEGACTMLDVVKVLGVPLTS
                     EEDAVRARAITLLSRVTGHVAARAPQRLSRQAVRTLSEFFSAKVSDAVIVGDSMAQRM
                     NEAPHVPASAPRASLQAEEDRAMQADGMLVECVRALRVLSGLPAPAGAMASDARTIAA
                     ALFGLDLRKYPQPLRFLVYDVVRTLVERHLGALRAMRVPDGADGSAFVRGYAQLVGGE
                     KDPRNLLVLFGVARAFLTAWPLPATEAEAMYNVLFCYFPISFRPPPDDPFGITPDDLK
                     RALRACLAASPAFATMAYPLLLEKLSATGGASKLDVLHTLTACMPVYGAGPTAAHAAD
                     LWSYVRLDIVQPTEAAVVPAAQETLTTLIRVLGATHPHVHTILEACIDDVRDAHARRA
                     SDAMLVLACLVRAGPDTRARTTQSVLRVLTREASPRPWALLATYLDMLCDTSTPLDRE
                     ALLALLTSEEAVASVHGMHALVALVRVPHSMHSDDAARAAPVWQDAVLSADDEIRACA
                     LEGLEAIRDAHPTLIETRTVPYLLHHLPTHIEAPPLRVRVVLHALARLCTTRTLFPLF
                     SRRVWDTLEAMRACEADAAHVGYVCALIVALHVAMEEQVSASDAPVREHAEDVAQRLV
                     AYRRAPIATHAHVAQHASDLLVLVGPHLSPEVASALASDVYAAPPWDAPCAAVMVGLP
                     RAASVPYASAWLHDVLATPPSTLPQHWLLCALANKWATPDSAALERLWQRIPDAPPEA
                     RAAALDAWTWTACGWLSRAEPIGQQMLDTLYTCLIQDARLGMQAAHALRVLTLHSRLV
                     SPSRGFVVRRLYRQRTMETMLVAVTEALEGRCAAREPCLVAMATLLPGATDALVSMHL
                     TTWLPLLVHTLGMDDAPVRLTCARTLQRIVSSEHAAALAEHLPLLVPRLLDAAATPQA
                     PRLRVAALQALQALTDAVPAAHLDAYRRQVVQALGRPHRGVDDAVRAVRTAAVDCRAA
                     WYATQE"
     gene            <150121..>151233
                     /locus_tag="MRET_3439"
                     /note="MRES_13800"
                     /db_xref="GeneID:38740205"
     mRNA            <150121..>151233
                     /locus_tag="MRET_3439"
                     /product="essential RNA-binding component of cleavage and
                     polyadenylation factor"
                     /transcript_id="XM_027630066.1"
                     /db_xref="GeneID:38740205"
     CDS             150121..151233
                     /locus_tag="MRET_3439"
                     /codon_start=1
                     /product="essential RNA-binding component of cleavage and
                     polyadenylation factor"
                     /protein_id="XP_027486102.1"
                     /db_xref="GeneID:38740205"
                     /translation="MDAAQHAALRSEIAQLSGAIDQQRSRIAHRGSARARGRGRHRSL
                     VLTHTPTDQWVHRRTNKSLALVNSSVYEPERPRAPANSGEVLVDGVPFVFDESGTKLV
                     KRSTLPTTPAAPRQASVHGEAYVRTKRGHLISKALVMERRAARAQHERTQRLAALGQQ
                     IGRAHQQQRAMLRAKAPPPLCTYYTRTGTCRRGAKCPFVHDDARKALCPGALKASGCV
                     LPPSTCPLSHTPSAHNVPHCVHFLRHGSCRNGDHCPYTHASLAPDAARCHAFAYLGWC
                     DQGAACAHRHTKEAPDTPARAPAAPASPLFVRDDYDAPDEERSPSFAEQDDFIELGED
                     VSDVSDDEASDASDHTDPAAGDAADVAEVDAALGMW"
     gene            complement(<151256..>151711)
                     /locus_tag="MRET_3440"
                     /note="MRES_13805"
                     /db_xref="GeneID:38740206"
     mRNA            complement(<151256..>151711)
                     /locus_tag="MRET_3440"
                     /product="DUF602 domain protein"
                     /transcript_id="XM_027630067.1"
                     /db_xref="GeneID:38740206"
     CDS             complement(151256..151711)
                     /locus_tag="MRET_3440"
                     /codon_start=1
                     /product="DUF602 domain protein"
                     /protein_id="XP_027486001.1"
                     /db_xref="GeneID:38740206"
                     /translation="MIRRAKKAASASEHEVARHVKSVKADVRQVTLHANRVQEAERGD
                     IHYFPYACPLTQRVMNGKHKFVCLWPCGCVVSETGLRETCLAGQSKRELIQPHACPQC
                     AQAFRPDALVAEEPRWGADVVWLYPSRAARDALEAQRQARSKRKAAPQP"
     gene            <152056..>152721
                     /locus_tag="MRET_3441"
                     /note="MRES_13810"
                     /db_xref="GeneID:38740207"
     mRNA            join(<152056..152067,152095..152158,152183..152232,
                     152258..152368,152394..152555,152581..152646,
                     152674..>152721)
                     /locus_tag="MRET_3441"
                     /product="DNA-directed RNA polymerase II subunit RPB7"
                     /transcript_id="XM_027630068.1"
                     /db_xref="GeneID:38740207"
     CDS             join(152056..152067,152095..152158,152183..152232,
                     152258..152368,152394..152555,152581..152646,
                     152674..152721)
                     /locus_tag="MRET_3441"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB7"
                     /protein_id="XP_027486064.1"
                     /db_xref="GeneID:38740207"
                     /translation="MFFLKNLDHRIELHPSFFGPSMVEFLNRKLRDDVEGTCSGKCGY
                     VIKVVSILDVGQGKIMPGTGLAEFRSRYQAIVLKPFNGEVIDAKITNVNKMGFFAEVG
                     PLSIFVSSHLLPIDYKFQPDANPPEFTSPTDNLVKGRRVRVRIVGTRVDANEIFAIGT
                     MKEDYLGPFD"
     gene            <152843..>154585
                     /locus_tag="MRET_3442"
                     /note="MRES_13815"
                     /db_xref="GeneID:38740208"
     mRNA            join(<152843..153778,153805..154521,154550..>154585)
                     /locus_tag="MRET_3442"
                     /product="serine/threonine-protein kinase TTK/MPS1"
                     /transcript_id="XM_027630069.1"
                     /db_xref="GeneID:38740208"
     CDS             join(152843..153778,153805..154521,154550..154585)
                     /locus_tag="MRET_3442"
                     /codon_start=1
                     /product="serine/threonine-protein kinase TTK/MPS1"
                     /protein_id="XP_027486065.1"
                     /db_xref="GeneID:38740208"
                     /translation="MLHEAWASTPPRPAPSEWGAGSDTDGSPLPTPPRVSHVYDLHDH
                     EDTRPSTPPTLRRYRADTPSDATCRPSRHPPPQTPMVSSFSRSIASQRSVGRDLHKLR
                     SSVRTGSMHIPARRVQRYQDDEDVMHENDEPHQGLSHDRPEDRPVEPSAPEQAPMPPA
                     APVPEDEARAFDYLQLMWDEAERQHQAGFVPSNPHHQKSMAKETTFRGCRFIKVRRAG
                     EGGFSTVWQVHGPVAIPAAVPDAEPDAVRMESVDARQQGYFAMKQVSLRRLEPESRDE
                     LVQEAQLLEQLAQKPGHEQYILRYFGHRLNRDTLKILLELGDMDFSHILKAHAPLSRV
                     QICEYWHQMLEAVHFIHEKGNLVHSDLKPANFLMAKGRLKLIDFGIAQKIPIGTIHIS
                     REAIIGTPNYMAPEAIKIAKAHGRRVYKAGKASDVWSLGCILYQMVYGRPPFDRLSGE
                     KKLEAIMDPAHDIPFPPHRVLDDPTSEPVDAPMLEALTTSLRYDAQTRAHIPALLSSE
                     LFHHHLGETVTISRKTLRALVVRLQQHAIQGELTDTNAIQRADVLFDNLRRTAS"
     gene            <154698..>157943
                     /locus_tag="MRET_3443"
                     /note="MRES_13820"
                     /db_xref="GeneID:38740209"
     mRNA            <154698..>157943
                     /locus_tag="MRET_3443"
                     /product="trehalose 6-phosphate synthase complex
                     regulatory subunit"
                     /transcript_id="XM_027630070.1"
                     /db_xref="GeneID:38740209"
     CDS             154698..157943
                     /locus_tag="MRET_3443"
                     /codon_start=1
                     /product="trehalose 6-phosphate synthase complex
                     regulatory subunit"
                     /protein_id="XP_027486002.1"
                     /db_xref="GeneID:38740209"
                     /translation="MPDAQSRRRVLIAAYLLPKTIEFQSNEAHEADESAIERTYSPPT
                     QHGTSYTEQLAHQLTSSLMEAIDKEQARSRVLAGRPGRVSTTMSSSPRQALSAPRDRV
                     NMAELMADAAAGTKPSYLQRSSSSITSYEVDMEQRHSDNAPQAVKSSLSDHGRRASAQ
                     GELGTSQATPPRSMPPPVSSASSTSPLPIPISIISDLEAKSHQGTATAPTPKENPYGL
                     GSSTPVPPVRSSAATSSTTPRLMEHPHLAPGWTDGIEAIHTSSAPNAAPRPRGPTPAS
                     TEGAVRDEERRTSTVWRFNIARPALRSRSKRFSSSQQRIPFEFLPNPGANHGLFNAVN
                     SAGTQVASRSVYVGTLGIEMDWLSTHMRAEIDAKAMDQHKCVPVWLKDDEYVHCYHHY
                     CKQILWPAFHYTQPSAQALETEHDAFHAYVKVNQSFADRIVAEYREGDVIWIHDYHLL
                     LVPAMVRAVLPRAPIGLFVHIAFPSSEIFRCLSRREELLRGMLGADLIGFQTHNFFQH
                     FRQTVSRILQLPTTSRGIVLQRSFVTVAPFPIGIDVRVLNQRRQHPDVREWVAKLKER
                     FAGMRVIVGRDKLDWIKGVREKLLAFELFLDQHPEWVGRVVLVQVALATVQENHEVGD
                     VSDIVSRINRKHSSLTYQPVVFLHVNEITFSQYLALLTMADAFVATSLREGMNLTSHE
                     YVIAQEERKRPLILSEFTGAYSALRACIGINPFHAQQVAQAIERALTMDEDEMAQRWT
                     DLHRTVVSQTAEHWVLSVLSQLERAHLSQPSPNTMFTPRLEIGQMQAEWRVAGTRLVL
                     LSLEHTLVWEDAKQLHEHGFEPPAELVGVLRRLTADPRNYVYVLSRKSTTDLDQLARA
                     VPALGIIAENGCYAQHCTRAPDGACEWISLVDGIDMKWREPVRNILDYFTERTPGAWI
                     EERSTTITWYFCEGTTNQQDVAWARRQASEVQSLITDSLGERFSLRMINENTHFVIMP
                     KNVGFTPAVQYMLALDNMGSLPVRQGTPGKALFEFVLYIGHDEKLLSHLNHVDLPFAP
                     RTCTTARPDTIAGSIASCQLEPGKQVLDALEEIVDVHLRDLKWGGPAMMDV"
     gene            complement(<157952..>158422)
                     /locus_tag="MRET_3444"
                     /note="MRES_13825"
                     /db_xref="GeneID:38740210"
     mRNA            complement(<157952..>158422)
                     /locus_tag="MRET_3444"
                     /product="actin related protein 2/3 complex, subunit 5"
                     /transcript_id="XM_027630071.1"
                     /db_xref="GeneID:38740210"
     CDS             complement(157952..158422)
                     /locus_tag="MRET_3444"
                     /codon_start=1
                     /product="actin related protein 2/3 complex, subunit 5"
                     /protein_id="XP_027486066.1"
                     /db_xref="GeneID:38740210"
                     /translation="MSEFRHLNVDQYDEEAFSAEELAPQDPRSDEELSQVAHAKQSDV
                     RARLSSGDMAGALHVVLADPPTGQHAVHARETTLSMVLDILNSTRTVDIMPAVKALDA
                     SERDTLMKYLYRGMERGRSAASVNCAVLLSWHEKLTLVAGTGSIMRVMTDRRMV"
     gene            <158602..>160902
                     /locus_tag="MRET_3445"
                     /note="MRES_13830"
                     /db_xref="GeneID:38740211"
     mRNA            <158602..>160902
                     /locus_tag="MRET_3445"
                     /product="serine/threonine-protein kinase CLA4"
                     /transcript_id="XM_027630072.1"
                     /db_xref="GeneID:38740211"
     CDS             158602..160902
                     /locus_tag="MRET_3445"
                     /codon_start=1
                     /product="serine/threonine-protein kinase CLA4"
                     /protein_id="XP_027486067.1"
                     /db_xref="GeneID:38740211"
                     /translation="MSYSPMNEAAMQDMYGFAPARPAPGPPPGVAAADSYRSGGRHAG
                     STSPYDRSAASSSSPLTGMAAFTAPLSSTLVPASAPPPHPGTLKPSASVVRSGYLSVK
                     EDGLRSWIWSKKWLVLRETSLLFHKNDSTAQATHILLLRDVRNISRTDLKPYCIEIET
                     KDRTIFLQVKSDEELYGWMDDIYNRSPLGASSPTNFVHQVHVGFDPVSGSFTGLPEHW
                     MRLLTQSAITKEDYAKNPQAVLDVLEFYTDIHNKRSRDDFGLGSPMMNLHAGGSGREV
                     VDRYKHTEDARSFGSLDPRRPAPAPPLGQPRQSPWPATPYQTHAVALPATDTSLSESD
                     TSALSFKTQQLRVSEEQQLQRRYMMEREEQRERALRQQRAAAERRRVSQPKTAPYAAP
                     PLAPTTAPPPQALPAVASPKPQPPSPAPPLPPVLPEAAPAITSADAYRTPQKSAPVSA
                     ASKPPAAVPQRRLDASNRSNTMTDAQIMDKLRTVVSRHDPHMLYRKVKKIGQGASGSV
                     YVAKTLATSQLVAIKAMDLTHQPRKELIINEIFVMKESQHPNIVNFLDAYLLREQDLW
                     VVMEYMEGGALTDVIDNNTLEEDQIAAICLETCKGLEHLHRQAIIHRDIKSDNVLLNN
                     YGQVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEYDAKVDIWSLGIMAIEM
                     IENEPPYLDEEPLKALYMIATNGTPTLKKPEKLSRELKGFLAVCLCADVKSRATAEEL
                     LQHEFLHKACPATELPKLLQFRNHEK"
     gene            complement(<160921..>162246)
                     /locus_tag="MRET_3446"
                     /note="MRES_13835"
                     /db_xref="GeneID:38740212"
     mRNA            complement(<160921..>162246)
                     /locus_tag="MRET_3446"
                     /product="splicing factor U2AF 65 kDa subunit"
                     /transcript_id="XM_027630073.1"
                     /db_xref="GeneID:38740212"
     CDS             complement(160921..162246)
                     /locus_tag="MRET_3446"
                     /codon_start=1
                     /product="splicing factor U2AF 65 kDa subunit"
                     /protein_id="XP_027486068.1"
                     /db_xref="GeneID:38740212"
                     /translation="MDRMAPRDGGGDEDASWYARRRYQTDMDYGERRWRGRGPRGGGG
                     GSRRSVVRTSPPPPGTMRLSARPIPHSNWDVRAPGFEDVDALSAKATGLFGAPVNSGS
                     AGMMMYGIRGAMPGTIPPGAMAELEATISAAAFNASMYLASRRLHVSPIAPGWSPTEL
                     CTYINAKMNERLLCSSGSFEPCYTVDMHDDFAFLEFRNPDEATNALLLDGVSFLGHRL
                     HIQRPKDYVGQDAVPAPGMIETSVPDGPNKLYIGSVPVFLNEGQVLELLKAFGEVKHF
                     DLIRDPDTQRSRGMAFCEFHEDAVTDLACEGLDGLEVGEQRLIVRRVHAPANEPMQEQ
                     ETSDTPTRAMLMLNMVTTEELLDDAEYQDIMEDVRSECERHGTVTSVYIPRPDGTDAE
                     PQGVGRVYVQFEHTPQCEAALRAIAGRQFDGRTVICAYVRDEAWPRAAA"
     gene            <162353..>164170
                     /locus_tag="MRET_3447"
                     /note="MRES_13840"
                     /db_xref="GeneID:38740213"
     mRNA            join(<162353..162394,162419..>164170)
                     /locus_tag="MRET_3447"
                     /product="pre-mRNA-processing factor 40"
                     /transcript_id="XM_027630074.1"
                     /db_xref="GeneID:38740213"
     CDS             join(162353..162394,162419..164170)
                     /locus_tag="MRET_3447"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 40"
                     /protein_id="XP_027486069.1"
                     /db_xref="GeneID:38740213"
                     /translation="MVAKGQGDGTVSAWVEYKNAQGRVYWYHPGERKSVWDKPNELKS
                     ARERAMDTTPWREYKSGDRSYYVNKETKESTWKIPADLQAFLDTIPDEPAPATAARPS
                     KSMSPALSPATPPRGATPTHEAVGTAALRQQTSSVTRHATPVYATQEEAEAAFQSLLQ
                     RKNVNASSTWEQTLREIITEPLYKALRTLAERKAVFHRYVDELKAQQAARREQKSAEL
                     RPKMLRAVPDLKPYASYATFKKKLGTHPLWSELEDEEQAVSIFEAIRQDFREKEAARQ
                     KARGEQRRAQFLALLQKIEIRPTTRWKDVQPQVPVADMPLTEQLRVFEDHMARVEADE
                     REQQQGHGHSRQDRKARDAFRSLLEERIKEGTLHARSTWASFFPMIREDERLLNMTRI
                     SSGSSAQDLFYDALDALEREFAGYMRSVQTSMREHQTLAREAADWDAWKETVQESDMI
                     RALPEHTLRALFDECVYQSERDTRDMRRRTERRLRHYADDLRYAFRHVEPPLDIHASF
                     EEVLPRIRMLPEYMALERAGDDETTTTARAAWDRYVRRQTEKLADAMYAPGRSRTDYT
                     DLDDAGEERKRKEPPEFPDPRAVRRRTEYET"
     gene            <164263..>166026
                     /locus_tag="MRET_3448"
                     /note="MRES_13845"
                     /db_xref="GeneID:38740214"
     mRNA            <164263..>166026
                     /locus_tag="MRET_3448"
                     /product="heat shock protein"
                     /transcript_id="XM_027630075.1"
                     /db_xref="GeneID:38740214"
     CDS             164263..166026
                     /locus_tag="MRET_3448"
                     /codon_start=1
                     /product="heat shock protein"
                     /protein_id="XP_027486062.1"
                     /db_xref="GeneID:38740214"
                     /translation="MTEEQGAVIGINLGNTYGSLACINQHGRADVIANESGERQIATR
                     IAFNGDQVYHGNEATPQLIRNAPNVIDNFVNLVGRSYDDLKEEEKVRKSAQVLNINGV
                     PSFEVEVNGTKTVLSAFDVLVRFIGVLYNAAKDFMSGVPIVGAVLSVPMWYSDAQNEA
                     IAAAAKEAGLHLLELVAAPAAALTAYGLTMPKPTGELPSHPDGDEGLPYAPEKILDRN
                     VVVVDFGGTSLDVTVYAARAGLFSKLAYVHDKTVGGRAIDDVLVQHFAKEFTKKTKVS
                     IGDQDARAWAKLRNESELTKRSLSASNSAQCSVESLAEGVDFSGSINRMRLNLLASSI
                     YQTAVDDVKKAIESSKLDTCHVDEVILAGGASRLAGLAEQLSFLFPEDSNTHITYSID
                     SDQVIARGCAVYAQSLVLLPKDSDELKFVTSLSNKHAERSAAVTVPATTRPIGVVLDA
                     PAEERVAKQVVDGKLFVPLVHAHTPLPARRIMRFPVSPNSNATLIRLAEGTPSVRVDK
                     VDPEPLDEEDEEDEPQEPEEVRSAYIQPDNSPLAELVVPHAATCQSITVQMIVQSGGQ
                     VSVEARCDKSDQVAASVQIGA"
     gene            complement(<166023..>166697)
                     /locus_tag="MRET_3449"
                     /note="MRES_13850"
                     /db_xref="GeneID:38740215"
     mRNA            complement(<166023..>166697)
                     /locus_tag="MRET_3449"
                     /product="guanylate kinase"
                     /transcript_id="XM_027630076.1"
                     /db_xref="GeneID:38740215"
     CDS             complement(166023..166697)
                     /locus_tag="MRET_3449"
                     /codon_start=1
                     /product="guanylate kinase"
                     /protein_id="XP_027486063.1"
                     /db_xref="GeneID:38740215"
                     /translation="MSSRIWSHIASAMSQRPIVLCGPSGVGKSTLIKRLFEEFPSSFG
                     FSVSHTTRNIRPGEVDGQSYHFVTRDEFEQRVRNGEFLEHAVFGGNMYGTTAQAVRDV
                     HEKGAGRRAILDIDAQGVRLIKQNHPDLNPIYVFISPPTFGTLKERLEGRATDSKDAI
                     ERRLNMALDELAYARQPHSFDCIIVNQDLAKAYEKLRAVIQGEVSVPSDSVPPEDEAE
                     RLRRSS"
     gene            complement(<167273..>168784)
                     /locus_tag="MRET_3450"
                     /note="MRES_13860"
                     /db_xref="GeneID:38740216"
     mRNA            complement(<167273..>168784)
                     /locus_tag="MRET_3450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630077.1"
                     /db_xref="GeneID:38740216"
     CDS             complement(167273..168784)
                     /locus_tag="MRET_3450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486034.1"
                     /db_xref="GeneID:38740216"
                     /translation="MFSTWAAPGTSRQTVGAVPSTPNPNAPSLNASGGAGSWMQTQAS
                     PGPSASTLGTPGAAGQQPGSLFSTPQHTSPQAFPGFMPAHPPTQSPFATQLAPTASPA
                     GAQPWTAAQASPMSQAPVAYLPGYLSKIRGGDRSSASTNRSAEAAVSPIVKPEADTSS
                     ILLPKEHTAASTIAPASPPNGFHSSFFARSSMDGGEPTRSPPPAGSGVREGSIFGYSS
                     LRGSRPPPVQDEADRSASRAPTSPPLPASLTNSAFPQVGADVMDDDDDAPPQQALQDM
                     PPSHLRAFDTSTASMAAVPEKTRVGAPTSQGAPVAQRSVLVYGFPPLMRSVVVEQLAA
                     LGEVETVDDVTTVHAQDKTLRLVYREPVQALQAVLQNGKSLAGTCMIGVRWENDAMHQ
                     QSLIRGLDAPLLGASSMDTKAAAAAVPSTPVTKAHPPSTPAFGRPIQKIDTPGSVLAQ
                     PAKDTSKKSTFESLMNMRASIFGTAPQPKDAILDVNAKPTSVWGYVAESLFGW"
     gene            <168994..>169918
                     /locus_tag="MRET_3451"
                     /note="MRES_13865"
                     /db_xref="GeneID:38740217"
     mRNA            join(<168994..169030,169062..>169918)
                     /locus_tag="MRET_3451"
                     /product="cyclin-dependent kinase"
                     /transcript_id="XM_027630078.1"
                     /db_xref="GeneID:38740217"
     CDS             join(168994..169030,169062..169918)
                     /locus_tag="MRET_3451"
                     /codon_start=1
                     /product="cyclin-dependent kinase"
                     /protein_id="XP_027486033.1"
                     /db_xref="GeneID:38740217"
                     /translation="MENYQKIEKVGEGTYGVVYKARDMTPGANGRIVALKKIRLEAED
                     EGVPSTAIREISLLKELRDENIVRLYEIIHQESRLYLVFEFLDLDLKKYMDNVASQPE
                     GLGPDIVMKFTYQLVRGIYFCHAHRILHRDLKPQNLLIDKEGNLKLADFGLARAFGIP
                     LRTYTHEVVTLWYRAPEVLLGSRHYNTAIDMWSVGCIFAEMAMRTPLFPGDSEIDEIF
                     RIFRILGTPNDDTWPGVQSLPDYKTTFPQWSGVPLKQAVPSLNDAGIDLLGLMLIYDP
                     AARISAKRALHHPYFASVTAN"
     gene            complement(<170011..>170668)
                     /locus_tag="MRET_3452"
                     /note="MRES_13870"
                     /db_xref="GeneID:38740218"
     mRNA            complement(join(<170011..170072,170101..>170668))
                     /locus_tag="MRET_3452"
                     /product="peroxisomal membrane protein 4"
                     /transcript_id="XM_027630079.1"
                     /db_xref="GeneID:38740218"
     CDS             complement(join(170011..170072,170101..170668))
                     /locus_tag="MRET_3452"
                     /codon_start=1
                     /product="peroxisomal membrane protein 4"
                     /protein_id="XP_027486032.1"
                     /db_xref="GeneID:38740218"
                     /translation="MASDLRTALTNILLDPSNQPILSIIKGARNGLVYGAKIRFPHAL
                     VMVSLFGAGTTRQRWKKIVTATRQHATRLALYVTIYKSVLLVLRDLFRNGKQASIDPF
                     VAGMLSGWYMFGERTPVNEQIVLYCVSRCLAALLPRERVPKNYPPNKVLPIDNTAHQI
                     FAAVTWGSVMWLFVNERRRLNGGLVNSMDYLYVLSDKWDSFRNFLWHNV"
     gene            <170974..>172371
                     /locus_tag="MRET_3453"
                     /note="MRES_13875"
                     /db_xref="GeneID:38740219"
     mRNA            <170974..>172371
                     /locus_tag="MRET_3453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630080.1"
                     /db_xref="GeneID:38740219"
     CDS             170974..172371
                     /locus_tag="MRET_3453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486031.1"
                     /db_xref="GeneID:38740219"
                     /translation="MNRRVRRDAPSCRSADMYASPVRNQKVSGSHLALKWKPDCMHSN
                     KFDVYLYSQKGDSVLPIHAWLGLNARDGAKTVQLDSKWWDKQQDLHVNLQYVPNGFQP
                     WETSYPLGATWILSANSSETPSNLDTSPSWSNAQVTDYIHHSSGLSGGELAASIVLPV
                     LAALAILGAGLFWHRKCWARREANRSEPPMKPSHSTAEHSAVSFHSPHHAYDSSPIPG
                     ELSAMHDSDVSVGDVKDPAGTLYADTSALTQNDSVPYAVYAYEQPYTLENTPVSQVAT
                     EPITRKLDGHEKCRSTRKPKRERRSEKPLVFESHTWSRSGSFQPDEYNVPEFVSREKR
                     KTAPYTAHRAGSKAPLTMLDQELTPKEDEDKSSSISDGPAMYALDEAMAPSMPKTTRT
                     LPSQGPEPRHKSISRAEPSTEESRNRRILSYLAGVAASQGDHRDDNVIYDNRGGLSSR
                     RPSNDSDVFQDADSM"
     gene            <172441..>173391
                     /locus_tag="MRET_3454"
                     /note="MRES_13880"
                     /db_xref="GeneID:38740220"
     mRNA            join(<172441..172597,172623..172828,172854..172881,
                     172913..173203,173231..173253,173281..>173391)
                     /locus_tag="MRET_3454"
                     /product="pseudouridine 5'-phosphatase"
                     /transcript_id="XM_027630081.1"
                     /db_xref="GeneID:38740220"
     CDS             join(172441..172597,172623..172828,172854..172881,
                     172913..173203,173231..173253,173281..173391)
                     /locus_tag="MRET_3454"
                     /codon_start=1
                     /product="pseudouridine 5'-phosphatase"
                     /protein_id="XP_027485824.1"
                     /db_xref="GeneID:38740220"
                     /translation="MVRAVLFDMDGLLIDSERIYTDVVNELLKPYGKEQTWDIKARLM
                     GKPERDATLVLLSSLWPPNPDHPQDVERGFSHECPFTLDDFLQKRNALLLPAFERVPP
                     MPGAERLVQHLAQHQIPICVATGSRRINYQVKARANPRIFDVFGDRVICGDDDIVGRG
                     KPTPDIFLIAAKHGLGIHNTDEGRAFLEGIRNPGAEFDDRLAGHEGDVLVFEDAVPGV
                     QAGLAAGMKVVWVPDANLRAVTDQGPPVGAHQQIGSLLEFRPEEWGLPPFEDA"
     gene            complement(<173388..>174038)
                     /locus_tag="MRET_3455"
                     /note="MRES_13885"
                     /db_xref="GeneID:38740221"
     mRNA            complement(<173388..>174038)
                     /locus_tag="MRET_3455"
                     /product="charged multivesicular body protein 5"
                     /transcript_id="XM_027630082.1"
                     /db_xref="GeneID:38740221"
     CDS             complement(173388..174038)
                     /locus_tag="MRET_3455"
                     /codon_start=1
                     /product="charged multivesicular body protein 5"
                     /protein_id="XP_027486030.1"
                     /db_xref="GeneID:38740221"
                     /translation="MQRLFGFSQSKPKPDLQQAISSTDARAEATQRKISRLDAELGRY
                     RDQMKKMRDGPGKSAVQQRAIRVLRQKRMYEAQMEQLIQQSFNMEQSIMATDNLRNTM
                     ATVDAMQQANKDLKRTYKNVSVDRIERIQDEMEDLLEQSGALQETLSRSYAMPEDIDE
                     EELEAELEALEEEPLEQESDMPSYLQHATGAFPAQPDSVDELPAESEPVPSEMRAA"
     gene            <174188..>174976
                     /locus_tag="MRET_3456"
                     /note="MRES_13890"
                     /db_xref="GeneID:38740222"
     mRNA            <174188..>174976
                     /locus_tag="MRET_3456"
                     /product="bridging integrator 3"
                     /transcript_id="XM_027630083.1"
                     /db_xref="GeneID:38740222"
     CDS             174188..174976
                     /locus_tag="MRET_3456"
                     /codon_start=1
                     /product="bridging integrator 3"
                     /protein_id="XP_027485823.1"
                     /db_xref="GeneID:38740222"
                     /translation="MSWGGLKKSINRAGTQLMQKTGQLERSDDSRFKEEEHKYREFER
                     HASALLKSSRDYLDAIRLMSASEARIGDTVEGFYHEESETAMIASMYKRALEDLDAKT
                     ARDLDAPYRATVLDPIGKLCSYFPEINKLIDKRSRKLLDYDATRSRYKKQSDRPSDDA
                     SKLPRMESEHNEAKLVFDAINEQLMTELPQLVDMRIPYLDPSLEMMVRVQLKFAQDGY
                     EQLGGVQRYFPEAVRTEYAEGQLDAQVEGVLQEMRSLSICGMNQ"
     gene            <175088..>176800
                     /locus_tag="MRET_3457"
                     /note="MRES_13895"
                     /db_xref="GeneID:38740223"
     mRNA            <175088..>176800
                     /locus_tag="MRET_3457"
                     /product="serine/threonine-protein phosphatase 5"
                     /transcript_id="XM_027630084.1"
                     /db_xref="GeneID:38740223"
     CDS             175088..176800
                     /locus_tag="MRET_3457"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 5"
                     /protein_id="XP_027485822.1"
                     /db_xref="GeneID:38740223"
                     /translation="MSSGTSTAPSTSSIPASSTDMSSVTSALSDVAASMSPDELTKKV
                     EEIKAAGNERFLKGDYTQAKALYTDALSLNPNIVAIYSNRAICELKLEQYGLAIADAT
                     KAIELDATFAKAYYRRACAHLAILDPKAALPDLKMVVKLDPRNAQVKMQLDATSKLVR
                     RLEFEKAIRVEEGPAPHQTIEEFLEQNMGGAQIPSDYKGPRLPTHASNQPISAPVDNK
                     PYLGQIDDAFIDQMIQHFKEGKQLPNGIAWAIILGALRAFEKEASLVEYTVPEGTTIE
                     VVGDTHGQFYDFVHLLSLTGRPSKNHALLFNGDFVDRGSWSVEIALTIFAFKWLYPAT
                     TLVNRGNHETSDMNKVYGFEGECKAKFGGDMTFKLFTQTFVAIPLATLVNVSRPPLPA
                     DKLPENASKSQAQKDPVVCKDTGFKRYFVVHGGLFSDDHVTLDDIRAIDRFSKKQPGQ
                     EGLMMELLWSDPQAASGRGPSKRGVGFSFGPDITRAWCELNGITAVLRSHEVRQRGYA
                     EEHDGMCCTVFSAPNYCDSTGNLGAFGHIDDQGTLSWTMFEAQPHPDIRPMAYAGGMG
                     GLLA"
     gene            complement(<176821..>177525)
                     /locus_tag="MRET_3458"
                     /note="MRES_13900"
                     /db_xref="GeneID:38740224"
     mRNA            complement(<176821..>177525)
                     /locus_tag="MRET_3458"
                     /product="ribosomal prokaryotic L21 protein"
                     /transcript_id="XM_027630085.1"
                     /db_xref="GeneID:38740224"
     CDS             complement(176821..177525)
                     /locus_tag="MRET_3458"
                     /codon_start=1
                     /product="ribosomal prokaryotic L21 protein"
                     /protein_id="XP_027485938.1"
                     /db_xref="GeneID:38740224"
                     /translation="MAAAPWNMARRAAIRQSRHSFLGILSPQISSMRTMASARPNMTV
                     EQVNEALSLLRSQPNHYVVASISGRTFVLSNSDLITLPRIRDVKLGDVLELDLVHEVG
                     SRDYTLRAQDPAHGARNPEGGRFPLALVRNNEQNTHSVRVATENLYKMADPASIVPFS
                     QSWAAKLIPSGLAHVGAALSRDIVRVQCVVVEHTKGPMERIEKFKRRKGYDKVITHKQ
                     PYTRVRVDSITLGTPQ"
     gene            <177911..>179702
                     /locus_tag="MRET_3459"
                     /note="MRES_13905"
                     /db_xref="GeneID:38740225"
     mRNA            join(<177911..177973,178122..>179702)
                     /locus_tag="MRET_3459"
                     /product="F-type H+-transporting ATPase subunit alpha"
                     /transcript_id="XM_027630086.1"
                     /db_xref="GeneID:38740225"
     CDS             join(177911..177973,178122..179702)
                     /locus_tag="MRET_3459"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit alpha"
                     /protein_id="XP_027485827.1"
                     /db_xref="GeneID:38740225"
                     /translation="MLARSTGIAVANLARTAAVPTARRAIPAFATAARSYATAKAAAS
                     EVSSILEQRISGATSNFDVEETGRVLAIGDGIARIYGLRNIMAEEMVEFSSGVRGMAL
                     NLEPDNVGVTVFGSDALIKEGDIVKRTGQIVDVPVGPELLGRVVDALGNPIDGKGPIK
                     ASERRRTQVKAPGILPRRGVHEPMQTGMKPIDAMVPIGRGQRELIIGDRQTGKTAVAL
                     DTILNQRRWNDSNDDKKKLHCIYVAVGQKRSTVAQLVQTLEQNDALKYSVVVSATASD
                     AAPLQYLAPFTGCSIGEWFRDNGKHALVVYDDLSKQAVAYRQMSLLLRRPPGREAYPG
                     DVFYLHSRLLERAAKMSDANGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLES
                     ELFFKGVRPAVNVGLSVSRVGSAAQTKIYKAVAGSLKLYLAQYRELAAFAQFGSDLDA
                     STRYTLNRGARLTELLKQRQYNPLAVEIQVPIIYAGIKGLLDEVPVEKIVDWEASYRE
                     ELASQNDLLSEISKGVMTPEVEEKIAASIKASVSSFLGN"
     gene            <180085..>182449
                     /locus_tag="MRET_3460"
                     /note="MRES_13910"
                     /db_xref="GeneID:38740226"
     mRNA            join(<180085..180218,180259..>182449)
                     /locus_tag="MRET_3460"
                     /product="dynamin 1-like protein"
                     /transcript_id="XM_027630087.1"
                     /db_xref="GeneID:38740226"
     CDS             join(180085..180218,180259..182449)
                     /locus_tag="MRET_3460"
                     /codon_start=1
                     /product="dynamin 1-like protein"
                     /protein_id="XP_027486005.1"
                     /db_xref="GeneID:38740226"
                     /translation="MDVDLIQVVNRLQETFTTIGGHSVDLPQCVVVGSQSSGKSSVLE
                     TIVGRDFLPRGSGIVTRRPLVLQLIHLPASEMSGGIEEYGEFLHLDRRFTDFNAIRQE
                     IENETFRVAGQNKGISKQPIHLKIFSPHVINLTLVDLPGLTKIPVGDQPSDIERQIRS
                     LVTDYISKPNCIIIAVSPANVDLANSDSLKLARTVDPQGRRTVGVLTKLDLMDQGTHA
                     LEILSGRMYPLRLGFVGVVNRSQHDINNAVPLIEARRSEEEFFRTHIAYRSIAHKCGT
                     KYLAKTLNQVLMAHIRERLPDMKARLNTLMGQAQQELASFGDTSFMGDQHRGTLILKY
                     MTQFAKDFVASIDGTSFDISTKELCGGARVYCIFQDIFAQALNSINPTQNLTVHDIRT
                     AIRNSTGPRPTLFVPEAAFELLIKPQIKLLLPPSLRCVELVYEELMKICHNCTSAGLQ
                     RFPRLHAQLIEVVSELLRERLGPTSEYVQSLIEIQSAYINTNHPAFVNDSANIATRMR
                     EEKQRKTVLEPPRHEISLDSDLGTPATEEDEDDKQNQALIMNGVPHTKRAVEAFRRNG
                     ASNEGTKRAPPSSDSSADAPASGSTYSASSGPISTSGQRESFLNYFFGGATMNDASSS
                     ISLSSHMPEQKPNILTGRLGLEGNSAAYNMKSLDQYLSMDPVPEEEFALSEREAMETN
                     LIRELITSYFNIVRLSIQDLVPKAIMHLLVNYSRDTVQNRLVVNLYKESMFEQLLHED
                     ETLTKERQRVQALLDAYKEGFNVLSDITFKPSSA"
     gene            complement(<182531..>183670)
                     /locus_tag="MRET_3461"
                     /note="MRES_13915"
                     /db_xref="GeneID:38740227"
     mRNA            complement(<182531..>183670)
                     /locus_tag="MRET_3461"
                     /product="U3 small nucleolar ribonucleoprotein LCP5"
                     /transcript_id="XM_027630088.1"
                     /db_xref="GeneID:38740227"
     CDS             complement(182531..183670)
                     /locus_tag="MRET_3461"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein LCP5"
                     /protein_id="XP_027486006.1"
                     /db_xref="GeneID:38740227"
                     /translation="MSSEADLPRSQSRPFLELAQSLRKNSQDSSQIARKISESVADGD
                     LDHPEGLSILTVKVDALLAYIQNLALLCVHRLSGHSLGEETGSQYVKNLVKLRLRLEK
                     MRPMEARLKYQVEKLLQTLAAVEREASSGAAHEDKQTDVEEDVDMLSFRPNPESLVSA
                     QVGRSDVADEETGEPSPAVGGVYRPPKVAPVVYDPDAHVSRNARKKERQVSRNTALLA
                     DLTAGMSTNPYETSVGGVGGDGAIGTSGSSRARALRRMQEFEEENYKRLSLNKKEAKK
                     RRRDEQDVALGGLGLSSHGGHRLSGGIEEEFGDLLRGSERDARRRARGDERDAYNALQ
                     KRAKRPTAMSQAKQHADTSDHLGASAASTHKFKKALRKHKQKSRV"
     gene            complement(<183775..>185601)
                     /locus_tag="MRET_3462"
                     /note="MRES_13920"
                     /db_xref="GeneID:38740228"
     mRNA            complement(<183775..>185601)
                     /locus_tag="MRET_3462"
                     /product="sterol O-acyltransferase"
                     /transcript_id="XM_027630089.1"
                     /db_xref="GeneID:38740228"
     CDS             complement(183775..185601)
                     /locus_tag="MRET_3462"
                     /codon_start=1
                     /product="sterol O-acyltransferase"
                     /protein_id="XP_027486004.1"
                     /db_xref="GeneID:38740228"
                     /translation="MSRDAETVSPSVESSSLSTGRASGVSSNMTSASVRKVTPDAPQS
                     KSQEVSSHDYKKTSGYRFFVRYMPRFSMFDSLSRNEMNGPFRGFYNLFWICLACVVLS
                     AFTQSFDNTGQILSLTLATLMSKDTHVLALSDAILVAQTFLCVPMVHGLRYFRITHRY
                     IILTILLLWHITTMVNVIIWARFRDWPWVQSGFFVLHSIVQMMKIHSYVDVNSAMNEE
                     HLKLLDTEKQLLDRVVEVDGTGVPSGKEKAWHRAAERTLQQLDQLYPEHTAYSRLKDV
                     YFKWADLRVQSGCSNERAHVLLPLLRNDIPRSRTPVPEDQRKMDVMVSDSASYPHPKL
                     VMDLRDLHPFIWHPDDKVRSLAHDIAVIRESLYAASVPGQGLSTMWPHNVTLANFLDF
                     QLVPTLVYKLQYPRRNEIRPWYIADRCIALFGTFLVTYVITVNWIIPVVEDKSSSLLS
                     IFLRLMTPMISCYCILFYLMFECVCQGFAEITRFADREFYQDWWNSTSMDEYARKWNR
                     PVHHFLLQHVYFSMVVRYGMSKQTASTLTFLISSVFHELVMIIVTGKIRGYLFVLQMS
                     QIPLMFMARLQFIRARPVLGNILFWAGMIIGLPILNILYIVF"
     gene            <185765..>186829
                     /locus_tag="MRET_3463"
                     /note="MRES_13925"
                     /db_xref="GeneID:38740229"
     mRNA            <185765..>186829
                     /locus_tag="MRET_3463"
                     /product="solute carrier family 35
                     (UDP-xylose/UDP-N-acetylglucosamine transporter), member
                     B4"
                     /transcript_id="XM_027630090.1"
                     /db_xref="GeneID:38740229"
     CDS             185765..186829
                     /locus_tag="MRET_3463"
                     /codon_start=1
                     /product="solute carrier family 35
                     (UDP-xylose/UDP-N-acetylglucosamine transporter), member
                     B4"
                     /protein_id="XP_027485792.1"
                     /db_xref="GeneID:38740229"
                     /translation="MPAVKSSRIPSYTTVRNVIADFGLIMALIFGGCCSNALTLELTT
                     KQLPASGTLLTLAQFVATTVIALVGEVEMRSVHGCYVPCLKRPGVPLRRWLIQVILYY
                     LTSILNNSAFAYNIPMSVHIVFRSGGMLVNMFLGYTIDGKRYSLLQLMSVCLVTIGVV
                     VATLSAALPSGTQNTSSNGDYMFGVFLLSMALLTSGAMGIFQERTYTKYGRQHWHEAL
                     FYSHLFSLPLFAFQSRGLSAQIADANATPRAPLPMCPICTKMGLTVPSYYVNLTLNVL
                     TQLLCINGVNRLTSRVSSLSVSLVLVVRKAVSLVISVVLLNRQTGSAGLWSGAAAVMI
                     GTIGYTYGGSKRRVPHAKSA"
     gene            complement(<186850..>188487)
                     /locus_tag="MRET_3464"
                     /note="MRES_13930"
                     /db_xref="GeneID:38740230"
     mRNA            complement(<186850..>188487)
                     /locus_tag="MRET_3464"
                     /product="ubiquitin carboxyl-terminal hydrolase 25"
                     /transcript_id="XM_027630091.1"
                     /db_xref="GeneID:38740230"
     CDS             complement(186850..188487)
                     /locus_tag="MRET_3464"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 25"
                     /protein_id="XP_027486008.1"
                     /db_xref="GeneID:38740230"
                     /translation="MVEDGQVQELQSILGCTYEQAYSALHDAQGNMEWAMNRILDGPA
                     SPAPPPSLPIPERSLTAPPSYTEYPSTQSQDEQDADLQRAVAASMVQHPTAPSASNED
                     EELMRALAESVQGAPHARPDLMRRRQKLEPVVFVPSIPTYKAVAWSLQALYAATPLCQ
                     ALYTYPKSDTRTTNLAQYWNGVSPSGPCTAESQHTQLIQRIQTLFYFATHTVRAVVVT
                     GDIDAILPRDIMLQASWQQDMHALIKAFVDLLAHAWKTNTCLEQHHLFQMFIVPTGAS
                     APTDELSMSTLVLDHTATESSVYSCLLYQLTDHEQAYFISRAPLVLCLPVQHSTTGPF
                     RIDLTVYLDSFLWNKRTEDDVASQCASLASQYKAAEAEKRHWTARLASFTEHDALSST
                     QQSEAYLEHVAHSPLSDWMTRIRKALEQRVSVARSHISALDEQLTSLRTTMTQLQEKR
                     WNDPALQTMPYDLCAAVFQTNESEWAYIQHNGQWWRLEDTHAQAIDPHTMTTDPGVVF
                     LAYTQRAYKAQEPTSEILTALRDAVAKDNEEAERTLS"
     gene            complement(<188538..>192176)
                     /locus_tag="MRET_3465"
                     /note="MRES_13935"
                     /db_xref="GeneID:38740231"
     mRNA            complement(<188538..>192176)
                     /locus_tag="MRET_3465"
                     /product="guanine nucleotide exchange factor LTE1"
                     /transcript_id="XM_027630092.1"
                     /db_xref="GeneID:38740231"
     CDS             complement(188538..192176)
                     /locus_tag="MRET_3465"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor LTE1"
                     /protein_id="XP_027485856.1"
                     /db_xref="GeneID:38740231"
                     /translation="MFLRRSRSIDVLGSSKKLDAQKSGGEMKKSKPKLKSMRSFRFLK
                     SPRLGFAPESSSRNPSQTPATRLDGSAISTPLSDAHGLGIKHSTGPGMPGSSGDTRPV
                     PHARMYSPHSAMSTDIFSTSRPPGTGMRLPPSRTDANVAQDPYLDWELPSEMAAPASE
                     PLPSVPVFPQMSELHTESMHSESNARLSPTKLTPEATKVPENAEVSQSTWPPYHTDPV
                     RNIEDAYYYINEAPGDHPQDVTMQGYAMQSDVTAPTSQLEAAAITSPVPPSGLYNDQA
                     QAASRPASLSDTINPSQDVVDALVHPYDSNMDETVNRPESWTLPELENGQPTTDDALM
                     PQGDENAARTATMRTSVNPDNHSTVTAEPALHESQDGANSLPPANSTHLASQDKQLPQ
                     IQSHPEFPVSALPTDASYYRVECMLGSHVLVCNDPIVQSKVPKPVAYTYDTWYLEPSN
                     GQKSANITAIVAASPSNEEALSVPLHLNVFASQLEPASEGPYVLDIATPLELEVPHTQ
                     PLSSNVTRLVPLSTSLRNAALFSMSSHVILAATPRRLVAEMTSGSAPGLLQDVLLGYR
                     PYFSAHRLLELLLQRTEWAIEKLGLPNVAPTAQRVLSQSQLALWHWLLYYYEYDFQKD
                     EALTRRLVQWTHEQNLRLESWPTTEVGSSWPSTVYDGEEHLPRDLRERMQSIYSLVEI
                     LVPETLLPPPEAANEKRGTGLLHKTRSISRMLSLSGGHSRRGHSRKSSSAAVAAAAHQ
                     DAANMSGDTDTSAEATRDVPFPSQIQRNRSLRGLRSMLSPRTDQHDDPSEYEPRHSIR
                     KYETLVPDNEDGDESTEHDAALKLLEEALGDIPRAEDLHQPASKSRVDGPFHWIPRYN
                     HTSWKEAQRMSMSMARTTKPPGASAAPPMSSTPSAADGEPVLALRDSLLLSQRSSTIA
                     RQMGMIERELMASIDWSELSEPSWDQHTVRQEQWQLEYQDYVMFRIRQTMNDEPSEGQ
                     KDALRQTIHGRGIHMLIARFNRTCAWVASHIVRSNNIQERVAIVNKFIRIAWHCYRQG
                     NMESLCQIMFGLQSPWIARLQQTWEQVSLWELRAFEALRRFTSPREQFAFLRYSMREA
                     IETNIPSRRFSPLTTSSSPYVPFFGQFVSDLSAIDSLASFVDASGMPNTMPLYDDQEL
                     SLSWDALVNVYRLRIKSHIVREFITLQRCQRQAPAPPMELPILIEVLQLDTLSAMAIQ
                     STSLALEP"
     gene            <192337..>193182
                     /locus_tag="MRET_3466"
                     /note="MRES_13940"
                     /db_xref="GeneID:38740232"
     mRNA            <192337..>193182
                     /locus_tag="MRET_3466"
                     /product="ribonuclease P/MRP protein subunit POP3"
                     /transcript_id="XM_027630093.1"
                     /db_xref="GeneID:38740232"
     CDS             192337..193182
                     /locus_tag="MRET_3466"
                     /codon_start=1
                     /product="ribonuclease P/MRP protein subunit POP3"
                     /protein_id="XP_027486029.1"
                     /db_xref="GeneID:38740232"
                     /translation="MVAQVHTKQHTQRHKANRDRPHGKDAKLIASMASGEKLSQRKRV
                     FRPVLTSPFAVSWPRIPKADGDTVLHTLLEILCDEDGKRPQKSDPAYVVGVNAVSRQL
                     ESHIHTVRQNIPLDRSCLPRYLFVCVADMDPPVLVSHLPMLTGAYNAMCAGKLASSSD
                     ETVPTLWHPSERQAFCIPAVVLVPLPQGAEFLLSTALRVRRLSALMTTTALRGDQQDR
                     LCTRIKQVLGPDTWQHGFRVPWLDQAGGLLPPHIKHVASSAPVTKGKKNAAQGRKPRE
                     HTPKV"
     gene            <193395..>194681
                     /locus_tag="MRET_3467"
                     /note="MRES_13945"
                     /db_xref="GeneID:38740233"
     mRNA            <193395..>194681
                     /locus_tag="MRET_3467"
                     /product="transcription factor"
                     /transcript_id="XM_027630094.1"
                     /db_xref="GeneID:38740233"
     CDS             193395..194681
                     /locus_tag="MRET_3467"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027486007.1"
                     /db_xref="GeneID:38740233"
                     /translation="MGRKKINIQPIQSDRNRKTTYIKRKAGLFKKAHELAVLTNSDVA
                     VLVFGPNGKLAEFCSGEIEELLLRYTEHHGTIERRGREHFTRMGHESPCHEPISSPRN
                     LTNRRNTSVLATMRGRIDSWDAHHSQKAHQTTAKVARAAFQPVASHATQDDLSLEKRA
                     CPMTTEHASMNESKDWAADLQRNVLTNMSSHPSDGAPTDRPMPEHVPLSRRWPQSVDL
                     GLLLSPADYLMTNAVGKDRFAPDAQASVSQHTYAQNTTQTSAPRLHITPTTNDSPGNT
                     PAVSLSMPASPMSPIHLVQNVGESLLPNRSCSCPHTTSPFVSSLDHAAIPIPHTFAMK
                     LQPQPRPCPHSLSPRSSCPDGAPRSPRSADPSDLSSPQFKMQELPPPMSTVSPLTTNL
                     EKPGLVAQASLHAPHSMTPAPILLSPSPYPSVPHTM"
     gene            <194775..>199097
                     /locus_tag="MRET_3468"
                     /note="MRES_13950"
                     /db_xref="GeneID:38740234"
     mRNA            <194775..>199097
                     /locus_tag="MRET_3468"
                     /product="sortilin"
                     /transcript_id="XM_027630095.1"
                     /db_xref="GeneID:38740234"
     CDS             194775..199097
                     /locus_tag="MRET_3468"
                     /codon_start=1
                     /product="sortilin"
                     /protein_id="XP_027486009.1"
                     /db_xref="GeneID:38740234"
                     /translation="MHGVWRWLCACVLAWTLVTHAAIPEVKVTHFPNMAAQIQYFEDS
                     SVVIWHDAVDGIVYRSADEGKSWAPIKGPVQGEAHLFVLHPYDKTQAYILTRSNQHWR
                     TSNRGETWQSFSTPHPPTTLKAMPLDFHPTHHDWILFTGQACTVNLFRKVCHDVAYYT
                     TDGFISDAHPLLDRVEQCHWAKMTPQVAVPEALTQRVLCLAWDVSMSRKRRDTTQLKM
                     FVSDDLFQTRQAVVLEDLPNPRGFVNMGRSDQFLIAAVQSDDDELRLYVSLDAETWTR
                     ARFPHVVLSHENAYTILEGPKYHLAVDVYDHASRLDGLFISDSTGTNFSLSIADTVRG
                     ADGIIDYEHMTHMEGVAIVNVHATGSPARVQTRITHDEGASWTDIPAPTQDLDGKKTS
                     CDRPGCSLHLHAVLAIRNLGHVFASTAPGIMMGVGSMGDRLRPYGECDTFISTDAGLS
                     WRMVARGPHKHVFADQGGLLVMAADAPSIDVVQYSFDYGTTWTTLALPEAIEPVVLTS
                     VPDGTALKILLLGGRRAKTAHERYASMFIDFAVLSKRKCAQADFERFYPATPHGSCVF
                     GRRQWYLRRKAQADCFVRDKFHEPQGHDEACACTPADYECDMGFVRSANGTCQPTMPV
                     PAPPGACTGNALTFRGPSGYRKVPGNTCVPPSVPLDAPVRRPCSEMAPATGSVRHAAF
                     TFPASIAQVLHFASSPRILVRLTNGQVFQSADDGSTWHTLPLRVHHHPPSTALRIVQH
                     PYDAQRAFVITQGTHVHYTMDGGRSWKWFSVPLLANGAGVEPMQFHPRHPSWVLWIGS
                     PDCFKYACTTELWYATVEGYAKWSRVATHVRKCAFVETRDFPAEDERAIVCEKPQKQG
                     FDIVVGDAFFTRRQRTVMRGVLGFSVFSQYMIVAQPVGMSLHMYVSMDARTFAPISLP
                     HSLRLDHSAYTVLDSVTRAVFLHVTTQAAQWGDIIKSNSNGTYFASSLGRVNRDAHGF
                     VDFEKMQGLDGIALANLVSNTHEASLSGRKALRTVITHNDGSLWKSIPAPPVDSSGRA
                     YECQHVGCNLHLHNLLERPDHLLKPTSPSATGMMLATGNVGLALKPYSECDTFFTRDG
                     GFTWQEMHRGTHKWEFGDHGAIILLADDTRLTDTVRYTLDQGLSWNTYRFAPAMRIQT
                     IDTVPEDTKRQFVMLGETADARATAVFLDFSHVLTRPCVWDAHHDDRSDFERWSPSQQ
                     RAEACLFGQQTWLWRRKRDRICYVGEHMPQRSVEKTPCACSLAADFECEFNHYRDVSD
                     GTCMPYPGAQLLPDDPDTQCARDAPDYDGFWYERTNMRKIPLSQCRGGERPDRGRRHR
                     CRSSWRISSVIWWLFAWLCLGGMGYVACMWMAARRVHATSPISLGDAEPFLRDTYAHL
                     QNVAQHGRHLVHIAWANVMAILHDLPITRDILRRYERPFSQYHMLSTDEDAEILRDDD
                     DMAS"
     gene            <199260..>200426
                     /locus_tag="MRET_3469"
                     /note="MRES_13955"
                     /db_xref="GeneID:38740235"
     mRNA            <199260..>200426
                     /locus_tag="MRET_3469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630096.1"
                     /db_xref="GeneID:38740235"
     CDS             199260..200426
                     /locus_tag="MRET_3469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486010.1"
                     /db_xref="GeneID:38740235"
                     /translation="MYTSAIVWLYIMLECAWAVEYEPLPTTAARPSLSRDTSNELIWV
                     CPPHSDTCMGVTSPFARYIRRSIWFERKAIIITAIFLSIFIILFIGTAVFLRDLRHNG
                     MDEEETLSEKSESEEPLPWPPSAQRARLFMHLRHRSRASRHTPPRDHSDADDEDSDTA
                     SELSLSDLPCAQPPLLNAVHIAAPVRPRSPRYPSHSEAPDASDIQVVNTLPMEPAATL
                     PPSYGTASSRTTYDKPEPICNPFEDPDTTTLSAHVATDEKATLQALHLAPSAPEVVDD
                     IPVPSAPDAIDDIPVPSAPDMPPSSSNAQQKGKERSSAIVPAPPAPFVSSYDEYASMS
                     KSKAQEAEEERAWLTSILPSMPGQPPDSLDLPTYQQRANELSEAPIPSAPVMDE"
     gene            complement(<200457..>200876)
                     /locus_tag="MRET_3470"
                     /note="MRES_13960"
                     /db_xref="GeneID:38740236"
     mRNA            complement(<200457..>200876)
                     /locus_tag="MRET_3470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630097.1"
                     /db_xref="GeneID:38740236"
     CDS             complement(200457..200876)
                     /locus_tag="MRET_3470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485971.1"
                     /db_xref="GeneID:38740236"
                     /translation="MTNILQQGKIKAVRSSTKEARRALEESDETCWTLDLNSPSTSEY
                     AEMHCTFDAGVPMHQLRTLLCTFGGGFSPIRVVVTAVVDGQDVLLADVYPKDGNMPQS
                     FPIEARGAQVASKVTLRLEGSTDGFGRVVVYHLAVLT"
     gene            <200915..>202003
                     /locus_tag="MRET_3471"
                     /note="MRES_13965"
                     /db_xref="GeneID:38740237"
     mRNA            join(<200915..201858,201883..>202003)
                     /locus_tag="MRET_3471"
                     /product="tRNA-dihydrouridine synthase 4"
                     /transcript_id="XM_027630098.1"
                     /db_xref="GeneID:38740237"
     CDS             join(200915..201858,201883..202003)
                     /locus_tag="MRET_3471"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 4"
                     /protein_id="XP_027485970.1"
                     /db_xref="GeneID:38740237"
                     /translation="MEPGALPPHHLLGAFEHVNVCAPMVRYSKLPFRALVAQYNTHIT
                     TTPMILAAEFSRHPQARDAEFSTNQAERGTFRLPSQHTNRDVVFRGSLVCQLAASEAG
                     PLADAAELVSPFVDGIDLNCGCPQPWAYAEHIGSYLLRQPETVRDMVRTVKDRLGHAY
                     CVSVKIRIDADLRRTDTLVRNALHAGASLITIHGRTMHESSASDPVHLDAVKFAVDCA
                     NACGLQTARGTSPNDAWVWAEDGGSGGRAPCIVNGDIWTNDDAVEWRRYTGARGAMSA
                     RGLLVNPALFAGEPRTPPEAITRFVDHAMSWGLPTSFLHRHLAYMLEDRMPSRAESIY
                     FNSLASPASILDWLSDAGYV"
     gene            complement(<202009..>202674)
                     /locus_tag="MRET_3472"
                     /note="MRES_13970"
                     /db_xref="GeneID:38740238"
     mRNA            complement(join(<202009..202165,202194..202593,
                     202617..>202674))
                     /locus_tag="MRET_3472"
                     /product="histone chaperone ASF1"
                     /transcript_id="XM_027630099.1"
                     /db_xref="GeneID:38740238"
     CDS             complement(join(202009..202165,202194..202593,
                     202617..202674))
                     /locus_tag="MRET_3472"
                     /codon_start=1
                     /product="histone chaperone ASF1"
                     /protein_id="XP_027485973.1"
                     /db_xref="GeneID:38740238"
                     /translation="MSIVHLQNVEIINSHARFSDPYIFKVTFECISPLEDDIEWKLIY
                     VGSAESEKYDQELDSCMVGPVPVGVNSFEFEAEAPSPEKIPASDLLGVTVILLTASYK
                     DAEFIRVGYYVNNDYESEELRENPPEDVQLDKVCREVLASKPRVTRFNINWDNPKDVI
                     EPSASETQTTQTQEGEAETVETTPKPMYRPESELSQGGSAFVPL"
     gene            <203313..>204350
                     /locus_tag="MRET_3473"
                     /note="MRES_13975"
                     /db_xref="GeneID:38740239"
     mRNA            <203313..>204350
                     /locus_tag="MRET_3473"
                     /product="sterol 24-C-methyltransferase"
                     /transcript_id="XM_027630100.1"
                     /db_xref="GeneID:38740239"
     CDS             203313..204350
                     /locus_tag="MRET_3473"
                     /codon_start=1
                     /product="sterol 24-C-methyltransferase"
                     /protein_id="XP_027485972.1"
                     /db_xref="GeneID:38740239"
                     /translation="MSSATELRNKQGIADYTKYWNPDSTKDTDKDQSARLDQYTDVVN
                     AYYDGATDLYEYGWGLNFHFARYYPGEAFYQALARHEHFLAHRMNLRPGMRVLDVGCG
                     VGGPAREIARFAGVTIVGVNNNAYQVDRANKYTAKAELQDQASFVKGDFMKLKEQFGE
                     NSFDAVYAIEATCHAPTWEGVYGEILSVLKPGGVFGLYEWCMTDEYDAANPEHRKIAH
                     GIELGDGIPEMRTIKQAREALRTVGFQIDEEMDLADQGDKIPWYYPLEGDIRKVQTAW
                     DVFTCWRMTWFGKFVTQSAVRALEFVGLAPKGTYEVGESLKVAADALVAGGRMKLFTP
                     MMFFVAHKPSA"
     gene            complement(<204371..>204686)
                     /locus_tag="MRET_3474"
                     /note="MRES_13980"
                     /db_xref="GeneID:38740240"
     mRNA            complement(join(<204371..204464,204490..>204686))
                     /locus_tag="MRET_3474"
                     /product="U6 snRNA-associated Sm-like protein LSm8"
                     /transcript_id="XM_027630101.1"
                     /db_xref="GeneID:38740240"
     CDS             complement(join(204371..204464,204490..204686))
                     /locus_tag="MRET_3474"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm8"
                     /protein_id="XP_027485975.1"
                     /db_xref="GeneID:38740240"
                     /translation="MSGVQSYVNHQVLLLTQDGRVIVGVLEGYDSNGTIVMSSCVERM
                     FSEDAPVEEVPLGVYIVRGDSIALLGPMDLAKDRAMPLSSMIAAPIPAVRHR"
     gene            <204828..>206744
                     /locus_tag="MRET_3475"
                     /note="MRES_13985"
                     /db_xref="GeneID:38740241"
     mRNA            <204828..>206744
                     /locus_tag="MRET_3475"
                     /product="dihydroorotate dehydrogenase"
                     /transcript_id="XM_027630102.1"
                     /db_xref="GeneID:38740241"
     CDS             204828..206744
                     /locus_tag="MRET_3475"
                     /codon_start=1
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="XP_027485974.1"
                     /db_xref="GeneID:38740241"
                     /translation="MSMLASSRAMRTLAPPMRFAQVRAMSFRSRPSVSRRVASRLVTV
                     TAVVAGAAFGVYCLDSRAGVHRWLFPPLMQMCTDPETGSKLSIKLLQYGLAPRDCGVD
                     DEVLRTELFGRTLSNPIGLAAGFDKQAEAIDGLFDLGFGIVEIGSVTPEPQPGNPQPR
                     MFRLPLDGAVINRMGFNSDGHEAVRERLHMRLHRWVQRVLAAGQGLVSSVGAPATDAK
                     HLTEAQLFAKYPDIRASLLDDAQVPRSLKQDRLLSINLGKNKTSREDSVVDYVKGVET
                     LGPYADMVVINVSSPNTPGLRRLQRRSVLEGVLRDVITARDSVAPHRTLPLLVKVAPD
                     LSDAELEDVADAARATKTDGIIVSNTTVSRPAGLLSHEHVNEAGGLSGPPVKPLALHA
                     LEVMYARTEGRMPLIGCGGILTADDALDFARAGASAVQLYTGLAYRGPGLPRRIKDDL
                     AKKLRAEGRTWSQVVGTGLSQRAATYAPDAVEHVGLYPGAQDAFERSVASVRHEIEQL
                     RESFQHEHVPEERRALPFDVEAHDDEFKAVLAEAHKVTDDTPQYSDSETPHAGVLPQR
                     DSAVPDNLLLLAKERGLTQGEMLQEAVLESTTVPEAHSQAPTSGATTLGGLQAPLTHQ
                     VPKAFQPPKQERVV"
     gene            complement(<206759..>208504)
                     /locus_tag="MRET_3476"
                     /note="MRES_13990"
                     /db_xref="GeneID:38740242"
     mRNA            complement(<206759..>208504)
                     /locus_tag="MRET_3476"
                     /product="zinc finger protein"
                     /transcript_id="XM_027630103.1"
                     /db_xref="GeneID:38740242"
     CDS             complement(206759..208504)
                     /locus_tag="MRET_3476"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027485977.1"
                     /db_xref="GeneID:38740242"
                     /translation="MNRFFSASMSAVTSSSGSSSGPPGGPSGSHPPPSVSKLVTSDGS
                     AAAVSPHASPRPMMPHHLPGVLSPYRESPSRFPAVGSPRTSSPRISALTREASFGSSV
                     YPTSSSRPASPSTVQERSYSPSPSSGAQSAAARMSTRPLPPRRLSDTSRLVNHAPASD
                     AGTLDDASLSRSHSPSVGPPPPLSTRASFDYYATNSPSRYNDMYVPSPKRDVFRFHAL
                     PSAGWRMPGRGNGDASPWFDNRNSPFASSSMRTGPGEDEERDAPPPPPAPSEDDPRVS
                     YAPRPPPLRPEAAYASPVYRAAALPGSSSPYAVQPPPAYARSMYRAAEYDTYESDAYG
                     VRKHKYEGDTYPESGPPMPYGADPYYAYARMPYKYSSAATSMPHSDASSGDDRSSDEK
                     MSVSAPQLPSGPIATAGAVPTPPPPHVGSAKTPESDSGGPKLHVCDACSKTFSRRSDL
                     ARHRRIHTGERPYPCEFPGCGKSFIQRSALTVHSRVHSGERPHQCEFEGCGKSFSDSS
                     SLARHRRTHTGRRPYVCTVPSCGKMFTRRTTLNRHVRSHQAPLKKGLVAPPYDDRPDS
                     DEEDDDDDDSSDMVR"
     gene            <208801..>212700
                     /locus_tag="MRET_3477"
                     /note="MRES_13995"
                     /db_xref="GeneID:38740243"
     mRNA            <208801..>212700
                     /locus_tag="MRET_3477"
                     /product="structural maintenance of chromosomes protein"
                     /transcript_id="XM_027630104.1"
                     /db_xref="GeneID:38740243"
     CDS             208801..212700
                     /locus_tag="MRET_3477"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein"
                     /protein_id="XP_027485976.1"
                     /db_xref="GeneID:38740243"
                     /translation="MERVGVDRRPPPTPARSPLKSVAQTPLRPRATPFKTPGRRPPPV
                     TPARTLGRTPAAQPAPPVRRLVIHKLVLQDFKSYAGRQEIGPFHKSFSSIVGPNGSGK
                     SNVIDALLFVFGWRANKMRQGRLSDLIHNRDGATPPSQCVVEVWFREIIDFPDSDDFN
                     VVPDSELVLKRFAQRNNTSQYTLNDKRSSFTEITDLLRHRGIDLDHKRFLILQGEVES
                     IAQMPPKGKTEHEEGLLEYLEDLIGTSDYKTPIEEHAKAVDAANEARSEKINRLKIVQ
                     RELDGLEPRRKEAELFLRDQNDLMRLQSRLWQAHMWDCRTLMAHATESLASIQQRIES
                     EQARHTEAESGLTTVREQHKAHAEACAQMEQQARELTRELEVAEKHGVELNARHKMLS
                     GKRKKLASALSEAKSAASDARASASTAAETIAAVQQEQSAHELALTKEESALESVCER
                     LKDKTQGFSDEIERKQKELAPWTAKISEHTSARDVLRHEREWLLSHNDEAMQRVEDAR
                     ATLADVQRHLQVQTEEKESLLYEQRALLDSIDEDRARVTSMQEEEDILRKKFDHARRA
                     ADDARHALESSKSRGEVLSSLIRQTELGLLTGFHGRLGSLGTIDPRYDIAISTACPGL
                     NNLVVEDVTTGQQCIEHLRKHKLGRANFILLKSLQVNPKAMAPMATPENAPRLFDLVA
                     PKDSRFVPAFYHQLGDTLVARDLAQANRIAYGAKRWRVVTEDGQLIDKSGTMSGGGSR
                     VIRGAMSSKLSEDVSPEQAARLEKELGIARGSLQSHSQSISQLITLLQKNENRIPDIE
                     RQLTMLDREIQATTQRVSEAEDRLYEAQTQSEPDQEDLRRMKELDQQWKHHDEQIATL
                     KNKSADLEQAIHRLEEDILEAGGVELRTQQSKVQGIKDMISLCAERLSKAEEEHARAE
                     SDYKRHEKSQATSEAQLATLEEELRNIGESQTAQSSQAATLRQQFDDLQADLEDRAEA
                     RRQIQAELDGHESTLRAFRALMMDLTQQCEDHEKAKMESERQLAQWTAKHATLVLHPV
                     STDEDESQCVKKEETDELPELSEEEARSVDKSHIQADMARLEERLASNQVNLDVLAEF
                     QKVEETFLSRAKDLEVTTEQRDEVQQRFEALRKERLDRFMEGFSQISLKLKEMYQTIT
                     LGGNAELELVDSLDPFSEGIVFSVMPPKKTWKNISYLSGGEKTLSSLALVFALHAYKP
                     TPLYVMDEIDAALDFRNVSIIANIIKERTRGAQFVVISLRNNMFELSSRLVGVYKTAH
                     CTKSLTIENTDLHKSEGPPSATASPSRPLGHRPPLLG"
     gene            complement(<212697..>214340)
                     /locus_tag="MRET_3478"
                     /note="MRES_14000"
                     /db_xref="GeneID:38740244"
     mRNA            complement(<212697..>214340)
                     /locus_tag="MRET_3478"
                     /product="Prm1-pheromone-regulated multispanning membrane
                     protein"
                     /transcript_id="XM_027630105.1"
                     /db_xref="GeneID:38740244"
     CDS             complement(212697..214340)
                     /locus_tag="MRET_3478"
                     /codon_start=1
                     /product="Prm1-pheromone-regulated multispanning membrane
                     protein"
                     /protein_id="XP_027485979.1"
                     /db_xref="GeneID:38740244"
                     /translation="MHRLATMVPVCIAIAMIGALQTVRFVERARSRQRQVLNIVYAWR
                     TSTEDVCAQVEKHVSVLMHVPAHILAQAQMQSSKAAEDVVQNMGRLVIGVLDMVRVMV
                     HMVVSSYKALAMCVLQLVVQGVLSLLDAATHAINLAVHDAAQALRTILDTVLQTADGA
                     KDLLMDTVNGVLGLFGHEKIETHAWSEPAALRVLNNISLPASLIDPFKQLRSSLPTVD
                     DLRTDAEEAFMLSISHAKKEVHRTLTQFHMPPPVSLPPAPMPVCQIDWTPLEHATRVW
