GenomeNet

Database: RefSeq
Entry: NC_040199
LinkDB: NC_040199
Original site: NC_040199 
LOCUS       NC_040199             453862 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome VII, complete sequence.
ACCESSION   NC_040199
VERSION     NC_040199.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 453862)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 453862)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 453862)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030257.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..453862
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="VII"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            <723..>1850
                     /locus_tag="MRET_3770"
                     /note="MRES_16360"
                     /db_xref="GeneID:38740536"
     mRNA            <723..>1850
                     /locus_tag="MRET_3770"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027630397.1"
                     /db_xref="GeneID:38740536"
     CDS             723..1850
                     /locus_tag="MRET_3770"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027486450.1"
                     /db_xref="GeneID:38740536"
                     /translation="MLLLPTFALVLAGFSSAVRIDLSRDAKGEPSFEAELEHLHHKYY
                     ALSKLHHNKTGEHLNVINLDLFNKQKRAHGKTHLRKAKAWSGHIEVGFPPQKTTAVFD
                     TGSADLVFDKSDYNPKKSLTSKNLHKTFDFDYYDRHVEGDLYADRVAIGGVKAWNVAV
                     GHGKDDYNKDVCGATFGLSFSTTTRSFFDVEQDAFIWAAKKQHLIQSSTYQFTLRPNG
                     KASLNVGNVDFSELNSLIHWSNKNTDKTFWRADVKLNGHAIKNAILDTGTSIITGPNE
                     EVGKFLKKLDGIKVEQGDDGLYHGTYDCKNPPRMEFEVFGKKLVFPEAAMQQGYVGDT
                     CTFAMVGSKVINDWILGSPFFEIGSFILNYDLRHMGVAQFT"
     gene            complement(<2066..>3751)
                     /locus_tag="MRET_3771"
                     /note="MRES_13565"
                     /db_xref="GeneID:38740537"
     mRNA            complement(<2066..>3751)
                     /locus_tag="MRET_3771"
                     /product="deoxyribodipyrimidine photo-lyase"
                     /transcript_id="XM_027630398.1"
                     /db_xref="GeneID:38740537"
     CDS             complement(2066..3751)
                     /locus_tag="MRET_3771"
                     /codon_start=1
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="XP_027486398.1"
                     /db_xref="GeneID:38740537"
                     /translation="MVVLAFLGPCMRTLDNPALYHAIRQAAKDKSAGAVVAFYVEDPT
                     QRLPGKAFTWWTRKSLPKLRKQLEELRVPLFCLRAPYPRIAEVLVSTALPFSAVHVNR
                     RWGGTTQDEDTRFAEIWAHAGIEQRVHTAHTLHEPWEIQTGQGQPYRVYTAFSKHFAN
                     ISPQLLEEPPCAPEDEDGQAYTRMEHALTEQKDITVLDWARPSSEFQEPWAAAFPWTP
                     GSDEAHRVLQAFMDHALATYKDARDIPFEAGTSRLSPYLAHGEISPHRVLSAVRRARS
                     AGSTSKSFIESTHTFERELVWREFNYHLLYHQPDLATRNHNVQWDAFSWAEVASPAQL
                     KQEKGCAPASSEAMYARAMYDCWRSGHTGIPLVDAGMRQLWKMGWMHNRVRMVVASFL
                     VKNLRIHWRLGEEWFWDTLVDADPASNPGNWQWVAGTGADAAPFFRIFNPARQADRFD
                     ERCAYVRQWVDELKSTSTSDIAEMYEHPKRSVASAMASPSPASLWVKRSNDAERMDMP
                     KASLFRPSMVAMAEPTYRAAMVDLKKSRSITLEYYQKRKNSSESPRVKQMKLA"
     gene            <4792..>5694
                     /locus_tag="MRET_3772"
                     /note="MRES_16350"
                     /db_xref="GeneID:38740538"
     mRNA            <4792..>5694
                     /locus_tag="MRET_3772"
                     /product="lipase precursor-like protein"
                     /transcript_id="XM_027630399.1"
                     /db_xref="GeneID:38740538"
     CDS             4792..5694
                     /locus_tag="MRET_3772"
                     /codon_start=1
                     /product="lipase precursor-like protein"
                     /protein_id="XP_027486448.1"
                     /db_xref="GeneID:38740538"
                     /translation="MRFLAFLLCLVPLALCIIEPRGIDGPTSHEAPTDLPIDWHILSQ
                     AAGMAHEPYCLFGDIGDRVGDAEVLWSKGHGVVIQRVKIFHSKSLGVTVSFEGTTASL
                     LSILHDVNAALIDPPKEVAPAYCEGVKLFAGFSNAYMELRDEVYEQIVKFQKQFNDKR
                     VTTTGHSLGAAMAVLAAMDLNKRLDDGIYRSFAFGMPRTGNGAFANDVDKKIGGRFFY
                     IVNGRDWVPRVLPRELGFQHPSGQIWINPPSTTHWKYYPGQENHYGANSEDPILTFDD
                     HHGIYFHTGLGHGPGKCPASVGTA"
     gene            complement(<5705..>6959)
                     /locus_tag="MRET_3773"
                     /note="MRES_16345"
                     /db_xref="GeneID:38740539"
     mRNA            complement(join(<5705..6839,6865..>6959))
                     /locus_tag="MRET_3773"
                     /product="MFS family protein"
                     /transcript_id="XM_027630400.1"
                     /db_xref="GeneID:38740539"
     CDS             complement(join(5705..6839,6865..6959))
                     /locus_tag="MRET_3773"
                     /codon_start=1
                     /product="MFS family protein"
                     /protein_id="XP_027486449.1"
                     /db_xref="GeneID:38740539"
                     /translation="MVLHEQEPWHSPIPWTAWLYVVGSFFLFFNSWGIVNSFGTFQAY
                     YKAHFLSHRSSFDISWIGSVQACLTLILSQLVGPLYDMGFMTILVWIGAFLVTFGMMM
                     TSLCTRFYQVLLAQGFCIGIGSSLLYIPSVMVCVTHCRRRKGLALGISSVGSSLGSII
                     YPIVFNQTEPDIGFGYAFRVMGFLALGTFVISLAVIRRVSGTKEIRPLLLLHAFREPS
                     YAWYVVSEFFCLMGIYVPYYYVTSYASGPSHMSEDLSPYMVPILKATSIIGRLVPALL
                     SDYFGPLNMYVPMIFASAVLNFGWIGIHSPASIIVYIVLYGITSGTVVAITPAVVAEI
                     TSDPKEVGTRIGMSYFVGGLGMLVGPPVAGRLLDMHDGSYYLGVQLFSACIMCAATMC
                     LVMARAHKAGWHVLRKA"
     gene            complement(<8256..>9780)
                     /locus_tag="MRET_3774"
                     /db_xref="GeneID:38740540"
     mRNA            complement(join(<8256..8511,8537..>9780))
                     /locus_tag="MRET_3774"
                     /product="multidrug transporter of the major facilitator
                     superfamily"
                     /transcript_id="XM_027630401.1"
                     /db_xref="GeneID:38740540"
     CDS             complement(join(8256..8511,8537..9780))
                     /locus_tag="MRET_3774"
                     /codon_start=1
                     /product="multidrug transporter of the major facilitator
                     superfamily"
                     /protein_id="XP_027486446.1"
                     /db_xref="GeneID:38740540"
                     /translation="MGSQETTQLRTRPPQDEERQDLPLSKPVVDPDAEAFSSLLPWAK
                     VMIVALASVSGFMSPFSSTIYVPALDEISKKLHISRADTLLSVTLYLVFQGLSPSFWG
                     PLSDQLGRRPILLSTFTVLLGANLGLAFSNTFWLLLVLRMVQAFGSSSAMAIGAGLIG
                     DIARRKERGRYMSYFQSGVLLGPCVAPVVGGLVSHRWDWHAPFFFLAAFGGLLNVVLA
                     LFLPETLRKLMGDGSRQPRGIWKPWVPMRWTPKPGANERAPPLMHPVSTLSIRQMGFE
                     KPWLVYGQLDISLLVASYAIPFALFSVTSSFFSPILASNYDYNTIVIGLCYLPLGAGF
                     ALGSILSGRLIDSEYQRAKRKHGLRLNLYKARLKLGPIFNVIFCCGVMAFAWCLDKRV
                     HIAAPLTIVFFTMTVSMMYFTAINALLIDLYPDLGASIIASVNISRCILSAVIVAVTQ
                     YIIDGIGTGWTFTLYSLVALVCPIPVTFLLVRFGPRWQEKRETRHASSY"
     gene            complement(<9914..>11413)
                     /locus_tag="MRET_3775"
                     /note="MRES_16340"
                     /db_xref="GeneID:38740541"
     mRNA            complement(<9914..>11413)
                     /locus_tag="MRET_3775"
                     /product="multidrug transporter of the major facilitator
                     superfamily"
                     /transcript_id="XM_027630402.1"
                     /db_xref="GeneID:38740541"
     CDS             complement(9914..11413)
                     /locus_tag="MRET_3775"
                     /codon_start=1
                     /product="multidrug transporter of the major facilitator
                     superfamily"
                     /protein_id="XP_027486447.1"
                     /db_xref="GeneID:38740541"
                     /translation="MSSSEHASSLDIESKASHEAETPAVQEEGKEAETVVADEPYSAF
                     PRPLKVFIVTVASASGFMSPFAINIYMPAVPDISRHLHISSAQALLSLTTYLIFQGLS
                     PSIWAPLSDTYGRRPILVCTFLVFLAANLGLSFTNVYWLLLVLRMLQACGASSAIAIG
                     AGCISDVSQQKERGSYMGYFQFGTLLGPSIGPIVGGFMAQAWNWHGVFFFLSAFGGVY
                     MIFLIFFLPESLRALVGNGSLQPVGVWRTIVPLWTKRTYGTKPKPMKMPPKLHIKTMG
                     FDKPWRMYGQPDVALMIATYAIPFGSFTLMSSCLSPVLYDNYELNSWQMGLCFLGIGC
                     GSAAGSIAVGHLLDREYARAMGVHGDQLNLHHVRMKYMPLFNILFSVFFIVNGWLLNY
                     TIYLAAPLIMQFFASWFAVMYFNCINTVLVDIYPQRAASVTAALNIGRCLTAAGFVAA
                     SQYIIDAIGYGWTQTIFGLVSLLAPMPMAWAVMRYGPTWKHRRECVSRE"
     gene            complement(<11479..>12180)
                     /locus_tag="MRET_3776"
                     /note="MRES_16335"
                     /db_xref="GeneID:38740542"
     mRNA            complement(<11479..>12180)
                     /locus_tag="MRET_3776"
                     /product="glutathione S-transferase"
                     /transcript_id="XM_027630403.1"
                     /db_xref="GeneID:38740542"
     CDS             complement(11479..12180)
                     /locus_tag="MRET_3776"
                     /codon_start=1
                     /product="glutathione S-transferase"
                     /protein_id="XP_027486444.1"
                     /db_xref="GeneID:38740542"
                     /translation="MIIVHHLNNSRSQRILWVLEELEIPYEIKFYQRGADHLAPKELR
                     DVHPLGKSPVITDTDRGNKVVAESGAIINYLIKYYGNGRGVPTKEREDDNDFWTQFSE
                     ASLMPKLVLLLIFMLLPTQAPFFIRPILNMVGNQVRRLLIDRDLDAMIKLSADALTQE
                     KSDGRAWFAGGDKDGNPTAADYQMLFPMEAITSGRLDASRVPEPIKNWVDMVHKRPAY
                     LRAYEKGGPYDYAKL"
     gene            complement(<12234..>14579)
                     /locus_tag="MRET_3777"
                     /note="MRES_16330"
                     /db_xref="GeneID:38740543"
     mRNA            complement(<12234..>14579)
                     /locus_tag="MRET_3777"
                     /product="mitochondrial intermediate peptidase"
                     /transcript_id="XM_027630404.1"
                     /db_xref="GeneID:38740543"
     CDS             complement(12234..14579)
                     /locus_tag="MRET_3777"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase"
                     /protein_id="XP_027486445.1"
                     /db_xref="GeneID:38740543"
                     /translation="MLRHLARRVCVRPMRHVVGGRPLHLTRSDAASVTAIEMGVPPSV
                     ERDHGVLQELLDTSSRAAAARTAGAPTGLFQIGHLRAPQDFVLLAQRTLVRCQLLVNR
                     ISRAHTPRETALVVQHLDRLSDMLCGVIDMAELVRHAHPDKAWATAANDAYEYLCNYM
                     NVLNTHTELYDALRRVMDDSQLYQQLSKEAQAVALIFLRDFEKSGIHLPPRERERFVD
                     LSDQIMVLGRAFLQDMSTGTSDAVIEFPTELLQGLDLSLLGQSLLRLRPAKTISVVPG
                     SWELHYISRHAPNPEARRLAYMMSYTGRDVPVAILEQLLRTRYELARLTGKESAAEMA
                     LVDKMAGSSEHVSSFLRLMAHAQRPAAQQMIAEFGALKHKLEGTSHMDIWDRDFYAEA
                     YLQLHQPAQLTPLSPYLSLGSVFTGLSRLFYLLYGIHFRAAETQPGEVWHPDVLKLEV
                     VDETEGGVIGTIYCDLYSREGKPPSAAHYTVRCSRRIDQDDAHLDVELGASPELPADT
                     STEHLLGVVGAPGRGRPGRFQLPVVVLMTDFPGMGHGGASLLRWHDVETLFHEMGHAI
                     HSMIGRTEFHNVSGTRCATDFVELPSILMEHFLVHPQVVQLTAHHHRTGSPLPYHQLQ
                     QHLDTQKRLDALDAHQQILLASLDQRYHSSRAGAPTFSTSKELEALQAEMGLFPPVPN
                     ATWQGQFGHLFGYGATYYSYLFDRAIAARVWDKVFAKQPLSREAGEEFKNQVLRYGGG
                     KNPWHMLARLLKEDDIAHGDSRAMETIGRWGLGCPTSYELP"
     gene            complement(<14619..>16226)
                     /locus_tag="MRET_3778"
                     /note="MRES_16325"
                     /db_xref="GeneID:38740544"
     mRNA            complement(<14619..>16226)
                     /locus_tag="MRET_3778"
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /transcript_id="XM_027630405.1"
                     /db_xref="GeneID:38740544"
     CDS             complement(14619..16226)
                     /locus_tag="MRET_3778"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /protein_id="XP_027486451.1"
                     /db_xref="GeneID:38740544"
                     /translation="MAQSAEQVLASIEAAGGHIQDSRSLAPTQPLSLEEQAERILRST
                     SDAQDQEDLQAEEAAHKAAAAWQLSLQGVLLSLQSKEMIEFRSMDHQPVFLTLDGRQT
                     VRLGSPEYRLWTLLPESGEGRAQQDLEAQLGKDTFKLAQSRAFRNKMARRLPDGSFAR
                     AEAMLGQALEDETRAELLEVARTGTLRGDGADKKLAELKKRKMIGQRKWLTFSMSKGP
                     QFALTVQKLETDLTADMLASGAWKKAAFKKYNFDAEGVLPPSGALHPLLKVREEFRHI
                     FFDMGFSEMPTNRFVDSSFWCFDSIFVPQQHPARDVQDTFFVADPPAAAEVPEDYLRR
                     VVQVHEKGDFGSIGYRYPFDRSVTEKLVLRTHTTAVSSAMLYAIANQPGGFQPAKLFS
                     IDRVFRNEAVDATHLAEFHQVEGVVADYGITLGDLIGFMQVFFSKMGVKNLRFKPAYN
                     PYTEPSLEIFSYHEGLRKWVEIGNSGMFRPEMLRPMGLPENVNVLGWGLSLERPTMIR
                     YGIKDIRHLVGHKVPLDSVERAPAVRF"
     gene            <16329..>17768
                     /locus_tag="MRET_3779"
                     /note="MRES_16320"
                     /db_xref="GeneID:38740545"
     mRNA            <16329..>17768
                     /locus_tag="MRET_3779"
                     /product="U4/U6 small nuclear ribonucleoprotein PRP4"
                     /transcript_id="XM_027630406.1"
                     /db_xref="GeneID:38740545"
     CDS             16329..17768
                     /locus_tag="MRET_3779"
                     /codon_start=1
                     /product="U4/U6 small nuclear ribonucleoprotein PRP4"
                     /protein_id="XP_027486452.1"
                     /db_xref="GeneID:38740545"
                     /translation="MADQSVAWDELDTQGPPSASDAAAHAMLEHRKLAQKVPVPTSDT
                     QVRERLRHYHEPITLFGEREPDRRARLLHVLIDRHGKNAVHVSHAPQAPEEDEEEDEE
                     FYTEGSHDLLIARRRMAAFSLQRAKERLRQQCQESTASMQEVAALRQTVLEPLKSYTS
                     LGTQVAAERPVSVVRFSPDASLLATGSWSGKASLWSIPNATPCGTMHAHEDRITGLAW
                     HPRATIGQPRSAIHMATGAGDGALCTWSLESERPLSVLRGHEARVCRIAFHPMGDYLA
                     SASFDGTWRLWDVARAQELMLQEGHSREVYAIDFQGDGALVASGGLDAIGRVWDTRTG
                     RTAMVLDGHAREILGLAFAPNGYQLVSTSGDDTARVWDLRMLRSLYTIPAHHSSVADV
                     RFFHAAESSLPSMDEDGSDTHSLSRSGLYFATAGYDGLVKIWSADDWQLVKSLRGDAG
                     KVMSVDISSDGQYVASGEWARTFKLWGHV"
     gene            complement(<17785..>18318)
                     /locus_tag="MRET_3780"
                     /note="MRES_16315"
                     /db_xref="GeneID:38740546"
     mRNA            complement(<17785..>18318)
                     /locus_tag="MRET_3780"
                     /product="large subunit ribosomal protein L24e"
                     /transcript_id="XM_027630407.1"
                     /db_xref="GeneID:38740546"
     CDS             complement(17785..18318)
                     /locus_tag="MRET_3780"
                     /codon_start=1
                     /product="large subunit ribosomal protein L24e"
                     /protein_id="XP_027486262.1"
                     /db_xref="GeneID:38740546"
                     /translation="MRVEHCYFCSAPSYPGRGIVFVRNDSKVFRFCKSKCHKNFKMKR
                     NPRKVRWTKAFRKAAGKEMTVDATLEFEKRRNVPVRYDRDLVTATLSAMQRIQEIKAR
                     RERAFYRARMSKAAGGNVKEKAKQVDRLAVHRHQHLRKAIQADAAKDERQKVKVAARK
                     SALVSAGDQGMSMDMQE"
     gene            <18438..>19287
                     /locus_tag="MRET_3781"
                     /note="MRES_16310"
                     /db_xref="GeneID:38740547"
     mRNA            join(<18438..19172,19210..>19287)
                     /locus_tag="MRET_3781"
                     /product="glutaredoxin domain protein"
                     /transcript_id="XM_027630408.1"
                     /db_xref="GeneID:38740547"
     CDS             join(18438..19172,19210..19287)
                     /locus_tag="MRET_3781"
                     /codon_start=1
                     /product="glutaredoxin domain protein"
                     /protein_id="XP_027486261.1"
                     /db_xref="GeneID:38740547"
                     /translation="MSTSRETRLELGLPLTHEPEDHVKGIPLAWFRRRKSTLMACALF
                     LVLGWCFWLPALQSRSAVPVRDKGIDRLLRKIPGAIPGVPAPIQKDLVDYGRHGESYP
                     SHQDLLIVLMQDLQDPLFRVDNSTWTEWRHWVSSSGGLPSDAHVQFLRRLKALAHGDL
                     SDAQLYLEHPDQWKTKHVQDAPMTVFSKSYCPYSRGAKELLTKYHARFTAYEVDLRPD
                     TNMLQGLLWDLTGHRTYPKVLRRSELLGGFDSLQELDEQGLLHSILSTAGAL"
     gene            complement(<19319..>19672)
                     /locus_tag="MRET_3782"
                     /note="MRES_16305"
                     /db_xref="GeneID:38740548"
     mRNA            complement(<19319..>19672)
                     /locus_tag="MRET_3782"
                     /product="signal recognition particle subunit SRP9"
                     /transcript_id="XM_027630409.1"
                     /db_xref="GeneID:38740548"
     CDS             complement(19319..19672)
                     /locus_tag="MRET_3782"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP9"
                     /protein_id="XP_027486260.1"
                     /db_xref="GeneID:38740548"
                     /translation="MVYLKHWSEFRAQALDLCKKSPNRTRFSIKARPKLQVLVIKVTD
                     DCVTLKFRSKSAIILNRLDEFQRDMFTIMSGVVPPAPTKEEPTSQTAETPKPSTASQP
                     PPKGSSGKKKKGKKK"
     gene            <19796..>20803
                     /locus_tag="MRET_3783"
                     /note="MRES_16300"
                     /db_xref="GeneID:38740549"
     mRNA            <19796..>20803
                     /locus_tag="MRET_3783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630410.1"
                     /db_xref="GeneID:38740549"
     CDS             19796..20803
                     /locus_tag="MRET_3783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486259.1"
                     /db_xref="GeneID:38740549"
                     /translation="MANDRRGMSSVEAFSSLLYELIAMNKLSGSRVARVTESATHALH
                     DPDGLSKVMLKAHMRAPPQNKLVSLYLFDAIARHAQDIARRNGTGMQTSESPAKLAAN
                     AAAFLHMLQEPAAQVGTDSLHHAPPEQREKVRKVMDIWDRAGTFHPRILQRIREQASA
                     PPSAPTKPAAPPPAPSAAKSPPPPPTSLPPHVLALLGQVQQSGALSAPQETAPRPATN
                     APSPPVVSPAPSAPAEDLKAFDQASFDPTNSDHWARLARLWKNSYNYEPSGPELMMAL
                     MSGMLSSEADPRWGAMPPMPGMPPMPGMPPMPGMPPMPGMPPMPGMPMASNDAPSPKD
                     A"
     gene            <21031..>23283
                     /locus_tag="MRET_3784"
                     /note="MRES_16295"
                     /db_xref="GeneID:38740550"