                     THTSHSIQALVMCIMAGVTLALFTLVWASTLPKHVDSEAASWLRRARQWLGSPSFLLA
                     SAWLLLQLMHDQVTLMAVQVLDRVSSQALQDILSPMADSAHQIHTHVASTMQHTARHI
                     QTLWQTTEQQVNRDMLGWVNESAPQAHAVLNGIWDLVSGTVHDVLGHTPLHDPVQQFA
                     GCVIGNKVNATDHILSWLQTHAYITLPPVIFNTAWPDVDRWIKSAWEHKIPVSPLEQV
                     HTMLAEERKEIEHDRWVVLLIGVGGALSLGICAVISAWI"
     gene            <214426..>214833
                     /locus_tag="MRET_3479"
                     /db_xref="GeneID:38740245"
     mRNA            <214426..>214833
                     /locus_tag="MRET_3479"
                     /product="RNA-binding protein with serine-rich domain
                     1-like protein"
                     /transcript_id="XM_027630106.1"
                     /db_xref="GeneID:38740245"
     CDS             214426..214833
                     /locus_tag="MRET_3479"
                     /codon_start=1
                     /product="RNA-binding protein with serine-rich domain
                     1-like protein"
                     /protein_id="XP_027485978.1"
                     /db_xref="GeneID:38740245"
                     /translation="MSVPEQDETPLRHRSHKVYVYRLTHNVTERHLEEIFGFYGEISR
                     LRLYAAVHKQPHAVIEYESEAGADLAIIHMDEGQIDGSCVRVTLTEEPERCVLPPRPS
                     QRRQGRRAIDHGWGRRADVRRSPLRRSRSASPS"
     gene            complement(<214839..>216031)
                     /locus_tag="MRET_3480"
                     /db_xref="GeneID:38740246"
     mRNA            complement(join(<214839..215097,215124..>216031))
                     /locus_tag="MRET_3480"
                     /product="protein of unknown function (DUF2418)"
                     /transcript_id="XM_027630107.1"
                     /db_xref="GeneID:38740246"
     CDS             complement(join(214839..215097,215124..216031))
                     /locus_tag="MRET_3480"
                     /codon_start=1
                     /product="protein of unknown function (DUF2418)"
                     /protein_id="XP_027485955.1"
                     /db_xref="GeneID:38740246"
                     /translation="MVRETIRRRTDTPQAQVSPFIRRHISSTDTLPATPYAHRKQHVW
                     NTMASSPLQRKGAWSSPGIRLSAATDDHASYHAEIPGRKPTLQDRWEQWPSAILGYIQ
                     GLWMDVGNLIHEPEMGVPLGAVLHAGSLVSQLMLPGTSFLYTRDSMERHPRSHLFAPY
                     RGLRAKHQEGSYSAYIGQLILQQRTAGFLYMSRLLSLALLVLSMYNAYVLFAKRRTYR
                     LWYREERDVLHNPHATLEVPPTDPLPRRTWQAWAKHAARATARQMPILEWFVPPPPVR
                     VAPARPVERIYTLRVWDICEVPLWVFTIYSPAHAVWWAVSGSLGMQVWTSWLVTLVLM
                     FLFSAQSFILAREYAAHVKDRQVLSSEVLREYDEKFVIPRAMPLVRDASTMTDE"
     gene            complement(<216064..>217689)
                     /locus_tag="MRET_3481"
                     /note="MRES_14005"
                     /db_xref="GeneID:38740247"
     mRNA            complement(<216064..>217689)
                     /locus_tag="MRET_3481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630108.1"
                     /db_xref="GeneID:38740247"
     CDS             complement(216064..217689)
                     /locus_tag="MRET_3481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486079.1"
                     /db_xref="GeneID:38740247"
                     /translation="MVPIMTANERLLTQPRKVIQDTFDKYEQHPTQALVHALSTQYAR
                     VFTEPSMLEQIPYVEPGSISSLISSLQGDRSQKVGILVRWRCMIQDTGMGNELCLATL
                     SSDGRRVCGLYGADAHFSHANQDDAAMDTANLGERTVFFAVSVPGETAWAHDHIVGAS
                     ASLGHAMEKLNVELNDTTRTPRSEHPSVTALVKVYDVDAAEQFKTSDVIDVLGLLDLG
                     TCPQAHWHLDETESTEAPILPCVHALHVRSAPPLFPADSDSLNAPENMRASLIQYFTQ
                     VLGGDALVAEYILLAMLSRVHARKNGIVIGPFSINVTGLDREHYETLVSALEQIMPAV
                     VCQPLTLAELNDAAHPLYVCGTDTGIQAGRLQLPHGTCVVLDESGMDEGQLNDAGVRN
                     IRALFSLLQQHTLPYVFPFSELDIPTDLVIIVVSQSKSLLPVDAHIHARPHHAPQMKV
                     SSSMLHTFRLFLTNIRQKTLSIPVDVSDHIQDDFVKMRRSGAHRFDQDDLQRCLHVSR
                     LLSLSHGLERLTTDMWSQAKVLDATRAERVALP"
     gene            complement(<217821..>218353)
                     /locus_tag="MRET_3482"
                     /db_xref="GeneID:38740248"
     mRNA            complement(join(<217821..217904,217936..217988,
                     218034..218185,218231..218275,218316..>218353))
                     /locus_tag="MRET_3482"
                     /product="cyclin-dependent kinase regulatory subunit CKS1"
                     /transcript_id="XM_027630109.1"
                     /db_xref="GeneID:38740248"
     CDS             complement(join(217821..217904,217936..217988,
                     218034..218185,218231..218275,218316..218353))
                     /locus_tag="MRET_3482"
                     /codon_start=1
                     /product="cyclin-dependent kinase regulatory subunit CKS1"
                     /protein_id="XP_027485956.1"
                     /db_xref="GeneID:38740248"
                     /translation="MSNEPTYEEYVDRIHYSEKYADDKWEYRHVILPKPFLKRIPKSY
                     FDPEEPGVLRILSDAEWRGIGITQSLGWEHYEVHAPEPHILLFRREKDYQAKYGPQGK
                     PSDAAKIKNDASQAHHVLHGN"
     gene            <218580..>219542
                     /locus_tag="MRET_3483"
                     /note="MRES_14010"
                     /db_xref="GeneID:38740249"
     mRNA            <218580..>219542
                     /locus_tag="MRET_3483"
                     /product="aldo/keto reductase family"
                     /transcript_id="XM_027630110.1"
                     /db_xref="GeneID:38740249"
     CDS             218580..219542
                     /locus_tag="MRET_3483"
                     /codon_start=1
                     /product="aldo/keto reductase family"
                     /protein_id="XP_027485957.1"
                     /db_xref="GeneID:38740249"
                     /translation="MVEYHLAPLQTLNTGAKISMVGLGCYSPDDPKAIIDGITAATKD
                     GYTHFDTASFYENEEVVGEGLRASGVPRENLFVTTKLWNFDHHNVEEAFDKSLAKLNV
                     DYIDLYLMHWPQATKSGHMFVADDTINFIDTWKAMEKLFETRPGKIKAIGVSNFSIKT
                     LTELLKHAKIVPALNEIETHPYNQENELIQFCREKGIVVSAYTPLGQANSPILKDADI
                     VKIAEEIGGDVTPAKVVLSWNVQRGVVILPKSSNPVRVKQNIELITLSDDHMQRIYNI
                     SKDPSRHQRFALVYDKTTETVFGWTWEQLGWEKPTHVSCLESGA"
     gene            <219749..>220702
                     /locus_tag="MRET_3484"
                     /note="MRES_14015"
                     /db_xref="GeneID:38740250"
     mRNA            <219749..>220702
                     /locus_tag="MRET_3484"
                     /product="aldo/keto reductase family"
                     /transcript_id="XM_027630111.1"
                     /db_xref="GeneID:38740250"
     CDS             219749..220702
                     /locus_tag="MRET_3484"
                     /codon_start=1
                     /product="aldo/keto reductase family"
                     /protein_id="XP_027485951.1"
                     /db_xref="GeneID:38740250"
                     /translation="MTEIQTPPTTKINTGTEVSMVGFGCFNPGNPPGIIPGIEAATKI
                     GYTLYDTAALYENEKEVGDVLRASGIPREKLFVTTKLFNDCHHSVEASFDRSLEALNL
                     DYIDMFLMHWPQATVPGQKYVADDSISFVDTWKQLEKLLETRAGKVKAIGVSNFSVKT
                     LTELLKHAKVVPAMNQVETHPYNQDRELVKLCQEKGIVVEAYTPLGFADSPFFKDQDL
                     LSIAKEIGDDVTVPNVVLSWNVQRGVIVLPKTCTPERAKENFRILRLSDAHMQRIYDI
                     ENDPKRRHQRLCQAYDPKTKTALGWTYDQLGWNKPIQMMEN"
     gene            <220890..>221822
                     /locus_tag="MRET_3485"
                     /note="MRES_14020"
                     /db_xref="GeneID:38740251"
     mRNA            <220890..>221822
                     /locus_tag="MRET_3485"
                     /product="aldo/keto reductase family"
                     /transcript_id="XM_027630112.1"
                     /db_xref="GeneID:38740251"
     CDS             220890..221822
                     /locus_tag="MRET_3485"
                     /codon_start=1
                     /product="aldo/keto reductase family"
                     /protein_id="XP_027485952.1"
                     /db_xref="GeneID:38740251"
                     /translation="MTCDMYTPGSAKLNNGAEVPLLGLGCYDPANPDSIGEAILVAAH
                     HGYLHYDTAKFYENERVVGQALRKSGIPRDKIFLTTKLWNTDHHDVEAAFDESLEKLD
                     LEYIDMYLMHWPQATMPDQRFKSDDSIDYIKTWKAMEQLLKTRAGKVKGIGVSNFSVK
                     TLTELLKHAEIVPAMNQIETHPYNQDRDLVRLCQEKGIVVTAYSPLGMALSPMPEDRD
                     IVSVAQATGVTPEQIILSWNVQRHVVVIPKSLNPVHIEQNMKMVKLNEEQTQRIDAIA
                     NDPERRCRRFCPAYDPQTDTVAGWTYEQLGWEKP"
     gene            complement(<221827..>223452)
                     /locus_tag="MRET_3486"
                     /db_xref="GeneID:38740252"
     mRNA            complement(<221827..>223452)
                     /locus_tag="MRET_3486"
                     /product="mitochondrial protein FMP25"
                     /transcript_id="XM_027630113.1"
                     /db_xref="GeneID:38740252"
     CDS             complement(221827..223452)
                     /locus_tag="MRET_3486"
                     /codon_start=1
                     /product="mitochondrial protein FMP25"
                     /protein_id="XP_027485953.1"
                     /db_xref="GeneID:38740252"
                     /translation="MLRAAGWRTIWRTAPPSRVVIGGAALVTGIAYVSSPYLLDSPLD
                     HAGSASEHRFPLCSLFAWGMNKNKVAAPHLKDTVVRLPENFQSLDGMALRDVQFSNDV
                     GVAVDASGNILQWGTGFDPVSPCPSQTLTGLDIERVQISGSKVFALSRSGHVYVFATQ
                     RSKLIRDASSWFSSPFDYIQLKANERFKDIAAGEHHVLALSRDGHVYSVPADDLANEF
                     GQLGYSSVSLTQRDSFKRVEARLEPRIVLNRRRSDALETPHKDIVDSSDIRYAPELRP
                     VPSLHGATFAQIDVGSNHSVARTAEGRVLTWGYNGFGQLGLGANISVDTVAVPSEVAW
                     PVSIVGRNASCSCVAAGGNNTFFVIQSSNAPILSDEKGALSKERVDVLAVGSGQRGTL
                     GNGQRSQVCGVPTRVKNVSGLYEYSEREKRLCPIQVHALTVGAGGQCALVMDAPPLSQ
                     DETRRDVYVWGDNDASQLGMGGKGHRAVPSLLTHTPPSNQDDKEQPAPQRILLVERNK
                     VRGSSWDGKERTYSRVEQRIVAGGSCVGVYTKV"
     gene            <223574..>225655
                     /locus_tag="MRET_3487"
                     /note="MRES_14025"
                     /db_xref="GeneID:38740253"
     mRNA            <223574..>225655
                     /locus_tag="MRET_3487"
                     /product="glycyl-tRNA synthetase"
                     /transcript_id="XM_027630114.1"
                     /db_xref="GeneID:38740253"
     CDS             223574..225655
                     /locus_tag="MRET_3487"
                     /codon_start=1
                     /product="glycyl-tRNA synthetase"
                     /protein_id="XP_027485954.1"
                     /db_xref="GeneID:38740253"
                     /translation="MLTAAWRSTILPKQVARTISVTLQRSMATAATQDPSLVKKDAHP
                     FERAQLEGLMTKRFFYTQAFEIYGGVAGLYDYGPSGASLQANIISHWRNHFIIEEDML
                     ELDTTIMTLSDVLKTSGHVDKFADWMVKDVKSGDIYRADHMIENVLEARLKGDEDARK
                     REAGVQTSSETAPPAEDKKSKKKAKAVAVKLDDAVATEYRHILAQIDDFSGEQLADLI
                     KKYDIRAPATGNEVSEPTEFNLMFESSIGPTGQTKGYLRPETAQGHFVNFERLLDFNN
                     GRVPFASAQIGKSFRNEISPRAGLLRVREFTMAEIEHFVDPDNKSHPRFKEVASLALP
                     FLPAHVQKGGETTVTKKTIGEAVSSGMVDNETLGYFLGRIFLFLEAIGINTERLRFRQ
                     HMDNEMAHYASDCWDAEIHTSYGWIECVGCADRSAFDLTMHSQRTKRDLMVQEPLKEP
                     RVYQKYVPTINKKVLGPFFKKNAKVIEDTIMSMSQDCLQKLQKGLEAGKATVSANGET
                     FEVTKEHVEVEYKTIKESVRNFIPNVIEPSFGIGRIFYALLEHAFWAREEDKERGVLS
                     LPPLVAPFKVLIVPISSNEQLSPIARDISKKLRSYGIASRIDDSSATIGRRYARNDEL
                     GTPFACTIDFASVSKGTITLRERDTTSQRIGSIDEVLDVITNLCHGRLDWHGACQILP
                     AYTGTQDVDAQ"
     gene            <225847..>232335
                     /locus_tag="MRET_3488"
                     /note="MRES_14030"
                     /db_xref="GeneID:38740254"
     mRNA            <225847..>232335
                     /locus_tag="MRET_3488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630115.1"
                     /db_xref="GeneID:38740254"
     CDS             225847..232335
                     /locus_tag="MRET_3488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485949.1"
                     /db_xref="GeneID:38740254"
                     /translation="MSTPIREIEAGIDAVKEQTYAAGLLGQGLLEHQRMLEALLEELN
                     DPNKGDQSMEIAERVQAELQDLQEQRDRLFQEISVALSISGPRHSNITRQLQFGFSPS
                     PSFQSRDELERMRQGKVDAEKHFEAMKARVLELERKHDIFKQENWDLYVMQQQLEEKL
                     ANRSSAQTKTEMDRQRLSKELENLRESLEQQRAQFQENEEALSKLRKQRETEDAQGRR
                     ERAGFRRNISDLHGQLKKLQSDSTPHVPRPLASSDGVDHIREIVHEAPRALEHASIME
                     EGASDRAADVLMSLPSNPEADELRAKLSVAIKRLGRDTQQQRKLREQVSELRRLLSNA
                     GVTVPQDDPSDNEADDDDAWVSFDEKPESPQKRRFYPSDSRRVLSHGASMHAMASGAP
                     ASEWVDTSTGDDSVVIKEPSLDPSLANLLSGSTLPRSESMRKLPTSNGGLDMELDAGG
                     YHVKSDMLDVDTMTDTHPLEAELKEARAQFQAEIERLANDHKAELDEVHAKHSHAISS
                     LSTAHEKALDDKSTESSATLEQIRTAHASELDQLRSKHKDELLEFEASRSKALSSLEA
                     NHTKAIQDLKQAQAEQISLQQNTHAAAVEALKLQHIKDLDARTADHEATLNKLSEEHK
                     DAAARHEAALAALKASHATDLSEQKVEAERQLSKLKKEHAETLAAHESILKQVQEEHA
                     SALSTRAKAHDEAIAKLKDEHAQSYKDLVTRHETELSDANKALSMHEEQMAMMRDAHA
                     SELKAKISEHEKIIESLKASHAKGLHELVEKHQAELEQKEALHTKEVESKMAERTRAF
                     ELLSKGHAAELEKQRNEFTEDRSARNKTYGSILDKLKKELSDKVAEHAQAVKSLQTLN
                     DQHSQTIEELMEKHRIALSSKDADHLNEKDAWQKSMDMLQTKTDEYQAAIQALEKEKQ
                     TLLDEHAKRIEELTQSHESRLSAQRSEHIKVLDSDRQTLINEHAKVLDALKRAHAKEL
                     SQSIATHNDALASLEKRIKDEYDQSMNDLHAKHVLELETLRQSVAEEQAKATEAVRAG
                     HAKELEKLQKQLADENSRASKAEESLRARHSDETKALEQRLVEEQSKAAEALQMCAEN
                     AKTEAAKAAENLRASHMKELDALKRSAHNEATQNAKALEELRANHADELESLKTKLAN
                     EASRAAEAAEKLRAEHAMEIKSLQQNAADEASKSIEASEALSARHAKELETLKQQLEQ
                     GQAIAMETLRNKHEKELETYQKKVADEKAKAGEATEQLRAEHVKEIQALKQSLMDEMT
                     QGAEKLEKLRSEQESQHNEFERETKAKYAAEVASLTKKHDEQVQALREQLTEQNERAN
                     KSMGQLQTEHAEALKALQQSMAANYARDQEALRTAHAAELEELKETISAELQSKHAKD
                     LEALQQTATSEQTTAAQAFEALRTTHAQELDTLKQHMAAEQTSALEAIRLQHNKDLEA
                     LKNSVSLAEGRRDEHARELEALRQTQSEKEALLISIQSQLNEAQTEYQRQAQAHATEL
                     DELRRKHENDIQALQRTLDTERDQYTTEQRKAMDALQKEHKSAVTSLIVKHESRIAAA
                     QNERLSSAESTINLLQSRRDAADKEHSAALESLTGEYEQKLSALKEQHASALENSLAK
                     HADTKAEHEAALASLTRDHAKAIEMMATKHAADLERALHDARNAHATELNDMRASHEH
                     ALASVYSEHATHHKALQDAESRLHILTSKVAEAQNALTSMRSEAAEYRAAAEQAQASL
                     EEHQQQLAAREQDGDDTLRAEQASEMQASRLQHYEALSAELRKQLSLKNAEMAAALRA
                     KERDMEEPLAELAVSRAERERLMQQVSDLTAQLRETRAAPPLTWTAGSQTPLTRSPSV
                     ATSHYASPISSRGDQRTVSEVDDDHAVGEVPAWVGTAAAPVALPGHMSNIDPEVADAI
                     IQCMRGEWLYKYATSMFGAERRHKRFFFINPFNRTIHWTSEEPQASTAGHVARSKNAF
                     IDQVALMDDYNMNPSGLYYQTIVIQSGHREVKFTAPSKVRHRIWCTALGYLLQSTDSP
                     VMGSANAPGAKVSIPLEAGNTVTSFNSSLTPMRPKSILSHSHSNNDSSSHVSIISRSM
                     HHAPLTRHSTVHATPPVPLISRSTRRSHPDKRVLSGPSAQPPLRAAGLMEGPATKAIF
                     NLPQPPNVPPAVISMSTPSKESRRKSTRWW"
     gene            complement(<232412..>232635)
                     /locus_tag="MRET_3489"
                     /db_xref="GeneID:38740255"
     mRNA            complement(join(<232412..232576,232609..>232635))
                     /locus_tag="MRET_3489"
                     /product="H/ACA ribonucleoprotein complex subunit 3"
                     /transcript_id="XM_027630116.1"
                     /db_xref="GeneID:38740255"
     CDS             complement(join(232412..232576,232609..232635))
                     /locus_tag="MRET_3489"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex subunit 3"
                     /protein_id="XP_027485950.1"
                     /db_xref="GeneID:38740255"
                     /translation="MHLMYTLGPDGKRQYTLKKVTESGVMTRSAHPARFSPDDKFSRH
                     RITIKKRFGLLPSQPARAA"
     gene            <232780..>233433
                     /locus_tag="MRET_3490"
                     /db_xref="GeneID:38740256"
     mRNA            <232780..>233433
                     /locus_tag="MRET_3490"
                     /product="p24 family protein delta-1"
                     /transcript_id="XM_027630117.1"
                     /db_xref="GeneID:38740256"
     CDS             232780..233433
                     /locus_tag="MRET_3490"
                     /codon_start=1
                     /product="p24 family protein delta-1"
                     /protein_id="XP_027485931.1"
                     /db_xref="GeneID:38740256"
                     /translation="MWRRTSFVASLAVCLVALFQVAYAVKFELPASKHPKPLCIWNYA
                     LADTLGIISVNVVPRVSKTADQQNVEVRIVDRTHHNVYLNKKGLKGETRLAINTHHNA
                     DLGVCLSNYGNDDLVSDIDLDVHLGGDAVDYNAISNQESLSGMETELRKLALIADEIL
                     EEMEFLKLREMRMADTQASTLKRVHGFSWIMIFSLIGLGIWQVYHLHGFFKRKYLID"
     gene            complement(<233430..>234656)
                     /locus_tag="MRET_3491"
                     /db_xref="GeneID:38740257"
     mRNA            complement(<233430..>234656)
                     /locus_tag="MRET_3491"
                     /product="E3 ubiquitin-protein ligase UBR7"
                     /transcript_id="XM_027630118.1"
                     /db_xref="GeneID:38740257"
     CDS             complement(233430..234656)
                     /locus_tag="MRET_3491"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase UBR7"
                     /protein_id="XP_027485930.1"
                     /db_xref="GeneID:38740257"
                     /translation="MDQGRASPIPALPDPSTAAPNIDPELGFTAQDLIDHQERLEAQA
                     NEAFPYHVDVCTHTRGYVRQLIYACKTCGGGGVCVGCSVSCHSDHDLVELFHRRHFRC
                     DCGTPNLYRHRPMTPYKQKTGYPEGAKPCSLRLHDSNKGWDIPNDENVYTKNFDGQFC
                     VCQRGQHYDPETEKEDMFQCLVCEEWLHESCTSLYPKGATKPLISQDDFDTMICNACV
                     RKEKTALLQAYLGQPGWLVVLPNENGWEVVGSSPDLEILASRKRARLDSDTCQQPTPL
                     VDPHAHAHRMDVYLSSQFRQALCRCAGCTQKWQKIYPFVFEEEETYEPSEPEETDDTN
                     SNASTSSSYDRAVAALSHLPRMQMIESLHAYQNLRDALFDHLRPYAENHELVSEETVR
                     AFFEQHLASRRERTKR"
     gene            <234751..>235461
                     /locus_tag="MRET_3492"
                     /db_xref="GeneID:38740258"
     mRNA            <234751..>235461
                     /locus_tag="MRET_3492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630119.1"
                     /db_xref="GeneID:38740258"
     CDS             234751..235461
                     /locus_tag="MRET_3492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485929.1"
                     /db_xref="GeneID:38740258"
                     /translation="MQVRLFVWALSVAIRAICTENKEQVALQARTLLLDDTTYFVGAL
                     GTVKNDATALVAYEYFAPCFDSNDKSTSNPGDLLLLALPASEQWRLALRPNTTATLAV
                     ASSPDMNTVDVRHGHMSPAGRLHWPEYRPKWRRGMASKGRMTMYGHMHLVTNSESIDA
                     LSNCFVAHHPDAAAWVPGSPQSPHIAKWVRFSPAKIRYVGGFGDEHFIGSVDMDLYRS
                     VEPGLNEHRAPGLYMQTA"
     gene            <235685..>236665
                     /locus_tag="MRET_3493"
                     /note="MRES_14035"
                     /db_xref="GeneID:38740259"
     mRNA            <235685..>236665
                     /locus_tag="MRET_3493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630120.1"
                     /db_xref="GeneID:38740259"
     CDS             235685..236665
                     /locus_tag="MRET_3493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485928.1"
                     /db_xref="GeneID:38740259"
                     /translation="MSGITPAANASLSISARLAVVVCPCLVCWWLYNTATEAAILAPL
                     VFLPTLCMYGAWACANHAKPERRGQLETMVWIYFSVSIFGTTLLGLAQLLAYLIVVSL
                     VMGPHAAEYWTEFLRGTVDGMTVEERERRAELAGTWKNWLLIVLFSFVMAGGFEEILK
                     YLPVAYARYLEQKHKWKRESAYIDFALAGSLGMATVECIGFLHDTYAGGSHGLLAPIV
                     TLVQRQIAGTTGHMTASMLTSLRATRSDFYGPVHSWLWIISPSMILHGIAIMTVFVSC
                     TLDGHVGWVHPTELISIAGMYGNFFCVVCVVTVLAYREHKILKSLGLHSK"
     gene            complement(<236637..>238928)
                     /locus_tag="MRET_3494"
                     /db_xref="GeneID:38740260"
     mRNA            complement(<236637..>238928)
                     /locus_tag="MRET_3494"
                     /product="fanconi-associated nuclease 1"
                     /transcript_id="XM_027630121.1"
                     /db_xref="GeneID:38740260"
     CDS             complement(236637..238928)
                     /locus_tag="MRET_3494"
                     /codon_start=1
                     /product="fanconi-associated nuclease 1"
                     /protein_id="XP_027485935.1"
                     /db_xref="GeneID:38740260"
                     /translation="MVLIRRRVNTKLSEQSLEMKSASVGKILSNLYVSTRRDLQLRLY
                     AMRSKSNLPLRMLSSVLFFGKGPVQSAMHGSDAQNVTSDRVLKRRYQQESMYVELFQD
                     MLRAVLEKESHLFTASEHACFSFFFQLHYDARYLFVRLLQRKKGQWYRLDKLEYNDVE
                     DLSSAARALSQPFAASSLLEPYRFSMMDGDIKDNILWRLELLTVDELKLLAKRLGKKS
                     SGTRDTLLKNLTAKPTNAVLFSQQHKLSMNMQPTHDRLLSYMADIMHGGCICLDSTVY
                     ALMERLAFVYYRGKPVLGSLLTSAVLSRTGKYTFPTYVYMRDSSMFPDRDCLLRYEEA
                     TQLVEHMDAFVEGMKSSLDSARACLPLLDTCEPAWREATHEMRSVYPVCVPRDRCHLL
                     RFHYGWALTRVLFKGCECLARLGMHDRESHILKQLLSQRYFWRGRRGSWYERLSILIA
                     RHDSKQHALVICQEALHDPDTHVTYTFSLQRRIARLESQLKIPKSARQTFVLAHREPR
                     VVEFEGVRVNGRLIQPRNMLRQTVLTFDARIPKPTTSKERKSGGRTQWQSICGTSCTV
                     EQYCLEQYALQGYRGYHCEGGILLFVFVLLMWDVLFLSVPGAFETPYQRAPMDLGTDI
                     FLEARKEAIEAQLHRIQETGGCDIIHRVDARERPKRTHAIGCRWDEFPIHDVMEVAEC
                     IGGTALAALCRILCENGASTTGFPDLTLWRYQDRQVRFVEVKSPKDRLNEPQKVWMDA
                     LLSAGVAVDLAKVRITSNEAQAT"
     gene            <239477..>243457
                     /locus_tag="MRET_3495"
                     /note="MRES_14040"
                     /db_xref="GeneID:38740261"
     mRNA            <239477..>243457
                     /locus_tag="MRET_3495"
                     /product="myosin heavy chain"
                     /transcript_id="XM_027630122.1"
                     /db_xref="GeneID:38740261"
     CDS             239477..243457
                     /locus_tag="MRET_3495"
                     /codon_start=1
                     /product="myosin heavy chain"
                     /protein_id="XP_027485934.1"
                     /db_xref="GeneID:38740261"
                     /translation="MSQNMGIFPSDPDRKDVWVPDKVHGYIAAYVVQEKDDQSLCCLA
                     TGNTVTVPTASLSEMNPPKFDKAADIADLTHLNEASVVHNLRQRYFSNLIYTYSGLFL
                     VAVNPYHALPIYTEHIIEMYKNKRREENPPHIFAVADGAMQNMLNGHSNQSLLITGES
                     GAGKTENTKRVIQYLAATAMDADAAGPWHAGEPLGLLERQILQANPILESFGNAQTVR
                     NNNSSRFGKFIKIEFSATGTIAGGNIEWYLLEKSRVHSRNANERNFHIFYQLLRSRDQ
                     TLLQSLKLSCFPEHYAYLANTRKDVEGIDDSIEFSGLLDALRTMGFTMAEEHDLFRVI
                     ALILHLGNIELTEDRSGQARITNSDQLSLVSELMGVDAAQLNTALVRPTVRAGREAVS
                     QQRTKKQVTEEVAALCKTMYEKTFGWLVDRINLVLDRPTSKSQFIGVLDIAGFEIFDT
                     NSFEQLCINYTNEKLQQFFNHHMFMLEQQEYAREMIQWDYMNFGLDLQPTIHLIESTS
                     PIGILAALDEECIMPRASDDTFTEKLTSTWSPPKSGPDAASSKFLPSRQVRRFIVRHY
                     AANVEYSTDNWLDKNRDPLNDHVARVLATSAQPFISSLFAGMAEESSGGAPKSRRGTF
                     RTVGQRHKEQLVSLMAQLDSTQPHFVRCIVPNTEKRPGRMELPLVLDQLRCNGVLEGI
                     RIARLGFPNRLPFTEFVSRYALLASSAYGKQSMDGRVQSGYIAESIGLDPACYKIGLT
                     KIFFKAGVLAELEEQRDAYLHDVFTRFQASCHGYGTRRIVRKRLRQRAAKQVLQESAR
                     EYKKLESNAWWRLYMRLLPLLAASHDDDEIKRHEMEMAVARERALRDEQEKARLVELE
                     SRLTKRCDMLQEQLDDERTSHASTQDTLNGTKQRLAEAEAELNDIQAEREGWSREAND
                     LQRQMDEGAQREMDIQAELASVCEQLNKQLSSRAVLEREHSEAVDRVSSLETMLDQAR
                     VSLDEHVQHAERHIEDLAAKHEAELHGVRTDLELARHQLSKSDALSERLAMLEAERQQ
                     LQEAHISVQATLSEREAHFKREEEKREALQGALASAQSECAMLHEKLKHMSDKLRETN
                     QLRDQVNETYASECRTSKTIMTERDNVRSELSALRQEYAKEKEEMQREIADKGAELKK
                     AHSKAYALELENRRLETMQNKTTVEHVHVLEEAKKYTDRQLSDVQNELQELSTYTRSL
                     ERTRARMQQGQEVLSRTVGGLSIEEAISQRDEARSALEEAEKTSSNQLKMARAEYETR
                     IKKLEDELRRMSKNHQTEKALTSLGSGRKSHAAAARQVLAEIQMETELLAKDLARASS
                     LHTPSQ"
     gene            <243607..>245325
                     /locus_tag="MRET_3496"
                     /db_xref="GeneID:38740262"
     mRNA            <243607..>245325
                     /locus_tag="MRET_3496"
                     /product="histone acetyltransferase"
                     /transcript_id="XM_027630123.1"
                     /db_xref="GeneID:38740262"
     CDS             243607..245325
                     /locus_tag="MRET_3496"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="XP_027485933.1"
                     /db_xref="GeneID:38740262"
                     /translation="MKNTATSKKRQGDSKAQARQKVRETWRLCAFCLGTEEQNRHTNQ
                     SEPLVECSECHSCGHPTCMDWDREGKKYAIVRSYKWHCMECKTCERCHGKENDDQIIF
                     CDRCDRGWHIYCLRPALSKLPKGTWFCPLCKPVEKHVPASPAPQSRAPLPKRKIESAA
                     PHRKVIRIKRSSAGENEKASQTTSCADDAPFSGLLQGDDAETKMNEPNKDDMERFERS
                     KRAAMNWLGGSLNEQLPNSKHVSGVDTVSTNANAAHTGKALPISMIRFGAFDINTWFQ
                     APFPEEYSLVPDGRLWMCEFCLKYMKSRFMVTRHRMKCMMQFPPGQEIYRAGNISVFE
                     VDGSKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVFVESDAYGSHFVGYFSKEKRS
                     PMDYNVSCIMTLPIHQRRGWGYFFIEMSYLLSRKEKRRGSPERPLSDLGFLTYRSYWR
                     LAVFRVLDADPVCSLEDICSRTGMKMDDVLYTLQDNNMLEVFHNEASTGRLPTEYEAS
                     KFADEKKVPPNDYRIVCDSEHIRASLAKHDAKNYVRVDPTKLRWTPFIHKRTGLEPIT
                     SNEVPG"
     gene            complement(<245347..>246058)
                     /locus_tag="MRET_3497"
                     /note="MRES_14045"
                     /db_xref="GeneID:38740263"
     mRNA            complement(join(<245347..245723,245751..245829,
                     245858..>246058))
                     /locus_tag="MRET_3497"
                     /product="CBF NF-Y family transcription factor"
                     /transcript_id="XM_027630124.1"
                     /db_xref="GeneID:38740263"
     CDS             complement(join(245347..245723,245751..245829,
                     245858..246058))
                     /locus_tag="MRET_3497"
                     /codon_start=1
                     /product="CBF NF-Y family transcription factor"
                     /protein_id="XP_027485932.1"
                     /db_xref="GeneID:38740263"
                     /translation="MGTDATERINETAPEVDEHENAESMKENLELSARNMSATNAAGG
                     TFGLGLDQFELPKASIAKIARTDIPEFMQLRKDTMTALVKSASVFVSYLTAASHDVAI
                     ARGSKTISANNVMDAMRELDFPAPMRKELRIQLEAYRDLQQKHAAAKAEAAAQSRERA
                     KAARAAASAASDAPPTEMTATGAATDTMDVDQGNMPDASHIDETSSAPIPVQPNSMET
                     "
     gene            complement(<246237..>247549)
                     /locus_tag="MRET_3498"
                     /note="MRES_14050"
                     /db_xref="GeneID:38740264"
     mRNA            complement(join(<246237..247485,247512..>247549))
                     /locus_tag="MRET_3498"
                     /product="platelet-activating factor acetylhydrolase IB
                     subunit alpha"
                     /transcript_id="XM_027630125.1"
                     /db_xref="GeneID:38740264"
     CDS             complement(join(246237..247485,247512..247549))
                     /locus_tag="MRET_3498"
                     /codon_start=1
                     /product="platelet-activating factor acetylhydrolase IB
                     subunit alpha"
                     /protein_id="XP_027486125.1"
                     /db_xref="GeneID:38740264"
                     /translation="MNSALSDRQRDELHKSLLEYLHTSGFHETFEALKRDASLAAYEP
                     DAKGKYANLLEKKWLSTIRLQKKNMDLSAKVSELEAELQTAPSARRGASVQDWYPRPP
                     ARHVLLGHRQPVTSVAFHPRFSLVATASEDSTIKIWDWETGELEQTLKGHTKSIQGIA
                     FDHSGQYIASCSSDLSIKIWDGNNDWKNVRTIHGHEHSVSGIQFMPGDQHIITASRDK
                     TLKIWEVTSGFCSRTLLGHHDWVRAVDVSSDGRWIASASSDQEVCIWDTASGELRHEL
                     RGHEHVVECVAFAPSSSYESIQKLLGMRSPDKPEPGRYLASGSRDKTVRIWSQQGQCL
                     RTLSGHDNWVRAVAFSPNGKFLLSVSDDKTMRVWDLSTARCLKAFECHNHFATCMAWG
                     RTHVDTSSSASPESHMQPVNVVATGSVDLGVKIWAP"
     gene            <247702..>249882
                     /locus_tag="MRET_3499"
                     /note="MRES_14055"
                     /db_xref="GeneID:38740265"
     mRNA            <247702..>249882
                     /locus_tag="MRET_3499"
                     /product="kinesin family member 4/21/27"
                     /transcript_id="XM_027630126.1"
                     /db_xref="GeneID:38740265"
     CDS             247702..249882
                     /locus_tag="MRET_3499"
                     /codon_start=1
                     /product="kinesin family member 4/21/27"
                     /protein_id="XP_027485998.1"
                     /db_xref="GeneID:38740265"
                     /translation="MARERDSGDSALAAVQVAVRIRPDAVDDITQTVSRFARPAVEAT
                     SSTSVVLEPSVLPVGMRDSRYTFNFDQVHAFDVNQTELYHESVEPLVRRFMDGFNTTI
                     FAYGQTSSGKSYTMGTSEATNSICTDTPFVDMDLHVGIIPRAAHQIFQSLEEINAEGE
                     ECTVSVSFLELYNEDLIDLLSDAYGQRNNIQIRETRTGDIVWTGLAQRSVSNAQDVVK
                     LLQDGMAIRQTHETEMNAQSSRSHAIFTISLIRKHRAKPGAQAERASSSLGRASPERA
                     FATPRTPKTSLPTLGVRATVSRAGSPTRPQTPTRPVVRGTPLRRAPVEDTVVVTTTSK
                     LHFVDLAGSERLKRTAATGDRAREGIAINSGLHALGNVISVLSDPGRSKRPIHVPYRD
                     SKLTRLLQDSLGGNAHTLMIACISSTEGNAGETLNTLQYAQRARNIRNKVERNQVEPG
                     WDNVAYLQSQVLSLRHELGLVHSSRELVASSPKRTTHLMPSEHERELLAWQEKCSALS
                     QKNVQLSFQLVQREQEHRHNSSSVDFLQAAEPVIVEYEKTVDALEGQLSMLKAAVAHL
                     EHSVQEQVSENVALSDRATKAERQMDVLRSTMRDLHERLDERNARVETLETELRRASM
                     STSSTTPLSFSRSSRSSSMSSDPGVLQQRPFGGILDYKGRNPSNRTYRVTMTQSRATS
                     DVDTYPTSQLGLPRSPSSLEQQPLSKRHASETTSPDELPTVHMH"
     gene            complement(<249898..>251085)
                     /locus_tag="MRET_3500"
                     /note="MRES_14060"
                     /db_xref="GeneID:38740266"
     mRNA            complement(<249898..>251085)
                     /locus_tag="MRET_3500"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_027630127.1"
                     /db_xref="GeneID:38740266"
     CDS             complement(249898..251085)
                     /locus_tag="MRET_3500"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_027485848.1"
                     /db_xref="GeneID:38740266"
                     /translation="MSPADKINELDDRHIKNVKPLVPPQIIMEELPLTIEALETVAKG
                     RNDTEAIFNNKQDRLVVIVGPCSVHDARAGIEYAKRLHEYAETAKDDLHIIMRVYFQK
                     PRTTVGWKGLINDPNIDGSFQINKGLRLARSLLLEVANIGLPAGTEFLDTITPQYTAD
                     LVSWGAIGARTTESQVHRELTSGLSMPVGFKNGTDGSVRIAVDAIRSSSSSHHFLSVT
                     KQGISAIVETEGNDKCHVILRGSNKGPNYHPEDITQTRTSLLEAGLPARIMIDCSHGN
                     SEKKHENQLKAARSISDQLAMGDENAQSIMGVMLESNLVEGRQNVPPEGPNYLTYGQS
                     ITDACMGWDMTVEALDILRAGVQARRAKLPSGPSEPVNPDTIQSLDPQPGYNDGVLAS
                     LSK"
     gene            <251368..>251808
                     /locus_tag="MRET_3501"
                     /note="MRES_14065"
                     /db_xref="GeneID:38740267"
     mRNA            <251368..>251808
                     /locus_tag="MRET_3501"
                     /product="negative cofactor 2"
                     /transcript_id="XM_027630128.1"
                     /db_xref="GeneID:38740267"
     CDS             251368..251808
                     /locus_tag="MRET_3501"
                     /codon_start=1
                     /product="negative cofactor 2"
                     /protein_id="XP_027485847.1"
                     /db_xref="GeneID:38740267"
                     /translation="MSDDEHDYNSAGPLDDEDLSLPKATIQKLIQEYLPKDLSCAKET
                     RDLLTDCCVEFVHLVSSEANEACEKDSKKTIAPDHVVKALNDLGFGKYTQEVQDVLND
                     HRQHQKERERKASRFELSGLSEEELQRQQEELFAASKARFEAAN"
     gene            <251994..>254939
                     /locus_tag="MRET_3502"
                     /note="MRES_14070"
                     /db_xref="GeneID:38740268"
     mRNA            <251994..>254939
                     /locus_tag="MRET_3502"
                     /product="methylenetetrahydrofolate dehydrogenase (NADP+)"
                     /transcript_id="XM_027630129.1"
                     /db_xref="GeneID:38740268"
     CDS             251994..254939
                     /locus_tag="MRET_3502"
                     /codon_start=1
                     /product="methylenetetrahydrofolate dehydrogenase (NADP+)"
                     /protein_id="XP_027485850.1"
                     /db_xref="GeneID:38740268"
                     /translation="MRVGLVPLSLYSKRALVRLHFHRLIQFQRCIMSVSAPLDKRING
                     TQLAGSIRQSVAERVRSLKEKHTGFQPRLSIIQVGEDGASSTYIRMKSNASAQCGIRA
                     DHIKLPAGSTEAEITNKIRALNEDPSVDGILVQLPLGDHIDSEAERRITEEVTPRKDV
                     DGFHTINIGQLASRACNPQFVPCTPAGILRLLETVCSNDLSGKFAVVMGRSDIVGNPV
                     SHLLRSRNCTVTQMHRYSTNVQEILAMADIVVVAIGQPGFVQGSWLKKGAVVIDVGIN
                     YVPDATKKSGERLIGDVDFASALPVVSAITPVPGGVGPMTVAMLMENVLIAATRRAEY
                     EASHPRGVTTLNPLTIQRPVPSDIEIARAQVPKTLNTLAQEIGILPSELEQYGNTKAK
                     VSCEILDRLSSRVNGKYIVVAGITPTPLGEGKSTTTIGLAQALGGHLRRPAFACVRQP
                     SQGPTFGIKGGAAGGGYSQVIPMEEFNLHLTGDNHAVMAANNLLAAAIDTRMFHEATQ
                     SDTALYDRLTPCQKGVRKFAPVMLKRLRKLQIHKTDPDALTEDERRRFARLDIDPASV
                     TWRRVVDTNDRYLRQITIGEAPTEKGFTRKTGFDIAVASECMAVLALSRDLSDLRERL
                     GNMVIGSNKQGEPITADDLGVGGALAVLMRDAIKPNLMQTLEGTPVFVHAGPFANIAH
                     GNSSILADAIALKLAGREADEPAESAGYVITEAGFGADIGMEKFCNIKCRESGLVPDA
                     VVLVATVRALKSHGGGPDVSPGKPLSIVYTKENIELLDKGCGNLAKHIQNAKQHGLKV
                     IVAVNKFATDTEAELDLVAKRSYEAGADAAIPSDHWANGGAGAVQLAEAIVELLQHSE
                     SQFRFLYDLDQPIEAKIEKIARCMYGADGIEITPEAQNQISTYTRQGYAHLPICMAKT
                     HLSLSHDPALKGVPTGFTVPIRSVRLAAGARFLYPLCGAMQTMPGLNTRPGYYDIDLD
                     DQGQVMGLF"
     gene            <255172..>257043
                     /locus_tag="MRET_3503"
                     /note="MRES_14075"
                     /db_xref="GeneID:38740269"
     mRNA            <255172..>257043
                     /locus_tag="MRET_3503"
                     /product="RNA-binding protein"
                     /transcript_id="XM_027630130.1"
                     /db_xref="GeneID:38740269"
     CDS             255172..257043
                     /locus_tag="MRET_3503"
                     /codon_start=1
                     /product="RNA-binding protein"
                     /protein_id="XP_027485849.1"
                     /db_xref="GeneID:38740269"
                     /translation="MRSSYSAGMRNSPSPSPDQQSQRPTSSMGNANGLRFSHGNKMGL
                     PNENIMRMSQSSQESPRVMNLGNGGHMTGLGRGSNLRPSSEMLPVGQHGTPETDVIDK
                     WFEDLQNYEATLEEMAAASLDQNFKEELSAIEQWFRVLSEAERTAALYSLLQESTQVQ
                     IRFFITVLQQMARNDPVGAFISPNPSNQSLNDQLEAKMAQLGIKSPTAMKSPSTNTRA
                     FQRQSTGFLSPNSASLYGSANPDVSAALAAQRSKLKANRTSAPGILPMESMTSYHGNS
                     GLENVQEKPRTNTGNAHERPHSSDVSRSPRASGSIEDALSPISVGGSWASMVNTPIMS
                     MLDNNNNSRSDDTNAKLEATAAQLAQLSHHMSATQAETPDSARMTRGSSAPSNTTRGF
                     AGDQAAGHANLMNTPAKLGNSPPFNIPAMSPNALAGLQSPSGGMSNPANLQMMNTMAA
                     MGGLNNMNSAQLLALQQQILQQQQQLNMAGFGAQGMRGAGRSSHRNFGGLQSPPMAPR
                     NLAGSPQPSSHVSGAQAEEEVADISILNDVPAWLRHLRLHKYTPNFEGSNWREMVMMD
                     DRALEEKGVAALGARRKMLKTFEAVRQKYGIDPPVNPQPASTASEGKASEMSSEPNA"
     gene            <257289..>258767
                     /locus_tag="MRET_3504"
                     /db_xref="GeneID:38740270"
     mRNA            <257289..>258767
                     /locus_tag="MRET_3504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630131.1"
                     /db_xref="GeneID:38740270"
     CDS             257289..258767
                     /locus_tag="MRET_3504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485844.1"
                     /db_xref="GeneID:38740270"
                     /translation="MDSLHARVSTCTPSAMDKGFNAPRAHSNIGKVNATPLKAHVNVG
                     TCPELFHSKIDRERRNALPKKVHPRLRSVSSQPSLPRTAPSATLSSPLSAHAKTSGRK
                     TFAETPRTKHEWSSETGFFICANTMHASVAEPEPLKSIPSLLPPGKISEPVSRPFSVR
                     ASTDKVNKPVRVHVNQRSGPKMLPSALSPKQAVSTASKQNVRHVSLYPQQNSDKVQSA
                     SRSPSHETYHTGCGPTTSASLAQASFMKDQQEHKSAPSPIPFPVLGMRTAPAASMLPS
                     DASSAWTDHKNQSAPGTLSPLSLNHRMHNELSLTSSTPNELTMEEASHILDARHARKL
                     LDLEISNKSLLAINATLESSKVKLTKELRELRHNMLVGKTNSEANHGEQISGSIRTSL
                     DELLHPMSGANEKDSLGEEVLRIYTQQDQETDTIYRRCCAKIDELLKEARSAILAKPV
                     PDAAPGGKILHPSELRHDTLDDTPVNATLTEGHLMMRLKDNL"
     gene            complement(<258945..>260612)
                     /locus_tag="MRET_3505"
                     /note="MRES_14080"
                     /db_xref="GeneID:38740271"
     mRNA            complement(join(<258945..260401,260444..>260612))
                     /locus_tag="MRET_3505"
                     /product="F-type H+-transporting ATPase subunit beta"
                     /transcript_id="XM_027630132.1"
                     /db_xref="GeneID:38740271"
     CDS             complement(join(258945..260401,260444..260612))
                     /locus_tag="MRET_3505"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit beta"
                     /protein_id="XP_027485843.1"
                     /db_xref="GeneID:38740271"
                     /translation="MPIIQRSAVRAVSRASRMASRVARQNAAGLSTAARVTVPSVRSG
                     AVPSIAKAVKVPARGLATESASGAGQVGNIRAVIGAVVDVHFNSEDLPAIFNALEVQD
                     VKGGNRLVLEVAQHLGENTVRCIAMDGTEGLVRGQKVVDTGAPITIPVGDGTLGRILN
                     VIGEPIDERGPVKTDAYRPIHREPPSFVEQSTDAEILETGIKVVDLIAPYARGGKIGL
                     FGGAGVGKTVLIQELINNIAKAHGGFSVFTGVGERTREGNDLYHEMIETGVINVDGDS
                     KVSLVFGQMNEPPGARARVALTGLTVAEYFRDEQGQDVLLFIDNIFRFTQAGSETSAL
                     LGRIPSAVGYQPTLSTDMGAMQERITTTKKGSITSVQAVYVPADDVTDPAPATTFAHL
                     DATTVLDRSIAELGIYPAVDPLNSQSRMLDPAIVGQEHYDVASGVQKLLQDYKSLQDI
                     IAILGMDELSEEDKLTVERARKMQRFMSQPFAVAQVFTGIEGRLVALKDTVTACKEIL
                     SGKHDSLPEAAFYMVGNIGDVLAKAEEISKQSN"
     gene            <261537..>262533
                     /locus_tag="MRET_3506"
                     /note="MRES_14085"
                     /db_xref="GeneID:38740272"
     mRNA            join(<261537..261786,261812..>262533)
                     /locus_tag="MRET_3506"
                     /product="septin 3/9/12"
                     /transcript_id="XM_027630133.1"
                     /db_xref="GeneID:38740272"
     CDS             join(261537..261786,261812..262533)
                     /locus_tag="MRET_3506"
                     /codon_start=1
                     /product="septin 3/9/12"
                     /protein_id="XP_027485846.1"
                     /db_xref="GeneID:38740272"
                     /translation="MTVPEPMPTPLHGYVGFDTMTKQVELKMMHRGFQFNVMVVGQTG
                     MGKSTMINTLFSSRLLESKGRFDPSDDMPKTTTISTVSHVIIENGVKLKLNLIDTPGY
                     GDLINNEHCWEPIVKYIKDQYSIYLRKELTAVRERHIPDTRVHVVLFFINPSGHSLRP
                     IDIQMLKKLGDIANVIPIIAKADTLTMEEREAFKHRVRNELQENSIRVYPFDHEDYDD
                     EERELNSQVQAMLPFAVVGSTKVYDVDGMPVRGRQSRCGMINIEDPSHCEFVQFRNFL
                     LRTNLHDLIDTTTYTYYESFRSKQLLALKESSAKQQQQHQQQYQQHA"
     gene            complement(<262614..>263510)
                     /locus_tag="MRET_3507"
                     /note="MRES_14090"
                     /db_xref="GeneID:38740273"
     mRNA            complement(<262614..>263510)
                     /locus_tag="MRET_3507"
                     /product="secretory carrier-associated membrane protein"
                     /transcript_id="XM_027630134.1"
                     /db_xref="GeneID:38740273"
     CDS             complement(262614..263510)
                     /locus_tag="MRET_3507"
                     /codon_start=1
                     /product="secretory carrier-associated membrane protein"
                     /protein_id="XP_027485845.1"
                     /db_xref="GeneID:38740273"
                     /translation="MAAQDEDPFDDPSIKSAVAGGDIDDLESNPFETTSLKQGDSGYA
                     PQVDLDEQEEIYPTSTHGTAPANAMRMDDIARREREIEERERELDARTERMRQFGRNN
                     WPPFYPIVYHDIAGEIPPDSQWIMKDVYRLWLLLAATLVWNFVTCLLLLIITGAISDL
                     VMGAFYMVFIGTGSFFLWYRPLYFGLMKEHSFFYYVFFLFCGCHLLFSIYAFVGVAAA
                     GCAGALTTIHWFFERGWKGWLFGTFSLITTLGFFAQGVGLVWYYRIIWRHNHDKGHTF
                     DQAKAELASHGMRAYLMNSARI"
     gene            <263636..>265369
                     /locus_tag="MRET_3508"
                     /note="MRES_14095"
                     /db_xref="GeneID:38740274"
     mRNA            <263636..>265369
                     /locus_tag="MRET_3508"
                     /product="component of the RSC chromatin remodeling
                     complex"
                     /transcript_id="XM_027630135.1"
                     /db_xref="GeneID:38740274"
     CDS             263636..265369
                     /locus_tag="MRET_3508"
                     /codon_start=1
                     /product="component of the RSC chromatin remodeling
                     complex"
                     /protein_id="XP_027485842.1"
                     /db_xref="GeneID:38740274"
                     /translation="MSTKVRLRRPMPPEQNEPRKSARIVSKVHTEPIVPNSEDVAEMG
                     RTMLDRLCTVRDARDDELLCEPFLKLPSRKQYPEYYVVIRRPISFAEIRLKLKQKEYG
                     TFLELKQDLELMCNNAKRFNMSESDIYLKARDLHGLIKDISATVFEEWQAQATAPASP
                     NDEATPVRPHKITLRRPVEKAQLQESPPSIPTTPTPASAPSVPVTPSPLRVPIMPVST
                     TAASYVIEPRRRGAPRGKRLKVMLRWAVQNMMAAQDMDGHTYSDMFLELPSRDEYPDY
                     YQFIQRPICFRDIERKLDMKEYINPHALVSDIRLMLSNAQFYNEEKSQVWNDAQALWR
                     HLDRVLVPALLAEGFTLDPNDHRQAAVPPGKPGYVPPPTPTTSSPSTQPAQPPMVRPA
                     PSAPTAASPAVSAPSTTSAPVTPATPAGSVVPVVPPAPSVTAVPAPAVPANVSLERVW
                     EDLQAKVWPRHPATFSVAPTCAAESRDAQPCPWTALHVTTSADAHISVRLEASQHHIL
                     TLPRGTHATSWHWDGMTSEEEAARILVRNEPVPITREGPALTHITHVDHGEVQAQQAH
                     GAAVHVYMHTV"
     gene            complement(<265371..>267953)
                     /locus_tag="MRET_3509"
                     /note="MRES_14100"
                     /db_xref="GeneID:38740275"
     mRNA            complement(<265371..>267953)
                     /locus_tag="MRET_3509"
                     /product="secretory pathway protein Sec39"
                     /transcript_id="XM_027630136.1"
                     /db_xref="GeneID:38740275"
     CDS             complement(265371..267953)
                     /locus_tag="MRET_3509"
                     /codon_start=1
                     /product="secretory pathway protein Sec39"
                     /protein_id="XP_027485841.1"
                     /db_xref="GeneID:38740275"
                     /translation="MHGQSDRAAPVTSVKSMASDAEKRAFLASLPCDAESVLSTLTSI
                     EDVWWVAAAAVAAVRTGTAWLAADAERVLAHALERSASFDQEVQAVLSKDVDRLLAWL
                     DAEPDRLPRVVLRRKLWHMRWLLSIPLSRSKSALVETDMARLSDIPLLEHARTLCLAG
                     NERALRALLGTNASVALCLYPHRFVLLRLLLTCGGVSPDHLMQLRLLPGTHLPVADRE
                     SGAWVDALGSFALWTEHPGMVSALARRGAATHPPAPPPPPPALSDWYMDVIRELEGRW
                     GLVDAAFALAQAGERMGMVPLRAARDELAFLHMLVYELHAEAWSVSTLRAAKAADLVR
                     LVVSHPAPMSETAQRLRDAVLPYLQHGTYADAHTLHAYSASALGVHIALMVLDTLSPA
                     RALPLVSAMLSWLDKEDQMRLTLVVIGAYDATDRASLAMYADMLRDVPLPDASPSPLY
                     LVLSRAPKHDALALWKCTHVASSHQLMHAVRDVRVLVDMAQALAPIRAYAPSYLWGDD
                     VHRHRAHRMAVELVQHALTQRGHERAALERILQALAPWIGTHAPYLPTECVRTLFKQL
                     LLARAPILFNEVVHALPHTCPKIAALLSPEDAEALVLETARAWTEQAPTCDPLHGALQ
                     RARDTLDAVPLSPSVNAELSFLQLLGLLHEHALPLSPKDVRATSRLDLLARVLSSHRD
                     AYRTAQPLARACMINEDDDVRIEAMLTDAAAASGDVSAALRSCDRLVTRVLSLDHTQH
                     TEAYDVAWRTCFQLAKQPWMWPDHRAPTQVFGHALRLAPPEHISTILTTLAPLAVRAS
                     HPPTIPRRDAQPTHAWSRLLTRTEEQSTAQLLDSVATQHAPNAARVARSLFDMGAAWW
                     NEAK"
     gene            <268313..>270661
                     /locus_tag="MRET_3510"
                     /note="MRES_14105"
                     /db_xref="GeneID:38740276"
     mRNA            <268313..>270661
                     /locus_tag="MRET_3510"
                     /product="betaine lipid synthase"
                     /transcript_id="XM_027630137.1"
                     /db_xref="GeneID:38740276"
     CDS             268313..270661
                     /locus_tag="MRET_3510"
                     /codon_start=1
                     /product="betaine lipid synthase"
                     /protein_id="XP_027485879.1"
                     /db_xref="GeneID:38740276"
                     /translation="MWDYVKSHASLLVQRIQALDWSRSALVVGSVFSAMVVLTVAFPP
                     VRQAVVFAYNCFLQPLGKTKNQAERLDRFYENQAGVYDATRTGLLRGRKTMLKLCAAE
                     MRLLREKEPNRKLVWVDIGGGTGWNIEQMDKFFPIAEFDQIYLIDLCEPLLKVARERF
                     ERLGYKNVQALCQNAKDFTLPGLPDERKVDLFTCSYSISMIPPFYAVLDRINEFLDPR
                     VGVFGVADFYVSSSESTADQMTLVGGSIMHHCHWFNSWFWRHWFALDHIQLHPARREY
                     LEHKFGTIKCFNGRNHFIVPYLIQIPYYVWLGVSRERDTTAAVTAFEVEAGNHVAVPP
                     TFPDIARERVQRMNKTTTEGAVVELKNDTAIQWPQSSFHYGSKVWRLPFVDNRFSDMF
                     RTWIYGFTWEDPYVDMEHLDLGPEDSILCITSAGDNALHYAAAAKPRRIHAVDMNPCQ
                     GHLLELKLASILTLDYETFWRMFGEGKINNFPELLDERISPYISSHAYQFWKSNNRSF
                     ERAFYFRGYSGHALRLAKTAFQLMGAKKDVVQMCTTKSLEEQKRIWDTKVRKTIINEA
                     LIRVFLSNPAFLWNALGVPMNQFNMFKNEGVSVEQFAVDTLDPIPARSLISTDNYHYR
                     LTLMGNYSRESCPLYLKEDAFNALRADNGKALDCFRLHTDAIVTVLRGLQDGSLTRAI
                     LMDHMDWFDPIDDSVPIPKLEAARNENDKTVADLDREVVEIARVIAKGGAVFWRSAAK
                     YPWYSKRFELAGFKVAPVHIRETGKPIDNVNMYASFYKAVRL"
     gene            <270741..>273149
                     /locus_tag="MRET_3511"
                     /note="MRES_14110"
                     /db_xref="GeneID:38740277"
     mRNA            <270741..>273149
                     /locus_tag="MRET_3511"
                     /product="AP-3 complex subunit delta"
                     /transcript_id="XM_027630138.1"
                     /db_xref="GeneID:38740277"
     CDS             270741..273149
                     /locus_tag="MRET_3511"
                     /codon_start=1
                     /product="AP-3 complex subunit delta"
                     /protein_id="XP_027485880.1"
                     /db_xref="GeneID:38740277"
                     /translation="MFEKTLTALIKGLRSHRGKDEAKYIAAMMDDIRGEIKSADMDIK
                     AEAVLKLAYLHMLGYRLSSASFHILETMASSNYRFKFIGYLAASLCFSEDTEVLILAT
                     NLIKKDLHSAQPLDVQAALHGLSHIMTQELAQHLSDDIILMLSHTRAPVRKRAVLVLH
                     AVILRCPEVLDRTYERLRDLLCDENLGVVTATVNVICELARRNPAPFVPLSPQLFEIL
                     TMSNNNWLLIKVIKLFGALSPVEPRLVRKLYKPIMSIMSTTPAMSLLYECIHTVIIGG
                     MLERGDSDELARRCVENLGVFLQNDDQNLRYISILALDKLAPSHPHLVAQHQNVILKS
                     IQHPDMTIRVRALELVARLATDPMSLRPIVDYLMLYLGSADETLAAPSAAQTLQRTLD
                     ADQAQVLETSWTSDLSGSKCTEFRTQVAECILDLGGANHFSRIRDLSWYMHTLIRLAH
                     LVNDSVIPRVVDQLMEFVFYHSEIQAEASSVLFPMLLDPHMYDAENPMSEVLRACATI
                     CSEYVEQVDSIPRFIEALLQDAILSLSPPIISVCIQSAMKMFAYWAAQLSDTWSQGTK
                     LQLLAITETMQSQLTKLASNEDAEVFERCKEGLQLFELLQNGLNVPSDAQPKEETCEE
                     QASSSETSAPRALFLLLPLFYARSELVDSPEPLPASMDLHAWIAPESSWTLLLNVVEP
                     APKPPKRTKPPRHTVMLEEKVPSGASPLEPTSSQRRPQADPDNPFYLKPRSKKSSKKK
                     ADSRPVPPPQLNQDEEDLRDIPIVKLNLSDFASQQHRSDDTLAPISSIQPKVVSHKKS
                     ARRK"
     gene            <273262..>274419
                     /locus_tag="MRET_3512"
                     /db_xref="GeneID:38740278"
     mRNA            join(<273262..273274,273312..273578,273620..273789,
                     273819..273893,273973..>274419)
                     /locus_tag="MRET_3512"
                     /product="glutamine amidotransferase"
                     /transcript_id="XM_027630139.1"
                     /db_xref="GeneID:38740278"
     CDS             join(273262..273274,273312..273578,273620..273789,
                     273819..273893,273973..274419)
                     /locus_tag="MRET_3512"
                     /codon_start=1
                     /product="glutamine amidotransferase"
                     /protein_id="XP_027485877.1"
                     /db_xref="GeneID:38740278"
                     /translation="MTDDVKNSGDVQKTISIAILTAGQPPKQLVEKYGGFEYMLRNAL
                     AEALANIPRHEWHPKISLHLQAFNIMMAEFPDISQLDDGAWDAMVVTGSPSSATEENS
                     MWMQVLSKYLEHLVLEHPLVRIIGLGFGHQLVARAFGGKVVQDKHHAEFGITKFKLTN
                     EGTGILSPFDHDTEWSLQQAHTDYVCDMPLPVEGDAWQSLGGNEKCPIQGLTLHYPTE
                     APPLPSSVKSSSYVAFDVEDIVTGASGPMPVRSAHVLTLQGHPEYNAAVMRDLLSHLR
                     ETGTVNETDYESALSSINEEQRNLDTAKILLAMLGMEPATAELEPMN"
     gene            <274719..>275870
                     /locus_tag="MRET_3513"
                     /db_xref="GeneID:38740279"
     mRNA            <274719..>275870
                     /locus_tag="MRET_3513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630140.1"
                     /db_xref="GeneID:38740279"
     CDS             274719..275870
                     /locus_tag="MRET_3513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485878.1"
                     /db_xref="GeneID:38740279"
                     /translation="MYVVAPALPPPYKWLQIPLSALHTDRWPGYLSTWPIRQGGSNQM
                     FSGELKAFLRGSGVRNTTHWPLVFLATATVVTSAVALYYYASTHGYDATGIDLRYYLS
                     LLTPQELGLVPTFSSGLFEHGEYDDDDCDDDEPVDPDLLDGYGSSQSKRRHNVILVSS
                     DPSSDLCHRPLQLDLIDGKTRRGFSSEHTLAKPRASILKRSACGYSQRNIKKGHNRSC
                     SHSYASDDDHLGRSLSKLVPEKRLKTSSSYDSIRAYCKGSLQEDQSNRRTRRKVLLTE
                     PDWEPFASIHGRARQRTILAVLAKSYTYMSSEGSVPSTPLEEKALEFFSQTQPITSVD
                     EDDGKNFWFERFTQSSAAAGKRRDFRGRNNHAVSNFDSDAFGQLLLHQQ"
     gene            complement(276377..276461)
                     /locus_tag="MRET_t0056"
                     /db_xref="GeneID:38741250"
     tRNA            complement(276377..276461)
                     /locus_tag="MRET_t0056"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:38741250"
     gene            complement(<276575..>277448)
                     /locus_tag="MRET_3514"
                     /db_xref="GeneID:38740280"
     mRNA            complement(join(<276575..277329,277358..>277448))
                     /locus_tag="MRET_3514"
                     /product="exosome complex component RRP46"
                     /transcript_id="XM_027630141.1"
                     /db_xref="GeneID:38740280"
     CDS             complement(join(276575..277329,277358..277448))
                     /locus_tag="MRET_3514"
                     /codon_start=1
                     /product="exosome complex component RRP46"
                     /protein_id="XP_027485876.1"
                     /db_xref="GeneID:38740280"
                     /translation="MSRNGSSVNDQPRIQLGWLSRSDGSSKFAYGTQTSAASVTGPIE
                     VRIRDELTDRATFQVIISPLEGYPGIASKALSAELRDLFQSVILLHHHPRALIQLSIQ
                     SISTPSSTSLTIPISLEGSRHETTDESKYRTPQLLGPDRPFHASEVATSINASMLALL
                     DANIPIRSTVIATSCAFLDPKDVDDQRNMDSYMADDDLPCLVIYPSPREENAAYSSLV
                     AAFSFTGHDPTEPSKSQVHGQLVFLSSIGQMTAHQRSLAINATKTASISILDHVRTVL
                     IERFE"
     gene            <277466..>279157
                     /locus_tag="MRET_3515"
                     /note="MRES_14115"
                     /db_xref="GeneID:38740281"
     mRNA            <277466..>279157
                     /locus_tag="MRET_3515"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM54"
                     /transcript_id="XM_027630142.1"
                     /db_xref="GeneID:38740281"
     CDS             277466..279157
                     /locus_tag="MRET_3515"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM54"
                     /protein_id="XP_027485969.1"
                     /db_xref="GeneID:38740281"
                     /translation="MEHFGGICKQWLDKLEEKSPKNWTFSFLRCLIILDSMSTETKAP
                     AQPKRSVPPSLRPLVWMGIPESVLAWKPRLPSRNWCIFLASVAAVGYLYYDDRRQCKK
                     ILEEYKDRVRGLSEHSMHPLEQPRKVLVYTAKYPGDDNYDVGTIYFKRYVKPILVAAA
                     VDYEILSGTSYGNLARELRNRIHDRRRNLAGLEPWTTNTVAGTSLPTTLSPAQFLQRE
                     LEGAVVLVGRPALKEWAWALKEGWGSSIPAKPVDYSEKLASELSEDGAFEEEPEEPGI
                     DSSSTIDNIDEPAASSVTATPGQGFALPTQIGLQSLQGRSLSPLGSTQPVAARIKATE
                     VSPSEQSLPPVSPIPAQPPICFVDFTNLVGFVNIPRRIARFFYRREDVRRGAEAGLRI
                     VLGTKNDAREFNPGDPGTISREPPQGNDLDWGLEEESFYPNSFSKTLENVKRWRENYY
                     NELRTELKASREIARGIREPTKAEKRDMPKSEIELRSQRFDKEQMWRNTEQGFKILDP
                     HAGVEWDESWRGSLRVLRDRPDDERIPRKEQPQEVSSDAATTPEQTAEKAAETAS"
     gene            complement(<279158..>280067)
                     /locus_tag="MRET_3516"
                     /db_xref="GeneID:38740282"
     mRNA            complement(join(<279158..279880,279905..279950,
                     279982..>280067))
                     /locus_tag="MRET_3516"
                     /product="tRNA (uracil-5-)-methyltransferase TRM9"
                     /transcript_id="XM_027630143.1"
                     /db_xref="GeneID:38740282"
     CDS             complement(join(279158..279880,279905..279950,
                     279982..280067))
                     /locus_tag="MRET_3516"
                     /codon_start=1
                     /product="tRNA (uracil-5-)-methyltransferase TRM9"
                     /protein_id="XP_027485874.1"
                     /db_xref="GeneID:38740282"
                     /translation="MARASQTVRVTAALEASDSAGYEQENVHAVYDVIAGHFSSTRYK
                     PWPLVSDFFDSLPAGSVGVDLGCGNGKYLHLRSALGSGEATKNSLVTLGSDRCLPLIQ
                     AAQHNFPQNPPTRLIQEVAVADALCSGYRGGVFDYALSIATIHHFSTPERRRHAIEEL
                     IRLVKPAPEGLVGTGRGCGRFMVYVWAFEQRGAGRRLFDAQLAGHGDATKAQDVLVPW
                     VRTAQHTDDQKQDVHHRYYHLFREHELDELVNDAAQHYADTGIHVVKETGGWEKGNWW
                     GVWRVVQR"
     gene            <280171..>281161
                     /locus_tag="MRET_3517"
                     /note="MRES_14120"
                     /db_xref="GeneID:38740283"
     mRNA            join(<280171..280293,280331..>281161)
                     /locus_tag="MRET_3517"
                     /product="5'-methylthioadenosine phosphorylase"
                     /transcript_id="XM_027630144.1"
                     /db_xref="GeneID:38740283"
     CDS             join(280171..280293,280331..281161)
                     /locus_tag="MRET_3517"
                     /codon_start=1
                     /product="5'-methylthioadenosine phosphorylase"
                     /protein_id="XP_027485875.1"
                     /db_xref="GeneID:38740283"
                     /translation="MSMRAPKIAWGGLPIRVGVIGGSGLYKLDGIEIIDVVNPETPWG
                     YPSCPISIGRTATGTLVAFLARHGTLHSISPSHVPSTANIAALKHLGVRAILAFSAVG
                     SLREEIAPKDFVIPSQIIDRTKGIRRSSYFGEGKEHSVIAHAPFGDPFDRNLSPIVEN
                     IVRDTLKNHSPDVKVHSNKTVVCMEGPAFSTRAESNMYRQWGGDIINMSALPEAKLAR
                     EAELSYVLIATATDYDAWRESSETVDVAEVIKSLHANAQASQVVTMALIDEVSSLVGN
                     DDSHFFTKMHGSMKSNIMTNPDHLSTEVKQRLRYILPWYPQ"
     gene            complement(<281417..>282253)
                     /locus_tag="MRET_3518"
                     /db_xref="GeneID:38740284"
     mRNA            complement(<281417..>282253)
                     /locus_tag="MRET_3518"
                     /product="mRNA capping protein"
                     /transcript_id="XM_027630145.1"
                     /db_xref="GeneID:38740284"
     CDS             complement(281417..282253)
                     /locus_tag="MRET_3518"
                     /codon_start=1
                     /product="mRNA capping protein"
                     /protein_id="XP_027485873.1"
                     /db_xref="GeneID:38740284"
                     /translation="MAPLTSRSIFGTDPVDEFASGIADWIWENSQGHEALEIEAKIGV
                     MIDKSTNARIRLPIYTEAIVNMNEINARFESNMSMKQHQIYNKLLNDLVAYSAQNLPQ
                     NEHMAYQHRKETDTFYDEVSEITGQREHIRVTRDTRTKEIVPNGVVKKTRIADLNVFC
                     PTQPFDYRISINIETPMYLPQSMSHPTFSREKDRLSYIQQNFSIDLTQVIEANRPSEP
                     LHELEIEIRDVNYLMHLANEAQQIKGESDRVWTQFEDHVLVLLNNIRLLIRNHDFGSG
                     GR"
     gene            complement(<282358..>284397)
                     /locus_tag="MRET_3519"
                     /note="MRES_14125"
                     /db_xref="GeneID:38740285"
     mRNA            complement(<282358..>284397)
                     /locus_tag="MRET_3519"
                     /product="catalytic protein kinase domain protein"
                     /transcript_id="XM_027630146.1"
                     /db_xref="GeneID:38740285"
     CDS             complement(282358..284397)
                     /locus_tag="MRET_3519"
                     /codon_start=1
                     /product="catalytic protein kinase domain protein"
                     /protein_id="XP_027485903.1"
                     /db_xref="GeneID:38740285"
                     /translation="MDPARSPAIRGGLPDRVRSESSRMGSDTFSVPPCVDVSSPPMES
                     GSSSLSTLSRQGLGLDPIPGFSDLDTGDTWVYPFSASNYLKKSNSIRSVRSLNDFEGK
                     SMTPLPSPLIPSQEPSEKMEMRPKDSKTDAFFNTTPSVLTPPKPPQSIARSASSRTAA
                     KTDKSMALEVTRRRQRAVSSPQRFDDNNSASLSPQKNGLLTAPGESSAYNSLTPHFSA
                     HHHGMTSLESKASSRHMHGPSIHINPDSINPCSDEPGISPQDDEPNKVNKQLLKSIDF
                     VTEDEDEQAGKVGPYKIISLLGTGAFSKVLLAKPNDGSSSVSVALKMIACEPWKVDER
                     MRVSWVREAETLKRISHPSIVNFLRAFRTPKHYTLVLEAVPGDELFELLSQHHAQVSQ
                     REWLVRRIFGELANAVHWMHSIHLVHRDIKLENIMLTRKLFASGSSLAPWTLGSTPLI
                     KITDFGLARFVKEGQLLETRCGSEEYAAPELILGKMYDGCKTDIWAMGVVLYAMITGA
                     IPFLSPGPQETTESSHNSFKDSRERNDRAYTDSGRERKAHLLRIVKCDLHWPEKINNT
                     CQDVPSDGEKWDFEPSNRLVTPPAQRIITRFLRRDPIKRVSCRELWHDPWFLYGSFAP
                     PNTFVPAPYNDSMMLCSAQEASANFSSIPLPYFPEDPRGKKWLEMNASSTRCTDS"
     gene            complement(<284540..>287914)
                     /locus_tag="MRET_3520"
                     /note="MRES_14130"
                     /db_xref="GeneID:38740286"
     mRNA            complement(<284540..>287914)
                     /locus_tag="MRET_3520"
                     /product="DNA mismatch repair protein MSH6"
                     /transcript_id="XM_027630147.1"
                     /db_xref="GeneID:38740286"
     CDS             complement(284540..287914)
                     /locus_tag="MRET_3520"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH6"
                     /protein_id="XP_027486000.1"
                     /db_xref="GeneID:38740286"
                     /translation="MSGGAKQTSLLGFFSKAPKPAAAPPQPETSPSTPPPTSQDAPSS
                     QHASPSATKHASSPPTPPRPAKQARTSPSLTPPPSSSPAPGRRRAARRVNYAEPRAGS
                     DDDDDDDGDDEPSEDDFVMSDASSDSSDEVSAAESEEPSTADDASDEDDVVASPPPPR
                     TKAPKPADAPAAPAAPTPSSVSFSHLTKAEKRVQEEKRKRIENEQAYDFLLDVRDKDM
                     NRPGDLHYDKRTLYIPPSAWKSFTPFERQFWEMKQNHWDTVLFFQKGKFYELYEEDAI
                     IGHRECDLKLTDRVKMKMVGVPEASFDMFATKLLALGYKVGRVDQCETAVAKGMRDKS
                     RGSGPDIVRRELRHVVTSGTIVDGSVLADELSSYCMSIKEHVRSDGLSEFGICTLDAA
                     TAEFRYMTFVDDAVLSQLETLLRSLRIKEVLHEKGVMLPSTLRLIRNTVPTTCQITML
                     KPDTEFLDDISTRGRLAHLFDTIPEGLAPLVEKGGWALSALGGLLWYLEQLHLDVDLC
                     ASGNFAERSAPADTQQGTLILDAKSLLHLHVLQNDEGTDEGTLHRLLNRCITPFGRRL
                     FKTWLASPLCNADAINARLDAVDDLCANPAWTDAFETFAKALPDLERLQSRVAAGKCR
                     PRDFLLVLRAFARFGNAKDELLSLSSTFASGMLKACLQAWPDVAALAQTLRSHFNSND
                     DGSFTPVHGESKAYDAAVEGVHAAEARLDEEKDRCISELGLSKRDAGWKHVGTNEIYQ
                     LEVPARTKVPAPWILMSQTKACKRYYTPRTRELIRQLKEARETRLAALKQFQEEVYLL
                     FRQDLSSYARAVRTVAQLDCLLSLAKSSMALGMPSCRPELVQHDAALFSFTQLRHPCM
                     APSVLTGATEFIPNDIALGGQAEDVMVLTGGNMAGKSTTARTAATAVILAQLGCYVPA
                     EHARIAPVDRIASRMGANDQLFRGQSTFMVEMLEASKILREATPRSLVIMDELGRGTS
                     TFDGQAIAYAVLYHLVARTQCLCFFMTHYTTMAQSLDTYPRLANRHMEVRVDDEYKNV
                     VFTYRLVPGIAESSYGTQVAQIAGVPLSICTKASEVSRQFWHDAQKQHAQRAHCAIPL
                     DALADFAHLVTLGRSKPQVPPPSWALVTQAIMSRVP"
     gene            complement(<288002..>295060)
                     /locus_tag="MRET_3521"
                     /note="MRES_14135"
                     /db_xref="GeneID:38740287"
     mRNA            complement(<288002..>295060)
                     /locus_tag="MRET_3521"
                     /product="serine/threonine-protein kinase mTOR"
                     /transcript_id="XM_027630148.1"
                     /db_xref="GeneID:38740287"
     CDS             complement(288002..295060)
                     /locus_tag="MRET_3521"
                     /codon_start=1
                     /product="serine/threonine-protein kinase mTOR"
                     /protein_id="XP_027485891.1"
                     /db_xref="GeneID:38740287"
                     /translation="MLPSLTGNNSASVVSQAMQPSGTLTRMFEDLKSKDKAVRNHAGK
                     ELGNFVSYMLSELKGERLQLFTNELNRRVIELSHSTLSASKLGGITAIDHFIGLESED
                     NSARLYRFYQYLKPNLPCSDPQVMMAAARVLGRVSKHGGHSLGDQFVEFEVQRALDFL
                     QGERNENGRYAAVLIIKEMARNVPYLFHTYVGRVMDHIWVALRDVKVGVREAAAEALG
                     ACFQIISDREKQMGTQAYELVYDDAEQGLRDPAIEVIHGSLLAILKLLRYSKSFMRTR
                     LHRACELILRLHRHRDPLIRRTVTNLIPVLAAYDPQYYAEEHLSPVMSTLIEQLRRER
                     DRSTKEAWGDTLEAVGLVAMAMGDRMEPYVDAIMQCVRDSLIQRGKKHALPETPVFFC
                     LGHMALAVGPRIEGDVHDMLDMMFGCGLSTALVSALEKIVHAIPALLPIVQERLLHML
                     SQILIGVPYRPLGAPVPRRGGVPPPVIHVAPDARAMETITIALQTLGSFDFSGHILSE
                     FVRACTLPYLELDAKEVRKAAAVTCAHMFVNDPICYQTSMHAIEVFNDVLDKLIMVGI
                     ADPDAELRLTVLSALDEHFDRHLAQTEYIRSMFMALNDEEFGVREVAIGILGRLAKHN
                     PAYVMPSLRKVLIQLLTGLEYANVARHKEEAARLLTGVVRALQGLVKSYALTILQVLL
                     PKVRDPHASVAARVIECIGELARVAGEELAPLVDELVSLMVTQLSRGSAHASVARRDA
                     ALKTLGRIASNTVHVANPYLQYPRLLGGLVKILKGEQSVPVRRETIRVLGILGALDPY
                     RHKLLENSLDTVVSGGDAQTDLFELATLIGTSTDEYYQNVAIEALMAILRDPALSVHH
                     HAVIEAVMYMFKTQGLKCVAFLPQIVPAFLGVLRTCAGGGLSEFYYQQLAILISIIKQ
                     HVRNYLHDIFELVQADWNPNSSIQLTIVALMESVARALEGEFKAYLPLLLPHLLQTLE
                     GEITPKRTPTLMRMLQAFYVFGANLEEYMHLVLPVLVGLFERTDAPLPLRRAAIVTVG
                     QLSRKVNFADHASRIVHPLVRVLHSGIVELRTPVLDTLTALVFLLGPVYLTFVAVVNK
                     PMVHHRIQHPRYQQAIACLVRGEALPPELLPPDTLALDKADEAPLAEASKMAVNQLHL
                     KAAWDTSRVSTAQDWREWLRRLAVEMLRESPSHALRACRSLAEVYHPLALELFNAAFV
                     SCWVELLDTYQESLVHAIETALDAYDIPDQVVHILLQLAEFMEHDDKALPISIRLLGD
                     RAYKFHAYAKALHYKEVEFMAEPSPQLVELLIDINTKLQQGDAAFGALTYAREHMDIT
                     HHEEWYEKLHRWEEALAAYERRAVEQPDAQEIVFGKMRCLHALGEWEHLTELVQAKWP
                     TAGAEGRRQMAPLATATAWSFGQWDMMDEFIAAMRPESSERSFYRAVLAVHHGQRHQT
                     KRLIARARDALDTELTALVSESYARAYDLMVRTQMLSELEEALAYKLDYADQPDRQAT
                     MRTIWMKRLQGCELDVEVWQRILSVRSIVLTPADDMDTWIKFANLCRKSGRMVLAEKT
                     LNSLLGPDAQAMDAPLAGPRAPPAVIYSHLKFIWACGARTESLSYLRDFTLHLADDLG
                     MATVDGDDRLVLPDVRASPRLADFAKLLARCYFKLGEWQVAMNEEWVADDSCDVIRSY
                     QRATELDREWYKAWHAWALANFDVITHHERHGVAIPFHEVAASIVPSVHGFFRSIALA
                     SGNSLQDTLRLLTLWFKFGHLEHVADAVRQGFSTVTVDTWLEVIPQMIARISAPSPRV
                     RRLIHHLLSDVGTAHPQALVYPLTVATKSPSPVRMQAAMGIMDTMREHSPVLVEQALL
                     VSNELIRIAILWHEMWHEGLEEASRLYFTEHNIEGMFATLGPLHDLLERGPETLRETS
                     FAQTHGRDLNEAREYVRRYRQFGEINDLNQAWDLYYHVFKRITKQLPASNSVQLALQY
                     VSPKLLAMRDLELAVPGTYVSGQPIVRITQFEPIVLVISSKQRPRRLKIRGSDGRTYQ
                     YLLKGHEDMRQDERVMQLFGLVNTLLSIDTESYKRRLSLRRFPVIPLSPNTGMLGWVA
                     NCDTLHMLIKEYREQHKILLNIEHRLMLQMAPDYDSLTVLQKVEVFQYALDNTPGQDL
                     YRVLWLKSRSSEAWLERRTAYMRSLATSSVVGYILGLGDRHPSNLLLDRNSGEIVHID
                     FGDCFEIACHRPKFPEKVPFRLTRMLIKAMEIGGIQGTFKVTAENTMRVLRDNRESVL
                     ALLEAFVHDPLISWRLVTDADAEQRAPDAHEHEHEWSGEIRGVEGEARNQRALEVVRR
                     IQNKLTGRDYDPTTPLSVPEQVDRLIQDATSVENLCVAFIGWCAFW"
     gene            <295570..>297690
                     /locus_tag="MRET_3522"
                     /note="MRES_14140"
                     /db_xref="GeneID:38740288"
     mRNA            join(<295570..297582,297610..>297690)
                     /locus_tag="MRET_3522"
                     /product="phospholipase A2 activating protein"
                     /transcript_id="XM_027630149.1"
                     /db_xref="GeneID:38740288"
     CDS             join(295570..297582,297610..297690)
                     /locus_tag="MRET_3522"
                     /codon_start=1
                     /product="phospholipase A2 activating protein"
                     /protein_id="XP_027485890.1"
                     /db_xref="GeneID:38740288"
                     /translation="MSRFVLAARLHGHSSDVRAIASHTLSNGTQLILSGSRDQSARLW
                     VRRHDGTHDVHVLDHGSGFVNAVAFFVHDTGIYALTAGQDALIYAYHIDTDGPVSVSG
                     SPTLSLVGHASNVCSLRTHSAYIVSGSWDSTVRVWKNWECVATLAGHSHSVWSVLPID
                     EDRILSASADKTVCLWSISSPKEPLYVFEGATQAVRDIARVSDTAFVSAGNDGQLRLY
                     PIHGGAPYKTFASLPAFVYALAPLADGFVSSGEDRCVRVWAHDALTQLVPVPALSVWC
                     VCTLSNGDMACGASDGTVTIFTRDAARAALLPEQEAFAADIATQSLSAPEVQGVRVCE
                     EHDTTPGASEGDVLVVRQGSKSTRYHWSTHTQQWIPTGIVTEGASSSQKTLFEGKAYD
                     YVFDVDIADGVPPLKLPYNVTDNAYVAASQFLERHQLPASFLDQVVRFLEKNTGVVDV
                     STTEAVDPYTGTSRYVPAQPAPLATLPQTRFLSFTHVQLASAHAKMLELSQSVPGATL
                     SDDDQAAVAALVAALEQGTGVMPVDILGKLLRTWPLAARFPLLDLLRAAALHACTQPL
                     TTLVSDALVGADWDGLDQASDVPSAPANAMLALRTLANGFVAPQGPATMASLALEALA
                     TLHQPPWHVLNRAGHTALATVALNYSILAVTRPTFEHAALLLDILTDILRHASESESV
                     YRALVALGNLVRMYN"
     gene            complement(<297818..>298918)
                     /locus_tag="MRET_3523"
                     /note="MRES_14145"
                     /db_xref="GeneID:38740289"
     mRNA            complement(<297818..>298918)
                     /locus_tag="MRET_3523"
                     /product="PQ loop repeat protein"
                     /transcript_id="XM_027630150.1"
                     /db_xref="GeneID:38740289"
     CDS             complement(297818..298918)
                     /locus_tag="MRET_3523"
                     /codon_start=1
                     /product="PQ loop repeat protein"
                     /protein_id="XP_027485889.1"
                     /db_xref="GeneID:38740289"
                     /translation="MSTDICELPPHDGMAWMLSSVVSVGIIASYIPQIVRIVSARSSV
                     GLSPWFLFLGTLSSWATMLNVLVLQWPVLSCTFRHWSLLAMEYWMGVIQTGVQQLMFT
                     ILFACFLRYYPLDMQARRRRRSRKQRKLSRAPVQEADLSLLRPPPTQQDSSDSDSDVE
                     SFHHHIHKSYGAVAESANPTQGNLASHAHSHDAYHNIPAHMRDILERHLLPSEEAIHG
                     RVGAMHEYAVARRLAWTAACLILAALGTSVVLLTGHAPRVRTWANVLGVAASVLTMCQ
                     YVPQIVHTARARLVRSMSITMMCIQVPGAALFVYALAQQVGVDWSSLMPFLVAATLQG
                     ILLILCIVFKMQQRRAGIDDYGQHIGAAALSA"
     gene            complement(<299458..>300465)
                     /locus_tag="MRET_3524"
                     /note="MRES_14150"
                     /db_xref="GeneID:38740290"
     mRNA            complement(<299458..>300465)
                     /locus_tag="MRET_3524"
                     /product="endonuclease G, mitochondrial"
                     /transcript_id="XM_027630151.1"
                     /db_xref="GeneID:38740290"
     CDS             complement(299458..300465)
                     /locus_tag="MRET_3524"
                     /codon_start=1
                     /product="endonuclease G, mitochondrial"
                     /protein_id="XP_027485895.1"
                     /db_xref="GeneID:38740290"
                     /translation="MSFAAHVGLFAGGILLGAGGATLVSKRLASSSSVPSVEPVIPEK
                     QAPLQKAVVKPTSDALQKSGHPGPIADFLRSQAYVTAYDRRLRHPVWTAEHLTSESIR
                     RPPGAEVNRAMSVFTEDERIPMPFRSTNSDYFGSGYDRGHMVPAADAKSSQAAMNETF
                     LLTNIAPQVGPGMNRDYWAHTEDFVRRLTSQFSDLYVFTVPLYLPRQSSDGKWRVTYE
                     VIGTPPKVSVPTHFAKVILGTGHLSSGPSMVGLGQSGMALGAFIMPNSMIPNSAPLRS
                     FEVDVSAVESAAGLTLFSPAIKSAAKKLCDTVQCEIIVRDFSQANKNLPAKSSPPLLT
                     K"
     gene            <300664..>302052
                     /locus_tag="MRET_3525"
                     /note="MRES_14155"
                     /db_xref="GeneID:38740291"
     mRNA            <300664..>302052
                     /locus_tag="MRET_3525"
                     /product="ornithine--oxo-acid transaminase"
                     /transcript_id="XM_027630152.1"
                     /db_xref="GeneID:38740291"
     CDS             300664..302052
                     /locus_tag="MRET_3525"
                     /codon_start=1
                     /product="ornithine--oxo-acid transaminase"
                     /protein_id="XP_027485894.1"
                     /db_xref="GeneID:38740291"
                     /translation="MSNFEQFQQKLSHFGQTVYSSASAMGHAAHTASTRQHFSSEELM
                     KMENEYGAHNYHPLPVVFDRAHGSRVWDPEGKEYLDFLSAYSAVNHGHCHPAVVGTLI
                     AQAQKLTLSSRAFYNSVFAQFAKRVTELLKYDMVLPMNTGAEAVETAMKLARKWAYVK
                     KGVPEDKARVLSATGNFHGRTIGVISMSTDPDSRNGFGPMLERVGPVVDDIKIRYNHA
                     EDIEAVLEKYGNETAAVLLEPIQGEAGIMVPDDDYFKKVEALCKKHNVLLICDEIQTG
                     LGRTGRMLCCDHYGVRPDIVTLGKALSAGVYPVSAVLADKDVMLCIQPGEHGSTYGGN
                     PLGSAVAITALDTIVKENMCERAEKLGESMRSSLKQIQNPLLLEVRGKGLLNAIVIDE
                     TKSTKGRSAWDLCLLLKDKGLLAKPTHQNIIRLAPPLVISEEEMERGIKIITEALDDL
                     DKVDTIPGAEAH"
     gene            <302143..>302901
                     /locus_tag="MRET_3526"
                     /note="MRES_14160"
                     /db_xref="GeneID:38740292"
     mRNA            <302143..>302901
                     /locus_tag="MRET_3526"
                     /product="heme steroid binding protein"
                     /transcript_id="XM_027630153.1"
                     /db_xref="GeneID:38740292"
     CDS             302143..302901
                     /locus_tag="MRET_3526"
                     /codon_start=1
                     /product="heme steroid binding protein"
                     /protein_id="XP_027485893.1"
                     /db_xref="GeneID:38740292"
                     /translation="MCAQYHRIPSTNGENSEKEPLFDIDPSTGRKVTHKRINKAYLVH
                     QRWLEKQKQIKERKQARAEGRSVPYDPELDEEEDVPFLANCLFSLTYTAFVVAIIALF
                     AGQFIHGDFLWGYRGKWTNWRTYFPPTMREFTPEQLQRFNGESSGPIYLAIKGDVFDV
                     TPGRNHYGKGGAYHFFAGRDASRAYVTGCFESHLTHDLRGFTEAEHVMLNQWHRFYAQ
                     HPKYFKIGTMRLPPINPASPIPPPCNEPRDQKPN"
     gene            <303603..>304250
                     /locus_tag="MRET_3527"
                     /note="MRES_14165"
                     /db_xref="GeneID:38740293"
     mRNA            <303603..>304250
                     /locus_tag="MRET_3527"
                     /product="H/ACA ribonucleoprotein complex subunit 2"
                     /transcript_id="XM_027630154.1"
                     /db_xref="GeneID:38740293"
     CDS             303603..304250
                     /locus_tag="MRET_3527"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex subunit 2"
                     /protein_id="XP_027485892.1"
                     /db_xref="GeneID:38740293"
                     /translation="MNEILPVMASEEVKQKKAVAAEASVKKEKKEKKEKKEKKKDKKE
                     KKESATEADDAADVSMMDVADVDVEVDPSTLSPIACPLASEALTKKVYKTIRKASKSR
                     GHVKRGVKEVVKGLRKGEKGLVILAGDISPIDILSHIPVLCEDSGCPYVYVASKDQLG
                     NASSTKRPTSCVMIVPGGGKKAVEKGETKVKEDYQEDYSFLHKEASRLVEQVLMS"
     gene            complement(<304302..>305435)
                     /locus_tag="MRET_3528"
                     /note="MRES_14170"
                     /db_xref="GeneID:38740294"
     mRNA            complement(<304302..>305435)
                     /locus_tag="MRET_3528"
                     /product="tryptophanyl-tRNA synthetase"
                     /transcript_id="XM_027630155.1"
                     /db_xref="GeneID:38740294"
     CDS             complement(304302..305435)
                     /locus_tag="MRET_3528"
                     /codon_start=1
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="XP_027485897.1"
                     /db_xref="GeneID:38740294"
                     /translation="MSCMLSGARRWASTLARRRVIVSGIQPTGVPHLGNYLGALKTWT
                     ALQNEADPQDELYFFIASLHALTIPQNPKQLYHDRRNLLAALIAVGLDPHRCTIFMQD
                     QVPQHAELSWLLMCQSPFGRLERMTTWKSKIATIQNSASEDHVNESQLQLGLFAYPVL
                     QTADILMYHATHVPVGEDQQQHLELTRDLAHSFNRSVKKPFFPIPEALLSESKRILSL
                     RNPEQKMSKSAPDANSRIMLTDTPEQIQSKVKKAVTDSEGTLSFDPASRPAISNLLQI
                     LAGMDGGVLQSHMTQEITQERKDPAFLARFLNEYAGGSSAALKRTLADSIIEELRPVQ
                     KEYSRLISEDGFLDEIERLGCEKACLRAQETMSQVRTMLGLHQ"
     gene            complement(<305504..>306774)
                     /locus_tag="MRET_3529"
                     /note="MRES_14175"
                     /db_xref="GeneID:38740295"
     mRNA            complement(join(<305504..306585,306624..>306774))
                     /locus_tag="MRET_3529"
                     /product="peroxin-13"
                     /transcript_id="XM_027630156.1"
                     /db_xref="GeneID:38740295"
     CDS             complement(join(305504..306585,306624..306774))
                     /locus_tag="MRET_3529"
                     /codon_start=1
                     /product="peroxin-13"
                     /protein_id="XP_027485896.1"
                     /db_xref="GeneID:38740295"
                     /translation="MPAPPKPWEQKSATEVASPLSASSNSAPEAAPALPEQPASLRSG
                     MDATTTGGMNANRGYMSGYGGYGSMGGYGAYGGLGGYGGYGSAYGSPYSRYGGYGGMG
                     YGGMGYGGMGYGGMGYGGMGYGGMGYGGMGFGQPGENSLTQRMESGTQATFELISSIV
                     ATFGGFAQMLESTFMATHSSFFAMVGVADQFAHLRNYLGEVLSIFALARQIKNLYLRM
                     IGRRPVHGIDAKNFGEFKRVGGAKPQPSKRPLALFFLAVIGLPYLMGKVVKLITAKQE
                     EERARLSKQAAEAGTSLQMLQDAQGAAALDPSKLTFVRARFAYTATDNLELSLRQNEI
                     IAVLSKTDPQTGEESQWWRGRTRDGRIGWFPSTYVETLEQARDRATKSAPKPAIEAST
                     TSPQAQHTKIVASKTSTQ"
     gene            complement(<306996..>307719)
                     /locus_tag="MRET_3530"
                     /note="MRES_14180"
                     /db_xref="GeneID:38740296"
     mRNA            complement(join(<306996..307607,307669..>307719))
                     /locus_tag="MRET_3530"
                     /product="large subunit ribosomal protein L10e"
                     /transcript_id="XM_027630157.1"
                     /db_xref="GeneID:38740296"
     CDS             complement(join(306996..307607,307669..307719))
                     /locus_tag="MRET_3530"
                     /codon_start=1
                     /product="large subunit ribosomal protein L10e"
                     /protein_id="XP_027485910.1"
                     /db_xref="GeneID:38740296"
                     /translation="MGRRPARCYRYCKNKPYPKSRYNRGVPDPKIRIYDLGRKKASVD
                     EFPFCVHLVCDEHQQITSEALEAARICANKYMVKMTGKDAFHLRVRVHPYHVIRINKM
                     LSCAGADRLQTGMRGAFGKPYGLVARVNIGQVLLSIRTRDGNRPHAVESLRRSRYKFA
                     GRQKIIISKKWGFTDMSRQEYLEARDSHRVIKDGCHLKYITNHGRVENNLRLQAQVAA
                     SK"
     gene            <308018..>309955
                     /locus_tag="MRET_3531"
                     /note="MRES_14185"
                     /db_xref="GeneID:38740297"
     mRNA            <308018..>309955
                     /locus_tag="MRET_3531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630158.1"
                     /db_xref="GeneID:38740297"
     CDS             308018..309955
                     /locus_tag="MRET_3531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485911.1"
                     /db_xref="GeneID:38740297"
                     /translation="MNQGSGPTRRGESESLLRSLTSNTQVRGSFNGVGNASSATTVPF
                     LTNVESHFGRVTLTAPDNMRRTKKRTAKSKSAHPASSSGIHAVPAQTLSSERAATTRT
                     QPRRERSTTSMRTTATRELDRRVNVWDSMGVLTSTDDADPPPPFVPSETPSARPSGPP
                     IPRSPPPAFVSEDEESDHDEVEYVTRLPAPVDPVKLRESDAWERDRLLGFSLEERVAR
                     MERRRAGVPHPSMRNTISTVTTQPETVRWNRPAVQSDTVEFPTLEVPKAPQALTRRDH
                     GDTVDDTSSEDSRLDEVDNSDEEWQHEHDALEALHRQEADARHEQQSRESLPRRVPPI
                     PDSGVEPPVSRPLPPPPPSRVPYIRSAYDQLRMWQSQNRLPEALNRDMNEHEERLLRR
                     NASMPGHFGSAFSNAQSSVAPLPRQVRLPVVTDATRHFPRSEPTSASAQAIDSTQEFE
                     RSVLTTEHADIPEVQVSEAVSESRHTEDVQPENVSESNTDQDVAMTATQPSEEAQPLD
                     ASEGITDLDVAVAHLDHPATHYEWATLISDFLGPAREQTQRTTEELEGISVGRVELEH
                     RRVTTSGQVRVRLSVAGMRVDRCGICLEQFREGQLACILPCFHMCVLFMTDHSFHNHC
                     TIELLRHAQQCPVCRRDILRS"
     gene            complement(<309952..>311817)
                     /locus_tag="MRET_3532"
                     /note="MRES_14190"
                     /db_xref="GeneID:38740298"
     mRNA            complement(<309952..>311817)
                     /locus_tag="MRET_3532"
                     /product="replication factor A1"
                     /transcript_id="XM_027630159.1"
                     /db_xref="GeneID:38740298"
     CDS             complement(309952..311817)
                     /locus_tag="MRET_3532"
                     /codon_start=1
                     /product="replication factor A1"
                     /protein_id="XP_027485912.1"
                     /db_xref="GeneID:38740298"
                     /translation="MSSEQLTEGVIGSMLASTDGTTPVVPKCQILSLKKLQTTSASAN
                     VSERYRVVLSDGVHYTQAMLATQLKPLVENGMLDKNVVVRITQFTSNTVQNRKILILL
                     NLEPISSALPHRIGNPQNIEASSSKPEAKPQSADSKPAVPAAAPQASRPAPSVAAQAL
                     SGSRGVAKASSGMPVYPIDALSPYQNKWTIKARVTLKTDIKHWSNARGDGKLFSVHLM
                     DESGEIRATGFNDAVDRFYPILQENKVYFISKAKVTIAKKQFSTLPNEYEISLESGSE
                     IEECAEAGDVPEVKYNFVPINELNTVEPNNTTDVIAILDSYSDVSEIVSKATQRPIKK
                     RELSLIDSSGMSVRMTLWGSQAENFESTISGEDKPVMAFKGVKVSDFGGRSLSMFSSS
                     TMSINPDIPESHGLRGWYDNEGNAAPIRAISSAMDGGAAAGGGTTPGAMRANEFRTFA
                     QVKDQSLGTSFERADFFNTRAMVVYIRPGTLYYTACPSQECNKKVLMDDDGNWRCEKC
                     DRSYPAPVRRYIFSANVADYTGQIWVSGFNEVGETLLGITADELDVIQNESEAGFKAV
                     LSRAIGRVIDIGCRAKQETFNDSSRVRYTMTRLQPVDFKKAGHELVNKIHALQAN"
     gene            <312153..>314419
                     /locus_tag="MRET_3533"
                     /note="MRES_14195"
                     /db_xref="GeneID:38740299"
     mRNA            join(<312153..312176,312203..>314419)
                     /locus_tag="MRET_3533"
                     /product="phospholipid binding protein"
                     /transcript_id="XM_027630160.1"
                     /db_xref="GeneID:38740299"
     CDS             join(312153..312176,312203..314419)
                     /locus_tag="MRET_3533"
                     /codon_start=1
                     /product="phospholipid binding protein"
                     /protein_id="XP_027485913.1"
                     /db_xref="GeneID:38740299"
                     /translation="MTSGFWNLSTRIPFQKSVNKSENHTTSTAAQKQPSKRQDASSTF
                     DSAENLVRWTTSHLRRPKSRSALARPMEVKNRSRNEDVVPEEANTQNSESSLSSSVTS
                     THSMTTDQSHTSIEEVTDTSESEFHDSPSREMSPPPFFYPVPQDMVPQVAQTAGIASG
                     YATPSISLPASASTLTEFRSLSRRASGVGHSPLRMSGIAPSSGAPIKLDDSTGLSIPM
                     ASTSSSHQGLEVPTVQEQERSPGSLTRIREEGPQPHDHSSSLSVSTRFDEHGSGDSIL
                     NDTVPPTPTQIMSHRSSMLGAPTLWMTSTCDVVSGTATPRLWRSQLNSPTVLPSPTAR
                     RAPYGPERSVVEESPGDSLTTTPRRLDSFAGAHKQGTTLAAVSANKSPNTLGLLGSMP
                     DNKPPLWMRRNQGQGLLRLQVDPSELSKQIGTSSLTHDMLLHANNILHGVAMEQERSM
                     MKHERGNKLLLHDASRSSLSFSEDMPREGEEELPPYQCTVHMEGYLPCKMENRTADTG
                     MARGWDSMYFVVHGTALYMYKTNVSLFYRPDMTPTHAWNLNNSEGVLVHKQPCNAEDV
                     LDDNHVAVDELSMSLEERVKQGIELGRSFASYQAPSHAPRVPNQEERTRFVDMLEKHH
                     FHTYSMDGAQCGYAADYTKRPCVIRIKVANNQFLIQTRNNHHLVDWIEALQGSTNVST
                     DLDCRPMPKFVTLPRRRRHRRDTEAMVIRDPEDTSRARSSAGTQPSTLPHRAEPVTMR
                     TSAIAT"
     gene            complement(<314428..>315054)
                     /locus_tag="MRET_3534"
                     /note="MRES_14200"
                     /db_xref="GeneID:38740300"
     mRNA            complement(<314428..>315054)
                     /locus_tag="MRET_3534"
                     /product="vacuolar protein sorting-associated protein
                     IST1"
                     /transcript_id="XM_027630161.1"
                     /db_xref="GeneID:38740300"
     CDS             complement(314428..315054)
                     /locus_tag="MRET_3534"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     IST1"
                     /protein_id="XP_027485907.1"
                     /db_xref="GeneID:38740300"
                     /translation="MARWHATRTKIQLKLAIQRSRMLQEKKAALHKKVRLEIAELVER
                     QKLESARVKTESLIMDDIHLELLELLELYCETLYARFGLLEGRDNEPDDAIREPMIAI
                     IHAAHRTEVKELHVLQNMLSARYSTEFSEAALQNTENCVSERITRKLAFHLPPPEMVD
                     AYLSEICKAYQVPFGQAPTPPDTLSTEAGDHDWHTLVQRFDALKRTHG"
     gene            <315167..>316552
                     /locus_tag="MRET_3535"
                     /note="MRES_14205"
                     /db_xref="GeneID:38740301"
     mRNA            <315167..>316552
                     /locus_tag="MRET_3535"
                     /product="DNA primase small subunit"
                     /transcript_id="XM_027630162.1"
                     /db_xref="GeneID:38740301"
     CDS             315167..316552
                     /locus_tag="MRET_3535"
                     /codon_start=1
                     /product="DNA primase small subunit"
                     /protein_id="XP_027485908.1"
                     /db_xref="GeneID:38740301"
                     /translation="MAAVEAPDAMEEDKAWDQAVSRMDEPVMSQSKTDDSVDPMALLV
                     YYRRILPFKSLYMWLNRDITPARNFTHREFALTLQNNAYLRYQSYSTWDEWKKEVCRL
                     NPSRFEIGPVYSAKPKDRKTMQKATFRPVARELVFDIDMTDYDEIRTCCSDKSICHRC
                     WKWIGVAAEVLDMTLREDFGFKHIVWVYSGRRGIHCWVSDQEAFVLADDARKALVGWI
                     EVIKGSANQAKKVSLGASAPGFHRTLHPSLRRALGHDILTATSSTAHARHRGLLQRAF
                     VDLVLQDQDCFRAQDRSDVLLSLLPASDADALAKLQSKWATSRSSVQKWDDVLEVAAR
                     SQERLRPAWVAALEDIVLQYTYPRIDSEVSKRQNHLLKAPFVVHPSTGRICVPLELEQ
                     IQSFDPQTSAPTVEQVLQELNQVAEASGHNEWENTSLRPFVAQFDQVCTRIVRQAQEQ
                     KRIAQRQSLDF"
     gene            complement(<316278..>317681)
                     /locus_tag="MRET_3536"
                     /note="MRES_14210"
                     /db_xref="GeneID:38740302"
     mRNA            complement(<316278..>317681)
                     /locus_tag="MRET_3536"
                     /product="CAP-Gly domain protein"
                     /transcript_id="XM_027630163.1"
                     /db_xref="GeneID:38740302"
     CDS             complement(316278..317681)
                     /locus_tag="MRET_3536"
                     /codon_start=1
                     /product="CAP-Gly domain protein"
                     /protein_id="XP_027485909.1"
                     /db_xref="GeneID:38740302"
                     /translation="MYTGLSHPRLADDLSRTARVPHADMEACLAHSFDQDAERIMAYA
                     LASKPKSDIWHHIVAHRWPHMPSTLRLAPAAQHQLAWLVCTGHLHPSSPCTASEWLSL
                     TDALASHHWPEAAQLIAAYAMITWDTQACAPLVTKPYVLADTAFWECMPQCPRAAALL
                     PTVPPTWRAHLLSCVMAHASGDTCLAYIDAVRHYGLDADRLSLVPLTTEPRQDVLPSA
                     RAWPHILDTCSPLLSYILHLLTSRLDVHNAPRMYEYVVGHILLPDDGPIPTKDALRVV
                     EQAQQDIVQFLHAHWVHVRAARGFDALPRWCLKELSDELGIDAPDLTLDYTPTSSATV
                     SDAQSTVGMTSAGLNTTRAPTHRGPASMYAAVLNKSAAAHASIKSQATVSAQCVSAPA
                     PAARSACTPDQTVRQRDASSYFPTHYGPTPRPLDSALAVPARRSVQMSEDQTTESALA
                     RAEHKCGLSTDAPQKAP"
     gene            <318016..>319491
                     /locus_tag="MRET_3537"
                     /note="MRES_14215"
                     /db_xref="GeneID:38740303"
     mRNA            <318016..>319491
                     /locus_tag="MRET_3537"
                     /product="glutamate decarboxylase"
                     /transcript_id="XM_027630164.1"
                     /db_xref="GeneID:38740303"
     CDS             318016..319491
                     /locus_tag="MRET_3537"
                     /codon_start=1
                     /product="glutamate decarboxylase"
                     /protein_id="XP_027485788.1"
                     /db_xref="GeneID:38740303"
                     /translation="MTPLGGEPASAELERLGAQCLATATEWIAYGESGEARAVPWPSV
                     DAFRASMDVRLPEQGVDESSLLEKMRAILYNSVNPWTERFLEKLYSAPAVVSILGDML
                     LGVMNASVHVFSASPILTMIEEQCAAALCERVGYGPQADGITMPGGAASNTLGVQVAL
                     LQKFGGVYRRGGVYALMKAYREQHGRVERGAYPAILTSASAHFSIARAAVAAGLGTDA
                     VVHIRTDAHGRMDVRELERMCAEMQADAAHPQGVPLIVCATSGTTVLGAFDDVAAIAE
                     VCRKYDLWLHVDASWGGAAAFLPLDAPERSVLAGLENAHSITINPHKLLGVTHQCSFL
                     LVHDKSVLIPPSHSDGGYLFHAPAEDALDMATKTLGCGRRGDALKFYLVWLRYGTQGL
                     GDHIAHGLRMAQALWQRLQRIPSLELGPHADPLFLQICVRPREQSVRALHAQLQAHGQ
                     FAVDYAPLDDGQEYLRLVVHPRTPWHVYEQLLAYLGEGRSY"
     gene            complement(<319554..>321986)
                     /locus_tag="MRET_3538"
                     /note="MRES_14220"
                     /db_xref="GeneID:38740304"
     mRNA            complement(<319554..>321986)
                     /locus_tag="MRET_3538"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027630165.1"
                     /db_xref="GeneID:38740304"
     CDS             complement(319554..321986)
                     /locus_tag="MRET_3538"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485914.1"
                     /db_xref="GeneID:38740304"
                     /translation="MSTDVPRHIREAAVPLPMAPRRAVLQSLSTQETVPVQRHQADAP
                     LYKLNENGLHTEAQKVVQDRIREQQPRVHRDHLAPLEGIHNVPPSGAQPPIAKETTSK
                     KPQLPTPPRVIVDPEGQQYERHAMLGQGGFARVYHVTNSRGEDKAFKVIAKSAIMQSK
                     KNRQKILAEIMIHKSLKHVHIVAFEDVFEDAENVYFVLELCHNGNMNDIVKRRGPYLE
                     SEARYFMVQILAGIQNMHNNSVIHRDLKLGNVFLDKDMQVKIGDFGLAALLKYPEERK
                     KTVCGTPNYIAPEILYDQGEGHSFEVDIWSVGVILYTLLVGRPPFQTSNVQKIYDRIR
                     RNEYEIPPEANLSPESKELIRQILSQRPSERPSLQEIMHHPWFQAGTVPLSVPSSAVY
                     HQPYIPTLSDAESRRNFEELKTRAHWQSEEQEAAALARTPPRSARQEMCVLEAAEEDR
                     DRIDRESQRAIDPGSPISTLLKVGRQPLMRVPQATGGSLASRMQDMQLQDKAPQRAVP
                     RRPLTAMELTEHYLSQALAHLDHGIIEPMVPVDPNGDVVTVPLPNVIDGEHGQLRLKP
                     DAPRLFIISWLDHSEKYGLGYALCNGTVGVHFRDSTSMVLAPARQAFDYVYTVRQRTA
                     HERHDQLRRENYALPPSLGQLEWLPHELVSKFKLLRFFESEIMERLYGADSPLTYVDE
                     QATSHLGFVHKWYRCKQAIVFRLSNGTVQFNFYDHTKVFLSCDGLVISAIEPVDRTDG
                     VPILRTWTLSELVAIAHPSRSATEAAAHEAAQFPTYFQTKPSERRFVRQVLKKLRYVR
                     DVLLTTTNASTA"
     gene            complement(<322216..>324416)
                     /locus_tag="MRET_3539"
                     /note="MRES_14225"
                     /db_xref="GeneID:38740305"
     mRNA            complement(join(<322216..322359,322386..>324416))
                     /locus_tag="MRET_3539"
                     /product="breast cancer 2 susceptibility protein"
                     /transcript_id="XM_027630166.1"
                     /db_xref="GeneID:38740305"
     CDS             complement(join(322216..322359,322386..324416))
                     /locus_tag="MRET_3539"
                     /codon_start=1
                     /product="breast cancer 2 susceptibility protein"
                     /protein_id="XP_027485915.1"
                     /db_xref="GeneID:38740305"
                     /translation="MAAARTEKRHNLPDTPKELLIQFDHTENSPKTRDDSMIDALSTH
                     KNQHTFWRRYNSCTSVFPNLKESKNDQADPWDEEIDFFETLDDSAWQLLDETSNNSMS
                     SSDPIDSMNVPCFQRASGKRIARPNAEAMKLAAKRLRLDEWDQSDTPSVKADNFSIPQ
                     QQGHFVPLTVAATPPRPRTPLAKSPMCRRSFRSPLRPITPQPKQMSVGLNPRTYKSGL
                     LTPQGRPPFISPFKKGVSATSLPSASHASPPMFILKAPEKRMSYKDAGIVPSYSPRPQ
                     ASSDILQILQNPTQAAQYVFHGQHHIQGPSEALEELERLGGLRLTLKWVRHHWSLILW
                     KLAAYTYWRPGMQLWSFAECLRQLRYRYEREFVRKHKSAIKQIQEQLSSSARCMVLCV
                     RQILFFDEDEGTSLMLELSDGWYCIRAEVDEPMRRAIQAGKLRVGHKLALMCTKLRSS
                     GEPTAVLDALYTADLQLYANSTTLAPWDAKLGFYGGSFVSSLSRLLPDGGVVGRVDVV
                     IERVYPTGYMEGTIDARGTVQFHGQPQYGAAEEAEREARWHGQYEAAKLQLNARVKRL
                     NKAATWLETQVESAYEEKDMHAYINALEEHDDPSLILRDAPLSGVLYAVQERLHALSQ
                     PSYEILPPRHTRSFTIVRVREARPTRRESGRTVQLTVWRQEGTPLIKEGSRYEITHLL
                     PTQLRSWRPRTHVADAFLSTTRDTQWYVRGTSGVSTERGSGC"
     gene            <324571..>325132
                     /locus_tag="MRET_3540"
                     /db_xref="GeneID:38740306"
     mRNA            join(<324571..324587,324622..>325132)
                     /locus_tag="MRET_3540"
                     /product="kinase phosphorylation protein"
                     /transcript_id="XM_027630167.1"
                     /db_xref="GeneID:38740306"
     CDS             join(324571..324587,324622..325132)
                     /locus_tag="MRET_3540"
                     /codon_start=1
                     /product="kinase phosphorylation protein"
                     /protein_id="XP_027486178.1"
                     /db_xref="GeneID:38740306"
                     /translation="MYATSSRGGTRGGQADFSWDVVREDKHRENYLGNSVAAPRGRWA
                     QGRDILWYSKNSKDHASTNDKEARSKELSELKAAEREAMEQMLGHKPQNHETAQTGAN
                     AEPLDASKRRYPRSTPTAKDERRHRHHRHHRHHRHDSQQRRTSARDYSPLRRESRYDD
                     NDRHKHGQHRDEAPQ"
     gene            <325735..>327947
                     /locus_tag="MRET_3541"
                     /note="MRES_14230"
                     /db_xref="GeneID:38740307"
     mRNA            join(<325735..325737,325807..325845,325884..>327947)
                     /locus_tag="MRET_3541"
                     /product="glucosamine---fructose-6-phosphate
                     aminotransferase"
                     /transcript_id="XM_027630168.1"
                     /db_xref="GeneID:38740307"
     CDS             join(325735..325737,325807..325845,325884..327947)
                     /locus_tag="MRET_3541"
                     /codon_start=1
                     /product="glucosamine---fructose-6-phosphate
                     aminotransferase"
                     /protein_id="XP_027486093.1"
                     /db_xref="GeneID:38740307"
                     /translation="MCGIFAYVNYLVEKDRRTIIDVLLNALSRLEYRGYDSAGLSVDG
                     DREKEALLFKQVGKVNALRKHISESSVDMDRTFVSHAGMAHTRWATHGTPSPLNCHPH
                     KSDPRGEFTVVHNGIITNYRELRLVLEKRGYKFETDTDTEAVAVLVKYFWDSYPENRK
                     PDFHIVVRCAVKELEGAFSFVFKSVHFPGEVVVARRGSPLLIGVKTEKKLKVDSVDVQ
                     FGNPLEGDEYSNEPNLHSPPNFDQVNAQAPMAHASIDKLIRSQSRAFLSEDGMPQPIE
                     FFIASDASAVVEHTKRVLYLEDDDIAHIADGELHIHRLRRNDGLSSTRSIETLEMELA
                     EIMKGQFDHFMQKEIYEQPESVVNTMRGRVNFDTREVRLGGLMSYLSVIRRCRRIVFI
                     ACGTSYHSCLATRAIFEELTEIPVSIELASDFLDRKSPIFRDDVCVFVSQSGETADTI
                     LAMRYCLGRDALCVGIVNTVGSTISRETHCGVHINAGPEIGVASTKAYTSQYIALIMM
                     AVHLSEDRISKMARRHEIIDGLHALPDQIRMVLANDKQFQDLGYNTLVNEKSLLIMGR
                     GYQHATCLEGALKIKEVCYMHSEGILAGELKHGPLALIDEAMAVILIMTKDSLYPKVQ
                     TALSQVSARNGRPIIICNDGDTNLPNDARVLRVPMTVDCLQGLITVLPLQLISYHLAT
                     ANGIDVDFPRNLAKSVTVE"
     gene            <328083..>330536
                     /locus_tag="MRET_3542"
                     /note="MRES_14235"
                     /db_xref="GeneID:38740308"
     mRNA            <328083..>330536
                     /locus_tag="MRET_3542"
                     /product="chromosome transmission fidelity protein 1"
                     /transcript_id="XM_027630169.1"
                     /db_xref="GeneID:38740308"
     CDS             328083..330536
                     /locus_tag="MRET_3542"
                     /codon_start=1
                     /product="chromosome transmission fidelity protein 1"
                     /protein_id="XP_027486095.1"
                     /db_xref="GeneID:38740308"
                     /translation="MELTESTASAREALVLPVPGHDAGENDAVRSRAFQFPYETAYRI
                     QLDLMTAVFQAVEHGQVGVFESPTGTGKTLSLLCSALSWLRMHRQRHIWGQRAASTVD
                     SQDAEPEWVLAHEEAKQREAIEAYETELRERLQRARSTRTHVPATQKRARREKDTLSD
                     DEFLVNDYHDAQDSFLSAEVRAMMHTYESQWSAPNIGDDETRPKIFYASRTHSQLVQL
                     VHEVKRTPYGQGDEPVRCVSLGSRKQMCIHHDVRRIGALFGTEAMNERCLELMEGKKG
                     KRCPYLPAQSDPVGRAEMDTYRDHALSHVQDMEDLVQLGKDMHMCPYFGTRHSARHAE
                     LVTLPYNLLLLRDAREALHLTLDGSVVIIDEAHNLIDTLLATYAAELTQAQIEQAVQQ
                     VEMYLRRFSMRLRGTNEEQVRILQVLLRALQGLCVELTESQTFSLPDFMSRLGGSVDQ
                     INLVRLERWLKDTRIARKMGGYADKVWLESHAAPAHRAVAMHALEAFLLALCNRAKNG
                     RVLVTVDKMQGVRFKYLLLDPRDAFEPIVSSARAIILAGGTMEPMSDFEQLVPRDRFT
                     TFSCGHIVPSSHVMGAVVPLGPKGQTLEFTHASWQQPAMLDELAVALGNYTNIVPHGM
                     VVFFPSYATLDAALARWQHTHALERLSRRKKVLTEPKDAKDVDAVLQQYAATIADPSP
                     SSPKGAMLLAVVGAKLSEGINFQDDLARCVVMIGLPFPHAKSRELAERLAFAGEDGRD
                     MYVNMCMRAVNQSMGRAIRHRADYAAFLLLDRRYAREQIQSRLPGWIRTQVQVHDRFG
                     SSIRALAQFFQQMRYRAAT"
     gene            complement(<330533..>331186)
                     /locus_tag="MRET_3543"
                     /note="MRES_14240"
                     /db_xref="GeneID:38740309"
     mRNA            complement(join(<330533..331054,331082..>331186))
                     /locus_tag="MRET_3543"
                     /product="phosphoglycerate mutase family protein"
                     /transcript_id="XM_027630170.1"
                     /db_xref="GeneID:38740309"
     CDS             complement(join(330533..331054,331082..331186))
                     /locus_tag="MRET_3543"
                     /codon_start=1
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="XP_027486094.1"
                     /db_xref="GeneID:38740309"
                     /translation="MRVALFVAGALAVCAAANAVAPQKRGDHHIKSTIYLIRHGEKVD
                     DDTTGLSDAGKSRANCIADIFSQSSMKPDFIMAQDYKSNGKRIRPYDTVKPLADKMGL
                     AVDHSCDRDDEDCAADLIKRAAKNGARRILVCWEHKVLSDIAHKLGVDDLDYPSDRFD
                     IVFQMYNGEMQRIFSEECPGLDDKFQGWTGNKDSDLIDDDDWADGAGH"
     gene            complement(<331334..>332599)
                     /locus_tag="MRET_3544"
                     /note="MRES_14245"
                     /db_xref="GeneID:38740310"
     mRNA            complement(<331334..>332599)
                     /locus_tag="MRET_3544"
                     /product="golgi matrix protein"
                     /transcript_id="XM_027630171.1"
                     /db_xref="GeneID:38740310"
     CDS             complement(331334..332599)
                     /locus_tag="MRET_3544"
                     /codon_start=1
                     /product="golgi matrix protein"
                     /protein_id="XP_027486097.1"
                     /db_xref="GeneID:38740310"
                     /translation="MADASKEAQDIHQSPDADVNGSEQVDTISERLRQLDVHEPMRLK
                     EEILRLQDERDALEEQYTSLLEKLSQMRMTLGDRLQQDAEELDRRDQQIEQLTQQVSD
                     LEARIHTLKEELGVSNDEARQLTHELEQMRAQLSNTTQKETAELHRLESRCRDLENKV
                     HAHRVDVDRLETVCIEERSLKEECQVRARHVSETLDHARLRIGELEAAVEQEKQVARQ
                     MQLTLEELQHAQDDGMQRSVSELQQQVDEAESEVEKYKLQVHSMESIVDEAQQATSKC
                     RDLEQELKEKHLLIGKLRHEAVILNEHLKHALGRLRRDSPEDYIDRRLISNLLLQFLS
                     TPRADTKRYEMLRLIASILQWDDTEREKAGLQRQLDRSQSSSYGFWGFGGRDTRSPRD
                     TEGDESVSNLFVEFLLSEVERGKTDRAPS"
     gene            <333109..>333471
                     /locus_tag="MRET_3545"
                     /note="MRES_14250"
                     /db_xref="GeneID:38740311"
     mRNA            <333109..>333471
                     /locus_tag="MRET_3545"
                     /product="small subunit ribosomal protein S20e"
                     /transcript_id="XM_027630172.1"
                     /db_xref="GeneID:38740311"
     CDS             333109..333471
                     /locus_tag="MRET_3545"
                     /codon_start=1
                     /product="small subunit ribosomal protein S20e"
                     /protein_id="XP_027486096.1"
                     /db_xref="GeneID:38740311"
                     /translation="MSYVAKDKEVDAPAPVKLHKIRITLTSRNVKSLEKMSNDLVNRS
                     KDKKLHVKGPVRLPTKVLSHTTRKSPCGEGSKTWDHYEMRIHKRLVDLHSPSEIVKQI
                     TSTALEPGVDVEITILSN"
     gene            complement(<333788..>334231)
                     /locus_tag="MRET_3546"
                     /note="MRES_14255"
                     /db_xref="GeneID:38740312"
     mRNA            complement(<333788..>334231)
                     /locus_tag="MRET_3546"
                     /product="large subunit ribosomal protein L27Ae"
                     /transcript_id="XM_027630173.1"
                     /db_xref="GeneID:38740312"
     CDS             complement(333788..334231)
                     /locus_tag="MRET_3546"
                     /codon_start=1
                     /product="large subunit ribosomal protein L27Ae"
                     /protein_id="XP_027485821.1"
                     /db_xref="GeneID:38740312"
                     /translation="MPTRFHKNRKSRGNVSAGHGRIGKHRKHPGGRGLAGGFHHHRTN
                     FDKYHPGYFGKVGMRHFHLMRNPQHKPIINLDKLWTLVPAEVRRNTTASSTEVPVIDT
                     LGAGYGKVLGKGRLPELPVIVKARWVSALAEKKIKEVGGVVKLVA"
     gene            <334611..>336240
                     /locus_tag="MRET_3547"
                     /note="MRES_14260"
                     /db_xref="GeneID:38740313"
     mRNA            join(<334611..334631,334672..>336240)
                     /locus_tag="MRET_3547"
                     /product="ariadne-1"
                     /transcript_id="XM_027630174.1"
                     /db_xref="GeneID:38740313"
     CDS             join(334611..334631,334672..336240)
                     /locus_tag="MRET_3547"
                     /codon_start=1
                     /product="ariadne-1"
                     /protein_id="XP_027486179.1"
                     /db_xref="GeneID:38740313"
                     /translation="MEQDPNFTYDGFDSTDGYAESADLDDMSVGSDQVLDEEDEDVYG
                     DMDVLSDDMALEQSVVDVRKKPYDVEYRCLTIDDIETAQRKESEHIAGMFMVSTADAA
                     VLLRHFQWNKEKLIERYMDEPDEIKWEAGVPDRDSCPRMLDLPDFTCDICFMSADDYG
                     GLISTLSMPCGHRYCKSCYTHYVEQKVREEGESRRIQCMHEKCKLVIDEDTMSQLLSP
                     ELMHRYRILLDRTYVDDNPHVRWCPAPDCDMAVECAVTRKQLYTIIPTVRCNCGHAFC
                     FGCGLDGHQPVICAVVRLWLKKCADDSETSNWIGANTKECPKCCSTIEKNGGCNHMTC
                     RKCKYEFCWICSGPWSEHGNNYYNCNRYDEKAGAEARDAQTRSRLSLERYLHYFNRYR
                     NHEQSARLDWKLYLKIEKKMEELQQTTSLTWIEVQFLKKAADTLTECRSTLKWTYCMI
                     YYLQRNNMTELYEDNQRDLERAVEELSGQLESPIEQETIPAMRQKVTDLTAYVHKRRE
                     ILLTDTIAGYQEDRWQWNVPI"
     gene            <336400..>337468
                     /locus_tag="MRET_3548"
                     /db_xref="GeneID:38740314"
     mRNA            join(<336400..336486,336525..336556,336589..>337468)
                     /locus_tag="MRET_3548"
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /transcript_id="XM_027630175.1"
                     /db_xref="GeneID:38740314"
     CDS             join(336400..336486,336525..336556,336589..337468)
                     /locus_tag="MRET_3548"
                     /codon_start=1
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="XP_027486099.1"
                     /db_xref="GeneID:38740314"
                     /translation="MFATVGARTLAGSRTVARTAAITRAFSTSMSRNEVKNVTVFGAG
                     LMGAGIAQVLADVGKYNVTLADVTDKALANGQGIIAKSLSRIAKKKMADKSPEEQEQF
                     VKSVVDSIHVTTDAAKAVESTDLVIEAIIENMKIKKELFSFLDSKAPAGAIFASNTSS
                     LSISEVASATKREDRFGGFHAFNPVPQMKLIEIVRTSHTSPETHETLVEVAKRMGKVP
                     VSCKDSPGFIVNRLLVPYQLEALRLVERGVASPEDVDTAMKLGAGYPMGPFELADLVG
                     LDTMEHIAQGWRESVAGTEDMPADLVKESPMLKQLISEGRLGRKTPEKGGFYQYKK"
     gene            complement(<337497..>338246)
                     /locus_tag="MRET_3549"
                     /note="MRES_14265"
                     /db_xref="GeneID:38740315"
     mRNA            complement(<337497..>338246)
                     /locus_tag="MRET_3549"
                     /product="dolichol-phosphate mannosyltransferase"
                     /transcript_id="XM_027630176.1"
                     /db_xref="GeneID:38740315"
     CDS             complement(337497..338246)
                     /locus_tag="MRET_3549"
                     /codon_start=1
                     /product="dolichol-phosphate mannosyltransferase"
                     /protein_id="XP_027486098.1"
                     /db_xref="GeneID:38740315"
                     /translation="MSQGVVMGSTHKYSVILPTYNERHNLPIIVFLLCRMFQAHNLDY
                     EIVIVDDNSPDGTQDIARQLAALYGPERIVLRPRAGKLGLGTAYIHGLEACTGDFVII
                     MDADFSHHPKFIPNMITKQLNTNADIVQGTRYSGPATGAGVYGWDLKRKLVSRGANVL
                     ATFVLDPRTTDVTGSFRLYKRPVIDTLIRQVTSKGYVFQMEILVRAKALHYKVEEVPI
                     TFCDRLYGESKLGGDEIVGYAKGVWQLFTGI"
     gene            <338362..>339846
                     /locus_tag="MRET_3550"
                     /note="MRES_14270"
                     /db_xref="GeneID:38740316"
     mRNA            <338362..>339846
                     /locus_tag="MRET_3550"
                     /product="WD repeat and SOF domain protein 1"
                     /transcript_id="XM_027630177.1"
                     /db_xref="GeneID:38740316"
     CDS             338362..339846
                     /locus_tag="MRET_3550"
                     /codon_start=1
                     /product="WD repeat and SOF domain protein 1"
                     /protein_id="XP_027486136.1"
                     /db_xref="GeneID:38740316"
                     /translation="MKIKALTRSVDDHAPARLGDAAPVQRNLNPNMHPFEKPREYTRA
                     LNAAKLDRLYAKPFVAAFEGHIDGVYSMARHPKRLDVIASGSGDGEIRLWDVNHQRCT
                     YTYPRAHAGIIQSLCISPLTFHGGGASKRMLSCSTDRTIKVWNADPVPDGFGEYEEFR
                     PADDDEEDSDDEASGARDAHLFSLQPTNSTPKEPLTVYQGKTAFHSLSHHAHLPRFAS
                     ASSTVQVWDLNRGGGSDALVNMAMGVDAVHVVRYNQSETDVLASAGTDRGVTLYDIRS
                     GKPLHKVVLTMRANDLAWSPVEPTTLAVASEDHNMYTFDMRNMSSATQIYKGHVGAVM
                     SVDWAPTGQSLVTGSYDRTVRLWDAGKGARSRDVYHTKRMQKVFTTMYTLDARFVLSG
                     SDDGNVRLWKHGASDKLGIVNARERASREYAQALRKRWHTVGDVAKIERQRHVPKPIR
                     TAQKLSHTMTEARRVKNDRRRKHTKSGAKKPTAARKSVIVEEKS"
     gene            <339860..>341092
                     /locus_tag="MRET_3551"
                     /db_xref="GeneID:38740317"
     mRNA            <339860..>341092
                     /locus_tag="MRET_3551"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630178.1"
                     /db_xref="GeneID:38740317"
     CDS             339860..341092
                     /locus_tag="MRET_3551"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486137.1"
                     /db_xref="GeneID:38740317"
                     /translation="MAPKAFIDQLPLATRYAHFYVDVRIHELLNVPVTTGDFCVVYKV
                     KHAVHLSRRAPQGDDAVPSPQSDAGSSSSSVMASSASLDDAASAREGLRIDTRVQDEV
                     VKRPWYMYSSPSSRSSSTHKLMTHQTPYEPIRAYKVKWDASIQTNIRIGIHRHLIRSR
                     EEEAGQLHSSFLLLTVYWRRPEDDDQRHRFGQIKINLAEYAPSTHGQRTELRQYLLGK
                     CACNALLRLSIHMHRVDATHAYRVPRIQQGIHDPTSAHHDDVPSPPPASSSSNAPTAP
                     DTDPNHGLEWHFKLPMPLLYNYMVIPPEHIEPGTRAPLFDDDILADLPDPSSGDEDNA
                     STTSAKSHHPGSRARMRWKRIMESVAGARRAPTDRREALRSYARSEASRQGRPSSPSH
                     RRTRAASDSDQHSPIPSS"
     gene            complement(<341096..>342286)
                     /locus_tag="MRET_3552"
                     /note="MRES_14275"
                     /db_xref="GeneID:38740318"
     mRNA            complement(<341096..>342286)
                     /locus_tag="MRET_3552"
                     /product="ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_027630179.1"
                     /db_xref="GeneID:38740318"
     CDS             complement(341096..342286)
                     /locus_tag="MRET_3552"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_027485926.1"
                     /db_xref="GeneID:38740318"
                     /translation="MSTLADIKVFCGSSHPELAHLICKRLGVPLGRSSVSKNDAGELM
                     VRMYESVREHDVYIINTSCVTYGNDGQVISPNTSLMELLIMINACKTASARRVTAVIP
                     HFFYARQDKKDKSRAPISARLIANMLETAGCDHVITMDLHASQIQGFFNVPVDNLYSE
                     PAALQYMREMLDIDRVVIVSPDAGGAKRATAIADQLGVDFALFHKERKKANEVSRMVL
                     VGDAKDKVAVLVDDMADTCGTLDLAAQRLKESGAARVCAIVTHGILSKPALERIAKSS
                     LESLVVTNTLPQSNNKLQCSKIEEIDISHILAETIRRSHYGESVSVLFSQVPYDTVQP
                     YRHGADTPSHSPPRSAASSPMPPQMSDSVLDKRLGILHSADKDTHAATVPSPLRNVSS
                     EKDL"
     gene            complement(<342438..>342843)
                     /locus_tag="MRET_3553"
                     /note="MRES_14280"
                     /db_xref="GeneID:38740319"
     mRNA            complement(join(<342438..342697,342726..342802,
                     342830..>342843))
                     /locus_tag="MRET_3553"
                     /product="small nuclear ribonucleoprotein D1"
                     /transcript_id="XM_027630180.1"
                     /db_xref="GeneID:38740319"
     CDS             complement(join(342438..342697,342726..342802,
                     342830..342843))
                     /locus_tag="MRET_3553"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein D1"
                     /protein_id="XP_027485863.1"
                     /db_xref="GeneID:38740319"
                     /translation="MKLVRFLMKLNNESVTIELKNGTVVHGTVTGVDVQMNTHLKAVK
                     MTVRGGEPMSLDTLSIRGNNTRYWILPDALPLDTLLVDDAPRPKGKRRDDASARGRAD
                     RGRGGRGGRGRGRP"
     gene            <342959..>344497
                     /locus_tag="MRET_3554"
                     /note="MRES_14285"
                     /db_xref="GeneID:38740320"
     mRNA            <342959..>344497
                     /locus_tag="MRET_3554"
                     /product="exonuclease 1"
                     /transcript_id="XM_027630181.1"
                     /db_xref="GeneID:38740320"
     CDS             342959..344497
                     /locus_tag="MRET_3554"
                     /codon_start=1
                     /product="exonuclease 1"
                     /protein_id="XP_027486140.1"
                     /db_xref="GeneID:38740320"
                     /translation="MGISGLLPLLKDIQHSTHVEAYRGKTLGIDAYVWLHRGAYACAT
                     DLALGRPTTRFITYAMHRIRMLQHYGVKPYVVFDGAQLPSKAGTERERAARRREHRMR
                     GLQFHAEKRASAARDAFVRSVDITPALAYELIKQLRVHGIPYLVAPYEADAQLAYLER
                     HGIIDAIITEDSDLLVFGCNKVLFKLDTYGNCLEIDRARFDKVKQLSFEGWTHQEFRQ
                     MAILSGCDYLPSITGMGLKNAHKFLRKYESVEKVLRALRLEGKWRIPPTYAADFERAE
                     FTFAHQRVFDPRCSDMSTLTPLPSDARADLVAAIGAPLSVEEARAIARGDLCPITRRH
                     FVQQVMTPSQPTLRTFFGAATAPCKTPPSVRADSSSSTATTASSLFDAPPSSSPCTSP
                     APSDKEDSDPCVSSPVSSPSPPRPAHSTPQTTPGLAWHAATPDDDMARRSAWFQRFKY
                     SGARARHIVLPGTSPHTSTPRLALGKRACPTPTSPSKRPAMDTPSRVHNGSAKLLQFQ
                     YRES"
     gene            complement(<344501..>344923)
                     /locus_tag="MRET_3555"
                     /note="MRES_14290"
                     /db_xref="GeneID:38740321"
     mRNA            complement(<344501..>344923)
                     /locus_tag="MRET_3555"
                     /product="HCNGP-like protein"
                     /transcript_id="XM_027630182.1"
                     /db_xref="GeneID:38740321"
     CDS             complement(344501..344923)
                     /locus_tag="MRET_3555"
                     /codon_start=1
                     /product="HCNGP-like protein"
                     /protein_id="XP_027486141.1"
                     /db_xref="GeneID:38740321"
                     /translation="MSHDDSGPQCHLEASVPPFLRPPPRSDADPTWGLGTETTAEADP
                     ALQSKLAHFHDLKARDIHVNEALARNRAFHNPHISAKLVEWTGIDEYGSHHARGTRPK
                     DVADEFARQHGSPSALAEAQRRDIEERRRQRTRIDFTR"
     gene            complement(<344950..>345431)
                     /locus_tag="MRET_3556"
                     /note="MRES_14295"
                     /db_xref="GeneID:38740322"
     mRNA            complement(join(<344950..345219,345246..>345431))
                     /locus_tag="MRET_3556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630183.1"
                     /db_xref="GeneID:38740322"
     CDS             complement(join(344950..345219,345246..345431))
                     /locus_tag="MRET_3556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486138.1"
                     /db_xref="GeneID:38740322"
                     /translation="MAAPVVDASWERVDAFEPPPMEQEGAWELVEDTSELIVLDLAQA
                     ESASSQAPTAPGTDVVLTGLETPTPMIKVGDTVMLGVHDELLGSEMVLERTADALTPL
                     GPLDGSRPSGASSTSTRRITFTPARRTTHQVPAPEVEEEDMPLAWQAPV"
     gene            <345616..>347052
                     /locus_tag="MRET_3557"
                     /note="MRES_14300"
                     /db_xref="GeneID:38740323"
     mRNA            <345616..>347052
                     /locus_tag="MRET_3557"
                     /product="UDP-glucose 6-dehydrogenase"
                     /transcript_id="XM_027630184.1"
                     /db_xref="GeneID:38740323"
     CDS             345616..347052
                     /locus_tag="MRET_3557"
                     /codon_start=1
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="XP_027486139.1"
                     /db_xref="GeneID:38740323"
                     /translation="MVPDKVTSICCIGAGYVGGPTCSIIAQQCPEIKVTIVDVNTQRI
                     AQWNSEDFRQLPVFEPGLVDVVRECRGRNLFFTTDIDGAIEEAQIVFVSVNTPTKTSG
                     VGSGYAADLRYVEASTRRIASVAKTSKIIVEKSTVPCRTAASMRAILESNCKPGVEFQ
                     ILSNPEFLSEGTAIQDLLNPDRVLIGNLDTPAGRKAAQLLSGLYHHWVPEERILHTGL
                     WSSELSKLAANALLAQRISSINAISAICEATGANVDEVAHACGLDRRIGPHFLRASVG
                     FGGSCFQKDILNLSYLSESLGLPQVAEYWRQVITMNEFSKSRFAKKVVQTLFNTVTAK
                     RLALLGFAFKKDTGDTRESPAISLCKHFREEGAHVAIYDPKVKREQIYLDLSEPGVVD
                     DRRALEDAISVCPTALDACHDAEAVVIATDWDEFKQIDWSLVYNVMRKPAVIFDGRRV
                     LNIAELKKIGFKVHSVGQGPELQDNVWV"
     gene            <347176..>348705
                     /locus_tag="MRET_3558"
                     /note="MRES_14305"
                     /db_xref="GeneID:38740324"
     mRNA            <347176..>348705
                     /locus_tag="MRET_3558"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630185.1"
                     /db_xref="GeneID:38740324"
     CDS             347176..348705
                     /locus_tag="MRET_3558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485927.1"
                     /db_xref="GeneID:38740324"
                     /translation="MSETSRGADAPIQPARRENIVLPHFEDSLERPPRVWLPRTGVWG
                     QTKYLMSGLLPGARRVPRELPKQSESGSSVPHLHKLHEQTMPRMYRLLGNTRLAHLRG
                     YRQASKIVVIGVHGWYAQSILKNIIGVPIGTSALFASMMSESIRRKYEEAGVHLSPDA
                     ITEIAIQHDGCVRDRADAFLAAIAQNAKWVNALREAEAVFVVAHSQGAIVSTFLLAHL
                     LDKGLVNPERARLCQLTMCGIFQGPFLHVKNMMTSSYLSYFETDAARELFDFQASDSV
                     VSIAHRAAYRRILAAGVKCVHIGSVDDNVVPLYSALFSCAAHPSILRAVYVDGIAFPQ
                     KDFLIMLIALCVLIRNCGFHDHNLLTLLSASVAGPLYTGQGHTNLYLEPRVYDMATQY
                     LFETYSPKSSGASEVPLVGMPYAPQRWNSYELPWSLRGLLEDSVIRHFFMKDIRIMIK
                     DYAAWTPTSKKLKDLQRRLAPMSTVRVPTEPSDMKDEPSDADEDDPFLPAMVLHPRAK
                     L"
     gene            complement(<348724..>349743)
                     /locus_tag="MRET_3559"
                     /note="MRES_14310"
                     /db_xref="GeneID:38740325"
     mRNA            complement(<348724..>349743)
                     /locus_tag="MRET_3559"
                     /product="ribosome biogenesis protein UTP30"
                     /transcript_id="XM_027630186.1"
                     /db_xref="GeneID:38740325"
     CDS             complement(348724..349743)
                     /locus_tag="MRET_3559"
                     /codon_start=1
                     /product="ribosome biogenesis protein UTP30"
                     /protein_id="XP_027485947.1"
                     /db_xref="GeneID:38740325"
                     /translation="MPPTRAGTKRVAKEPAKKRTEGKEPAPKRSKAQNVAPTLISDRV
                     DAAQVLKACKALAAYTERRRQGGGENELPIGPSVSKDTDHTVFLQITVKQLDTKRKVK
                     PARIPLAHPLLDADASVCLLTKDPQREYKDLLMEKSITTVNRVVGVEKLKGKFRPFDA
                     RRQLVRDHDLFLADERIVAMLPKLCGSVFYKDRKFPVPIDLTNKKHLAETIDRAIAST
                     YYLQNKGSCSTVKVGFLHRHTPAELVENVALALPSIVSRIPGKWANVQNVELKTGKSA
                     ALPIWNCRLSEGEGDGVRWTLSADDRADDDDQEEEDNDEEEDNGDKEEAETAPKPKSG
                     KRRAK"
     gene            <349866..>350399
                     /locus_tag="MRET_3560"
                     /note="MRES_14315"