     mRNA            <21031..>23283
                     /locus_tag="MRET_3784"
                     /product="FYVE, RhoGEF and PH domain protein"
                     /transcript_id="XM_027630411.1"
                     /db_xref="GeneID:38740550"
     CDS             21031..23283
                     /locus_tag="MRET_3784"
                     /codon_start=1
                     /product="FYVE, RhoGEF and PH domain protein"
                     /protein_id="XP_027486347.1"
                     /db_xref="GeneID:38740550"
                     /translation="MSAPSGTSASVAQRQRSRTSATRPRSSILMLSNMDRRLSLGEQS
                     YARHLLWEEPAASEHTASSPAMPDHQISKRKRLAVEMYETEKAYVRVLMHVDKLYYTP
                     LLMSLQDTHPILSRSAVNRIFANFYDILQLSKELLFRLEERIGNPMRLLADKTPVQVP
                     EWDPAHDTIGDLLVPILPFLKVYALFMQNFSHAMQCIESERRTNDRFRVFLAHANQHY
                     DHESPHGVSLGLEAQLLNIVQRVPRYRMLLRSLLQHTPVTHKDHAWLAGSFSVVDHIA
                     RSVNEHIRQHELTMTAIALQRTLIGLDEPLVVPGRRLLKHGTLLKTRRKDIQPRHFYL
                     FSDCMIVAAASSLDESDKSWPRLSHSFEGELSDVLPSTFGMLHLTNKLHLSDVTVISY
                     DDMEVPLPAPAERPVPFLRHKFEILSPQCSFSLYAPSQAAKHSWVTAIREAQDEFRTS
                     LPSIRKSLELSERPSSFASMSSEGGSAHGGTASHSTTDGETTTSSASSRTGHTRSASM
                     SSLFASSASLPLLEEYHAPVWVPDSLVSRCKRCSEPFSFWRRKHHCRLCGYVFCATCC
                     SRVVLVRTESPHMAHVRARVCIACYTSNFRSSMPCSPRTASTSLSSPTHEPPSPAWRG
                     TSLRPMLHTVPASSAQASPPASMPTKAVLQSLTNTPIARKSHRRQWSIVSVPREAHQA
                     DPRPRVQVETKTTGLPTLDQHIPSNSAMPTSASMPALASHAPPPRRSTSRETLRASQA
                     VSWLQSLLPP"
     gene            <23349..>27293
                     /locus_tag="MRET_3785"
                     /note="MRES_16290"
                     /db_xref="GeneID:38740551"
     mRNA            <23349..>27293
                     /locus_tag="MRET_3785"
                     /product="Mus7/MMS22 family protein"
                     /transcript_id="XM_027630412.1"
                     /db_xref="GeneID:38740551"
     CDS             23349..27293
                     /locus_tag="MRET_3785"
                     /codon_start=1
                     /product="Mus7/MMS22 family protein"
                     /protein_id="XP_027486346.1"
                     /db_xref="GeneID:38740551"
                     /translation="MPRGDDVAVVGTSDDEEAVGWTSDAESGELVPTHRSSKQWTLFH
                     TRPRRRLWHAQVCRDAEQPAPRHHLRTRKLSQIHPYTVEALRYRRELYANDWQDAVVS
                     QREWRHWRIPERSTDDLGSWTAQDERSSSPSLIESLPERAPTSPARASSAPPSPAPTS
                     PARASPAPPSPTSSEDSTDYERRFRVLKRMMPAHMARACIDDLRAMRHGDVDSDAVTD
                     RARSPSPPHELQPGESRRRIRAHDGPPAPLLSDASSSEEDVHEPSLTLHDSDLRWWAV
                     PKRAASPVREGDVIDRMLARTETRKPRRPRRKGFGQSSRRAAASRPHRSQRVAVPAWI
                     QASEPREPPPRFHGLPTKRADLGAHARLPYIPGPHSTLSVAQEVRTTVPMSTATRPRP
                     VSRRGPMPMPSAPPHTIPKEWERAPPEWHDELQELLAWDGVRHIQWDFGITSPPVGLS
                     FAPDTDLARGRLHELLHLAPATSEPPPLCVYERTLHVWMSWEEVASALLGLSLDDHRS
                     TRDLLHFLGLWLTWQASLAHTAQPIALTTFDAQVACDALCAWAQDWLDQPCSPDLVLR
                     LLWFRICILWRAMHTGTTTVTHVTVLEATYPLLLRLLSMGVAHIADALTAAGAVDDPT
                     AEMWVCIIHLLHAMDDQAFWDVWDPAWAEWLSLTRSSPLVACERTWYALFVVCALSHF
                     HASTGMAGHTSYLRAHWPAVQRLVSRIKLRFDERVERAAPRVLLQRRDAYIHLLLRRC
                     FLLCTRWSWSLEHADAILNHWFDVFNAHRLADLPTETDHDFAPFLRRFDVSLLYAEPS
                     GTAYHQFLQLLGRASHVLSMADDAQRRLARLFSRMTPVRVMAFTHDNPPISSEFAMLF
                     NHYSLVMLFLYFEPPSALQRLRQIRSFLAFSRADRSSQIACIRAVVYAGVLFRHHGLD
                     IQPIVVWLVDVLHSLQASMHQDRDTSELFSVRRADQTMREASRMMAVLIRSVHHLVTH
                     ASMKSDPSTPYPPLGLLHPAWTDQLIRSGDMAPEVANEVLGLIRVYLDTRAASVWPHV
                     SVAADDDDEFDDAWWTDPGLAALLGEDPQPPIDTQLAEQLHTHLSPALFQWLMTGEPS
                     TPRSISPLERLMARAEEDERYAMVVDNWASCAHVLVYHRRRAWHAYLTLGNESWKRLS
                     HPIRKRDVAVRFVVRMAHLDEAAFVEHVSECIAIWFQCMAACHVTMQPALTRLLARHA
                     DVFRGVWVEDDADAYRERRAAVLQQVLTQMQAAYAPSQGFVIQCVSALLSSIRAYAEH
                     VHDEAYWSWCHATLHAVSTYADDRLLRGIRTELHATLSYLATPRSSHHGAIP"
     gene            complement(<27270..>29499)
                     /locus_tag="MRET_3786"
                     /note="MRES_16285"
                     /db_xref="GeneID:38740552"
     mRNA            complement(join(<27270..28079,28105..>29499))
                     /locus_tag="MRET_3786"
                     /product="sphingomyelin phosphodiesterase"
                     /transcript_id="XM_027630413.1"
                     /db_xref="GeneID:38740552"
     CDS             complement(join(27270..28079,28105..29499))
                     /locus_tag="MRET_3786"
                     /codon_start=1
                     /product="sphingomyelin phosphodiesterase"
                     /protein_id="XP_027486258.1"
                     /db_xref="GeneID:38740552"
                     /translation="MMRRLVLWGIVAAASACAASSSSRYGEPVYTGRAEFPTSLFESM
                     YYVPSRPTAEPRPAVPRLSGGWYPDELNHPTKLPKSALPSEQVLPKPLPQREKLQALV
                     HDLLNVGHQLFRPQAPRHALCNLCRTGLSTLQTLTHQFPSAVPDVLTTLCRTFDLLGK
                     KDVADQCALTLSRDMYGGPIGQVMSYGNFSGSAPDATLVCAAVPFHFCEYPSEVLSDD
                     FLYHWFNGSTQAPDDALERWHEQQKCAQESFDESKLLRVLHISDLHVDGRYMVGSESN
                     CTFGETRYCCHSISANKDLWSKTITDGVVPRANISAPAHYWGNYTCDAPWSLIGSTYE
                     AIRHVGRSHGYDMGLCTGDLVVHDDLFRYSHDLVEYSARSLFDSLAEVLGRHVPVFAT
                     LGNHDSSPENFYAPHAMPKHQSTQFDWDSDFMARLWRENGWIDAAGEEQARSHYACFS
                     VSPRRGLRVISLNSDFWYYANVFNYIHSTDPDFSGMLRFLTDELFAAERKGERVWILG
                     HVLTGWTGAEALDKPANLFFQIVSRFTPHTIAAIFFGHTHQDHFSVFYRAQSGASRDI
                     SRHTRDARTVSFVGPSVTPLTNVNPSFRVYQVDPITFDVYDYDQYYTPVDEFDSLQAG
                     PIWRHLYNARDTYGDMRASVQHHNYHAPVSLNGTAWPRAAPLNASFWAALTDEMEVRP
                     ALVSTFAQLQSRRSAAAGACTDAKCHKANICYMRSGTPTQGRDCPSGYGSVV"
     gene            <29573..>30805
                     /locus_tag="MRET_3787"
                     /note="MRES_16280"
                     /db_xref="GeneID:38740553"
     mRNA            <29573..>30805
                     /locus_tag="MRET_3787"
                     /product="proteasomal ATPase-associated factor 1"
                     /transcript_id="XM_027630414.1"
                     /db_xref="GeneID:38740553"
     CDS             29573..30805
                     /locus_tag="MRET_3787"
                     /codon_start=1
                     /product="proteasomal ATPase-associated factor 1"
                     /protein_id="XP_027486257.1"
                     /db_xref="GeneID:38740553"
                     /translation="MSVVRGVPWISVPASLREVVHDMEQASPGTWEDVWVSWHGVDEQ
                     RSLKHAVWRVSNDGHAPQVASLAPSTLPVRGLHPLCVDVEASPPMMVHLADQISALPA
                     AWGPSVMALSACVGGVQRYAVGGADGVLHTGTWSHELFGSEDVTCEGHASDVTSVRFF
                     PSAQVVLSTSVDMRARIVSALDGTCPRVLEGHTRAVNDSAIFGRGREVATGSSDGTVR
                     VWDVGHHVTQARWDVQDGVNALAVLGAAASLPDDRQGLLVAGTDGGRLCGWDTRTAPQ
                     AAWGARVPPHPWCKDVARICALDADDTRVLLGTSNGMSALYDVRQPTAPLDAWHRNAA
                     SVTSVELAGDTAKVSTSDGLPYGWHASTGQVHEYAGWDADVTSSIRTDAWGRTIVLGA
                     RGMLATYGYHGYQGHDPC"
     gene            complement(<30802..>32694)
                     /locus_tag="MRET_3788"
                     /note="MRES_16275"
                     /db_xref="GeneID:38740554"
     mRNA            complement(<30802..>32694)
                     /locus_tag="MRET_3788"
                     /product="transporter (MirC)"
                     /transcript_id="XM_027630415.1"
                     /db_xref="GeneID:38740554"
     CDS             complement(30802..32694)
                     /locus_tag="MRET_3788"
                     /codon_start=1
                     /product="transporter (MirC)"
                     /protein_id="XP_027486264.1"
                     /db_xref="GeneID:38740554"
                     /translation="MLHVDGAPVKIRSVSGRDLHRPYSDVCPPIRTSVLSRAGDSAAS
                     RWCQVPDTLPSWITYMGSVEENTPLISLRTSHTREREHTRTLLLLYLAIFFLALASSL
                     DSMSFNLFLNYACSEFQALSHLGTIMIAQQLVRAISKPPIARFADTMGRIATLVMCIT
                     LYAGGHAIMALAPSFRMLMLGTMIQSLGTTGVGVVLAVIMADTSSPQWRGFVIGLFNV
                     PYILNFALTGPVVDGMLKAGGWRLGFGFWVVLVPLSAVPLLSLLMIGSRRASKHFPHL
                     VESTLSSTRARHVVSQMDIVGTALLSSALTLILLPVSMEGPRALFDGLSLFRSDIPTG
                     VMLLLVFGAWEMWTDTPLFPLSVVTHLGVSITCCIAALDFAGFYLSWTYLSSCVQILK
                     NWDQVRTAYFITIQNVTSTITGVCVGMCMAYTRQLKRYMFIGLIFRLLGVALMICYRH
                     TRHTAAVLLASQVLQGIGGGALSLTTQVAVQVHVEPSEIATVTAFELLTMDLGSALGS
                     TIASALVMSQLPAALRARLPDRPASEIERIQGSLEEVLRHAPGSPMRAGIVDAWVYVM
                     QWLCILSFLVQLPALALTFLAPKVDLHEERSLPSTARTNRTAGAPSFMTAPSLWRTQL
                     VVHGEA"
     gene            complement(<32872..>35988)
                     /locus_tag="MRET_3789"
                     /note="MRES_16270"
                     /db_xref="GeneID:38740555"
     mRNA            complement(<32872..>35988)
                     /locus_tag="MRET_3789"
                     /product="RNA binding effector protein Scp160"
                     /transcript_id="XM_027630416.1"
                     /db_xref="GeneID:38740555"
     CDS             complement(32872..35988)
                     /locus_tag="MRET_3789"
                     /codon_start=1
                     /product="RNA binding effector protein Scp160"
                     /protein_id="XP_027486263.1"
                     /db_xref="GeneID:38740555"
                     /translation="MQEAPSAGTIGSTAPMSLPRPMDDPFPSLNQTIGADVDVAPPPK
                     KSGKSQQPDITSEDMFPSLGASQSSARVSAPKTAAPMIQRVMHQTTVSMHLSDEQLVR
                     LSSLLQRVQQKCRSVKIEASTMRKTGQTKFIIKGASESAVQEAKRELAIQLAERVTLT
                     MLIPASLRAFVIGAGGKNIRSITDDTGVRIHIPPRSEEQTPATDEPGDLLLGEQIEIT
                     IEGDSFNAQDAQARIQEIVAERTSKITQRLTHIEPVFFPFLLGPEGAGIAALTQTIGK
                     GEVSVKVPAQRERAAIVVSGERSLVPLVVQAIDAQVDDMRRSFRTISFNISKRQHAFL
                     VGESASDILAKTQCSIELPPSNEPSEAITIRGPQSQLPQALTAAIERANAVAVETIDL
                     HAMHSDADAAHFRHLLRWLATYAPREDSVQVFLPRTDAGHIEVVSEDADAARRIAQTI
                     EHQLRLVTPPCVRLMEVDPLTHGFIIGKKAQNLRGYEARGVDVMLPPEHSGRDDVLLV
                     YRRGKDAEEAVNVLDDVQNAIASAAAAAADLRTVHFSVPRKFHSVIRGADGTVLNALI
                     GEDRMLVSMGGRIPVKTVSEPLTEDSIVVRGPGEAVARVVAQIQQMARDAEQDSIENG
                     FVEEIQVRGSYLPHLIGRGGSNLIKLREELGVRFDVGSEESDRSKPVPVRITGRKECV
                     AVAKERLLAQVERLADEVLQIIQVPVEMHGALIGQGGKYVLRLQDKYDVRIHFPHQGD
                     STTLKPNEVSIRGGRKGVAAARAELLELLEYEKENNHSQTITVSERAMPRVLGRAGAT
                     INRIRLESGALIDSVKSSNASPSKKLKLRGSREAVAAAEGMINAIIAEVESEAELIVP
                     IPPEFHPHMIGAGGQRLHELIEKAGGPSDITTHTQMVRFPREKGNANVLVRAPHDLAH
                     RIADVLKAEAALMANRVVYGKKVPLRMHSQMVMRGGRRHSPWQTDLSVQIFLPNWREY
                     PTIGTPENADELQDAEPASIVKVVGPVENVLQVLDEMQSMIDASPRPRKTRAQREAMD
                     ARIDDVDR"
     gene            <36198..>38135
                     /locus_tag="MRET_3790"
                     /note="MRES_16265"
                     /db_xref="GeneID:38740556"
     mRNA            <36198..>38135
                     /locus_tag="MRET_3790"
                     /product="DUF907 domain protein"
                     /transcript_id="XM_027630417.1"
                     /db_xref="GeneID:38740556"
     CDS             36198..38135
                     /locus_tag="MRET_3790"
                     /codon_start=1
                     /product="DUF907 domain protein"
                     /protein_id="XP_027486245.1"
                     /db_xref="GeneID:38740556"
                     /translation="MRMRFGIALCALGAVAILEQVQASNSDIFHPNHTLYTSSVAYCE
                     APGPLLLQSLDLKYSDDTHTLDFDVRLSSTTTDLTYDTDFMLYAYGRKFVKVHQDLCA
                     LASGSFCHIPNYNFSGSAQVHVPDYISSDIPRIVYTVPDIEALAMLRLYDSKTKKPKG
                     CIQVQISNSMTVDLPGVTYGVGAFVIAATVASLITSAWTNSLSPLQWRVVDVVTTMQL
                     TPMASMLTIIVPRVVHAFSRRFGWIVGLWYIESIVSSIFDARQNTGSKDLNINFGSLM
                     EAEYSRLANFFPAEMLNGNDSAEVLDVNDVSSLGFNSLLRRKLYAPNTGPGGEMDPGK
                     SADNVVWAVAMDGFSQSGIFYYAASLNISPYSAFLTSLVTWLMAICIAIGLALLATIP
                     VVFLTRTPMPYALERLYVQWVRPLLLRILASAMTPVLIFAFFQFAHSTGWLSHFIAAL
                     TCFAIVCVWSIILAQQWVQVHRSGPDSLYYIRSQPWDLQSAALHIGSMSHPWRPKYWW
                     FWTVMHGCMFLRACFIGFAQKHDYGLRQSAGLLVTDFLLFAVLVVCRPGRDIQSNVVQ
                     CLLCAFRVVIWALCIALSTEANVWGIPRAIVGFVLLAVLSLAIVFIFFVFLLEIVQTL
                     FSRRQRWKGDYQDLYHVHSET"
     gene            complement(<38114..>38831)
                     /locus_tag="MRET_3791"
                     /db_xref="GeneID:38740557"
     mRNA            complement(join(<38114..38614,38642..38727,38753..>38831))
                     /locus_tag="MRET_3791"
                     /product="nicotinamidase"
                     /transcript_id="XM_027630418.1"
                     /db_xref="GeneID:38740557"
     CDS             complement(join(38114..38614,38642..38727,38753..38831))
                     /locus_tag="MRET_3791"
                     /codon_start=1
                     /product="nicotinamidase"
                     /protein_id="XP_027486373.1"
                     /db_xref="GeneID:38740557"
                     /translation="MTPTVPSGPGVALVIVDVQNDFINGTLTVPGGQDIIPSVKHLVN
                     EFPCSCIVATKDFHPPNHASFASTHGLAPFQLHTIPHPYDPRASLSQMLWPDHCVQGT
                     RGAEIHDDIQAALDMREKAGTPVSYVLKGTDARVDSYSAFACADYLQFTNMASILHRA
                     HIHTVVVCGLATDYCVRATAVDAAKFGFRTYVLQDCIRGVDPSTTAEAEQVMSWYQVS
                     LCT"
     gene            complement(38860..38970)
                     /locus_tag="MRET_t0060"
                     /db_xref="GeneID:38741254"
     tRNA            complement(38860..38970)
                     /locus_tag="MRET_t0060"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:38741254"
     gene            <39078..>40463
                     /locus_tag="MRET_3792"
                     /db_xref="GeneID:38740558"
     mRNA            <39078..>40463
                     /locus_tag="MRET_3792"
                     /product="protein phosphatase PTC7"
                     /transcript_id="XM_027630419.1"
                     /db_xref="GeneID:38740558"
     CDS             39078..40463
                     /locus_tag="MRET_3792"
                     /codon_start=1
                     /product="protein phosphatase PTC7"
                     /protein_id="XP_027486274.1"
                     /db_xref="GeneID:38740558"
                     /translation="MHAFGRAKIRVTRRTLCTCHGRCLFPWTAPPASLAGSRKQIFDS
                     SSFGGQTTTYVFHSGAYGIPKSRPRVHGEQTSSHGFLGPLADFFLGGQKDGQPHPSLD
                     QVSVLPSSLASLHGCGLQSAIRSDGRIVKTRLQSQNVGQDAYFLKNDAMGVADGVGGW
                     AAQPHADPSLFSRLLMHFLYAELQQLDETLCQSLDDPQGTDDVLSEWFMCNPVDVLQR
                     AWERCVRASKREGILGSSTALAAILRGDELRIANMGDCVLFLIRNGKLIFRSAEQQHS
                     FNYPLQLGMMDATVESVMLSRALCMHRSGRIPAGAHDMDLPDVNDSMSDYIHMYDRVP
                     SHDDVPYDTPQHDAGHWEVKVLPDDLVLVASDGLFDNLFDDEIMDTVHDVFSHFASSD
                     LEAMQMYAPTLISERLCRLARSVMDDPRVMCSPFQQHANEEGMYYVGGKSDDVTVLAG
                     LIAEQQRPCPL"
     gene            <40541..>44020
                     /locus_tag="MRET_3793"
                     /note="MRES_16260"
                     /db_xref="GeneID:38740559"
     mRNA            <40541..>44020
                     /locus_tag="MRET_3793"
                     /product="component of the NuA4 histone acetyltransferase
                     complex"
                     /transcript_id="XM_027630420.1"
                     /db_xref="GeneID:38740559"
     CDS             40541..44020
                     /locus_tag="MRET_3793"
                     /codon_start=1
                     /product="component of the NuA4 histone acetyltransferase
                     complex"
                     /protein_id="XP_027486275.1"
                     /db_xref="GeneID:38740559"
                     /translation="MSDATTSRVTIDDVRAQTINETETQLNSIVASHREHVRELLYLV
                     QTAEADAHAASYAPPAAPLVPDEHAGLPKLVLPNHAAQELSARLAQTMKLLRENATRN
                     AELKTPLPPPDTATQLPPPPAPLFKVQSQPKNTPHPARNAAVRLPPSPMPRPVEYDQT
                     LPNPTPPLTLQTLAPNPLSVTYASSLRPLPPDPSRRVTGIGTGGGSVHHRTRRSTQRP
                     GPMAKPVKGTAGPDLLRWQVRIRACPSASLVRKASKCLLTGDWKVAFTEQKFLRAMMR
                     MEDMKQQGLWSFRQPKRVKGRVERKTHWDYVLEEMRWMQTDFREERKWKLAMAYEFAH
                     QIAQWHRSSPEERASLCVSRRRVEPMQWEEPEPAPGSEPEPAPEAESEAESDPKARVQ
                     DDPADEPRDEKPSNEPDIDVDADAEGEDDSQAMPRLTYTEPPAKADEPAQPMRSDANK
                     ETTLSDKLPLALVTAIRAPIFSLDTTATTVSPWSLLEHLDPQTSAALMRMDDAPSIDP
                     EQLDFDKLFPELPPYAPPNASDDPASQKRRDESQAQSTRLVHVSRLLDAKPILVSTLD
                     PARYRENGHWVDTSEWAERMPHAPEVSPPYVAGVPPGSLLFSRRAGKAPRESMAGPRI
                     PTAPAHPDARVQQLSWSSEQDAFVQALAKQYHDHWSLVADLFNAACFVIPTEKRTAWD
                     CYDRCQWLATAADQRPSRPAPRDSKQAYRQHLLDMMRKWAKRREQIQRQAAANAAANA
                     SMERANLTAHDTHTQVKMTTTPTPQALSALKAERDQAAIRQFFEQQRAAQFAYAQQQQ
                     RLQLVQAQAAQANDDPHRKAAAVAMSASASGAAPAAGVAAAQSPSAAGTTSGSGPSPA
                     ASAALLSRSTSGPAPPPPHVTATSSPSSTSLPPQQQYLAAMSANQGAATAAAAATKPT
                     PAPAQPPVMMAGPSLPLARAAQPYFGVDSAAIPAATSASPLSAANLKASTQPTGSPIV
                     ASATQGPPRPPQPIVIASSASPSSRLAHPAPAGVGFDAQATGTPSPMSTPAAPAIPMT
                     NAAAPGVNAVGRPPTAVAGPGSSYLGSTQAAPTSAPPNLHALQQQLAITLAASHLSQE
                     QINSLAIQLYKQAQQQQQQQRAQPDGHSQGSAPTGLVGHAPRFVPVPQPSAGSHTTSL
                     PANHHATPPSRQT"
     gene            complement(<44024..>44998)
                     /locus_tag="MRET_3794"
                     /note="MRES_16255"
                     /db_xref="GeneID:38740560"
     mRNA            complement(<44024..>44998)
                     /locus_tag="MRET_3794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630421.1"
                     /db_xref="GeneID:38740560"
     CDS             complement(44024..44998)
                     /locus_tag="MRET_3794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486276.1"
                     /db_xref="GeneID:38740560"
                     /translation="MRLVRLMWAAWALWIAAVGVVHGTASSPHMAIIDNIPDGISDSC
                     SQLLQELDQDKVFQQCTEPLIVATNTFAQQSTNSSRSVALSSSMEKLCQAQNGCDRHL
                     VRYFLFEFWNQCTDELEARHPEILQLYEYLYIFNPFRDAVCSKDASGRYCLPTITKKA
                     AKKSSKTKRAMPLPQDVYSEAYWARVLPTIPRSHMMAATNASSSPAINTSQLPSLAPQ
                     QVFFFLSGESDPDVLCTECSKHVLAAYISYELSSPYAPGLENSDVLKSQQSIYERAKS
                     VCGRDFVSSINQQAHVQSFTGPASGAVSPRALTPHLWGWLVVAYLLST"
     gene            complement(<45084..>45968)
                     /locus_tag="MRET_3795"
                     /db_xref="GeneID:38740561"
     mRNA            complement(join(<45084..45304,45331..45493,45520..45837,
                     45862..45912,45945..>45968))
                     /locus_tag="MRET_3795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630422.1"
                     /db_xref="GeneID:38740561"
     CDS             complement(join(45084..45304,45331..45493,45520..45837,
                     45862..45912,45945..45968))
                     /locus_tag="MRET_3795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486277.1"
                     /db_xref="GeneID:38740561"
                     /translation="MVRYGQLIIGPPGSGKTTYCYGMYQFFSALKRGVHIVNLDPANE
                     RVPYPCDISLSDLISVSDVMAELDLGPNGAMLYCMEYLEHNIDWLESRLAALEHDYVL
                     FDLPGQVELSTNHPSLQRILERLQKQDWRLVAVHLSDATHITDPARYVALLVLALRAM
                     LMLELPHVNVLSKFDLLDEEQQSQLIFPLDYYTEVQDLHYMSDHLHATQPRVAQMYEV
                     LGDIVEDYGLVSFETLAVEDRDRMLHLVEVLDRAIGYIGA"
     gene            complement(<46048..>46627)
                     /locus_tag="MRET_3796"
                     /note="MRES_16250"
                     /db_xref="GeneID:38740562"
     mRNA            complement(join(<46048..46231,46260..>46627))
                     /locus_tag="MRET_3796"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 4"
                     /transcript_id="XM_027630423.1"
                     /db_xref="GeneID:38740562"
     CDS             complement(join(46048..46231,46260..46627))
                     /locus_tag="MRET_3796"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 4"
                     /protein_id="XP_027486278.1"
                     /db_xref="GeneID:38740562"
                     /translation="MSTMIRSLLYRHTLPMRPSLYRTMHTSLRVGKDSAHQTVPARPA
                     PGEKRDLVAEQVNRISEPTAASVVSDAPNSLHQRYVRIFQPAKPATQSGRAGTRDWRV
                     EFEVLQGSGRWESPLMGWASTADHQQSLSMRFDSLDAAIHFCEKQGWNYLVQQPHKAR
                     IPPKSYAANFKYSPGKLRIHHTK"
     gene            <47111..>47911
                     /locus_tag="MRET_3797"
                     /note="MRES_16245"
                     /db_xref="GeneID:38740563"
     mRNA            <47111..>47911
                     /locus_tag="MRET_3797"
                     /product="exosome complex component RRP40"
                     /transcript_id="XM_027630424.1"
                     /db_xref="GeneID:38740563"
     CDS             47111..47911
                     /locus_tag="MRET_3797"
                     /codon_start=1
                     /product="exosome complex component RRP40"
                     /protein_id="XP_027486279.1"
                     /db_xref="GeneID:38740563"
                     /translation="MVVVLPGDVIHEAAPSLQQTKLGPGVLPAPHAPEAPATLSSIHT
                     GALGHIRTQQRTAQAAVPMHGWYVESARRRYVPCEGDRVIGQVTNRGAESFTVTLFSA
                     HHASLPVLAFEGASRRNRPHLEIGALVYARIESAEPWTEPVLSCIDPVHNKADGMGEL
                     KVAQEPELSMVWRVSEPLARSLLRPSHTLLPSVSRHFAFEAAIGVNGLVWTRASRAEH
                     VAALGRILAAADEACRQHALAGDASPTSLHKRIGERGELPPDTISQLV"
     gene            complement(<47915..>50149)
                     /locus_tag="MRET_3798"
                     /note="MRES_16240"
                     /db_xref="GeneID:38740564"
     mRNA            complement(<47915..>50149)
                     /locus_tag="MRET_3798"
                     /product="vacuolar protein sorting-associated protein 53"
                     /transcript_id="XM_027630425.1"
                     /db_xref="GeneID:38740564"
     CDS             complement(47915..50149)
                     /locus_tag="MRET_3798"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 53"
                     /protein_id="XP_027486206.1"
                     /db_xref="GeneID:38740564"
                     /translation="MDSVAARVDALLAGGDGDGLSRAHVERAQARVHAQLTRHRDETR
                     RLLSLTAHPLPNEHEHDAQALLAALADLETHASRAEKSVGEITAEIRWLDMAKRNVGH
                     SIVTLRRLQMLVSSTMQLQQLCETQQYRDAASTLQAVEALLSFFVRFHSVPCILQQRT
                     LTDSLREKLHKMVMSEYEAAFQRPRWDASTSALPDAALVVDALGPEVRDKLMEWYCTR
                     QLREYRRVFRAVDEAGQLDNVPRRYAWIRRLLRTYADEHAPAFLPAWHVERRLLVLFC
                     DITHDDMRSVLVREQPRLHVDVLLNALHSTNEFEASVARQFGFHADRPISSAFTPYLG
                     VYVDAQDRQLSEMLAQMAASSQAATTDMSADEPVRVLVSSTELVTLYRQALERCASLG
                     PRAPLRELGSVYGKWLRRYAHDVLLPSLSSRDVLHLCTVLNTADYGATTCTQLAERLT
                     EKLRAVDAEAAPVVLDAERHEFFGVMSSALQALTRALSTALDPAFQALLRPDVPWSQR
                     EHLDEKSAWVDLLASGLESVGVVVRHHVENKRYVRSWCDKAAHLTMMRITQSIVRLRP
                     IRPRMAEQLQRDVQHVHTLLIEWPSGASQAAYVRIVDKAMSRVQPVLAILAVPSTDAP
                     AFVNAYRQHVGDQSLPNFQKILDLHGVRRLEQHALVEAFLAAVDRAPDTLPTTSALSS
                     LELDPHADVYAETGGDRPRDEPSAADAPPGRPSTPSAGTALGLPDWKKFGSMFGVALG
                     QRRP"
     gene            <50285..>51542
                     /locus_tag="MRET_3799"
                     /db_xref="GeneID:38740565"
     mRNA            join(<50285..50298,50327..>51542)
                     /locus_tag="MRET_3799"
                     /product="nucleosome assembly protein 1-like 1"
                     /transcript_id="XM_027630426.1"
                     /db_xref="GeneID:38740565"
     CDS             join(50285..50298,50327..51542)
                     /locus_tag="MRET_3799"
                     /codon_start=1
                     /product="nucleosome assembly protein 1-like 1"
                     /protein_id="XP_027486207.1"
                     /db_xref="GeneID:38740565"
                     /translation="MDIGKKRDANWTAPTPQNTPLSNAPIEREQLARPTVGTIGEEEE
                     QGEAADAAAALLPNAALTNMIQDRLSTLVGQSSGYIESLPAEVRRRVEGLKGLNVDHQ
                     KLEAQFQHEILALEKKFASLYAPLYNRRKQIVLGEDEPTAEEVEHGEAVDKDEDDEDD
                     DEASLAHLSISTDAPKGIPEFWLTALRNHVALSELITERDEGALRHLTDVRLRYLDAS
                     SEAVPGQAQQGFQLDFVFDAAHNEFFSNAVLTKTYFYQDQVGFSGDLVYDHAEGTQIE
                     WTSPDTNLTHRLETKKQRNKNTNETRTVKRLVPTDSFFNFFSPPRPPTEADDVDDEDL
                     DSLEERLELDYQIGEDLKDRIIPHAIDFFTGKALQYENPDEWDDEDDFEDDDDEDEDD
                     DDDAPAQRPEPQECKQQ"
     gene            <51623..>53304
                     /locus_tag="MRET_3800"
                     /note="MRES_16235"
                     /db_xref="GeneID:38740566"
     mRNA            join(<51623..51885,51909..>53304)
                     /locus_tag="MRET_3800"
                     /product="DNA polymerase kappa"
                     /transcript_id="XM_027630427.1"
                     /db_xref="GeneID:38740566"
     CDS             join(51623..51885,51909..53304)
                     /locus_tag="MRET_3800"
                     /codon_start=1
                     /product="DNA polymerase kappa"
                     /protein_id="XP_027486249.1"
                     /db_xref="GeneID:38740566"
                     /translation="MPPRHAYPIGRVKDARPLLCQRLVLRPSSFAAEPLVIRSFVAPR
                     RPGPLHPTARAWMTSADEASLYQHLGGPSSHKAGVASDADTQKRIHDVSQGSKYYENE
                     RRRHEAVTRRIDRMLERRSAALDRLGSVERARAESHVSRVVAELEAQRDVSRIILHCD
                     MDMFYAAVEVQRCPELRGKRFAVGHGVLLTASYEARQRGVRSAMAEYVARALCPDLLV
                     VETHFDAYRRRSEQVMSVLRTYDPTLHQRSLDEAYLDVTSYCATHAMDPRDVAAQLRL
                     DVYQATEGLTVSVGIACNRLLAKIASDHGKPDGVWYVPPTRDDMIAFMRGLSVRKVPG
                     IGQVTERMLSAISIHTCDDIWARRVELSVCIDSYRMLLAAALGISDTHIAPPSRDARR
                     SVGCERTLAPTTDPATLHAHLRTTCESLSRDLVQQAYRARTVTLVCKRDTFERFTRAQ
                     ACRVAVYTSDDLYAVVHALLEQERAASPVPLCLRLVGVRASSLIDMHTARDGPLAQWL
                     KTPHTASRDPIVCPVCSKDIQVRGVRTASINAHIDACLSRASRT"
     gene            complement(<53301..>54242)
                     /locus_tag="MRET_3801"
                     /note="MRES_16230"
                     /db_xref="GeneID:38740567"
     mRNA            complement(<53301..>54242)
                     /locus_tag="MRET_3801"
                     /product="pH-response regulator protein palC"
                     /transcript_id="XM_027630428.1"
                     /db_xref="GeneID:38740567"
     CDS             complement(53301..54242)
                     /locus_tag="MRET_3801"
                     /codon_start=1
                     /product="pH-response regulator protein palC"
                     /protein_id="XP_027486401.1"
                     /db_xref="GeneID:38740567"
                     /translation="MLVSSKFRLHGLLSEVCLMHMLYACSLRAEAATIVEALGAYELG
                     AHDRKACDDRLRVAIDLLCRASGVCEYVATQLLPTYPAPPSKSAYPPELVSEGVQACS
                     KLAMADAHALAIRKLLVPYARHHGPPLPPQHPSPSLLAKLHLHTASLFLEAHTLGAQS
                     LGMEPHSAKHKLAQKLHALRPDTDVDDKMAFLPYARRSAHTHKALAYQWLGIDQGEYA
                     KNTGWAMAYLAMALSMLDGHKKTSAWADMSRWHAAYKKMNDTLSFQRIPSVQEVLLCT
                     SEGRAAMFPKAYMPVYAFGAKREATHRTTYAGAGAYY"
     gene            complement(<54723..>55101)
                     /locus_tag="MRET_3802"
                     /note="MRES_16225"
                     /db_xref="GeneID:38740568"
     mRNA            complement(join(<54723..54748,54780..>55101))
                     /locus_tag="MRET_3802"
                     /product="F-type H+-transporting ATPase subunit f"
                     /transcript_id="XM_027630429.1"
                     /db_xref="GeneID:38740568"
     CDS             complement(join(54723..54748,54780..55101))
                     /locus_tag="MRET_3802"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit f"
                     /protein_id="XP_027486418.1"
                     /db_xref="GeneID:38740568"
                     /translation="MIARGFMHSNKAARAVRVAGQQVRFNSNLPIPPKIATPKSVQGE
                     NAANTEAVVNFYKALPKGAEPERRPSGFKAKYFDGKHASAKPLVWTIAGLMLFGYTLE
                     YNGHLKYHKNAHH"
     gene            complement(<55341..>56139)
                     /locus_tag="MRET_3803"
                     /note="MRES_16220"
                     /db_xref="GeneID:38740569"
     mRNA            complement(join(<55341..56002,56046..>56139))
                     /locus_tag="MRET_3803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630430.1"
                     /db_xref="GeneID:38740569"
     CDS             complement(join(55341..56002,56046..56139))
                     /locus_tag="MRET_3803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486400.1"
                     /db_xref="GeneID:38740569"
                     /translation="MAERGRGGFGRDRGRGGRGRRGARKDEKEEWVPVTSLGRLVKDG
                     KIKSMEEIYLFSLPIKEYQIVDILLPKLTDEVMKITPVQKQTRAGQRTRFKAFVAIGD
                     SDGHLGLGVKCATEVASAIRGAMIMAKLTIIPVRRGYWGSALGKPHTVPTKVSGKTAS
                     VMCRLVPAPRGTGIVASPAPKRLLQLAGIEDVYTQSKGQTATMGNFLKATFEAVSKTY
                     AVLTPNLWEEVPVPPTPYVEHATHLARVGKKLH"
     gene            <56406..>57281
                     /locus_tag="MRET_3804"
                     /note="MRES_16215"
                     /db_xref="GeneID:38740570"
     mRNA            <56406..>57281
                     /locus_tag="MRET_3804"
                     /product="small subunit ribosomal protein SAe"
                     /transcript_id="XM_027630431.1"
                     /db_xref="GeneID:38740570"
     CDS             56406..57281
                     /locus_tag="MRET_3804"
                     /codon_start=1
                     /product="small subunit ribosomal protein SAe"
                     /protein_id="XP_027486344.1"
                     /db_xref="GeneID:38740570"
                     /translation="MASKQPAILNPTPEDISLLLAAQTHIGTKNCEKAMLPYVHKRRA
                     DGIHLINIGKTWEKIVFAARVLAAVENPADICVISGRTYGHRAVHKFAANTGATAIAG
                     RFTPGSFTNYITRSFKEPRVIVVTDPRVDHQAIRESAYVNIPVIALCDTDAPLRHVDI
                     AIPGNNKGRHSIGLLWWLLCREFLRLRGIVPRTPNGWNVMVDMFFYRDPEEIEREQAE
                     AALAKQAAAASAVQESTIEQVDFAIEGAGAGGVNPSVAANLSAGGEQVDWSADAAQDW
                     AADTGAAPAATSSWD"
     gene            complement(<58112..>59512)
                     /locus_tag="MRET_3805"
                     /note="MRES_16210"
                     /db_xref="GeneID:38740571"
     mRNA            complement(<58112..>59512)
                     /locus_tag="MRET_3805"
                     /product="histone acetyltransferase HTATIP"
                     /transcript_id="XM_027630432.1"
                     /db_xref="GeneID:38740571"
     CDS             complement(58112..59512)
                     /locus_tag="MRET_3805"
                     /codon_start=1
                     /product="histone acetyltransferase HTATIP"
                     /protein_id="XP_027486403.1"
                     /db_xref="GeneID:38740571"
                     /translation="MAPRAVGKNAKAVQDVAPRKSEGGSYTLKDIMVGAKLYAEKTTP
                     ESGETEQRQVEVLSIREERQNRLHLLQEMQEKGADNVEEKEPELHFYVHYCGFNKRLD
                     EWIPSAKLVLSREMEWPPPPEAAESNKNTKRKVVKDARSTPQAEDSNVKKEQGDDTSF
                     SKEKEVEKLRTNGSMTQCASEVSRVKNLNMIQMGKHQIEVWYFSPYPSEYAYIDCLYV
                     CEMCLSYFPSDFLLKRHRQKCTMLHPPGNEIYRCEDISFFELDGRRQKTWCRNLCLLS
                     KCFLDHKTLYYDVDPFLFYVMCQRDNTGCHMIGYFSKEKESAEGYNVACILTLPQHQR
                     TGFGRLLIEFSYELSKRESKLGSPEKPLSDLGLLGYRAYWSETIVELLLKTTEEISID
                     DIANKTSIQHADILQTCQALSLLKQYQGKHYLVLSDAVLEKHERQMKKKRRRIHAEHL
                     HWKPPVFTRDQLRFGW"
     gene            <59581..>62976
                     /locus_tag="MRET_3806"
                     /note="MRES_16205"
                     /db_xref="GeneID:38740572"
     mRNA            <59581..>62976
                     /locus_tag="MRET_3806"
                     /product="splicing factor 3B subunit 1"
                     /transcript_id="XM_027630433.1"
                     /db_xref="GeneID:38740572"
     CDS             59581..62976
                     /locus_tag="MRET_3806"
                     /codon_start=1
                     /product="splicing factor 3B subunit 1"
                     /protein_id="XP_027486420.1"
                     /db_xref="GeneID:38740572"
                     /translation="MGSVDRVASRSLVATMSSEELDEIQRLRAARASGRQGIGLGSNQ
                     EDRDIYGSGASRSSYVDSLPTGPDDDDDDDEPRRSNPLDAFTAPQHLLHEFADDSYDP
                     LAERVAQRQLASRQSDYHNRRFHRDAGPESQHDPFSAESTGEEGYRDAMRRANLEREE
                     QRVRKIIEEKGEEPKPDDSTKRRRSRWDETPADEPTEKKRSRWDQTPVDGPSKPTRIR
                     YMSDEELNALLPSEGYTIVEPPPGYAPAQAHKLQEPESSGFYMPESSTLGAMADDIVA
                     DLPTDVPGVGQLAFMKPEDQKYFGKVLQEDDEEERISRAEAREREIMRLLLKIKNGTP
                     QLRKQALRQITEQARTFGPGPLFDKILPLLMERTLEDQERHLLVKVIDRVLYKLDELV
                     RPYVHRILVVIEPLLIDEDYYVRIEGREIISNLAKAAGLAHMISTMRPDIDHADEYVR
                     NTTARALAVVASALGIPAMLPFLRAVCRSKKSWQARHTGIRVVQQLAIMMGCAVLPHL
                     KGLVDCIEKGLEDDQQKVKTMTALALSALAEASAPYGIESFENVLKPLWLGIRHHRGR
                     GLAAFLKAIGFIIPLMDADSTLYFVKEVTPTLIREFQSADDEMRRIVLKVVKQCAMTE
                     GVTGAFLRNDLAPDYFRCFWVRRMALDRRNYRQVVETTQALADKMGVSEVVERLVHFL
                     KDESEPFRRMAMDTIRHVVSTLGTADIGERLEMQLVDGMIYAFQEQSDEDRVMLDGTG
                     TIAHALGMRIKPYLMQIVSTILWRLNNKNASTRQQAADLTTKLAVVLKQCGEDALLSN
                     LGVVLFEQLGEEFPEALASMITAESAIANVVGMTQMNPPVRDLLPRMTPILRNRHERV
                     QEASINLIGRIADRGAEFVSAREWMRICFELLDLLKAHKKAVRRAAINSFGYIARAIG
                     PQDVLQVLLTNLRVQERQSRVCSTVAIAIVAETCGPFTCLPAILNEYRTPELNVKHGC
                     LKALSWVFEYIGEMSKDYVYSVITLLDDALTDRDPVHRQTAASIVKHLALGTAGLGRE
                     DGMQHLFNLVWPNVFETSPHVINAVMEAIEALRVALGPGVILYHTLQGLFHPARKVRE
                     AYVRIYNTNYVGAQDALVAYYPTLQDRPEEHRDYVRHDLDMFV"
     gene            complement(<62978..>65527)
                     /locus_tag="MRET_3807"
                     /note="MRES_16200"
                     /db_xref="GeneID:38740573"
     mRNA            complement(<62978..>65527)
                     /locus_tag="MRET_3807"
                     /product="U3 small nucleolar RNA-associated protein 13"
                     /transcript_id="XM_027630434.1"
                     /db_xref="GeneID:38740573"
     CDS             complement(62978..65527)
                     /locus_tag="MRET_3807"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 13"
                     /protein_id="XP_027486425.1"
                     /db_xref="GeneID:38740573"
                     /translation="MTTTGGSSRGRLRTSFAKSEALDPFYSGGAVAVTSDAAWIAATF
                     GTDVHMVEARTSRILHKIAGDGEDIQSLTLSNDDTYLVTASRSLALHFYVLPGMEHVR
                     TISKAHEAPVALMAVDPTSSLLATGSADGSVKIWDMRGGYCTHVFRGHGGVISALCWH
                     VESPSKAGRRVQLFTGCVDGKVRVWDLHGHKKAMHAKPSAVLNAHAGVVRGISLSSDG
                     QTLVSGARDQTLVFWDARDGHWHRREIQLAHERIEALHFLPDVPYFITAGSRGALRVW
                     DTQGRVVSEQTVERVDEDDEDELRGLVDAVLASNTIVTVSATQDLAFFVWDGQLVQTR
                     QLVGYNDEIVDLALVQTHYLAVASNNSQLRIYRLDTQDRDHDVALVDGHSDMVLSIDT
                     NGEWLVSGSKDHTARIWARVHDGRHGWVCLGVCEGHAESVGCVVFSKKEDAPFVITAS
                     QDRTVKLWDLSVLTNDSRNVKLSSLLTLKIHDKDINSIDIAPNNALLVSGSQDRTAKV
                     FRLHYVPPRKNAKPTASLELLSTCRGHKRGVWSVQFSPAEQAFATASSDQTVRMWSLK
                     DFTCVRVFEGHTGSVLRLRYTPSGTQIVSSGNDGLIKIWNVRDEECAVTIDAHEDKIW
                     TLVVRDETPTTPLQIVSGAADSTMAVWNDTTEVVEAEQAAAAKDAVEREQAFTNLVLL
                     QDYRSAIALAFQMNQPRRLLQLFAQVAASRPEEDAIASMERLFQDALGTADAQSGSIT
                     GLATVDDILRDLPRSQLAQLLVYVRDWNTSARTSPIAQLVLHAIVRQWDAESILDAIE
                     DARASLQVSAVALLEGLVPYTERHYARVDRMLVESAMLEYTLQAMDTIIGE"
     gene            complement(<65738..>66292)
                     /locus_tag="MRET_3808"
                     /db_xref="GeneID:38740574"
     mRNA            complement(join(<65738..65825,65857..66121,66148..>66292))
                     /locus_tag="MRET_3808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630435.1"
                     /db_xref="GeneID:38740574"
     CDS             complement(join(65738..65825,65857..66121,66148..66292))
                     /locus_tag="MRET_3808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486312.1"
                     /db_xref="GeneID:38740574"
                     /translation="MMVSGSMRMLRAPASRSMGAVRGLHMTKVARGVQQPMSEAQTAE
                     YPREGFNSRLWTLGIAAIAGGAATNYYLKKYVKGDEEAAKPFFTDLIESCSTSTDKIR
                     EANQEHIDLSIKRAEAQLMIQDAQKPSTHRVRFPYLMEQYPRRGLQTGSVVDTSDLQV
                     NQERV"
     gene            complement(<66411..>69353)
                     /locus_tag="MRET_3809"