                     /db_xref="GeneID:38740326"
     mRNA            <349866..>350399
                     /locus_tag="MRET_3560"
                     /product="ER membrane DUF1077 domain protein"
                     /transcript_id="XM_027630187.1"
                     /db_xref="GeneID:38740326"
     CDS             349866..350399
                     /locus_tag="MRET_3560"
                     /codon_start=1
                     /product="ER membrane DUF1077 domain protein"
                     /protein_id="XP_027486091.1"
                     /db_xref="GeneID:38740326"
                     /translation="MSSSPLSSWSVRYDSIEPSVTKLSAIPDALIGYMDPKTMSKYEH
                     SSSKKVGVVETSGIQQAKAWELAMSPAKTLPMNMMMMWMSGSSVQIFSMMVVAMMITN
                     PLKGITSMNHAFAPYRSPTHSLLPQMIVFVLCHLMGVALGVYKCWNMGLLPTESSDWL
                     AWYEAPIPLEVSASLAM"
     gene            complement(<350405..>350864)
                     /locus_tag="MRET_3561"
                     /db_xref="GeneID:38740327"
     mRNA            complement(join(<350405..350767,350793..>350864))
                     /locus_tag="MRET_3561"
                     /product="cytochrome c oxidase subunit 20"
                     /transcript_id="XM_027630188.1"
                     /db_xref="GeneID:38740327"
     CDS             complement(join(350405..350767,350793..350864))
                     /locus_tag="MRET_3561"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 20"
                     /protein_id="XP_027486177.1"
                     /db_xref="GeneID:38740327"
                     /translation="MATRGWTPSMTEATPSRLVDIPLETTKKPSYTDALRQFSLTNEL
                     QRLPHVPCARTTLLMGMATGAAVGTIQVIFGRGIMRSMNWAVGSFVCISVLGWYVVCS
                     SPAGRHVVDRTRPSRRACMTLLYSTKSDWKVVVTMYRHLNQA"
     gene            <351007..>352754
                     /locus_tag="MRET_3562"
                     /note="MRES_14320"
                     /db_xref="GeneID:38740328"
     mRNA            join(<351007..351151,351184..>352754)
                     /locus_tag="MRET_3562"
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /transcript_id="XM_027630189.1"
                     /db_xref="GeneID:38740328"
     CDS             join(351007..351151,351184..352754)
                     /locus_tag="MRET_3562"
                     /codon_start=1
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="XP_027486176.1"
                     /db_xref="GeneID:38740328"
                     /translation="MEPVPDHNVKNVLVLGGSYGGSHAAMVLARKLPPTHRVILIERN
                     THFNHLYVFPRYNIVPGHEHKAFIPYTSIFSDAPVRGRRLKKAASSGPDRVATQSKED
                     ESASQARGDTHAIFMNVSDLISNNLHVGSAQAHKPTATADPNEEDVASDPYAYAEPHL
                     VVCGQVERIRDSYVTVKQNPSDSSAKHPLWSLDTIDIPYTHLVYALGSHMPDPLRHET
                     YTKKEGIAWMKVNQKRIDASRDIIIIGGGALGVEMATDIASQCKKRGTSKNITLIHSR
                     QQLLPNFDVRIHEIVHKELLDLGVHVVLGHRLATAEGCPLGSNIRQIADTSMASDVPK
                     DTMDTIASAPRQQVRTTLGLELECDLLLMCTGQHPNSEIMAEFSPGSVNPDSRLVRVL
                     PSLQVMQPTPEEAVPQPFSMVPPCIDCDCFLDKKSEGLHRTVGEGHSMPPHFKNIYAI
                     GDVADAFGALNAGYQAWFMAEVAAENILRDILRVRSTKESDDGPLAPTDTIPLDSFKP
                     GPPLLKLSIGLDKLLVQGAPERDTSVPGEPVRPTITMNAKQSEDMEPTHAWRMALADT
                     SDLHA"
     gene            complement(<352941..>353510)
                     /locus_tag="MRET_3563"
                     /note="MRES_14325"
                     /db_xref="GeneID:38740329"
     mRNA            complement(join(<352941..352995,353039..353097,
                     353139..353420,353508..>353510))
                     /locus_tag="MRET_3563"
                     /product="small subunit ribosomal protein S24e"
                     /transcript_id="XM_027630190.1"
                     /db_xref="GeneID:38740329"
     CDS             complement(join(352941..352995,353039..353097,
                     353139..353420,353508..353510))
                     /locus_tag="MRET_3563"
                     /codon_start=1
                     /product="small subunit ribosomal protein S24e"
                     /protein_id="XP_027486175.1"
                     /db_xref="GeneID:38740329"
                     /translation="MDPNSPITLRTRKFISNRLLQRRQMVLEVIHPARPNVSRSELQE
                     KVGELYKTPKEQVSVFGMRTHFGGGRSTGFALVYDSKDAVQRFEPTYRLVRNGIVPKV
                     EKPSRKLRKERKNRGKKVRGTKKAGGDKKK"
     gene            complement(<353910..>354274)
                     /locus_tag="MRET_3564"
                     /db_xref="GeneID:38740330"
     mRNA            complement(join(<353910..353930,353974..354027,
                     354065..>354274))
                     /locus_tag="MRET_3564"
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /transcript_id="XM_027630191.1"
                     /db_xref="GeneID:38740330"
     CDS             complement(join(353910..353930,353974..354027,
                     354065..354274))
                     /locus_tag="MRET_3564"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /protein_id="XP_027486174.1"
                     /db_xref="GeneID:38740330"
                     /translation="MADIGAGIHEPFDLIRFSLSEPVLVKLRGDREMRGILHAYDGHM
                     NLMLGDVEETIYEVHVEEDTGAETVKAIKRNSDMMFVRGDGVILVSPPKM"
     gene            <354399..>355385
                     /locus_tag="MRET_3565"
                     /db_xref="GeneID:38740331"
     mRNA            <354399..>355385
                     /locus_tag="MRET_3565"
                     /product="large subunit ribosomal protein L5"
                     /transcript_id="XM_027630192.1"
                     /db_xref="GeneID:38740331"
     CDS             354399..355385
                     /locus_tag="MRET_3565"
                     /codon_start=1
                     /product="large subunit ribosomal protein L5"
                     /protein_id="XP_027486173.1"
                     /db_xref="GeneID:38740331"
                     /translation="MLRACLGHGAPSSIMRRGIHMSRMAHLDYVPSRNQLPWPPLVVG
                     EMQKSRLREHYERTLAADMMYMMYEPTGPSASSKDSPGDGTNDRSRRWSNDSPYHANR
                     PARAQLGNRPLVPLHKPLSMSRHIEHDIPRIDRIIFTAFCREAITNKQALLPLLGQMR
                     AITGLPVLGSLADPAAGSSPETAGPSARYGYLQVLRAKQGAASFRLRAGMPVGVQAVM
                     YDDVAYEFIETLTTFVLPRLRGFAGLPLPPATQPLLSPAAVSGVVTFGMGPEAMPLFP
                     QVEVNLDQYPGRRYGFQVDCVTNQRGRRATERARTLLSGLGLPFVRRGTVAL"
     gene            <355446..>356894
                     /locus_tag="MRET_3566"
                     /note="MRES_14330"
                     /db_xref="GeneID:38740332"
     mRNA            <355446..>356894
                     /locus_tag="MRET_3566"
                     /product="DNA damage-responsive protein"
                     /transcript_id="XM_027630193.1"
                     /db_xref="GeneID:38740332"
     CDS             355446..356894
                     /locus_tag="MRET_3566"
                     /codon_start=1
                     /product="DNA damage-responsive protein"
                     /protein_id="XP_027485904.1"
                     /db_xref="GeneID:38740332"
                     /translation="MAVCQFFLQGRCRFGSHCRNEHPAQARTSAFGEPSTFSAFGSKA
                     KTTSAPEPEIVLTKEGISTDMGAQGRPIWHLSCYAPARGEPNLIEGVDVSPDEDRVLA
                     YQAKQSGQEAAYLQHVQTQTLSAEQMYQNASMHPQNALQKAIANRQQYKQTLQPAMPA
                     FGAASSSASAFGSAAQPPSSAFGAAAPPSAFGAPSAFGSQPSAFGSVGKPSAFGQPSA
                     FGQPSAFGAAAKPSAFGQASAFGQASTFGQPAAFGQPSAFGRAAQTSSFGSTSQPSAF
                     GAAAKPSAFGTPSAFGTASTPSAFGQPSAFGSTAAPSAFGKAAAPSAFGSSAQPSAFA
                     SAAKPSAFGQPSAFGQPSAFGQPSAFGQPSAFGQPSAFGQPSAFGASAPSSASGSSSQ
                     PSAFGAPSAPGPASVPPSAFGQAPAFGTPSTQASVPPPASAPVTQAHTDVFDDQRIES
                     QALPDDVRACFEADHFVWGHIPAVEPPVAFCT"
     gene            complement(<356908..>359601)
                     /locus_tag="MRET_3567"
                     /note="MRES_14335"
                     /db_xref="GeneID:38740333"
     mRNA            complement(<356908..>359601)
                     /locus_tag="MRET_3567"
                     /product="vacuolar protein sorting-associated protein 41"
                     /transcript_id="XM_027630194.1"
                     /db_xref="GeneID:38740333"
     CDS             complement(356908..359601)
                     /locus_tag="MRET_3567"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 41"
                     /protein_id="XP_027485902.1"
                     /db_xref="GeneID:38740333"
                     /translation="MGLDDRSHDEDALSTTSSDTHEPAFHEEHMQASVRDMTVRDSIS
                     AMAVSRSHVALGMQSGMMYIVSLEGHLEKGFRFHTAPILDLVFDATGEFVASAGMDGI
                     AAIASLTTSEQYQFDARRPLRVIRLEPHFASRSSRAFVCGGMSGVLTYREKRWFGHRD
                     VVLHSDEGPIWALAWRGRWLAWANDRGVRVAHAQTHEMITLMPTPDDAPRPELARCTL
                     AWRDASTLVVAHGDRITIARICEASDSHFVEVTDILQLDCLVAEMACTPQSMFILACV
                     EYDDGVAPELRCVSWQGEELSSDALDMQRSRCMNDWHMCMAQEVRYDPLRQHDMRRPV
                     LYVASPRQLSVLRPRDERDHIAWLLARRAYRQALEALEALGSAPAAALGYDVAAIGRE
                     YLWYLMEERGAYAEAAALMPLLLRTDRGAWDTFVCCYLERHQVDAILPHIPTQDPQLS
                     EMVYDLVLVHLLQHDPTQLLATLRAWPSHIYSKQAVAAAIGDHARNSRTLLECLAQLY
                     MAAHQPGKALTYYMRLRDPCVFDLIREYDLLIDVQHHIGTLVELDQECAGSTEPRSSA
                     LMPLLVPYTHSIPIQRAMAQLEPYPWYAYLYLDALYERDPSLVTHYAMDLLRLYCRFD
                     YARLMPFLRTMSSAYSLKDAYDVCETYSYVPEMVFLRGRTGDVVGALQLILERLQHVD
                     MALDFVRQQDDAELWDTLLAYSQDKPAYIRGLLEQASGEIDPVRIIRPIQDGLEIPGL
                     RPSLIKIFHNFHAQHALLGVGLAVLQRDAYERLAEYDTACQAALVCDARTLCTVCLQP
                     LLAAAVPIVLFLCRLHAAHLTCVTSASMPPLPPAVFAPVHETTTQQYRRTRATTDLTR
                     SPGRIAQERADRRAWLYARQARRLVRGCPACAEAQRDRLAD"
     gene            complement(<359693..>360290)
                     /locus_tag="MRET_3568"
                     /note="MRES_14340"
                     /db_xref="GeneID:38740334"
     mRNA            complement(join(<359693..359752,359842..359983,
                     360009..360158,360193..360205,360278..>360290))
                     /locus_tag="MRET_3568"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 13"
                     /transcript_id="XM_027630195.1"
                     /db_xref="GeneID:38740334"
     CDS             complement(join(359693..359752,359842..359983,
                     360009..360158,360193..360205,360278..360290))
                     /locus_tag="MRET_3568"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 13"
                     /protein_id="XP_027485921.1"
                     /db_xref="GeneID:38740334"
                     /translation="MSEGITYKQDLPPQGGYAPIRYKRNLPARGPSGVMLMLSAVGIT
                     AFGFWRLGLGNVERRELARERAWSRIYLAPLLLAEADRDAYRRDRASELREKKLMKDV
                     PGWEAGKSVYNSKRYTPSSFVVM"
     gene            <360433..>363175
                     /locus_tag="MRET_3569"
                     /note="MRES_14345"
                     /db_xref="GeneID:38740335"
     mRNA            join(<360433..361000,361140..>363175)
                     /locus_tag="MRET_3569"
                     /product="nucleolar protein 14"
                     /transcript_id="XM_027630196.1"
                     /db_xref="GeneID:38740335"
     CDS             join(360433..361000,361140..363175)
                     /locus_tag="MRET_3569"
                     /codon_start=1
                     /product="nucleolar protein 14"
                     /protein_id="XP_027486092.1"
                     /db_xref="GeneID:38740335"
                     /translation="MAASKKGTGGSQLAQLRSGLRAAGVTGPKPKKGKRHDAEDSRVG
                     QYRAQQRRKRLESLMTNLNTFDERVSHSKNQAIGTKTKGAVGRPADAKSASLQQRRAK
                     LLPEYDRRHKSSSFVDRRFGEYNPSISLEDKMLKRFTEERMNRAPKTSMFDLNDDDAE
                     LGLTHFGQSLSGLDEMPDVPPEDDDDDDPGHIDAQVTNDEHFAGFDDAPRSKHEVMKD
                     VIAKSKLAKYERQKAKDADEELRMELDEELGDIRSLLFQRPEQPTETPAAEPDKGDTY
                     DAFVREMAYERRAKPQDRLKSAEELAEEQAKRLQEAESARLRRMRGEENDEGEPLLDY
                     AMDDDDDEKEPSEPRTMRSKFGLGQGLDKEDEDDEEMSLKDDEMGEHTDLSEDEDVDQ
                     AANEVDTPKEPVPSLPFTFSCPSSHDALLDLLDEHRIEPSQIHTVVSRIRTLHAPNLA
                     EENPVKLQRFLGALVDHVLYRAGQQDTKADDLRVINDLVLHIYELARAYPLRAAEHFV
                     AKISLMQHNLMRGLALGALDPNARTWPRLSELAFLRMCVLLWPTSDKWHAVATPMHLL
                     MAQYLAHARIRSLRDMASGLYLCSLVSSAQRESRRIVPEALNALFNIAAMLLPLHHGK
                     SMHGRSPVKALAEEFGIPTPDFEAPHTLPFTIQSDAVPREKMSLLCVDSCSLSTQHQA
                     DLLHMCTQLMQSLAHLYQHSPAYVELFTPLLFLLEIGEAGLKDVAPSLVPCVHTATTD
                     VRSLLERAYATRRALRLQAHRALSISSYAPKFDQQSFDPSRATDPDTERAQAAKLRAM
                     LKKERKGAIRELRKDAQFLAEERDQRRVAEDTAYKKKMDKIVGGIQEERSEQKQLDRA
                     KALIKKRAGKK"
     gene            <363215..>364081
                     /locus_tag="MRET_3570"
                     /note="MRES_14350"
                     /db_xref="GeneID:38740336"
     mRNA            <363215..>364081
                     /locus_tag="MRET_3570"
                     /product="DCN1-like protein 1/2"
                     /transcript_id="XM_027630197.1"
                     /db_xref="GeneID:38740336"
     CDS             363215..364081
                     /locus_tag="MRET_3570"
                     /codon_start=1
                     /product="DCN1-like protein 1/2"
                     /protein_id="XP_027485805.1"
                     /db_xref="GeneID:38740336"
                     /translation="MSRVSRSQGLKRFCELTGASDNAAYPYLHHANYNVDHALAMYLN
                     EVYGVTDVPLLTPQQEKAARKELGALFDKYRDADDDTISSEGALRMLSDLDIDPASVN
                     VLPLSYYLDSPGLGQFTRAGYVHGWIRLNVCVSSTDHVLAQQKDAFARVMQAFATDGP
                     VRPPYMGLASFATALRLTPKKGLYTTVYEYTFAFAREEQQKNVPLDTAITLWDLLLPH
                     APSSSFSTKQYELWKRFLKEASHLQVISKDTWTQFLEFTREIDGTFSNHDFEAAWPSI
                     IDEFVAWVRKQI"
     gene            complement(<364118..>364415)
                     /locus_tag="MRET_3571"
                     /db_xref="GeneID:38740337"
     mRNA            complement(join(<364118..364225,364251..364376,
                     364410..>364415))
                     /locus_tag="MRET_3571"
                     /product="small nuclear ribonucleoprotein F"
                     /transcript_id="XM_027630198.1"
                     /db_xref="GeneID:38740337"
     CDS             complement(join(364118..364225,364251..364376,
                     364410..364415))
                     /locus_tag="MRET_3571"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein F"
                     /protein_id="XP_027485806.1"
                     /db_xref="GeneID:38740337"
                     /translation="MPDIPLNPKPFLQNQIGKKVIIRLKWGLEYKGFLVSTDNYMNFQ
                     LANTEEIQDGNSNGTLGEVFIRCNNVLYLRELNEE"
     gene            <364614..>366323
                     /locus_tag="MRET_3572"
                     /note="MRES_14355"
                     /db_xref="GeneID:38740338"
     mRNA            <364614..>366323
                     /locus_tag="MRET_3572"
                     /product="solute carrier family 45, member 1/2/4"
                     /transcript_id="XM_027630199.1"
                     /db_xref="GeneID:38740338"
     CDS             364614..366323
                     /locus_tag="MRET_3572"
                     /codon_start=1
                     /product="solute carrier family 45, member 1/2/4"
                     /protein_id="XP_027485807.1"
                     /db_xref="GeneID:38740338"
                     /translation="MLDNIEDVAGDGLPLESHLKGVPLILGPRRLRSPILTMGHLGTH
                     VVWSILNARATLFLQRLGIYKSFVAIILMAGPLSGLIVQPTVGVLSDHCTSSWGRRRP
                     YVFIGLVFCCFSLVCLAAASSMSYQEEGARFRPFTALIGILGIMGIDISVNTLSAAHR
                     ALTMDVLGPEEQDMASAWSTRYGNAGSLIGYMLGLLDLPKIFGFMGLTDHLALLCICA
                     IVFVLITHASLFFLLRESVLLRLNRPRTLAQSITNIPVDLYRCGRTLPPALWDLLVIQ
                     FFSWLAWFPVLYYAATWVAEIFSLAHGHSAKEASAKTKLGEEARRVGSKALFYYALTG
                     LVASIVLPWCVYEPMTARSLAHTRYESAPQNDTELNDLHGTERPENMGDDEGDDNWNH
                     PTAGSITNAPRQPWWRRIRHGLTLAEIWFLSQVMFVFTIMLFTCPVFGSKSITGAIVL
                     VSVLGILWSVTMWVPYALLGILVISNKSTTIGLQRATIDLRSETGTVTGLHNWAIVLP
                     QLVTSMLSSLVFLLPSLLFDPSTAESLDSTGLLLRVGSLCTLYAATCTFRWIRTHDAA
                     ICR"
     gene            <366784..>367599
                     /locus_tag="MRET_3573"
                     /note="MRES_14360"
                     /db_xref="GeneID:38740339"
     mRNA            <366784..>367599
                     /locus_tag="MRET_3573"
                     /product="14-3-3 protein epsilon"
                     /transcript_id="XM_027630200.1"
                     /db_xref="GeneID:38740339"
     CDS             366784..367599
                     /locus_tag="MRET_3573"
                     /codon_start=1
                     /product="14-3-3 protein epsilon"
                     /protein_id="XP_027485808.1"
                     /db_xref="GeneID:38740339"
                     /translation="MATPSREDSVYLAKLAEQAERYEEMVENMKRVASSNQELTVEER
                     NLLSVAYKNVIGARRASWRIVSSIEQKEESKGNETQVSMIKVYREKIESELAQICEDI
                     LQVLDTHLIPSAASGESKVFYHKMKGDYHRYLAEFATGEKRKDSADKSLESYKAASDV
                     AITELPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDTLSEESYKD
                     STLIMQLLRDNLTLWTSDMQDTEKPAEGAAPAAPADAAAPAQPATESKGEEAA"
     gene            <367879..>370734
                     /locus_tag="MRET_3574"
                     /note="MRES_14365"
                     /db_xref="GeneID:38740340"
     mRNA            <367879..>370734
                     /locus_tag="MRET_3574"
                     /product="AP-2 complex subunit alpha"
                     /transcript_id="XM_027630201.1"
                     /db_xref="GeneID:38740340"
     CDS             367879..370734
                     /locus_tag="MRET_3574"
                     /codon_start=1
                     /product="AP-2 complex subunit alpha"
                     /protein_id="XP_027485809.1"
                     /db_xref="GeneID:38740340"
                     /translation="MRGLSRYISELETCQSHEAQNEIVRREMERVRSKLTHASKSDGY
                     EMKKSMAKVLFTHLQGYPVDQSYLEPLSLMSSSKYSEKQMGYLALSIMLRDRSDIPAM
                     VLPIMRKDLASLNESDTCLALQLVSGMSMPDLAKALGEEVLKLLISPTSSVHVRKKAA
                     LTALSFFRLDPLFVDLAAWVDRLAVLLQHRHHGLAQCVSSLVTALVQHAPSEYPMFYR
                     PAVEQLCQIQLEKDHRLEYMYHRVPAPWLQVQLLALLRVYPEVPKEARGVEAKLQNVF
                     ASIWKRDTLHAMTADVHESNALYAVQLEAIRLAVHLDPSSYVVTRSAAQVGRFLTSSQ
                     SNVRYLTMEVITLLAHDMPSLQPIQTHSDMIFLSLSDKDISVRRRALDLLYAICDRTN
                     VRDIVQRLLDYLRVAEASLRQDMTFKISLLAEQHASDSTWYIDTTLELFHLAGRHVDD
                     AVWHRIVQVVTNHPKVHKYAAQRIMVYLQQALCYETLVKLGAYLLGEYGFLISDLAGG
                     SPLDQFQSLHRHMASCSPRTQSMCMSTYAKWASVYPDMQDLLLDVLQRHTHVLDVETR
                     QRAAEYAMLIQLQRQGHVDLQDVLDELPPFTSTQFRGTQAPANDLFKPNRRISAVPVV
                     SSVRRGEARRASRLPVLLSDPDAPSASVVTSPGLFSSDVSVDLVDLQSVRIDSPSLDS
                     ASEQHPWASASDVTGPQSPLLEHAYHEPAPFPLSNAQHIYLDLPFMQLFAHQGTLFEG
                     HGGRLEYERQNTGDASVTVTLRIHNTDVLRALHVSDIQVQTSIEAHVTHPDRVDPQSS
                     VAGTIEFVCHRPFDESPQMDMTWRREADDTHVLHVVLPVSLATFLRPWTMDRTTFFEH
                     WHAMRSQPDQQAQRVCRYAHMNDRVFYAAGLAVLAGVDARPQNVVAAGRLPDAVPVLV
                     RWEPSPETHLARLTVRASHPVAAQAIHKMVLRYMDLM"
     gene            complement(<370737..>373003)
                     /locus_tag="MRET_3575"
                     /note="MRES_14370"
                     /db_xref="GeneID:38740341"
     mRNA            complement(join(<370737..372842,372872..>373003))
                     /locus_tag="MRET_3575"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN3"
                     /transcript_id="XM_027630202.1"
                     /db_xref="GeneID:38740341"
     CDS             complement(join(370737..372842,372872..373003))
                     /locus_tag="MRET_3575"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN3"
                     /protein_id="XP_027485810.1"
                     /db_xref="GeneID:38740341"
                     /translation="MPASPQRSSLGARKASQTGTQTPHGARQGMYVAYVKNAMLQKAQ
                     GDYAPYDELVAQFQSTGNVMPSTKNTASSVTQLQAWLSALTHVAPSLDRTCVTLVESV
                     TEFPWLAMPEDIADAWVRLVCSIVSARSEWVSHVASLLFQNMNLRPAWCRGTHTFLPG
                     HRSAMSRRQLYSRLHSLLQTLLRLIPTLPATLQPLLIQHFPHKRESTMDQVLYIQNLL
                     RITEYCEALTEPIWNVIIDHTLQIDVAIQVELDELEEQGVEPSSHTTDLSAVLDQGAD
                     SDSESATVSPALAAQDAIEETLDTLEDLSDEEGYDDSDGLLATELAQEPAWNEIAVLA
                     GKLDAIMKAVHDFLEQHIGMARSPAMLTRRYQLYQTLLGIFTRTILTTFKSRHVQFVL
                     FWFASLDHEFADMFLGTLLSKSLYAVPAAGTSESGESAIILRIAAASYVASYVARARY
                     IDASTTRMVVVNLCTYMDACLESFAAQGLHAPPPGAREHAVFYAVTQAVFYIFCFRWR
                     DLRDGAVSDAPSFALDEDHAPSLAATYPNTGSFELSPQLMPVLHASSLSSVSSTHSMT
                     GERGWAPGLAVVQRAITSPLNPLRYCNANVVQQFAYVAQYTDFLYCYSVLEANAQRRP
                     SQAARESTPTTRSPVKTAPDAPAAVAAPALDAFFPFDPYRLRDSSSLVYRLYREWSDV
                     APEESDGEEDEDSDDGISALPHEQMTRLSAVLKSRGEYPSHSSITPESIAQSMEAMSI
                     SPYTG"
     gene            complement(<373227..>373877)
                     /locus_tag="MRET_3576"
                     /note="MRES_14375"
                     /db_xref="GeneID:38740342"
     mRNA            complement(<373227..>373877)
                     /locus_tag="MRET_3576"
                     /product="GTP-binding nuclear protein Ran"
                     /transcript_id="XM_027630203.1"
                     /db_xref="GeneID:38740342"
     CDS             complement(373227..373877)
                     /locus_tag="MRET_3576"
                     /codon_start=1
                     /product="GTP-binding nuclear protein Ran"
                     /protein_id="XP_027485811.1"
                     /db_xref="GeneID:38740342"
                     /translation="MTDAQNIPNFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGV
                     EVHPLQFHTNFGPIVFNVWDTAGQEKFGGLRDGYYIQGQCGIIMFDVTSRITYKNVPN
                     WHRDLERVCENIPIVLCGNKVDVKERKVKTGAVTFHRKKNLQYFEISAKSNYNFEKPF
                     LWLARKLVGNPALEFAAAPALAPPEVQVDQQLMEQYNKELETAAAAPLPDEDDGDL"
     gene            <374031..>375002
                     /locus_tag="MRET_3577"
                     /note="MRES_14380"
                     /db_xref="GeneID:38740343"
     mRNA            <374031..>375002
                     /locus_tag="MRET_3577"
                     /product="DNA-directed RNA polymerase I subunit RPA43"
                     /transcript_id="XM_027630204.1"
                     /db_xref="GeneID:38740343"
     CDS             374031..375002
                     /locus_tag="MRET_3577"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA43"
                     /protein_id="XP_027485812.1"
                     /db_xref="GeneID:38740343"
                     /translation="MGKKGAEAPSTSTGIVQVSATMNMAIPPFWAMDPMASVLEQLDT
                     LVMRFVPQLEGVLLAHADAKLLSKLGSIDGDSAFAEVPVRFTCFVWRPEVGMSVKGTI
                     TLSSPSHVSLLLYDTFNAAVSAPHIPADAWEFVHYSDVGESQRQDAKDRSVGFWQNKE
                     TGQRLGGQDNTLTFCVISMTVANQMLSLHGSLLSDPFSVPPPQPGTMSFDQAIGSTEP
                     MEEEKTEETAPKPRRVRWEDSDEEAEEVVQQAAVADDAVDDHQAEAQDEEDAPLVEAP
                     TQSSEAPKEADSDKKEKKEKKKDKKSSKKRDRDAEGGSKKKKKRHSE"
     gene            complement(<375098..>375535)
                     /locus_tag="MRET_3578"
                     /note="MRES_14385"
                     /db_xref="GeneID:38740344"
     mRNA            complement(<375098..>375535)
                     /locus_tag="MRET_3578"
                     /product="thioredoxin"
                     /transcript_id="XM_027630205.1"
                     /db_xref="GeneID:38740344"
     CDS             complement(375098..375535)
                     /locus_tag="MRET_3578"
                     /codon_start=1
                     /product="thioredoxin"
                     /protein_id="XP_027485804.1"
                     /db_xref="GeneID:38740344"
                     /translation="MIPTVRASAALRAPLRAVMRAPPSVRAFSTSIVRRRIEENISGE
                     RLAQLLQEQSAKPLLVDFVAEWCGPCKMLSPVLHKLASSPDLVGGKDIDLVTMDVDHE
                     IGAAQKYGVRAMPTVIAFKDGRPVSQFVGVLPEAQLRQFIQGL"
     gene            <375686..>382540
                     /locus_tag="MRET_3579"
                     /note="MRES_14390"
                     /db_xref="GeneID:38740345"
     mRNA            <375686..>382540
                     /locus_tag="MRET_3579"
                     /product="negative regulation of cAMP metabolic process"
                     /transcript_id="XM_027630206.1"
                     /db_xref="GeneID:38740345"
     CDS             375686..382540
                     /locus_tag="MRET_3579"
                     /codon_start=1
                     /product="negative regulation of cAMP metabolic process"
                     /protein_id="XP_027485905.1"
                     /db_xref="GeneID:38740345"
                     /translation="MSRATADTVDAPSKEITSWNWKSTIQGAVRRVIESVASSHPPWI
                     PDNTCTAAISVLFEALQHDRDHVMDALLNGLKGIELPVSLSTMDSRLRLHQALCMTRV
                     ISSCVFHDWLSYQTEEILSTPFGAWKDPPRMADSTARQFVSTVSKHFVQLVGYRELSI
                     SQQSDGHASSFKDDKLRSFTFLSRDTNSNVREYDCLYAMLDAHLGMYTASASPEAYFV
                     LDAHFPPYRAPFKLTPTGVSYTATLWHTPADALDASEHTVAAYLYRELAYLMLYTSST
                     NWETTMHCIGSLTDARTNVSLYECVHWRWPQLEAFLRQVIRELPLMPRSHFATAAVML
                     RRVVHMWTHFHDDERHMVCSNGLPDVTSQLFDTLFAQADSLSRRIVLWPTLGALLGLS
                     PTPYTPTRVWRDVHSKKWAFSDALHHHLSHSRLGFAAWFSVVMMHSVNETGGAPIPAA
                     ITSGACSRLVEHLHSFTANDARLGGLLLASQVRLGNMEEAMNLVHACLYVRPSNVGVL
                     VVVHALLLLIIRDIGSWRAVLYPPCAPVLRRSIRHGVRAWCVDKALDDMTMTAIHGIL
                     YVALLDPMSVLTLLPNEPLDQLQLPRAPSAAQLDTLLQKDSRVSLVLAFLHVPMARMR
                     LHAASNAAIMRLSGDKPNVGVLSHFPYVPITMLEQPSTPTPDMACILQMLGPIDIDVA
                     TNAVQHVMTANSENDQLYWLIALQTSVSCLLRLQISVERKVGPAAVLYGLFMPSVLNV
                     QAALDATMLLSHLYPLPEPLPTLVKSRPDLATICHVLRHTPAPNHFTQMAWSALLRLW
                     LTCLPKSRANRVNKSDMTHIVHILAAGAHIGLHGVMIKDDIPFVHMVSDMLLHYPDLR
                     DLAFVLLDAVPTPILPRMILLAHTELPRSESHTLWLRLLKECVPRLSIDSVDATTLRA
                     IVDMLLACAMSVTTISSRMTVCEVTAVLAPCERPEMVRARAQLVDWILPWTIGDGSLR
                     QKALECIVHMCRGLTDDIPLMVLRIDVSREAALFRRTARIVDRLIRAATFGKLMDAGA
                     QDVSLAVVALEHVLRQNLDFLSHEAVTLTTSPLPSARMALMLAMARLFSHPDYEALEH
                     VAETPKMLIQDALFLDEGRWIAHLICTGTIHHAQLMEKVLSGTCTTDKMHTVLQRVLQ
                     TKVDASTGDLLWLRTNSAALIFLTAYARRFTHVHIQSIVQSLVTAVSQSPLEGFDWTN
                     TTDLSEERLRAQHMGEIQLITLLGEKLEEFARAFPTEMHWVSTRLYQAIARRFGDETA
                     SFSLGTFLCLRLLGPAIAAPESVAVEPPQSEAARRALVFLNKVLVALPQGGFPAHRES
                     RLTMLNDVMTQRNMTLRRTLEETVQYDVQNSNISMPSEHIPQRICRELRKHMQQLASK
                     GDANASTLLQVLPTHPSLQERFATALCGESRDAVFQSFMDMYSTYDTRALSNLCVVRH
                     GEEYTTVCFFYSRLDLIRGDFTTLSYYICSVASKFTRPWILILDMTGSTERMLVQNQY
                     TAFVSAILPAKAFGFLHSVVIVNGGLALLRHGWMVTEEPYENGYIARRHMDGGPPLKL
                     EWVTSAEELHAQTKDVQLSLAPASTRLFFAKPSYVLTDVSCDDGFCAPVSATLVLLND
                     YMLIRSKPLAHQDGPLKPPRSCDIIPLSDMIVMSDHVSRLCIHRYSCPDVLFLNTRHC
                     DDLEHKLYSLRMSNGDYARGLYAPVPRSSIRAVFVGMGLFYRTSTDVTMRFAADTLLR
                     AAGVFHQGIQPMFIPPNLPSIDIPVPLRAMALRTALGITACLGRQHVLFTRAEQLLMS
                     VPHEQLPQILHLGLVLWMTHPELRTAILPALDLLPTLPSAAHELFLDVCIDLTPMCMS
                     PVMNAMQDAIMTAAVPHLLHIILSRLHETFCSPRRPGLLHQVHALVALLAVQCLVPDT
                     PLRAHVPEVMCILLLFHQDPLPSFHVASSMSFVHTLVMWPAPELASLAGEKLKSTLSI
                     SSLVELVNKAVLTLAADAEQCAQWTLAIENQIQHIALSRGSLMQSRALQVLGHLCNAS
                     QSIMHRLGLVLLESFPHAPMTVDAAAMCLSRVFLPAQAPTLFWAGMILIAVGVHSGGL
                     RLCSAALDALDSHAFAAIMEARRRFAADATALDEALGVSFERDFSFACASLLRRPLWD
                     GHPSIQELTRSLIERLNALVPCDATTGDNRRVSGLSLLLFLFDPSTTDASQLPPQYFP
                     LTDDDQMASSKILSAALARSFLPRASDSQLHLMLPLLSDGQAHALRKSDEPILPENNV
                     SPLSQLGFSGLKFDTGSGPYAAECRSWLQHLVEQWA"
     gene            <382567..>383718
                     /locus_tag="MRET_3580"
                     /note="MRES_14395"
                     /db_xref="GeneID:38740346"
     mRNA            <382567..>383718
                     /locus_tag="MRET_3580"
                     /product="putative methyltransferase"
                     /transcript_id="XM_027630207.1"
                     /db_xref="GeneID:38740346"
     CDS             382567..383718
                     /locus_tag="MRET_3580"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_027485993.1"
                     /db_xref="GeneID:38740346"
                     /translation="MSLIPSRFLPARVSDASEQELAQALAQLRAVYAIGVPREMWVWE
                     GEHADEDEETDDAFEAHYVRTWLHRLVQYGCTHAKAADLVDEAASVLVHLAGQAACGE
                     RWCTYYFFLTPHAPRHSDEAVASVSICDGAFVGDALGVRTWGAAPYLTRRLIQQYASA
                     GKHMLPRRVLELGAGTGLVGLGLAQWLGAQRADAHITLTDYDATVLANLRRNAEASHG
                     RADVRHLDWETVYRDMQTTSRCYDTWAQETLPHDRDTSPAQYGGVDRHEQFDVLVAAD
                     CIYDPQHALWIHAVAERHLVRPTAAYPSPQLHMLVPVRRTHLAELASVHAVFSESSPF
                     RIAQTHVIQGHDDFGPPCLSSQSPRARKGNPISCQHFVIEWRHDSPFHA"
     gene            complement(<383694..>384158)
                     /locus_tag="MRET_3581"
                     /db_xref="GeneID:38740347"
     mRNA            complement(join(<383694..383940,383968..>384158))
                     /locus_tag="MRET_3581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630208.1"
                     /db_xref="GeneID:38740347"
     CDS             complement(join(383694..383940,383968..384158))
                     /locus_tag="MRET_3581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485992.1"
                     /db_xref="GeneID:38740347"
                     /translation="MDVLRAWCGCCLGTGRKEAPSREASECAPLLQQAESAPGGPVTR
                     HHPCLFPEPVVERILQRLRTDLLDVDTNAPKHGNTPGSSHVESSSDAPITIPTQGIHV
                     HHMKLHAAGASDDSSSADVPNDQVDDAAIQGSQQRLQAWKGES"
     gene            complement(<384194..>385412)
                     /locus_tag="MRET_3582"
                     /note="MRES_14400"
                     /db_xref="GeneID:38740348"
     mRNA            complement(join(<384194..385228,385257..>385412))
                     /locus_tag="MRET_3582"
                     /product="mRNA m6A methyltransferase"
                     /transcript_id="XM_027630209.1"
                     /db_xref="GeneID:38740348"
     CDS             complement(join(384194..385228,385257..385412))
                     /locus_tag="MRET_3582"
                     /codon_start=1
                     /product="mRNA m6A methyltransferase"
                     /protein_id="XP_027485995.1"
                     /db_xref="GeneID:38740348"
                     /translation="MGPTNVLPPPPIWCLALRLHGMDGDTNARAAAEIAQRYLSHPTG
                     KQRLLMRMFQSTDNRFQPLCQHITRYDCSQARSGLGLHGCCDRLHFKPTIYPHTNVAL
                     GHCGYLSSCHRKSTCKYLHYELDTSPPHEPFVWRCAGPESYASDSEYARYAACLEPTR
                     QLERFGLDAWLRKMHWDGVPTLSQEAQWIDCDVRTFDLSSLGKFDVILIDPPWDIHMS
                     LPYGTLSDEDMYALDIPVLQDEGLLFLWVTGRAMELGRFLLKRWGYVRVDELIWIKTN
                     QMDRLVRTGRTGHWLNHSKEHCLVAMREPKKGAQAPPPCLWTHAGLNTNVMVSQTRET
                     SRKPDELYTMIERICPGGRKLELFGRLHNVRPGWLTLGNQLKSTQVREPMLRRVMQPP
                     VENV"
     gene            <385436..>386671
                     /locus_tag="MRET_3583"
                     /note="MRES_14405"
                     /db_xref="GeneID:38740349"
     mRNA            <385436..>386671
                     /locus_tag="MRET_3583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630210.1"
                     /db_xref="GeneID:38740349"
     CDS             385436..386671
                     /locus_tag="MRET_3583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485994.1"
                     /db_xref="GeneID:38740349"
                     /translation="MSDSSLRQICADATRAFLQKNYAQCLLEIQKGMSMHYSIPGSDA
                     WLEQLLVLRFTVVHSVYVSTSERTRVLDALSRETSIIKLFSMPPSHLYATLWYECLYT
                     MSHLPIPDACPSTLETSDDICTMILRLPAPLISSAILMALRMDTYADTTQRKGTPSSC
                     ARQTCECFFAATLHQDEHHFDLNTYEKILRLYVLQVLGTHLGEWDHARHVIQDCVLPT
                     RSKTAALNDLEKLHKELDLRVLRESDVLRHAQQQYADEMARRSSTKAKDTPTFQDQDA
                     VAIKDEPIASAKLQRTSSIHGREKKNTSTPTSELMEQGDTHAMKRSHLRSYLQRRSLS
                     ESSSELSRPRPVNASYLLRILSSSLTRQSVVSVIVLLATVLLAFLSKKRGLLTTPNGA
                     SWSQRLWETFRMATQVTYL"
     gene            <386978..>388324
                     /locus_tag="MRET_3584"
                     /note="MRES_14410"
                     /db_xref="GeneID:38740350"
     mRNA            <386978..>388324
                     /locus_tag="MRET_3584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630211.1"
                     /db_xref="GeneID:38740350"
     CDS             386978..388324
                     /locus_tag="MRET_3584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485991.1"
                     /db_xref="GeneID:38740350"
                     /translation="MNHITFPRRLIFSRQVLFTACMCMLFWATFAAAQDPPEDENDID
                     DTRDTLQEVEQPFISASIAFVAACGSIFVVAVVLGLILKFTNPPRLEAFHPSHGALLG
                     QRARRHGQQVRSSQADMSKSTVNLLHQMPPAAVSSQNLSASDPFEGGEPVNQVATTSR
                     YMQPGVPQAGATMDLQPAAVSDSTGQSRRKHRPRALPQPPITTTHPGNSFQAGGAYYQ
                     NAYAGSSNVGMGYTTDYDLPYGYGKHWDTQAGYSNALPYTTHYQSSGPPNEVSPFDAY
                     TVSPAVTQPFGSSYRTPNGYAPLPDVSNNYASMPEYYYNAGIAPNSTSLRHKNSGASV
                     HRVDSVSAGDHRRHSQRGKNGTKSRASSHAAPSKRYSNTAYQPPSTAAQYASNYQTSY
                     PYTDGSYADGYASHAMPAYDYGDNATYHQNYASYPLREEYKYSTPYTAWDSYKSPY"
     gene            <388635..>390071
                     /locus_tag="MRET_3585"
                     /db_xref="GeneID:38740351"
     mRNA            <388635..>390071
                     /locus_tag="MRET_3585"
                     /product="F-box and WD-40 domain protein 1/11"
                     /transcript_id="XM_027630212.1"
                     /db_xref="GeneID:38740351"
     CDS             388635..390071
                     /locus_tag="MRET_3585"
                     /codon_start=1
                     /product="F-box and WD-40 domain protein 1/11"
                     /protein_id="XP_027485990.1"
                     /db_xref="GeneID:38740351"
                     /translation="MLAPFCPSSWRRTIPPDLPMLFPSPISTIDAHDELHSDELMRYK
                     PLGHCCDILTSLPLDIARYILSQLPLRGVLNASLVSHAWNQIVSDAILWRLLFERKEK
                     WHICTDLLPRLPHIPYKDPTLPFVDWKSVYMNRLELDRRWYTLKTKPRGDSIAIPFQP
                     SKVPLEGHTNSVYCACISSPTATSPHVYVFSGSRDNNVCIWDSETGRCLASLHGHQGS
                     VLSMSYRDGVLLTGSSDNTACLWECSNFSDGPVFHMTRALRGHNGGVLSVCFDDTWIV
                     TGSRDATVRVWRRMDGQLVHTFYSHGACVNACSLDRGRVASAASNGTAFVWDVATGAI
                     IQNWEGVRRGIASIQLHDSIGFTGSSDSCIRLWRVSDNACLLKFFAHEQLVRSLCYDQ
                     RRELLVSGGWDGMARVWDMSPTLAHIHDTHPTTPIPTPRLLFELRVPHTRVFDVALDV
                     SHIIVACENHTLWMMNFGSPELDAHVYA"
     gene            <390273..>391656
                     /locus_tag="MRET_3586"
                     /note="MRES_14415"
                     /db_xref="GeneID:38740352"
     mRNA            join(<390273..390501,390533..>391656)
                     /locus_tag="MRET_3586"
                     /product="Pal1 cell morphology protein"
                     /transcript_id="XM_027630213.1"
                     /db_xref="GeneID:38740352"
     CDS             join(390273..390501,390533..391656)
                     /locus_tag="MRET_3586"
                     /codon_start=1
                     /product="Pal1 cell morphology protein"
                     /protein_id="XP_027485901.1"
                     /db_xref="GeneID:38740352"
                     /translation="MSGARWAGNDPSISPATAQKSGQGLWPKLGFFRKQQDVRLSQFV
                     DPQIIQEGPSSADNSRLDVIDQLDISGLTGGSLFHHDSPYDACSPQFNRGNNRKAPIN
                     AFDRSEDPITNALLEHHRMREEGQMHETPADLPNGQEDYESRDPYAVPQGMGYDGPTD
                     ADNPNSEYFGVATEPWQEFSNPITSAHNASRSKNPTGGTKAENQFGDMEAILRGGRRS
                     EPRVPAYESVSQTSASQVEPETTKYNYREGRRPSLFRSRSMSRSKSLASRFRRHHAEP
                     EPLRQEPPAQVASHVPTQQLQPATLGQPDSLMNQGLAPPISGASNPAPTTTALYNQIE
                     AGRYHDASSLNMKGDTSNVATGIAQSSYMDEPAYVYGSAYTRSSRRHYTEAPEPPPKQ
                     TGLSDEPSSMAQTNDQSLLNAEAGKANRAPTGPAGSDPLRRGLRRLASIGRSRSRRSP
                     "
     gene            complement(<391782..>392187)
                     /locus_tag="MRET_3587"
                     /note="MRES_14420"
                     /db_xref="GeneID:38740353"
     mRNA            complement(join(<391782..392057,392095..>392187))
                     /locus_tag="MRET_3587"
                     /product="lipid transfer protein"
                     /transcript_id="XM_027630214.1"
                     /db_xref="GeneID:38740353"
     CDS             complement(join(391782..392057,392095..392187))
                     /locus_tag="MRET_3587"
                     /codon_start=1
                     /product="lipid transfer protein"
                     /protein_id="XP_027486101.1"
                     /db_xref="GeneID:38740353"
                     /translation="MSDFKSTAIFKQIQEGLAGFPENERKNLQKKTNAVFEFHVKNAG
                     GKELVQTIDLKKDATVYEGPAKGKADCIINLGDDTFADLADGKLNGQKAFMSGKLKVK
                     GNIMLATKLDAVLKAQKSKA"
     gene            complement(<392505..>394826)
                     /locus_tag="MRET_3588"
                     /note="MRES_14425"
                     /db_xref="GeneID:38740354"
     mRNA            complement(<392505..>394826)
                     /locus_tag="MRET_3588"
                     /product="collagen"
                     /transcript_id="XM_027630215.1"
                     /db_xref="GeneID:38740354"
     CDS             complement(392505..394826)
                     /locus_tag="MRET_3588"
                     /codon_start=1
                     /product="collagen"
                     /protein_id="XP_027485789.1"
                     /db_xref="GeneID:38740354"
                     /translation="MSAVPLNPYLGISFPWEKTEDVTIMGGHAHFLQSSMTEFESEND
                     ESEGHGSGMYGELAASRSSGTFSAPLSRSVGPSSTVGSMQEYSPLPEETHFASQPVQQ
                     QDINLVQPTQQHAQPTEDLSEWTHDTIQPTENATKETLPVENASSAEAAYPDQASSIE
                     KNEATQSTEKTTAQKAFVEHAPTDRAPTEASFPQETTMGFDDFERALLREHMEPQSSL
                     RATKVTRITSNTPALEGERRSTEQPAHALDGQQGETMSDDPASNMSKESTHNHKQDGQ
                     AANCFGEETAHGATEQVPVNVQDESKSVYSPGARSPEGENFEKSSSPVDFSCVPEMRT
                     THHSMYSFNPHEKTALENSNQMSKELDADKAQIENSYDGLGISGTSHVGTQPEHEQAK
                     PVSHPAGIEETPPIRPKAQRTTAPQMPATSAIPQHASTEDMNRTLKNKASRFFKSVWS
                     GNKSKRLLDTPKSEPIHDPSNKQRWNIRDRLRPRNVRGHACSTTETDMTSSHFDSGER
                     PTAPMRRMNRDVPSAYYSPAVSSHPTPGRHSQSQSQSPLKETQDSKTPLGFLFKKRAS
                     DVDPVRPSLSHKASNGILPMRRVNEEPTPVETEIRRNESMMRSRRRTHSISNMTPVRE
                     NMQERNEKGFNNQSGLSPVTHTNEPGQHTMPHSTADDAQIHEANHDAATLEPVVNPSS
                     EAPVTESVPAQQSPASRTDEEKLMQNHNTVNSIVDAPSSLPPLSAEEKRLSLGLDEDS
                     WALDLNFDTQLNTSSAATSSPISVQNNPFLAQP"
     gene            <395118..>398021
                     /locus_tag="MRET_3589"
                     /note="MRES_14430"
                     /db_xref="GeneID:38740355"
     mRNA            <395118..>398021
                     /locus_tag="MRET_3589"
                     /product="putative sensor/transporter protein involved in
                     cell wall biogenesis"
                     /transcript_id="XM_027630216.1"
                     /db_xref="GeneID:38740355"
     CDS             395118..398021
                     /locus_tag="MRET_3589"
                     /codon_start=1
                     /product="putative sensor/transporter protein involved in
                     cell wall biogenesis"
                     /protein_id="XP_027486135.1"
                     /db_xref="GeneID:38740355"
                     /translation="MQQPRSKVSWSAAIFSISHTVLGSLAFIVALLTCLSLHYRRVVR
                     NHVAGYPEEWWPSVSATIGDWFPERNIFQILCAATAGFRLAMIGLCGALASYSYNRPL
                     GGTLLGATGVLRTFSCGGWIFVTSTDHSLVHDIMMGVYIGLTPIWMGLCLTQLEPRVK
                     SEAYRRAQTLRTVSAFLFYACTPLMVYFYRKHRIDRIPGMYSRYALLEWTLVAMDVLF
                     DSASAWDLSVIQGEVSFPLIKHEKSAAAPKNQSSPVWPWTVSQAFLAFTAWSTWFGLI
                     PTIFYFSVSNMAAEGVELFVLSQCVGIALVAMTPIERLVRGTHAMSIRHPHPWILVSG
                     WVASLCGGIASYALQSASMRLTASAGACALLAVLTAVDWSHAWETGRLNECVAIWLVG
                     LVGALVARYANHANLPTWVFMDATNGGRHVLVLSIAIVCLVPLVVPSLRQLPTPHVRR
                     SPSSFGSFILASVALGTWLIEIQTLLSDSGTLIAFTWAGYPVRGPQAVPHGMWVVSAM
                     AVSVTLSMWYPYTGSSVLAIALHALGVYIVLVYDHWLGFAGGLCIALTLPAMAMPLFH
                     SALAHHPLRAMGVAWLTATFLAFLGVLTTAYAFLPGAYVMREHTGALLGIETAILSWG
                     LWHARREGVRARIAHATGARSRRAMRTLTALLVALVGAASVVPLVRYVPPSSITPHHT
                     PDRILTAGIWTVHFGFDQLMRDSTRRMSSILRTMELDIVGLLETDLHRPAFGNRDLTQ
                     WLAQDLHMYADLGPSPKKHTWGAVLLSKFPIINSTHHLLPSPHGELAPAIHAVLDIWG
                     VPTHVVVSHNGQFEDKLDRELQTKAIARILSDAYPHPAIFLGYVVTKPHAPRPEPYDI
                     LFSDGLIFDVDPDDKDRWCQYLGFRGLERVGYARVSRYTVTDTELQTFKLAVPDRLEP
                     NRDVRPFRVSGRHFKPAAWTYPLSLVRPGVRVNETHKYSPYIYPQYFEFEARH"
     gene            complement(<398027..>398999)
                     /locus_tag="MRET_3590"
                     /note="MRES_14435"
                     /db_xref="GeneID:38740356"
     mRNA            complement(join(<398027..398455,398589..>398999))
                     /locus_tag="MRET_3590"
                     /product="eukaryotic mitochondrial regulator protein"
                     /transcript_id="XM_027630217.1"
                     /db_xref="GeneID:38740356"
     CDS             complement(join(398027..398455,398589..398999))
                     /locus_tag="MRET_3590"
                     /codon_start=1
                     /product="eukaryotic mitochondrial regulator protein"
                     /protein_id="XP_027486023.1"
                     /db_xref="GeneID:38740356"
                     /translation="MWRPVVRTYATQAREQTARKGGRTAGGGRSDPRPRPTLTSVPLP
                     PYRQWLKSGAQAYRFPKPRRGPHWLGETPFPQNPFFHPPPPVHQSVRDDMWRLHTQSP
                     QQWTVRSLSSKFRISLERTEAILRLKALEDVYTQEGKPLQTELQRHMERLLGSRPSFL
                     AESQPVPATAPHSPRGAPYEERNESTTPSTYTSPLAEALKAANRNRREVMRHIPTGAP
                     NRPDHDRTVEASREGRAPMRIVSVGADSYMGVGTLERNKKRALYRAARRSRRREKLQQ
                     QQP"
     gene            <399138..>401090
                     /locus_tag="MRET_3591"
                     /note="MRES_14440"
                     /db_xref="GeneID:38740357"
     mRNA            <399138..>401090
                     /locus_tag="MRET_3591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630218.1"
                     /db_xref="GeneID:38740357"
     CDS             399138..401090
                     /locus_tag="MRET_3591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486024.1"
                     /db_xref="GeneID:38740357"
                     /translation="MGQVTSQDAVALSQAQANLASVAQKQHIHIDLGTERATCTLQAS
                     LLFPPSQSVRAWRLWTGDDTSATFMDSRIDAPECIREAYIVRQDGVFLMVPPSRSQKD
                     AILLSLTLYLQTPLVHHAPKAPCSMQCPVLRCKKNTFSCELYAYEGHEIEVMANPPLA
                     SQAWTPSTTNDEQQQLTATFSETDVLGIQWMPISGRGTNTLRSKSAHVTYHTNASIVH
                     MWSEALGAHMPWAVFDMDVHVSLSQAYVETMTREARLDLSVDMHGDTSAHWDTLSVDG
                     GPSIARQMSTGLSLWVDVHLACGSYGAPAPVPLQFVLHGRMSLALQDRSNAPRLTLPS
                     LRLPTDQITSEYVLRHAPWSEGTAAYALDVLEPMQAAHDSQRVGRAPARIAADTLTMR
                     WRPTNESHSEVLTPRKVAPTSVQHTVWPGASEACHRVFVHTRELVPGAHTLCLLPCEP
                     SSIQVVRGGQRFVRTYTVRRAPLAPFDRVYEVRLGVDEPLDLVDVQLDFVSRRLDFER
                     PLFAGGVASYLLQVGTQPSYTARFHVSDALVAYDDTNSARWTHIPPSTPCRIRVTLMH
                     RDARPLPYVPVALGILCAVAACLATIWAYGAHTTARQLSMRIDALAMALDVDFTDGQW
                     LASADAPYTPVPGVASSWRLPWFPLP"
     gene            <401140..>403815
                     /locus_tag="MRET_3592"
                     /note="MRES_14445"
                     /db_xref="GeneID:38740358"
     mRNA            <401140..>403815
                     /locus_tag="MRET_3592"
                     /product="cortical actin cytoskeleton protein asp1"
                     /transcript_id="XM_027630219.1"
                     /db_xref="GeneID:38740358"
     CDS             401140..403815
                     /locus_tag="MRET_3592"
                     /codon_start=1
                     /product="cortical actin cytoskeleton protein asp1"
                     /protein_id="XP_027486055.1"
                     /db_xref="GeneID:38740358"
                     /translation="MSTTAPIRLGVAAMDRKARSKPMQNILNRLLSSGRFEVIVFGDK
                     VILDEDVDTWPIVDVLISFFSTGFPLEKAIKYYELRRPVCVNDLYMQTVLWDRRAVLR
                     ILEQVGVPTPPSVYADRDGGPRLSKPVLDEIRANTGLDLSQRAPPAEVQLIDHDTLRV
                     NGRTIRKPFVEKPVSGEDHNIHIYYPLSSGGGGRRLFRKVGNKSSEFDPSLVEPRTDG
                     SYLYEEFMDVNNAEDIKVYTIGPVFSHAETRKSPVVDGLVKRNPDGKEIRHVAELSAE
                     ERDMARRITMAFKQFICGFDLLRVQQQSYVIDVNGWSFVKGNDDYYDQCARILCQFCE
                     AHRIARPLRPPSEDVRAIEETSSWVLKANVTVFRHGDRTPKQKIKRSYKTRDAWTAPL
                     VELMHGCREEIILRSHFDVVLHALDKAKELDGADAHDLSFVSDIIQRKMSFPGTKIQL
                     KPSYHHDQLEKVQLVIKWGGEFSHAAIHQARDYGVNLRRDILIMNKEALDHCTIYTSS
                     ERRVLASAETFAQAFLDGSESDAPKNMIVRKDLLDDSNAAKDLMDNVKEELRARLQPT
                     PENAHIRPEHWPKDLPPPSLIGTEIQKLLHSLGETMHENFSKLDVDVIQDRWCTHETP
                     ALFCERWDKMIEDFDSPNEPSRASELADMLSHDGLHNRAFLETIFSRAEDDEAHKLER
                     LHHLYRMSLALFDYICPREYGITPEQKEHIGLLTSQPLLQSIVQNLQVSEDVKGMCTF
                     YFTKESHVHTLLNLLLSSHLSIIMPRMPPMDYFSSITFEVYERERPTSATRAASSKPE
                     RSLVISVSEGAHSSEVLFIRLDARHALTPLPSRPLTSHMDFDESISKLSSLCQKRDAL
                     DTRRGLIEGSAVYFGKPEDEEHVVPIRSRGASASP"
     gene            <403901..>405064
                     /locus_tag="MRET_3593"
                     /note="MRES_14450"
                     /db_xref="GeneID:38740359"
     mRNA            join(<403901..404745,404778..404815,404844..>405064)
                     /locus_tag="MRET_3593"
                     /product="LETM1-like protein"
                     /transcript_id="XM_027630220.1"
                     /db_xref="GeneID:38740359"
     CDS             join(403901..404745,404778..404815,404844..405064)
                     /locus_tag="MRET_3593"
                     /codon_start=1
                     /product="LETM1-like protein"
                     /protein_id="XP_027486056.1"
                     /db_xref="GeneID:38740359"
                     /translation="MLCQMHASIMRNNMVRSVPSGCLVPLFCKASIVLPKARLAYPHA
                     VSCPYMPTRTIHASMPRFSGPKKDDNLPQTLMDRAQNMWSNIKYLFRFYLNGVKQIWR
                     NRTTVREIHADVRRTKRDYTWEEMQMIRTHSKDMVKLPFFVLILATVEELLPLMVIYT
                     PFMLPSTCILPSQLTKIRQRFELKRSTAIKSLRAALPTLDVSNVSDKSAQAAVAALPS
                     QALHELATVYNLSKWGGSIMQRGRIVSHMRILQEDDERLIKSKTFTSTEDADYKLSNA
                     CIQRGICAVNVSSKDMRLSLQRWLDVTLRPNPPSPLERILLPMRIPQFGAPETELRPE
                     LDEQDSLSVKEKTSTVVEEVVEQEKRRETKKSS"
     gene            complement(<405094..>405598)
                     /locus_tag="MRET_3594"
                     /note="MRES_14455"
                     /db_xref="GeneID:38740360"
     mRNA            complement(join(<405094..405398,405423..405491,
                     405529..>405598))
                     /locus_tag="MRET_3594"
                     /product="U6 snRNA-associated Sm-like protein LSm1"
                     /transcript_id="XM_027630221.1"
                     /db_xref="GeneID:38740360"
     CDS             complement(join(405094..405398,405423..405491,
                     405529..405598))
                     /locus_tag="MRET_3594"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm1"
                     /protein_id="XP_027486021.1"
                     /db_xref="GeneID:38740360"
                     /translation="MEAQEILANIAFTTSGALVDLVDKKVIVILRDGRKLIGILRSYD
                     QFANLVLQEAIERIFVRNRYGDVPKGTFIVRGENVVLMGEIDLDKEDNVSPSVASSIP
                     ESALPQLLEAHAAENVTKSQSEQHKAAMLRSLRGFSGEGAEGDSY"
     gene            complement(<406356..>407435)
                     /locus_tag="MRET_3595"
                     /db_xref="GeneID:38740361"
     mRNA            complement(join(<406356..406850,406877..407281,
                     407307..>407435))
                     /locus_tag="MRET_3595"
                     /product="AdoMet-dependent methyltransferase"
                     /transcript_id="XM_027630222.1"
                     /db_xref="GeneID:38740361"
     CDS             complement(join(406356..406850,406877..407281,
                     407307..407435))
                     /locus_tag="MRET_3595"
                     /codon_start=1
                     /product="AdoMet-dependent methyltransferase"
                     /protein_id="XP_027486022.1"
                     /db_xref="GeneID:38740361"
                     /translation="MSFSFGFCVDEEGVPGEHASVAQTSPIQDPCNMPAKELFLSDML
                     TCIPEKLSYSPVLISQASEPVTLVRRDLFDVRFQIIHNDGQVADAESDLIPGVYEGGL
                     KTWECALDLVVELDKLHTRVSSQDATWPSGRHTVELGCGTAIPSCYVLDQILRARQSS
                     KGKSTLTLCDYNQEVLSLVVLPNLLLTWYFSPSGRETLGHSQSAIEPGELEVDENLLL
                     KFQHALASHEIELRFFYGGWDSLHLANRADLVLSSETVYSLSSLPSLCRVLHSLCWPT
                     SKDQHDAGIAPNSTLCLVAAKVLYFGVGGGVDAFVRELEMQGGWHSQKRTQVMGVGRA
                     VIQAGWLT"
     gene            <407483..>408604
                     /locus_tag="MRET_3596"
                     /db_xref="GeneID:38740362"
     mRNA            <407483..>408604
                     /locus_tag="MRET_3596"
                     /product="WD40 repeat-like protein"
                     /transcript_id="XM_027630223.1"
                     /db_xref="GeneID:38740362"
     CDS             407483..408604
                     /locus_tag="MRET_3596"
                     /codon_start=1
                     /product="WD40 repeat-like protein"
                     /protein_id="XP_027486019.1"
                     /db_xref="GeneID:38740362"
                     /translation="MLRAGTDASPTPEWIVRHHAPIPVHTVALVNHGHLLVAGDADGR
                     VSVTTLSTYRPIVFWQAHQGAVLRADAWSGYLVTHGRDHSLRVWKMPDELGSVALFSS
                     MAKNLPLPTMLHEMGVNALNYCAYDMCIRNEDTPTLDGWLVIPNTLESGWIDLYHVPS
                     QQRIIESLGRQADIRSGTERPAIVMALQICILRDILWIVAGYEDGVLQAWTIPVSTME
                     PTLVWTHKSHAESIMALSMSPTCDSVLSLGADYNIVRTALHQEAVPHVQRIKRPGHAC
                     ASVRWDEQVCVLGGWDACARVFTWPSLEPLAKLAYHKDSIYALSFVRHDAVHVLHAHL
                     DESSDEDAEETSASRQLLLACGSKDGRISLWNETFTKKP"
     gene            complement(<408588..>412221)
                     /locus_tag="MRET_3597"
                     /note="MRES_14460"
                     /db_xref="GeneID:38740363"
     mRNA            complement(join(<408588..412054,412080..>412221))
                     /locus_tag="MRET_3597"
                     /product="trafficking protein particle complex subunit 8"
                     /transcript_id="XM_027630224.1"
                     /db_xref="GeneID:38740363"
     CDS             complement(join(408588..412054,412080..412221))
                     /locus_tag="MRET_3597"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 8"
                     /protein_id="XP_027486020.1"
                     /db_xref="GeneID:38740363"
                     /translation="MGADSVHRAFCPRIAVLSCQDTNLIAERNGFSCFADLFRPFEST
                     SQNVTVRTSQLEQRMIPRFHVRFDMLDDFLSLGNEPVPIDKLLDTVQRFFHDEIQDCD
                     PLLPLVPAENEYQAWNEKLHQQNESFSCFASILYGYRPISSFDTMSHPCAMVLAVSSN
                     NPDPLNAFARLYEQSKKSDVFAKQPFVESNILRCYLVVHDTAALGTDMSRSMGLFEEV
                     RRTYGLDCAIVHVNSASEPVPEVHALYTNNAQKVPSRVCAKEGAPLAQRMSLQDAQRV
                     QSYVRELITKSLVPFLERSVQHLGEHISSQRLGLTGRLLGASRKWLLPRGSTGSSTSR
                     LNHDIYPANSIVSQTRRLGDLAIHVRDYRLASTMYDAAYRDYEEDQAAMYSACASEML
                     GLAQMLHASLSRKGPMPPPSAYLRACDEYVKLRTGEFYALRASVLYAALLNDMQKYDM
                     VAMASFRAAQFTDEIVRALLLEQASMAYLRMERPHTRRSAASLLQAASQYEACGQKHL
                     ALRCYTCAANYYKTRCTYLYDHALFKMAFLVHNSGRIDEALSYLLPLLHGSLPPIDEL
                     HLRAIESVAKYAHEHRVTLPSPFIVAERCCILRLSSSYNDNPCISLNEPCRIELFLVN
                     PLGVRVSLTDVRLHFSRAQRDGTALSSPVEADAPVQDVILEPNERRSVVCSARIFTDG
                     YARVSHATYTLSRVLHVHQSLQKLGPRLQTTVEQRRSRTYAHDKSLLIWVSKDMPCLE
                     LEVTTPARVTIGEIVSVSVRITNTSSIDIESASMSTSPCNMQAFSSPTESLPSILAPS
                     TSEHALPKLTAGAHCDIPCLWHVTDSGSHTLTWHVKYATSMHGSFEKRASRQIQAQAM
                     MNASFHIKLADQAQPAYMLALHVSNVGSKAVTCTGISFVSPLWTTVEGSMQPALLAPG
                     DTFASLVRLQPSPSNYTLASTVRALHAFFDGSVSLPSPAPIPVHVSQHGKTPAACLLH
                     YASLYTASRSAWARQRQISEFDYLPPHIVRALPCMDPNDIDVTVHWRDENGNLGDTLL
                     CGGRVGVQYASMDDMAILNLLLKSDTPQRAMYEETAREQAIMKGRLSKSILANNVLPL
                     SIYVPLNAIHMETVPFVCPMTLHVRNEAPWPLHFTIEMVSSNTGIAWLGNIVHKGTVP
                     AWSSIPLRACVFVPKPGMYEDLGAWRCSATLQDNHGRPVRVWTDACALKVPFKAFL"
     gene            <412379..>413878
                     /locus_tag="MRET_3598"
                     /note="MRES_14465"
                     /db_xref="GeneID:38740364"
     mRNA            <412379..>413878
                     /locus_tag="MRET_3598"
                     /product="integral peroxisomal membrane peroxin"
                     /transcript_id="XM_027630225.1"
                     /db_xref="GeneID:38740364"
     CDS             412379..413878
                     /locus_tag="MRET_3598"
                     /codon_start=1
                     /product="integral peroxisomal membrane peroxin"
                     /protein_id="XP_027486171.1"
                     /db_xref="GeneID:38740364"
                     /translation="MPGNEPAPVTEANLAKMNGEIYIEESKEKGNSSPPVSAKTSMSL
                     SQRAMDSMSSMVVRSIIAVNDEPIRLPTKNRKAPLSVATTAVNFRGFVQKSGPLFVFQ
                     DAVESTLMWDDWPWTTLWMGIWAVVSLHPRLFLCVPPAIALTIMCNTFFIRFPLTHED
                     RNKAPCDALRASFNVPDMLRDEPKAPPIEPRPVKEGELKYFMHMRDIQNMMRLIIDGY
                     DSISPVVKYLNWSDVPRTLRIFQICIVALIAAYFVAPLIPWRLAAFFGGELVLVAHHP
                     WLKPAMEAVKKQSRDSPSRFKSAQRQHRLKQRLIDMLDEDRLPEFVWQRGWKDVEMFE
                     NQRYQPGRRSISNDLNWSPRHLRADERRPWTRGIDGYSVDITAPTDFPLRADDVDYQL
                     DEGYEWIEGENWRIDWGGAWSSVGVDDHGYVYTDASWCHPAPYAYGTDESAPKSPFYW
                     SQDEDDNQSTDMDSDISALAVTRRRRWLRRAVRVKNPGSSKCGVTPKGT"
     gene            <414024..>415256
                     /locus_tag="MRET_3599"
                     /db_xref="GeneID:38740365"
     mRNA            <414024..>415256
                     /locus_tag="MRET_3599"
                     /product="nitric oxide dioxygenase"
                     /transcript_id="XM_027630226.1"
                     /db_xref="GeneID:38740365"
     CDS             414024..415256
                     /locus_tag="MRET_3599"
                     /codon_start=1
                     /product="nitric oxide dioxygenase"
                     /protein_id="XP_027486090.1"
                     /db_xref="GeneID:38740365"
                     /translation="MTVTWEKPQLSESHANVIRATLPLVGEHINEITSLFYKTMFQNH
                     PDLIKDLFNRGNQKQGAQQKALAASVAVFASKLVSENEGLPAHLFSRIGHKHAALGIT
                     ADQYQIVHDNLFYAIVQVLGADTVTAEVAEAWDRVYWLMADMLIKFEKGLYDEAGVEP
                     GKVFRQVKVVQSDKLTDDVTLFSIESTDASKPLPAHKPGQYISVRARLPDGAGQLRQY
                     SLVDDGVKAGRLSFAVKAVSATESAPAGEVSNWLSENARVGTELEVSLPFGDLVLDTA
                     SSAPVVLVSAGIGATPMMGMLSRLVHDKSERQIIVLHVDKSAATDAFASQAKQLVSKL
                     SNCRFHSWYAEGTSDDTTTIGEKLNLGKESLPKDALVYLCGSTEFLQAAAKDLKETGI
                     PEDNVQFELFTPNDWLIS"
     gene            complement(<415453..>417390)
                     /locus_tag="MRET_3600"
                     /note="MRES_14470"
                     /db_xref="GeneID:38740366"
     mRNA            complement(<415453..>417390)
                     /locus_tag="MRET_3600"
                     /product="nucleolin"
                     /transcript_id="XM_027630227.1"
                     /db_xref="GeneID:38740366"
     CDS             complement(415453..417390)
                     /locus_tag="MRET_3600"
                     /codon_start=1
                     /product="nucleolin"
                     /protein_id="XP_027486015.1"
                     /db_xref="GeneID:38740366"
                     /translation="MGTKDKSAAVSAKAAPKSDVKPKNEEKGIKKASSPAEKSSKKSK
                     KPEPMDEDSSDSEDSESDDSDDSDSSSNSDDSDDSDESSDSDDSDDDSEDDSEEDSSD
                     SDDSNKGDESKKNVKDESDSSSESDSDSDDSDDDANPSEKKQQSSESEDSDDSDDSDS
                     SESSDDSESSDDSDDSDSDDSNDNETKSSKQKSESSDSDDSDDSEDSDDSDSDDSEDN
                     EKNVPKEKSKNSDSDDSEDSDDSDSDDSEESNSDDSDDSDSDDSDDSDDDDSDDDDKK
                     VSDKSESSDSDDSDDSEEEDSEKQESSDSDEDSDSSESSDSDSDSDSDSDSDSDSDSD
                     SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESESDKNTESKKTSVNKKRKSDEME