                     /note="MRES_16195"
                     /db_xref="GeneID:38740575"
     mRNA            complement(<66411..>69353)
                     /locus_tag="MRET_3809"
                     /product="telomerase reverse transcriptase"
                     /transcript_id="XM_027630436.1"
                     /db_xref="GeneID:38740575"
     CDS             complement(66411..69353)
                     /locus_tag="MRET_3809"
                     /codon_start=1
                     /product="telomerase reverse transcriptase"
                     /protein_id="XP_027486342.1"
                     /db_xref="GeneID:38740575"
                     /translation="MPPTGVVAKHVLPTYYAAVVSLRTYVERVCAASIPSPDLSRNLI
                     LDGLVALPCSLDEHIHQGETDTYGLEANDYMPLESVVGHVQRTLHIRRRHDMLLLGFH
                     VTPHRMVATHTNSIVHALLTDDVWNSLLFLMGTHAFVHMLCGTTYYYPMAPHRDCYSQ
                     MWGMPLTDQRPLTRGPPSVSERRVSAAHLFFRRSRLFYARPVQVYRYGIVLGLPPTHS
                     FHMHGHTHTDRRAHTARIMRDMQPHAFDLPHAWHRLPSKNENHDLPRRRWPKGLTTLA
                     HLVSRMLQKHRRCRYDVILEACCPRQHLVPTMSVPSCSPPEVLSQQTTSARPSPLEPG
                     SSSPPLLSYATPPSRVTWYVCVVLRTILPRDMVGSPHNWAVVRRTIRRFVHARRSEKI
                     SVHEALQGFRKNECAWLQEYRDPVQTHTRLCAWMWWLLDDVVLPLLRTCFYVTDSAVF
                     RRRVLYFRQDVWAQQTRPHVHALCMHLFSRVQTPMDAPIPYATMRLVPKEASVRPIVN
                     LARRPMGFGRSINAQLQGALDVLSYEAAQQSPRIFGAAMPSIHAVYARLKAYKQRFQG
                     RWPRLYMVRADIRAAFDSLDHTRLLHLVRALVPRHATYVLQRHAQIRPGIGMIRRTQV
                     RRAWPAPHPPSFLEQHAAQSAPPPRHAVLVDGVTYTTIKAEDVLARVEAHIQCTLVRI
                     GNALHRQTTGIPQGSILSTLLCNLVLADAERTYLSIDEDEDCLLRFTDDFLFVSPSYQ
                     RAYDVCQALHRGFPQHGCRIAPEKSLVNFDACLPTGHVVRRLAPHTPFPWCGICIDPT
                     TLAIQPDTQRYPRHMGDTLTVRAAGLTSMLVHAMHPRAAAVYTDTHLNTPYGVYTNLL
                     EGFVFAAAKLRVFMRHMPFAYAPPVMRAIVHAVRLTWNMIRAAIREARVTLHPHAQCH
                     IQRACVEWIGYFAFAHVLQPWPVHAPLVATLMPFVHAQRYARSRRKIGPLVLRAWTAH
                     RERIRRLT"
     gene            complement(<69452..>70048)
                     /locus_tag="MRET_3810"
                     /note="MRES_16190"
                     /db_xref="GeneID:38740576"
     mRNA            complement(join(<69452..69734,69769..69842,69870..69985,
                     70015..>70048))
                     /locus_tag="MRET_3810"
                     /product="PRA1 family protein 1"
                     /transcript_id="XM_027630437.1"
                     /db_xref="GeneID:38740576"
     CDS             complement(join(69452..69734,69769..69842,69870..69985,
                     70015..70048))
                     /locus_tag="MRET_3810"
                     /codon_start=1
                     /product="PRA1 family protein 1"
                     /protein_id="XP_027486291.1"
                     /db_xref="GeneID:38740576"
                     /translation="MASRVMDYAQQVSETLKNFRENKLSTVRPVREFFDYHRISVPRD
                     TNEAIQRITYNTRHFSGNYSLVIILLAIYSLLSDPLLLIALFILVGGFAAINRFAPEP
                     MQVGNHLVTQKSLYAILVVVVLVLLWFAQPFALIFWLVGSSALLILGHAAFIEPPVSS
                     EYAGVESV"
     gene            <70159..>71322
                     /locus_tag="MRET_3811"
                     /note="MRES_16185"
                     /db_xref="GeneID:38740577"
     mRNA            <70159..>71322
                     /locus_tag="MRET_3811"
                     /product="mitochondrial carrier protein"
                     /transcript_id="XM_027630438.1"
                     /db_xref="GeneID:38740577"
     CDS             70159..71322
                     /locus_tag="MRET_3811"
                     /codon_start=1
                     /product="mitochondrial carrier protein"
                     /protein_id="XP_027486453.1"
                     /db_xref="GeneID:38740577"
                     /translation="MSSMAGQVVWLLLVPMILAVEIAFFVGISVPVANVLTRLRANYL
                     PHAVSLDHVMEAGREPSRPSLWGLLFAWRHYENPKIGPNIRTFIPMARRVYRLEGIRG
                     LYKGTTLTLVQFLVMLVLILLLNQPSAYHPNEVRMIAVERPFRSLCTLIVSVLVLLPT
                     EVLLRRTMVHHAAVSWRHPRTALRQVLSPAEVLQPWRLYIVPGLVPLQLFRHLTASYM
                     THMVRYWTLPLLEDFVPQVSRQNKDTYEGPTSDTFRVTFWGLLLFVGWSLSVAVLLVP
                     IDCILVRLMTQYDRTTSIDASTAPASHNHQASYEQDVEDEMRATTTAEPVTSLRPCYG
                     HDQPTSTEFGASEVQPYTGAWDCACKMYDEEGQESLMRGAFYTVVGYMLMAFT"
     gene            <71448..>71780
                     /locus_tag="MRET_3812"
                     /note="MRES_16180"
                     /db_xref="GeneID:38740578"
     mRNA            <71448..>71780
                     /locus_tag="MRET_3812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630439.1"
                     /db_xref="GeneID:38740578"
     CDS             71448..71780
                     /locus_tag="MRET_3812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486290.1"
                     /db_xref="GeneID:38740578"
                     /translation="MDGESKEALVVLKYLICLLSMVLIFIRLLRIRRKRCSEALKQMS
                     FSIRPDGPASLDHVQIDIEALAPVTPAWQRPPILDNSESDHRLSRFIQGDIETTIKVV
                     CEEETGTC"
     gene            complement(<71802..>72899)
                     /locus_tag="MRET_3813"
                     /note="MRES_16175"
                     /db_xref="GeneID:38740579"
     mRNA            complement(<71802..>72899)
                     /locus_tag="MRET_3813"
                     /product="mitochondrial carrier protein"
                     /transcript_id="XM_027630440.1"
                     /db_xref="GeneID:38740579"
     CDS             complement(71802..72899)
                     /locus_tag="MRET_3813"
                     /codon_start=1
                     /product="mitochondrial carrier protein"
                     /protein_id="XP_027486289.1"
                     /db_xref="GeneID:38740579"
                     /translation="MEVHVHDVISLVALLIALLLAFFVLSALVLSVSMPILVTITCYR
                     ANYTPRAVSLSEDTPVKSPSYLASFFRQDHTRKLGPEDMRGFVATWKRICAIEGWRGL
                     FRSTHLLVCAYAVTMLLSFFVPFGIILAQALSNPSKDVSASANVGAGLMIFVSLLLFP
                     VDILIRRTIVYPRHLNWAHPCECLKHILTVQEYKQPWRLFLLPGVTSTCLARLLISLL
                     TSLVALFLAPPGRFAILTLFVSQTSDNRAVTVHGDAWQVLVRVLLSCLVWFVLLPLDN
                     IYVRAATQLSDRSYAAVHGAELVVLDKEPIVSLRPCHGNDDPAWTYFGASHVEPYTSL
                     VDVFRKIRDEEGNSSLTRGLLYTILGRLFLM"
     gene            <72960..>74066
                     /locus_tag="MRET_3814"
                     /note="MRES_16170"
                     /db_xref="GeneID:38740580"
     mRNA            join(<72960..73413,73441..>74066)
                     /locus_tag="MRET_3814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630441.1"
                     /db_xref="GeneID:38740580"
     CDS             join(72960..73413,73441..74066)
                     /locus_tag="MRET_3814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486294.1"
                     /db_xref="GeneID:38740580"
                     /translation="MRISIPSLPQTQRLLPTVTDVQEAVEQLYQLLDHDRRVLCITGA
                     GVSVGSGISSYRGPNGVYVNKGYRPVYYHEFMHQGAFGDLKRRRYWARSYLGYPSVRL
                     AQPNATHQVLAALQHTKYLDQLITQNVDRLHHVATDSIGGDTSSIHELHGSLGEVRCT
                     SRHDPPYGHDKRWWEARHTRSFGLIDRFFPTPVGSTDVHHGCGFVCSRDALQDKLTEL
                     NPDWHAWAERLEREPHLSLRRNPDGDVQLEGVAYETFQYPSCPACGGILKPDVVFFGE
                     NVRRSLRHTCERLVEEADALLLVGTTVATHSAYRLVRDAVEADKPVILLNQGQTRADA
                     IIDTRIGLDSSTVLQQLADNMALSI"
     gene            complement(<74097..>76310)
                     /locus_tag="MRET_3815"
                     /note="MRES_16165"
                     /db_xref="GeneID:38740581"
     mRNA            complement(<74097..>76310)
                     /locus_tag="MRET_3815"
                     /product="component of nuclear aminoacylation-dependent
                     tRNA export pathway"
                     /transcript_id="XM_027630442.1"
                     /db_xref="GeneID:38740581"
     CDS             complement(74097..76310)
                     /locus_tag="MRET_3815"
                     /codon_start=1
                     /product="component of nuclear aminoacylation-dependent
                     tRNA export pathway"
                     /protein_id="XP_027486293.1"
                     /db_xref="GeneID:38740581"
                     /translation="MEYFRSLSSALGKSGGPLSNYIIDEDVDSYHGQSIWTLHRGTRR
                     SDSVPVSIFSFDQTQASRDQIAMAQNAIKRLRTTRYPHILKFLDTTESQGTLYLVVER
                     VEPLIDTMALWAQGKGRGASTPAWIVWGLGHIASALAFFHQNMHAVHGNVHPGSVFLA
                     PSGEWLLGGMETLSQPSEPDALVLRLGGRSPRANVYAAPEVVQAGFGALNTRHIYATD
                     SYSLCMLAVEAFNGTLPANTSHFPAGRIPTPLYAHLKRMAQPRPDTRLSVTEFLELGR
                     LPQGFLSTNVLVQADQILEDFRVAHPVDKGSALARLVVSQEQIAPSFAQFKVLPALVE
                     TFRYKGGSKDLDLEFSASSLLPLILEIGATMDSDAWRRVLSEPILGAMASPYQPIRFV
                     LMSNVTLYAHHLDAKAVSHQLWPLVWKSFQSTQELERTAAINSIRVLLPKFSERILNN
                     ELLRELAKMQKDVRPLLRLQATQLLSEMSPRLTSRTKADVLIPAFACSLRDTFDETRL
                     AGIKAFREAADNFDAPTAACHVVPALSPCLVDANAAVRDSASEALHFYLNKISEYTQD
                     MSSHSVELPSEEPSSKDTEPTLKPEPRANKFASFLSATAGSAASRLGEWAMAQLEEDD
                     ALATQVSQSLAQPSKAAQSQASLTPDLLSPPAVPVHQASSSGMDLSANNRAEKVANTL
                     MQSQPKKAAPSLTSKPREVSPITRVNAPSKTLSKEEKMAQLHKLREERRAVRMTD"
     gene            <76355..>79454
                     /locus_tag="MRET_3816"
                     /note="MRES_16160"
                     /db_xref="GeneID:38740582"
     mRNA            join(<76355..78997,79023..>79454)
                     /locus_tag="MRET_3816"
                     /product="mediator of RNA polymerase II transcription
                     subunit 14"
                     /transcript_id="XM_027630443.1"
                     /db_xref="GeneID:38740582"
     CDS             join(76355..78997,79023..79454)
                     /locus_tag="MRET_3816"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 14"
                     /protein_id="XP_027486288.1"
                     /db_xref="GeneID:38740582"
                     /translation="MSHQNPEARVTLEQLLQELPLEDGGLVPLAVIVERITNSAYQVI
                     QSLSDTLPSLSSDAKRAKIFTAALELRRLFVKLLVIVRWTKDAKLLHRARNVVALLVE
                     QQWAHEDAFSGLTQVRKILPNARMSDADFVTAIDVLCTGTYQRLPASIKDSTVMPTPL
                     NNEEARSIMANLDRILRARLAWTESIPMKLRLQRIADGKAYMEMPGLYDMCLTVQGPE
                     KQDRWWLLDFHFADQVDEDDQESTWTEAYLDRIHEKAEAMFSSETSEDDEPALMRLHH
                     MLEQEALQRQLHIMHRQLQRMSSSNWGRHISYTLKEHVLDITYWNGHSELQGHITLQL
                     ESLPLQGPNRVLSEIMSGTNVTAKQNRIHVQWHLEDEVRAHVPRDEQTCALDRLDIEA
                     LVLLCIRRHSHALMKRFEAEIGRFEGLGAGNPGLCRLCTHKDNGYGPQYSLQLQLTET
                     VRIMLYISTISGRIGLKLLEANPNEMALSLSQSQNAALQQMADRIQTNLSCVADTIFA
                     FRMQCLTKNLQLKMAWLGLPCSASISLRSGEFSRMGLQKGHPLLYVPLGILPGYHFLL
                     YFEPKQQLGMALVLIASEMENGKITKVISSVKWLNKTHLSQFSIQDSMLVNTPADLAS
                     EPHDSYTKDRIHTEELELALHYSVATVVYSHLEEQLRLKLVPFVLLDGTSHATTPPTG
                     KSPDPLLPSLCVQACKLLTSYQDLIKPNMSLQLCEWWLPLRRRVVMHFKVNLKEYYDM
                     ESLQLSDRLNFDPRSGVFTFTCYEVTACLTKFQQIWQQVARFCLLLNTLSSWNASNFF
                     LTLQSLSWQQVNITYGEKEHDHPYFLRVKFNMVEPLEQPRYILECGVQHSAMSNPHQY
                     ILRILERSLNVLTSDAENIWFTMFQTLASTLPILSQLHDLIQNAVVSADCPDVQIMDA
                     QWYRVRFYEVHALDLRVMPDNRLLMTDTCENSASKKTKDITEASSSSLLRPLPNLASL
                     WNEIVTETATHGTSRASNHDRTSNPNMVTVSLLPNQENIHTLIKNIQEEINL"
     gene            complement(<79510..>80437)
                     /locus_tag="MRET_3817"
                     /db_xref="GeneID:38740583"
     mRNA            complement(join(<79510..79593,79626..79659,79693..79713,
                     79754..79852,79899..80009,80082..80326,80363..>80437))
                     /locus_tag="MRET_3817"
                     /product="maltose acetyltransferase"
                     /transcript_id="XM_027630444.1"
                     /db_xref="GeneID:38740583"
     CDS             complement(join(79510..79593,79626..79659,79693..79713,
                     79754..79852,79899..80009,80082..80326,80363..80437))
                     /locus_tag="MRET_3817"
                     /codon_start=1
                     /product="maltose acetyltransferase"
                     /protein_id="XP_027486287.1"
                     /db_xref="GeneID:38740583"
                     /translation="MTEAIYAEIDKKYADIASTLSEKDKMVLGLAYCPLDGELTRDRI
                     RVRKLYRKYNLSAPATMSMDPSDEGDDDSDDIMGVQRRELLAQIFGLDDEQKHRIEIE
                     PPFYLDYGYNVKFEGAFYANSNATILDCAEVTFGHGVLLGPGVHIYAATHSVNARERD
                     AVLERALPVKIGKNCWIGGNTTIVAGVNIGENTTIGAGSAVTKNIPKNCVAVGCPAKV
                     IKYI"
     gene            complement(<80534..>82909)
                     /locus_tag="MRET_3818"
                     /note="MRES_16155"
                     /db_xref="GeneID:38740584"
     mRNA            complement(<80534..>82909)
                     /locus_tag="MRET_3818"
                     /product="N-terminal acetyltransferase B complex
                     non-catalytic subunit"
                     /transcript_id="XM_027630445.1"
                     /db_xref="GeneID:38740584"
     CDS             complement(80534..82909)
                     /locus_tag="MRET_3818"
                     /codon_start=1
                     /product="N-terminal acetyltransferase B complex
                     non-catalytic subunit"
                     /protein_id="XP_027486298.1"
                     /db_xref="GeneID:38740584"
                     /translation="MAAKGNVFDQYKCIEVYDALDSGQYGVAVNKADALLASGPFPLA
                     RALKTVALFRQHRHDEAEREVDQLLGGSVDLNVLSPLGFVLPRMGKAKQLADLYMAAS
                     QAHPQDEELADGALLVLIKAGMFQRALQLILKRFRTSKDPRDFWRYVQVAVLHAQHVK
                     PPSSKLTLDVALRLIKEQKLNEHSFTPETLSLYLHFFSILDHTQLREALDLLTKPPIQ
                     DMVDKNLGIQFQVRECWKALEDQDSLLNDCRTRIQSGDRNWAVISQFVSSSVARGSLA
                     EEDVTLLLHAAAQDEWRDRGSFLGVLELCRLALDAKQSLPDGVDYAKLVTNYVERFAS
                     KLTCFDDIRPHLAVLHKTPDVPHQPLTSETSITQRINAEKIALFFEQGASADDLLQAY
                     IESLEHVHEPSTEMQPGDDLALLAAYVTLGKSSSVENLIQAAAIASYACEKSVRAYKL
                     RLLLIRLLLRLGCLKLAVYHFDALELKAVQLDTMPHYLLDRNASFGGSHAADVGNHWE
                     GGIKDFYELSAFEVPEALGRAFLNGKFSQVSDLCDFYDCVEGSYARLILLVDMLCSKF
                     VTQDLVDSERDHAVKLLQYIFDMIQADRLSDQRDTHLLPWINETQKTHLESVLSCGPL
                     RKKQWLKAMLEILSVALPTPSAPTDISSDVLTGPEGALLDLARALREGTNLAAPSFFE
                     QMHTYASQATAPFEMLHAAWTGIMGLRLLEAVGEGTNKDIKDLLGPVAGSALSNIHDL
                     LIKEMDKNIHVNLTERLGASGLAFIQDVDSGRKDALKDALRPYQAVLRTIA"
     gene            <82949..>84070
                     /locus_tag="MRET_3819"
                     /note="MRES_16150"
                     /db_xref="GeneID:38740585"
     mRNA            <82949..>84070
                     /locus_tag="MRET_3819"
                     /product="crossover junction endonuclease EME1"
                     /transcript_id="XM_027630446.1"
                     /db_xref="GeneID:38740585"
     CDS             82949..84070
                     /locus_tag="MRET_3819"
                     /codon_start=1
                     /product="crossover junction endonuclease EME1"
                     /protein_id="XP_027486297.1"
                     /db_xref="GeneID:38740585"
                     /translation="MSQSDASLVTLSSPPRLVDIQSSPTLEARTARRAAGPLDPLFFS
                     SSPTPPPPPKRRPVKRAPTEHQRWREANRVRRRRADTMRDLIVHMDTGLAEELWSDIY
                     VQIRARLQDDEATLRLVPRTAPMSRLVFERKVRSTYDPIQQLWEPLADEQIVREPTLV
                     FVAAARHILDSTNDEVLAQMDECEQRILLIMGLESLLRQVRTRQNRDYAHSIRQRMQG
                     HASDVQMPNDDTRERIERRLLQLQLEHQCHIVRLEKQEEAVEWVHALASDISIRPYKR
                     IQSEAPPRRVAKAADDGLPAYRAMLEEIPRCTSQASAVISAQYPSLASLVQALQRDGP
                     DVLADLVSDGGRPTRRLGPQLSRRIHAAFTSRDPKASAE"
     gene            complement(<84025..>85698)
                     /locus_tag="MRET_3820"
                     /note="MRES_16145"
                     /db_xref="GeneID:38740586"
     mRNA            complement(<84025..>85698)
                     /locus_tag="MRET_3820"
                     /product="phosphatidylinositol glycan, class B"
                     /transcript_id="XM_027630447.1"
                     /db_xref="GeneID:38740586"
     CDS             complement(84025..85698)
                     /locus_tag="MRET_3820"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class B"
                     /protein_id="XP_027486299.1"
                     /db_xref="GeneID:38740586"
                     /translation="MVGAALGAVHAVGALLTSRTFFQPDEYWQSLEIAHRIVFGYGYR
                     TWEWTTDPPLRSIVHPALFVPLYKLLDITGTSAYALATAPAMQQALVSALGDWFAYRL
                     IARTAGRSVALVWCVLHLGSVYWLYTASRPFSNTMEAALCCIALYYWPLSRACVLHVS
                     RTRHTYRIALLAAWAAVLVRPTSVILWSFLGLQVLYDAWNTACCGRLLFEAVWIGAAV
                     LAVGAGLDTLYYGTWTWTPLAFVHTNLVRGLSSFYGMNAWHWYVSVGLPSILTVYTPY
                     AFLGWWRHGTRHPALRRLFGACVGTICVYSCLQHKEVRFLQPLVPWLHLAAALALRSA
                     SSRPIVSLRHAYAALPRWTRIWLLIQVPVLVYVCAFHARAQVQVVSYLHTLSRSTSPP
                     HSVGFLMPCHSTPWQSHMHTPHFEAAGDSGDTGLAWFLACPPPPATAAAPYWDQSDYF
                     FHDPVTYLRTRFPPTVDPTFPPMSRTSFASRVGHDLGWRHPWPSHLVVFSSLLANTSV
                     SDLFYAQGYRPTKRFWNSLFHPDTHRRGDVVVLTHYSADALGSRDVNAA"
     gene            <85824..>87263
                     /locus_tag="MRET_3821"
                     /note="MRES_16140"
                     /db_xref="GeneID:38740587"
     mRNA            <85824..>87263
                     /locus_tag="MRET_3821"
                     /product="mitogen-activated protein kinase kinase"
                     /transcript_id="XM_027630448.1"
                     /db_xref="GeneID:38740587"
     CDS             85824..87263
                     /locus_tag="MRET_3821"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase"
                     /protein_id="XP_027486426.1"
                     /db_xref="GeneID:38740587"
                     /translation="MGEDPAAAHPGGPNAPRKSSIPAGGFAGINARTREMAAAKLPPR
                     LQAKLSENARISALTSGPPSSTMKHDEKLDSSLLMPKMPSTAPRPRPRPNLRLSDMGS
                     EASASGQRRRPDLTLGGLPSKAPTPFGSFSKIVDPSGRLVFDGKAVLHASGVEFKNGT
                     TFTIHMDDLEMLEQLGHGNYGTVTKVRHTRTGVEMAMKEIRLELDEAKLNAIIMELDI
                     LHRALAPQIVEFYGAFFVESCVYYCMEYMDIGSLEKLTTGRHCVVPEDVLAQITLSTV
                     RGLRFLKDELQIIHRDVKPTNILINSLGEVKLCDFGVSGQLEKSLAKTNIGCQSYMAP
                     ERIRADRMRSTYTVASDIWSLGISIVEIAMGTYPYPPETFTNVFAQLQAIVEGDAPQL
                     PTPSAEPITVTRPNGTTLELERGTCTYSDTARDFVAQCLCKIPERRPTYARLLEHPFL
                     THAPTVDMATWAAQALASRRRVDEDVSVS"
     gene            complement(<87287..>88612)
                     /locus_tag="MRET_3822"
                     /note="MRES_16135"
                     /db_xref="GeneID:38740588"
     mRNA            complement(<87287..>88612)
                     /locus_tag="MRET_3822"
                     /product="autophagy-related protein 13"
                     /transcript_id="XM_027630449.1"
                     /db_xref="GeneID:38740588"
     CDS             complement(87287..88612)
                     /locus_tag="MRET_3822"
                     /codon_start=1
                     /product="autophagy-related protein 13"
                     /protein_id="XP_027486200.1"
                     /db_xref="GeneID:38740588"
                     /translation="MPTAQEAVEQEAPARIDAVLYQFYAKTVAVVCDSRGQADGDAPR
                     NKWFALELGASEAYRAPLRPWRALASARMPVVVPTLVVSVRVRCLDAAYDVYAHVPHR
                     TRLEPGVAVLLEQWRVDVRADDAPAQRLPTIYKQAVVHFRTMYAMAHTLPLSRVCQQL
                     DHHALAVDVSIDAAPTPLDLPAKTWHMAPISTPIGSLQCRVDAATVHALSLERRERLS
                     PSYGHAPPLSIDVAPSTPRASVASVPGCEPGALRSLFTSSARMSSSPSSLARTPPSDA
                     YMRAESPTEGAARPQRIPRYATQPSSYRHRHSPSLEDSSARSAGLRIGPRRPAATAGR
                     DSLSSSSPTAPSRVFGGRSPTAAFAVPRHRRMSTPHDALDLVAMIDARQHRESLDDDA
                     ASRPWGADVYDDLLGQMTRSLHLHALDEVFGPPPTQRRGVPIRETEPRH"
     gene            <88712..>89923
                     /locus_tag="MRET_3823"
                     /note="MRES_16130"
                     /db_xref="GeneID:38740589"
     mRNA            <88712..>89923
                     /locus_tag="MRET_3823"
                     /product="peroxin-16"
                     /transcript_id="XM_027630450.1"
                     /db_xref="GeneID:38740589"
     CDS             88712..89923
                     /locus_tag="MRET_3823"
                     /codon_start=1
                     /product="peroxin-16"
                     /protein_id="XP_027486292.1"
                     /db_xref="GeneID:38740589"
                     /translation="MSAARRPQRGAYESFLLQHVSQVTALESSLRSMTYILPGRFKDA
                     ELAGEVIYALVHLLGLYHDSVLFRIVYARHRDRDQEALASALASANVPKISPHARYTS
                     FWRTTQPRYALAAAALATTEAVQLLAEMLARRRLGERRAWDVVLAIEALKAACRFTLV
                     RASQNRPVITPPLPQREFDPAQLEQPAPSTMPLTWRGTRTHCLRRSLASVGSRDVYEH
                     LLSRTLTEQDVSPPPLLVRPLTQPAARIAEAVWILRPLLYVALLRTYGRRDLRPFATS
                     LLVECLARTLRQHTRVQHSKSPSPPSISLWLSVLGMENSFLDWLASGLSTQSAAQRPV
                     STVEGDEWIARNRSLWWYLLRGPVWYGWTRPKLASFVARTEHRRLLGLLGSIIREYLP
                     LIDDYYYYSAM"
     gene            complement(<89889..>90797)
                     /locus_tag="MRET_3824"
                     /db_xref="GeneID:38740590"
     mRNA            complement(<89889..>90797)
                     /locus_tag="MRET_3824"
                     /product="methyltransferase"
                     /transcript_id="XM_027630451.1"
                     /db_xref="GeneID:38740590"
     CDS             complement(89889..90797)
                     /locus_tag="MRET_3824"
                     /codon_start=1
                     /product="methyltransferase"
                     /protein_id="XP_027486475.1"
                     /db_xref="GeneID:38740590"
                     /translation="MRQGAVRGAASPYAVALRALLSHRRDAEACRQEARWLVDEVRAR
                     HGLSSAWVTWPAPARQTLLSLARRAARDEPLSYVIGHQPFGPLSLLTRPPILIPRCET
                     EAWTYQLLSLVRARFADDGPRPRRILDLCTGSGCIAVALAHGLQAYDVDVVGVDSDER
                     AVRLARENAERHDLKRVTFVHGDVWDDACLSRLGAFDLVTCNPPYIAEAAWAGLDASV
                     REHESYAALVGAAQDGYAYYRRLRSVSLWTASPMAPSLVMEVGAGQAGRVAELFAPWP
                     VDVWKDDAGWDRVVAVTWPSSSSSRR"
     gene            complement(<90831..>92972)
                     /locus_tag="MRET_3825"
                     /note="MRES_16125"
                     /db_xref="GeneID:38740591"
     mRNA            complement(<90831..>92972)
                     /locus_tag="MRET_3825"
                     /product="lanosterol synthase"
                     /transcript_id="XM_027630452.1"
                     /db_xref="GeneID:38740591"
     CDS             complement(90831..92972)
                     /locus_tag="MRET_3825"
                     /codon_start=1
                     /product="lanosterol synthase"
                     /protein_id="XP_027486203.1"
                     /db_xref="GeneID:38740591"
                     /translation="MTDVTGPPLGQTDLHRWRLRVSDVGRHVWHYLETDAEVEAWPQT
                     PMDRYWLGLPVGAETYPEAAATPLEAARRGLAFYRHLQADDGHFPGEYGGPMFLLPGL
                     IIGMYVTQTPIPAAWRVEIARYLWHRRHPDDGGWGIHIEGHSTVFGTALNYVVLRIVG
                     VPPDHPMMVQARTTLWRLGGATGLPSWGKLWLALLNVYDWEGVHPIPPELWLLPDAVP
                     IHPWRWWVHTRMVYLPMGYLYGQRFRAEETELVKALRAELYPTPYDEIHWPAQRNHVA
                     AADLYAPHTRVLDALFCVLGQYERVHIGALREAGMRRAYELIVKEDINTSYQCLGPVN
                     KMLNYIVRWIVDGPASEAMARHREKLRDFVWMSADGLMMTGTNGSQLWDTSFIAQAMC
                     DAGLARDHRDMCQSILAWLDATQIRENPTFYRSAYRFATKGAWPFSTREQGYTVSDCT
                     AEGLKGVLMLQEASGADLGRPVSQQRLRDAVDLLLSMQNPGGGYASYETINGPSVLEW
                     LNPAEVFGNIMVEHAYPECTTSVVSGLRMFQRYDSYRSADIDAAVDAAVGYILRAQRA
                     DGSWYGSWAICFTYAAMFALESLRHAGHTHANSEAVRRACAFLLGHQREDGGWGESYK
                     SCETHAYVQSRSQVVQTSWAVLALMHADYPDATPIRRGIALIMSRQQPDGSWAQEQIE
                     GIFNHNCAISYPHYKFAFTIWALGKAAGRVG"
     gene            <93046..>93334
                     /locus_tag="MRET_3826"
                     /db_xref="GeneID:38740592"
     mRNA            join(<93046..93048,93073..93182,93208..93242,
                     93270..>93334)
                     /locus_tag="MRET_3826"
                     /product="transmembrane protein 167"
                     /transcript_id="XM_027630453.1"
                     /db_xref="GeneID:38740592"
     CDS             join(93046..93048,93073..93182,93208..93242,93270..93334)
                     /locus_tag="MRET_3826"
                     /codon_start=1
                     /product="transmembrane protein 167"
                     /protein_id="XP_027486201.1"
                     /db_xref="GeneID:38740592"
                     /translation="MTALFHFQSLLLVVLLVICTCTYIRATAPALVDRNRKGMLGVFF
                     KAARIGERLSPYCSLACVAMAVYIVT"
     gene            <93365..>94108
                     /locus_tag="MRET_3827"
                     /note="MRES_16120"
                     /db_xref="GeneID:38740593"
     mRNA            <93365..>94108
                     /locus_tag="MRET_3827"
                     /product="26S proteasome non-ATPase regulatory subunit 10"
                     /transcript_id="XM_027630454.1"
                     /db_xref="GeneID:38740593"
     CDS             93365..94108
                     /locus_tag="MRET_3827"
                     /codon_start=1
                     /product="26S proteasome non-ATPase regulatory subunit 10"
                     /protein_id="XP_027486202.1"
                     /db_xref="GeneID:38740593"
                     /translation="MAQLPALHKACLDGSLEGVRAALAQPDAPQVLQTPDADGRTPLH
                     WAASSDAKHALIEALHAAGPLDVNARDASLWTPLMIASSAGALRVVQWLLAQGADVHA
                     GNAKRITALHYACSKNHIDIVRELLEAGADVNAIDGAQQRPIHRAASAGHSAVVQVLL
                     APPPRNDGTPHPKTRVNPADRLGNTPLHLAVDSAHAQTAALLIDVGGADRWRQNADGL
                     VPEQLEGVGGLEQKRVRDMLVQSFGPLGI"
     gene            complement(<94109..>94816)
                     /locus_tag="MRET_3828"
                     /note="MRES_16115"
                     /db_xref="GeneID:38740594"
     mRNA            complement(<94109..>94816)
                     /locus_tag="MRET_3828"
                     /product="transcription initiation factor TFIID subunit
                     11"
                     /transcript_id="XM_027630455.1"
                     /db_xref="GeneID:38740594"
     CDS             complement(94109..94816)
                     /locus_tag="MRET_3828"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     11"
                     /protein_id="XP_027486272.1"
                     /db_xref="GeneID:38740594"
                     /translation="MDDTPTSRKRGRKSEAPPTPVDVLDEVDDELVGWPAKRGKKRKN
                     DSGARERSSSVRGASADRRSASRVPDSADDARHESDDNDDDASEDESDVAEGDALADD
                     EFSRQQTIYAAQQRSMGLLSHLMDEDQLERHMASRRGSLNKGSVRKLVNHVLSQTVNQ
                     HIVMAVSGVGKVFVGEMVELARTVQRERHESGPILPLHLYEAYRRYKNAQERPGRFPP
                     GLSSGGAGLGRRRRLFS"
     gene            <94902..>97193
                     /locus_tag="MRET_3829"
                     /note="MRES_16110"
                     /db_xref="GeneID:38740595"
     mRNA            <94902..>97193
                     /locus_tag="MRET_3829"
                     /product="saccharopine dehydrogenase"
                     /transcript_id="XM_027630456.1"
                     /db_xref="GeneID:38740595"
     CDS             94902..97193
                     /locus_tag="MRET_3829"
                     /codon_start=1
                     /product="saccharopine dehydrogenase"
                     /protein_id="XP_027486273.1"
                     /db_xref="GeneID:38740595"
                     /translation="MSSNVVLTHPLIRDGWFREESPQWPGQAMSLRVRRILHHEKSLF
                     QDVLVFESETYGNVLVLDGAIQCTERDEFSYQEMIAHLPINSHPNPRRVLVIGGGDGG
                     VLREIVKHDMVEEAVLCDIDEAVPRVSKQYLPRMAEGLSHPKSRVIIGDGFAFLKDPQ
                     NQGSFDVIITDSSDPDGPAEVLFQKPYFELLKGALRPGGHISTQAESMWLHLQLIRSL
                     TQSTKELFPVADYAYTMIPTYPCGQIGFVVCSLDPERNVREPLRTVPHCSYYNNDIHR
                     AAFVLPQFAHRVIMDGEPAPAPVVATGDVKRRRTDASKPKSVLVLGSGYVAAPVIEYL
                     LRFPELSVTIGSARHAAKLGAQFPKARTVQVDVQDAQALSAAIQPHDLVISLIPYTHH
                     AAVIRAACQHKVDVVTTSYVSDAIRALEPEIQAAGITVMNEIGLDPGLDHLYAVKAIA
                     DIHQAGGQVQSFRSFCGGLPAPEAATNPLGYKFSWSSRGVLLALRNTAKFVRDHAVQT
                     VSGLDLMATAQPYHILPSLALVAYANRDSTPFREWYGIPEAAECIRGTLRYQGFPELV
                     LALVRLGFLDETSQDWLAAPGLTWSQLAARLVGTQADEASLRRGIEERTGASELVIEG
                     LRWLGLFSDDAVTVGGLPEQLAAKSGNLLDTLCVRLEGKCAYAPGERDMVLLQHRFGV
                     VTKDGAHKTLTSTLLDYGVPNGTTAMARLVGLPCAIAARLVLERHPALKKTGIIVPYS
                     LDVAEPIRLELVQEGVALEEQWL"
     gene            <97302..>98651
                     /locus_tag="MRET_3830"
                     /note="MRES_16105"
                     /db_xref="GeneID:38740596"
     mRNA            <97302..>98651
                     /locus_tag="MRET_3830"
                     /product="tubulin beta"
                     /transcript_id="XM_027630457.1"
                     /db_xref="GeneID:38740596"
     CDS             97302..98651
                     /locus_tag="MRET_3830"
                     /codon_start=1
                     /product="tubulin beta"
                     /protein_id="XP_027486338.1"
                     /db_xref="GeneID:38740596"
                     /translation="MREIVHLQTGQCGNQVGTKFWEVLSDEHGLDGSGNYVGTSPLQL
                     ERINVYYNEAADNKYVPRAVLVDLEPGTMDSIRSSALGNMFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDSVMDVVRKEAENCDMLQGFQITHSLGGGTGAGMGTLLISKIREEYP
                     DRMMATFSVMPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICFRTLKLK
                     TPNYDDLNQLVSLVMSGITTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTAQ
                     GSQQYRAATVSELTSQMFDAKNMMAASDPRMGRYLTVAAYFRGKLSMKEVEDQMQAVQ
                     MKNSSYFVEWIPNNVQTAHCDIAPRDLKMSVTFIGNNTAIQELFKRVSAQFQAMFRRK
                     AFLHWYTGEGMDEMEFTEAESNLADLISEYQQYQEATADDDLEEYDGYDGEEYEEDM"
     gene            <98767..>101493
                     /locus_tag="MRET_3831"
                     /note="MRES_16100"
                     /db_xref="GeneID:38740597"
     mRNA            <98767..>101493
                     /locus_tag="MRET_3831"
                     /product="filamentation protein (Rhf1)"
                     /transcript_id="XM_027630458.1"
                     /db_xref="GeneID:38740597"
     CDS             98767..101493
                     /locus_tag="MRET_3831"
                     /codon_start=1
                     /product="filamentation protein (Rhf1)"
                     /protein_id="XP_027486336.1"
                     /db_xref="GeneID:38740597"
                     /translation="MWKPNRGAHAARELQMARLRGIAPGSQQSAHDVADAIAAFRQHV
                     PAQTLTAQLATLELELHSAILSHLASVGYRDASHANDAPGRAVFPPTMDDDERVRRIV
                     HDLERLAPSTASDPVNATVCVALCELGYFVLGNDSMVIQLTERTELLNADPFGATPLN
                     EHHVAVAILGATVYGMANERAGETDDALFAYERAHELHERARAHTTHQTPLVDEMERW
                     TETALYRYALLLLHARSPKAQHALQRYEAHASRWPATFRQPQRRVIQACLAPAPAAAA
                     PVAPAAQPPATPEATRSSASVAPATTSPRRPLPLPAPMASYASIQARAVRLLQQPPGF
                     PRADESNAHVDTLCEQLVSSWRAEHASHGTKEADDVVLLLYGLAGLSFHSHTVTRLLI
                     HMLHAAEAYAEAYELVPKYIALVHTAWTAQGVPPHRDTQGLRAIDGPSEYVDTVLLGA
                     HIATHYIHAPAQAHEWTDDLLLIGTTDKSPEHRFTMPTPMLARVLRCAGEARLAQARA
                     ATPSERATLLDDARVFLRNAVTLDDDASESHYALACLLATQRDTDTALPHARRAIELE
                     PAFVDAWHLTVLLLSARKDVAGARSLAAEALTQIEADDEQPPLRTFLASFDTPPSPFA
                     RACAYMQLLITHNALVELTHGVQLALYGQRDLFSAYHARVAPLSTPHAPAEQAPRFTT
                     PGPEVAASTLEARRTFRAREATRLLQRLWLVSAASFRRADNLEQARCAIAEAEQLDAR
                     CADVWVQLAQWCLAAGQRTGAAITCLHKALACDTYHTAARVHLARVLLHEPEHEADAS
                     IRSPREAEDHARSTPSRSLGSTAHSLQDVEPSFRTPDASSTSSTSTAEALLRTVTQSH
                     GYDVPEAWHALAQLAKQTSRPTDTQRRALLEALRLEASRPIRAWHEALALRM"
     gene            <101560..>103908
                     /locus_tag="MRET_3832"
                     /db_xref="GeneID:38740598"
     mRNA            <101560..>103908
                     /locus_tag="MRET_3832"
                     /product="carbon catabolite-derepressing protein kinase"
                     /transcript_id="XM_027630459.1"
                     /db_xref="GeneID:38740598"
     CDS             101560..103908
                     /locus_tag="MRET_3832"
                     /codon_start=1
                     /product="carbon catabolite-derepressing protein kinase"
                     /protein_id="XP_027486376.1"
                     /db_xref="GeneID:38740598"
                     /translation="MSVDRGAKEHRHARRENKHHHAAATRSGKETRMIGLYVLHQTLG
                     SGTFGKVKLATHALTGHRVAVKIINKHKISSMDIGGRIKREIQFLRMLRHPHIIKLYE
                     VIATPSDIIMVLEYAGGELFQYIVDHGRLPESEARRFFQQIITATNYCHKHKVAHRDL
                     KPENLLLDEFLNIKVGDFGLSNLMGDGDFLKTSCGSPNYAAPEVIAGRLYSGPEVDVW
                     SCGVILYVMLCGRLPFDDDYVPSLFVKISKGIYSLPSHLSPEAKDLLSSMLVVDPVKR
                     ITIPDIMQLPWFNVDLPAYLRPYPLTPSVEDKQFVLHRAPVMDDTLGTEHIEAAASQH
                     GEPPPDPSMISPDLGVIDPLILQELLGKVEGISRNRVLEMLRAPNTNQIKVAYHLCRD
                     YHCTLNMMSDMLSDMDDEPAPSTSSSSPGGPPSEAPPPSLRPMQRRPSLRPALAPGTS
                     PMHYNVLIKRSGATTDLMHAKEPRSRRPSAASRRPIDEDTKARVNELMAAVEDEAIEG
                     SDAEFPIFDDESDDDDDESDALSHMSDSDEEYASFDMIDDTAVDDVGREPLHETYMRR
                     SNHLAVLQSSLSPSQRSLYQTSHSGSSTPNHRLSSTPSSVSTSASVSLATSRDGTPHP
                     SHSKPVSRRSRTPWHFGIRSRSSPMEIMLVLYRTMESLGMQWCPKAPLPSMSRDLDDM
                     SAKERQDVLSALNEDIFYVQTQCILCHHKVCMDLQLYRVADQSYLVDFRNVGYALASP
                     TCPKGSSSISSSSVALRRDTPSPFLFFDAVFRLIVALAGGGS"
     gene            <103979..>105211
                     /locus_tag="MRET_3833"
                     /note="MRES_16095"
                     /db_xref="GeneID:38740599"
     mRNA            <103979..>105211
                     /locus_tag="MRET_3833"
                     /product="Ca2+:H+ antiporter"
                     /transcript_id="XM_027630460.1"
                     /db_xref="GeneID:38740599"
     CDS             103979..105211
                     /locus_tag="MRET_3833"
                     /codon_start=1
                     /product="Ca2+:H+ antiporter"
                     /protein_id="XP_027486339.1"
                     /db_xref="GeneID:38740599"
                     /translation="MSESQPLLHPRDTHPKTLLSSFRWLILSSAANWLLLFVPLGMAA
                     QWFHWGSLAVFTLNFLAIVPLAKLLGDATEQVSMPLGPALGGLLNATFGNAVELIVGV
                     VALLQGQLRVVQMSLVGSILSNLLLVLGLSFFVGGIYQPENTFAQTAAQASGSIMTLG
                     CFTMVLPAAYWGSVKNGNTDKDIFSTAFSSLGASRAPLEKPAPGTFDALGGILFISRG
                     TAVILLLIYVGYLFFQLRTHSFLYESPTREQDEQEEQPDMSPQASILALLIITLITSV
                     NADYLVSAIDDVANNYGISKVFISTILLPIVGNAAEHVTSVWMAAKDKMEIVLGVSVG
                     SSVQICLGLVPVLVLVGWAVGQPLTLYFHDFETINLVVSVLLVNSLIQDGKSNYLEGA
                     LLVALYLVISLSFWVSPS"
     gene            complement(<105260..>106546)
                     /locus_tag="MRET_3834"
                     /note="MRES_16090"
                     /db_xref="GeneID:38740600"
     mRNA            complement(<105260..>106546)
                     /locus_tag="MRET_3834"
                     /product="epsin"
                     /transcript_id="XM_027630461.1"
                     /db_xref="GeneID:38740600"
     CDS             complement(105260..106546)
                     /locus_tag="MRET_3834"
                     /codon_start=1
                     /product="epsin"
                     /protein_id="XP_027486384.1"
                     /db_xref="GeneID:38740600"
                     /translation="MSLQNISKSAVRIGKNYIKGYTDTQIKVREATSNDPWGPSGAQL
                     NELSQLSHNPTDFIEMMEILDKRLNDKGKNWRHVFKALSVLDYLLTSGSENVWNYFHD
                     NIYIVKTLKEFQYVDDANIDQGINVRQKAKDITALLLDDSRMRHRRRMRMEEETRFRA
                     AGDYTDDAGRRRRQREQERMSAEDRELEQALAESRRMAQEEEERRRREAEDESNLQQA
                     LRASREEEEKRKQNETLIDLDKEESASLQPQYTSFIPFQATGFNPFFQAQMQQQEMLQ
                     QQYLQQQEYQRQLALQQAAQQYQYMMTQQPAMMMPQPTSFGSNNPWLSPSAPAPAPAP
                     EPASQKTDTLINLDGSEEEGPEDPEPMPKPKPQGPPRAKVTNMNPELNRLLASGDGVD
                     TFGNTGDMRLGPNAAMWHQAMQQQRTGQAGSNPFAK"
     gene            complement(<106745..>108202)
                     /locus_tag="MRET_3835"
                     /note="MRES_16085"
                     /db_xref="GeneID:38740601"
     mRNA            complement(<106745..>108202)
                     /locus_tag="MRET_3835"
                     /product="ammonium transporter, Amt family"
                     /transcript_id="XM_027630462.1"
                     /db_xref="GeneID:38740601"
     CDS             complement(106745..108202)
                     /locus_tag="MRET_3835"
                     /codon_start=1