                     EQKTTKKSKVDQSEDTGIKTLWVGQLSWNVDNDWLKSEFEQYGTVLDARVQCDRDSGR
                     SRGFGYVDFASSAEALRASKEAHGKELDGRALRVDLQPPRGPQERVESRAKHFKDELS
                     APSNTLFIGGLAWALTEDDVWNAFAEFGEVAGVRLPKEIESGRPKGFGYVEFTSEENA
                     AKALEAMNGQALGGRPIRIDFAGKRDNSNSSRGAPRGGHTGRPRDSGWGGRAGGARSA
                     SGSARSGAIAPSTGKKMTFDD"
     gene            complement(<417487..>421677)
                     /locus_tag="MRET_3601"
                     /note="MRES_14480"
                     /db_xref="GeneID:38740367"
     mRNA            complement(<417487..>421677)
                     /locus_tag="MRET_3601"
                     /product="DNA-directed RNA polymerase III subunit RPC1"
                     /transcript_id="XM_027630228.1"
                     /db_xref="GeneID:38740367"
     CDS             complement(417487..421677)
                     /locus_tag="MRET_3601"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC1"
                     /protein_id="XP_027486016.1"
                     /db_xref="GeneID:38740367"
                     /translation="MKELVVQDAPKKIKSIQFGVMSKQEIVNLAELEVVTRDIYNLPD
                     RQPRVGGVLDRRMGVSDKVSTCETCGHRMADCVGHYGYIKLVLPVFHVGFFKHIVSIL
                     QMVCKSCSRILLEEPDRRRFLRRFRRPGLENLQRTQTFKAVNTAARKVLYCPHCGSTN
                     GTVKKAGVLKIVHEKFRQKKTEEEQLDFRKTFTTAVQMGHGELAPHLNKAQEDLNPLR
                     VLDLFRRISDEDCELLGLKPQFGRPEEYIWQYICVPPVCIRPSVAQDGATNEDDLTVK
                     LTEIVFTNNIIKSGLTKGSKGTTTAQLVEQWDFLQLSVALYINSEMPGVPPMSGHKPI
                     RGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLAIDEIAVPERVAKILTYPERV
                     FAHNIESMRAAVRNGTDTHPGANYHVNGRDGFKRFLKFPGMRDDIAANLCVGDIVERH
                     IRDGDIVLFNRQPSLHKLSIMCHRVKVRPWRTFRLNECVCNPYNADFDGDEMNMHVPQ
                     TEEARTEALTLMGVRHNLVTPRNGEPIIAAIQDFITASYLISRRDRFFTRAQFVQLCS
                     YFGDATLHIDIPPPAIQKPVRLWTGKQLFSTLIRPSKSSSVLVNLEARCRTFEKPRDG
                     HPKEMSPNDGYLVIQNSEVLCGVMDKATVGDGNKHSVFGVILRDYGPDATVAAMNRLA
                     KTCARWLCNQGFSLGIGDVTPGDRLRKTKDQHVEEAYRQCSDLIDMAKRGKLENLPGC
                     NQEQTLESKISGVLSSVRSDVGEICMTELSRHNAALLMSVCGSKGSKINVAQMVACVG
                     QQIISGSRVPNGFQDRSLPHFPKKSKDPPSKGFVRNSFFSGLEPTEFLFHAISGREGL
                     VDTAVKTAETGYMQRRLMKALEDLSTHYDFSVRNSEGGVVQFLYGDDGLDPAELEGNA
                     LPVEYHRTFLHAAAKTADIPSRYLLPYEVMDMVDEALSEDRFQRLCTAKYIEQVRDFC
                     QDKIAKHMARTREVYGMYPALTRDGDFDADTDLSLGADEAQRAIVENKARVSEATIRE
                     FLYLCWEKYMRAKIEPGSAVGAVGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIK
                     EIINAAKAINTPIIAAKLVSEKNERAARIVKGRIEKTYLGDIASVIEEVWAGNYTYLG
                     VQIDMDAIQKLQLEVTLDDIKRAIVNMPRMKIKEERVIVQPNQNALHIYIHSDDKEKD
                     VYYSLKHLKRQLPKVVIKGIPNASRAVISDEKNERKLLVEGYGLREVMTTEGVVGTQT
                     YTNHVMEMQQVLGIEAARNSIYREIDYTMASHGMSIDPRHVMLLADVMTYKGEVLGIT
                     RFGVAKMKDSVLMLASFEKTTDHLFDAALYGKSDSIAGVSECIIMGNPAQTVGTGMPA
                     LVCPAPSLPPRRPLVFDQ"
     gene            <421813..>423819
                     /locus_tag="MRET_3602"
                     /note="MRES_14485"
                     /db_xref="GeneID:38740368"
     mRNA            <421813..>423819
                     /locus_tag="MRET_3602"
                     /product="protein unc-45"
                     /transcript_id="XM_027630229.1"
                     /db_xref="GeneID:38740368"
     CDS             421813..423819
                     /locus_tag="MRET_3602"
                     /codon_start=1
                     /product="protein unc-45"
                     /protein_id="XP_027486013.1"
                     /db_xref="GeneID:38740368"
                     /translation="MDDQRGPRVAHALLTQAATRAHATPSLLDDMAAVTHVDPTEAPA
                     WAHVLLEAVAGRARDVAVVMGFVCLSQVPLATALVDQGVMDAVLAHAECDEDACAAAH
                     MLSEGASHAPLRSQLAAREAVTQWLASQSEASAPLRAILDLVHIKLAIQTDKVLPDDV
                     CCAAWTSTVSFLETTPPPAQVSVPLYFEPAYTAYGDALESLYYLVSRPALRVALSERA
                     AMLRKLGALLDMPKKSLFPARNASGPQVSVYSDKDAPAPLAPAHAFVIVSILTTMTAY
                     LPQRSAQDHHIHALRRSAMQKAGQDVQDDDADERLQPTAVQRRVRALVDADIVPRLVS
                     LATQPQPDQLRQALQSLFLALVTEQDAAFRGRLIQQGLSRALLAQAQHVYTQEETDNL
                     LPLQALAKLSVSTDPALLYGLDGTPARAAAYLAVLFLAPSATLLQVFEATLALTNLAS
                     MSPAMASCVAHAKCASSEHADVQAAITPMFLQYESDMFRCALLELLCNLAQDESTFIY
                     WSGEDQASSDDSSDEVLRLHTPYGRIRFLLTLLDVSDEHVPLLKAVTGLLATLSSSPA
                     TCELLVRMPPESVHALVDVLTYSYASPLATYELALRVMTIISSLTQYAAWLGPSRSDQ
                     VRPCLSHLLPAVRQFVQAQHKATSMEPLQKQVLAVALDIFQTIT"
     gene            complement(<423812..>426868)
                     /locus_tag="MRET_3603"
                     /note="MRES_14490"
                     /db_xref="GeneID:38740369"
     mRNA            complement(<423812..>426868)
                     /locus_tag="MRET_3603"
                     /product="ubiquitin-activating enzyme E1"
                     /transcript_id="XM_027630230.1"
                     /db_xref="GeneID:38740369"
     CDS             complement(423812..426868)
                     /locus_tag="MRET_3603"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme E1"
                     /protein_id="XP_027486014.1"
                     /db_xref="GeneID:38740369"
                     /translation="MSQPTIDESLYSRQLYVLGHDAMRQMSSSNVLIVGLHGLGAEIA
                     KNIALAGVKSVTLYDPAPVSVADLSSQFFLRNEDVGQPGVTRASATASRLSELNSYVP
                     IKVLDVPSLDKATLESFKVVVLTHTPLNEQLRVNDLTHNTSTHFIAADVRGLFGTVFN
                     DFGSHFVCKDTNGEQPLDSMIVSVTHDEEGLVTTIDEKRHGLQDGDYVTFTEVQGMSE
                     LNGIEPRRVTVKGPYTFTIGDTRSFGEYRGGGIFKQVKMPEILNFKSLRESQQAPEFL
                     FSDFAKIDRSMILHIGFEALSAYEEKNGHSPRPRNADDANALLALARDIMQSRNQLPE
                     GEEATKLSNWILTELSYQATGDLSPMVAFIGGFVAQEVLKACSGKFHPLMQHMYADVL
                     EALPKDVPNLPESEFSPQHSRYDGQIAVFGKTFQERIGNTRQFLVGSGAIGCEMLKNW
                     SMMGLGAGPQGQIYVTDLDTIEKSNLNRQFLFRTQDVGKFKADTAAAAVAAMNPDLSG
                     KIKTFQQRVGPETEDLYDQDFFAQIDGVTNALDNVAARNYMDSRCVFFRKPLLESGTL
                     GTKGNTQVVVPDLTESYASSHDPPEKSIPVCTLKNFPNQIEHTIQWAREQFDELFQKP
                     VANVNQYLSQSDYLSSLSSSGDSGYGQQVEQIKEYLVDARPQSFDACIVWARLKFEEN
                     YVNMIKQLLFNLPHDAKTTTGQPFWSGPKRAPSPLVFDPHNELHMAYIVATANLHAFN
                     YGLNGSTDVGHIAQVASQVQVPEFVPKEAKVQINDSDPAPGQSTNAAEDQASLEEVVS
                     SLPAPASMAGYRLTPAEFEKDDDTNHHIDFVTAASNLRATNYQIEPVDRYTTKGIAGK
                     IIPAIATTTALVTGLVNLEMYKLMDNKRDIESYSNAFVNLALPFIAFSDPIAAPVHKY
                     NDREWTLWSRFDVEDMPLRDFLEYFHREHGLEVTLVSGNMAMLYADFMPPKKKEERLP
                     MRLRELVEHVTKKPVEPHVRHLSIEIMADDLNGEDVEVPTVSVRIK"
     gene            <427118..>428275
                     /locus_tag="MRET_3604"
                     /note="MRES_14495"
                     /db_xref="GeneID:38740370"
     mRNA            join(<427118..428171,428196..>428275)
                     /locus_tag="MRET_3604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630231.1"
                     /db_xref="GeneID:38740370"
     CDS             join(427118..428171,428196..428275)
                     /locus_tag="MRET_3604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486012.1"
                     /db_xref="GeneID:38740370"
                     /translation="MAPNENSNGSESLPVSSSSGTNPRPMTLSLDDISSPIEQESDLG
                     GAPPSPSTLTDIILSLHGSLYGAKRQICEIHEMVRRYYDSNAVFDSPLVSAHGRDRII
                     DQFVLAFALPLLHVRSELRDVICSDFEFDGTRAGIIHHTITVTLFPHLFGLPTTSSSQ
                     DLFTPGTATSFGGNTPLPYFNNNPVSASETSGHSIRRRSSLQNFASPRDSGTPQDLNR
                     SASISSLRARTLPGGVSSSHLPRPLSLGPSALEVSVSSKAQDVSETMPSPSVPSMPVD
                     AAKKHWNAPPGLGRRSLFALIMDVVFPSDALRAMFSIELSLFSRLEFNEMGRIVRHED
                     TWSVRELVVGILPFFSLFYNIQRFIFGLFVSWWVRFRQETLAS"
     gene            <428504..>429676
                     /locus_tag="MRET_3605"
                     /note="MRES_14500"
                     /db_xref="GeneID:38740371"
     mRNA            <428504..>429676
                     /locus_tag="MRET_3605"
                     /product="SRP40, C-terminal domain protein"
                     /transcript_id="XM_027630232.1"
                     /db_xref="GeneID:38740371"
     CDS             428504..429676
                     /locus_tag="MRET_3605"
                     /codon_start=1
                     /product="SRP40, C-terminal domain protein"
                     /protein_id="XP_027486054.1"
                     /db_xref="GeneID:38740371"
                     /translation="MNLFTTVLLALSVASLGTAVPLDNYGAFASSLSAGPTNVVDSHG
                     GGVGNMPNLQFSRMKQHGDGQNPIFVDGEPVRLAGHAAPKSSSTSKESGVKTVYHNNQ
                     LGVSVPTLEEFNSRGKAQAVSLLKKQTRGKSSISPQQKSVIQQRLNALTSSDGASVPS
                     AYAHHAHTPVHHKSAQHKKGPKRLHVSKNGKSASKRSSSAGVARPSSVSLNKEQLRLL
                     QSASKMVESMAKRHDGHVFEAIESVSDDGSSKTSSASSSDAPVSTKSKSSTSSKKSST
                     SSKKSSTSSKKNSTSSKKSSTSSDAKSTTTSSKKSAVTSAKGKMRKCRPRKKFTSNAS
                     VKTVTLSPSSTSSSSKGHGVTVSQGSSESLRYGKTISLGDDRSVDDGSDVIQKLLL"
     gene            complement(<429689..>432373)
                     /locus_tag="MRET_3606"
                     /note="MRES_14505"
                     /db_xref="GeneID:38740372"
     mRNA            complement(<429689..>432373)
                     /locus_tag="MRET_3606"
                     /product="mediator of RNA polymerase II transcription
                     subunit 13"
                     /transcript_id="XM_027630233.1"
                     /db_xref="GeneID:38740372"
     CDS             complement(429689..432373)
                     /locus_tag="MRET_3606"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 13"
                     /protein_id="XP_027486011.1"
                     /db_xref="GeneID:38740372"
                     /translation="MAHSAALAHTSAPLPPHASVQWRQYVAPDAPDVLADAARKLQGA
                     LITAAPASPSPATWIAAPTSVPLYALQGTPSCLWVFLWQDTHPTPVMERYLSSLVLRS
                     SGAYVVSRVDEADPASSTREAHLHFLHAVCHAVADGLCGASQLRVAGGLLHLDGRDDA
                     GAASSTDYTTFRAYTSHTTLHVMSRTERRPWTRLDARVVAGDALPRNVVLGETRVRLL
                     PTLRRGRLLSTCIDTSESCRQLREALDDVLPTRDPHFATLWLDEHDDERPLGTVLWPV
                     DLCLVEHDVSALDAPVPWTMRSAQALLASAAWPDERTKLVSPMPPRIVSLVSSSPHVD
                     PPGFDDDDMFRTIGQLTEDDLRFFQTPPRPADPPFPAPASTTPARTPVAPKYDVHGKF
                     FIPSGPRREEGRPSMSPRYSFGTPPSAGAWTASPTPSTDSDSAADEPDAAQRTLALAR
                     LHTRAAAPPRFSPPALPVSDAHAQRVRLAWVALYARTAQHAVPPTKLLAPLVSTTYPA
                     EACSPPSLLVGCQHALIQISIDAVSSWTQLGLVPVGGPRTIGAHVVLVECDLPDDAVR
                     SWVQTLSDELGAHALGTLVPGHVWRTQRDSDLQAVRDVIQDRAVVYLVYGHDHAACER
                     LFRSWPMPRADVSLVPVPESEVWMRPPSRALMWASYEDALHRVCHIAPRTYEACTYLR
                     ERASLRLAWPPLLSYDPLHQGAVLHVAYDIVGRIVRVVCTDDRAQRLVCRAWDAGDAC
                     ACIPLLWQVVRAIVANTSAAWHVVIGRLGTMSQADMDMWASCLDTREPFLLSVGLVCL
                     ERDAWPTAHADASVVYLSDMPLGLASGAWPIRVPRSAYVSAGAYAIHLVQLRHLADLD
                     AYIHDVVLHYYALQCMTQLRWTTPAPALPWPFAILACT"
     gene            <432431..>433999
                     /locus_tag="MRET_3607"
                     /note="MRES_14510"
                     /db_xref="GeneID:38740373"
     mRNA            <432431..>433999
                     /locus_tag="MRET_3607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630234.1"
                     /db_xref="GeneID:38740373"
     CDS             432431..433999
                     /locus_tag="MRET_3607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486053.1"
                     /db_xref="GeneID:38740373"
                     /translation="MVVWHDICTGKPLEAPRHVYWDAFADTKGTDADPKHVAALARQL
                     AAVGKPADDEVLPYLRALHYVSRDKSACEHLDSESFFQSLFPYASAVNLARRDQVAYE
                     AFCTLSNMLIHFQSHVQLFSRTYLDSLFDQLDSSDFEPTEEEYADEQGPYSLLCLCLV
                     YCTIGDYFIGTNMLTTLQFRTYLDHHIAKYLPPRDTPTSSWKPPNFFVFLLATAVNMV
                     RKQNEYMHSFFLPALYAFHAMAVGSPCMLTPPLMYALTLLVLVRPYVPEEEKGRTPPL
                     VEITDKLAHITASLIERYVCDSEEESDRLLAQDGVQGHLEGLLSPCIAYLSTLVGILP
                     DLIDVAEQRFFEKQGDEERPTKPRSPKFSQFLCSAAYPMLGRYFGDVMLLLSDGNTDF
                     LLKRFDIQTCAAVISDQYSRMQSTVKDLRGKEGDKPLAEVTVHEAGEQVPGSLSLEEL
                     VEGIRELEQEGKTLLDAHEEDLKEDRVDDDLQNRILELQQKDTLSEDEEKELDVLTHL
                     KEALDAELHRRIES"
     gene            <434053..>436014
                     /locus_tag="MRET_3608"
                     /note="MRES_14515"
                     /db_xref="GeneID:38740374"
     mRNA            <434053..>436014
                     /locus_tag="MRET_3608"
                     /product="kinesin-like protein 8"
                     /transcript_id="XM_027630235.1"
                     /db_xref="GeneID:38740374"
     CDS             434053..436014
                     /locus_tag="MRET_3608"
                     /codon_start=1
                     /product="kinesin-like protein 8"
                     /protein_id="XP_027486017.1"
                     /db_xref="GeneID:38740374"
                     /translation="MPPDASASSVAAQRASVQWRTRTLFPLAVAILSHAALVREAHVL
                     SMRLGLHVRFQLAVHRPHVCHRSQHDGLDDIRADASVADASLAKAVVRVVDMDRCTIQ
                     TWPCAFLAHQVRVMQRMCGAMAWGDMDVRAQVLGPTQPAFAPVAHVLIPLVPCEDVLM
                     PLLPWYGGEAVMGTCRLRVAWTAQQRACQLMVRDVRGLSRRLVSQVHWQVRIGSDTYA
                     TQPVDVGADAVCHHTFRRSAWPDAVLATLFGRPTRTLLTEIEAHDQAQEQAATRGTST
                     YAAHDVAQVVGAPLRMRRPERDRQWEQWCSTLVTVHMQGAAVQSGAFVARPAPAHLLG
                     VALAQEAAAVAWTHVEGLAMGDVSLRDTHDVVRASDARFLPLQRVAEHPGTALRVHAV
                     WPPAMHDVPPPHAHDTMHATLRLHVACAHEDRPHLTYDVRLAWRWRRAHAPEPPRWDC
                     HSDPGEHVVQRLYRVRWAPHTPGAADLWRADTRNVQVPGSDLLGSWHVRGLSLVRDYY
                     AELVWQRRVRHGMPTVPAWTPPALRADDAFRDLRTLWAGLHAAQPRRYTGHATCVDAL
                     VCTHRGWLTWGQRVWCELCGAFLVMRRAPRERITHAILLHRAHVALLSPDAPTLALYT
                     SSASYALAADSWASAHAWQHALAPASHIT"
     gene            <436112..>437890
                     /locus_tag="MRET_3609"
                     /db_xref="GeneID:38740375"
     mRNA            <436112..>437890
                     /locus_tag="MRET_3609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630236.1"
                     /db_xref="GeneID:38740375"
     CDS             436112..437890
                     /locus_tag="MRET_3609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486018.1"
                     /db_xref="GeneID:38740375"
                     /translation="MTSAADDVALVPGRVQRDASSLAQRRKRMLEEDDAEVMTPKTLR
                     EAYVPRPHVAHVGADLQPAVFDAPTARLVQRASPTTTKRAPAFFSPQDMASSDRAARR
                     MEEPLPYATNSSLPLPSAFQQLVTFHKAVEQALLVHMATHGAPAAEPCTSSPRRRVVI
                     PHVLTFQRLRLMVERTCRRTFDINDFRRLVWVWSHAPGVPRETSMDTGGMGFLVTRTR
                     SMDVHTRRKTYDWAIGIEMALHRAHAPPLQVQYGSPRNGASSPTPASPPPSPTRRENM
                     SHLAIWNAGIDDRRRELAHRLTQVVAAAHAQWIETHQLSLDDCLDALVPASHTALTRA
                     MMEPVTPTKRANSTGLLTPSASRSKDGHASRIAPSIDDMPPPTSPLSARTLPSTPPPS
                     THKRALGSPMRSSPQTHRLMRWHPDFALESMPPIPLAQLPPLAAPQPPAPVYPTPAPP
                     AAPAPGRSLEERIRAKEQALRSSTTHSIAQLQERSLLSRLGDVANTIYLLYMPLPSTQ
                     SQHGHESRILPLDTVLTSLEQSSSLTRAESRSCLGKLETLVPGWLEVCTLQSKTWLRL
                     HTDPATGRTLRDVRSKIRTALATYRS"
     gene            complement(<437885..>439009)
                     /locus_tag="MRET_3610"
                     /note="MRES_14520"
                     /db_xref="GeneID:38740376"
     mRNA            complement(<437885..>439009)
                     /locus_tag="MRET_3610"
                     /product="homoisocitrate dehydrogenase"
                     /transcript_id="XM_027630237.1"
                     /db_xref="GeneID:38740376"
     CDS             complement(437885..439009)
                     /locus_tag="MRET_3610"
                     /codon_start=1
                     /product="homoisocitrate dehydrogenase"
                     /protein_id="XP_027485985.1"
                     /db_xref="GeneID:38740376"
                     /translation="MRPTGRMWQRALRIGMIPADGIGREVLPVAQRVMSAAPGAPPFE
                     FVPLPAGFELFQKTGEALPQVTIDTLKNECDGAMFGSVSSPSHKVEGYSSPIVRLRKE
                     LGLYANIRPVSGPVLPGSPIKVPVDIVTIRENTECLYIKQETLEETPHGKVARAIRQI
                     SESASTRIGKKALDVALARQAMRAAAGSAQQTKVTICHKSNVLSVTDGLFRTSVRRVY
                     DSDKREHGGHGRYEGLVLDEQLVDSMVYRMFREPNVFDVVVAPNLYGDIISDGAAALV
                     GSLGLVASVNAGDTFIMGEPVHGSAPDICGKNMANPMAAVRSAALMLEYMGYTEPALA
                     IYRAVDHVLVQGQAWTPDLPGGTATTSDVEAAILRALQDS"
     gene            <439119..>439998
                     /locus_tag="MRET_3611"
                     /db_xref="GeneID:38740377"
     mRNA            join(<439119..439404,439460..>439998)
                     /locus_tag="MRET_3611"
                     /product="elongation factor"
                     /transcript_id="XM_027630238.1"
                     /db_xref="GeneID:38740377"
     CDS             join(439119..439404,439460..439998)
                     /locus_tag="MRET_3611"
                     /codon_start=1
                     /product="elongation factor"
                     /protein_id="XP_027485984.1"
                     /db_xref="GeneID:38740377"
                     /translation="MSRHRAVRNLNLDEELNEDYGNEYDAIDDLSPEDQEAMDVALAT
                     VQSTLGEPDECGVTERRMREVLWDTYFDASSAVTQLLEEKQRNEAQARKRADITVPGT
                     GTRQREQSPVGATGPAPMSELLRQSAQKRGASGAAPNKALQKLQAYRERKKALATQGV
                     QQPLISHAQKPDIGTAQQSAQSPTPPPPAQPAVERSKTPSGARIDTLFPHTACPAPPS
                     RFGQLVQSRPSKQRASACSVLAKQSEADVERLRAVFSELSPDDRVLQARAGTRLVD"
     gene            <440072..>441520
                     /locus_tag="MRET_3612"
                     /note="MRES_14525"
                     /db_xref="GeneID:38740378"
     mRNA            <440072..>441520
                     /locus_tag="MRET_3612"
                     /product="elongation factor 1 alpha-like protein"
                     /transcript_id="XM_027630239.1"
                     /db_xref="GeneID:38740378"
     CDS             440072..441520
                     /locus_tag="MRET_3612"
                     /codon_start=1
                     /product="elongation factor 1 alpha-like protein"
                     /protein_id="XP_027485987.1"
                     /db_xref="GeneID:38740378"
                     /translation="MKVSDSPTSSAPGTPGTPSRSHMPPAPKLAYTREHILHELQQQE
                     QNCQREIGLVVVGHVDAGKSTLMGRMLVELGHVTDREHHQNVRNSSKAGKGSFAYAWS
                     LDSSEEERAHGVTIDVAHDTFRTERTLFHLLDAPGHKDFVPNMISGAAQADAGVLVVD
                     AITGEFESGFSPQGQTREHATLLRSLGVQQLVVAINKLDAMDYLQARYEDIVAQLTPF
                     LSHCGFDMSHVQFVPVAGVTGENLRARSESGSLATWYRGDTLAEALDKLQQPSRMYDA
                     PLRMPVNNVFKGGSLISSGLGVSGRIVSGIVQVGEVLRALPGDAWGIVKAIECENDTR
                     PWAAAGAIVTLYLTQIEANEVSVGSILCVPSAPVPLCREVLVQLLVFAPTYPILPGTA
                     VEVFHHSAEIPAQITELVSLLDRASGDVIRLRPRVLSRHATAVVRVSLGRRGHGAGFP
                     LEVFSTNKDMARLLFRMHGETIAAGIIIEATP"
     gene            complement(<441523..>442701)
                     /locus_tag="MRET_3613"
                     /note="MRES_14530"
                     /db_xref="GeneID:38740379"
     mRNA            complement(<441523..>442701)
                     /locus_tag="MRET_3613"
                     /product="Myb-like DNA-binding domain protein"
                     /transcript_id="XM_027630240.1"
                     /db_xref="GeneID:38740379"
     CDS             complement(441523..442701)
                     /locus_tag="MRET_3613"
                     /codon_start=1
                     /product="Myb-like DNA-binding domain protein"
                     /protein_id="XP_027485986.1"
                     /db_xref="GeneID:38740379"
                     /translation="MTQHDGGWSQDKDTELVTLEQLYEQLNTMHTAGVAQEHAQIHAL
                     QAIESERRIVEDALRDLDMEEDNGTQEYVVRPIDEASKYAVPHLSHEQIQAIPLLRTH
                     AEERRRMRALLSTPPWSARDIECLQTSVQNESLRQNTLYGTPEAKDWSRISVQVPYHT
                     PRDCRTRWTMTQRPGINHARWSTAEKKQLLAYVDAVSIPSWEEAAAKLGTGRTGYQAL
                     EMYQRSAKRQVEWTPELDKALLQAARAVGPDWKTIAQKLGYPVSCAFQCHQRHNKLKS
                     SAMVLGRWSPEEDAALRAAVAQFGCDWKRIEIHVAGRTGQQCRERWVGRLANIPEGKK
                     KAARRTWTKEEDDRLRASMEKCQSWVEVAAQVGGRTDKMVRERWLLLKRRDEAQHAST
                     "
     gene            <442741..>443382
                     /locus_tag="MRET_3614"
                     /note="MRES_14535"
                     /db_xref="GeneID:38740380"
     mRNA            join(<442741..443066,443093..443154,443179..443264,
                     443290..>443382)
                     /locus_tag="MRET_3614"
                     /product="trafficking protein particle complex subunit 2"
                     /transcript_id="XM_027630241.1"
                     /db_xref="GeneID:38740380"
     CDS             join(442741..443066,443093..443154,443179..443264,
                     443290..443382)
                     /locus_tag="MRET_3614"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 2"
                     /protein_id="XP_027485981.1"
                     /db_xref="GeneID:38740380"
                     /translation="MSYYFCIVGTRDNLLYEADLSPPSTTSAGGAQEAESQRTSSVFG
                     FTSALGQWTGGFPLLPTADPTDEVKREESKFTSTSTATNERHLLQMIAHGSLDSLEDR
                     QFLESNIYFKNLDRIYDWNVSVFLVPCNIKFILLHQHKHEEGIRLFLMDVWELWVKIF
                     MNPFQDLDASIQSTSFDTRIRASAKRHL"
     gene            <443454..>443741
                     /locus_tag="MRET_3615"
                     /db_xref="GeneID:38740381"
     mRNA            join(<443454..443470,443495..443677,443702..>443741)
                     /locus_tag="MRET_3615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630242.1"
                     /db_xref="GeneID:38740381"
     CDS             join(443454..443470,443495..443677,443702..443741)
                     /locus_tag="MRET_3615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485980.1"
                     /db_xref="GeneID:38740381"
                     /translation="MSRYVVVFKSEAAESQIDAYKHDVEKQGGEVHQAYHASFLRGFS
                     ATLPATYASQLEQATKDGTHPSIEYIEKDSSVHTK"
     gene            complement(<443742..>445380)
                     /locus_tag="MRET_3616"
                     /note="MRES_14540"
                     /db_xref="GeneID:38740382"
     mRNA            complement(join(<443742..445036,445065..>445380))
                     /locus_tag="MRET_3616"
                     /product="protein kinase C substrate 80K-H"
                     /transcript_id="XM_027630243.1"
                     /db_xref="GeneID:38740382"
     CDS             complement(join(443742..445036,445065..445380))
                     /locus_tag="MRET_3616"
                     /codon_start=1
                     /product="protein kinase C substrate 80K-H"
                     /protein_id="XP_027485983.1"
                     /db_xref="GeneID:38740382"
                     /translation="MMLWAWLLFVVALSTHVYAQVRGVAPKDAHLYEPQNASGYKEPM
                     FRCLRSGKLIPFINVNDDYCDCEDGTDEPGTSACSNGRFYCENKGHFPRYIRSSRVND
                     GVCDPECCDGSDETDGKIQCPNVCEKNHKEYKRRMAQEEKVHTAGSRVRAKYIAKARS
                     DRQARMNKLQSLKAKLPELILAEDSLRSAKENSQSAEELVQEQKRQNPLYKKLEERHR
                     ALDTLLSATESALDELRVVARFIERLDKDHAVESIERAKESFETWLGTNDDDDAIQSI
                     EDRIRTIREEAPSRDEIRALSQESIYDMLDYMPDDDDALDASSMLYHIPSYLPDALIP
                     LYERALSWISRTLVHLNLIKPSRVRSSAWQKDGLQAAHDKHRESEEALDNLKQEIQME
                     EEALNQWDDKYGREGEFFSLQGKCVTSDMGSYTYELCFGEKTAQISNNDGYRFNLGYF
                     KHFDMDQQYDRSDDRHYLSMLFDDGQVCWNGPPRSSRITLECGEEEALLHVFEAEKCT
                     YQMHVKTPAVCFDRKKTDNEAAVNHDEL"
     gene            complement(<445460..>446494)
                     /locus_tag="MRET_3617"
                     /note="MRES_14545"
                     /db_xref="GeneID:38740383"
     mRNA            complement(<445460..>446494)
                     /locus_tag="MRET_3617"
                     /product="lysophosphatidate acyltransferase"
                     /transcript_id="XM_027630244.1"
                     /db_xref="GeneID:38740383"
     CDS             complement(445460..446494)
                     /locus_tag="MRET_3617"
                     /codon_start=1
                     /product="lysophosphatidate acyltransferase"
                     /protein_id="XP_027485982.1"
                     /db_xref="GeneID:38740383"
                     /translation="MGRIFRGIASFSTLSFLLLVLASARSRKMRYHLNAMLYVFGACV
                     CSSIGMVYAIFSSFIPGKRLHTNFVVARSFFYFTRPLIGLDVTIENEHYLQNRPAIMV
                     GNHQSMVDTVYLGRMFPTSSIILGKKELLYVPFLGQFMWLGGNVFVDRKNRASAIKTM
                     DSIGAYMRKNNLMMFIYPEGTRSHLATPDLLPFKKGAFHLAVQTQLPIIPVVCENYYR
                     LYDSKTRFEGGRLRVAVLPPIETKGLTEQDVGPLSENVRKVMLDQLVAFDRELDQRDV
                     DMTMHPSPTSQKPRLYGLAGLAARLIGTGNQTSYKRSLDKIAQKQKVSKGPAPSDYGL
                     VSEGSHAKTA"
     gene            complement(<446603..>449428)
                     /locus_tag="MRET_3618"
                     /note="MRES_14550"
                     /db_xref="GeneID:38740384"
     mRNA            complement(<446603..>449428)
                     /locus_tag="MRET_3618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630245.1"
                     /db_xref="GeneID:38740384"
     CDS             complement(446603..449428)
                     /locus_tag="MRET_3618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485989.1"
                     /db_xref="GeneID:38740384"
                     /translation="MDALEPTPLHMARRIGLRGPRAPPSVAGSGTPSITSSVSDMSHL
                     HLTSEQDRDTSTSASDPESDAGVEADHHVLPPNFREIRARAAEQRRARAEARVSSQEQ
                     DPPADEIPRLAINSIAEEPVVTETVSEPESEATQGPLASPRPQPPLRAPMALPPFLGA
                     RASQLYETPQRAASESAAPESQALEVPMLSEPRPRAASQMSDHPPHTTRGPPPAPSAQ
                     SPNTQRSRRRESQRRLSLLRGQRREPNHSLLAALSAQGQTGPGVLLPSLYGSLSNEPA
                     PTQLRPAGVSYGQHAHGRVGAPWQADTSLGVTSSDGHGYVHPRLSERILASGPSVTNL
                     HPASSSVHMSPGAELRIQTAQLRHAHVQPGSVLFPAGITSALCTEAKARDAHMSRKFE
                     ENSALSFSWVIEDAALLADEVAHGSNAASGFGKSEAWKLQPLFGEERWRLELVRRPKV
                     QTPQLHTPTKSSTASKKDVPHVLCLYLSYLGLMAMPISAELPTHVMIGIRPAQRVHKL
                     PRSLNPSFLWRDFFSFTFQQDNDTVVFDRLPDLADVLADPDVAESNAFDLVVQITTGP
                     SVLPECDVRGSSGISGMRLPFEAPEMASIPQGLLQGLKALVDDGSSGDLMITVLEKGF
                     EQRPTQELAESVGLTTFIHPWPVGTPMPDFEDASDPDAYPPVFVRDRVLWAHSSILRE
                     RSDFFATMIDSQFSEGALHETQGSRGRTRDAWRRPYRILRIPCADFVTMYWFLRYMYT
                     EEVELLKEEDVQGLALDDFWILNQPHPSAKPDFKWRLVEGVDDWDADIFPPMEEGQPP
                     TLSEGHAQRLEDTRARAQEKSATAMDPHPHPPMLPVPPASALALYRLAHRYGVQPLCD
                     LTMTHIMSVLTPHNAMHYLLCTALLSQIQDAIQEYIIQNWKAVSSSPEFEYCCDQVST
                     GEWGPLAGRSLLSLMRQLRQTNDTPST"
     gene            complement(<449511..>450778)
                     /locus_tag="MRET_3619"
                     /note="MRES_14555"
                     /db_xref="GeneID:38740385"
     mRNA            complement(join(<449511..450541,450568..450674,
                     450701..450717,450743..>450778))
                     /locus_tag="MRET_3619"
                     /product="TBC domain protein"
                     /transcript_id="XM_027630246.1"
                     /db_xref="GeneID:38740385"
     CDS             complement(join(449511..450541,450568..450674,
                     450701..450717,450743..450778))
                     /locus_tag="MRET_3619"
                     /codon_start=1
                     /product="TBC domain protein"
                     /protein_id="XP_027485988.1"
                     /db_xref="GeneID:38740385"
                     /translation="MSGIVTLEEFLEILNEEQYIDIVKLRNYARHGIHPQVRGEVWLY
                     LLGVLSADKSQEMTTVRNKFLEYEGVSKRIPSIEKDVRIEVLRYFRHRMNPTQQRHKQ
                     DANSIIRSSRSIDNFPEYSHESGQTTAESGVGGPHIPRILPSTQYGLAIMRENSNVDD
                     SELINDQRRLSHCVENVLCAYLNRHLVSQEEPAQPERESGALQSEYLPVHMQKEFSWP
                     FHPHSHPGDQINNFHPSMVYLCAPFARCVRAEAGMYFAFDRLMGMIREYNETCPIPQR
                     VATFLTLFRKTLPELYAYFEAEEVDILSVATSWLQHLLAREMQSHDLMRLWDTYFAVP
                     DLLDLHLYVCLAILTNCRDALEDLDRSETMSMLFSLPPLNVDRIISDAVNIRLSLEHD
                     EMYE"
     gene            <450895..>451382
                     /locus_tag="MRET_3620"
                     /note="MRES_14560"
                     /db_xref="GeneID:38740386"
     mRNA            join(<450895..450971,451000..451346,451372..>451382)
                     /locus_tag="MRET_3620"
                     /product="Rab5-interacting protein (Rab5ip)"
                     /transcript_id="XM_027630247.1"
                     /db_xref="GeneID:38740386"
     CDS             join(450895..450971,451000..451346,451372..451382)
                     /locus_tag="MRET_3620"
                     /codon_start=1
                     /product="Rab5-interacting protein (Rab5ip)"
                     /protein_id="XP_027486085.1"
                     /db_xref="GeneID:38740386"
                     /translation="MSAGVTVWDQPHDPESVAHNISQAYGFRSLTLSIAGAIAGVLGL
                     QNLWGFGFFLVSVAFVNVMLIAVNTSYKPEQYFVIVPPPVLTTALERLVPSKAEQLRK
                     PQSLIRRAVFLGQWVLFQGAQENILSFMLWWTLWFGLVHVYD"
     gene            complement(<451414..>452781)
                     /locus_tag="MRET_3621"
                     /note="MRES_14565"
                     /db_xref="GeneID:38740387"
     mRNA            complement(<451414..>452781)
                     /locus_tag="MRET_3621"
                     /product="COMPASS component SWD1"
                     /transcript_id="XM_027630248.1"
                     /db_xref="GeneID:38740387"
     CDS             complement(451414..452781)
                     /locus_tag="MRET_3621"
                     /codon_start=1
                     /product="COMPASS component SWD1"
                     /protein_id="XP_027486086.1"
                     /db_xref="GeneID:38740387"
                     /translation="MNAQLLNPFARDTPERIESSLENASATCLAFNRGRGLFAGQYLA
                     VGRSDHYVAIYDLELRTILRWFLGHVKPITSVSWSPYGRYLASSSLDWNVNIWDLRHG
                     PAKCVRTLRFTAPVLQVQFSPSSSRTLLAVLESREAFLVRFPSWEDVQSTTMSTEPRR
                     IALHGTPDTSAACFTPDGLWILTGSVKGVIRLVNGQDGRLVHDLPCQIGASMIREIVL
                     DEQSRHVAVNMNDRTVRTLRVTYNDGCEMPTGLTPTHKFQDLVSRTPWSGIGFSRGAE
                     YVIGGAAQDPTHNIYIWDMDAGVLVKILEGPREPLVYACWHPIKPLIASIASFGDVYL
                     WSTKTNEIWSAYAPGFEELEKNVEYDEPENEFDLDEETDDTRQRQEEADRIDLFANGP
                     VPDTSLPPTGVATDLTRTHSTLAAELRPTAVWSPDMFRDDDDQVAFIIPPLLEDYTLD
                     EDVKE"
     gene            <453021..>455747
                     /locus_tag="MRET_3622"
                     /note="MRES_14570"
                     /db_xref="GeneID:38740388"
     mRNA            <453021..>455747
                     /locus_tag="MRET_3622"
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpB"
                     /transcript_id="XM_027630249.1"
                     /db_xref="GeneID:38740388"
     CDS             453021..455747
                     /locus_tag="MRET_3622"
                     /codon_start=1
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpB"
                     /protein_id="XP_027486087.1"
                     /db_xref="GeneID:38740388"
                     /translation="MSGFDFTDRAQTSLAAAFQLAKDYAHAQLAPAHIALSLFNDDTS
                     NSTGVQSTNKDSQSLFKSICEKTGIDISSLDSKLRTALRKIPQQSPAPDDVSLTGAAN
                     KVLKNAQQFKTQQRDSFIAQDHLLLALLEDSNIASMLKDAGLANEELFKNALNQARGG
                     RHIDSKTAEAGYDALNKYCSDLTALAAEGKLDPVIGRDNEIRRVVRVLSRRTKNNAVL
                     IGSPGVGKTAVVEGLAQRVIDRDVPPNLLGKIYSLDMGALMAGAKYKGEYEERVKSVL
                     AEIEKMTNDGTPCILFIDEMHLMMAGKGGDSGMDAANLLKPMLARGKLRCIGATTLNE
                     YRQSIEKDAALERRFQQVLVEEPTVEDAIAILRGLREKYEVHHGVRILDSALVSAAQL
                     AKRYLTARKLPDSAIDLVDESCADVTVSRETVPEAIDTLERRKVRLQIAMTALEREKD
                     PQSKERLTQTRQELAQLDDELAPLKAEFEAQRAKGDELNNVRRKIEELRAKASDAERR
                     YDLETASDLMYYAIPDLEKRADKLQEQARKDEAEGKTNLANTVTSENIASIVSRWTGI
                     PVTKMMESERVKLLRLEKILQRDVVGQEDAVKAVAQAIRLSRSGLSNQSRPIASFLFC
                     GPSGTGKTLMSKTLASYMFDDPDAIVRIDASEYSEKHSISRLIGAPPGYVGFDEGGVL
                     TEAVRRRPFSIVLIDEIEKAAREFVQLFLQVLDEGRLQDSQGRQVSFRNTIIIMTSNL
                     GSSFINESEEEDISEPVRQLVQSAISAHFPPEFINRIDSIVTFRKLGRMDVRRIVDIR
                     LKEVQKRLIENGRHSRIMVDEEAKNWLGSIGYSPTMGARPLGRAIQDQLLNPLSLLLL
                     RGQIHNDDPEIHVTFDKYRNALTVQANHEAVPGTLDDDDVDMEEDDLDEPLD"
     gene            complement(<455792..>456910)
                     /locus_tag="MRET_3623"
                     /note="MRES_14575"
                     /db_xref="GeneID:38740389"
     mRNA            complement(<455792..>456910)
                     /locus_tag="MRET_3623"
                     /product="transcription factor"
                     /transcript_id="XM_027630250.1"
                     /db_xref="GeneID:38740389"
     CDS             complement(455792..456910)
                     /locus_tag="MRET_3623"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027486088.1"
                     /db_xref="GeneID:38740389"
                     /translation="MNSSQNQNALSSSCMADRPDRPPCPPTRGPADTESTLPRSSSKG
                     EIQASYELPPNQSALSAIDQSLCRASTELASCACLPAPRPSSDGQNSSSDVPPAQVSS
                     CSTHVPPVSKLSSWPQESHRDEPMVRDGGENSHGIKPESNDEARTPSPSGSLSQGPLP
                     DDDVEECSSFKRKSFLERNRKAAQKCRLRKKEWCASLEAKVKYLESVNESLQNTVISF
                     RSEIVCLQSKLEELQQQLHQQQQFQHQHVHRAVDVCFDPGKHHAVSHEMHPRCPHDGM
                     HTGDYPTFHEYLSHSPHASPSPSYAPHPSIVHTSEPLLPSRMAPYSPLKRGFHSAPPK
                     SAPDSRAPHRYAPSSSSYGSPYASSHLPPLYMSSRGPI"
     gene            <457336..>458226
                     /locus_tag="MRET_3624"
                     /note="MRES_14580"
                     /db_xref="GeneID:38740390"
     mRNA            join(<457336..457422,457463..457536,457566..>458226)
                     /locus_tag="MRET_3624"
                     /product="RNA recognition motif domain protein"
                     /transcript_id="XM_027630251.1"
                     /db_xref="GeneID:38740390"
     CDS             join(457336..457422,457463..457536,457566..458226)
                     /locus_tag="MRET_3624"
                     /codon_start=1
                     /product="RNA recognition motif domain protein"
                     /protein_id="XP_027486082.1"
                     /db_xref="GeneID:38740390"
                     /translation="MNPEEVQNPPATTTAPAMTSSRKSVRITKIHVRDISLQTNLASL
                     LDLLGQAGEVVSMDVRVIQRRGALSIKCQAAYKNATSAATAAETLNGAELDGSKLIVS
                     LHEPKQRQSSAAKSTDAEQEEDKQKSQPADQQANDAAPQPASNAAATGSTKKKSIRKP
                     KSKPARGEPSETMLYVSHLAYSVNNDTLMELFSPYNVKSANVVYNRFRSSKSRGFAFV
                     DFHTHEDQQRAMAEKNGLELMGRVLNVTVALQEAQPQQEAPTESAEPAEPTADAA"
     gene            <458415..>460035
                     /locus_tag="MRET_3625"
                     /note="MRES_14585"
                     /db_xref="GeneID:38740391"
     mRNA            join(<458415..459923,459955..>460035)
                     /locus_tag="MRET_3625"
                     /product="aldehyde dehydrogenase (NAD+)"
                     /transcript_id="XM_027630252.1"
                     /db_xref="GeneID:38740391"
     CDS             join(458415..459923,459955..460035)
                     /locus_tag="MRET_3625"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NAD+)"
                     /protein_id="XP_027486083.1"
                     /db_xref="GeneID:38740391"
                     /translation="MTRSVLTSTPVDTISALIEDLRRVFLSGKTRCVTYRKNQLKQLC
                     FLVHDNEQAFVDAIYRDLGRPKMETVFAEIIGFKNDILTTIAHLDKWTRDRYVYAGLP
                     FLSHGTKIRKDPKGTVLVLGAWNYPITVQLGPVIGALAAGNTVVLKPSELSMHTAQLI
                     ADLWPKYMDPDTSAIVNGGIAQATALLDERFEHIFYTGSGRVGRIVAEKAARWLCPTT
                     LELGGKSPVIVDASADLRIAARRTLWAKAFNAGQTCIAPDYVLVERKVQDPFVQELVR
                     AKREFFVSMDKSVRDFGRIVNDNHWKRLHGLITSSKADVVMGGTEGADQPTKFIPLTV
                     LNNVDPREAVMSEEIFGPILPIVPVDDVKAAVQFINERDQPLALYMFTSRSDVQEYIL
                     TYTRSGGVVSGDMLLHYAIDALPFGGTGPSGYGAYHGKAGFDCFTHERAVVEAPSHGA
                     VGHLIESIMAKRYPPYSEAKLSFFRHLLSKWILFGRPADATASLTSIDQPTSRSHLNS
                     LSRYKKLLFLLVVLLVLVRSV"
     gene            complement(<460063..>461928)
                     /locus_tag="MRET_3626"
                     /note="MRES_14590"
                     /db_xref="GeneID:38740392"
     mRNA            complement(<460063..>461928)
                     /locus_tag="MRET_3626"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027630253.1"
                     /db_xref="GeneID:38740392"
     CDS             complement(460063..461928)
                     /locus_tag="MRET_3626"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027486084.1"
                     /db_xref="GeneID:38740392"
                     /translation="MTGRHTRVRRAHLTSAYHELGKQLTSGKLSVVGQYTLQRSIGQG
                     TYGKVRLATHRLTNERVAVKQIPKQHVASLTREIHHHRRLHHPHVLQLYEVILTESHI
                     WMVTELCSGGELYDVVESRGGLHESEAYTYFAQLCDAVAYIHAQGIVHRDLKLENILL
                     DAQGHVKVSDFGFTREFEPHRWLRTRCGTQAYCAPEMLDGRPYVGEQVDIWSMGVILY
                     ALVCGQLPFDDDNDAVLHDCILHASPHLPSQLSVELRDLIGSILSKDGARRPSIKDIV
                     SHSWFQLHADPVQVDHLAHISTPPLPLMESAEEKELYAMLQELGLAVGQIRHSVLTHA
                     CDSAGAFWWLLLHRRRRRAASYTLRVPGAYKDAPELLPSVSSPDPSARSSPVMPKPAR
                     PISMTRRTSSRLSRTSSARRSSLSSTDSHVSMSLRRHKSSMSSVLHAPLPRRRRDSES
                     IVYRLRKESHHALAPVRALHEKHRSLDEASLQRKGMNLTSRTTPPVALGTSSLSPLRI
                     RCRRPLVTPKRPSLLRVSKPERKLPPEDEEGDWIDEEHEFAGGLGQQPTLLLDAAPGL
                     SQRRGSPCPLLRPKLWTQGDKSVSSTPLRQKMRRDVPATLIEEEDDNSSDPSSVM"
     gene            <462010..>462825
                     /locus_tag="MRET_3627"
                     /note="MRES_14595"
                     /db_xref="GeneID:38740393"
     mRNA            <462010..>462825
                     /locus_tag="MRET_3627"
                     /product="phosphoserine phosphatase"
                     /transcript_id="XM_027630254.1"
                     /db_xref="GeneID:38740393"
     CDS             462010..462825
                     /locus_tag="MRET_3627"
                     /codon_start=1
                     /product="phosphoserine phosphatase"
                     /protein_id="XP_027486027.1"
                     /db_xref="GeneID:38740393"
                     /translation="MTGRAERLAPAWSSWRRRPLPTMSTPKYGDAKYIFLTDFDGTIT
                     LLDSNDHMVDTVGMGYAERRKINDAIVAEKIGFRDGFRQMLESVHRPFEEMKELTRRD
                     VKLDPGFKEFHAFAKENHIPIVVVSSGMTPIIRSIFSNLIGEEEASKLEIISNDVEFT
                     DPEKKGDTWSIVYRHPDNVNGHDKSLSILPYRDLPQRPLLFFAGDGISDISAARHADV
                     LFVKDKKDNDLATYCDKHNIGYHLFKDWTVPKHMIQQWLNGDLTREQLITRRA"
     gene            <462920..>463672
                     /locus_tag="MRET_3628"
                     /note="MRES_14600"
                     /db_xref="GeneID:38740394"
     mRNA            <462920..>463672
                     /locus_tag="MRET_3628"
                     /product="20S proteasome subunit alpha 2"
                     /transcript_id="XM_027630255.1"
                     /db_xref="GeneID:38740394"
     CDS             462920..463672
                     /locus_tag="MRET_3628"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 2"
                     /protein_id="XP_027486080.1"
                     /db_xref="GeneID:38740394"
                     /translation="MSAGAGEGAYSFSLTTFSPSGKLVQIEHALAAVGQGTTSLGIKA
                     SNAVVIATEKRPPSPLVDDSALEKVALVCPNIGIVYSGMGPDFRILLARARKIAQSYW
                     KIYGEYPTTKVLVQEIATVMQDATQSGGVRPFGVSLLIAGFDAVRGPSLYQVDPSGSY
                     FMWKASAMGKNMTNAKTFLEKRYSDDISLEDAIHTAILTLKEGFEGQMTEKTIEIGIV
                     GHATKSIVGEGKEPIPVFRRLTEQEVKDYLAL"
     gene            complement(<463674..>466001)
                     /locus_tag="MRET_3629"
                     /note="MRES_14605"
                     /db_xref="GeneID:38740395"
     mRNA            complement(join(<463674..465617,465648..>466001))
                     /locus_tag="MRET_3629"
                     /product="ribosome biogenesis protein ENP2"
                     /transcript_id="XM_027630256.1"
                     /db_xref="GeneID:38740395"
     CDS             complement(join(463674..465617,465648..466001))
                     /locus_tag="MRET_3629"
                     /codon_start=1
                     /product="ribosome biogenesis protein ENP2"
                     /protein_id="XP_027486081.1"
                     /db_xref="GeneID:38740395"
                     /translation="MSAAQDPARVYTVSGGSSSAPEEASYNSTSLPDILRRSGSSNKR
                     KKRKAAIENDKILSKIELIQDFEFPVASNKIRCTHDGLHIMATGTYKPQIRVWECEQL
                     SLKFERHTDAENVDFLFLSDDWTKSLHLQSDRSLELHNQGGMHTRVRLPRFGRALGYH
                     YPSADALIGAAGNEVYRLNLDQGRYLAPYTLGQQGNVVHGCNAIDVNPAHGLLSFGTD
                     GSGVVELWDPRMRRQAGSLSVATRTVLDAALLAARRQLPGVQLGEDADAEAVAQASST
                     LAVTSLASAADGLNLAVGTNTGHVLLYDLRMDKPYTTKDQGFGLPIQSLSWPGDANVD
                     TPTRTQSEADGKVLSADAKVIKIWDKDSAENLVSVAPAGPLTNLNHVMHYPGSGLLFA
                     AVEATQMAAWYVPALGPAPRWCSFVDNITDEIDRTDTAVATGDSGVNAYEDFKFVDHA
                     ELERLELAHLIGTPLLRPYMHGYFLSLKLYERARLLAHPQAYDEAKQRAIRARMEREA
                     ESRVRSVQNAKPSRQVKVNRPLADKLASDEASTLLHDDRFKELFTNPEFQVDETSREY
                     ALLHPSASIQSRPAPRETERKLVPAVQEDMDSDNESLDPDQEESQSESESASEPEVGT
                     PPKPAAKPSSAPPAKPLHMPRMVQSFDATEDDPQAKDRPLGDRARRQPAQARVSDDAL
                     FTGTSISWTPSAASAETDAPKKRTKKAKKSEHETFGMGLSKGAGVEQGYGVDALSDEA
                     RSGRTQRRKPTRSASKNTFRAASRQ"
     gene            <466131..>466598
                     /locus_tag="MRET_3630"
                     /note="MRES_14610"
                     /db_xref="GeneID:38740396"
     mRNA            join(<466131..466514,466542..>466598)
                     /locus_tag="MRET_3630"
                     /product="large subunit ribosomal protein L11"
                     /transcript_id="XM_027630257.1"
                     /db_xref="GeneID:38740396"
     CDS             join(466131..466514,466542..466598)
                     /locus_tag="MRET_3630"
                     /codon_start=1
                     /product="large subunit ribosomal protein L11"
                     /protein_id="XP_027486048.1"
                     /db_xref="GeneID:38740396"
                     /translation="MSKAGGKQAVATIVKLLVPAGSASAQPPVGPALGAKGVKAIDFA
                     KEFNARTSDLEPGLLTPTVVTIQPDRTFSFRTLTPPTSLLLKRAANITTGARKPGAEI
                     TGTVSIKHIYEIAKIKMKDVDITEKEMCKVVAGSARSLGIKIVR"
     gene            complement(<466694..>467476)
                     /locus_tag="MRET_3631"
                     /note="MRES_14615"
                     /db_xref="GeneID:38740397"
     mRNA            complement(<466694..>467476)
                     /locus_tag="MRET_3631"
                     /product="sorbose reductase"
                     /transcript_id="XM_027630258.1"
                     /db_xref="GeneID:38740397"
     CDS             complement(466694..467476)
                     /locus_tag="MRET_3631"
                     /codon_start=1
                     /product="sorbose reductase"
                     /protein_id="XP_027486047.1"
                     /db_xref="GeneID:38740397"
                     /translation="MVFEIKLNGTVVTTGGNRGIGLAISKSCAQAGANVAMLYHSNPE
                     AEKAAEEVAKEYGVKVKAYKCDVSDAELVKKTIQQAEADLGQITGLAANAGVSIVKPA
                     LELTPDDFHKVFNVNVLGVFNACKAVAQHWVDTKFDKGSIVVTSSMSSEIYNQKGPND
                     PLTQVFYNASKGAATNMVKGLAAEFAKYNIRVNALEPGFCNTEQTSVMDKSIRDYQAS
                     SVPMGRFSEPHEQGAPCVFLLSEYASYMTGGHIRPDGGFTLW"
     gene            <467784..>468344
                     /locus_tag="MRET_3632"
                     /note="MRES_14620"
                     /db_xref="GeneID:38740398"
     mRNA            <467784..>468344
                     /locus_tag="MRET_3632"
                     /product="iron-sulfur cluster assembly enzyme ISCU,
                     mitochondrial"
                     /transcript_id="XM_027630259.1"
                     /db_xref="GeneID:38740398"
     CDS             467784..468344
                     /locus_tag="MRET_3632"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly enzyme ISCU,
                     mitochondrial"
                     /protein_id="XP_027486046.1"
                     /db_xref="GeneID:38740398"
                     /translation="MISGLTTSVLRTGIARMPRAMVAASRPVRMYHEKVLDHYNNPRN
                     VGSFAKGTKDVGIGLVGAPACGDVMKLSIKVNEEGVIEDVRFKTFGCGSAIASSSFMT
                     ERVKGMTLDEAAAIKNTEVARELSLPPVKLHCSMLAEDAIKSAIKDYRKNRLESGNTK
                     QGHIEIMQDAATGQTTATPHVGSGTV"
     gene            complement(<468401..>469166)
                     /locus_tag="MRET_3633"
                     /note="MRES_14625"
                     /db_xref="GeneID:38740399"
     mRNA            complement(join(<468401..468625,468665..468817,
                     468856..469008,469040..469082,469108..>469166))
                     /locus_tag="MRET_3633"
                     /product="charged multivesicular body protein 6"
                     /transcript_id="XM_027630260.1"
                     /db_xref="GeneID:38740399"
     CDS             complement(join(468401..468625,468665..468817,
                     468856..469008,469040..469082,469108..469166))
                     /locus_tag="MRET_3633"
                     /codon_start=1
                     /product="charged multivesicular body protein 6"
                     /protein_id="XP_027486045.1"
                     /db_xref="GeneID:38740399"
                     /translation="MGTSQSKGVRVTKQDRAVLDLKVQRDRVRQYQRKLQQVLDREHD
                     IARQAVREGHMERARLALRQRAYQNGLIEKTDQQLATLQELVSTIEFAQLEQSVLYGL
                     SQGSEVLKQIHEETRLERVEQILDTAAESQHYQNEINDMLSSTLTADEQQSVEEELVR
                     IASQAQEMPDAGTHHTTMEPTLPSAPKHDMARTSSGRERTHEVLVTEHAS"
     gene            complement(<469228..>470280)
                     /locus_tag="MRET_3634"
                     /note="MRES_14630"
                     /db_xref="GeneID:38740400"
     mRNA            complement(<469228..>470280)
                     /locus_tag="MRET_3634"
                     /product="ribosomal RNA-processing protein 36"
                     /transcript_id="XM_027630261.1"
                     /db_xref="GeneID:38740400"
     CDS             complement(469228..470280)
                     /locus_tag="MRET_3634"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 36"
                     /protein_id="XP_027486052.1"
                     /db_xref="GeneID:38740400"
                     /translation="MSRADIGRDEAVPTRGDVVSEDEYDAEEMEDSSEEEEGDGYAQF
                     IDPDDEESDSEEEEVDEEDALRREIESIPYDKLLKARRAMSSSQLGGDVSETESIQAK
                     RAMVKQQLREMGAKSRAKDTAKKQSLGTRETKSAPTIMSTRRPVSRMRHVVDPIPRAK
                     SRDPRFDSLSAGPVNHDLHTKSYGFLSELYQNEIKQLREKHGKLKRAEMHHAGPRAKS
                     QQALDIRQERDQVEQSLRRAESLQNERIRRERERSVKSEFKKENQRRVDAGLRPYFPK
                     KAQFHEAVLRKQFESMSNGTGSSAALRKSMDRKRRKDAQKEKKSLDSALGGGARTDLA
                     SHRPGGARPHKRGRRG"
     gene            complement(<470331..>472697)
                     /locus_tag="MRET_3635"
                     /note="MRES_14635"
                     /db_xref="GeneID:38740401"
     mRNA            complement(<470331..>472697)
                     /locus_tag="MRET_3635"
                     /product="U3 small nucleolar RNA-associated protein 14"
                     /transcript_id="XM_027630262.1"
                     /db_xref="GeneID:38740401"
     CDS             complement(470331..472697)
                     /locus_tag="MRET_3635"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 14"
                     /protein_id="XP_027486051.1"
                     /db_xref="GeneID:38740401"
                     /translation="MSRRVHRRRRERIMPVEDDSSSEDRDSSHIRGPRVFDDSDDEPE
                     GIQGDDEEIDSDEAFGEDDEYDMGGRNDDDAQEEDEEGEDMVALSNLLDEAPDEDEAP
                     AHVDEEEDAEDDFGIDDPDWDAIWSKKRAHTDDTSMPKKRTARPERTEAVGEATEAAG
                     SSDVKLSLQDLMAHDSGTSLSNVQALAEQRSSKGSQPTASKRGGGVLHAPLPAPVQDR
                     LDRVEAYKLSKEEVEGWAPTIKRIREADHLSFPLQPPAQPPAPSNAGLTASFAPTTDM
                     EKSVASLLHEGGLSEKQVAEQEGLVLRDMDPAEAGKRLAELRRMRELMFRAEQKARRA
                     NKIKSKTYRRIHRRERERMKQQEAQDLQDDDDDEEQRYQAAKDRAKERATLRHKNTGK
                     WAKFHASRNDDASQEARLAVEDQLRRGEELRKRIHVEDSDEESLASMHSDDREAAFDE
                     LESFARKEAEQDERDAQALEQSGKKSKSLLHMKFMQDARDKQSRETQETIASLREELE
                     HQDDTVNERPVGRAVYSQGTKGHDATLPANPFHTGASNPWLRQSTSGGTSKQTPQVLV
                     GKDSRAATRSIHRTERHAARGDEARASAAEDATLAIDPTAQLEALSSESEAEPTEISR
                     HARGKRGRGKRNNAPLQRDLVAEAFAGDNVALDFAKEKRAMIQADAPQEQDMTLPGWG
                     SWGGKGVRHRQKKNPALIKKIDGLDPSRRKDFGMEHVMINERQDKKASKYKAKDLPFP
                     YTSAAQYEAAMRTPLGSEWNTRTQHQRLTMPRVTTKMGQRIDPIQRKF"
     gene            <472812..>473354
                     /locus_tag="MRET_3636"
                     /note="MRES_14640"
                     /db_xref="GeneID:38740402"
     mRNA            <472812..>473354
                     /locus_tag="MRET_3636"
                     /product="60S ribosome subunit biogenesis protein NIP7"
                     /transcript_id="XM_027630263.1"
                     /db_xref="GeneID:38740402"
     CDS             472812..473354
                     /locus_tag="MRET_3636"
                     /codon_start=1
                     /product="60S ribosome subunit biogenesis protein NIP7"
                     /protein_id="XP_027486050.1"
                     /db_xref="GeneID:38740402"
                     /translation="MRPLTDAETTTLFEKLAHYIGKNLVHLIDRPDDPYVFRLHRDRV
                     YYVSESNMKLAVSVARPNLMSLGTCFGKFSKTGKFRLHITALDYLVQYARYKVWIKPN
                     GEMPFLYGNHVVKAHVGRITDDTPEHAGVVVLSMSGVGLGFGVTARSTSDTRNMDPTN
                     IIVFHQADVGEYLREEETLF"
     gene            complement(<473426..>475486)
                     /locus_tag="MRET_3637"
                     /note="MRES_14645"
                     /db_xref="GeneID:38740403"
     mRNA            complement(<473426..>475486)
                     /locus_tag="MRET_3637"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027630264.1"
                     /db_xref="GeneID:38740403"
     CDS             complement(473426..475486)
                     /locus_tag="MRET_3637"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027486049.1"
                     /db_xref="GeneID:38740403"
                     /translation="MDRSDSTQSRGDNDQRTSTRGNGNASSRGSESDRSISTGGNNQP
                     RQTSSSNDTSDSGNDRRPTSTTEGNNRPTQTSTRRTSNDNNDSSSTSDNDDQRTSSST
                     SSRSSSTSSEASRTSQSSSTNGVSDGRSSTSSSDQSRTSGSSLSSGSSTSPTRSSSQA
                     PTSSSTNSNSSSNDSSSSNSSTNSSNRSTVSSSNSAGPTSSQDGAITSSSSGLNTATS
                     TDVFVTTIDGHAVTSTRKSVFTSTPDAGDRSANKNNGDDGYWQDGGAVGGTFAAVGIV
                     VVALIIGLGWLLYRRRKSKRMDADVMAAASAAAATTRTPFDDDDDDDIMGGPFGTPGG
                     GNGSVDQNSGLHGSAGPPSLEANGVQAAQPLYQPSSGYHQPAHYVNSVDDPYGSMHGS
                     SVPVSTGAVLGGLGQPTVQYYSPGRAGSNDAQRGVYESLPTDSAFVYQRPSVDSSGYH
                     AVGSSAYAYAQPDPFRDSTEAEPAAAASNLQHHPSVSGQSNASGQPSSSAEYEPAQSH
                     VSHMYMPHVPEDAPYPVSYNNATAPATGAAAPVSGEVTAWPSFIPGVAPTHNENYVRE
                     AEPSTTHYADMSGHNAGVVQAFGGDNEGQSAMDHGDWDPPALSSAWFPTSVNDQKQAS
                     PPSEPAMHSEMPSSSLPPYPSNENTAPWPADEKAAATRPPVSTPPATGHQPLMVRNPS
                     PEDE"
     gene            complement(<476068..>477498)
                     /locus_tag="MRET_3638"
                     /note="MRES_14650"
                     /db_xref="GeneID:38740404"
     mRNA            complement(<476068..>477498)
                     /locus_tag="MRET_3638"
                     /product="ribosomal RNA-processing protein 8"
                     /transcript_id="XM_027630265.1"
                     /db_xref="GeneID:38740404"
     CDS             complement(476068..477498)
                     /locus_tag="MRET_3638"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 8"
                     /protein_id="XP_027486044.1"
                     /db_xref="GeneID:38740404"
                     /translation="MPGDAAAIDLGVLQQQLQTHRSSLADQIMQHLPDQTSTSSHAPQ
                     PTQSARRPATLGVGASTSQPNSYSAADHKFRAKLGAKAGRKRSFEDIKPAAPPEDDDE
                     GDSRGSAAQKRARPQRRMDMFAAAEAKIKAGKEKAQVHDVPPHVATMSKAQRKKWNKQ
                     QRIAASEKSNSPSSGEPPAMTPLQSSMLASLQGARFRSINERLYTHPSRDALAFMQDD
                     PQLFDDYHAGFRQQVRKWPKNPVDKIAELLTPSKKAKSTHRIRAASIPGALVVDMGAG
                     EGGLAKMLAAHGFHTLSYDLVDTPDGWVRGLDAAALHALPLPGIYTPLGIVWDRDANF
                     ITAASTVDVVVFCLSLMGTNWVDMICEAWRVLKPNGEMVIAEVTSRLGSTGDTHAFTE
                     LLCALGFHVDWVDTTNTHFVLLTCTKTVEARQADTSQPGPTLCPTASPSELRRAVTNA
                     AQANDARSTLVQVGADVLKPCWYKRR"
     gene            <477649..>483066
                     /locus_tag="MRET_3639"
                     /note="MRES_14655"
                     /db_xref="GeneID:38740405"
     mRNA            <477649..>483066
                     /locus_tag="MRET_3639"
                     /product="brefeldin A-inhibited guanine
                     nucleotide-exchange protein"
                     /transcript_id="XM_027630266.1"
                     /db_xref="GeneID:38740405"
     CDS             477649..483066
                     /locus_tag="MRET_3639"
                     /codon_start=1
                     /product="brefeldin A-inhibited guanine
                     nucleotide-exchange protein"
                     /protein_id="XP_027486043.1"
                     /db_xref="GeneID:38740405"
                     /translation="MAPDAPAGDLPTKHGVSTAEAIQQEPQAPDSQVEDVDRSEPKEA
                     SQAEPTTSASPEEERSNELNHPDTSKESEENQDTNSVIDKTDHEPIPEEASTPEVPQE
                     PAPANIAPELTSAPATDPSMVSMPQEKESLPASEPVPEAEAVAEKPPSQPSEQAPATP
                     TMQHSKLSANSLSRGGAVFVISALEAISASKETRRNKTLKEATTTALDMVRRATGTES
                     NTAGQPMVLDPRVVFEPLRLACESKNVALLTTSLDCIAKLVSYAFFAEDHAQAHADSP
                     LADLVVETVCNCFDDQMDERVSVQIVKALLACVLSAGLRVHQTSLLRSVRTVYNVFLI
                     SRTPVHQGISQGALDQMVSYVFQRMPLGDAAAEAASDTHANTEPITLQMLESRHSLEA
                     GEREDTAGEPIDAPDLLVKDAFLVLRALCKLTMKPLSTESERDIKSYSMRSKLLALRT
                     VKHVLQNHMNVITAANVRFHSTASGGASTFVQAVKQYLCLCISRNAVSSVLPVFEESC
                     DIFWLVLSGMRNKMKKEIEVLMNEIYLPILEMRSSPMAQKTVLLNTLQRLCRDPQALV
                     EVYLNYDCDRTALENLYERLMNVISRLTQTLPAEGQPSSDEQQSLDVRLKHRSLECLC
                     SVLQSLVAWMGRFVEEPSVASADEAVVPEEDRDMAPSAAVAASVPSTQALDDDPGQFE
                     SAKQRKTVLLEAIRTFNFKPKRGIQQLIAHGFVRANDPLAVARFLFFADGLSKRSIGE
                     YLGEGDAENIATMHAFVDLMDFRDMPLTTALRRFLQAFRLPGEAQKIDRFMLKFAERY
                     TEGNETTFANADTAYKLAYSVIMLNTDAHNPQVKHRMTLQDFIKNNAGLDDDRDLPEE
                     YLTAIYDEIQKNEIKLIGEEAPSVPTSSGLAGVIATVGRDLQHEAYVLQTQGMANRTE
                     VLFRTMLHAQQQAGVHRTLADRYFSASHIEHVKPMFEVAWMSFLAGMSAPLQDSNDAE
                     IIHMALDGFKNAIKIVCFFGLELERNAFITTLAKFTFLNNFGEMKSKNVETIEALLDI
                     AHTEGNFLSGSWREILTCVSQLERFQLISGGVDARTLPELGRRPSGSVSRTSANGGRT
                     ATHRPNEDVMQAGASSEITVSADRVFSATPQLSGEAIVDFVQSLCDVSWEEIQSSGMS
                     ENPRLFSLQKVVEISYYNMGRIRMEWSRLWTILGEHFNHVCCHPNPAVNAFGLDSLRQ
                     LASQFFEKEELLHFTFQKDFLKPFEYTMRRNRDVNAREMVLQCLEQMVQTRAERIRSG
                     WTTILGVLGVAAGTNERIALYAFELVRRIQQQYLQAVLANRSFSELCVCIAQFGKAAN
                     QRVSLPATELLRALVPTAHGAAVPDDALPSSLWLAMLFSLYDILMTGDDLEVRRVALD
                     SLFSILTEQGASFSMAFWDEICHDVLFPIFNVLRNRSDVTRFTTQEDMSVWLSTTMIQ
                     ALRQLVVLWTHFFDTLKPRLSGLLELLCACICQENDTLARIGTSCLQALIVKNMTRMD
                     DECWQQVIDAFLRLFRATTASQVFDPSLSSPEDVMPAQERRQAFKQIIVKCVLQLLLI
                     ETSNELLRNTEVYEAVPVPQLLRLTAALEDSYRFSRRFNADRSLRTALWKVGFMKQLP
                     NLLKQESTSASTLVYVYLRMHNDHRPSFATYRREVSDRYLPLAEEIVSVYLPLDNETQ
                     ARNIAAWTPVVAQVLQGLAAMYELDPSGHVPATPTFFMLVIELLDKITLAPALAAPLK
                     RYLGAVGTAHGLIDSEAAAARAYAREQARAEMLHAAPTPRSSTPISSQADQSQADLRH
                     MSLVNPSFDALSTTAGAGAPS"
     gene            complement(<483077..>483814)
                     /locus_tag="MRET_3640"
                     /note="MRES_14660"
                     /db_xref="GeneID:38740406"
     mRNA            complement(<483077..>483814)
                     /locus_tag="MRET_3640"
                     /product="translation initiation factor 6"
                     /transcript_id="XM_027630267.1"
                     /db_xref="GeneID:38740406"
     CDS             complement(483077..483814)
                     /locus_tag="MRET_3640"
                     /codon_start=1
                     /product="translation initiation factor 6"
                     /protein_id="XP_027485851.1"