                     /product="ammonium transporter, Amt family"
                     /protein_id="XP_027486230.1"
                     /db_xref="GeneID:38740601"
                     /translation="MVEFHTTAEHNIQWATSDGRAIVYNLGDMAWVLTSTCLVFIMIP
                     GVALLYSGLLRQRNAFTDIAMSVMVLAVASIEWFFWGYSLAFSPTSSKFIGNLYHFGL
                     MHVDMQALPGVANIPVLLYALYQLMFAALTPVIACGAFAGRARVGPVLLFTFCWCTIV
                     YNPIACWTWNSNGWSYMMGGLDYAGGTPVHISSGTAALVISLYLGYKYGSRSMELPAR
                     PHNTTCIILGTVFIWFGWFGFNGGSGAGANLRSAQAMMVTHIAACAGGITLLVLDYRF
                     DRKWSVISFCSGAMAGLVAVTPASGYVGTPSALVFGVVGSVASHLATPMKDVLGYDIF
                     VVHGLGGMVGNVLTALFADGRIATFDGTSPTESTGWINHHWVQLGYQLADSCAGFAWT
                     FVMTLILMMVIDHVPYCAFQCDEDISMVSDLPQSLEHGLSSSQDMDKAPAAVMPLERG
                     VADLETGAGPSGMETMDDRESITEKGVVTNTTLSS"
     gene            <108458..>110353
                     /locus_tag="MRET_3836"
                     /note="MRES_16080"
                     /db_xref="GeneID:38740602"
     mRNA            <108458..>110353
                     /locus_tag="MRET_3836"
                     /product="tRNA pseudouridine13 synthase"
                     /transcript_id="XM_027630463.1"
                     /db_xref="GeneID:38740602"
     CDS             108458..110353
                     /locus_tag="MRET_3836"
                     /codon_start=1
                     /product="tRNA pseudouridine13 synthase"
                     /protein_id="XP_027486341.1"
                     /db_xref="GeneID:38740602"
                     /translation="MSSADKSEHPSKRQRTEPSGHTYESDVGLLAYVHPGWRPVHAII
                     KQRYADFIVHELAADGRMVSITSLDPPPVWESKKPQGSWDDLRDFFGDRLPDVQAGCL
                     QGPVDSCALTDKSHRTHIHRLLRALTGDRLISETIQVPEGSAVRVQQNTSRRSSRDDP
                     DSESAAAPPYIHFTLQKTNRDSQEALQWLARFLKLDHRGRASSVNALSVAGTKDKRAV
                     TVQRVALQRGRRTLREVWDRVNHIGQPISSDPGQKQRRTVHDAVTTRAERGLRIAHLS
                     YADAPLQFGMLRGNHFTITLRDVRWTDTATPSDDIQRILGEHVRDLEAHGFINYFGMQ
                     RFGTGLVSTHQVGIAVLRKDFREALRLVLEAGALHGDADEEDAPPAVLATRQAQAAVA
                     EKQYEDAYRLMPKKGVAERAVLEKMKMPGWSPNDALGPFQNIPRSLRLMYVHAYQSYL
                     WNRLVSERVARFGALSPVVGDLVQHSDDSIHVLDAETVSQHSMDDVVMPMPGADVHLP
                     QDGWLEQLYKDMLQQDGLTPDSLSSSHQPEYRLKGAYRRLIHKPRNLRCEFLTYADAN
                     APLCATDEEALLGVAIPTQSEAPYLAMKLSFELPPSSYATVMLREILRTDTSAHVHKE
                     LTKQSTA"
     gene            complement(<110350..>111096)
                     /locus_tag="MRET_3837"
                     /note="MRES_16075"
                     /db_xref="GeneID:38740603"
     mRNA            complement(<110350..>111096)
                     /locus_tag="MRET_3837"
                     /product="Ras-related protein Rab-18"
                     /transcript_id="XM_027630464.1"
                     /db_xref="GeneID:38740603"
     CDS             complement(110350..111096)
                     /locus_tag="MRET_3837"
                     /codon_start=1
                     /product="Ras-related protein Rab-18"
                     /protein_id="XP_027486231.1"
                     /db_xref="GeneID:38740603"
                     /translation="MAMVQGAERIATWLFPSTTTDRPMGEPTTTAELPTLKLLLIGSS
                     GVGKSAFVRRYTDDLFVEDDAAATIGVDYKLKSVCVDGKWFKLSIWDTAGQERYRTLT
                     SSYYRGAQGVVLMYDITDLRTFEDVSEWIRELRMFQGDVPPVCLLVGNKTDVDEERQV
                     TTEQGRDYADEKGMLFMECSAKAGRHVDEAFDELVRKIVTTPALWLHVAPGVRRPGDR
                     IPGGAPDAGGVISLTGVSSYVTAAQDRCGC"
     gene            <111089..>111668
                     /locus_tag="MRET_3838"
                     /note="MRES_16070"
                     /db_xref="GeneID:38740604"
     mRNA            join(<111089..111433,111459..>111668)
                     /locus_tag="MRET_3838"
                     /product="UPF0172 domain protein"
                     /transcript_id="XM_027630465.1"
                     /db_xref="GeneID:38740604"
     CDS             join(111089..111433,111459..111668)
                     /locus_tag="MRET_3838"
                     /codon_start=1
                     /product="UPF0172 domain protein"
                     /protein_id="XP_027486252.1"
                     /db_xref="GeneID:38740604"
                     /translation="MAMTTQSTEVAPLAYRKIVYHSAKYMSSTVIGILVGTTRERVED
                     VIPFVHHWHTLSPMTEAGMALVEAHTAKHHQQILGLYEVPEHLAQKDVSPTTAALAET
                     LATRMGHAPLLFNLNGTKLMDIRGAIDATVQGRTVQVQVPQPESLALALRQELGQGVF
                     QFLYDWDDHLENTQLDWLTNPDLA"
     gene            <111744..>113273
                     /locus_tag="MRET_3839"
                     /note="MRES_16065"
                     /db_xref="GeneID:38740605"
     mRNA            <111744..>113273
                     /locus_tag="MRET_3839"
                     /product="adrenodoxin-NADP+ reductase"
                     /transcript_id="XM_027630466.1"
                     /db_xref="GeneID:38740605"
     CDS             111744..113273
                     /locus_tag="MRET_3839"
                     /codon_start=1
                     /product="adrenodoxin-NADP+ reductase"
                     /protein_id="XP_027486251.1"
                     /db_xref="GeneID:38740605"
                     /translation="MFSTSVRRFGASLTTNAPPMRVAIVGSGPSGFYAASRILHSFDA
                     QCGTGENGVDIHMYERLPTPFGLVRYGVAPDHPEVRNVENKFDEVARDPRFTFLGNVQ
                     VTGGADVLPSAAVPIPLSCMAPYYTHILFAYGASDARHLHLPGTGPDGLQHIHTAFDF
                     VQWYNGHPDAHTPDAPFPRMKGHDLRHVAVVGAGNVALDVARILLRQCKSAPKDETLQ
                     YTDAPQPVLERLRTWGVESVDLYVRRGAAQLAFTNKELREMLNLPHAPCQPLDPAHLQ
                     QALAEVGHSDNVSHKRAMTRLLTQLAKGSKTPYAPDHTPRWGLQLLRSPKAFYGDKRV
                     RQAEWDVTEVRDGRAVTTGATETTPADLVLASVGYRSQPLAGTLPPPVPFDSQRHIIP
                     NERRRVIRDGQPVPGMYVSGWLATGPVGIIVSTMLDAFGVADEMLTDWHAPDGKTRTL
                     CASVGEKEALRGTPEALRGQQVVSYADWLRIDAAERERGQALGKPREKFVHVQDMLQV
                     L"
     gene            complement(<113268..>113993)
                     /locus_tag="MRET_3840"
                     /note="MRES_16060"
                     /db_xref="GeneID:38740606"
     mRNA            complement(<113268..>113993)
                     /locus_tag="MRET_3840"
                     /product="splicing factor 3A subunit 2"
                     /transcript_id="XM_027630467.1"
                     /db_xref="GeneID:38740606"
     CDS             complement(113268..113993)
                     /locus_tag="MRET_3840"
                     /codon_start=1
                     /product="splicing factor 3A subunit 2"
                     /protein_id="XP_027486246.1"
                     /db_xref="GeneID:38740606"
                     /translation="MDFQDRAGNKGAGLASASDAARDRRERLRRLAMETIDVSKDPYI
                     LRNHLGSLECRLCLTMHANEGSYLAHTQGKKHQTNLQRRAAMDARSNDVHGQKAATAL
                     LAPAPEMPKKTFVKIGRPGYKITKIREPSTPDTEGRVGLLFEVHLPEIKDGVVPLHRF
                     MSSFEQRKEAPNRAWQYLLVAAEPYETIAFKLQSREIDRSHTIILPGTPLPEQHDEPC
                     TWSHWNHVDKTYTIQVLFRPLVS"
     gene            <114183..>115375
                     /locus_tag="MRET_3841"
                     /note="MRES_16055"
                     /db_xref="GeneID:38740607"
     mRNA            join(<114183..114210,114236..114337,114363..>115375)
                     /locus_tag="MRET_3841"
                     /product="cell division control protein 12"
                     /transcript_id="XM_027630468.1"
                     /db_xref="GeneID:38740607"
     CDS             join(114183..114210,114236..114337,114363..115375)
                     /locus_tag="MRET_3841"
                     /codon_start=1
                     /product="cell division control protein 12"
                     /protein_id="XP_027486309.1"
                     /db_xref="GeneID:38740607"
                     /translation="MTTTTTEPIGISNLPNQRHRIASRRTANFTLMVVGESGTGKTTL
                     INTLFRTELAPGTNYAQRHMTQLDKAVEVDVIRAELEEKQFRVNLTIVDTPGFGDYVN
                     NRDCWVPLIDFIDDQHESYLRQEQQPDRSHLIDTRVHACLYFIAPTGHTLKPLDIEVM
                     KRLSQRVNLIPVIAKADTLTRRDLAVFKERIRNVIHTHGISVFAPPVDAIDEASAEHA
                     RALMSSMPFSIIGSTQDVRTHDGRVVRGREYLWGVAEVENEHHCDFKKLRSLLIRTHM
                     LDLITNTEDFHYENYRQTQMETRKYGEPRVKRFENPRFKEEEEALRRKFTDQVKLEEG
                     RFRQWEQHLIAERDRLNKDLETAHSAIKQLESEIESMQMAARTQRR"
     gene            complement(<115378..>116193)
                     /locus_tag="MRET_3842"
                     /note="MRES_16050"
                     /db_xref="GeneID:38740608"
     mRNA            complement(<115378..>116193)
                     /locus_tag="MRET_3842"
                     /product="DNA repair and recombination protein RAD52"
                     /transcript_id="XM_027630469.1"
                     /db_xref="GeneID:38740608"
     CDS             complement(115378..116193)
                     /locus_tag="MRET_3842"
                     /codon_start=1
                     /product="DNA repair and recombination protein RAD52"
                     /protein_id="XP_027486319.1"
                     /db_xref="GeneID:38740608"
                     /translation="MAQVESYTRGATRVLRSLMDDDRASKGGREDEATQLSRWSATRL
                     AAMQAVLNQRLGPEFLSQRPGPGGGGRKLTYIEGWRVVDLANEVFGFNGWSTSVRSLD
                     VDFLDVQAETGRCQCGVSAIVRITLQDGAYHEDVGYGHAEGVRGKHAALEKCKKEAIT
                     DSIKRGLKTFGRLLGNCLYDQHYTTQLARMSTPARPPLQPRDLYRGPSMKRPAPDDGP
                     TRPPPKAAPVKEPPSDDLWNDDSEAATMALELELEDDMLLRQSQIAQELDENV"
     gene            complement(<116211..>116942)
                     /locus_tag="MRET_3843"
                     /note="MRES_16045"
                     /db_xref="GeneID:38740609"
     mRNA            complement(join(<116211..116265,116292..116391,
                     116420..>116942))
                     /locus_tag="MRET_3843"
                     /product="vesicle transport protein SEC22"
                     /transcript_id="XM_027630470.1"
                     /db_xref="GeneID:38740609"
     CDS             complement(join(116211..116265,116292..116391,
                     116420..116942))
                     /locus_tag="MRET_3843"
                     /codon_start=1
                     /product="vesicle transport protein SEC22"
                     /protein_id="XP_027486311.1"
                     /db_xref="GeneID:38740609"
                     /translation="MVLSTHIARVSDSLPLAQSVDDVQGPDLTQYKQQAKLIFRKLTP
                     SSETRCSIDSGPMSLHYLVHPPPSDPSSVVYLTITEASYPRKLAFSYLDELAREFEMS
                     YGRQILQRTLRPYAFVAFDTFMQRTKRLYADSRTAESTAGSHLDKLNEDLQDVQKIMT
                     KNMEDLLWRGDSLDHMSTLSSSLRDESLKYRRAARKINVDAMIRKYAPIGALVLLFLF
                     ILYVKFG"
     gene            <117055..>118265
                     /locus_tag="MRET_3844"
                     /note="MRES_16040"
                     /db_xref="GeneID:38740610"
     mRNA            join(<117055..118047,118074..>118265)
                     /locus_tag="MRET_3844"
                     /product="general stress response protein Whi2"
                     /transcript_id="XM_027630471.1"
                     /db_xref="GeneID:38740610"
     CDS             join(117055..118047,118074..118265)
                     /locus_tag="MRET_3844"
                     /codon_start=1
                     /product="general stress response protein Whi2"
                     /protein_id="XP_027486328.1"
                     /db_xref="GeneID:38740610"
                     /translation="MGDEFESSADGMPSFSRLYLDLRGVCFVIDRDTLMSLPESILLC
                     LFPNGLMLPDPVAGDDDASDAKQVYSVDSDAQCLQFVLSFFRRAQEYFYGTDTTPGVY
                     RGAGLSPQYLDFADAMNGEMVNGLGQPLHLPLFHKQAVILLREELEFFTIPPKAMART
                     AAMPHTPPNMPPNATPEFTQLKNACGDALLARRQIFTALQRNVNKENNMAEQHLIDML
                     CMSGFEPQDEWGYRAREPARCAITSMALVLLKTGVTQPGELPGGAPPHAPPLRRPIGV
                     QRAGIDMELGIPVNQTPTDDELGEWTDDGQGGSLRVNHQQLSTTQKLLLFWRKPARKC
                     WWDGIDLVVPIRPTTATPAVVPPHIYGTLSPLERSWLEQGMGQLVRVWIRRVWTLEMS
                     LI"
     gene            <118591..>119094
                     /locus_tag="MRET_3845"
                     /db_xref="GeneID:38740611"
     mRNA            <118591..>119094
                     /locus_tag="MRET_3845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630472.1"
                     /db_xref="GeneID:38740611"
     CDS             118591..119094
                     /locus_tag="MRET_3845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486332.1"
                     /db_xref="GeneID:38740611"
                     /translation="MASFGSPSPFTMFLGNAKGPSSVACPSLASVEALDSPRPFTAST
                     LHTPTPSVPIPMQPSHYASMPMERSYSLPAATQQEHDIRLSMQCGMGSSSSSRAWCTY
                     TPPEYATSYLLSESPVLHDELSGSASSPGASVRRHQSWALLSRAALVHSQRACATPPP
                     SSTDALL"
     gene            complement(<119116..>119691)
                     /locus_tag="MRET_3846"
                     /note="MRES_16035"
                     /db_xref="GeneID:38740612"
     mRNA            complement(<119116..>119691)
                     /locus_tag="MRET_3846"
                     /product="small subunit ribosomal protein S10"
                     /transcript_id="XM_027630473.1"
                     /db_xref="GeneID:38740612"
     CDS             complement(119116..119691)
                     /locus_tag="MRET_3846"
                     /codon_start=1
                     /product="small subunit ribosomal protein S10"
                     /protein_id="XP_027486337.1"
                     /db_xref="GeneID:38740612"
                     /translation="MTMNLMPRGVFARTFASSAMRATSPAEPKAYANHVPDIAPPPQT
                     HGIHVATLQLKSHHAQTFDLDFFADFAMRAAHAFQIPTGGVAMLPIRTTLWTVPRGPF
                     VHKKSQENFWRRIHRRSIKVYDASDETVERWLHFLRVHEMPGVASKVQLFRRYPLGVG
                     RHMESAALVQDDTTPQDVRAMAEQILRAQKA"
     gene            complement(<119765..>122566)
                     /locus_tag="MRET_3847"
                     /note="MRES_16030"
                     /db_xref="GeneID:38740613"
     mRNA            complement(<119765..>122566)
                     /locus_tag="MRET_3847"
                     /product="phospholipase A2"
                     /transcript_id="XM_027630474.1"
                     /db_xref="GeneID:38740613"
     CDS             complement(119765..122566)
                     /locus_tag="MRET_3847"
                     /codon_start=1
                     /product="phospholipase A2"
                     /protein_id="XP_027486308.1"
                     /db_xref="GeneID:38740613"
                     /translation="MTLLHRIRSSPSYLFIKCYLICTLVTLFAARPLSSRLNANGPWT
                     WYESTEGGHGLSSWGRMQALLASATRRESRASTSTSQAASATDRPSVTGAPPAAQATG
                     LGFWWQERRFPFLFPPPQIPLSLAPPVRLPRIPLFERWRLRWHDMSHLRRLVAYDDQD
                     TETFPELEWDARVRCSSELHDEEKAAIYQRRIHMSSHGANTLAQFLQLPNDEYVHPDD
                     VPLIAIGGSGGGYRAMYGYTGFLKEAENTGLWQCTMWTSAVSGSCWTLAAYYTIAKCS
                     TDVLVAHLLAMAHEEAHPMSLQAMDRIARSSHGIYYLLGPLLRKSRNKSMQCRIMDFY
                     ATLVLSYQFLPRPLSLFGTDYSYNGPSSDREPSLQEHSMWTKYEPSEGLSRKSFQWSK
                     VWKRTHIDEGLQPIPIMTGVRRVWRPHSKAEVAVVEQAPGVERAPLVGSGYDWYEISP
                     LELGCRNIGAWIPTWAYGRAFENGVSTHRAPEEMLASIVGQCTGAPAGPLTAYISTML
                     ASIPQGTVMSTLLKWVNDFVMMKQWEKRWGNPIRAADEPNPFYGRGMDDVVVDMREAD
                     VTPPPKAVTKPPEAEPAPADAPSQEGAHFLPWDGRQTSEQINAFFARFPAVELRPRRG
                     SDASASTSLYEHDPETFMAPIEDLEAQAPTEPPRPRQWRWEHTRRLRLMDSGLSNNLP
                     NHVLARDERQADVIISFDASSDVKTGAAVERIHEFGRECGIHIQKRPPKEGEEPPAPS
                     PTSEHDADTASMSPSDMERQWQSEADHIRRAYEPLYAQRFDGWRLRKDKSTDRAPDVH
                     FVYCPLLPNAAQPGFDPTTAHYSTSYNLIWTADQVRALLRTAMANVEEGSRAVGVIRE
                     AVREAYESRKKTRLEREAQSASRRMARAEASKEAHGAQDPANASQHAMSAATDAQVQG
                     AAPSLPIDGPGMLAPPVAG"
     gene            complement(<122660..>124024)
                     /locus_tag="MRET_3848"
                     /note="MRES_16025"
                     /db_xref="GeneID:38740614"
     mRNA            complement(<122660..>124024)
                     /locus_tag="MRET_3848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630475.1"
                     /db_xref="GeneID:38740614"
     CDS             complement(122660..124024)
                     /locus_tag="MRET_3848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486295.1"
                     /db_xref="GeneID:38740614"
                     /translation="MSETASVASTATVTVSPDVRAYVDMYYALRGEEDVRSQEQLLTE
                     SMWKLRGVVESRKQLLTRHTQALDGARAQHERLRSSLLHRMTRAQHIRVTAEGVARAE
                     SRVRDTAQALSAAQAEQSALEKQRTELARAAAARAMEQTRLDMLGDALCAPGSSAAAA
                     TAPCMTELETLRLLCKLIPTEMVREKRTRAALVKAESNGRACLKILRDVLNMSIQLGM
                     ANDNRDRLFPGQPSTLTKRSMPYFLRAKVCLGDFYTNVSNARMRQALVERAPIMDLAD
                     LTRLPGKKNKPLDADGMQKSIETSYTQCQHVCTYAQHEIRISLAREAALRTFQTETEE
                     QIRAAEERVRQARAYALEGDEGKLALLIEALPDEHDGPRPPPLAALGLDEDEERESLS
                     DTASVACTLASTATAVSIVGSSPAVYARAWTRLHRRVVDINHACRTDHDDEDLPWTPG
                     ALGF"
     gene            <124063..>125066
                     /locus_tag="MRET_3849"
                     /note="MRES_16020"
                     /db_xref="GeneID:38740615"
     mRNA            join(<124063..124122,124146..>125066)
                     /locus_tag="MRET_3849"
                     /product="transcription initiation protein SPT3"
                     /transcript_id="XM_027630476.1"
                     /db_xref="GeneID:38740615"
     CDS             join(124063..124122,124146..125066)
                     /locus_tag="MRET_3849"
                     /codon_start=1
                     /product="transcription initiation protein SPT3"
                     /protein_id="XP_027486313.1"
                     /db_xref="GeneID:38740615"
                     /translation="MSDDARSETVYRYQQEIAQMMFVSTEIENPDPRVTRLIEDIVRN
                     QVIEMIIQSRRMAQRRLSKYFTPEDLIFLIRYDKAKVNRLRTYLSWKDVRKNAKDTND
                     ASAGGSAGPAQEGDGIEEGGEDTPLRVNKRKMRLPWELSSVFCDYPRASQDDADDDDD
                     DVNETNEDSIRRLKAADETTRRMTREEYVFYSECRQASFTFRKAKRFREFIHANLYLD
                     VKPSDDTIDILGFLAFEVVHELCTRAMRIKRDWEHKAEAMRTMRGRHTDDDAPACTLF
                     STSASAEPPLEAWHIREAFTELQAEHALLDTGRSTAGPAGGLRRTQVFVI"
     gene            complement(<125059..>125904)
                     /locus_tag="MRET_3850"
                     /note="MRES_16015"
                     /db_xref="GeneID:38740616"
     mRNA            complement(<125059..>125904)