                     /db_xref="GeneID:38740406"
                     /translation="MALRCQFENSSEIGVFARLTNSYCLVTVGGSANFYSAFEVELGD
                     LMPIVHCTIAGTRLVGRLTVGNRHGLLVPMTTTDQELQHLRNSLPDSVAIQRVEERLS
                     ALGNVIACNDYVAIVHPDLDRETEEILADVLKVEVFRQTVGDNVLVGSYLAMSNQGAL
                     VHPKTSLQDQDELSSLLQVPLVSGTVNRGSDLIGAGLLVNDWVAFVGLDTTATELSVI
                     ESTYRLQNQEAGAVVDQLRDALVDTYA"
     gene            <483960..>484254
                     /locus_tag="MRET_3641"
                     /db_xref="GeneID:38740407"
     mRNA            join(<483960..483966,483992..>484254)
                     /locus_tag="MRET_3641"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM9"
                     /transcript_id="XM_027630268.1"
                     /db_xref="GeneID:38740407"
     CDS             join(483960..483966,483992..484254)
                     /locus_tag="MRET_3641"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM9"
                     /protein_id="XP_027485852.1"
                     /db_xref="GeneID:38740407"
                     /translation="MDLSALSSSEQLQMQRLIEQKQLKDFMRLYSGLVERCFGSCIHD
                     FTSRAITSKESECVSHCTQKFLKHSERVGARFAEENARLMGQQPQ"
     gene            <484485..>484769
                     /locus_tag="MRET_3642"
                     /note="MRES_14665"
                     /db_xref="GeneID:38740408"
     mRNA            <484485..>484769
                     /locus_tag="MRET_3642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630269.1"
                     /db_xref="GeneID:38740408"
     CDS             484485..484769
                     /locus_tag="MRET_3642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485830.1"
                     /db_xref="GeneID:38740408"
                     /translation="MAEESSATAPSSLPPASSGLPPNRARARGIYQAGTAVARADEPE
                     AWELDTSTHEPVTMVQAGFDPLTSGEKSWMLASAAVTLIIVAIGLYISLA"
     gene            <484918..>489342
                     /locus_tag="MRET_3643"
                     /note="MRES_14670"
                     /db_xref="GeneID:38740409"
     mRNA            <484918..>489342
                     /locus_tag="MRET_3643"
                     /product="THO complex subunit 2"
                     /transcript_id="XM_027630270.1"
                     /db_xref="GeneID:38740409"
     CDS             484918..489342
                     /locus_tag="MRET_3643"
                     /codon_start=1
                     /product="THO complex subunit 2"
                     /protein_id="XP_027485835.1"
                     /db_xref="GeneID:38740409"
                     /translation="MAPSTPDVHAEPQWLVHALRTEISGADVRSRLEHEWRTQPAHAR
                     IAIAELMREYILQQDVSCARIAEALAITETSWCDVILDTCWALDAEMEVRCDGNLPLE
                     TARSRLADVVRAFVTGGLLTAKLVASRLDAALLGAIGLLDANVFQRRGIQIRTATFFK
                     QPKYNLLREENAGYAALFMSLESCIGPAMYADGDTVVESETARDRDARAESWLQTSML
                     ECIGRFGLDAVRVLDIILASFCAHAVHHYPFFLSVMRRVPWSSARIAEVLGFQYAHYT
                     HPDTRESTPEELYLLTALLIREKVVSFAQMLAYVSPDDTIQKLKQAHDEALTSKTATV
                     GANALTMAAPLIDDDHDSSAASSTTPANTVDAAPPPPPSPQGIFLIRALLRCGALDEV
                     RGFLAAHPWIFGAYPSVTHAYLRLVWYRLDTPAFRDAVTRFARTGNDQTSELTMYVPE
                     PHATRTHRYIFCVRDWAHGHAPLNQVEEVFELLSPLGVYVCQDRRLLQLLCRVCAQAP
                     SKEAWMPFLRTQVLPAVTLANGGAPLLYELWECIQTLPYPQRYSLYGEWKHRSTKRPE
                     LRYAKMQTEREARGILRRISSDNVRASGRSLAKAAHAHPTVFFEVVLHQIQSYDNLIE
                     PVVDSAKYLTPLEYDVLTYALLEALSDPGKARTKQDGTNTSLWLKSLASFAGALFRKY
                     AAMDCTPILQYLANRLHEGQVADLIVLSELILKMAGIEPMGELSDAQMAALSGGPLLQ
                     TEAHLTLIPGTTPAAVLLARNSLKKGAMRLYRTLMQNRLAVPLLILVAQQREACVFSD
                     DDVHIKSLSSTFDTCVSILLQYTHFLMSQGTSEYAQLVPSPSAWIRRFGVDVPIAYHL
                     GRLSPDTPENCGVLGPLFFGTFWQLSLPDLVVPMERYQHELDRLKQAVQHVETTTDMT
                     ESLKTSARVRLQESMTQLQAELKEQTLAHQATRRRLQTEKGQWFHADIDRAQLIQQLV
                     AQCLYPRALFSPTDAVFAARFLRTIHTLGTPHLPTLGVYDTLLTQHVAPTLFLATENE
                     ARSYARFLYTVLHDLHAWLVSPDAYDKEAIGSDVTGFSLAWHGMRGMHTRPDEQPLSF
                     TAFKACMLQWHSSLYEAFSACFGVEYMRMRNAIVVLNRLSAFFPLYRDHGQRLLQVVQ
                     HVVATEHRGDLKVLAQGLAATLEKHAPKWVDVTYFRPLTKEERARVREEARLEEERKE
                     EERKEKARREEERKEKLRREEERKKQAREEEARREEERRERARQEEVRREEERQEKAR
                     QEEARRETRKEEAHREQARPRDTHHDEARNEGRRPDAREESRRGPRSRRDARRDDEPR
                     EVRIRGARDRPKESIKETPRDDPRSDRGSRGRWSRERQSYGRYDRQMDRSDEGWPETN
                     AQWGRRRVDGAAEDEHSARKRSLADRLGSSEGGASDAQSTPDSKRMRKERMDVPDRGP
                     PARSWGRGSGRAPTPPRDVPPREHRERDRRKRRAGGEG"
     gene            complement(<489367..>489624)
                     /locus_tag="MRET_3644"
                     /db_xref="GeneID:38740410"
     mRNA            complement(join(<489367..489387,489416..489510,
                     489543..>489624))
                     /locus_tag="MRET_3644"
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC4"
                     /transcript_id="XM_027630271.1"
                     /db_xref="GeneID:38740410"
     CDS             complement(join(489367..489387,489416..489510,
                     489543..489624))
                     /locus_tag="MRET_3644"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC4"
                     /protein_id="XP_027485857.1"
                     /db_xref="GeneID:38740410"
                     /translation="MSYAARPGGVPLGGAGMRQPAVEYICADCSAINEIRPREPIRCR
                     ECGHRIMYKKRTKHMLHFEAR"
     gene            <489738..>491291
                     /locus_tag="MRET_3645"
                     /note="MRES_14675"
                     /db_xref="GeneID:38740411"
     mRNA            <489738..>491291
                     /locus_tag="MRET_3645"
                     /product="AP-3 complex subunit mu"
                     /transcript_id="XM_027630272.1"
                     /db_xref="GeneID:38740411"
     CDS             489738..491291
                     /locus_tag="MRET_3645"
                     /codon_start=1
                     /product="AP-3 complex subunit mu"
                     /protein_id="XP_027485859.1"
                     /db_xref="GeneID:38740411"
                     /translation="MDGLIIAGRHGQPIMLSRFRQTNPLYSMLHTSFLSDLIADMQMQ
                     AEAGTSKNASVRDIPPVLSVPLPDSIFAEKEEEDEQDDDDEGESVSPPDLPDEALAWS
                     ESVKKTAEDPTETCISIEGGSILCHIMVGDVRFLCPVSHSIDPLIPFAFLHKVVAILQ
                     EYLIGSTDPALMTEDVICEHFDIVYELMEEMLDGAGHVLLTEVNALKDIVLPPSWLDK
                     LIHTVGLSSSAEHARTSLASPVPWRRPNSKYAKNEVYLDIVETMDGIVNASGAPLSLD
                     VHGTLECSALLSGIPELVVKLSHPTMVEYPAWHKCIQQRDWHENRILRFIPPDGDSRL
                     GEFRIKSAATAKSTLPLCIHANVMPYEAALGGLPFEISVEHTLDHSYDLQDVCVEWLL
                     GNGIQGIDATTQVQTVANKVSMSSDIGSIPSLSRSTGTMVFDRKRQLMRWTIPTLMPS
                     TMSVLRGTILSSTIHCRPMYALQVQFMVQGYSFSGLRVTSVQLEKEAYTLSKGARVRL
                     MGDIEWRLI"
     gene            complement(<491323..>492285)
                     /locus_tag="MRET_3646"
                     /note="MRES_14680"
                     /db_xref="GeneID:38740412"
     mRNA            complement(<491323..>492285)
                     /locus_tag="MRET_3646"
                     /product="ubiquitin metalloprotease fusion protein"
                     /transcript_id="XM_027630273.1"
                     /db_xref="GeneID:38740412"
     CDS             complement(491323..492285)
                     /locus_tag="MRET_3646"
                     /codon_start=1
                     /product="ubiquitin metalloprotease fusion protein"
                     /protein_id="XP_027485853.1"
                     /db_xref="GeneID:38740412"
                     /translation="MNRSKLRIAISYRSKTYPITLEDISTVSAFQDLIFDTIGVRPEN
                     QKILVPPKARQLLQTLRAGTTTQTTIRDVGLSDCMQITVIGAPDDEIKEVQAEEEKWD
                     KARAKRRQLHPSLLKNTTPQKRSVVVPESVFGKNVVHASIPSSNPLHAKIFSYLNRLA
                     SDPAILHVCHLHGYKVGTLTELLPHEHPDLLGLNINMGDTILLRIRTDAADGLRDYKT
                     TRRVLLHELCHNEIAGHPPEFNALNSQLNREVEAFEHNQILGTHRLSTEPVYEPASNV
                     PVDADEEREERRRKILAATEKRLADIDQNIQSQCGDSKKVPFSK"
     gene            <492580..>493689
                     /locus_tag="MRET_3647"
                     /note="MRES_14685"
                     /db_xref="GeneID:38740413"
     mRNA            <492580..>493689
                     /locus_tag="MRET_3647"
                     /product="glycosyl hydrolase catalytic core"
                     /transcript_id="XM_027630274.1"
                     /db_xref="GeneID:38740413"
     CDS             492580..493689
                     /locus_tag="MRET_3647"
                     /codon_start=1
                     /product="glycosyl hydrolase catalytic core"
                     /protein_id="XP_027485854.1"
                     /db_xref="GeneID:38740413"
                     /translation="MKLLFAFALQALLFSAVAQASFIRRRPHDSILHRRNDDEGLLGH
                     IHDDVSSLWNGLAGSHSDSSSSSASDSSSEGRVAHTNSSHDSSLVDWLNGVLGGIWHG
                     DGNHGFYKTNPSSGRLLANKPKLGLAWPNGGSMNITHFMTKKVSWFYSWDATPGFSPV
                     PENITFCPMLWGQNKISHFKKHVLGNINSANNAGKCVLGMNEVNQQNQAKMSEGEACS
                     MMRENIMPLKAHDFYVVSPVTTNAPSGMKWMKNFRKQCSDVWNTVDAVAVHYYGTNTT
                     EFKQYVSEWHDTFNKPVWVTEYACQDFNGGEQCSDSEVYSFHMEMAVWFDKQNFVEAY
                     APFGVMQNLQGVNKANSLQEGREPNFMYNSISSVP"
     gene            <494169..>495920
                     /locus_tag="MRET_3648"
                     /db_xref="GeneID:38740414"
     mRNA            <494169..>495920
                     /locus_tag="MRET_3648"
                     /product="bud emergence protein 1"
                     /transcript_id="XM_027630275.1"
                     /db_xref="GeneID:38740414"
     CDS             494169..495920
                     /locus_tag="MRET_3648"
                     /codon_start=1
                     /product="bud emergence protein 1"
                     /protein_id="XP_027485916.1"
                     /db_xref="GeneID:38740414"
                     /translation="MKALRELKNTFKDLGLANAKLNPVVHSTQKHETTLLPPKMVIRA
                     TADYVPESPHELSFHKGDFFYVHTSADPGQQSWIEACNPATDARGYVPLTHFEIISRT
                     KPRTTVPLSTKSELNPNGLPSTPSTTESFISNSSSSVCTNGGTFATMKFDFKAELPHE
                     LSAKEGEGVFVMARSNDEWLVAKPLEYLSAPGLIPTSYITFRDMRSGQALSSEENVSV
                     LSGIPSVYEWGEQNRRYCEQIVPLEDINNHKLHDSNSLKMSKQGRLSKLLPATPHYYY
                     NMDDYFSSLETINHSQAYNMPLIETTMPRDVPSRSTKLTLVAVDHIHMDEQSSRFCVH
                     LFYTYKVPSSSTPMYKHHELLLNRLYSDFVSLRHSLQEELASYLPLAALSQNLPSLPP
                     GSTGTAEMDHKAISSFLHGFCALPDFILQSSSVQIFLDVRSYDQCHITTTQHNIPQST
                     MLRRACARHIPDMYSAPNLPADSQNIDSTIHTAPAGSDTTSLSDTYYHRIKIIHQGDT
                     SKVVALRVPSVICYDSLMQRIEEKLGTKFQALQSTETSPDQGCIQTDEHLQSWLDTSR
                     AHGKKLILVASPMRQIP"
     gene            <496817..>498253
                     /locus_tag="MRET_3649"
                     /db_xref="GeneID:38740415"
     mRNA            <496817..>498253
                     /locus_tag="MRET_3649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630276.1"
                     /db_xref="GeneID:38740415"
     CDS             496817..498253
                     /locus_tag="MRET_3649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485829.1"
                     /db_xref="GeneID:38740415"
                     /translation="MAGPQPNWNGNALDQKQQEHRRSYTTQSATSKTNDSRSRRKSSN
                     TTAPVTNQPYPSLPSHEPLGHMYMQPNPLLGQQPGAAVPQNHSAFMPWHSYNMSANQT
                     SLLADAYGAANGQPQPGTTTSLDWVNGMSAYMLMDPSARPSSFSSPMVQQTPSNINVY
                     QPSPSQLTQYMSQLQFHNQQQENIAMQQNLFLSQIQHAQEQRAQQAIQDQITLLQQRM
                     SPSQDSALDSNARLRTDILSARSREAHSQHLHNGPLKEATFVSSRIPDVLSKRYSGHS
                     NVGTPSKDSILPFQSDRDAYEDACPSPSVEQSARLESKRVSSKLSKEETGDISSERRR
                     SLTPSIVIDQVNIESTDHDLARKVNSVGMRMGPRTATIMHEVQVPENNTKSKNGKEGL
                     RRSLVQDGNRLGNGHSALSLPLIQPRRQPRGPPMDAFFANNFLARRSLRTRREAMSKL
                     CASPRASIFQNLRSIRTSSPAKKTPDVE"
     gene            <498563..>500495
                     /locus_tag="MRET_3650"
                     /note="MRES_14690"
                     /db_xref="GeneID:38740416"
     mRNA            join(<498563..498569,498610..>500495)
                     /locus_tag="MRET_3650"
                     /product="proton-dependent oligopeptide transporter, POT
                     family"
                     /transcript_id="XM_027630277.1"
                     /db_xref="GeneID:38740416"
     CDS             join(498563..498569,498610..500495)
                     /locus_tag="MRET_3650"
                     /codon_start=1
                     /product="proton-dependent oligopeptide transporter, POT
                     family"
                     /protein_id="XP_027485882.1"
                     /db_xref="GeneID:38740416"
                     /translation="MDLENTEAAIGFAEKVQFDEHLKDGHKNAQTLQSDLVPLPPAKH
                     GDPDTNISDQHFPTDEERATLRRVPEKLSVAVFSIGICELAERFSFYGATQVFTNFIA
                     RSRPKVDGEISASGAAKHSSQASGALGKGSETANGLVTFNQFWCYITPLLGAYVADVY
                     TGRFNALCLGVAFAMVGHILLVISAIPSVLDDADGAIGCFAVAIVIMGFGTGLFKSNC
                     SVLIADQMKVKEQTVVKLKTGERVIIDPALTMERLYLWFYLMINIGSFGGQLGMVYAE
                     KWVGFWLSYLLPTLVFIIPIPVLWFGRKYYKVLPPDRTVFNNAARVYALAFKRNWSWS
                     PLTFIRNWRSEHYWDCVKPCTIEETQRKPWMTFDDHYVDLLSRGAKACMIFMLFPLYF
                     VCYNQITNNLIYQGGQMDIGSTPNEIPATLDPICIIVFVFIFNMGVYPLCDRLKIPFT
                     PIKRITVGFFAASFAMVWSAVLQHYIYQRNPCGNRVGDDVVRNGINCSETNADISVWV
                     QVGAYGLVALSEIFASVTSMEVAVLMAPVNMRSIIMAVSLFTTAIAAAIQEAFNPLSK
                     NPLFVVNYTVFAALAFVGGILFFIVFIGIDRKQEELNLMSQEGALREAQEAEWQSVPH
                     DTKSNS"
     gene            <500828..>501283
                     /locus_tag="MRET_3651"
                     /db_xref="GeneID:38740417"
     mRNA            join(<500828..500857,500900..500950,500991..501027,
                     501065..501083,501124..501158,501237..>501283)
                     /locus_tag="MRET_3651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630278.1"
                     /db_xref="GeneID:38740417"
     CDS             join(500828..500857,500900..500950,500991..501027,
                     501065..501083,501124..501158,501237..501283)
                     /locus_tag="MRET_3651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486089.1"
                     /db_xref="GeneID:38740417"
                     /translation="MYNNNMQGGYYPPQNGGYPAAGPMGGSALDNRRARVHEKHGACG
                     PCCAFCVGLLACWCLEDIICAGCLDFIF"
     gene            complement(<501367..>502688)
                     /locus_tag="MRET_3652"
                     /db_xref="GeneID:38740418"
     mRNA            complement(join(<501367..501527,501556..502592,
                     502621..>502688))
                     /locus_tag="MRET_3652"
                     /product="guanyl nucleotide binding protein"
                     /transcript_id="XM_027630279.1"
                     /db_xref="GeneID:38740418"
     CDS             complement(join(501367..501527,501556..502592,
                     502621..502688))
                     /locus_tag="MRET_3652"
                     /codon_start=1
                     /product="guanyl nucleotide binding protein"
                     /protein_id="XP_027485884.1"
                     /db_xref="GeneID:38740418"
                     /translation="MPPTLAHILPCQKPGDFWRSAAWSPDGSLLLLRSETHAVYVYKY
                     HHHETPRLCSTYQAPSPILDLQWYMLPAMAPSNHDIERRWCYVISCRDVPTRFVDSID
                     GSTKASYGIINHVEMYDPLYALTFSDDASWMYAGLRNALALFPLHAVGNNHHLALDLS
                     SQASEQDNGGQHGIVSALAVGCSPAVAQQDASETVQVTAVGTFTNLIGIYLTESQWLA
                     DFLTTDKTCSSSKWGTQNLLPGGRVCLCGWTVPEGRGITQLAWHPKEKHILVVSMRRA
                     PCLYVYDTSYLYGASSPFQFKPLATSDVSLVARLPRDAGETHQRLQFGMDSQGQYLAA
                     GDQYGWIRIWSWASILERNGTPHVQPVAEWQAHADAVGSVQFHPFDIHIIVSVGGARH
                     WDHDASLEKGPIPDDQDAKVWRWNTTETR"
     gene            complement(<502808..>504040)
                     /locus_tag="MRET_3653"
                     /note="MRES_14695"
                     /db_xref="GeneID:38740419"
     mRNA            complement(<502808..>504040)
                     /locus_tag="MRET_3653"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_027630280.1"
                     /db_xref="GeneID:38740419"
     CDS             complement(502808..504040)
                     /locus_tag="MRET_3653"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_027485883.1"
                     /db_xref="GeneID:38740419"
                     /translation="MRKANLFRHESALPRMSWSPRNLYNLIARSTNMRLVDEFNFTKT
                     SMTMYQQRWRSKRLLRGYHGDWIPERRFKRWFLPSSLPSYAPEAATSFNPRWKGDEHD
                     EHALDTPTPPIKSLFLRDVERRLDTVVFRCCFAHSVYYARSLVLHGKVHVNGEALREP
                     GYLLQPGDLISVEPSSVPMLNEQVAKRVKVEQERYGLKKTPSEETDSASEPTPAQEEA
                     APEVEAKPASDKESDAVPDESKEEQPPKDTEPKEPSDALPAGVLPFHLPPFAAPFLFI
                     PPYLDVSFRTCSAIYLRHPTLSTTVLRSRHADKHGGARQYTEVAYRSDIPSPYPANAD
                     MFGLVWELYVRNAPRVRSDERRTKLLGRFGRNGFMSARAFEQDRRRVAIRRGWGRKRP
                     LSLPQAPSVESSTQRTST"
     gene            <504338..>505504
                     /locus_tag="MRET_3654"
                     /note="MRES_14700"
                     /db_xref="GeneID:38740420"
     mRNA            <504338..>505504
                     /locus_tag="MRET_3654"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_027630281.1"
                     /db_xref="GeneID:38740420"
     CDS             504338..505504
                     /locus_tag="MRET_3654"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_027485886.1"
                     /db_xref="GeneID:38740420"
                     /translation="MSNKQVLPEGHFLFTSESVGEGHPDKICDQISDAILDACLQQDP
                     RSKVACETAAKTGLILVFGEITSKAQLDYQKIIRDTIKEIGYDASEKGFDYKTCNVMV
                     AIEQQSPDIAQGLDHGSLDDIGAGDQGIMFGYASDESPELMPLTVVYSHKLNHAMASA
                     RRNGHLPWLLPDTKTQVTIEYKKDGGAVVPVRVDTIVVSTQHTDDISTEDIRKLIKSE
                     IIDKVIPAHMLDERTVYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFS
                     GKDFSKVDRSAAYTARWIAKSLVHAGLARRALVQLSYAIGVAEPLSVYVDTYGTSSKS
                     DAELVQIIKNNFNLKPGVIVRDLELQKPIYRQTAFGGHFGRSEFSWEQPKELKF"
     gene            complement(<505766..>510448)
                     /locus_tag="MRET_3655"
                     /note="MRES_14705"
                     /db_xref="GeneID:38740421"
     mRNA            complement(<505766..>510448)
                     /locus_tag="MRET_3655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630282.1"
                     /db_xref="GeneID:38740421"
     CDS             complement(505766..510448)
                     /locus_tag="MRET_3655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485885.1"
                     /db_xref="GeneID:38740421"
                     /translation="MRKAMNVMGLRKHAPQPPAAGMDPPPPMRPAVLPQEERSWTSQP
                     SRTESSYSEEYDPYDEDMSESATYDDEPYSEVTGYDDEPYSELTGYDDEPYSEAATYD
                     DEPYSEETDYDEEPYSDMTGYDDEYTERDSIETLGTNASAAYVDHEYSDPYEDEYTSD
                     DTASDGTPRAISEAPGGATKGPKDAGTMRTDMPRPAEVPVPPPVPVAAEKKSGFLPGL
                     RRKLPGKDVPQKTSLLHRLPILGQRSKRPTTDPASPRLAMAESHDPAYDLGQDADAAI
                     GKSALQTSPPMGGARVLGETEPPAMRSDMAPRRAGPPASRTMSPRRASPSLLSAKAPG
                     DPQPVSLVAERPPDAGLAPRSATSAPYPIPTRPAQARHVSAPSTPRTDDMSVATERVS
                     TPGRDSYDSAMPAATPVRPAQRSRADHVLETRSGAAPYARPHAYANHAVLRDEPSGRR
                     PELIDPFVEERALDRLVRPVSRPESIEPSLFDEEAVSGQPSSPLMPRSGPLSGQRVSD
                     GWDVPPLSRHAPTASASSGDFFSVRSGTPIPGRGESRRPRRGTSATHLPKKARAPPPQ
                     RFRDLEHKVPTSRSPAQPRTQLARDARKYLLTPSVAPTDTETETEDQAQERRRGKAKA
                     AHQPWLVRDLAPEQVHYFLREMVSKELTWESERLFAMRSLERPQDSRRAASAPDSETD
                     SRADDFGDTEFDDDEDIFRRDVYDPETPPIDLPLMRFLLRNVLCTCPLFVPPPPAKHG
                     PPPPSKAAMGRRYFFTAVAPILREVQARSLSAGIDRRGETDGMPFMAQSFLSSVAGLL
                     HKWATRYMVAVLRVGPGNPYYPNELVHSRSWPWPHAKLLPPEAFVCYRRPTDRLRAGG
                     FEVDIVAVREHAHRERDFVLRIRRPNRMDEFVVRNDRDWEEFRARLAHELGPYVHVRP
                     LPRLPGRPPSTATLSTPSGSDTEAQSYTSSYLSTTGTDHDASSYMTRPSDDDDDASVP
                     DGRAPPPGLTATEILQPLYGARARSMPRFEVDRRLLRSWMRDTLAIRSVCESSEVRAF
                     LSIGCFHDRELDTDELLNIAERRRVDGRRIEEREKDAEMAGETVLSMRRVQMRIWLDC
                     VEGDGFLKMYDALKATPTFAELPSSYQMMVSWGHLQAARFLYGVFVQSDQSRANLLRV
                     RDVVDAVPWRKLAHAMRLPVMQCVAEWQKQFLRNKFLQSILEIAFEDNPVAMDDELRA
                     LQQDIGSDTMIRKLRMFVDSPGDFKRLVRQHAHKARIPLVAAIVRGSDAPKLSKVEVQ
                     RVMSASREYTEFLATHPNALRKKTHTGPGYMLIIHLQRVLRLYSLHRDVAQIRGMLQD
                     PAILDALTVLFEPFLEALVRMHRIKGIREDIQHLHVFLLRLLDLLESLRARVQDPARS
                     INTLASFLDRGAPAWYDFLHRWSHVDPFVFSTFAWLRHMALTIGAGSDDLASIWTPPA
                     SAMQDTDDVGQVVDALESTHLATPDAPPDHAPPPECKVGASLRAEIEGLAEAARRKRG
                     RQMEIASRWAAGDTEADFSIQVFGDGEGRMRRDPFLPKEPLPAPPTDNLSRLLCSFRE
                     AVSSALYR"
     gene            <510829..>514161
                     /locus_tag="MRET_3656"
                     /note="MRES_14710"
                     /db_xref="GeneID:38740422"
     mRNA            <510829..>514161
                     /locus_tag="MRET_3656"
                     /product="sulfite reductase (NADPH) flavoprotein
                     alpha-component"
                     /transcript_id="XM_027630283.1"
                     /db_xref="GeneID:38740422"
     CDS             510829..514161
                     /locus_tag="MRET_3656"
                     /codon_start=1
                     /product="sulfite reductase (NADPH) flavoprotein
                     alpha-component"
                     /protein_id="XP_027485887.1"
                     /db_xref="GeneID:38740422"
                     /translation="MATTKSSALNAAALFTGGAFVGAALYTVARSLVQASITKTPKSQ
                     VKLVEAPPKAPGPDQDEQGLYVAPVESDAASMYDVCGVMGQPYEPRSAIPAVQPQDTH
                     VDLGTDTTLVSDVQDLPNLNKNMLTLSLLVMEMLALEYSGTIFTYESSSTGFGAFCES
                     QHDKRVIPMQTRAGAGQAVVGFVAGQGSSGSAVPNSSSTVTVLTNAAGFLAMGPSLAT
                     IPADNTDLVVHVSGINQGMHDDLRVANDYASALSTAAMLSDVGYEVVLSASRQEAIDV
                     AHYAYTRQTKRAFVHIFDGAYAACERSVLSPPSSKVPEPCTYTGPSAPATALVMPHGA
                     MSHRARALLLSLPPHLRGKVGIVSVRRLGSWDAAVLRRAVPTSVQTLRVVEEAFSSTD
                     GALYADVLESVLSGALRGVRAQSLVLAPGQALCPEAWHALLSLAAEQAAPLSLKDVLA
                     RAAAVQVPDLMPFSNSHLVTFVGTDAGVSVPTAELLARSLFDASKYVRMLSRYDNYAA
                     GGAVRSDVLMSERPGVDVPMDVLARDGTSHVVVVSEPASLLPGYRVLEALRQDGTLVL
                     NAANWTPEDVQGALCAADKALLASKRAKVVVIDAQGVAQTLLSDSKARGTAADVAPAV
                     LMSSVAAAAPHLGQWVPHTHQAQPVRTDGWSTTSDEVPERQTLSYNGVRANTALASDG
                     GQVVRASWALAAWQLMFREAYGLEEAALRPDLPEKTYNVRVAVNKRLTPLDYDRYLFH
                     MELDTTGTGLRYEVGEALGVHGWNDEHEVSDFVRWCGFHPDELVYVPSVTRPGSFETR
                     TVFQTLQQNLDIFGKPPKSFFEALGKIVESQDEARWLRFISSGEGNSTFKKLSDLETV
                     TYVDVMHMFPTARVTMDWLVKNVEPIKPRHYSIASAQAAVGDSVHLLIVTVDWKTPHG
                     SPRFGQCTRYLSALKPGSMVTVSLKPSVMKLPPLDSQPIIMAGLGTGAAPFRAFLQAR
                     ALKKSQGIEVGPMYYYFGSRHRSMEYLYGEELEAYLHDGLLTHLGLAFSRDQKKKVYI
                     QHKIIEDGRQLVKFLVPDIDGQEVKDGDKGIFTLCGPVWPVPDIQEALVQAFSEYGWG
                     REKAENKIAELKDDERYVLEVY"
     gene            <514302..>514877
                     /locus_tag="MRET_3657"
                     /note="MRES_14715"
                     /db_xref="GeneID:38740423"
     mRNA            <514302..>514877
                     /locus_tag="MRET_3657"
                     /product="small subunit ribosomal protein S7e"
                     /transcript_id="XM_027630284.1"
                     /db_xref="GeneID:38740423"
     CDS             514302..514877
                     /locus_tag="MRET_3657"
                     /codon_start=1
                     /product="small subunit ribosomal protein S7e"
                     /protein_id="XP_027486003.1"
                     /db_xref="GeneID:38740423"
                     /translation="MATVNQKIFRTAKAPAGPPSEVETTVCQALIDLESHIPELKMEL
                     RPLQVSAVKEVEVKGGKKAYVVFVPMPQLKAFQRIQQRLTRELEKKFSDHHVVFIGQR
                     RIMGKPTSHSRATQPRPRSRTLTAVHSAILEDLVFPTEITAKRVRVSTDGSKLVRCAL
                     DSKDATSLEYKLETFSSVYRKLTGKEVAFTI"
     gene            <515247..>515927
                     /locus_tag="MRET_3658"
                     /note="MRES_14720"
                     /db_xref="GeneID:38740424"
     mRNA            <515247..>515927
                     /locus_tag="MRET_3658"
                     /product="DUF1768 domain protein"
                     /transcript_id="XM_027630285.1"
                     /db_xref="GeneID:38740424"
     CDS             515247..515927
                     /locus_tag="MRET_3658"
                     /codon_start=1
                     /product="DUF1768 domain protein"
                     /protein_id="XP_027485899.1"
                     /db_xref="GeneID:38740424"
                     /translation="MSKRISSWFKKGSKRSTSDSESSDDVLAANVGSIAGDNELLYAS
                     PAVMESVKHSKNSANGNNRIEFYSKDLPFFWLNNASPHPVVVDGIRYPTAEHLFQAQK
                     FIDSRPDIATKIRKASNPVEAIHIARTFAKEVRPDWIRDGVNVTTMRMVLLTKFMQYS
                     DLRLALLETGDAEIVHASPNDAFWGSAAMSDSIGRGRNVLGRTIMQTRELMRVAAGVG
                     ANSGTQTV"
     gene            <516029..>517055
                     /locus_tag="MRET_3659"
                     /note="MRES_14725"
                     /db_xref="GeneID:38740425"
     mRNA            join(<516029..516286,516311..516969,516995..>517055)
                     /locus_tag="MRET_3659"
                     /product="mitochondrial alcohol dehydrogenase isozyme III"
                     /transcript_id="XM_027630286.1"
                     /db_xref="GeneID:38740425"
     CDS             join(516029..516286,516311..516969,516995..517055)
                     /locus_tag="MRET_3659"
                     /codon_start=1
                     /product="mitochondrial alcohol dehydrogenase isozyme III"
                     /protein_id="XP_027485898.1"
                     /db_xref="GeneID:38740425"
                     /translation="MKEVVPDVWVGKPPSSDVLGSIQAVISCALDPCPTSLAELNVPV
                     DDAPEAPIFLYFAQAHQFLSTHVQRKEPVLVYCESGRSCSVTIVAAYLIAERHAASVE
                     QALAQIRHVQPQAEPNAGFLQQLELYVSESCRVRLASPRVRRYLLQHTFAMGDYITPA
                     MLAAQDDPYSDAVPDTPASTCARLRCKMCRRELAKDADVVQHEPGKGELAFEPHKRDS
                     VRRGQDTAPVARQKGPSLGLERMQRVLGPRRGLLHSPACSAYFVEPQLWMTESSDVVV
                     GVVSGRLVCPNTHCHAKLGSWTWAGTQCACGAWVTPAFALQRAKVDEVK"
     gene            complement(<517063..>517446)
                     /locus_tag="MRET_3660"
                     /note="MRES_14730"
                     /db_xref="GeneID:38740426"
     mRNA            complement(<517063..>517446)
                     /locus_tag="MRET_3660"
                     /product="oligosaccharyltransferase complex subunit
                     epsilon"
                     /transcript_id="XM_027630287.1"
                     /db_xref="GeneID:38740426"
     CDS             complement(517063..517446)
                     /locus_tag="MRET_3660"
                     /codon_start=1
                     /product="oligosaccharyltransferase complex subunit
                     epsilon"
                     /protein_id="XP_027485958.1"
                     /db_xref="GeneID:38740426"
                     /translation="MGKSKAAVPRASNKAAPPSNAFTQLYKAYISETPSHFKLIDAFL
                     LFLFVTGVLQFVYCVVLSDYPFNSFLAGFAATVGQFVLTLALRMQIGARADTKDRPRV
                     TEGRALAEFVLASVVLHFFVVNFLG"
     gene            <517563..>519404
                     /locus_tag="MRET_3661"
                     /note="MRES_14735"
                     /db_xref="GeneID:38740427"
     mRNA            <517563..>519404
                     /locus_tag="MRET_3661"
                     /product="peptide chain release factor subunit 3"
                     /transcript_id="XM_027630288.1"
                     /db_xref="GeneID:38740427"
     CDS             517563..519404
                     /locus_tag="MRET_3661"
                     /codon_start=1
                     /product="peptide chain release factor subunit 3"
                     /protein_id="XP_027485959.1"
                     /db_xref="GeneID:38740427"
                     /translation="MNPNAPSFGFNPAAAGFVPRFLQQQQQQQQQEYDAYYNQGFTGF
                     AAPPPQSAAPPMPPAPSSGPAPLPPKAAAMASESKPAGTKKAVSVSIGGAKKPEPPAA
                     KEEPPAPKEEPKPAKPAKEASAAPKGQAVKQQTKVEQKVAEKASVDSDKVLQDAQRAT
                     DEETLRDLFGDQEIKSHLNLVFVGHVDAGKSTMGGNLLYLTGMVDKRTLEKYERDAKD
                     IGRDSWYLSWALDSTQQERDKGKTVEVGRAYFETSKRRYTLLDAPGHKSYVPNMIGGA
                     AQADVAILVISARRGEFETGFERGGQTREHAVLVKTAGVQRLIVVVNKMDDPSVGWDK
                     ERFDEIVSKLSPFLRASGFNPKTDVIFIPVSAFSGANLKEKSSDCAWYEGPPLLTYLD
                     DLELGDRKMSASLKMPVSEKYADMGTYVVGKLESGKMKKGDALMLMPNKTTVEVLAIF
                     NEVDEEVPAAVSGDNVRVKLKGVELDEVQAGFVLTDPKDPVHVVRRFEAQLAILEHRN
                     IICAGYSAVMHAHSLNEEVNLTALLHYYDKKTGRKSRRGPQFAKKGMKIIALIETTAP
                     VCLERFRDYAQLGRFTLRDEGKTVAIGKVTKLLSDDDVPNVGKLSIN"
     gene            complement(<519420..>520739)
                     /locus_tag="MRET_3662"
                     /note="MRES_14740"
                     /db_xref="GeneID:38740428"
     mRNA            complement(<519420..>520739)
                     /locus_tag="MRET_3662"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630289.1"
                     /db_xref="GeneID:38740428"
     CDS             complement(519420..520739)
                     /locus_tag="MRET_3662"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485960.1"
                     /db_xref="GeneID:38740428"
                     /translation="MRAALAAGLRHARYTSRPFLYLVPHVRCKHASRAPSSDRVSAKN
                     GTDTAPTRTQEKERERHEQDMSATSLVSATAEDLLKQRFLHAQKRSPGNTLMTGGSGT
                     AKDMPSFFRDEGERHSSTAPDETSLMSMPSSQAPRAKQEAAPKPADASCAYADDMVGP
                     IPAFQTPALSPIRRSDLSLLPDQPFDTHAFVQRLEDGGWKATRSDASARRHDPAEAIM
                     DLTRALLRHHGETLMNENINRSDLHNQLYLFSSALSELRTEVRVRARNDAAALRSITL
                     LLEREIDGLNQKLQSDIEQLKHDIQVEMNSRKTEVQEESNNLEQEIQDLNNRFTIFLS
                     DLKTEIEQRIKWDATRRALALVFGIVAIMVCTLALADYFTRESAPVDEEAQSTSPTPA
                     KPRVLQQARVPVDHHTLEDDQDVALPPKSAEEWGLLPRYDADEVRHV"
     gene            <520887..>521492
                     /locus_tag="MRET_3663"
                     /note="MRES_14745"
                     /db_xref="GeneID:38740429"
     mRNA            <520887..>521492
                     /locus_tag="MRET_3663"
                     /product="Rho GDP-dissociation inhibitor"
                     /transcript_id="XM_027630290.1"
                     /db_xref="GeneID:38740429"
     CDS             520887..521492
                     /locus_tag="MRET_3663"
                     /codon_start=1
                     /product="Rho GDP-dissociation inhibitor"
                     /protein_id="XP_027485961.1"
                     /db_xref="GeneID:38740429"
                     /translation="MSGELPEVSDNINPTPTAGYKPGEKKSIQEYQSLDAGDESLRRW
                     KESLGISSSATQGAMDPHAPRLVIHSLALESEQLPDGRVGIQLDRPGELEKVAKMPLQ
                     ITEGIEYAVTIQFTVGREVLSGLKYIHVVKRAGIAVDRMEEMIGSYPPRAEPYTKRFA
                     PNTAPSGFLARSGTNTVRSRVVDDDGTTYADFTWSFKFTKA"
     gene            complement(<521530..>522117)
                     /locus_tag="MRET_3664"
                     /note="MRES_14750"
                     /db_xref="GeneID:38740430"
     mRNA            complement(join(<521530..522020,522048..>522117))
                     /locus_tag="MRET_3664"
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein 1"
                     /transcript_id="XM_027630291.1"
                     /db_xref="GeneID:38740430"
     CDS             complement(join(521530..522020,522048..522117))
                     /locus_tag="MRET_3664"
                     /codon_start=1
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein 1"
                     /protein_id="XP_027485962.1"
                     /db_xref="GeneID:38740430"
                     /translation="MNDVVGGLFALVTLWVIVRIIGGAARQTHGSALTQPSPEAVQAV
                     RSMFPDIPEASIRYDLSLSGSAEVTCERILQQGYLPLPPPGFPGADEARQAVSEDYQR
                     RQTPSTSAAATASATKAASSTSSNLISRFHLESRLHEPHTTPKGKEPAAVAWSPNAQD
                     RQQSLQERKAQMILQARKRLEERRSE"
     gene            <522260..>522731
                     /locus_tag="MRET_3665"
                     /note="MRES_14755"
                     /db_xref="GeneID:38740431"
     mRNA            join(<522260..522524,522565..522592,522628..522643,
                     522675..>522731)
                     /locus_tag="MRET_3665"
                     /product="NADH dehydrogenase (ubiquinone) 1 beta
                     subcomplex subunit 9"
                     /transcript_id="XM_027630292.1"
                     /db_xref="GeneID:38740431"
     CDS             join(522260..522524,522565..522592,522628..522643,
                     522675..522731)
                     /locus_tag="MRET_3665"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 beta
                     subcomplex subunit 9"
                     /protein_id="XP_027485963.1"
                     /db_xref="GeneID:38740431"
                     /translation="MFATAAKLSSAQPAFSELHKKYVMNLYRRFLRDSLNWHIRRDAW
                     RLDAIRIRTEFEQHRHVRNPRELANILNQAEARLESRQHPDPYKPPTYVGGTKWERNL
                     PPRLFTDEQKTESLKDQNV"
     gene            complement(<522779..>523555)
                     /locus_tag="MRET_3666"
                     /note="MRES_14760"
                     /db_xref="GeneID:38740432"
     mRNA            complement(<522779..>523555)
                     /locus_tag="MRET_3666"
                     /product="flavin reductase domain protein"
                     /transcript_id="XM_027630293.1"
                     /db_xref="GeneID:38740432"
     CDS             complement(522779..523555)
                     /locus_tag="MRET_3666"
                     /codon_start=1
                     /product="flavin reductase domain protein"
                     /protein_id="XP_027485964.1"
                     /db_xref="GeneID:38740432"
                     /translation="MWARHARSARVWCARVRRGLCTSSPVCAAKDRVALGEAIRRVMR
                     TSAQPVALVSAFVPSGDPNDPSLHIHATTLSSFTTVSLAPPLVAFSIREPSRMTDALR
                     AGVASPEPHPSESPDRLVQSAFARQPHFLIHILSFTQQSMSNFFARPGAQTYPTSHQH
                     VPDDHPFRHHPMQPSKAVEGQLIPTEAIGSLACSLVYQLDLTSPDLHGTTEFVNGCVH
                     TNEAGSALFLAQIHDVEIGHEHMDSKPRPLVYWQQGYCST"
     gene            complement(<523843..>524340)
                     /locus_tag="MRET_3667"
                     /note="MRES_14765"
                     /db_xref="GeneID:38740433"
     mRNA            complement(<523843..>524340)
                     /locus_tag="MRET_3667"
                     /product="trafficking protein particle complex subunit 2"
                     /transcript_id="XM_027630294.1"
                     /db_xref="GeneID:38740433"
     CDS             complement(523843..524340)
                     /locus_tag="MRET_3667"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 2"
                     /protein_id="XP_027485965.1"
                     /db_xref="GeneID:38740433"
                     /translation="MRGAQVLTPPASHTDLGHHVKCVVIISKNNAPLYLRAIEPTDAV
                     AKWHFLAHSALDVVEEHVRLHTNPYLGHLLSIEDWAIYGYQSPSQIKIMLMLEQLNEP
                     FPDDQVQILCKAVHATYLSYLSNPFLGYEKPDASRLIPMNTDPSNAPITDAHFDRRIL
                     QILGL"
     gene            <524463..>524819
                     /locus_tag="MRET_3668"
                     /note="MRES_14770"
                     /db_xref="GeneID:38740434"
     mRNA            <524463..>524819
                     /locus_tag="MRET_3668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630295.1"
                     /db_xref="GeneID:38740434"
     CDS             524463..524819
                     /locus_tag="MRET_3668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485966.1"
                     /db_xref="GeneID:38740434"
                     /translation="MSFWRNILPLRWRSRRSLESTFFVTTFIAAMVTVSLSASTILPC
                     PANGKGNLQDRLDSRGTFSEEEIMSDDAKKAHTRYAPESLPVGGLGQRAYLTRRGGWI
                     EIEERPPLFSWRRWTS"
     gene            <524939..>525184
                     /locus_tag="MRET_3669"
                     /db_xref="GeneID:38740435"
     mRNA            join(<524939..525097,525125..>525184)
                     /locus_tag="MRET_3669"
                     /product="fungal protein of unknown function (DUF1748)"
                     /transcript_id="XM_027630296.1"
                     /db_xref="GeneID:38740435"
     CDS             join(524939..525097,525125..525184)
                     /locus_tag="MRET_3669"
                     /codon_start=1
                     /product="fungal protein of unknown function (DUF1748)"
                     /protein_id="XP_027485967.1"
                     /db_xref="GeneID:38740435"
                     /translation="MLGRVLHVVVDAMLISMVLSGIKRNTGLTVALPRIKHLEMRKFV
                     SAYLEAGEWLMDFAVVCLGRSSSFERIR"
     gene            complement(<525196..>527229)
                     /locus_tag="MRET_3670"
                     /note="MRES_14775"
                     /db_xref="GeneID:38740436"
     mRNA            complement(<525196..>527229)
                     /locus_tag="MRET_3670"
                     /product="serine/threonine-protein kinase ULK2"
                     /transcript_id="XM_027630297.1"
                     /db_xref="GeneID:38740436"
     CDS             complement(525196..527229)
                     /locus_tag="MRET_3670"
                     /codon_start=1
                     /product="serine/threonine-protein kinase ULK2"
                     /protein_id="XP_027485946.1"
                     /db_xref="GeneID:38740436"
                     /translation="MLSSEESDIGLSQVGDYALDSEIGKGSFALVYRAHHTAMPHQLV
                     AVKSVIRSKLSSKLLENLEGEISILKSMRHTNIVDLRDCLYTDQHIHLIMEYCPGGDL
                     SMYIHKHGQVAPWDGDAQTNPLAAAQRAKFPHPEYGGLNEHMVRSFLAQLVSAVRFLR
                     SGDIVHRDIKPQNLLLQIPDDESLASGHPREIPLIKVADFGFARNLPAASLAKTLCGS
                     PLYMAPEILRYEKYDAKADLWSVGAVLYEMCVGKPPFRASNHVELLRRIEQSNDRIKF
                     PDERSEQSLAKDAMRRHLNGEAPRPPPPVIAPDIKALIRRLLKRHPVERMSFDELFAD
                     PVVTHVPYSGHAIIKDQLAASVHLAHLPADIFAPPKPPTNDAPLPTPHTPDDRPPAQP
                     SALSRAMQLASQGHALTEQNKPASLGPEAPPLSLLSKPMSAPSYPGLSYTADEGLLPL
                     LQTLAKKAYVLIEFADTRHAEVPPSPLHLHSYSPAGSSPNSTSAYLQEVAGAESLALY
                     IRSLSLLQRGLEYLNAYAERSVGSEPPEQLRDLTQWFRVRFDECYHKSLQARSNCHTN
                     VLVDPAQHIDRLIFDKALELARMAALDELEGNKQDTRTWDPTHCIMAYETALHLLMGL
                     LDPTEDRMNSCVPSTSTVETFLKSITKRLAVLHGRGGTVGPTPTSAMVSLSAS"
     gene            <527476..>529389
                     /locus_tag="MRET_3671"
                     /note="MRES_14780"
                     /db_xref="GeneID:38740437"
     mRNA            <527476..>529389
                     /locus_tag="MRET_3671"
                     /product="protein-serine/threonine kinase"
                     /transcript_id="XM_027630298.1"
                     /db_xref="GeneID:38740437"
     CDS             527476..529389
                     /locus_tag="MRET_3671"
                     /codon_start=1
                     /product="protein-serine/threonine kinase"
                     /protein_id="XP_027485945.1"
                     /db_xref="GeneID:38740437"
                     /translation="MSTVTSAPTSPGPTRRWMKLFRQSKRQESPPGSVPALVPDTLSP
                     SSSSTHVTSPAPSLMSTHSPASAVEPARRGAELDASTTSSLASGSSVMLPSLGMLGDV
                     LDRQPAHLPDLYGARDEQWIRRVASAPDTKALYQSTAFQALAPPILPRWHEEPQRAPA
                     SSSNASWRDGTDSSQTHEWPWQLPSSSDTPIESSSSVEAPPAAPVPPVVKPVSPRRTR
                     FLPGLRSTPRTRQASENEVPKRRLAKLFKSKSSNALQAEARRADVAPPLPLPTKSVSR
                     VKTSEVRVCPSDFRTLKLLGKGDVGRVYLVQGQGLYALKVLSKAEMQKRNKVKRVLAE
                     QAILLASNHPFIVPLYHTFQTRDYLYLYMEYCAGGEFFRALQNLPGRCLPESDARFYA
                     AEVVAALEYLHLMGFIYRDLKPENILLHESGHVMLSDFDLSAYAQEQQVGAPGVFQAS
                     RGAAPLVDTRACIADLRTNSFVGTEEYIAPEVIKGCGHTSSVDWWTLGILIYEMVYAT
                     TPFKGASRHSTFANVLRRDVSFRDESVSMSAAGRNLIKKLLVKDEHKRLGAQLGASEV
                     KQHRWFASVSWGLLRHQTPPIVPSAPSMAALEQDRSTRPTRTYDWEHQPVLDPSLHDA
                     SPFHEFRQASIVR"
     gene            complement(<529406..>531289)
                     /locus_tag="MRET_3672"
                     /note="MRES_14785"
                     /db_xref="GeneID:38740438"
     mRNA            complement(<529406..>531289)
                     /locus_tag="MRET_3672"
                     /product="U4/U6.U5 tri-snRNP-associated protein 1"
                     /transcript_id="XM_027630299.1"
                     /db_xref="GeneID:38740438"
     CDS             complement(529406..531289)
                     /locus_tag="MRET_3672"
                     /codon_start=1
                     /product="U4/U6.U5 tri-snRNP-associated protein 1"
                     /protein_id="XP_027485813.1"
                     /db_xref="GeneID:38740438"
                     /translation="MGAFRASLSLDEANRVRLSLGLRPLEVDDETGADERFVPERPAE
                     PVARDEAVATSHAPQGPTLGQGASMSARAWIQHARRQAQVHAAERAAQADKEQAAAAP
                     PAYTSQDTHGLRVAHDLAELDGHERILTLRDAGVLDMEEDELEEAMTQRRAPPSASSG
                     VLDKYDHVETLDAPAPRADVGFRLGEAMDAPLRTEALASESRHAQHVSLDYEKNVPVS
                     DYDTAFKKRKKKSRQPRRVWVEESAPARAEALVDDDELAASLARARRQRAKASMKKVT
                     PAMVAQSVAAHQDEAPAADGLLFDGTSNFVQQIVERKEAPRRSAPEHASPAADAEAHE
                     HASAPEPPSPPVPASPHAPVDEAPATSPTDAPHPAAEADPSSVASVLQYLRSQGSLES
                     TSSEQREHEKTQLQYDAWLHRHRDHADDDDDAQAIMDKFKDYKPDIKIEYHDEFGRTL
                     STKEAWKQLSHTFHGTAPGHRAQEKRLRRIAEEQRRERMLAGDTSAMTQAFQARSERT
                     GQAHMVLSVGHHDHAPHHFDLGAPPRLEKAPRPSAAPRAPPAAPAPPAVPAPPAAPAP
                     TAVPAPPAAPPAPPAAPPAAPSAAATQPAFKPAFAPAFQPAQQAPAAEGSRVRIALKR
                     KAT"
     gene            <531395..>533296
                     /locus_tag="MRET_3673"
                     /note="MRES_14790"
                     /db_xref="GeneID:38740439"
     mRNA            <531395..>533296
                     /locus_tag="MRET_3673"
                     /product="RhoGAP"
                     /transcript_id="XM_027630300.1"
                     /db_xref="GeneID:38740439"
     CDS             531395..533296
                     /locus_tag="MRET_3673"
                     /codon_start=1
                     /product="RhoGAP"
                     /protein_id="XP_027485944.1"
                     /db_xref="GeneID:38740439"
                     /translation="MPSLLTRLNRAIGGDGQPGAGAATSSAESSAAGAEPRRAIGASL
                     ASPSLVSLQSTQRSIRSLNHKVKSMRFGARGARPSTEGSRSSFMASRASSDVAAPVET
                     PAPPSASSSPRPSPAKAADELHAPPPVMPLSVPWLAEPKKDTDEDADVVPTNASMTDV
                     SSAPTCSSHVDTELPTSHSLLGSMRGLRLRAPPAVHRRMPPLDTARHETRRRSLFVPI
                     RGPRSGEPSSATRAWIEWRDSVGSPTRATRLRALRSSSVLSSSSSTQSLRTNASLTEE
                     ATPSQPALFGMRLRDAGAPLPHDLEQSDRPPLLSREQTRHFVVPRIVTRCIESLEKWG
                     IYEEGLYRVPGRSSHAARLRALWESPGTDLAMAEISPADLDVHAVCSVFKMYLRELPA
                     PIVPHEIAAAMDQICAEESNDAVLATRLEPYIQSLPFYEWYLLRDITEHLGVLTEPKN
                     VECTKMTLSNLALVLSPSLQISSTLTMTLVRCRPRLFHERARPTQPDKASPPPLLDKP
                     QPAVHGALVAHAGIGPRAPQPSPVCEEAETTAPAAQVDKKEAPLPAHPSETGKDSLRD
                     TDAEEALFLDPDAHENAEEWHPADLSQDSMQTVQEVPARASTDITSLPIAQRFSRPRS
                     SLLSDASIL"
     gene            533416..533508
                     /locus_tag="MRET_t0057"
                     /db_xref="GeneID:38741251"
     tRNA            533416..533508
                     /locus_tag="MRET_t0057"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:38741251"
     gene            533577..533669
                     /locus_tag="MRET_t0058"
                     /db_xref="GeneID:38741252"
     tRNA            533577..533669
                     /locus_tag="MRET_t0058"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:38741252"
     gene            <533718..>534662
                     /locus_tag="MRET_3674"
                     /note="MRES_14795"
                     /db_xref="GeneID:38740440"
     mRNA            <533718..>534662
                     /locus_tag="MRET_3674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630301.1"
                     /db_xref="GeneID:38740440"
     CDS             533718..534662
                     /locus_tag="MRET_3674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485943.1"
                     /db_xref="GeneID:38740440"
                     /translation="MASSAVRRVARRCEDDAPIPWHELLCWDATDNALQALRFSLLLL
                     HVHARAPPPTTAWEAIRNPTGYAFVRLSSLRGRKRIRHGLLVATEGVANVRRLVLVSW
                     WVYTLGKECRVRSQRGAQDVAPHRALDSLAQVGECLAHVGESFDVASFLQGSGLFWRA
                     LGMSAVADLPPWLQRRRRGLERVGVFVSLLALTIQLYVEHQRRKRILRSMMHHVQSMQ
                     REVRRIDNERSAAQQIVPQARERVEEAYACLVTERRRLRWLGVERLCLWGDMAFTLTE
                     AWAPSHDHELLEAGTGLVAAVLRILRLWNEVRFGALDI"
     gene            complement(<534683..>536287)
                     /locus_tag="MRET_3675"
                     /note="MRES_14800"
                     /db_xref="GeneID:38740441"
     mRNA            complement(<534683..>536287)
                     /locus_tag="MRET_3675"
                     /product="CCR4-NOT transcription complex subunit 3"
                     /transcript_id="XM_027630302.1"
                     /db_xref="GeneID:38740441"
     CDS             complement(534683..536287)
                     /locus_tag="MRET_3675"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 3"
                     /protein_id="XP_027485942.1"
                     /db_xref="GeneID:38740441"
                     /translation="MAARKLQTEIDRTFKKVSEGVELFEGLYDKLQTSSNQGQKEKLE
                     SDLKTQIKKLQRLRDQIKVWLQSNEIKDKKPLLDNRRLIETQMERFKAAEKEMKTKAF
                     SKEGLIAASRLGPEEKAKVEMSQWLTSMVDELSRQIEVAEAEIEQALASSKKSKKASV
                     KDEHVSSIEHRNERRSWHISRLEILLRMLENGSLEVDQINDVKEDIAYFVESNNEDDF
                     EEDEGIYDEFNLDDEEEAFGLKEADDSTVQDSSMPTDEPAEAPPAPAPPPEEPPKAPK
                     KEEKKSAKKAPVTTEPTEPKPAPEPAPASASVASPAPAPAPAPASPAPKAAAPPPIRY
                     ATAAAAAVAASSAQGSDEQASRPPRPPSDGDARLPDTLSDLVVSFEWAKQKSALRDSN
                     LPHAQHALATSYTNGVPEPQDSERPKHYVPKDPYPTPPYYPQTPASIFDNPALYTKFD
                     VDTLFYIFYYQPGTYHQYLAARELKKQSWRFHKQYLTWFQRHSEPQTITDEYEQGAYV
                     YFDWEGSWCQRRKNDFRFEYRWLEDN"
     gene            <536425..>537135
                     /locus_tag="MRET_3676"
                     /note="MRES_14805"
                     /db_xref="GeneID:38740442"
     mRNA            <536425..>537135
                     /locus_tag="MRET_3676"
                     /product="large subunit ribosomal protein L19"
                     /transcript_id="XM_027630303.1"
                     /db_xref="GeneID:38740442"
     CDS             536425..537135
                     /locus_tag="MRET_3676"
                     /codon_start=1
                     /product="large subunit ribosomal protein L19"
                     /protein_id="XP_027485941.1"
                     /db_xref="GeneID:38740442"
                     /translation="MIGMWAPRIVPRALPRMYPRAFSSARYSLKQQEQSEAPVGAMPS
                     AHAYPFATHVKSRSHAAPPPDAIRAPPPKVKDMTRGVMQRVDSQLTMERDPDERIARL
                     FSRRSPDCIPPGSIVMVESYLNSSKTSTTTFAGVLIAVRRAGIATTFLLRTIAHKLGV
                     EMRYHAYSPMIKDIKVLQAANADKRQPGLTRTRRAKLYYMRRNDDRRVLSVANVVKQY
                     RAAQMQEHKSSTESRKRS"
     gene            complement(<537300..>537638)
                     /locus_tag="MRET_3677"
                     /note="MRES_14810"
                     /db_xref="GeneID:38740443"
     mRNA            complement(join(<537300..537362,537390..>537638))
                     /locus_tag="MRET_3677"
                     /product="small subunit ribosomal protein S14"
                     /transcript_id="XM_027630304.1"
                     /db_xref="GeneID:38740443"
     CDS             complement(join(537300..537362,537390..537638))
                     /locus_tag="MRET_3677"
                     /codon_start=1
                     /product="small subunit ribosomal protein S14"
                     /protein_id="XP_027485940.1"
                     /db_xref="GeneID:38740443"
                     /translation="MSMRPNARVLRDIAKRHTVHSNELLRTAYKYIARNTTLPSRVRY
                     MAQLELNNFPAKSRPAFVKDRCIETSRGRGVFTEFGLCRYQFRRKAVHHEIPGVEKAS
                     W"
     gene            <537898..>539877
                     /locus_tag="MRET_3678"
                     /note="MRES_14815"
                     /db_xref="GeneID:38740444"
     mRNA            <537898..>539877
                     /locus_tag="MRET_3678"
                     /product="5-aminolevulinate synthase"
                     /transcript_id="XM_027630305.1"
                     /db_xref="GeneID:38740444"
     CDS             537898..539877
                     /locus_tag="MRET_3678"
                     /codon_start=1
                     /product="5-aminolevulinate synthase"
                     /protein_id="XP_027485793.1"
                     /db_xref="GeneID:38740444"
                     /translation="MDLTRVSPSRLRGLCPYLRGLPRATLCHLARSFSMASRTGASGG
                     LLSRVKQCPYMSQSIAETDCSTDTMPSGTTVGGASSSVNDMVVPHPLPKAMVEMSGGV
                     CPVSHQRLPTSMMQKRTYATQSTLAKASMVSLNPSAAASMPAPATLEAAPYQRRTPGS
                     GLGRLPEPPKTTDPGFDFERFYHEELKQKHDGNTYRYFNNVNRLAQRAPMGHLTENEA
                     HEITVWCSNDYQNMSRHPRVLSAMAETLSKYGAGAGGTRNIAGHNMHVERAEEVLARL
                     HRKDAALVFGSCYAANDATLTVLGSKLPDCVILSDASNHASMIQGIKHSGARKMIYKH
                     NDMTDLENKLKSLPLSTPKIIAFESVYSMCGTIGPIEETIALAKKYGAITFLDEVHAV
                     GMYGPHGAGVAEHLDWMLNATMPPGKLRGTVMDKIDIITGTLGKAYGNVGGYIAGSHR
                     MVDLIRSYAPQFIFSTTLPPAVLTGAATAVEVLMESNHTRQLQQIRTRELKNALLDAG
                     IPLQSNPSHIVPVLVGSAEKAKQASDLLLNQHGCYVQPINYPTVATGLERLRITPTPE
                     HTSQHVRHLVQALQQVWDQLGLRTVQDLLDAPRDGSDVLADLFRRSQFEEDTSPLWSD
                     AMLALPSEMITGSSSAAFHCGCSKVDMPSPSTLVA"
     gene            <540193..>542763
                     /locus_tag="MRET_3679"
                     /note="MRES_14820"
                     /db_xref="GeneID:38740445"
     mRNA            <540193..>542763
                     /locus_tag="MRET_3679"
                     /product="integral membrane protein"
                     /transcript_id="XM_027630306.1"
                     /db_xref="GeneID:38740445"
     CDS             540193..542763
                     /locus_tag="MRET_3679"
                     /codon_start=1
                     /product="integral membrane protein"
                     /protein_id="XP_027485939.1"
                     /db_xref="GeneID:38740445"
                     /translation="MRGLPGSHASRHASAWVKVYSIVPLCFAIYLLCMSCVSASPTGI
                     MEARHGGHDDETPASSFTSTQTAASLSVSQIPAAPSSTARLSSTSLSSVAPSSSMAPV
                     SLTTHDAEHGHSHDHGHESSGFSYDSITPEQWPAFCSVPTLADKWANADMKDCIAADQ
                     IDHPIGADVAGWGLYPSPRINHTNLHAHAHGTDPIMENLNETRLFIRKGAVPLSYVEW
                     DFASGLGRLSELRRFVSVDAERIQAMWPNRSVIGASGGYWRTLGDIDYNVTWNALRDD
                     IKWRTSDGVSEPARQKGLAIFSATLFIVACFILLPAVLCLQTAHSTLVPLFSLLYLAI
                     LTTSLFFGRLYFALTPELYPPSALPGLVIAYFLLSMICFGLPAAKLVLLIVPLVRGRL
                     RSWNDLRSLMRVLTQGSSPGLYDREESFPMSMSHSAGSTDGALTDPVLSTGPGTAESS
                     HGFGVLDQEREPGAPLLDSPVSAEEDKSIPIPMRRPYERFVHRFPRLSFTLGMIYTTV
                     SRGLVPLAFVIVYVAIAIYTGSCRRGYKNVCLAHGIKGAIFFWYGVLTFARYLGAFGE
                     YGWAWNKRPTPENSTHSRAAFWRRNMPSAEFVESLVIFLYGISNTWLERLGAKPGDPY
                     TIKQIQHISIAVMFWFIGLIGMALESNKVRNILGYVVVHTHPAATPARANEDEVEAQA
                     QPPSYVQSFNPFPSLVIGVTGVAMAAHHQDYVYEVQIHILWGEMLAAFAFFRWLTYFF
                     MWLRPPVSTLPSRPPTEALASFALCCGGLLFMLSNEEVSFAAMRADYADVMAVLNLAI
                     SLIALVFCWSFCLMVIKAWAFKRDAQWREPVVFHAKPLDTDEPFAKEQVFAVSDDASD
                     "
     gene            <542945..>544555
                     /locus_tag="MRET_3680"
                     /note="MRES_14825"
                     /db_xref="GeneID:38740446"
     mRNA            <542945..>544555
                     /locus_tag="MRET_3680"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027630307.1"
                     /db_xref="GeneID:38740446"
     CDS             542945..544555
                     /locus_tag="MRET_3680"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027485871.1"
                     /db_xref="GeneID:38740446"
                     /translation="MNVGQGGSPRSRGQRTRHMRTSSGLGLDTLLVRTAQDGSRSSMR
                     VKAPLVGGFYFSDLVVVMLSAMYHLLCSCSIAELLDLMYFMFVYHTIHLWRDVWSRPA
                     GLSFFHAYMLCMMRKVMHVMPFLPPRICLSSLSMAPFLRWRTGGAAAILIRAYGHHKE
                     DGFRAYWMRSVPASSTASPPPSSRTVVLYVHGGGFALGSVALYAEPLLRVLSYTKGHH
                     VECVALEYELAPKARFPSQLVEALRCYAHLLERERIPASRIVLAGDSAGGNLVMSMLL
                     CLHGQGYSRLGGRTWSSLPLPARAVLLSPWLDLRRPSHPCAAPLDIVTSANLHQFAQV
                     YTQILPRPRRVAGPASRLVRRLLRSPSYPCIWLRTWLSQPLWLATRAVEAAEARTDAV
                     PCAQLYDTNNDHPVMNHVNVSPVLGEWHDIAQRVNLSVLWGEHELMAEDIAAWTRRLP
                     RVDTYVATHDWGVHVWPFLNALLAPSVAEREWGLWQMARAMVGVPMALSEPTSPPSSM
                     PSDTDEPEPDEQAQRAWDAELQRLHVKT"
     gene            complement(<544582..>545766)
                     /locus_tag="MRET_3681"
                     /note="MRES_14830"
                     /db_xref="GeneID:38740447"
     mRNA            complement(<544582..>545766)
                     /locus_tag="MRET_3681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630308.1"
                     /db_xref="GeneID:38740447"
     CDS             complement(544582..545766)
                     /locus_tag="MRET_3681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485872.1"
                     /db_xref="GeneID:38740447"
                     /translation="MSAADAEPATSGSMNARSMSTSSFTTAVPPTFIVTEVPDVPPED
                     DTYALAGQTEYTQTEEQRLETRHVEEYLRRMSEKHRTQKRARHDQPQAASTSGSTGLV
                     RRISTSLSRVPSLRHQRRAPSEQPYENTTTGSAYEMTPSHYGAQPAPLHEVPHSTIQG
                     YEPIAGDADESQSPSVHIPEASYSRQELHDQTPLNRAPTGDMSTISLEDLHEPREALD
                     APESAVISSPTDMSDASAAQRRLHARNFPTVTAGKASSKQMQRTLTQRQRAKAGGSWA
                     PTIPEGDAHADVGIPRDLNSEALGASTNVKKDDPFETPPFSASFGRSSSTDLQELPLQ
                     SQSYPSAVLMTTDSAATPSRDLGTSERKNRWYWSDLLLGCGLCDTTNEEDEQAARTNP
                     ME"
     gene            <545936..>546205
                     /locus_tag="MRET_3682"
                     /db_xref="GeneID:38740448"
     mRNA            <545936..>546205
                     /locus_tag="MRET_3682"
                     /product="cytochrome c oxidase assembly factor 5"
                     /transcript_id="XM_027630309.1"
                     /db_xref="GeneID:38740448"
     CDS             545936..546205
                     /locus_tag="MRET_3682"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor 5"
                     /protein_id="XP_027485869.1"
                     /db_xref="GeneID:38740448"
                     /translation="MHGVCDRIRAELAECLKKSDCMRVHGHSGKECMSKYRDTLPPEC
                     QQVYYGFVDCKRSLWDMRKRFRGIPGGQYNSSSTMFAALDRRMEK"
     gene            complement(<546208..>546852)
                     /locus_tag="MRET_3683"
                     /db_xref="GeneID:38740449"
     mRNA            complement(<546208..>546852)
                     /locus_tag="MRET_3683"
                     /product="conserved serine/proline-rich protein"
                     /transcript_id="XM_027630310.1"
                     /db_xref="GeneID:38740449"
     CDS             complement(546208..546852)
                     /locus_tag="MRET_3683"
                     /codon_start=1
                     /product="conserved serine/proline-rich protein"
                     /protein_id="XP_027485870.1"
                     /db_xref="GeneID:38740449"
                     /translation="MLRHCGTLICVVLQGRHLTRKRTHDTQDPVAEVRIDGTRLRTLP
                     DRRGGSAPLWDEQMQFEIVDNGTSPHTLELVCYATDKEPDYIGRTAIDLTPALTQRQY
                     DRWLSLTHHGQCTGQVYVELTYYPLPQPLDIASPASTPPTPSHPHTPHDTMAADDAAQ
                     APASPSRDRGHSIPAPTHISSPPPAPSRTRPPHTSIPTPPKSSPRFVAPIPGTP"
     gene            <546960..>547217
                     /locus_tag="MRET_3684"
                     /db_xref="GeneID:38740450"
     mRNA            <546960..>547217
                     /locus_tag="MRET_3684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630311.1"
                     /db_xref="GeneID:38740450"
     CDS             546960..547217
                     /locus_tag="MRET_3684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485868.1"
                     /db_xref="GeneID:38740450"
                     /translation="MWMLRAGVRATRGVVARSYSTGAKSRHALVYREIFPPMFRVLAY
                     STATYFAMHLLWVTLATEEERRAQAAEIEDLRGEIRAAQGK"
     gene            complement(<547235..>552025)
                     /locus_tag="MRET_3685"
                     /note="MRES_14835"
                     /db_xref="GeneID:38740451"
     mRNA            complement(<547235..>552025)
                     /locus_tag="MRET_3685"
                     /product="Ras GTPase-activating-like protein IQGAP2/3"
                     /transcript_id="XM_027630312.1"
                     /db_xref="GeneID:38740451"
     CDS             complement(547235..552025)
                     /locus_tag="MRET_3685"
                     /codon_start=1
                     /product="Ras GTPase-activating-like protein IQGAP2/3"
                     /protein_id="XP_027485999.1"
                     /db_xref="GeneID:38740451"
                     /translation="MARRPDQPLQPPLPMSTAPLREPLRQHAPTQSRTADMRGKFERP
                     PLRPVARDAPTRRPPSRFESGKLASNPFVQQAARTEPVKAASGRENRPVARAESSVMS
                     RSKTARKVSEATGALSHTRIRLSRQSLKSFPSIDIKAATSVSALQDSGKSPGGKWLDQ
                     ERDHVQAYEYLCHCSEAQQWMERCIGEPLGGDIANMAEEMRNGIALAKVAKSFEPSCV
                     PRIFVHPKLQFRHTDNINYYFQFVDKIRLPSCFRFELTDLYEKKNFPKVVYCLHALSH
                     FMAHHGRSDKVDDLVGKLEFDEEQLFKTQKTIEAAGTAMPSFGGVGQALAQEMGVKKA
                     PAAPKAPPAPPAEPRSSPGRAARLGVEATTLQAQRAHLKHVEASPKKPATPHTVASMR
                     AQLKPVDSEPTLRSPDKRAHDALERERERHARLEDRERARQERERERTRLRKERERER
                     TRLREEREQRAQDLERERAQLRAEREREREERDRSLVHATQDLERARREQLYMHVRSS
                     THRELARDDKEWRERLREAEERARAEEREERFKRELAHELERQRQAELYAAELAAAHA
                     ETAAVEARLQALAEESARRDAAERARAETRLAVPLQAQIRGALARQALFTQLSQMDEV
                     WAVQLQAHVRGTLARRSLFRTIMDAEAHTPAIVYVQAAARGVLARRRLLAHMQALEQD
                     AVLTALQARIRGALARRAFAQMRTAYQRIALVRAASPAVSTGALARRPHHELRKHMAY
                     VRPDLTGVQAQIRGVLARHEYVWWRTHLHTNVGAIVYVQSLLRGVLARRAFDAGIGRF
                     LAHIPDVVRVQSLCRARRARSHYRALRRGTGVPLDTVRALALDDGGRDYADERAVSQL
                     RHLVVQQRRTNQSMEAHILDLDRKIALLVKNKIGIEDIVKARTERGWLGASASAAHAH
                     VLAEANDPFAAHVLTPDAQRRLEAYQALFYVLQTQPTYLARLLVLTNAADVPEHERGQ
                     LEQTVLAMFAYAQQPREEYLLLKLVQATIHTHAPRIATLSDWATPLHAPFQRMLIHLT
                     CGVRERTYLCAMLTPPMSRLLSEPHLELDAVAALRTHADMDAALEEPATRAEFLHRLQ
                     ALRAVCETFVNALRAASPPTPYGLQFVARAHFDALRTQFPHAHHTDIVRAVAYTLYHS
                     YIHPAIVAPEAYGMPSPSDHARRQLACLSHTLHQIARGTPFDDADRYLQPLNEYVLDA
                     STRVHHWVQTLLDTYVDAEHHFGLDEWTDLGSTHARPVIYISPNEVYAIHQLLCTNVA
                     SLTDSHDALAELLAQLGTPPVSTTPELSRARDGEVTLALSHHHTDLAHVHDVDAEDKL
                     LFSEAKQLVMAVLRIQQGPANLLDLFVAPVSGADEAAWAARRTQPPYAGTPTADLSFA
                     ELKAKALERILHLEQLGRVHRANAYQDMLDAMAADIRRKDQRRQERRAQRDMLQTTLT
                     RLQEQQQFMESQIKSYETCMDRGKHAMQKPTSRRRRLMDTLPFSPQFFHQRSLKAAGM
                     MPTYGSYRYSATRLHAKGILAYIERPDNLAIDQLSFTIASDQVGVFELEASVGSIVAG
                     NATLRMDDLLEAQYANQTHVGMLDGAIQFHLTPLIRFINKKFYT"
     gene            complement(<552087..>552778)
                     /locus_tag="MRET_3686"
                     /db_xref="GeneID:38740452"
     mRNA            complement(join(<552087..552114,552143..552176,
                     552202..552290,552315..>552778))
                     /locus_tag="MRET_3686"
                     /product="coatomer subunit zeta"
                     /transcript_id="XM_027630313.1"
                     /db_xref="GeneID:38740452"
     CDS             complement(join(552087..552114,552143..552176,
                     552202..552290,552315..552778))
                     /locus_tag="MRET_3686"
                     /codon_start=1
                     /product="coatomer subunit zeta"
                     /protein_id="XP_027485866.1"
                     /db_xref="GeneID:38740452"
                     /translation="MPAGALNLTLYTTQAVVLLDAEGHRLYAKYFEPLAAKDAPAPPT
                     MAPGLAPLVARNPFPTLKQQQKFEQSIWDKARRASGDLFQYEGHLVLFKASYDVYLFV
                     IAPDRENELMIHSFLQSLYDTLTILLQSQMDKRTVLDNLDLVTIAIDESVDDGIILET
                     DSAAIANRVTRTRPDTIEVQLNEQTIMNAYSNFRDKVVQRLGSL"
     gene            complement(<552844..>553896)
                     /locus_tag="MRET_3687"
                     /note="MRES_14840"
                     /db_xref="GeneID:38740453"
     mRNA            complement(<552844..>553896)
                     /locus_tag="MRET_3687"
                     /product="TBC1 domain family member 20"
                     /transcript_id="XM_027630314.1"
                     /db_xref="GeneID:38740453"
     CDS             complement(552844..553896)
                     /locus_tag="MRET_3687"
                     /codon_start=1
                     /product="TBC1 domain family member 20"
                     /protein_id="XP_027485867.1"
                     /db_xref="GeneID:38740453"
                     /translation="MSAWHEAGRSALPPPRPVAQHADESQVALDVRRSFHAWDAALVG
                     DVHLRQAQLSDLLCGTLRAYPYLHYYQGLHDIVAVILLTMCPTPTWPSDAVRERVQTV
                     VHYVCLMLVRDDMTTDLLPAMAQMKLVLHIVRAADAPYAYALERTFGSSHIVVVLPWL
                     LTLLTHDAPSLAVAQHVVTFVLEHGPASMLYVCAALVLAQKEGALHVVDDMPLLHQHL
                     AQAPRTQMTSGAQPILTAAASLMQTYSLECPVVCAHRVLSRDSVLFTWPRTDVDVAHI
                     LSLPTSHLVLDAAPTPREHPRVAVAPRLRPLRRVLRLWRGPPTLWVSSLSLLLGGSVL
                     SLLLAMHVASAPYART"
     gene            <554007..>554585
                     /locus_tag="MRET_3688"
                     /note="MRES_14845"
                     /db_xref="GeneID:38740454"
     mRNA            <554007..>554585
                     /locus_tag="MRET_3688"
                     /product="Ras enriched in brain"
                     /transcript_id="XM_027630315.1"
                     /db_xref="GeneID:38740454"
     CDS             554007..554585
                     /locus_tag="MRET_3688"
                     /codon_start=1
                     /product="Ras enriched in brain"
                     /protein_id="XP_027485864.1"
                     /db_xref="GeneID:38740454"
                     /translation="MSASSAQQLRKKRKIAVLGSRSVGKSSLVVRFVEDAFVDSYYPT
                     IENVFEKTVKYRGQDYYCDIVDTAGQDEYSILNSKHAIGIHGYVLVYSIASRTTFEMI
                     QTVYDKILNYTGTSTVPCVLVGQKSDLHAQRQVSEAEGKALAQSLHCAWIETSARHNA
                     NVSKVFELVLAEIEKASSQGGAEAPSSSCVVM"
     gene            <554686..>555831
                     /locus_tag="MRET_3689"
                     /note="MRES_14850"
                     /db_xref="GeneID:38740455"
     mRNA            <554686..>555831
                     /locus_tag="MRET_3689"
                     /product="D-xylulose reductase"
                     /transcript_id="XM_027630316.1"
                     /db_xref="GeneID:38740455"
     CDS             554686..555831
                     /locus_tag="MRET_3689"
                     /codon_start=1
                     /product="D-xylulose reductase"
                     /protein_id="XP_027485865.1"
                     /db_xref="GeneID:38740455"
                     /translation="MNNSLPTPPAQGNVSFVLRRVNDTVLEDRPVRPLRAGEVRVNVR
                     QTGLCGSDCHYRSHGRIGEFVLEAPMVLGHESSGIVCEVGPGVTTHAVGDRVALEPGV
                     PCLSCSLCLGGRYNLCRAMVFAATPPYDGTLATYYQVHASFAHKVPDHMTLEEASLME
                     PLSVAVHAAVARGRLAPLQNVLVLGAGPIGLLVGAVARAYGASSVVMSDLVDEKLAFA
                     SDFCATSTFKPDAPRPDESEGELAARTASALKASLGGSVQANDGFDLVLDATGAQSCI
                     MLGVWAARPQGRVVAVGMGRPDILVPVTRMSVQEIELVGSFRYSCGDYERAIALVASG
                     QIDVKRLVTHRYVFSDASKAFDATTAGRGEDGRATIKVQICQGEARS"
     gene            <555889..>557145
                     /locus_tag="MRET_3690"
                     /db_xref="GeneID:38740456"
     mRNA            <555889..>557145
                     /locus_tag="MRET_3690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630317.1"
                     /db_xref="GeneID:38740456"
     CDS             555889..557145
                     /locus_tag="MRET_3690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485838.1"
                     /db_xref="GeneID:38740456"
                     /translation="MLRRGGRAVRAGASRLVALHDALAQRHAPRVMEAFVGVARDDPA
                     LLTPAEYRGMLRVLLRAEPRSPSTVQHVLLMLEHMQERVSVAPASAAEALVHAELVHM
                     LRDAYVWNGLLTCTRPKLSSMFQMLARGASVLRATDGTPCVPAYTPLAGLGVAPYRAF
                     PDTVTYNVLLHAIVQGARARRLPPVPPSIVPLTVWHTLHTPPTRPSTERVVLELWHHM
                     RQAPHTQPSPISWCIRLQLYIRMGRLDDVHACMRDMQAHDAVSLDALHAVWQAYARTG
                     GTHLHEAWCAFRAQTPTAAWTRATGLDAVPRIEPSATTFGIVTRLLAERGDVWAALRV
                     MHDGLAQGACRVSPATYYALFHALAHTQRTPATSRVLAELMEGYLALAPRVPRRRLGT
                     LLQALRRHAPSAAMEVRLTSAAGTRH"
     gene            complement(<557117..>559186)
                     /locus_tag="MRET_3691"
                     /note="MRES_14855"
                     /db_xref="GeneID:38740457"
     mRNA            complement(<557117..>559186)
                     /locus_tag="MRET_3691"
                     /product="gamma-tubulin complex component 3"
                     /transcript_id="XM_027630318.1"
                     /db_xref="GeneID:38740457"
     CDS             complement(557117..559186)
                     /locus_tag="MRET_3691"
                     /codon_start=1
                     /product="gamma-tubulin complex component 3"
                     /protein_id="XP_027485837.1"
                     /db_xref="GeneID:38740457"
                     /translation="MAAVVRVSDVQDVRVPRAELLTRLRARQGVSLVPEHELVRDVLY
                     LFQGMSGTHVRWRHEWQLPSDDGSRPAHMDMRLDFDEQYGMIAPPTRALIHRLAELGQ
                     LYERVQRYVDETQQTKASLHLAAQSLCYFLANELHAHCELVSAWDRTWHAQVEGDGGR
                     PLTLQRLASCTHEPVMRMRLMSTIVASCEHAHGGALVSTIHTYTLTGHPFIRRYTAAM
                     LDHVSRPFFHTLSRWLYYGELDDPFSEFFVRRATAPAERPHVVDDLVVTSEQGVDAAD
                     VWHHRFVLSRDMLPTFLSEHFARKIFSTGKSLHFLRECCLEGSAPSRHRRELRYSDMA
                     GLEHAIDAEFALASGQLCTRMLRAFRLFDHLRALKSYLLLAQGDFADALLQTLGPSLS
                     RPASTLYQHNLSAALETAIRASSAQYEDPEILRRLDARSLEFGPGDTGWDTFTLEYRV
                     DSPVNAVLDASAMAGYQLLFHYLWHIQRVASRISTAWTQLLSVQKEVARSRHRRALGQ
                     PLLLQLRATHAHLCEMVHFVRQLQSFSELEGLSHAWQRLEHDLLVSPPTDLDHLIEIH
                     RTYLHTLIHTTLLRAPGSGRRTTDHLAHDVRAQLHCILAYADATDELGMYVTAELARL
                     ASDATAPLAAAARTHAHVSQRLATHHTEFVERLHTMLAALERHPTLTVRDLARRWNFN
                     AVYQRRS"
     gene            <559310..>560188
                     /locus_tag="MRET_3692"
                     /note="MRES_14860"
                     /db_xref="GeneID:38740458"
     mRNA            <559310..>560188
                     /locus_tag="MRET_3692"
                     /product="endosome-associated ubiquitin isopeptidase
                     (AmsH)"
                     /transcript_id="XM_027630319.1"
                     /db_xref="GeneID:38740458"
     CDS             559310..560188
                     /locus_tag="MRET_3692"
                     /codon_start=1
                     /product="endosome-associated ubiquitin isopeptidase
                     (AmsH)"
                     /protein_id="XP_027485840.1"
                     /db_xref="GeneID:38740458"
                     /translation="MLRSPRARGPAEQRLTLTSPMNQIGVLGRSTHARAPPAPTQPAS
                     LAELDAQVAELRHELRFSSAVPISHWIRCADTFKRQADQHHNASDLDMQYLCLAKCDK
                     LLNELMPREHAGWHKLDRETRAQCRRHAALIHELVWLTRDALLEARGGAAPATHPPVS
                     PSSHAATPTRSSFRQASRASKHVSFAEAPPSARTAPWSPTHAVPTTWAAPTLPLSPPL
                     SLAGQPPPWSPPLTCPPLSPPPTSPVAQPPRIPSPRPRRLRRRPSERLFLTADPPVSL
                     PVARGVPRHGLSCTLG"
     gene            complement(<560180..>561394)
                     /locus_tag="MRET_3693"
                     /note="MRES_14865"
                     /db_xref="GeneID:38740459"
     mRNA            complement(<560180..>561394)
                     /locus_tag="MRET_3693"
                     /product="paxillin"
                     /transcript_id="XM_027630320.1"
                     /db_xref="GeneID:38740459"
     CDS             complement(560180..561394)
                     /locus_tag="MRET_3693"
                     /codon_start=1
                     /product="paxillin"
                     /protein_id="XP_027485839.1"
                     /db_xref="GeneID:38740459"
                     /translation="MSVTQRPLPQPAGHVVASPSAHDLFPYGLSSPIRHGMPATPPRF
                     ETPPPTVPPKPLSPHTSPFKTPRKRPLPTSPTRPLPRPGARPLPTIPLDTPHRTTSPL
                     PPPPSMSPAAPSSPSKAGLPARVPSPRGPQPVPREAAPVPVPLLMVDGEVMTDDMMDP
                     TSSSAPSVATSDGAVVAQHASSSSAAERDAAMPPVPPVSQGVHAMCHRCGRWIGGYMV
                     HAMGKAWHARCFTCAHCATPLEHVSFYEHEGEPYCHLDFHELFSRRCFYCQTPIVDER
                     FVTVDAFGEPRTYHEAHFFCANCGDPFVEQKDGNTSVTEHSRPFYVHGRHAYCEACHR
                     PRCQACKKVVGDEHIQALRAVWHPECFVCTRCGRPCQGATFVAPDGSPCDFDCYQAWI
                     RGTAKRSTTFLS"
     gene            <561535..>562122
                     /locus_tag="MRET_3694"
                     /note="MRES_14870"
                     /db_xref="GeneID:38740460"
     mRNA            <561535..>562122
                     /locus_tag="MRET_3694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630321.1"
                     /db_xref="GeneID:38740460"
     CDS             561535..562122
                     /locus_tag="MRET_3694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485834.1"
                     /db_xref="GeneID:38740460"
                     /translation="MHTTLRLCVSRRAQRLMRRAKDENMRHAVSLYHLTPSFYPTNVS
                     GDKDPVLENEVTESILGPFYNGRSGRPFVQFTTVHELLLRQRREHLHNRRDTMGEMTD
                     MYESTVLPGSLSHASMLQDSTNARSHFVKQPASYPTRRARDTAGHGDLYAMDELSVRS
                     AQVRDALYGTVAGELPGLEIVREHERAWDAEKESS"
     gene            562235..562313
                     /locus_tag="MRET_t0059"
                     /db_xref="GeneID:38741253"
     tRNA            562235..562313
                     /locus_tag="MRET_t0059"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:38741253"
     gene            <562413..>564788
                     /locus_tag="MRET_3695"
                     /note="MRES_14875"
                     /db_xref="GeneID:38740461"
     mRNA            <562413..>564788
                     /locus_tag="MRET_3695"
                     /product="DNA replication licensing factor MCM7"
                     /transcript_id="XM_027630322.1"
                     /db_xref="GeneID:38740461"
     CDS             562413..564788
                     /locus_tag="MRET_3695"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM7"
                     /protein_id="XP_027485833.1"
                     /db_xref="GeneID:38740461"
                     /translation="MSGASTGPILPVINVPVRYEEERDKIQDFLQHFKAPLDQVPPLS
                     DVGTTQASSMPDETRAMDIEEDAAPDAMVNKYMIQLQRIANRDQEMIVIELDDIAQFS
                     STSGFVGGALVASIQANTKRYVNLFCDVIDRIMPDPSRDISDKDDVLDVIRHQRLERN
                     ALNEQHEESMGEVAETFPPTLLRRYMLYIRPLSRSTPSLAVRSIRGAHLGKLLSVRGV
                     VTRISDVRPSILVDAYACDVCGAEVFQEVTGQQYMPLTFCSSRVCATNKARAPLYPQV
                     RASKFLAYQEIRIQEMTDQVPVGHIPRSMSVHLYGRLTRQVSPGDIVQVGGIFLPQPY
                     TGFRGIRAGLLTDTFLEAQSIQQLKKTYEAMEPTPEIEAELDALRADPSLYHRLASSI
                     APEIYGHEDIKKVLLLLLVGGCHKTMGDGLKIRGDLNVCLMGDPGVAKSQLLKYIAKV
                     APRGLYTTGRGSSGAGLTAAVLRDPVTDEMVLEGGALVLADNGIACIDEFDKMEESDR
                     TAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRVSPVDNINLPAALLS
                     RFDILYLILDTPSRDDDERLAEHVTYVHMYNAPPVQAQDVVPPHVLRHFLAAARQCRP
                     TIPRAVSDFLVNAYVQMRAQHKHDEERDEAFTYTSARTLLGMVRLSQALARLRFADVV
                     ETSDVEEALRLMDVSKASLYTSARRRGDLSSRDQSYVSKIFRLLRDMAVQSGRDDPSR
                     ANAAGLGELALSDVRARAIAAGWVEDQLHETLLEYSSLNVLHVVGQRIVFA"
     gene            complement(<564789..>566492)
                     /locus_tag="MRET_3696"
                     /note="MRES_14880"
                     /db_xref="GeneID:38740462"
     mRNA            complement(<564789..>566492)
                     /locus_tag="MRET_3696"
                     /product="nucleoporin NDC1"
                     /transcript_id="XM_027630323.1"
                     /db_xref="GeneID:38740462"
     CDS             complement(564789..566492)
                     /locus_tag="MRET_3696"
                     /codon_start=1
                     /product="nucleoporin NDC1"
                     /protein_id="XP_027485836.1"
                     /db_xref="GeneID:38740462"
                     /translation="MSLVNAAPPPPAVVAPADTFRALVKRAMRPRQQRILFLCMIAAF
                     LGLALSTPILTWQRPCSALAASLALVACVMLPVLLWRRTSLLHSTWRPEGAPVARAAY
                     AYHVLPGTPVRWHAGVGAVAVVVYAALSTPSLAVMQWVPAHGAHYVNETFVVALVGGT
                     MMSGAYAVASALWMRGARRGVPPYQVRFADARLYEHAIAALATHVPPAVFLAAALWPL
                     CIAVYCLSRDTLWTMVLHMTGIDTPLRRWIVPSFRWPFRSWHLLLSTWPAVVLPVALL
                     EVAHTLFDVYWTHPLDSITASYKDPLTALLGGLHDPHLFFSTHALMELARRARHDAAF
                     RRAVFDDVQHGRPPALASMIHACLRALDAVAPPPAPPPAPTPAPTPAPTAAPPNDKRP
                     APRPTPAALLRTMLRHAWSLLPPEARHVLFPRTLYCALWAPAPSLALDARLASSVPRA
                     FWAAAAIEAWMLASLTQDTYGVAQHHTAAVVDALARAHARLERVRTDVERLAIEADSE
                     HVRDVAAWRGALADTGAAAAFGPSSAPFFTEMQASWQAYAPADAALSRALRRIVESFP
                     T"
     gene            <566605..>567474
                     /locus_tag="MRET_3697"
                     /note="MRES_14885"
                     /db_xref="GeneID:38740463"
     mRNA            <566605..>567474
                     /locus_tag="MRET_3697"
                     /product="superoxide dismutase, Fe-Mn family"
                     /transcript_id="XM_027630324.1"
                     /db_xref="GeneID:38740463"
     CDS             566605..567474
                     /locus_tag="MRET_3697"
                     /codon_start=1
                     /product="superoxide dismutase, Fe-Mn family"
                     /protein_id="XP_027486028.1"
                     /db_xref="GeneID:38740463"
                     /translation="MFRVARPAVHAAMRATSVRALHQLPPMPEALAEGCEPFLSKRTT
                     HLLWTQWQAGLLQRLNEEVRGTPRATESVVETVMNAAHDRDSILAFNYASLALNTSFF
                     LSCLVPHAAQKQPAYPQPSTHIGAVPTLFGKTLATAISDQFGSLPQLKLAMSSAAMGM
                     VSSGWVWLVKDEHGRLGIVPTYGAGTVLVQQRRQCGPKDLVTAVQDGEAQAEAPAAPD
                     APTRPPRFDALSRASGADAIGQHLYPLLCVSMYEHAWLGDYGFWGKERYMTHFWDCVN
                     WERVERLWGDDRT"
     gene            <567550..>568956
                     /locus_tag="MRET_3698"
                     /note="MRES_14890"
                     /db_xref="GeneID:38740464"
     mRNA            <567550..>568956
                     /locus_tag="MRET_3698"
                     /product="SNARE associated golgi protein"
                     /transcript_id="XM_027630325.1"
                     /db_xref="GeneID:38740464"
     CDS             567550..568956
                     /locus_tag="MRET_3698"
                     /codon_start=1
                     /product="SNARE associated golgi protein"
                     /protein_id="XP_027485832.1"
                     /db_xref="GeneID:38740464"
                     /translation="MSRHPVDVPRRSDTVTPRQRKTPSLRVQTQLRSHSHDTENTAWR
                     PMRSGTRSPRSPSRLRSAAHAAQSLVSVMARSMSPTVASTLIDVPTTMSPVSMEPEEM
                     PHEHTISMDVAEPIVAPQARHGAVYLRPRSRQSRRIRRRSAWAHVQAIARLVGHPREC
                     LVLAFQYVCAQYTYWDHAFRDPVTDQRTWWPPWMQSYAPLLVWVVISLSSTVLVMLFH
                     TPLFHALDHMSTLLRDQGLLGRILFGALIFALTFPPMPLYSTMIVLSGFAFGMWQGFV
                     VSYVAALSGAAAVFLLSRTYLHTWMMRVLAHAGGLQRVVHAIELRPQLLFLVRLAPYP
                     YNLLNMLLASSHILTFRTYLSCTALALPKLLVHTSIGASIENWTTNRASNDAYTVRHM
                     AGLCGMVLCVGIFIYLHHVTSRAVNDSLEHGSGEEYDMEDDVEPKSPGTPEHCDTTTS
                     HAPSWLAESIEEFERAVE"
     gene            <569188..>569934
                     /locus_tag="MRET_3699"
                     /note="MRES_14895"
                     /db_xref="GeneID:38740465"
     mRNA            <569188..>569934
                     /locus_tag="MRET_3699"
                     /product="DUF431 domain protein"
                     /transcript_id="XM_027630326.1"
                     /db_xref="GeneID:38740465"
     CDS             569188..569934
                     /locus_tag="MRET_3699"
                     /codon_start=1
                     /product="DUF431 domain protein"
                     /protein_id="XP_027485831.1"
                     /db_xref="GeneID:38740465"
                     /translation="MRAEYIIEHMEEDEPEAPAHFPPWALLEYRHMLYHVGEGTTVHF
                     TALSRASLDALHEAFRQPLPPLTQKPARFELHAESVTTLAQQRGWDLQRICLLDPKAP
                     LPLSVRDAGLHGSTPAPFTHFLFGGILGDDPPRDRTASLRELGFPGRHLGSVQMSTDT
                     ALGVTKRVVEDGLRLGLDELRGMDGADGASDGCGALSFVDSPTLQFGRGESVELPYRY
                     LVADPTTSEPLMAPGMRDIIYRDFDRTFDI"
     gene            complement(<569931..>570497)
                     /locus_tag="MRET_3700"
                     /note="MRES_14900"
                     /db_xref="GeneID:38740466"
     mRNA            complement(<569931..>570497)
                     /locus_tag="MRET_3700"
                     /product="DUF775 domain protein"
                     /transcript_id="XM_027630327.1"
                     /db_xref="GeneID:38740466"
     CDS             complement(569931..570497)
                     /locus_tag="MRET_3700"
                     /codon_start=1
                     /product="DUF775 domain protein"
                     /protein_id="XP_027486042.1"
                     /db_xref="GeneID:38740466"
                     /translation="MFSCVVAGRLPLPPPQQIDATHAVFQLEEASHINHLVVFMTGEQ
                     AFPEGYGATVHLMWPRDNPAEAPPTWQLLGCLQNTKPSAIFRIRDPKRDQLQPRTATL
                     GISIETLDEVERQMQTLAKPPEQALTRPPTITQAAQLTIPIAQNVFAYLSSFAPDSAP
                     QAVPLLQRWLEQFERKLQSQGLDFLLRN"
     gene            <570541..>571485
                     /locus_tag="MRET_3701"
                     /db_xref="GeneID:38740467"
     mRNA            <570541..>571485
                     /locus_tag="MRET_3701"
                     /product="ribokinase"
                     /transcript_id="XM_027630328.1"
                     /db_xref="GeneID:38740467"
     CDS             570541..571485
                     /locus_tag="MRET_3701"
                     /codon_start=1
                     /product="ribokinase"
                     /protein_id="XP_027486041.1"
                     /db_xref="GeneID:38740467"
                     /translation="MSLCVVRSSVNIDETFQVPHIVRPGETISSSAMWSRPGGKGANV
                     AAVLGLAGVRARMLGAVGEDAKWPIRCLEERHVDTSCMYVSPDVPTGRAFIQLSQGDG
                     ENSIVLLKGANFALDTPLDDVRRWLSPEVTHLILQNEIPLASTIAYVQHAQSLSICTV
                     LNPSPMLTPDELRAFPWAGLHVLIVNEGESAELQAALGPDARTLADVPCLAPIPWLVV
                     TRGSQGSSAGVILDGKRTWIDVPASRTTHVVNTTGAGDTYTGYLVAGLMTTDHWTIDR
                     VRAVLQRASVAAAMAVEVDGAMDSIPAASEVEARCRSL"
     gene            <571502..>572695
                     /locus_tag="MRET_3702"
                     /note="MRES_14905"
                     /db_xref="GeneID:38740468"
     mRNA            <571502..>572695
                     /locus_tag="MRET_3702"
                     /product="general repressor of transcription"
                     /transcript_id="XM_027630329.1"
                     /db_xref="GeneID:38740468"
     CDS             571502..572695
                     /locus_tag="MRET_3702"
                     /codon_start=1
                     /product="general repressor of transcription"
                     /protein_id="XP_027486040.1"
                     /db_xref="GeneID:38740468"
                     /translation="MDRRVPGNVTPRRASRFFLPRVSPPSPTRQQEARRATIPLALQK
                     RRSKYRASSAYLSAFASGEDAYYVLASDQTAQSVANPLSLAFLEQYLAVGDDEGRVSI
                     LDTLEPHASALAYSSEPLVHGSVFALEWHDDLLAIGGSDCTVRLWDAEKQAVTITWEG
                     HAGSPRALAWSPDGYVTSGARDGDVYVWDARTPAAAVHIPRAHAKKKSVAAVTALAYL
                     PGGQTFASSSSANAVLHVWDLRMTKRPVAKTDDASRRASWNTRSHGISSLAVAASRHA
                     IYAACTDGCVYVFDAGDVARPAVPGEASALYEVEQYQNSLYARLALYDDSLLALGCHL
                     GHVVLWDVSTRLRPDVDCHGFVRGGTVLTRLHNAEINDVSWTCGPHGPYLASACDDLT
                     TRLWT"
     gene            complement(<572673..>574202)
                     /locus_tag="MRET_3703"
                     /note="MRES_14910"
                     /db_xref="GeneID:38740469"
     mRNA            complement(<572673..>574202)
                     /locus_tag="MRET_3703"
                     /product="threonine synthase"
                     /transcript_id="XM_027630330.1"
                     /db_xref="GeneID:38740469"
     CDS             complement(572673..574202)
                     /locus_tag="MRET_3703"
                     /codon_start=1
                     /product="threonine synthase"
                     /protein_id="XP_027485820.1"
                     /db_xref="GeneID:38740469"
                     /translation="MKYLSTRGGDERLTFEEAVLQGLAPNGGLYVPERIPALPADWQD
                     AWATLPFPELAFRIASLFVPPTAEEGGIPPDDLRMLMNKSYATFRHDDVAPLHQVSPR
                     EWCLELWHGPTFAFKDVALQLLGNLFEYILERRNQAQGTHTLTVLGATSGDTGSAAIA
                     GLRSKAHIHIFILHPRGRVSPIQEAQMTTILDDNVHNLAVDGTFDDCQDIVKTLFADR
                     AFNDKHHLGAINSINWARILSQITYYFAAYFALRKQTDDADRMQVVVPTGNFGDILAG
                     YYAKRLGLPMSQLVVATNENDILQRFWATGRYEKAQGGHVAATLSPAMDIQVSSNFER
                     LLWHLAHDTSEASDRAADAGRQVQAWMQALKTHGSMAVTPAQWELARRDFSAERVSDA
                     ETRATIRRYFDEQSYLVDPHTAVGFEAARRRANTAPQVILSTAHPAKFSDAVLSSFAD
                     HRDMASYFDAHVLPPEMQGLLDKPRRVVHIPAGDDHFASLLQRTKDQIERDGFTSTNA
                     S"
     gene            <574304..>574825
                     /locus_tag="MRET_3704"
                     /note="MRES_14915"
                     /db_xref="GeneID:38740470"
     mRNA            <574304..>574825
                     /locus_tag="MRET_3704"
                     /product="riboflavin kinase"
                     /transcript_id="XM_027630331.1"
                     /db_xref="GeneID:38740470"
     CDS             574304..574825
                     /locus_tag="MRET_3704"
                     /codon_start=1
                     /product="riboflavin kinase"
                     /protein_id="XP_027485817.1"
                     /db_xref="GeneID:38740470"
                     /translation="MARPSVCGGDEPQAPFPVYLRGSVEHGFGRGSKQLNCATANLPV
                     QAIDDPVNDAEHQLADTGVYFGYAQVHFHDASQRHEDELRVHPMVMSVGRNPHFQAEH
                     KTLEVHILHTYSDDFYGEHMRVIVLGYIRAQRKYESLEALIQDIELDKRVGEQSLRRP
                     AYEAYRHHTWFAP"
     gene            complement(<574832..>575887)
                     /locus_tag="MRET_3705"
                     /note="MRES_14920"
                     /db_xref="GeneID:38740471"
     mRNA            complement(<574832..>575887)
                     /locus_tag="MRET_3705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630332.1"
                     /db_xref="GeneID:38740471"
     CDS             complement(574832..575887)
                     /locus_tag="MRET_3705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486039.1"
                     /db_xref="GeneID:38740471"
                     /translation="MQPTERPSSAKARMQGHLAQVPRAIPQSPVRPASSMHLPLSPSR
                     DSSLLAAPSATIPTGHGAASSSASLVSANELPDDPERASNVVHLFAPPLAPAWSPVSM
                     SRSQSSRTDDASSTYFPIGARASLSPRSPPYQAPLSPEASIFERNIQMLGSPHVRTPR
                     EAVDMAVPPVLDDAADAIVSDSTLEIVSPRSPPSPYASPSASHRTSGVDMLRGASHDG
                     TWRQRAYGHRRLQSDQTSVMKNIPSSPAGQRRSACPPTPTAAPSVTHSPSLSIDGAVI
                     HEGRAAMLSHSLDGIADAMVANDRSPGSSRLGHLSVPSASPSMHPSPGRKRLSWMSYA
                     DIVHDVNEQVYDIDPQV"
     gene            <576330..>577283
                     /locus_tag="MRET_3706"
                     /note="MRES_14925"
                     /db_xref="GeneID:38740472"
     mRNA            <576330..>577283
                     /locus_tag="MRET_3706"
                     /product="RNA-binding protein"
                     /transcript_id="XM_027630333.1"
                     /db_xref="GeneID:38740472"
     CDS             576330..577283
                     /locus_tag="MRET_3706"
                     /codon_start=1
                     /product="RNA-binding protein"
                     /protein_id="XP_027486038.1"
                     /db_xref="GeneID:38740472"
                     /translation="MSGASTRLYVGRLAPDTTRDDVADLFNRVGPIVDVRVLNGFGFI
                     EFEDVRDAEYAVRDFDGTMFMGDRIIVQFAKQSTRRERDFERGPRDGYAPRGRRDGPP
                     RPPPRRGPRRGQYRVIVFNLPPGTSWQDLKDVGREHGHVTFAEINPSYPDEGALEFET
                     RDDYERALARIEGTDLRGTLLRAEPAADAPPPPRERSPVRRYRDDYRDDYRDERPPPP
                     MRDDDQRDRWDDARHKEERGDAPRDEREDRYEQADRHEAPRDDAPANESEARHEREHE
                     EQAREEEAPRDEAPRETPRDAPEDSAEKPEARSDPAPTAES"
     gene            <577381..>579174
                     /locus_tag="MRET_3707"
                     /note="MRES_14930"
                     /db_xref="GeneID:38740473"
     mRNA            <577381..>579174
                     /locus_tag="MRET_3707"
                     /product="chromatin structure-remodeling complex subunit
                     SFH1"
                     /transcript_id="XM_027630334.1"
                     /db_xref="GeneID:38740473"
     CDS             577381..579174
                     /locus_tag="MRET_3707"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     SFH1"
                     /protein_id="XP_027486037.1"
                     /db_xref="GeneID:38740473"
                     /translation="MMPALSAPQGAPGPYQSSRTWVCGTSSAPVRLQARIAPGQAQYS
                     TYASRMRAGTSTLMQPIQRSARDPETLLGSRTSRHVYYAEDEDDEDDEDDAEEPDEDD
                     LDDDDDEYNDAGSDDEEYGVQHRPKRRRGETRSRSPVDPEAEAELLPPGQQLGRPVPS
                     HRLVVRPAKRTPHTYFTERQLEQQGDSTEVLVPIRIEFHTETHRIKDVFLWNLHEQLI
                     SPYQFAHIFLQDLELPMQPYATQIESLIIQQLSDAMSALDSAGDGHERLIHLKTVARD
                     RERKRLEIEAEQRRRAAQPMVLDSATSMPRKRGRPRKYPLPEPPAEAWEAPPPAPIPP
                     EPIYVPPSEADEAKATDKTRIHDTLAKVDAEDDLRVMVEYEVQMARYMLRDRLEWDLC
                     STLTPETFAQTLVRDLGLPLEGGMLISHALHEQLLHHRRAAMELGLFGTGKMYKCTMD
                     ELLQIEEAEAAGPPQEADEWSEDAVVAMSMRDDQAPPHTRSRRMAAAAVQASALASSA
                     GTGTLPFLVPDTTLPLPVRRRQALATLHDLLAMGPRPLEGAWRDYADTLDFGPVLEYL
                     SEAEVEKMEEVDLRATRRNRRDAQRLGRGRR"
     gene            <579288..>580104
                     /locus_tag="MRET_3708"
                     /note="MRES_14935"
                     /db_xref="GeneID:38740474"
     mRNA            join(<579288..579447,579482..>580104)
                     /locus_tag="MRET_3708"
                     /product="small subunit ribosomal protein S3Ae"
                     /transcript_id="XM_027630335.1"
                     /db_xref="GeneID:38740474"
     CDS             join(579288..579447,579482..580104)
                     /locus_tag="MRET_3708"
                     /codon_start=1
                     /product="small subunit ribosomal protein S3Ae"
                     /protein_id="XP_027486036.1"
                     /db_xref="GeneID:38740474"
                     /translation="MAVGKNKKLSKGKGNRKRAVDPFTRKEWYDIKAPVFFENRNVGK
                     TIVNRSQGLKNSADALRGRILEQSLADLNKDDEQAFRKFKLRVDEVQGRNCLTNFYGM
                     DFTQDKVRSLVRKWQSLIEAHQDIKTTDGYLLRVFAIGFTRRRANQVKKTTYAKSSQI
                     RAIRKKMFEVMQRESSSCDLREFVAKLIPEVMGREIEKSTQGIYPLKDVFIRKVKVLK
                     RPKFDTNKLFELHGGASVVGAEDVGTKIKSGEFKEPVPQASV"
     gene            <580224..>580658
                     /locus_tag="MRET_3709"
                     /db_xref="GeneID:38740475"
     mRNA            <580224..>580658
                     /locus_tag="MRET_3709"
                     /product="protein of unknown function (DUF788)"
                     /transcript_id="XM_027630336.1"
                     /db_xref="GeneID:38740475"
     CDS             580224..580658
                     /locus_tag="MRET_3709"
                     /codon_start=1
                     /product="protein of unknown function (DUF788)"
                     /protein_id="XP_027486035.1"
                     /db_xref="GeneID:38740475"
                     /translation="MARGAQKRVSHANARAVATLQYGFVVANTAFVCGTWLWPPRAWW
                     WTWVMYGVTELVAVGLAWQLLGIARAGDDLAQAGMTAYMFDVVYLTWFVHVGTALVSA
                     RLWWTYAVIPAYLLYLAYKNVLPYVWPQAHAAAAPQRRATRR"
     gene            complement(<580645..>582447)
                     /locus_tag="MRET_3710"
                     /note="MRES_14940"
                     /db_xref="GeneID:38740476"
     mRNA            complement(<580645..>582447)
                     /locus_tag="MRET_3710"
                     /product="transcription factor"
                     /transcript_id="XM_027630337.1"
                     /db_xref="GeneID:38740476"
     CDS             complement(580645..582447)
                     /locus_tag="MRET_3710"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027485936.1"
                     /db_xref="GeneID:38740476"
                     /translation="MSVQQRVHASSSSMPMSRSASWTEAGSTPAPASAPTSTAPTPPL
                     PPQDGPIRAYAKLEFPGFSYYIQTLPVTIGRRPQGPPPSPVGTSWSVPRDVDVDLGPL
                     KSISRMHARIFYSAQVLRGSVAPPPADAPKLEGQFMLEVLGRNGAFVDDVWVGMNGVV
                     PLGPRIKIQIAERVFYFVLPPPPSSMDEEEEEDEEGVEDEEEGAPLSSDLSDASPPAK
                     PPKLVLKPRAQLPKRPHESEDDDVSKRIKEEAPDTPLPFQKPDLSNVQLITNALSSES
                     CAKKGHKLTLQEVYEWLQNTYPWFSQNGRKTGRDWQSSIRHTIGTSREFCKVPRRSDE
                     PGKGIFYTLATSDLAKAQPPQAEPPATDTPPSSAPTRTDTKPAAPAAPAAPAAPATPA
                     TPVTPSTSSMPRIPLVVGVPPTDATAAPKAPGSLESLLETPPIAHHQGKLYLSPSVFG
                     HLSQDQLRHIEGLGAQQALQVLQSYLVTHLKAKMRKAKAPTPPPPPPAKSPSAYDQRL
                     EPPKVPRIPVPDTPREAHIPKDKSDPLSALSALAAHPEAAGLIALLKKQQAGGQGTVK
                     LTAGQLELLQLANRLAMQRKKKQAPGSQQPSTSG"
     gene            complement(<582515..>583692)
                     /locus_tag="MRET_3711"
                     /note="MRES_14945"
                     /db_xref="GeneID:38740477"
     mRNA            complement(join(<582515..582989,583013..>583692))
                     /locus_tag="MRET_3711"
                     /product="RF-1 domain protein"
                     /transcript_id="XM_027630338.1"
                     /db_xref="GeneID:38740477"
     CDS             complement(join(582515..582989,583013..583692))
                     /locus_tag="MRET_3711"
                     /codon_start=1
                     /product="RF-1 domain protein"
                     /protein_id="XP_027486070.1"
                     /db_xref="GeneID:38740477"
                     /translation="MRRAAWRPSLRRLSTLAYRAAAADCVREVPTPLLFVAAPAWSGT
                     PPARELYKPWLEPLATRGFSVMLLDLAPEVPPGTSVLAAMEREMSATLAKPPQGGPPP
                     PFPPALIARGAACVVAEAYASSFPLTALQLVDPPISMQRATQRYPSLFPSALPEFTFE
                     AQFPVRVAWTQPELAWHAEHGVPWYEVHRIEHEREDAAGECLDRYEWASFDEGLDDTI
                     RWLEDEAGFALRLDAPETPTPTRTESVRDETAAPAVPAGTVPAWFSAGHYAFATDGSK
                     KRPIILDERDLQERFIRGSGPGGQAINKLSTNVELVHIPTHTRVTCQHTRSRQQNREI
                     ARRLMSQRLEWLIKQSWHPRAGVSVLQARIDKIRQRKYHKRKKQHRSVVT"
     gene            <583712..>584284
                     /locus_tag="MRET_3712"
                     /note="MRES_14950"
                     /db_xref="GeneID:38740478"
     mRNA            <583712..>584284
                     /locus_tag="MRET_3712"
                     /product="AMMECR1 family protein"
                     /transcript_id="XM_027630339.1"
                     /db_xref="GeneID:38740478"
     CDS             583712..584284
                     /locus_tag="MRET_3712"
                     /codon_start=1
                     /product="AMMECR1 family protein"
                     /protein_id="XP_027486071.1"
                     /db_xref="GeneID:38740478"
                     /translation="MREADRRHALFCFGVLRAALGLCAMPGDDELPDECVRLFVSWHL
                     VTDGARHLRGCIGTFEPQPLAQGLRAYAIRSACHDKRFPPICAAELERLACTVSLLTP
                     MEVCADWLDWDLGVHGVYVRLEGGASATFLPEVAPAQGWTKAETIERVIRKAGWTAPI
                     TDTVLRHATLLRYTSTHATVTYDEYMLYTR"
     gene            complement(<584277..>585191)
                     /locus_tag="MRET_3713"
                     /note="MRES_14955"
                     /db_xref="GeneID:38740479"
     mRNA            complement(<584277..>585191)
                     /locus_tag="MRET_3713"
                     /product="phospholipid-binding protein that interacts with
                     both Ypt7p and Vps33p"
                     /transcript_id="XM_027630340.1"
                     /db_xref="GeneID:38740479"
     CDS             complement(584277..585191)
                     /locus_tag="MRET_3713"
                     /codon_start=1
                     /product="phospholipid-binding protein that interacts with
                     both Ypt7p and Vps33p"
                     /protein_id="XP_027486072.1"
                     /db_xref="GeneID:38740479"
                     /translation="MDPVVAGSSSDVYAPSVGTSGTRPTLYIRRADVSASLESYKRLL
                     DATKAYTAAMSHMSEASADLAAALQDCSTLKGAHASGASLQAAGGLHYLKSNYEQILC
                     DTIWKECSIPLLSHLDAYRQSVQERQQSHEVSMEEHKRVLKSIEAQYHKSGSRHARDL
                     QSFRTMLTELQDKVNEMEDTKAQHYMDVLQNEEHTWDLVAQNVLLLVRAQVDMADRLS
                     SKAVQDPVLESLMAHMPDPFQSYGPPKRENELFSILQPTDASPTAPSPGLPRSDTSLF
                     PEPDAAPEERSLASRPSIHHLFGYAAPT"
     gene            <585308..>585812
                     /locus_tag="MRET_3714"
                     /note="MRES_14960"
                     /db_xref="GeneID:38740480"
     mRNA            join(<585308..585310,585342..585495,585522..585735,
                     585761..>585812)
                     /locus_tag="MRET_3714"
                     /product="myosin regulatory light chain cdc4"
                     /transcript_id="XM_027630341.1"
                     /db_xref="GeneID:38740480"
     CDS             join(585308..585310,585342..585495,585522..585735,
                     585761..585812)
                     /locus_tag="MRET_3714"
                     /codon_start=1
                     /product="myosin regulatory light chain cdc4"
                     /protein_id="XP_027486073.1"
                     /db_xref="GeneID:38740480"
                     /translation="MADSEIKEAFSLFDKKGSGTILSENLGDLLRALGQNPTQAEVAS
                     LASNAPAEIDFPTFTNILNRPNGFKPAGTPEEFIRGFQVFDKDGTGHIGVGELRYVLT
                     SLGEKLSDEEVDELLKGVTVGEDGNINYEAFVRQILSQ"
     gene            complement(<585929..>586261)
                     /locus_tag="MRET_3715"
                     /db_xref="GeneID:38740481"
     mRNA            complement(join(<585929..585945,585976..>586261))
                     /locus_tag="MRET_3715"
                     /product="small subunit ribosomal protein S25e"
                     /transcript_id="XM_027630342.1"
                     /db_xref="GeneID:38740481"
     CDS             complement(join(585929..585945,585976..586261))
                     /locus_tag="MRET_3715"
                     /codon_start=1
                     /product="small subunit ribosomal protein S25e"
                     /protein_id="XP_027486074.1"
                     /db_xref="GeneID:38740481"
                     /translation="MPPKKSAIAAAASKTGKKKKWSKGKVKDKAQNAVYLDKVLYERV
                     IKEVPTFKMITPSVLIDRLKINGSLARLAIRHFEREGQIKPVIHHNGQLVYTRNSD"
     gene            complement(<586367..>587085)
                     /locus_tag="MRET_3716"
                     /note="MRES_14965"
                     /db_xref="GeneID:38740482"
     mRNA            complement(join(<586367..586516,586560..586651,
                     586680..586703,586731..>587085))
                     /locus_tag="MRET_3716"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_027630343.1"
                     /db_xref="GeneID:38740482"
     CDS             complement(join(586367..586516,586560..586651,
                     586680..586703,586731..587085))
                     /locus_tag="MRET_3716"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_027486075.1"
                     /db_xref="GeneID:38740482"
                     /translation="MAVIEEVDEDSVSLLRVKEDMLRRRGAQLTTEGDDAPAWHDSDD
                     EDDGPMLEEDTAQWLYEEVEDAKLPDSVAFVLDLVSWSIPFVFAFELLNLLVQKQYNH
                     ETTVLDEIRTLLSRIPPLILLIAWNLREKRRWLTQAVMFVLGTVAGCYMAYLVNQASF
                     QRAMARAPAVGTLWFLAIVRLDLTACVFSLLLFAAYVWGAGYRLVL"
     gene            <587269..>587896
                     /locus_tag="MRET_3717"
                     /note="MRES_14970"
                     /db_xref="GeneID:38740483"
     mRNA            join(<587269..587448,587536..587643,587672..>587896)
                     /locus_tag="MRET_3717"
                     /product="F-type H+-transporting ATPase subunit d"
                     /transcript_id="XM_027630344.1"
                     /db_xref="GeneID:38740483"
     CDS             join(587269..587448,587536..587643,587672..587896)
                     /locus_tag="MRET_3717"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit d"
                     /protein_id="XP_027486076.1"
                     /db_xref="GeneID:38740483"
                     /translation="MASKAAAVNFHKILSSGIGKETGAQLAAFRKRSEEARRALNQLK
                     AQPVTVDFAAYKGVLKNQAVVSQAEKIVNEFKPVTYDVSAQVKAIESFESVAVKQAQE
                     SSAKLEAELKDLKETLSNIEGARPFDQLSVADVIAARPEIGKTVDEMVKKGKWTVPGY
                     HEKFGNLAVM"
     gene            <588117..>589202
                     /locus_tag="MRET_3718"
                     /note="MRES_14975"
                     /db_xref="GeneID:38740484"
     mRNA            <588117..>589202
                     /locus_tag="MRET_3718"
                     /product="cAMP-dependent protein kinase regulator"
                     /transcript_id="XM_027630345.1"
                     /db_xref="GeneID:38740484"
     CDS             588117..589202
                     /locus_tag="MRET_3718"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase regulator"
                     /protein_id="XP_027486077.1"
                     /db_xref="GeneID:38740484"
                     /translation="MCGLFQDPFGGANCAVEDASYDCPIPEGINLGRRTSVSAESMTS
                     TQVQPQDVACFPKTESQEARLLSALRMNVLFQQMEPEIGSTLVQAMREKHVPKGGIVI
                     KQGDDGKYCYVTESGTLDVYVQPPGTPADVALAAPSDQLGTKVLTYGPGAAFGELALM
                     YMQPRAASVVATSDCVLWALDRVTFRSVLAHADIQHRLMLGAFMRQVPLLQHLREDER
                     ARVSDAIHLVDYRAGEVVLREGDIGTQFFMVVYGLAEVTKADDKEHPVTLLQRGDYFG
                     ELALLRRAPRAATVTASERSPDGVLRVAVLEEDAFTRLLGPLSDIMNRHAETHYGATP
                     AGASTTAEPANHTSSPRSTSNDGGAGL"
     gene            complement(<589161..>591404)
                     /locus_tag="MRET_3719"
                     /note="MRES_14980"
                     /db_xref="GeneID:38740485"
     mRNA            complement(<589161..>591404)
                     /locus_tag="MRET_3719"
                     /product="aspartyl-tRNA synthetase"
                     /transcript_id="XM_027630346.1"
                     /db_xref="GeneID:38740485"
     CDS             complement(589161..591404)
                     /locus_tag="MRET_3719"
                     /codon_start=1
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="XP_027486078.1"
                     /db_xref="GeneID:38740485"
                     /translation="MVMVAIGRGTSDVLCASGHESRQLPYYAITTTRHTSSRDILHRV
                     LAWPVLVGGRCAMRRLAGWPGLWRFVSRRARGPSPRYSSSSASSHATLSTARWPTQAP
                     THACGRLRPEHADHRVVLAGWMLAPRKISRKLAFIPLQDVSGTVQLVVTDPELVDAMS
                     NVPVESVVCVHGSVQGRSQGAVNEAMRTGAIEVRVDAWELLNAAASKLPFYPTQCHDA
                     ASLPNEALRAKHRYLDLRRPTLASHIRERSRIMHAARSFLHECDFTEVETPILLRSTP
                     EGAREFLVPTRGTQPQFYALQQSPQQPKQLLMVSGVTDRYFQFAKCFRDEDGRKDRQP
                     EFTQIDMEMSFVTGRGDEPAWPLGGTEVRRVTEGLVRAMWDASSAATTLPTPFPVLSY
                     EHVMSVYGSDKPDTRFGLQIENLLPKGASEALDVLVVPHYTSCQLSARQKEALLQDKS
                     GTGRLPIEHFKARRSAPQALAERLWTKSHHVRGWQPHWGCAEALGAVLHGVMERANAF
                     RDAAPLPREDTCDVYVARRALPIQGGSTPMGDLRLRWAEALPLACAEPQILWVTQFPL
                     FTRADDDKAEMAHGRWSASHHPFTAPLADDVPRLYQALACEDASERDALLSTIHGQHY
                     DLVLNGAEIGGGSVRIHDAHLQRTMLEQVLALTPHETARFDHLLRALASGAPPHAGLA
                     LGFDRFMAIVCDTSSIRDVIAFPKSGAGIDPLFSSPAPLDDAEQRTQLAMYSLQPRSS
                     VVGRGSR"
     gene            <591397..>592443
                     /locus_tag="MRET_3720"
                     /note="MRES_14985"
                     /db_xref="GeneID:38740486"
     mRNA            <591397..>592443
                     /locus_tag="MRET_3720"
                     /product="Tol-Pal system protein YbgF"
                     /transcript_id="XM_027630347.1"
                     /db_xref="GeneID:38740486"
     CDS             591397..592443
                     /locus_tag="MRET_3720"
                     /codon_start=1
                     /product="Tol-Pal system protein YbgF"
                     /protein_id="XP_027485861.1"
                     /db_xref="GeneID:38740486"
                     /translation="MTMTNPVQDVSNKALDAEKGVENKVPQEVTDTVKQGASELTSSE
                     KEKPSTEQERPNNVTSPVASDAKAAAPESAPTAAPSTQEPAIDAGERVTEHTTVYTEA
                     TPQVLESENHHVVTESVPITHTSIPDYNERATAAPPIVGSDLYSILRDSSQQRSMDYT
                     KTQTAAPTASGAVQSGVPSYLQNSSQVPATSTAAAVPAPKSLEQFEPTDEQAWSVRGP
                     ASSVQSRGPADLAKNTSASTAGAAAGAGTGGVASQVGKSGEAVQGAQNKLGESAKEVG
                     GKPGNALEGAKDKVGDVSKKPGDVAQQAESKAGDVKKQGTDAVDEAKKAGKTQKKGLL
                     QKIKKALKIGKDYK"
     gene            <592690..>593109
                     /locus_tag="MRET_3721"
                     /note="MRES_14990"
                     /db_xref="GeneID:38740487"
     mRNA            <592690..>593109
                     /locus_tag="MRET_3721"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630348.1"
                     /db_xref="GeneID:38740487"
     CDS             592690..593109
                     /locus_tag="MRET_3721"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485900.1"
                     /db_xref="GeneID:38740487"
                     /translation="MYYGDDDFDRSYDNLTHGQRIAIGVCVSIGGVILLVAIGYFISQ
                     YRSRPFLPRFRPGFSTGYYGGGQPYHPQPYPMAQQSQGGYPGPGVPWQPGPYTPAGGP
                     GPQYAPPDHPPPTHQPEKSGGPYAPPPGPPPGEGAGP"
     gene            <593258..>593699
                     /locus_tag="MRET_3722"
                     /note="MRES_14995"
                     /db_xref="GeneID:38740488"
     mRNA            join(<593258..593327,593356..>593699)
                     /locus_tag="MRET_3722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630349.1"
                     /db_xref="GeneID:38740488"
     CDS             join(593258..593327,593356..593699)
                     /locus_tag="MRET_3722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485925.1"
                     /db_xref="GeneID:38740488"
                     /translation="MRQCGDGEPCDDGSSSHGAGIGIPVGIFIVIVALAVYSLWRLQR
                     HRQTLRFTRNAHRHSALRPTSGAATHPPPFPRHQRQDWPSPYDTYPPRASHAPPEVDE
                     EPLPRYEPPATPPPQFHEHDDTLTPPPKAYQGASQ"
     gene            complement(<593730..>594059)
                     /locus_tag="MRET_3723"
                     /note="MRES_15000"
                     /db_xref="GeneID:38740489"
     mRNA            complement(<593730..>594059)
                     /locus_tag="MRET_3723"
                     /product="Shwachman-Bodian-Diamond syndrome (SBDS)
                     protein"
                     /transcript_id="XM_027630350.1"
                     /db_xref="GeneID:38740489"
     CDS             complement(593730..594059)
                     /locus_tag="MRET_3723"
                     /codon_start=1
                     /product="Shwachman-Bodian-Diamond syndrome (SBDS)
                     protein"
                     /protein_id="XP_027485920.1"
                     /db_xref="GeneID:38740489"
                     /translation="MSSNQLTRVIYKADPMSTDEYIVIVNPEAYVSWRNGDKTIPLAD
                     VVESFQIMTSGQGQQGIMGQVSKQQLHAVFGTTKEDEAIVKLLEQGTMQAGSLKPNDK
                     SSRNSSN"
     gene            <594377..>595782
                     /locus_tag="MRET_3724"
                     /note="MRES_15005"
                     /db_xref="GeneID:38740490"
     mRNA            join(<594377..595730,595757..>595782)
                     /locus_tag="MRET_3724"
                     /product="pleiotropic regulator 1"
                     /transcript_id="XM_027630351.1"
                     /db_xref="GeneID:38740490"
     CDS             join(594377..595730,595757..595782)
                     /locus_tag="MRET_3724"
                     /codon_start=1
                     /product="pleiotropic regulator 1"
                     /protein_id="XP_027485862.1"
                     /db_xref="GeneID:38740490"
                     /translation="MAEAQRAALSDLAERHAKRSRTILQHFHAQAPDYADVTRAHLAS
                     KMHSDYQQALVLPEVIQARQGPAPPIPSKPTELSGMLDEMEVQRGLAKQHAPSSAVAL
                     RPAAAAKATPASASHLQTALMRPEEAVHDTGRSMLNSALIRKKELAQQQVKPAYHAPW
                     KLMRVMSGHLGWVRCVAVDPHNQWFATGAGDRIIKIWDMASGELKLSLTGHISPVRGL
                     AVSHRHPYLFSAGEDKLVKCWDLETNKVVRQYYGHLSGIYALSLHPTLDVLVTAGRDA
                     SARVWDMRTKTQIHVLGGHRGTVASVACQEGDPQVITGSMDATIKLWDLAAGRCVTTL
                     THHKKSVRALALPPHEFTFASGSAGGHNIKRWRCPEGTLMTNMTHEGIVNTLSCNADG
                     VLFSGADDGSMQLFDYATGVPFQSMRDTVQPGSLDAEAGVFCSAFDQTGTRLITGCAD
                     KTIKIYRET"
     gene            complement(<595760..>598159)
                     /locus_tag="MRET_3725"
                     /note="MRES_15010"
                     /db_xref="GeneID:38740491"
     mRNA            complement(<595760..>598159)
                     /locus_tag="MRET_3725"
                     /product="N-acetylated-alpha-linked acidic dipeptidase"
                     /transcript_id="XM_027630352.1"
                     /db_xref="GeneID:38740491"
     CDS             complement(595760..598159)
                     /locus_tag="MRET_3725"
                     /codon_start=1
                     /product="N-acetylated-alpha-linked acidic dipeptidase"
                     /protein_id="XP_027485937.1"
                     /db_xref="GeneID:38740491"
                     /translation="MHLCQEQRLRPQATRAAPETWPEKSARAHAAAASPRRPSRWPLG
                     LSLVLMLYVWCRWLRADAPHNDSDTTALLRAFGPSIADEARCRVRASMNATGCVSTWR
                     DRARAAEAAFLDVPSAESARAALQRYTSHVHIASDDRDAASARQVLTEWADLLGVPTD
                     ATDAIFDAGSTQSRTYMTQHGEPRVWADTYAVWLDRPVHASLSLTAANGSTVWEADLA
                     EDVVRDDPTSAHGAPAFHAYSASGTAHAHVIYAGHGSHADFARLDALGVRVRGSVVLV
                     RNGGVFRGLAVRAAQEHGAVGVLLYTDPADDGGVTEAHGHAAYPDGPARQRSSVERGS
                     VQALSFQPGDPSTPGAPSYRDAARLPREEAISLPRIPSLPISYMHAQRLLRDMEGVGV
                     EASAVRPDWGGAIPHTTYWTGPSRHMAHMTNEMDMQTRDIWNVYAVIPGHIDTQRIMV
                     GHHRDAWGFGAGDPSSGTAAVHEVVRGLGHLLRRGWRPARTIVLASWDAEEYGLVGST
                     ECGEDYASFLQDHVALYHNLDMAVRGSQFRAKASPSLQRVLHDAVKALPNVTLDHVGP
                     LGSSSDFTVFLQHLGIASSDLGFDRAPSDPVYHYHSNYDSFAWMDRFGDPDFARHETV
                     AKVYGLLVLRSAQSLFLPLSLTDTAQALVTHLASLENVARDANVRLAPTWLQRLADAI
                     ERLSQGARRLAAEQAALAKRLDAPDGDLAPTLRAVHAINERLQPWEQGWLDARGLRQR
                     TWYRHLGVAPGRWLGYGATTFPGVTESITLDGGQHTTDELARLTLALERLAALMSRGR
                     S"
     gene            complement(<598239..>599151)
                     /locus_tag="MRET_3726"
                     /note="MRES_15015"
                     /db_xref="GeneID:38740492"
     mRNA            complement(join(<598239..599032,599058..599083,
                     599115..599122,599149..>599151))
                     /locus_tag="MRET_3726"
                     /product="20S proteasome subunit alpha 6"
                     /transcript_id="XM_027630353.1"
                     /db_xref="GeneID:38740492"
     CDS             complement(join(598239..599032,599058..599083,
                     599115..599122,599149..599151))
                     /locus_tag="MRET_3726"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 6"
                     /protein_id="XP_027485918.1"
                     /db_xref="GeneID:38740492"
                     /translation="MFRNTYDSDNTVFSPQGRLHQVEYALEAVKQGSAVVGLRSKTHA
                     VLVALKRAPSELASYQRKVLKIDHHLGMGFAGLTSDARVLSHYMRQLALSSRLMYTRP
                     LPVSRLMGSLADRAQLNTMQYGKRPYGVGFLVIGMDDTGPHLYEFNPTGNCFEYYAMS
                     LGARNQSAKTYLESHLDEFHDADLEALLLHGIRAVRETLPQNKQLERAAVTVAFVGPG
                     ADADASSPALRDGQKLTILEDDALASYFDRLGPTERQRAAQARAEAQPHEQPPPMDEN
                     "
     gene            <599272..>600345
                     /locus_tag="MRET_3727"
                     /note="MRES_15020"
                     /db_xref="GeneID:38740493"
     mRNA            <599272..>600345
                     /locus_tag="MRET_3727"
                     /product="signal recognition particle receptor beta
                     subunit"
                     /transcript_id="XM_027630354.1"
                     /db_xref="GeneID:38740493"
     CDS             599272..600345
                     /locus_tag="MRET_3727"
                     /codon_start=1
                     /product="signal recognition particle receptor beta
                     subunit"
                     /protein_id="XP_027485917.1"
                     /db_xref="GeneID:38740493"
                     /translation="MPVDAVRVLCTCALVLCVTAVLLLRRTRAVPEAPYVSKGPRKVV
                     LLGVEEAGKTNVFLRMVMGVAPDTTTSQRVNAARLSPSDACPHGIELVDTPGHARLRA
                     QAMDAMRGADAVVFCIDASVASRGANEPAPGMSSTHARPSLHEALQHSVDYLHDVLHT
                     LAADVPPQPLALSILFTRMDASPLFSDRATLADDKRRQQLLARCRRGLETAFMSRRET
                     RGLSRTDATGRVVVGEIGDIRGDASLRERVWGRMRQALVPLGLVPAEARTAAELHPTR
                     WGHKVRAGEGHQRSAEYALDYMVARRGAGAEAPFQCLDPRLVQGGCAAMDLGYVDRHG
                     WDPTRVGEAYLPDVHAWLSPRAS"
     gene            <600434..>602905
                     /locus_tag="MRET_3728"
                     /note="MRES_15025"
                     /db_xref="GeneID:38740494"
     mRNA            <600434..>602905
                     /locus_tag="MRET_3728"
                     /product="ribosome biogenesis protein ERB1"
                     /transcript_id="XM_027630355.1"
                     /db_xref="GeneID:38740494"
     CDS             600434..602905
                     /locus_tag="MRET_3728"
                     /codon_start=1
                     /product="ribosome biogenesis protein ERB1"
                     /protein_id="XP_027485906.1"
                     /db_xref="GeneID:38740494"
                     /translation="MPLGRKRAEPGGAPTRQTEVARVPAPDFPVGEGTLPLDDDEDAE
                     RELDARSADSGEDAVPALDARSADSEEEGEEASTESGFDSEEIEQWDDEADAKYADAE
                     ADEDVAEGDAALARMVARARVKPDEGERRTNKLGIDTAVAARFFDETRNDDGSQRGRV
                     VRSDATGELKTVYPPIEPEYDSDSSTEDVPNRIGQVPMSWYDDLPHIGYDINGRRVLR
                     PAQGDELDKFLESVEGEGGDAWFSARDEQRGMDVKLTDEELDMIRRMERAEVPLGDYD
                     MYEPATDWFTQHERTMPLTARPEPKSRFVPSKWEHKKIMKIVRAIRQGRIVPHAPGRE
                     KPRFYAIWSDADEARADHPMHMPAPKLPLPTHVESYNPPEEYLLGDDERAEWEAADPE
                     DRKLPFLPAKYASLRHVPGYEHALQDRFQRCLDLYLAPRVRRQRVEVDNPEALLPALP
                     APRELRPFPTHTDVVYAHAPWRVRTASLDPSGAWLLTGADDGHVRLWDAALGRCVASW
                     DVNVGVAQSDRSPVYCVQWCPQRSWAIAAAVSAGRITLLAPPQCGRTRHEASVAHLTP
                     PHADAPVDGHAQWTRLPERERARGVCVRIDVRSTQRATLVPKYVRWHARGDYFATVCP
                     DTSGEAVLIHQISKQRSQAPFRRTRKAGTSAMAVQCVCFHPTRPWLFVATQRYVRIYD
                     LVQQALVKTLQPGVRWISSLDVHPSGDHVILGSYDRRVQWFDLDLAERPYKTLRYHTR
                     AVRAVAFHPHLPLFASAADDGTVHVYHATVYSDLLQNALLVPLKILRGHAVQQALGVL
                     SLAWHPSLPWLVSAGADGDARLWTP"
     gene            complement(<602914..>604416)
                     /locus_tag="MRET_3729"
                     /note="MRES_15030"
                     /db_xref="GeneID:38740495"
     mRNA            complement(<602914..>604416)
                     /locus_tag="MRET_3729"
                     /product="oxidoreductase"
                     /transcript_id="XM_027630356.1"
                     /db_xref="GeneID:38740495"
     CDS             complement(602914..604416)
                     /locus_tag="MRET_3729"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_027485996.1"
                     /db_xref="GeneID:38740495"
                     /translation="MASIRPLRTALNASGRYAYRAPELRIDHLVMGGGVVGLAIANAL
                     AHRFPSKSTYLVERHALPGQETSSRNSEVIHAGLYYPPHSLKTRMCTRGRTLLYDRIA
                     RHPDKIGGKQVGKLIVGTESDASYLAALHEHCSAIQPHTPPTRLLSGDEARQMEPSLS
                     PRITHALYSPSTGIVSAHDLMSHLAAELEAELPDGETPDATMVLGTSVVRIDPHTPPR
                     PPTKAGNDGSQEGWVVQLRTHDAAHAETDALLARVVINAGGLNAPRILNAVRPERDWL
                     PMYLAKGSYASYRGAHDVRHLLYPTPHFGSGAKATSAFHSLGTHLTLDLEGHVRFGPD
                     LTWLSAPSTLDPTRIDELGFEHDFWESHLAPEASEAWLESMHAAIQAYLPWIQRDGLQ