                     /locus_tag="MRET_3850"
                     /product="FHA domain protein"
                     /transcript_id="XM_027630477.1"
                     /db_xref="GeneID:38740616"
     CDS             complement(125059..125904)
                     /locus_tag="MRET_3850"
                     /codon_start=1
                     /product="FHA domain protein"
                     /protein_id="XP_027486234.1"
                     /db_xref="GeneID:38740616"
                     /translation="MTADEHGVAPDVWDDYPFLRLVKLSSDVLPSHKTVAIVDGRYGG
                     VSIGRDKAFTPRLRLPSMEVSKHHANLFSTSRAPIRFSIADTGSMHGTYVRRRASTSY
                     ERLSPPKHASRPWTLEHLDVVRIGVQSTEFEVHLHDKEACDRCAVGLDGQNELSLAPT
                     ATKAARRPAAEPVVGDGRKQLKALKSMYVPRTVPQTSTAYRDRAAVRRRLYPPEPAPP
                     APPTTTTTTTVEPDIGRRMLQHMAQGADVPLLRQAPIVPRVTQGRAGLGSGRMVDADT
                     YGRTK"
     gene            125998..126105
                     /locus_tag="MRET_t0061"
                     /db_xref="GeneID:38741255"
     tRNA            125998..126105
                     /locus_tag="MRET_t0061"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:38741255"
     gene            126180..126287
                     /locus_tag="MRET_t0062"
                     /db_xref="GeneID:38741256"
     tRNA            126180..126287
                     /locus_tag="MRET_t0062"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:38741256"
     gene            <126367..>128736
                     /locus_tag="MRET_3851"
                     /note="MRES_16010"
                     /db_xref="GeneID:38740617"
     mRNA            <126367..>128736
                     /locus_tag="MRET_3851"
                     /product="elongation factor G"
                     /transcript_id="XM_027630478.1"
                     /db_xref="GeneID:38740617"
     CDS             126367..128736
                     /locus_tag="MRET_3851"
                     /codon_start=1
                     /product="elongation factor G"
                     /protein_id="XP_027486233.1"
                     /db_xref="GeneID:38740617"
                     /translation="MRMNVASVARCATRARAMRWVRSLATQATPLATDIKPTESDLQR
                     LLCQRNVGISAHIDSGKTTLTERVLYYTGRIKDIHEVRGRDEVGAKMDSMELEREKGI
                     TIQSAATYCNWKATPPTERSDMTGDAADTTEVTTQKKQDYHINIIDTPGHVDFTIEVE
                     RALRVLDGAVLVLCAVSGVQSQTMTVDRQMRRYSVPRLSFINKMDRAGANPFRVIEQI
                     RTKLRMPAAAMQVPIGAEDDFAGLVDIVRWKAVYNEGTKGNVVRETDEIPAEVLELAK
                     QKRQELIEQLSDVDDEMAEIFIEEREPTLEELVAAVRRATVACRFSPVFLGTAIKNKG
                     VQALLDGMCAYLPNPMEVRAVANDTAVAKRLAAEANEAGEDVTAVQSTAQRGSEVQLV
                     PATEAPLVGLAFKLEESRFGQLTYMRVYQGVLRRGGIIFNSRTGKKVKVPRLVRMHAD
                     DMEDVQEIGPGEICAMFGVECSSGDTFTDGSTALSMSAMFVPEPVISLSLTPEGKDTS
                     VNFSRALNRFQKEDPTFRVHVDSESGETIISGMGELHLDIYVERMRREYNVPCTTGKP
                     RVAFRETISQPATFNYTHKKQTGGAGQFGRVIGYIEPMKVDEDTGKDTAFVNSVVGGN
                     IPPSYIPACEKGFHDGLEKGALAGYPVCGVRMVLEDGASHSVDSSELAFRIAAHAAFR
                     EAFRGAQPLILEPRMAVEVLAPVEFQGAVIGALNQRKGTIEDTEVREDDFTITAEVSL
                     NDMFGFSSQLRGLTQGKGEFSMEYKKHEPVMPNVQADMEAAYKKSLERK"
     gene            complement(<128737..>130011)
                     /locus_tag="MRET_3852"
                     /db_xref="GeneID:38740618"
     mRNA            complement(<128737..>130011)
                     /locus_tag="MRET_3852"
                     /product="STE24 endopeptidase"
                     /transcript_id="XM_027630479.1"
                     /db_xref="GeneID:38740618"
     CDS             complement(128737..130011)
                     /locus_tag="MRET_3852"
                     /codon_start=1
                     /product="STE24 endopeptidase"
                     /protein_id="XP_027486322.1"
                     /db_xref="GeneID:38740618"
                     /translation="MIAGWIQALCAVLDTPAVPWHQVASALTTLEYVVHMYVLQRQAP
                     LYERTQLPPALAPFVNARDFAARQRASRAIVRWEMVTHTARYVLTMLRIVFLANALAW
                     TWAGRLVQHSEKGQMVAYVCVLPALFFPFEQLVHAGELYMAQRQLSPASLAPWRTHLR
                     DFFVMLPFRLLFSLAFVVCGVAFAVYVGEMLPAYMIALGALYIAFVSFVYPRAVRPFF
                     DQPVVLDSGALYTRARAVAAKLGLPLEHVFLATQNTSDGGAYCFGSRTFCVVVLDRLA
                     SDAEIEAVLARAMVPWTLRHPRILTLCAAVPRALWVLGMALLVRNASLGRAFGFDDVP
                     LPVGWDLAACLVQPVVALASFAVHVVQHRLCFEADAHAVRLEPKAGSLARAIATLDVA
                     HLLMASAYDDALYSAYERDTPTPAQRIMALAT"
     gene            complement(<130028..>131389)
                     /locus_tag="MRET_3853"
                     /db_xref="GeneID:38740619"
     mRNA            complement(<130028..>131389)
                     /locus_tag="MRET_3853"
                     /product="STE24 endopeptidase"
                     /transcript_id="XM_027630480.1"
                     /db_xref="GeneID:38740619"
     CDS             complement(130028..131389)
                     /locus_tag="MRET_3853"
                     /codon_start=1
                     /product="STE24 endopeptidase"
                     /protein_id="XP_027486232.1"
                     /db_xref="GeneID:38740619"
                     /translation="MGPLWTVGLQALQTRLDTPAIPWKALVNALLWGVYVFETYVSWR
                     QYRMYSRTAPPPALAGHVSADDFRKSQRYGRDKMRFSMVSDAVMHVVSLVSVNYNASA
                     HMWGWGGELLRWLRVAPSEQALSAAHMLVTTVCYLPLKLVLEAYRAFVIEARHGFNKQ
                     TWGTFGMDHVKQLLLSVVLGAPLVALLVSVIRWAGDAFVVYTVLLVLAVTLFGSVIFP
                     TFIQPLFNTLTPVPEGRLRDRVTALATSLRFPLKHLYVIDGSKRSSHSNAYFYGVVPG
                     GSKHIVLYDTLIEHSTPAEIEAVLAHELGHWSYSHPVKMMAVSYVQIAALLTLFTAFI
                     HNASLYEAFGFHGPPLPVWIGLELFSLVLHPLDALLQFGMHAMTRQMEYAADAFAVRL
                     PRPQGADDGKTYQELLQSSLIKLQVHNLSTMHHDALFSAYHHSHPTLPERLAAIERAA
                     KTD"
     gene            complement(<131419..>133446)
                     /locus_tag="MRET_3854"
                     /note="MRES_16005"
                     /db_xref="GeneID:38740620"
     mRNA            complement(<131419..>133446)
                     /locus_tag="MRET_3854"
                     /product="DNA ligase 1"
                     /transcript_id="XM_027630481.1"
                     /db_xref="GeneID:38740620"
     CDS             complement(131419..133446)
                     /locus_tag="MRET_3854"
                     /codon_start=1
                     /product="DNA ligase 1"
                     /protein_id="XP_027486237.1"
                     /db_xref="GeneID:38740620"
                     /translation="MARRQATLDALFGGQPEAKRVKTEAPAEKKSELPPKVSDGVPIA
                     YAVLVDTFTRVEATTKRLEILELVTNVFMRIIYESSEGKPLVSARDNLLHAVYLCINR
                     LCPDYEGLELGIGEGLLIKAIAQSTGREVVRIKKDFESLGDLGLVARASKKHQPTMFR
                     AQALTLSYVFHQLRLIAAASGAKSQDKKLGIIKRLLAACSDDEAKYLIRSLEGKLRIG
                     LAEKTVLIAVAQAVMLVMRGEACYTAELAPSLEHGIHTVKAVFSELPSYDVLIPALLA
                     HGVEHLHEHVTLTPGIPLKPMLAKPTKAIGEVLDRFEAQAFTCEYKYDGERAQVHGFM
                     EDGQLQVRVFSRNSEDMSVKYPDLVVQIPRCLREGRVRSFVLDAEAVAWQPRGSEPGR
                     LLPFQELSRRKRKDVQADDVRVAVKVFAFDLLYLNGASLLQEALARRRSLLWECFAPV
                     EDEFDFATSKDCTTTEEIQAFLDESVAHGCEGLMVKMLTGGDATYEPSRRSINWLKLK
                     KDYLSGTGDSLDLTVIGAYYGRGKRTNVYGAFLLACYDEDSETYQSVCKIGTGFSEAD
                     LDAHYTTLKALEISAAKSYYDLGEAKPDVFFEARIVWEVLAADLSLSPVYTAARGAID
                     ARGVSLRFPRFVRIRDDKTPDMSTTPEQVASMYRAQVATSARIDDDADEFW"
     gene            <133559..>137110
                     /locus_tag="MRET_3855"
                     /note="MRES_16000"
                     /db_xref="GeneID:38740621"
     mRNA            <133559..>137110
                     /locus_tag="MRET_3855"
                     /product="structural maintenance of chromosomes protein"
                     /transcript_id="XM_027630482.1"
                     /db_xref="GeneID:38740621"
     CDS             133559..137110
                     /locus_tag="MRET_3855"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein"
                     /protein_id="XP_027486330.1"
                     /db_xref="GeneID:38740621"
                     /translation="MRIEELVIDGFKSYPVRTHVRGFDPSFNAITGLNGSGKSNILDA
                     ICFVLGLTNLSSVRASNMQDLIYKRGQAGVTKASVTIVFDNSDKERSPVAFENYATIT
                     VTRQVAMGGASKYLINGHKATQQAVQNLFQSVQLNINNPNFLIMQGRITKVLNMKPAE
                     ILSMMEEATGTRMFEERKERAFRTMAKKDQKVREISALLEEEIRPKLDRLREEKRAFL
                     EYQKATSELERLERLAKAHEWQTLHTQREQSGLEDTRQRIRDKQAEMTAWAQHIESLR
                     TELAALEEQQRGQKSTGPDAKQLHHQLVEATAQHDFRQAAQEEEARRVEADTHALDAA
                     KMALEKQEKDHASLSSSFATFKDAFDKESASLAEQESLLQTLLTGVGTQDTQGGFQGQ
                     LAKARENETAVKSELQQIQVRMEHLERELRTKEPQAQQERHASRALHTKLERAQQAAE
                     AAQAQLDAHAWDARRFEQLRTHRMQLQDDMARLSSERRALEDRLPSALQFTYADPSPD
                     FDRSRVKGLVASLVHLDAERAKFATALETCAGGRLYSVVVEDEHVGAQLLAHGQLKKR
                     VTLIPLSKIQPHVASSQRVQAAQKLAPGHVDLALSLIGYEDEVAKALEYVFGSTLICR
                     DAATAKRVTFDAAVRMKSVTMDGDVYDPAGTLSGGSAPSSGSHSVLLRMQDVARKAAQ
                     WHEARAAYEATHTEWDALQAQHAAYQELVSHVELKAHEARLVQQQVEGGRAAMLQAEI
                     DTCRTSLDKWRSSMEAAQTRLKEATARTASIVRDISEFDTDKEAKVGQVRASCKSMKA
                     QFVERAKELKQRQSSLRSSELACQQARIEVEHAQERLDEAHASLQQADDELQASSSHM
                     HLLQTRVAESEAAMAETRAAMAACDDQVAELQAALQAKKASVADGELQLKQWHRELEQ
                     LEHVHATAQRHITALETAFPWILDECHLFGQPGSAYEFAKHNMDDVRRQCKRLDEQQS
                     GLRRRINPRVMHMIDNVEKKDASLQHMLSTVLRDKNKIEQTIEELDRYKRDALQTTFE
                     QVNRDFGAIFGELLPGNYAMLQPPEGQDVTQGLEVRVRLGATWKQSLTELSGGQRSLI
                     ALSLIMSLLQFNPAPMYILDEVDAALDLSHTQHIGHLFSTRFKGSQFIVVSLKEGLFS
                     NANVLFRARFRDGTSVVERVSHKAGTASAPRRTTARS"
     gene            <137236..>138601
                     /locus_tag="MRET_3856"
                     /db_xref="GeneID:38740622"
     mRNA            join(<137236..137340,137375..>138601)
                     /locus_tag="MRET_3856"
                     /product="solute carrier family 25 (mitochondrial
                     aspartate/glutamate transporter), member 12/13"
                     /transcript_id="XM_027630483.1"
                     /db_xref="GeneID:38740622"
     CDS             join(137236..137340,137375..138601)
                     /locus_tag="MRET_3856"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     aspartate/glutamate transporter), member 12/13"
                     /protein_id="XP_027486236.1"
                     /db_xref="GeneID:38740622"
                     /translation="MAFSPLLCDAMPLATAAATSEDPSSLKGQSKLQFQIYTPKDLPP
                     LLASKLRYFETGAQRENSKVKYETHPSPNGEYVRHTISVHDAGAVESLMDQASGAVAS
                     QDKTTSPSFLKSALQNFGQSTFNFVLGGFAGATGAAFVYPIDLVKTRMQNQRSNAAGE
                     VMYRNSLDCARKVLRNEGFLGFYSGLLPQLLGVAPEKAIKLTMNDLVRSLTMDKDGHV
                     SLGAEILAGGVAGGSQVIFTNPLEIVKIRLQVQGESPNPSKVKSGAIHIIRSLGLMGL
                     YRGAGACLLRDIPFSAIYFPAYAHLKHDYFGERPDHKLSFGELMAAASIAGVPAAFLT
                     TPADVIKTRLQVEARKGQATYSGISDCFAKILANESPTAFFKGSLARVLRSSPQFGAT
                     LVAYEYLKKFIPSPFETKDQTIKSIVNHEDFQQAQEALSLFAVIHRAARSS"
     gene            complement(<138712..>140442)
                     /locus_tag="MRET_3857"
                     /note="MRES_15995"
                     /db_xref="GeneID:38740623"
     mRNA            complement(<138712..>140442)
                     /locus_tag="MRET_3857"
                     /product="chaperonin GroEL"
                     /transcript_id="XM_027630484.1"
                     /db_xref="GeneID:38740623"
     CDS             complement(138712..140442)
                     /locus_tag="MRET_3857"
                     /codon_start=1
                     /product="chaperonin GroEL"
                     /protein_id="XP_027486235.1"
                     /db_xref="GeneID:38740623"
                     /translation="MLRASAASSRMPRVLNSRALSTSAAALAHKEVKFSNDGRAAILK
                     GVNLLANAVSVTLGPKGRNVIIEQPFGGPKITKDGVTVARAIELKDKYENLGARLVQD
                     VASKTNEVAGDGTTTATVLARAIYAEGVKNVAAGCNPMDLRRGSQAAVDAVIKYLEAN
                     KREVTTSEEIAQVATISANGDKHVGSLIATAMEKVGKEGVITVKEGKTLEDEIEITEG
                     MRFDRGYISPYFITDIKTQKTEFEKPLVLLSEKKISALQDILPSLEAAVTMRRPLLII
                     AEDIDGEALAACILNKLRGQLQVCAVKAPGFGDNRKSILGDLAILTGGQVFSDDLDMK
                     LERASPDMLGTTGSVTITKEDTIFLNGEGSKDAITARCEQIRSAMNDPSTSEYDRTKL
                     QERLAKLSGGVAVIRVGGSSEVEVGEKKDRYDDALCATRAAVEEGIVPGGGVALLKAA
                     KSLDSITTANFDQQLGVSIVRSALTRPARQIVENAGEEGSVVVGKLMENPGDFGFGYD
                     ASTGEYKDLIAAGVLDPFKVVRTALQDASGVASLLTTSECCIVEAPEEKPAPMPGMGG
                     GMGGMGGMGF"
     gene            <140761..>141127
                     /locus_tag="MRET_3858"
                     /note="MRES_15990"
                     /db_xref="GeneID:38740624"
     mRNA            join(<140761..140763,140804..>141127)
                     /locus_tag="MRET_3858"
                     /product="chaperonin GroES"
                     /transcript_id="XM_027630485.1"
                     /db_xref="GeneID:38740624"
     CDS             join(140761..140763,140804..141127)
                     /locus_tag="MRET_3858"
                     /codon_start=1
                     /product="chaperonin GroES"
                     /protein_id="XP_027486355.1"
                     /db_xref="GeneID:38740624"
                     /translation="MSAAASTIRNIKSVVPLLDRVLVQRFKPETKTATGIFLPSSSSS
                     TPMPEASVIAAGPGAPNKDGQVVPTSVKPGDKVLLPSWGGNQIKVGDEEYLLIRDSEI
                     LAKIQE"
     gene            complement(<141213..>141769)
                     /locus_tag="MRET_3859"
                     /note="MRES_15985"
                     /db_xref="GeneID:38740625"
     mRNA            complement(join(<141213..141269,141307..141484,
                     141512..141575,141601..141716,141744..>141769))
                     /locus_tag="MRET_3859"
                     /product="putative mago nashi protein, exon junction
                     complex"
                     /transcript_id="XM_027630486.1"
                     /db_xref="GeneID:38740625"
     CDS             complement(join(141213..141269,141307..141484,
                     141512..141575,141601..141716,141744..141769))
                     /locus_tag="MRET_3859"
                     /codon_start=1
                     /product="putative mago nashi protein, exon junction
                     complex"
                     /protein_id="XP_027486354.1"
                     /db_xref="GeneID:38740625"
                     /translation="MSEFYVRYYTGHKGRHGHEFLEFEYNRGRLRYANNSNYRNDSLI
                     RKEMWISPLMTDQLRSIVESSEILKEDDTTWPKRNANGRQELEIRLGKEHISFETAKL
                     GSLIEVQDSEDPEGLRVMYYLVQDLKCLVFSLISMHFKIKPISV"
     gene            <141990..>143678
                     /locus_tag="MRET_3860"
                     /note="MRES_15980"
                     /db_xref="GeneID:38740626"
     mRNA            <141990..>143678
                     /locus_tag="MRET_3860"
                     /product="N-glycosylation protein"
                     /transcript_id="XM_027630487.1"
                     /db_xref="GeneID:38740626"
     CDS             141990..143678
                     /locus_tag="MRET_3860"
                     /codon_start=1
                     /product="N-glycosylation protein"
                     /protein_id="XP_027486361.1"
                     /db_xref="GeneID:38740626"
                     /translation="MGRLDVDVSLRRAESFDVHDQTGTCALATSHVARRESGTSACRA
                     RRMAPCAEEASWSRDALSMSAPSHVSTQLPDALAMNALDCPPPYSMVAQESTHFHTLT
                     SREPLVRSSSEPEFSHIDTDAASVSSGDLLLSDEDEECLYHRRRRRTFSQQTLHQHDM
                     NRMKYRNTKSQPSFVAAAASSSAHGARESLSRHYRGILSMVPSFLASDSPMSSVPRPT
                     EQVEPLEPLPLGFELLLHSLRLFAVVPGLVGTVSLLQHSYQQALNYRWLRTNFMSLTP
                     SAIEYFFCSLWSICTAFHALSLMTMLLRRWLIYYTLVPSLIRLITFQSICWSLVRWVL
                     WCFGPSQPAAGWIVISTFTSFFEILARWITSNITDVDLPSSNDGANSDVNETGVSDAE
                     GLHSDQEDLYHLLHSRPWRLSRSERFRLYREGGVWVIRALTGAPDDGVTSESDTELPD
                     KPGANQGSSVPGTQGSTSSPHTLLSQVDMERWHRRLDERRRQRKQRRRYRPRKQKTRM
                     SAFFQNYRAARIHSRRVFHWNVAVWRNVVPIGILGYVTLWVFLIEFTITRFQSN"
     gene            complement(<143710..>144822)
                     /locus_tag="MRET_3861"
                     /note="MRES_15975"
                     /db_xref="GeneID:38740627"
     mRNA            complement(<143710..>144822)
                     /locus_tag="MRET_3861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630488.1"
                     /db_xref="GeneID:38740627"
     CDS             complement(143710..144822)
                     /locus_tag="MRET_3861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486362.1"
                     /db_xref="GeneID:38740627"
                     /translation="MSRAQRTPEDSGKVEENAGSAKTLKPSDTPGAAPPVTRRSLPAI
                     FGGAFFKSPPAPPSANSKSSRRPSARGVDASTPAPSVAQGHEGNLTEQQQQILDAFTK
                     ELVENKIISLENAPPYQTTQLLRFLRARNFDKKAAMDMYVRTEEWRKKIDMDRLYEEF
                     SFTERAQVARYGWRMYFHKTDRMGRPIFIQDLSGLDTEKVFSVTTADRIVQNFAVTLE
                     HAVRERYLACTASAGRTVDDNLMILNVQGLGLSTFWSMKNKLQELLGILDNNFPELSG
                     RVQIINAPMLFTTVWSCIKGWLPTQTVEKIDICDSDYMPKIRALVDMENWPKHLGGAC
                     TCGRDSNDNDDDDDAHESRPACEISDAGPWPKQPGL"
     gene            <144998..>146170
                     /locus_tag="MRET_3862"
                     /note="MRES_15970"
                     /db_xref="GeneID:38740628"
     mRNA            <144998..>146170
                     /locus_tag="MRET_3862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630489.1"
                     /db_xref="GeneID:38740628"
     CDS             144998..146170
                     /locus_tag="MRET_3862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486359.1"
                     /db_xref="GeneID:38740628"
                     /translation="MQHAATHRAQGLPLEVVFLVVWQLHMPAADGDATSIQTLVRLSA
                     VSHVVRHWALHALYDTLYLPRHVRDFRKWYARMRAAKPPFPCVGYVRALFVGMDDITR
                     LTQSSAGWEAELLRLLHYCGSTIEHLSLWQTESRALLRDAAQVSGSHARAAWAVGEHI
                     LDDTPEELERDESDDMPQWLRDELAQLPAEHVARQHMAHFPFVPRAPPKPPAWLARPK
                     PRLCTPRFLSLVLYYPFFENERPELFARMVLWSRVEELDVYLSMEPRKSLHLLACLAH
                     TPTWRLRVSSAHATLAIETQNAAWPNACGILAALLRHAHLEEALLNEMRGHGVANADL
                     FENACFRELGCLRHVRLNLTQKNQAVWGKLRHRLWDFRERAQFHRQGAWSEVLRPT"
     gene            complement(<146163..>147992)