                     EDYAGIRPKLGGPDARTFFDFGLLWHASRDIESQRTWQTAPNEAGPRGPCGWLVSLVG
                     VESPGLTSSLALGEHVAAMLQTHVWGRYDPSGRRRRYVDDVGHDALEAWA"
     gene            <604547..>606280
                     /locus_tag="MRET_3730"
                     /note="MRES_15035"
                     /db_xref="GeneID:38740496"
     mRNA            <604547..>606280
                     /locus_tag="MRET_3730"
                     /product="transporter"
                     /transcript_id="XM_027630357.1"
                     /db_xref="GeneID:38740496"
     CDS             604547..606280
                     /locus_tag="MRET_3730"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027485826.1"
                     /db_xref="GeneID:38740496"
                     /translation="MVETAILPDKKVVVLHEPVQIDNEKPWGDHPVHVDVDPQAPPPL
                     DAQEGVLLPGRTFQRRVSNVAVTQEHLNEGAFGHLPLHGMPEVSGVEVVHKDKLEERN
                     AQGPQMEDEFVVKWDGSDDQDRVLNWSMPFRIYQMTLAAALTLCTSFTSSVPSNIAFQ
                     MTEEFNTTINVTKAAIFMYVAGFCFAPLVWAPLSEMYGRRIVFIVSFAGFVCFNVGCM
                     LAPNIGAMIVFRIFAGAFSSSSLTNSPAMIASLFSIRYLMRGIAVFSLGPIVGPCIGP
                     IVSGYIVTAGANWRWVFRVSTIFSFVMLVLVLLTMPETHDGLRLKKKARRLRRETGDD
                     RYKAPIEMRHVELTKMIGTVLGKPIKIFFTEPMLILVTIYMSFVYGTLYLFFVAYPIV
                     FELMHGLSSGAEGLMFLGFSVGAFIGAIYCIFVDQRMYESKRQRHGSDLAPEVRLYTC
                     MIAAPLLTISLFWFAWTSYPSISFWSPLVAGGMFGTATLFIFLSLLTYITEVYLANAA
                     SAIAANTVVRSAFGAGFPMFGQQMYETLKPRWATCVLAFIALAMFPIPFVFYRYGHVI
                     RSWSKNALSEL"
     gene            <606393..>607076
                     /locus_tag="MRET_3731"
                     /note="MRES_15040"
                     /db_xref="GeneID:38740497"
     mRNA            join(<606393..606748,606776..>607076)
                     /locus_tag="MRET_3731"
                     /product="charged multivesicular body protein 4"
                     /transcript_id="XM_027630358.1"
                     /db_xref="GeneID:38740497"
     CDS             join(606393..606748,606776..607076)
                     /locus_tag="MRET_3731"
                     /codon_start=1
                     /product="charged multivesicular body protein 4"
                     /protein_id="XP_027486058.1"
                     /db_xref="GeneID:38740497"
                     /translation="MAGWFSWISGRRDNKNSARDAIIGLREQLHLMAKKEEHLLTKID
                     DELRKAKEHVTNNKRAAQAALRQKKMYETELDRLAGSRMTLETQVNAIENANMNLETM
                     RAMQRGSAALKSIHANMDIDRVDNTMDSIREEMALSNEISEAISNPVGMGHELDEEEL
                     RNELQELEQDELQHQLVGAESAPAHHLATSSAAPRTSNHADTLDEDAELRALQAELAM
                     "
     gene            <607815..>609848
                     /locus_tag="MRET_3732"
                     /note="MRES_15045"
                     /db_xref="GeneID:38740498"
     mRNA            <607815..>609848
                     /locus_tag="MRET_3732"
                     /product="transporter"
                     /transcript_id="XM_027630359.1"
                     /db_xref="GeneID:38740498"
     CDS             607815..609848
                     /locus_tag="MRET_3732"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027485825.1"
                     /db_xref="GeneID:38740498"
                     /translation="MSAMSTSHESISSKSSGPYLDAASDVDTEQQLQAVKQGDKNKVL
                     PEEPVTAPAPALTTQSPYLASSEDQPYAPGTAANIEVPPEAHVKLPDAPPIPASEAQR
                     HPTWLEGPEHDRHGGGHARGNSNATLVRSLSRISLHHNGSHAPTGPHANLHLSKHELE
                     TGTWGFEGHRGGMEFPELAGINVDENEPEDGRPVPTEAEEEAKYEEETQHILVKWDGK
                     DDGEHTLNMNFYYRCYLTVLAGVLTLCTAFTSSAPSGIIVDMVEDFKTTPNVAKASVF
                     LFVASFCFAPLIWAPLSETFGRRIVFIISFTGFVCFNVGCMLAPNIGSMITFRILSGA
                     FGSSSLSNAPAMIAGLFHIYYLMTGIVIFAIAPIAGPCIGPIISGFIADSGTDWRWLF
                     RACTIFSFVLLLLVIFTMAETHDPIRLRMKAERLRRETGDDRYVAPIELRKVDPMKMA
                     VQVVCKPIKMLFFEPMLMAVTIYIGFVYGTLYLLFVAYPVVFIQLHGFRWGPEGLTFL
                     GFFIGCFLSALYCVFVDQTLYLKTIKAKNVIMLPAERRLMTSMIGAPFLTISLFWFAW
                     TSFSSVSFWSPLVAGGMFGAGLFFIFLSLMTYITEVYLLNAASAMAANMVVRSAFGAG
                     FPMFGEPMYHNLNPRWATTVLAFIALAMVPIPFVLYKFGNKIRSLSKHAHHPS"
     gene            complement(<609914..>612625)
                     /locus_tag="MRET_3733"
                     /note="MRES_15050"
                     /db_xref="GeneID:38740499"
     mRNA            complement(<609914..>612625)
                     /locus_tag="MRET_3733"
                     /product="phosphatidylinositol 4-kinase B"
                     /transcript_id="XM_027630360.1"
                     /db_xref="GeneID:38740499"
     CDS             complement(609914..612625)
                     /locus_tag="MRET_3733"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase B"
                     /protein_id="XP_027486057.1"
                     /db_xref="GeneID:38740499"
                     /translation="MGQGRASLPAASMASLLLRLFNSDYFSPQLALSYLRTYADHVGI
                     TYFLISRLSESFPPEDIEFYWPQYCHLLVTRPTSSRALENFILRKCEDDVHVALLTLW
                     FMQAHLADLASMPESTHFRTCQRVYNRCQRILFEDPDPHVRQVDRHELPVYIPFFEAR
                     RPLCVGNTTSALAGMASGILAPARPDVASYGQHMALQQGRSPTTDAQVAQPDNAREVP
                     PPSPKSPPPAPAPPVHQRPDPARLDPVQQVFGQETAPSMSDANLAPVTAPSSPSKSPP
                     LQPANAPLEPGSPEYTLQQKYLCSHFGRTEMQFIQALQDIPARLQQLPKPARLSALRA
                     ELTSLNRTLPAEVCFPTWCAGTAIGSPHVERHHRVMRISPSEAVVLNSADRVPYLLHV
                     EVLRDDLDFDPNRRYNRELLHGRRHKYVAPRPSIPSPHQKGLPAASTDNSEVDLTEQM
                     YGSDLSEFGKEQVHESPEKQFGTKNDTLDTVAWAHASSETSATDFSLDEYSQRMRTAA
                     ILLAQLNRGSSHSRTSADPASDSALNEPAPTRVSYADAQVIRQRIMEEMMALEEQRME
                     RMKRGGQYFTRRKRNTMAAEDENAVLRAVNKDDPSAAYFRESWTVKKERIRASSPYGT
                     QPGWDLFSVIVKTGADLRQELFASQLIHEFKRVWNECQSPCWVHYFRIVILNENAGLI
                     ETITDAISVHSIKKEAYASQMDGNGQPVSTYNLYDHFVQTFGDPHMPRFRRARRHFME
                     SLAGYAIVSYLLQIKDRHNGNILVDTEGHLIHIDFGFILGLSPGGVGFEAAPFKFPRD
                     YIDILGGMDSDGYNEFKALMRRGFRDARKHAERFILLVELMQRHSHLPCFAAGNDSAA
                     GLLRDRFQLGLTAAQCDEFVDRLVLSAAGSAFTRLYDQYQNFTQNVL"
     gene            <612731..>623311
                     /locus_tag="MRET_3734"
                     /note="MRES_15055"
                     /db_xref="GeneID:38740500"
     mRNA            <612731..>623311
                     /locus_tag="MRET_3734"
                     /product="transformation/transcription domain-associated
                     protein"
                     /transcript_id="XM_027630361.1"
                     /db_xref="GeneID:38740500"
     CDS             612731..623311
                     /locus_tag="MRET_3734"
                     /codon_start=1
                     /product="transformation/transcription domain-associated
                     protein"
                     /protein_id="XP_027486060.1"
                     /db_xref="GeneID:38740500"
                     /translation="MGSAGGAEGARASTMPPDAADFAKCLADPNADLRVKANVVAEIK
                     EMVEVYVNVDYTSFLNAVLPVQMDLLERTPCAFVSDAPEQRLRHGLIETIYRYPQHDA
                     ARPHVERLMQVMLKTVQEDNEENATLAFKVIIDLHRSFKTVLQSQVQPFLELVQKLYL
                     NMRSAVAEAFGTEQTPGKAVGAPSEGDALLALSEQSEGSSPRTLLKSSQSFKVLTECP
                     IAIVLIFQTYRHVVNASINVFVPLIFEHCLTLQALPQRQAHEAARQRGQIFVGIAPGI
                     KNRALFGEMVTTQVKTMSFLAYVLRGSAPIVRQYAHLLPEVNVRLLKDCPPENAVTRK
                     ELLVATRHILSTDFREHFVGQIDTLLDERVLLGTGITTRELQRPLVVSMLADLMHHVR
                     QELTTEQITRVINLHAQLLHDPTLAPSIQTMCVKLLLNLVETIIVKHADRSVAMLQGI
                     FTTFLDKLPELHQLGQDLRQMRGHGEDEEPLNDPATEHAVQIEQAKLIQSSLAVLEHV
                     ADPMKNARFLFRNLLFGFKTLMTVFKHRGIPEPDGEVMGRLFVGGIQCCMLQTQRDGR
                     EEKDMIDLFTSIIIDLPPETFHEVFTAHLPFLFEQILRAPALLGIPQNLLSNDAVSRR
                     FVEILLKFLVARLEDLGTPDKKLASVSLRLFKMAFMAVTIFPEENEAVLEPHLTHLIM
                     HSLKCASRAEEPTNYFLLLRALFRSIGGGRFELLYKDVLPLLPVLLEKLNLLLDAAEP
                     GEQDLFVDLCLTVPVRLSVLLPYLGQLMRPLVLALRSSSELVSQGLRTLELCIDNLTQ
                     EFLDPIMEPYIQDIMAALWTHLKPLPYSHHQHSHTTMRILGKLGGRNRRFLQQPPVLA
                     YQSGARPTLPLVLHGTVDRVSLLPAIDMALLRVQDPDAAHHRAAYDILTASAAMLVHE
                     ASDHEQRAELRRVTLGLFRAASHDDIDGVRDFVQGLYAHCLHMEITREVPGPSGVSQR
                     HLLPLTLVMLEALAHAIDGSGMRDDTAQVSLLLSIVHAFLAACETVPSTRARLGHTVM
                     HALASSFCSRCYEPHWHRRLGGWLGMDVLVRRASLGKAWVADHQLEMVRALLYMLKDM
                     PSDPPRGVDRIRATLYEVLEQAYTGRAPAHDESTSRAARVYAEASPHLRWLVGILIPE
                     LSCANDMAREATQASLERLARLTECTVTDLLEPQRDRLLLPIFTKPLRALPFGMQIGH
                     IDAVRYTLQLPRPLPAFNEELFRVLTEALALADADDQALVGRVTLYKNMLAVTKLRVV
                     AIQLLAAAMQCAEFQTQEHVAMRMRIISVYFKCLYSSSEEVVAVAYDSLKATLAQQSK
                     LPKDLLRSGLQPILMTLADRHRLTSAGLDGLAHLLQLLTNYFKVEIGIKLLDHLSALA
                     EPAMLRRAAAGPLDTHEKLRILTAIVRVFHLLPDTAYQFLPRLLVYVAEIESHLRRSG
                     PTPLTDMLTLFLDHFSEHTVRYYFESDGHVRFTDVLQNPRLFRLLRLALQSPRGASLR
                     RELSRRAETLLLPLLSDASNTQSVYAALQLIEALVQHEPAWLAQHRGVLHCLVALWST
                     PAMQALRRTEADVLATQHRLTPLFVALLHAALRVEPLVEAYMALLDLYPLSPSRDATH
                     HTRFVYEQACVRADVATKRALVQQCIQLVADPGVPTVQKTYALRVMVNPMLVMEASTE
                     RVMTPELVQALAVQVWRQVQHGAGVYGDDELRVELLQMSTLVLEHSADLLAAESTTKM
                     DAIKFGWSFLPLEDVTVKHAAYLLISRFLQRFESPLKITGQVYVGLLRLPPNDGRGLV
                     RRALDILVPALPERVPSTDSTSPPLWVKWTKRTLLDEGHYALQLCTILQLIVRYADLF
                     YPSRDLFVPHMVTSLAKLGFASGSTAETKKLAIQMVDLLLQWDTPPRDGESPRKRPKT
                     ESYTMPAHLRDMTLRFIARFVSLSLEPIATNEVTKHAFELLEKMHTLPAWQDVQVRLA
                     LLQRALIHTDVTEQHHGPIANALATLDVVTRGRDEAWLQAHAAQLHKLLEKTLASDQT
                     ELLDAARPVLMRLCSILPPTEDESAQNEDVRAFSTAAETAISEGLKNGTGLATALALL
                     DAWSHTHPGVIDRHQLPLIKTLTRLAKEHLSGHGGDAALTHLLRVLTLLRSRISHLGD
                     QRRWFLSAVVQLVEKSPSDKVCAFLLEMMRTWILESREAFPTVKEKAGILVKMLCFED
                     REASLAAAFLALILAIYKDPALARTELTARLEPAFLMGCRCADVAVRREFLALFDASL
                     TRSVPARVLYLLGHQNWSWMAEHYWLHQVLDLVLAAVDTTPPLIGAAYEGDHAFAQMM
                     RHGTAASFVSAVRTLQYADAHAADALWQALFPAIWRTTPKRLQLDLNHALIACTTHEH
                     LLKQAAARPNVVQSLLSGALACVPALEMPPHVLKYLGKTFQAWYISMEQLQEQLYALR
                     ADDAVRESTQDALAEAYAELSEADYFYGLWRRRCMFPETNSALAYEQSGRFAEAQLLY
                     EAAQVKGRSSGLPLTEAEYQLWDDHWVLSALELQQWDLMADLARLEHNDDLALECAWR
                     LSDWTAERESLERSLEGLQVMSTPRRKVFEAYLALLKSQAAPDKPSDFGRICDEAIQL
                     TLYKWYTLPAHVSQAHVPLLQIFQQFVELQEVSTVFASLAHTNATNLNHRSIELKTLM
                     QTWRERLPNLWDDINAWSDLVAWRQHVFSSVNKAYLPLVPLIQRNEGPGSSTNSYAYR
                     GYHETAWIINRFAHVARKHGLGDVCISSLTKIYTLPNIEIQEAFLKLREQARCHYHKP
                     HELSQGLNVINNTNLMFFAAAQKAEFFSLKGMFLNKLGMSEEANQAFATAIQMDLNLP
                     KSWTEWGRYNDGLFREKPTSMHLAANAISCYLQAAGLYKNAKARKILVRVLWLLNCDD
                     AQGTLWQACDNYSGETPIWYWITFIPQLIQLLSHRQSKFARKLLMQIAKSFPQSLYYY
                     LRTSKEDFALMKRNSITASQRAARAQNKDAPADAPKNDEADKDPANTHRFPADHVEEI
                     LNILKTAFPLLALTMENMAEQLQQRFKPSNDEDIYRLTNALLNDALQQYIHRAPLTTD
                     NGQLPQTSQMNVTLFAENLPPGPLKSAFESDFVTSKPNLHEYVARLRRWRDRYEESLD
                     KRPRLQHLEHCSHYLVEFQHQKFDEVEIPGQYLRLEDNNSNFVRINRFLPEYGLLRSN
                     GMCNRRITILSNKGSLHSFAVQLPSARYCRREERIFQLLRLLNTVLERKIQTRKRGLT
                     FNVPTAVPISPQLRLLTYDESFISMQDIYERHCKQVGIGKDDPIIAWVEKMRSTWDGG
                     SYRRTNVDFANLRMELLEEISVKMISDKILTQFMTMSMSSPSDLWIMRKQFTLQMAAT
                     MFLTYILFISARYPGRIHISRSNGVVIMSDMVPTFSPQAPHFKSPDPTPFRLSPNIQH
                     FIGPIGIEGLLASSFMALGTALTSSEHGLEDYLSIFVHDEVRFWFSGMQHQSKHLEPT
                     IDLVRQNVFEVVKRARLMSCRFGQDKASITPVNQAVLDLINYASHPSKLALQDPTWMP
                     WL"
     gene            complement(<624316..>625512)
                     /locus_tag="MRET_3735"
                     /db_xref="GeneID:38740501"
     mRNA            complement(<624316..>625512)
                     /locus_tag="MRET_3735"
                     /product="DNA-binding protein"
                     /transcript_id="XM_027630362.1"
                     /db_xref="GeneID:38740501"
     CDS             complement(624316..625512)
                     /locus_tag="MRET_3735"
                     /codon_start=1
                     /product="DNA-binding protein"
                     /protein_id="XP_027486061.1"
                     /db_xref="GeneID:38740501"
                     /translation="MSSPYDSAAVDRRKWTPEEDALLTMAMNNLQDVNETRWTEVAAS
                     VPGRSAKACRKRWVNGLNERLKKGTWTAEEDNRLREAIMHLDSDWARIAEFVGNRSGD
                     QCSKRWREVLDPTINKAPWTAEEDRLLVEFYHKHGSCWQIISTYLNNRRALQCRNRCC
                     KLLGLHAHPRKKGTSGNKQSPSARSFSASPNMIPTQNSVTVSSSLNVMDIKDTRKLES
                     DDLFELNSHVPSTISNMNATACASKGINMLDINGQTDPCTPGISVNGDIHNNDDHVTI
                     TYNDVHTMGFLDAWSKVQGYSSAERKGLPAALNLSENTTFYPQTTSPTDSIYSYLDST
                     ASLPSSTLTTPGATSLDGFLLDSDFGLHSMAQHTMPESNAKGTLNNRWLHDPFVPLSG
                     IGFHND"
     gene            complement(<625925..>627966)
                     /locus_tag="MRET_3736"
                     /db_xref="GeneID:38740502"
     mRNA            complement(join(<625925..626080,626122..626226,
                     626257..>627966))
                     /locus_tag="MRET_3736"
                     /product="transporter"
                     /transcript_id="XM_027630363.1"
                     /db_xref="GeneID:38740502"
     CDS             complement(join(625925..626080,626122..626226,
                     626257..627966))
                     /locus_tag="MRET_3736"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027486059.1"
                     /db_xref="GeneID:38740502"
                     /translation="MPATPANEQPKEPEVRATASHGQNEPSIVIWPSGASQPLSEQDS
                     SIGDDIKERHNMYIPSSQALESDSEAQNGRPSVLFEKLPKVPRPPRTASSSDQAWKTL
                     TSVPSRNGQDSMPERTGHGRRASVLSMKTDGGVDRPRRLSYSSYNDEPNTDNSDVIIG
                     QGTTDLETGARVPHEVKDTSSLEDKEADTIIVEWDGDDKELGMTWSLTYRAYVAILVG
                     ALSIASTMTSSLPSNLMPKTAAHFGVSEEVIKLSTFIFLGGYCFGPLLWAPYSELYGV
                     RWPFIFSMAGLTIFNMACALAPNIGGLIAFRFLAGVFASCPLVVGGGAMANIWPKELL
                     GLGMCVFSMSPMAGPACGPVIGGYVAVVKSATWRWGFWACTILSGFLTLLTFLTLKET
                     NQVITLKKKAQRLRKETGDNRYKAPVELRTIDLRELATRWLILPILMFVYEPMLQAIT
                     MYMSFVYGVLYLFFEAFPVVFGAHGLNNLQTGLTFLGFLLGCIIGGLFYIFVENPRYV
                     KLMRANPQGAPPPEERLMVCMYGAPILVISLFWFGWTSYPWISIWSPIAAACFYGIAM
                     FFVYFALMTFIADAYRAQTACALSANTIVRSTFGLGFPLFASQMFVKLNPRWASTVLA
                     FISVALFPIPFVLYKYGPWLRSKAKYAFGEDN"
     gene            complement(<628222..>630081)
                     /locus_tag="MRET_3737"
                     /note="MRES_15060"
                     /db_xref="GeneID:38740503"
     mRNA            complement(<628222..>630081)
                     /locus_tag="MRET_3737"
                     /product="Chs5-Arf1p-binding protein BUD7/BCH1"
                     /transcript_id="XM_027630364.1"
                     /db_xref="GeneID:38740503"
     CDS             complement(628222..630081)
                     /locus_tag="MRET_3737"
                     /codon_start=1
                     /product="Chs5-Arf1p-binding protein BUD7/BCH1"
                     /protein_id="XP_027485828.1"
                     /db_xref="GeneID:38740503"
                     /translation="MGDTFAELPEFFETELAESIRSRTETLSSFRELGPPDLCHVLKS
                     NGRKDVGTYHLVSGVDASSSATLATYITSLSYEIEQGSAWLGSKASFRIKGGVFCCYN
                     AFSRLDLRVEVCIPGSVQTYTVNARGERGNATPEIWQETYLSAVLRAILYADHPTYSL
                     LGYRKLNPFPTPDHEMRFIMAAENLFFKGWQLGSDPEIQVATIVYNHLSAGILRYFGG
                     LSRYEHAVNLFEKLWSREPEVAALVARSYLYINEEIKAVQIMHQALQLNPHNFAVLHV
                     QIDFLCAKGQVQWAVELAKQAVRCAPSEYVTWAKLAECHIKAGNWAEALLTLNSCPMF
                     TYAEPDLHRIPPASRTHLPIPRLALQSKLLEEDPTSTADADPALLRLPAPALRGTFAS
                     AYAILTKLVHALGWDDLLKYRSQVFVMEEEYRNPQPKEQADQPGESNERGDHWLTFTD
                     KRLCERWLDNLFMVLYEDLRIYTIWRAEQGHYDAQSLPYERTGNDWEILGELALRLHH
                     PTEAYDAFVHCIQAKFSAKAYMYLLEHFTETLDVEKALSAAMHLAAYQHRWYGDHVYP
                     SKVGQCIFHLIRAEGLGKVSNTLISMKPRPATLHIMQRYFAYAQEFRLVGSDT"
     gene            <630227..>631153
                     /locus_tag="MRET_3738"
                     /note="MRES_15065"
                     /db_xref="GeneID:38740504"
     mRNA            <630227..>631153
                     /locus_tag="MRET_3738"
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /transcript_id="XM_027630365.1"
                     /db_xref="GeneID:38740504"
     CDS             630227..631153
                     /locus_tag="MRET_3738"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /protein_id="XP_027486025.1"
                     /db_xref="GeneID:38740504"
                     /translation="MADDLAPENIELQQQSSSLASSVKSFVSGGFGGICAVLVGHPFD
                     LIKTRLQTAPPGTYSGALDVTSKTIRADGLRGLYRGMGPPLIGVTPIFALSFFSYDLG
                     KKLVYAATPNRADQTLNLTELSIAGFFSAIPTTLVAGPAERIKVLLQLQGQSQSGPKY
                     NGPVDVVRQLYKEGGMRSIFKGTGGTLARDGPGSAAYFAAYEVAKRSLTPAGSDPNDL
                     NIMTTITAGGLAGMANWALAIPPDVVKSRYQGAPEGTYKSFMDCARKTVAADGVGALF
                     KGFGPAMARAFPANAAVFVGVEMSQSLLNMVM"
     gene            <631266..>632582
                     /locus_tag="MRET_3739"
                     /note="MRES_15070"
                     /db_xref="GeneID:38740505"
     mRNA            join(<631266..631655,631680..632468,632493..>632582)
                     /locus_tag="MRET_3739"
                     /product="DnaJ subfamily B member 12"
                     /transcript_id="XM_027630366.1"
                     /db_xref="GeneID:38740505"
     CDS             join(631266..631655,631680..632468,632493..632582)
                     /locus_tag="MRET_3739"
                     /codon_start=1
                     /product="DnaJ subfamily B member 12"
                     /protein_id="XP_027486026.1"
                     /db_xref="GeneID:38740505"
                     /translation="MDADEARKALDLARKHDENGNIDAALKWARKSVAIYSTPEAMAL
                     FTRLKEKGTQGTPSADSGTSSAPKETVYMAAKTETRTTDTEGTRSEYTEQQVEVVRRV
                     KRAGGDFYAVLNVHKTATDTEVKKSYKKLALQLHPDKNRAPGADEAFKLVSKAFTVLS
                     DKDKRSMYDKFGGDPESRFGAASSSASAHPFAQFQSTRMRPGAEMDPEDLFNMFFGGG
                     MGGGPFGTTPVFTFGGPGMRTHYYRPGTRTRQAGQQSAQNASQTAMWFQVLPLLILLF
                     CTMLSYLPNLFTVSDPDFRWRPTALHRAQRTTLDRGISYFVDPVAFAKHPYVTATTKA
                     TRHGGSVQRFSSDKSSSELRAFERRVEEAWMKELYRQCDSAQEYKRRRMLDAQGFFGF
                     GANKDKLEKIRSEVYESCEQLEHLFGIRLR"
     gene            <632674..>633126
                     /locus_tag="MRET_3740"
                     /db_xref="GeneID:38740506"
     mRNA            join(<632674..632704,632729..632839,632867..>633126)
                     /locus_tag="MRET_3740"
                     /product="DNA-directed RNA polymerase I subunit RPA12"
                     /transcript_id="XM_027630367.1"
                     /db_xref="GeneID:38740506"
     CDS             join(632674..632704,632729..632839,632867..633126)
                     /locus_tag="MRET_3740"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA12"
                     /protein_id="XP_027486195.1"
                     /db_xref="GeneID:38740506"
                     /translation="MSVGVSTVVPDKIGSLLFCSACGSLLDLPNNDDVLTCAPCGTSH
                     DARIYDNLAIVTRSHPTAFPSVLRQKRQLVSHTGEDGDVEMEQATIKEKCPGCGNEEM
                     NYHTLQLRSADEGTTVFYDCPKCGYKFSQNN"
     gene            <633179..>634120
                     /locus_tag="MRET_3741"
                     /note="MRES_15075"
                     /db_xref="GeneID:38740507"
     mRNA            <633179..>634120
                     /locus_tag="MRET_3741"
                     /product="hydroxyacylglutathione hydrolase"
                     /transcript_id="XM_027630368.1"
                     /db_xref="GeneID:38740507"
     CDS             633179..634120
                     /locus_tag="MRET_3741"
                     /codon_start=1
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="XP_027486194.1"
                     /db_xref="GeneID:38740507"
                     /translation="MSLGLHRVRRACFSLPLAPRIPRRNMRIIPVPVREDNYAYILMS
                     TPKGARPQGAFVDPYDVPTVRRAAHALGLQDTDIVGSITTHGHYDHAGGNDAFAKAFP
                     GRPIWGGAASIASVTHVVRDGDTFELFSDGAEVLVKAYATPCHTRDSICFYVEDKRGE
                     DALAELPHGLKEGADGEKKRGVFTGDTLFISGCGRFFEGQAEDMHRALNVVLRQLSLD
                     TLVYCGHEYTASNVAFSAAVLPNAPGIQRLVSDVRSGRNGGVTTGLYTLSDELKHNPF
                     MMVEDAVVQKAIGGTDAITTMHALREAKNQGTLRIRL"
     gene            <634320..>635366
                     /locus_tag="MRET_3742"
                     /note="MRES_15080"
                     /db_xref="GeneID:38740508"
     mRNA            <634320..>635366
                     /locus_tag="MRET_3742"
                     /product="short-chain dehydrogenase"
                     /transcript_id="XM_027630369.1"
                     /db_xref="GeneID:38740508"
     CDS             634320..635366
                     /locus_tag="MRET_3742"
                     /codon_start=1
                     /product="short-chain dehydrogenase"
                     /protein_id="XP_027486193.1"
                     /db_xref="GeneID:38740508"
                     /translation="MSAIRMIPSQLLRTAGLRTKLPVMSRAISFSSAALKFKHWEAPD
                     RPKINPEDMPTNPGPNPNPSNIGVNAVLNLRPESMDKHTTSIFAEFSLEGKTAVVTGG
                     NRGLGLEMALAFVEAGAHVYVIDRATEPCEDFKKVAKHCHLLDRQIEFITADVTNVEE
                     MNEAMQYIEKDSSTGTVDVCVANAGIMQSYPAMDYPVDEFRKVMEVNTIGVFITAQAA
                     ARVMRDNPKVRGSIILTASMSGTVVNRDQSWVAYNTSKSAVLQLGRNLAAEWGPYNIR
                     VNTLSPGYFRTSLVASQLDADPGMMKRWSDANPMNRIGLPHELRGVVVWLASNASSFC
                     NGSDIIVSGGHTIW"
     gene            complement(<635447..>637831)
                     /locus_tag="MRET_3743"
                     /note="MRES_15085"
                     /db_xref="GeneID:38740509"
     mRNA            complement(<635447..>637831)
                     /locus_tag="MRET_3743"
                     /product="protein HIRA/HIR1"
                     /transcript_id="XM_027630370.1"
                     /db_xref="GeneID:38740509"
     CDS             complement(635447..637831)
                     /locus_tag="MRET_3743"
                     /codon_start=1
                     /product="protein HIRA/HIR1"
                     /protein_id="XP_027486192.1"
                     /db_xref="GeneID:38740509"
                     /translation="MVHITVPDWVVHKPDERTKRTTIYSVSVHPDGTRIATGGLDTKI
                     RIWATAPILDEDAREPRHLCTLARHTGAVLAVRFSHSGRYLVSGSDDTVAVVWELDES
                     AAPTSFGSSEPALEHWRMHRRLPGHTSDVTDISWSESDTYLATVGLDSLVIIWSGDTF
                     DRVRTIRGHHGFVKGVAFDPTELFLATSSDDRTVKVWRTHDWGLEASISDPFRSSPSS
                     TFFHRLSWTPDGKFLLTANAMNGPVFVSSIVERYTWASDLALVGHEHAVSVAACSPQW
                     FQRGDQPPVSVVALGAQDQTVSVWVTGIPRPLLVARDLFERHVMDMQWSADGYTLYAC
                     SSDGTVAALAFDASDLAPVAPDDVLATARRQLGAVPRARPAVRQAPPQRPLAPPILHA
                     HPPQRLVQTITRDQHGKRRICPTPVGASPAVTTTMPNIPTEPPTLVSWPRPDPRTRFF
                     DTHRTPLEPAHPLDVDLDDEQVMDDISVASSQTYTQDGIEGVLEVRNDAHSAEIAWVA
                     HERVHWVDYAPCAVLCAAVSSCVVCVALCDHTLVWYTHHGRRTASMMLGVPTVKLAAC
                     GPYVAALGRDARVRRWHTQQRVALGDVPLPRDSVAAMYVHTNGVPVAVLRRRQCIVAL
                     DTKTQAFVCIGHAALARLSTSWDVRLRQGAHAPVRHAECVLNDALATQTMEPERGVTP
                     VRVLTATIRHLEMRMQAAELLESAGEYREALHALATVLATEGLALQADDLLRSLLGPM
                     YYRPDAPAWDPCVLGMPKRELLASVLTTMQQHRRLDTLVHGVQHVLRTLASDAT"
     gene            complement(<637871..>639694)
                     /locus_tag="MRET_3744"
                     /note="MRES_15090"
                     /db_xref="GeneID:38740510"
     mRNA            complement(<637871..>639694)
                     /locus_tag="MRET_3744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630371.1"
                     /db_xref="GeneID:38740510"
     CDS             complement(637871..639694)
                     /locus_tag="MRET_3744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485855.1"
                     /db_xref="GeneID:38740510"
                     /translation="MAALPEDAFPNPYDPPAGENRNGATSEAPSAPAQDSEEDELSRA
                     LRASLVVQQDQAQKRQDEEEAMLQEALRASEAEHAMQQREREQQQQRIEEIMEESRRE
                     AYRDQRRREAEKQRHALLEMEIIAQSRQEHERRIRALSPGPPDSHSIESAPEMEALLW
                     LRARPSILTPGGSLSQGVPIQDEAEHQAPEALSYQEPTNPWVREPTPPSPDQEPELPK
                     PVPPESHTLSRYEQMFGRHEEEDDGFLSDAPESPWSRSDDEPPVSSAEPDSCAAEAPL
                     TEPAPEDPGWEEPTAQPDDCDASAAPAESPPQLATEAADHDLPLLPYPPEYAEGQPAL
                     RGVQFGTATHAYAMDLYAPSGAILYPTPDVASECCMPPEHKLYFPDVIELGTERPYFV
                     LRAYSWKMLLQAMAWHGKTRVEAPSTSLYLHVALSVPRRADTLPFASPSFALLALSTR
                     SQPLLKTPEIASFCKERQSTLTCVPLVSHPLALPTDLVTLAHTLFSAPQLSHASSLRE
                     LHQAISVEDDWLETRSQCVPLSSAPLLGALEQQCLHQQLSLHQHPLEPLQDSQDAPPP
                     REHFRDRMRRKLSRWNVASNVAPEEDLATWITPYDLSSVPP"
     gene            <639763..>640755
                     /locus_tag="MRET_3745"
                     /note="MRES_15095"
                     /db_xref="GeneID:38740511"
     mRNA            <639763..>640755
                     /locus_tag="MRET_3745"
                     /product="histone acetyltransferase"
                     /transcript_id="XM_027630372.1"
                     /db_xref="GeneID:38740511"
     CDS             639763..640755
                     /locus_tag="MRET_3745"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="XP_027486197.1"
                     /db_xref="GeneID:38740511"
                     /translation="MAHHPRPPPPPIERVVFDDYVIRTWYTSPYPIQAPTLWICHGCL
                     KYMRSAHTFHAHRRTCTYTHPPGRKVYQRGAHILWEVDGAQQKLYVQNLCLLGKLFID
                     HKTVFFDVAPFWAYVLTDASSQFDHVLGFFSKEKVSYDHYNLACIVVFPPYQRRGYGT
                     LLMEYSYYLSRSDDTPGTPERPLSDLGLKGYMAYWSAQLVRTLLAAYSPEGAMIRAIL
                     AGHKPPAPHSMPTSPSPRRRRRRRGGWAGEERVERPDEPLTSIPHASIPMTTTLARIA
                     DAAGLRSDDATLALAHAGLLVSTSSAFILSLEAIQQAAQRLSLRPPILDEGYCL"
     gene            complement(<640752..>641891)
                     /locus_tag="MRET_3746"
                     /note="MRES_15100"
                     /db_xref="GeneID:38740512"
     mRNA            complement(<640752..>641891)
                     /locus_tag="MRET_3746"
                     /product="mitochondrial distribution and morphology
                     protein 34"
                     /transcript_id="XM_027630373.1"
                     /db_xref="GeneID:38740512"
     CDS             complement(640752..641891)
                     /locus_tag="MRET_3746"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 34"
                     /protein_id="XP_027486172.1"
                     /db_xref="GeneID:38740512"
                     /translation="MSFNFAWPQFSPEFYQYAMETLTMALNRGQKPKSIVGDIIVKEL
                     HMGTTPPELEILEIGDLSRERFRGIFRFVYSGDAYLEFSTGVQANPLARGSDEPSFFR
                     ASSTARGMLFAASPLTVPMRVRLSEVKLRAIVVLVVSRNKGITLVFKNDPLESVKVSS
                     TFDGVGVIQRYLQEEIEGQLREMFRDDLPSIIHRLSQDWLCADMDDKATPPRPTPPPA
                     PSVDHARPSAPSSMDSEAWPIDDTADVPLSVLALEEATPSTHSPHLAKLAATSQGSRG
                     LKDLVQPSSSQGSSYARTFHTTSRVRVPHTLTSPTSLSMPATPTRPNPVSSDISGHLA
                     ELLRANHTLSPFTPHPRLVALRTMPAHRARPSRVHAQQKRSFSLS"
     gene            complement(<641954..>642592)
                     /locus_tag="MRET_3747"
                     /note="MRES_15105"
                     /db_xref="GeneID:38740513"
     mRNA            complement(join(<641954..642471,642496..642516,
                     642541..>642592))
                     /locus_tag="MRET_3747"
                     /product="TBC domain protein"
                     /transcript_id="XM_027630374.1"
                     /db_xref="GeneID:38740513"
     CDS             complement(join(641954..642471,642496..642516,
                     642541..642592))
                     /locus_tag="MRET_3747"
                     /codon_start=1
                     /product="TBC domain protein"
                     /protein_id="XP_027486196.1"
                     /db_xref="GeneID:38740513"
                     /translation="MTSRTRPAPPLTALCRRVILRHISTLYDVGDMPYRVAAPLLQQC
                     KPEQLRMIEEASPHLLEHTNDIWQRACLRDFSELRKAQKDGTLEAPPSWRALYLTKQQ
                     QTEEAKALATARIKGRYAEHSAQKDAKKLVVSNVPIPTHRRARRPAPSRPSTPYESKG
                     RSMLLKARTGLAMRTRQMMRPRGLRPPRRTPPSSRP"
     gene            complement(<642615..>643880)
                     /locus_tag="MRET_3748"
                     /note="MRES_15110"
                     /db_xref="GeneID:38740514"
     mRNA            complement(<642615..>643880)
                     /locus_tag="MRET_3748"
                     /product="TBC domain protein"
                     /transcript_id="XM_027630375.1"
                     /db_xref="GeneID:38740514"
     CDS             complement(642615..643880)
                     /locus_tag="MRET_3748"
                     /codon_start=1
                     /product="TBC domain protein"
                     /protein_id="XP_027486191.1"
                     /db_xref="GeneID:38740514"
                     /translation="MADSAYIRDTYAHFTRTGVPHDGIAEGVEHTRYKQDVPPWECVD
                     PPTSPPPALHVDRYGFFDTPKQPSCIVLARHVYVHRRMLQRTRQARTPKSHVREPSAD
                     HVKTMLDHRASSDQRRASRRTRKWHGMLNASERCIEAGVSNTLLQRRVFKGIPDDMRG
                     LAWYALSAQHSSHDPRLLSLTDYLQHASTSDVQIDLDIPRTVRGHKAFHTRYGRGQCD
                     LFGVLHAMSLMCAECGYCQGMGPLAAMLLMHMPASDALRVMQRMHDVYGFHELFRPGF
                     PGLRAEFYVLSQLLDALVPRMAQALAQAGLAPSAYATRWLLTVFHDALPHATQLRVWD
                     IFMACGRDALLVVAVGLLRALDMERYASRTNDMLECLWSPFLPEDDDALLAWVQHTLH
                     RRRVQTCIQQSRAEWSRLVEQGLDGSAFV"
     gene            <644273..>645730
                     /locus_tag="MRET_3749"
                     /note="MRES_15115"
                     /db_xref="GeneID:38740515"
     mRNA            <644273..>645730
                     /locus_tag="MRET_3749"
                     /product="cyclin"
                     /transcript_id="XM_027630376.1"
                     /db_xref="GeneID:38740515"
     CDS             644273..645730
                     /locus_tag="MRET_3749"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_027486190.1"
                     /db_xref="GeneID:38740515"
                     /translation="MANMVVSAHMGLPYANQCDPHTGRPYDAASYAQPVYLCAPPPAP
                     KPQAARTYCPPQFILQAYPYDAWYGSAPMMMPPPPPVPSWPPQPPAMPRVDAWGMYRA
                     PVPAWPPPYAVPPQMPTYAGAAHPMHVPLPPAPPVCPEPEPEACDVVQSEVARPPVPL
                     EKTAVILSHFGAEAVWRTSAELVGLRRSATRSGARLSLHRETRSLSPESLPTDDCLSA
                     SSYSSHSMAEPVTPPNITPTLSEEALSEPPLVSLPPSHDERSADLHRLVRAMGHMQQR
                     PFPSLDQCTGRTGLPMSKSVTVALTPATTPSRRARISMKREHAALLGEVNPAFRHFTH
                     QVLTQTLVSPMTLLLALHYIHMLQGTMWPDDGSGDTHAGLSLLAQPISTTPFKLLTLG
                     LMMANKFLDDHTFLNKTWHEITGIPLDELNRMESFFLCRTQFHLAVSDSAWRQHLQAV
                     RADMYAYEKQAGQEDSKMVATLDQLLAAQVSGLCI"
     gene            complement(<645805..>646374)
                     /locus_tag="MRET_3750"
                     /note="MRES_15120"
                     /db_xref="GeneID:38740516"
     mRNA            complement(<645805..>646374)
                     /locus_tag="MRET_3750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630377.1"
                     /db_xref="GeneID:38740516"
     CDS             complement(645805..646374)
                     /locus_tag="MRET_3750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485803.1"
                     /db_xref="GeneID:38740516"
                     /translation="MDRQIAWWPAHAPCLDACARVVSQVVGRDESYVRDLLQQAHGVP
                     WTICNPYFEAHVEHVYVRDRGEAQPRPAIVLLVPHTAERAVHARIIAEAVDGLAASVS
                     LVVGLPVVGEAPDVDELDAWYGQAGWEYIAPTHDASQRISEALMVHPWPGMHLTGRGW
                     PQWEDAPSDDSDASMGAFQSCPPVDDGAG"
     gene            <646437..>647816
                     /locus_tag="MRET_3751"
                     /note="MRES_15125"
                     /db_xref="GeneID:38740517"
     mRNA            <646437..>647816
                     /locus_tag="MRET_3751"
                     /product="magnesium transporter"
                     /transcript_id="XM_027630378.1"
                     /db_xref="GeneID:38740517"
     CDS             646437..647816
                     /locus_tag="MRET_3751"
                     /codon_start=1
                     /product="magnesium transporter"
                     /protein_id="XP_027485818.1"
                     /db_xref="GeneID:38740517"
                     /translation="MNRVGGSLAASVARHIRSPVRVACAVPRRPYTMSELPPRPGAGV
                     SGVGLTQLSPNILLRCTILDSKGSIKTISGLFKKSELCSHHGLQPRDLRKIDSRVPNL
                     VPTILARRTGILVNILHIRAMVKSDAVLLFESYHTSNPRLHSAFVYNLEHNLRQNASS
                     LPYEFRALESILASVLDALRSELSWLRIVVDDLLEALEDDIDREKLRMLLQISRKLNG
                     FLSRSRGVKVAVTEVLENDEDMALMYLTDAQKGVLKTEKSNLEDLELLLESFEKQVEE
                     VISEIDQICANVNNTQEIVELILDSNRNRLLTLDLGTSIVTLGVSAATLFVGLFGMNL
                     TSHLEEHPHAFYLMSGVAYVMALLVSVAGLRRLARLRRIGLSVGGSSTAAFGAQSPRK
                     PDAHLVSHARAWWWRENQFRAMQRKQSQHHAHEHLRSMDYAMPPSDPLDPAELNAGPS
                     PHDTNKNGS"
     gene            complement(<647818..>648789)
                     /locus_tag="MRET_3752"
                     /note="MRES_15130"
                     /db_xref="GeneID:38740518"
     mRNA            complement(<647818..>648789)
                     /locus_tag="MRET_3752"
                     /product="transaldolase"
                     /transcript_id="XM_027630379.1"
                     /db_xref="GeneID:38740518"
     CDS             complement(647818..648789)
                     /locus_tag="MRET_3752"
                     /codon_start=1
                     /product="transaldolase"
                     /protein_id="XP_027485819.1"
                     /db_xref="GeneID:38740518"
                     /translation="MSNALASLKQFTTVVSDSGDFESIAVYKPQDATTNPSLILAAVK
                     EEKYARMVAPAVEYAKAQGHSRQEIVEHAVDRLLVSFGEEILKIIPGRVSTEVDARLS
                     FDTRATIDKAIKLIELYESVGISRERVLIKIASTWEGIQAARELESKHGIHCNLTLLF
                     SFCQAVACAEANVTLISPFVGRILDWFKKHQPDADYTGANDPGVKSVQHIYNYYKQHG
                     YNTIVMGASFRNASEITELAGVDYLTIAPKLLDELKNSPTALERKLSKEHALAAPPIE
                     KCSFIDDEPAFRWAQLEDAMGFEKLHEGIRKFADDAVTLRDIIGQHL"
     gene            complement(<648863..>649369)
                     /locus_tag="MRET_3753"
                     /db_xref="GeneID:38740519"
     mRNA            complement(join(<648863..649147,649175..>649369))
                     /locus_tag="MRET_3753"
                     /product="mediator of RNA polymerase II transcription
                     subunit 11"
                     /transcript_id="XM_027630380.1"
                     /db_xref="GeneID:38740519"
     CDS             complement(join(648863..649147,649175..649369))
                     /locus_tag="MRET_3753"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 11"
                     /protein_id="XP_027485924.1"
                     /db_xref="GeneID:38740519"
                     /translation="MDDARAASPASEAGTADELLDRLLQCDAQLVELLRTASRAMLAL
                     SDESPATSSEDDMTQWFATLHDIQITLRHAAHALRQARLPPVLSPAAAQARLRGEVGV
                     AGLSHTQTSSAPYSLSTLRLRECAWRRVAESLARAHHDAQAPLVASLARGASLASDT"
     gene            complement(<649429..>652500)
                     /locus_tag="MRET_3754"
                     /note="MRES_15135"
                     /db_xref="GeneID:38740520"
     mRNA            complement(<649429..>652500)
                     /locus_tag="MRET_3754"
                     /product="N-acetyltransferase 10"
                     /transcript_id="XM_027630381.1"
                     /db_xref="GeneID:38740520"
     CDS             complement(649429..652500)
                     /locus_tag="MRET_3754"
                     /codon_start=1
                     /product="N-acetyltransferase 10"
                     /protein_id="XP_027485922.1"
                     /db_xref="GeneID:38740520"
                     /translation="MRKQLDPRIPTLIRNNVASGHRSFFVVVGDHGRDQVVNLHFLLS
                     QSRVEARPNVLWCYKKDLGFTTHRKKREAKIKRDIKRGVRDQDAQDPFELFVGVTDIR
                     YCYYKDTPKILGRTFGMLVLQDFEALTPNLLARTIETVEGGGVIVLLLQSMSSLKQLH
                     SLSMDVHKRYRTASSDEEPVARFNERFLLSLSSCQDCLLLDDELNVLPVSRGRDIRPL
                     PETQSSQSTGGVGAAVRRDEASRQRAEQLASLRADVSETRVVGDVIRHARTMDQATAV
                     LTILDVLASSSLSTTVTLTAGRGRGKSAALGLCLAAAIAHGYSNMFVTSPSPDNVRTL
                     FEFVLKGLDALGYEEVADWDLQRGTGEWKDTVVRINVFRGHRQTIQYIQPQDHAVLSQ
                     AELVVIDEAAAIPLPMVRALLGPYLVFLSSTIHGYEGTGRSLSLKLFQQLRSSGAGGR
                     SLKEVELREPIRYAPGDRVEAWLNELLCLDASLAKLPAHARDGCPHPSTCELYMVNRD
                     TLFSYHPASELFLQRIMALYVASHYKNSPNDMQLLSDAPAHAVFVLLPPLEKRTSLPE
                     PLCVLQVALEGNISRQVILQSLARGTRDAGDLVPWIMTQQFQDADFASLSGARIVRIA
                     VHPDYARMGYGARALEQLQSFYEGSLLDVDAHAHKLARDAARPAVSRSEWGGRDAKSL
                     PPLLERLSERQPESLDWLGVSYGLTPELFRFWSKVGYTPLYMRQVPNELTGEYSTVQL
                     KTLHGEQAWLGAFAADFGRRFCSLLSFRFRELKTTTALGVLEAASGASTPQPPLSHAE
                     LRFLLTPFDMKRLESYGNNVLELPIVLDLLPILAQLYFARRLRSADEADVERILHVSG
                     LSSALLLAVGLQRRNIEDLAHELNMPLHQAHTLLCKAVRAMVQSLRAVERRAAEADVD
                     ATRAEPALLAPVAENLEAELAEAGRQAVPVDASRAALSQELMNDAEMSQYAMSQDQEV
                     WEEAEARVRKMKSDTSGRPYSSTFSVKTSHPAPAPPSHPRASRASTKRRRT"
     gene            complement(<652572..>653777)
                     /locus_tag="MRET_3755"
                     /note="MRES_15140"
                     /db_xref="GeneID:38740521"
     mRNA            complement(<652572..>653777)
                     /locus_tag="MRET_3755"
                     /product="type I protein arginine methyltransferase"
                     /transcript_id="XM_027630382.1"
                     /db_xref="GeneID:38740521"
     CDS             complement(652572..653777)
                     /locus_tag="MRET_3755"
                     /codon_start=1
                     /product="type I protein arginine methyltransferase"
                     /protein_id="XP_027485815.1"
                     /db_xref="GeneID:38740521"
                     /translation="MAMVVDESTDAKYDRQDEAYFGYYSMLTHQAQMLQDSVRTSAYQ
                     MSIMQHALPYFANQTVMDVGAGNGILSLFALQAGAKLVFAVEASTMVEHLHHLVRAAH
                     AQDGDSAPNMWTRDRLAVVHARVEDVTPGMLREAAPIPVEPRVDTIVSECLGVLLVHE
                     RMCETLLEARDRFLKPDGAVFPRVGILCFSLLNDARMWQEVRARGEWWNTTDFYGIDL
                     TPFVDAARAEAFASPVVGCFSPVHVIGTTPDGADTESAVCRYMMDFSTISMRDLREFD
                     VPLAFDCIDEATVVHGLGAWFDLSFLQADDHPGIYDAEQNYMTTSPFAPPTHWAQVRL
                     FFPEPLALNAGQKVFGTLHFCANKNRSYDIQADIYVPFGDDQGAQQALYRRQAWWKLD
                     KQTYSWETM"
     gene            <653929..>654996
                     /locus_tag="MRET_3756"
                     /note="MRES_15145"
                     /db_xref="GeneID:38740522"
     mRNA            <653929..>654996
                     /locus_tag="MRET_3756"
                     /product="Bromodomain associated protein"
                     /transcript_id="XM_027630383.1"
                     /db_xref="GeneID:38740522"
     CDS             653929..654996
                     /locus_tag="MRET_3756"
                     /codon_start=1
                     /product="Bromodomain associated protein"
                     /protein_id="XP_027485816.1"
                     /db_xref="GeneID:38740522"
                     /translation="MERQPAPAAWPLREQLLLAQIVHQDGHVPPNWASVSTHITSHPC
                     VKETPRARSADTCERVWTALMQTHVPSDAVRTDRGAQLALAQRLYAARLEELVSDIAA
                     EDKAFHELHEKIEGLRAGRYDDELQKHVQVKAPSEPAKTEAASTEPVVSDVAETEEEA
                     PDDDDDLQVEQDLLGDTADPSRADMGKHAAPPPSTTTYSTRVRKRSRVVAASSSPASS
                     PELPAHTPRSHRAEEDESVSDAERDKSRRRTTQLLLMLHNQVSNHTHANLFDQPIKEM
                     DAPNYYTVIKQPMDLKLMKQRIKEGAITSSMDLRRAFSLMFANALMYNHPGTEVHRMA
                     NEMRVATDEILDEFDRTPLGS"
     gene            <655122..>656555
                     /locus_tag="MRET_3757"
                     /note="MRES_15150"
                     /db_xref="GeneID:38740523"
     mRNA            join(<655122..655463,655494..>656555)
                     /locus_tag="MRET_3757"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 2"
                     /transcript_id="XM_027630384.1"
                     /db_xref="GeneID:38740523"
     CDS             join(655122..655463,655494..656555)
                     /locus_tag="MRET_3757"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 2"
                     /protein_id="XP_027485923.1"
                     /db_xref="GeneID:38740523"
                     /translation="MARMLSSTWHMASMRALRSAVRPSVKLAHRGSMALSRRMYASES
                     TEKVGNPTHSATTVEDLQGMDAATLLREEGTQNDSNLRHFTVNFGPQHPAAHGVLRLI
                     MELNGEEILRVDPHVGLLHRGTEKLIEYKTYQQALPYFDRLDYSSMMTNELCFSRAVE
                     KLLNIEVPERAKWIRTLYGELTRISNHCMAVLSHIMDVGGLTPFVWGLEEREKIMEFY
                     ERVSGARMHAAYVRPGGVTYDLPPGLLDDIYAWATQFAGRVDEIEELVTANRVWRERT
                     IGIGTVTAQEAINYGFSGVMLRGSGVPWDIRKVAPYDAYDQVEFDVPVGKNGDCYDRY
                     LCRIEEFRQSLRIIHQCLNKMPAGQIKVDDHKIAPPSRAMMKDSMESLIHHFKLFSEG
                     FAVPPGETYSAIEAPKGEMGVYLVSDGSNRPYRCSISAPGFRHLAGADFVARHHYLPD
                     MVAIIGTMDLVFGEVDR"
     gene            complement(<656571..>657857)
                     /locus_tag="MRET_3758"
                     /note="MRES_15155"
                     /db_xref="GeneID:38740524"
     mRNA            complement(<656571..>657857)
                     /locus_tag="MRET_3758"
                     /product="endoplasmic reticulum-golgi intermediate
                     compartment protein 3"
                     /transcript_id="XM_027630385.1"
                     /db_xref="GeneID:38740524"
     CDS             complement(656571..657857)
                     /locus_tag="MRET_3758"
                     /codon_start=1
                     /product="endoplasmic reticulum-golgi intermediate
                     compartment protein 3"
                     /protein_id="XP_027485919.1"
                     /db_xref="GeneID:38740524"
                     /translation="MGPGGLFGQLRGIDAFGRMSEDVRIRTNAGALITLASGLLILVL
                     IVSEILDYRRVQTSPRLEVDLGRGERLAVQFNVTFPRIPCYLLSLDVVDVVGENQVDV
                     HHDIERRRLDEQGRPVSQDIIRALESEAKQIVAERGPDYCGDCYGAEPPESGCCNTCD
                     EVREAYLMQNWSFTSPDDIEQCRQEHWSEHVREQNHEGCNIAGEVRVNKVVGNLHFSP
                     GRTFQRNDIHTHDLVPYLHGVGESVHHFGHKIHRLSFGMHDEFAIERTSRGKRWGPLK
                     RQLGIVDALENHVGKTDNSDVMFQYFLKVVPVEVHKLNGRQMSTYQYSATSYDRDLDD
                     YDRGERSGHIVRSIEGIPGVFFNYEISPLRVVQTEWHHSVWHLVSNLFALIGGIVTVA
                     GLIDGAIYRARRTFRIVSQGGYSDDADGLGMDAKLL"
     gene            <657992..>660973
                     /locus_tag="MRET_3759"
                     /note="MRES_15160"
                     /db_xref="GeneID:38740525"
     mRNA            <657992..>660973
                     /locus_tag="MRET_3759"
                     /product="response regulator receiver domain protein"
                     /transcript_id="XM_027630386.1"
                     /db_xref="GeneID:38740525"
     CDS             657992..660973
                     /locus_tag="MRET_3759"
                     /codon_start=1
                     /product="response regulator receiver domain protein"
                     /protein_id="XP_027485814.1"
                     /db_xref="GeneID:38740525"
                     /translation="MRPLTKDVPSTPVWRAPSPSLSSTSSQEGALCMSPLPRPLYHGG
                     MLTGSTSSTSSSVAVTSTAILHDLLLTYSLLEAEPFELLSLERVAELRQEQHRLTASL
                     QDVQERISLEKKMRGATHRLHTSGQNAPSAPTLVRREDVTMAMERTDEVMQQYMQVSD
                     ALCDVQRQLLSHHIAVLRDHIQSEHHAASESSSVHAFVTPRRTTSSTMPLTPRRCRDR
                     PTASPTARSARLDALLMHEQDASPSPQRRNLQRRLSQLCAEHTTLQDWWMAEKPTHRV
                     LRDYIRDMQQMQSSLKELQLSVAAPDADPTKDPAWEPCMQEAQRLQRLLQEVQSRHEA
                     DATPAQESASPRARERGVSAEPQPRTELRGPAQDGAGPATEDQLRALEERHAQALQDA
                     HDQIQSLQDERQKVWEDAKVRIRSLQDKLDQALQAAEDPPSSLSERQDGLAAENSAPS
                     LREREASEPPPASASAWPADDVPRDASDADPERDIDRRLAALQAEHAAQEAAHAQTRA
                     SLEARIAQLESMVENEARQAAAPPTLSSRWHQMLRGSEPAMTRDVSASSKDRSPSRDM
                     DELRAQLAMEREQKDTVAKRLEDVMLLYRSVVDHLGPSSASDESGARMDTPVADDAAP
                     SDDALILRTPDTLTPTTPQVPETPLRLTRLETYLDANQTPTHRSERRTAVEARVRLLE
                     VQVEQHKRAAEQARAAYEQFKARHEADRASTAHERDVVQLWTQAWRTLCERLQRQHEF
                     CMRVLGKDDGREEMDGLLDQIKAASSRGAVTPTSAARDDSLQQEASRLLGQLEEHMGD
                     MAEGFARAGSSELGDNVIAQLEDRIEDLEEQLAARSATSVPAVVPKPSESDEMSVYAL
                     VLVHALLPEDDVLARSMSLSLDALRALFAPPEPTEDTLSAALPPVPGLLAARDLLDVT
                     PRATSPVLAERVRRLLDSVLREGTTHHAVATLAAQVMTRVVGTLDASHMVTERAMVLE
                     ETVRGYTDTSASDAPSIDLWP"
     gene            complement(<660970..>661584)
                     /locus_tag="MRET_3760"
                     /note="MRES_15165"
                     /db_xref="GeneID:38740526"
     mRNA            complement(<660970..>661584)
                     /locus_tag="MRET_3760"
                     /product="tubulin-specific chaperone B"
                     /transcript_id="XM_027630387.1"
                     /db_xref="GeneID:38740526"
     CDS             complement(660970..661584)
                     /locus_tag="MRET_3760"
                     /codon_start=1
                     /product="tubulin-specific chaperone B"
                     /protein_id="XP_027485888.1"
                     /db_xref="GeneID:38740526"
                     /translation="MSLHVEAPSVRVRGEHRLAVDTWDELQLRLERITGIPPEAQRLE
                     LDGAPLETIHRLAPGHTLRVLDARGSTLGEEEQVTKFELTDDQYAARDDSVRAFKKRH
                     HLGRFGPPPPRPSAPCPDVGVRGMVDTGDGFERRGTVRFVGPTSFAAGTWVGIEFDEP
                     VGKNDGSVQGTRYFTTRPRHGGFVRPSSVHTGPQYEPLEDDWEV"
     gene            <661614..>662336
                     /locus_tag="MRET_3761"
                     /note="MRES_15170"
                     /db_xref="GeneID:38740527"
     mRNA            <661614..>662336
                     /locus_tag="MRET_3761"
                     /product="GINS complex subunit 1"
                     /transcript_id="XM_027630388.1"
                     /db_xref="GeneID:38740527"
     CDS             661614..662336
                     /locus_tag="MRET_3761"
                     /codon_start=1
                     /product="GINS complex subunit 1"
                     /protein_id="XP_027485791.1"
                     /db_xref="GeneID:38740527"
                     /translation="MPSEAALQLVQEAKLSQTTGSLRAYHTERVRHVMLETRQLHAEL
                     APMAELARAEQASGQARPNAALAARLVAYHLQAYRNKRCLLAYHRQRLDWLRARVWDK
                     AGSLSLVLDEGPEGMRASLRTLLDPTEFEWLRSYAALVALYKDAFLDVLDVTWPITQG
                     ISPAHAREALGSDFRAHASSVAPNAIRPPEDVMLSVLVTRNVSHVETERGTMHLRAGE
                     RLHVRRDEVEGLLLRGWLRETD"
     gene            complement(<662337..>663752)
                     /locus_tag="MRET_3762"
                     /note="MRES_15175"
                     /db_xref="GeneID:38740528"
     mRNA            complement(<662337..>663752)
                     /locus_tag="MRET_3762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630389.1"
                     /db_xref="GeneID:38740528"
     CDS             complement(662337..663752)
                     /locus_tag="MRET_3762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486134.1"
                     /db_xref="GeneID:38740528"
                     /translation="MRRRQPPTAWRDSCVSLSSDEEEEDAVVADGQGVWDHAFCVVCN
                     CLIESDQASGPDEADRAVEEHDEVWEAAALSSLRRHRLRKHKAHTPRVSPATAPLFCS
                     EACRQLDQQRSEGLREFLHYVSRTPSRAAKAASLAPTTSPPSSPDLLDAHTHTSPSLA
                     TSLSRAEYHTRRQAYDDTDDDAPLSALPGPLQAAASRSLDTPSNLTRSRVAMVHATPR
                     RRPCTETSSPPKSVVLDSAPPTPPPRLSRSVHAASPLDLMTPVRPHPVPPTSATHAPV
                     SLPATTHVPASSSRPTQRLSAKAPATVATATVHAATAHAPSSLSGGGGSHDPAPLRRA
                     TYHDRRARPPLLAPTRSRAHPMDAVRRPSPARSKRASSGSRSPYASTSLPSTSPRRPG
                     LGWSALPPPRDDDEPRTRTWSQDVAAKGTPMYPILQLPHDDVIHDKYSQYWPAPPQAP
                     SLPSGSLPRGRHRKSLFHFAT"
     gene            <663830..>665066
                     /locus_tag="MRET_3763"
                     /note="MRES_15180"
                     /db_xref="GeneID:38740529"
     mRNA            join(<663830..664648,664674..>665066)
                     /locus_tag="MRET_3763"
                     /product="sister chromatid cohesion protein DCC1"
                     /transcript_id="XM_027630390.1"
                     /db_xref="GeneID:38740529"
     CDS             join(663830..664648,664674..665066)
                     /locus_tag="MRET_3763"
                     /codon_start=1
                     /product="sister chromatid cohesion protein DCC1"
                     /protein_id="XP_027486160.1"
                     /db_xref="GeneID:38740529"
                     /translation="MHVPLVTSPAQETYQLLELPPELEAHIEAGPATLHFLGRLSDEA
                     VLVTQDATYAVRQVLQSNSRLLCSVETALDGDVQLRLRENVRETLEVVRTSALLDRLA
                     TLLQDDMYMGPADEVEQRHYTPAEVKSIVQASEAELLEGRRTYHILELDGFWRRVAPD
                     VVLDLLRSLLAHLDIFACSPDRVPFARMCDALAPRACRAVAQAVVGDWFCASVPRSLD
                     TPPAYVSLARASIVQFMGRHVLQTHKRMPLRAFLDAWHQQVGQALQADVQLTLLQGHY
                     LLYPPPATMTESSPHTPLPPTPAALALADTMTIQSFSHTWLPTAPAQRFQELFLMRPQ
                     WIREELVPFIAPLATSPSGIESLLLKHGRSLRARWSSTHAQVLLHGQLTPPASSAPVP
                     CTLYQARVKYA"
     gene            complement(<665053..>666888)
                     /locus_tag="MRET_3764"
                     /note="MRES_15185"
                     /db_xref="GeneID:38740530"
     mRNA            complement(<665053..>666888)
                     /locus_tag="MRET_3764"
                     /product="solute carrier family 24
                     (sodium/potassium/calcium exchanger), member 6"
                     /transcript_id="XM_027630391.1"
                     /db_xref="GeneID:38740530"
     CDS             complement(665053..666888)
                     /locus_tag="MRET_3764"
                     /codon_start=1
                     /product="solute carrier family 24
                     (sodium/potassium/calcium exchanger), member 6"
                     /protein_id="XP_027485860.1"
                     /db_xref="GeneID:38740530"
                     /translation="MLRWPGLLLWSVGSGAGRAAEAVCEPMPPSLTPREACAFIQDTC
                     RPSSAYVHLALYYCSDAWSTSVLASTAVHMGVTLLLTVWLLALFSVLGLVASDFFCPN
                     LSSMATRWGLSDNVVGVTLLALGNASPDVVSTFRAMRKDAGSMALGEIMGAAVFTVAI
                     VCGSIMVLHSFRLDPFVFVRDVGTYMLAVALSLYFLHDGSLSVSEGMCMLGLYLVYIG
                     TVIWCDTPPQRTPEHDPLLPDATHAHHSVLSAIRVRDMTAHSDPDLASSVLRSPRNEP
                     ARAEPRADAARPASLAPVAWWRIAFVALCPSLVHWSDKSWGHRLASVAYAPALLVLRL
                     TVPLVSADEYQLHATLQAMQGAADEGTTQALRAAVWDEAVAVLDTPGPLVPTGERVAA
                     DHFLLSVQCTGVPVLVLWMYDAPLYWAIPGTIAGVCLWRYLRASPSRDAPEQLQRYAV
                     LRHALGFFTGLLWIVASVDGVLAVLRAYGYIFHWSEAVLGLTVFAWGNSLGDVVTNLS
                     MARVGRPHMALTACFASPLTNLLFGVGFATTWLTLLHPTHEAYRIAWSPVLALSCVVM
                     LCMLLVMLGTVSLHGFRTSRPLGYALLLTYVGVMMGSLLLEVTHT"
     gene            <666969..>668645
                     /locus_tag="MRET_3765"
                     /note="MRES_15190"
                     /db_xref="GeneID:38740531"
     mRNA            <666969..>668645
                     /locus_tag="MRET_3765"
                     /product="triacylglycerol lipase"
                     /transcript_id="XM_027630392.1"
                     /db_xref="GeneID:38740531"
     CDS             666969..668645
                     /locus_tag="MRET_3765"
                     /codon_start=1
                     /product="triacylglycerol lipase"
                     /protein_id="XP_027485858.1"
                     /db_xref="GeneID:38740531"
                     /translation="MRRWRPSGGPSAVHRAFHTRPAAAIKRPPRPERAKDERMPYATP
                     GSRLEALMQHPHLFDPPRAPRYPIVLCHGLYGFDVRGPFMGFEYHYWSAALDVLQQRL
                     GAQVYVFAVPPTGSIQERAETLHKLLVRQHFPRGQRLNFVGHSMGGLDVRYLISHIQP
                     QEYTPVSLTTVATPHRGSPFMDWCNENIGVGLELMDSMMREAEPKTVPDDLPTRAPFS
                     LKSPLLTYAKTSEDRNSLRRALSHVSSSFSSYILSIFDQPAYAMLSTRYMTRLFNPTV
                     PDQPHVRYFSIATRTKSIPIWHPLWLPKLILDKAAATGTCGADADGSYAAWHTSHTGS
                     DGLVSVNSARWGEFLGMIENWDHWDVRGPGGPRRLRPARKPPKAPDNARTPWSRLWTL
                     LNQWLPRSRQAKPPVLPDDPEWDWRVAALSDYEETTHKERPETPVTAAAYAMSSVYVK
                     GADARETSKVARMLAEWISSHLPASHGTSQDDSRMLFKYLTGDQPLEGSLGHGRPDSQ
                     ATSAQRMSHTLLHMFPFLAQIEARTPPPPPNDVLERFWAAVCRNLYDAGL"
     gene            <668699..>670777
                     /locus_tag="MRET_3766"
                     /note="MRES_15195"
                     /db_xref="GeneID:38740532"
     mRNA            <668699..>670777
                     /locus_tag="MRET_3766"
                     /product="serine/threonine-protein phosphatase"
                     /transcript_id="XM_027630393.1"
                     /db_xref="GeneID:38740532"
     CDS             668699..670777
                     /locus_tag="MRET_3766"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase"
                     /protein_id="XP_027485881.1"
                     /db_xref="GeneID:38740532"
                     /translation="MRALCIVALCVTLVRGAAWDAQVYGRGRLPRYDDELRPLEWGQL
                     QVLHTTDIHGWYQGHTKSSPPEPNYSGDWGDWIAFTQHMRRLADERGVDLLLVDTGDL
                     HDGNGLSDAGPGVQGHVSDQVFALADYDLLTIGNHELYNMSVAQDVYEHFVPHWGDRY
                     LTSNVHITLPGTTQSRPIGHRYTRFTTKNQRLTIQAYGVLFDFQLGAPGITVQDPKAM
                     VKEAWFQASLRASSDVDAFVIAGHMPVTGYDGWDAIHEAIRSVWPTTPILMLGGHTHV
                     RDCRMLDSHAMALESGRYLETVGWMSVSNVSVPTFSRRYIDANPRNYAFHAGLVHAGH
                     LSTPRGRFVRATMDAMARAWNLTDVYGIVPRDYYLDRAPYGDPSALLTLMSEHILPDV
                     VRSSFPARANASSLIIMNSGSQRFDVFAGAFTKNDQYIVSPFRDAFLFVPDVPWYVAR
                     RLVHRLNELGAVHNEQPGAVHPAQGDADPIFHQYLRHAFYSYWLNRLSPTSTSSTQSP
                     VPSGRPASARRLEELLEQVGTDGSMAEALPHLVGGSRGRSPSLGYVTADSCSGLGDDT
                     VHTPIPYSDEQPDYIAAQPVPLPSSDHDHVDVIFADFIAQSILSLLNTYDARRHYTMA
                     DVSVWGNATTESLYSSFAQLHWRLDSMDSALHDMDRAATFDGYPPLAPFDTYAGDPYA
                     PVTAPRLVFQ"
     gene            <671120..>671398
                     /locus_tag="MRET_3767"
                     /db_xref="GeneID:38740533"
     mRNA            <671120..>671398
                     /locus_tag="MRET_3767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630394.1"
                     /db_xref="GeneID:38740533"
     CDS             671120..671398
                     /locus_tag="MRET_3767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486100.1"
                     /db_xref="GeneID:38740533"
                     /translation="MIKAFVVLAAAAASLVAASDRVSVKGYTADSKGALDCKFGSGDI
                     LKKCGTCAKSITECATSNPNKTEQVCVSDIASFAGDCGGCAVNILECL"
     gene            <673737..>674414
                     /locus_tag="MRET_3768"
                     /note="MRES_11535"
                     /db_xref="GeneID:38740534"
     mRNA            <673737..>674414
                     /locus_tag="MRET_3768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630395.1"
                     /db_xref="GeneID:38740534"
     CDS             673737..674414
                     /locus_tag="MRET_3768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486112.1"
                     /db_xref="GeneID:38740534"
                     /translation="MKTSTIAILLAAAALNTANALKCHKNATGVLATWEDTEILDSHV
                     GFGWTQYYHMKDGKLAKSNLPGEEYDFYECEAPEKFGKGGGVVKTKDGKKCLTNSFIR
                     ERDMSPDGSLENRDKQVPENVEKKVTLEDCAEGGMELRKQWFELGLGDQERKGCSVPL
                     SKVGYEHDEIMDLSYGPDGVAFDTEGGLGYDKSDKVSYFHRSRSYLMTGNLDATCVYK
                     NPVEPGK"
     gene            <675094..>675702
                     /locus_tag="MRET_3769"
                     /db_xref="GeneID:38740535"
     mRNA            <675094..>675702
                     /locus_tag="MRET_3769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630396.1"
                     /db_xref="GeneID:38740535"
     CDS             675094..675702
                     /locus_tag="MRET_3769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486111.1"
                     /db_xref="GeneID:38740535"
                     /translation="MKIAAATILSALAFSSLVSAVPAKRDGLKCQAKYAPGPLAARAH
                     FGSATERQYFAFRGVEGREGEVLATSDKPGQVVQFYECEKPAENYYPGKDDDDKSFGQ
                     LRLKEDPSLCVTVGADEALRLEKCEEGATKKMEGQWMAATNAGEGCASIVWHAPLQGQ
                     KLQGQVEFNHDVIQLDEVRRSNIKGAVAFKMDNGAFGGRCVG"
CONTIG      join(CP030256.1:1..677500)
//
DBGET integrated database retrieval system