                     /locus_tag="MRET_3863"
                     /note="MRES_15965"
                     /db_xref="GeneID:38740629"
     mRNA            complement(<146163..>147992)
                     /locus_tag="MRET_3863"
                     /product="mitochondrial import receptor subunit TOM70"
                     /transcript_id="XM_027630490.1"
                     /db_xref="GeneID:38740629"
     CDS             complement(146163..147992)
                     /locus_tag="MRET_3863"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM70"
                     /protein_id="XP_027486360.1"
                     /db_xref="GeneID:38740629"
                     /translation="MASNATANRVARWVQDNRFAAVALAATVTVASAAGLYFLTSSAS
                     VTGTSAPGSSAASSSGKSSSSAAKKKRAKKAKKSSKASTEGPILDDAGDEHLARLSEA
                     ELARLPQERKESVAQYLKGLGNKAYSDKKHEEAIQHYTKALSLMPSAVFYSNRAACYA
                     NLGQPDKVISDCNEALKLEPTYIKALNRRAVATEQLGEKSAANGAEGDRARERLEQSL
                     SDFTAVAILGQFRDVNATASVERVLRKLASGKAKMILSKREPRLPSPTFVKAYLDAFR
                     PKPAPSIGDDAPQGDQTLKRAFEALEAQDYAHSLSLFQEALQQGLSTQELEAAALNMH
                     GTYMFVMGEPKRALEDLDRSIELSPENVQTWVKKASVHVELGDKDAAMADFDRAVALN
                     ADDADIYYHRGQVHFILGEFEAAMSDYSKSTSLDDTFIFSQVQHAVASYKLGNIARST
                     AEFCRILKKFSDSSESYNYFGELMLDQQRHEDAVANFDKSIALEQAKPKGKNVLPMIN
                     KALVLFQWKQDLSGAEQLCRDALRIDPDCDVAIATLAQLSLQQSKIPEAIEYFRKSAD
                     IARTEPELVNAITYEYASRAQLQFIRDYPEQGAALSQIASSLM"
     gene            <148117..>148444
                     /locus_tag="MRET_3864"
                     /note="MRES_15960"
                     /db_xref="GeneID:38740630"
     mRNA            join(<148117..148335,148361..>148444)
                     /locus_tag="MRET_3864"
                     /product="small ubiquitin-related modifier"
                     /transcript_id="XM_027630491.1"
                     /db_xref="GeneID:38740630"
     CDS             join(148117..148335,148361..148444)
                     /locus_tag="MRET_3864"
                     /codon_start=1
                     /product="small ubiquitin-related modifier"
                     /protein_id="XP_027486358.1"
                     /db_xref="GeneID:38740630"
                     /translation="MSEETVPKPEVAPEQLNIKVKDAEGNEVFFKVKRTTKLAKLKRA
                     YAERMGKPENSVRFIFDGQRVGDEDTAESLDMNDQDEIDAMIEQLGGSAHVVLLRT"
     gene            complement(<148441..>149214)
                     /locus_tag="MRET_3865"
                     /note="MRES_15955"
                     /db_xref="GeneID:38740631"
     mRNA            complement(<148441..>149214)
                     /locus_tag="MRET_3865"
                     /product="ESF2/ABP1 family protein"
                     /transcript_id="XM_027630492.1"
                     /db_xref="GeneID:38740631"
     CDS             complement(148441..149214)
                     /locus_tag="MRET_3865"
                     /codon_start=1
                     /product="ESF2/ABP1 family protein"
                     /protein_id="XP_027486351.1"
                     /db_xref="GeneID:38740631"
                     /translation="MSQEASAAAASDERFATTSWDAQDVREDHSEDRPIPVLSTEELE
                     AYKKKQQKRGIIYLSRIPPGMTPAKVRHIFSQFGEVGRIYLQPQHAASKKSTSRYSEG
                     WIEFLSKRVAKTTAEMLNAQPIGALGGAAHSSRRSSSASVINRWKDDIWTMKYLKGFR
                     WPMLMEQMTHERASHAARLRMELSQSAHEQRDYLRKVERSRRQRKREASDEAPSAPAR
                     VFQQRTPIYRDVRDQRAQGQEGGHGERKQDMEQVLSQIF"
     gene            <149321..>149578
                     /locus_tag="MRET_3866"
                     /note="MRES_15950"
                     /db_xref="GeneID:38740632"
     mRNA            <149321..>149578
                     /locus_tag="MRET_3866"
                     /product="diphthamide biosynthesis protein 3"
                     /transcript_id="XM_027630493.1"
                     /db_xref="GeneID:38740632"
     CDS             149321..149578
                     /locus_tag="MRET_3866"
                     /codon_start=1
                     /product="diphthamide biosynthesis protein 3"
                     /protein_id="XP_027486356.1"
                     /db_xref="GeneID:38740632"
                     /translation="MAPLSFYDEVELEDMEYDEDKQLFHYPCPCGDRFEISVAQLRAE
                     EDVARCPSCTLLIRVIYDPLDFMDSDGANPPAVSPMVSAAA"
     gene            complement(<149621..>155167)
                     /locus_tag="MRET_3867"
                     /note="MRES_15945"
                     /db_xref="GeneID:38740633"
     mRNA            complement(<149621..>155167)
                     /locus_tag="MRET_3867"
                     /product="DUF1708 domain protein"
                     /transcript_id="XM_027630494.1"
                     /db_xref="GeneID:38740633"
     CDS             complement(149621..155167)
                     /locus_tag="MRET_3867"
                     /codon_start=1
                     /product="DUF1708 domain protein"
                     /protein_id="XP_027486357.1"
                     /db_xref="GeneID:38740633"
                     /translation="MPSATQGSTSSGRSGQRLYTSGSPALKWIAQHGRSSSTSMSPAS
                     LSSPEVRDADTEPATQRTHSSMPARSTLPVQPSSGLGLYISPEQERANEAPHGVSDEP
                     NVSAVLNDVMHWDVHAPLPASNGRSPFSSKREDIVQSTSHVRIISSATPARQQPVEPV
                     QDEAMTSTLSMAEAPTQTAQRSIPIELSDYARPSQAETPASDGIRHAPRSLKEDAVEL
                     PRPEPPAKVVPPASVPRTASIARTSRTSRSTPHGAAPAVKGAYVSGNSPPLGYPTTTV
                     TRSVPPVTITSPETEARQTWTHEPSEHRDVPAKQPAPEPRMSAPEPRAEAPASTERPP
                     TFGRAAAVPDRGIPGRSVPEALRHSSVVYGYTGEAWDELLDMEVATAYVMRITARIRA
                     LGVDVPQLLSSMAVDLSASETRRLIRAVVATLRSPTAEADKAFDEELQFANVHSLVAL
                     LKWVLARIGTVTAVRSGSETLVMRQEHGFVPWMTYTSWRAQEGKDGFSTLSYLLLIQR
                     LEKRTARLLDAVMDFLALVATHSAQNHMTPSKVGRYFGMLLFGAPEDASFAETYAAFV
                     RASNATEHILLAFMRYHVSMAKARTYLPRRLLRLVDDYPRMLSPDLDAASGAVRTVPA
                     TYVAHHVREYSHDLMDRRAWPDVLEGFDFAHDTCKMLNIVPYRARRPRSEVPTELADS
                     YVSTLMQRWNEFSFEGFDDLDTTFLSFDLRESDRRQRMQRPESVPWFQFEERGFHQNA
                     DDNTQWDWVMRLDEPSEQAPVLVQHEGGMPRSSSHIFQGEELPFPYTTEPLLADTVMD
                     ELFPEVWADYLVGNGWSNRDERVHRDASFAVLQLTRDSPAWYVLEEVVPQSYRDTLDQ
                     MGRTRRHSIPMLRKLNQFRMVRAGQAPESTVSVEFHFTSDADAVPTSFPTPKPPPRDE
                     ASAIEASEALEHGKAGPIEASQPPEYDEAGPIEASQPLALGGTGAAGARQAGGQVPAQ
                     PEPATYERGQASLANQTHRHAGPAEHPTPTSAQGSQARQLSEPPVGAPWQNERPPPTP
                     PKRAELPSRPAPKAPAPEAAPGDRPKMGKLRRILSSMGSPRRQQDGTSPRSLWSPIFH
                     SPPLDGRASPPQDKPGLAHTIRKRSSQWILRGRKSMRGMHPSSPDETRTSSAVEQPPI
                     RGDAPPLATAPAASSPAADALAPPEPISTYSPSVVDHGPFSQPRSRHSSPVMPSPDMQ
                     RLSEERRPATMMIPRKQTPAITPEQMAAMDATPADTLEADAQESRPGQPTSDAPDAQQ
                     VPSLTHANVPTVPLHDTVVDELQETQDLFASHEPHEAQTPVLHKPLVAQVTPVTQEPP
                     VVQEPSVAHIDHAAHVPRGASAKLPPAVPGAMSSPPIVEPASFTTSHTSPASSMPNPW
                     ASSVTRRPSRTSPRDAEPAMSWTLSPVASGRPTSSVGSHVASPDSPDMFDDAHSQLET
                     PPLPSAEMSVPQPRMDRAGDEYVLGDIAEETDAEAQARTDAEPLGFSAEEPILRHDAL
                     GAMYLQATDDAAITESTHAAFQDAAESPPQSTLKAAEPARPMPASTNPFTRFSDNHRT
                     WASRDGPASVESVWAPTSTHEAQLPPQELPPQAAMEPTEARQEPEPGTVERSADVLFD
                     QAPDERVSRHVEQEPLHAAEEARVEQRAAEPLVHDAATPMILDQAPRAVESTQREGPA
                     CHGEEVTTNDETPSMPASHPMPVSLSSTSSKLNNASPAVPTSRIRLVSTEPVSRNLST
                     GGLAAQQPSARSHTVWRESAPLHEPPSVASSVAKSPSATEPPKLAGFSRPSFSVEDVI
                     LPKSQSTMSASKASAARGSDELTDTAFLRHMASEKRTQSGTTTIARAKVSQHAPGTNP
                     PGYAPA"
     gene            complement(<155359..>156168)
                     /locus_tag="MRET_3868"
                     /note="MRES_15940"
                     /db_xref="GeneID:38740634"
     mRNA            complement(<155359..>156168)
                     /locus_tag="MRET_3868"
                     /product="putative subunit of the 90S preribosome
                     processome complex"
                     /transcript_id="XM_027630495.1"
                     /db_xref="GeneID:38740634"
     CDS             complement(155359..156168)
                     /locus_tag="MRET_3868"
                     /codon_start=1
                     /product="putative subunit of the 90S preribosome
                     processome complex"
                     /protein_id="XP_027486345.1"
                     /db_xref="GeneID:38740634"
                     /translation="MGDDLDDGLLLDEHLIAQSDDEQAPAVPDAVDATTQKKRKRREH
                     AKTQRRKKAAVRQEQSEAALTVAQQPSDIQADFLRTTQRKAFPKLSDLELQETGVPAA
                     CMAETYTFERERTLEHMPAFVRQFFPLPDTLSSECGAPHVLVVAGNAQRAADIARVLR
                     VLLPNPKTTHVGKLFARHFKVEEQDAWLCAHVAPLCVGTPHRLQSLMERGSLRLEHTQ
                     ALVIDYTWRDAKQRTVLETPETCTALLMLLGQRAVRDALQRPRRPCRVALY"
     gene            <156285..>156991
                     /locus_tag="MRET_3869"
                     /note="MRES_15935"
                     /db_xref="GeneID:38740635"
     mRNA            join(<156285..156393,156420..156513,156538..>156991)
                     /locus_tag="MRET_3869"
                     /product="Dr1-associated corepressor"
                     /transcript_id="XM_027630496.1"
                     /db_xref="GeneID:38740635"
     CDS             join(156285..156393,156420..156513,156538..156991)
                     /locus_tag="MRET_3869"
                     /codon_start=1
                     /product="Dr1-associated corepressor"
                     /protein_id="XP_027486348.1"
                     /db_xref="GeneID:38740635"
                     /translation="MVRRSASSKFPIARIKRIMQADEDVGKVAQATPVVISKALELFI
                     QDIVETAVEQTRKTGGKRVAPYHLKRAALMTETFDFLRDILEKVPDPLESATPRGTKR
                     RKTAKATTEEDPVQIKVPKSEENAPTVPEDDEEEHVPVSKYDPVHDACVAVSEPEQEP
                     EQEPEQEPKQEPKQEPKQELEQEPEQEPKQELKQEPEQEPEQEPEQEQEPKQEEKDLA
                     "
     gene            <157283..>164077
                     /locus_tag="MRET_3870"
                     /note="MRES_15930"
                     /db_xref="GeneID:38740636"
     mRNA            <157283..>164077
                     /locus_tag="MRET_3870"
                     /product="carbamoyl-phosphate synthase/aspartate
                     carbamoyltransferase"
                     /transcript_id="XM_027630497.1"
                     /db_xref="GeneID:38740636"
     CDS             157283..164077
                     /locus_tag="MRET_3870"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase/aspartate
                     carbamoyltransferase"
                     /protein_id="XP_027486380.1"
                     /db_xref="GeneID:38740636"
                     /translation="MSRESMSVSGQAPTAPTGISPSLRNALADSVPSRAPSPAPPVTL
                     APVGHEHAPRMVLELADKTELQGISFGAEGKSVSGECVFQTGMVGYVESLTDPSYEGQ
                     ILVLTYPLVGNYGVPARPASDDEVPKLKAPFESSRIHVAALVVAYYSHDFSHYLAASG
                     LSDWLKEQGVPAVYGIDTRALTKRIRTKGSMLGRLLALQPHAPMDENNWRQRMIDVPW
                     HDPNGENLVARVSRKTSMLFTPQDTQPAGLREANEPTLMHASGRPIRIMALDLGMKRN
                     QIRCFTSRGVELKVVPFDHDILSETEPYDGLFLSNGPGDPTHCMSTVERVRALISRKT
                     DVIPVFGICLGHQILALAAGARTTKMKYGNRGQNIPCTDQLSGRCYITSQNHGYAVDA
                     ASLPADWAELFVNANDHSNEGIYCQTAPFFSVQFHPESTPGPRDTEFLFDVFVRSVVD
                     HAAIRGPQTVGPVAFPGGRREEHEARFQRLRPKKVLVLGSGGLSIGQAGEFDYSGSQA
                     IKALKEEGIYTVLINPNIATIQTSTGLADKVYFLPVTPEFVLKVLQHERPDGIYCTFG
                     GQTALNVGIQLNDEFEKLGVKNLGTPIETILKTEDRDLFAQAMEEINEHCAPSASANN
                     WDEALQAARSIGFPVIVRAAFALGGLGSGFAKDEDELRQLCNTAFANSPQVLVEKSMR
                     GWKEIEYEVVRDCRDNCITVCNMENLDPLGVHTGDSIVVAPSQTLSDEDFHMLRTTAV
                     NVIRHLGVVGECNIQYALNPHSREYCIIEVNARLSRSSALASKATGYPLAFVAAKLGL
                     NIPLNELRNSVTRETCACFEPSLDYVVTKIPRWDLRKFLRVSSKLGSSMKSVGEVMAI
                     GRTLEESLQKAIRSVDPSFAGFSQNDLVDDAEIEEELASPTDRRIFALANALSNGMSI
                     ERIHELSSIDRWFLSKLAGIIATAKAMERSGAAQIPADLLRHAKQLGFSDHQIARYSA
                     STELAVRRRRQELGIMPFVKQIDTVAAEFPAHTNYLYTTYNALEHDVSFDDQGVMVLG
                     SGVYRIGSSVEFDWCAVRAIRTLRAKGFKAVMVNYNPETVSTDYDEADRLYFENISLE
                     TVLDIYEMEQSAGVIISMGGQVPNNIALPLHRQGVKVLGTSPEMIDNAENRYKFSRML
                     DRLGVDQPMWKELSSLEDAHSACARFGYPVLVRPSYVLSGAAMNVVYSPEDLSSYLSQ
                     ATAVNREHPVVITKYLEGAKEIEMDAVAKDGKLVMHYISEHVENAGVHSGDATLIMPP
                     QDLEAATVRRIEHATSMIVAALNVTGPCNIQFIAKNNEIKVIECNVRAARSFPFVSKV
                     TGVDAIEMATCAMMGLDLQAYPPVDMPRDYVGIKVPQFSFSRLGGADPILGVEMASTG
                     EVACFGRNKYEAYLRALLASGMRMPTNNVLLSIGPYSEKQELLPSVRTLHQLGFTLYG
                     SSGTADFYSENGIPVIHLEALPEDEDWRGEQGNKASYSLLTHLTQGRSSLFISLPSKN
                     KYRRPSSFTSMGYRARRLAIDRSIPLVTNVKNAKLFVEALAVHRRQGNEFHLLPVDAK
                     TSHVTCSFPGLVQLQAVVPALTKDAVAAYTRAAARGGFTSIVFAPLGAQSAIVDDASL
                     SAAEAALDGSCAIDASLTLLATPEHVDELPALAARVRALYVSYAGEAQVHSARTANVA
                     AYFAHWPEDKLIITDAAGAHLASALLLASLHRRALHVTNVRTRDDVQLIALSKKQGLR
                     VTCDVAVYALFFSSDMYPMASCLPSSSDQAALWEHLEHVDALSVHTVPHDLAVQTGHT
                     PSQPVAGLDDSVRLLLQAVNDGRLTLDFIESRLCTNPRTIFQLPEQPHTHVFAEVDRI
                     AQDDEQAGVWSPVQAAALRGTINRVEVRGQTIMLDGRWQTDAPLGSNVSAVAPPIKAA
                     AAAAETPAMPAVPASPSWPARSPFHRAARGMAPMDELRLDPIAGPAPATQLSLYHPSL
                     SRRHILSVRQFTRDDLHALFAVAQEMRFLVQRHGTLDILRGRLLSTLFYEESTRTSSS
                     FEAAMLRCGGQVVSINTSRSSVAKGETLADTVRTLGCYSDVIVLRHPAVGSSQEAAKF
                     SPVPIINAGDGVGEHPTQALLDVFTIREELGTVNGLTVTMLGDLKNGRTTHSLVRLLS
                     LYGVRVNFVSPPSLEMPREVIREVLKLGMPVYETANLDEVIGKTDVLYVTRIQRERFA
                     SPEEYEAVKGCYVVNNDVLARAKPDMVVLHPLPRVDEVDLEVDFDIKRAAYFRQMRCG
                     LFIRMALLAMVLQSPA"
     gene            <164166..>164993
                     /locus_tag="MRET_3871"
                     /note="MRES_15925"
                     /db_xref="GeneID:38740637"
     mRNA            <164166..>164993
                     /locus_tag="MRET_3871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630498.1"
                     /db_xref="GeneID:38740637"
     CDS             164166..164993
                     /locus_tag="MRET_3871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486379.1"
                     /db_xref="GeneID:38740637"
                     /translation="MPTPPAWDPDVALQWPPPYHALIGTYACVFASTTGVLLLYVMMR
                     RPRACYAYATGVSALSAAAMCVRYVRPERFYIARLLDLWLAEATLGMCMRLLDALMAL
                     VALSGRGAWPHRPAWQAYMRVSHIAWACSGLTVRSRLLYSLMYLLVCLQWGMYATTLH
                     RLRRALPVRERAPALTPTTAWRVSISLLHPPRPRQVSPNTLVYLHDLLGSAVVLCVQL
                     MFLVIYTYAEELRDFHAWIVHTTRLFSLVFVGLLMAPGLVPRFAAANYRAPRYPTCP"
     gene            complement(<165010..>165960)
                     /locus_tag="MRET_3872"
                     /note="MRES_15920"
                     /db_xref="GeneID:38740638"
     mRNA            complement(<165010..>165960)
                     /locus_tag="MRET_3872"
                     /product="BAR domain protein"
                     /transcript_id="XM_027630499.1"
                     /db_xref="GeneID:38740638"
     CDS             complement(165010..165960)
                     /locus_tag="MRET_3872"
                     /codon_start=1
                     /product="BAR domain protein"
                     /protein_id="XP_027486256.1"
                     /db_xref="GeneID:38740638"
                     /translation="MEHWKQWTASVGPLGQKLTERFGTLNQQARERFGHAQDLTELPA
                     EYKQLEQRVDALKSAHQHMVRTIKTYENEAYDYPHALQESVTHGAQHLGHTLSTWAAQ
                     ATKSAAPAPAASASHPRTLSHAIARSATAAAMDLSQCPPKVPAYAEGELVDTTESKLA
                     ELLRRFAVAQDAVGHARLHQDQSIVYSFLVVWNTFGAQIQMAIRARQQVRDARLHLDG
                     WRAHLKSAEQSSTPSGSKLASIREEVEQAEDKLVSATEEAISLMKTVLDNPEPIKSLA
                     QLVQAQLAYHRSAAATLEQLSADMSDVVTSVETDFRASRE"
     gene            <166084..>167097
                     /locus_tag="MRET_3873"
                     /note="MRES_15915"
                     /db_xref="GeneID:38740639"
     mRNA            <166084..>167097
                     /locus_tag="MRET_3873"
                     /product="mortality factor 4-like protein 1"
                     /transcript_id="XM_027630500.1"
                     /db_xref="GeneID:38740639"
     CDS             166084..167097
                     /locus_tag="MRET_3873"
                     /codon_start=1
                     /product="mortality factor 4-like protein 1"
                     /protein_id="XP_027486254.1"
                     /db_xref="GeneID:38740639"
                     /translation="MQYQPEEKVLCFHGPLMYQAKILMAEDWKGTENQHGAVGPHYFV
                     HYQGWKKTWDEWVPDARLLKYTDENLARQKALVDAHKAEAAAAAAVAAAHAENAASRS
                     KTDARHKGGSAAGPGTASGRRGSKRSRDASEADDHERKPDLRLVLPESLKSQLVDDWE
                     NITRKEQLVPLPRTPNVKQILQEFAERHRPSDARSSHVLSEVLAGLQLYFDKSLAQNL
                     LYRFEREQYVQMRKLHGPQPRDEEPKPARRGRAAQQEVPVNAAGQLDLEASDMYGAEH
                     LLRLFVNLPDIVSHTSMDPASVSLLRDHVHAFLAFLAQEQARLFCQAYQEPSPAYHRL
                     HSV"
     gene            <167181..>169607
                     /locus_tag="MRET_3874"
                     /note="MRES_15910"
                     /db_xref="GeneID:38740640"
     mRNA            <167181..>169607
                     /locus_tag="MRET_3874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630501.1"
                     /db_xref="GeneID:38740640"
     CDS             167181..169607
                     /locus_tag="MRET_3874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486375.1"
                     /db_xref="GeneID:38740640"
                     /translation="MNVQVDRNQPRTPATDSRALQNLIKSEKAYVDDLLGATSAAYAA
                     ASSLHAWGISETPDLDHASGIVSQALESAANAQKTYAQALDQYNASLRDMLDREQSIR
                     SIVRDRDILMSRVIKMTQRKPTRWELMKGEEDHQARVIDAQNELQACEQTLANETTAL
                     VAVKRRTFKEALTMRAKVLGDTGARMMDSARDILVFLDTFDADYPVAPVPIQPYTMPY
                     PPPPPPTVVGPADQHVFLSDASVFRHIMPQEAQPQPLIQPSAHDHALVYEQPQLPYEQ
                     AWTEPAADAVAPSPLPSMDHSSLMASPVPRSRSRTKRSSSLSRHLHAASLPTVPGGVP
                     TAPRMNLDHARDGFVAPAVPGGVPTAPRLFVHDNDSDELSTADTSVVHRPQRHRRVAS
                     DDGHRRSHSSGGGFFSRVSNLFRTDMAGAPSSSDALLSPRKSSSRSGRSSAWHMREHR
                     DSSDDEMPTNVTRHVNERVGASRATPRMPIRSREEQMLDDAIRQSVIGAGITARPSSR
                     QSDSYGISKGPPPAHVMHQRKTRSSSVDLGAPGATRKVKKRVSSDRVSSTGSAASTHS
                     VKTKKKRDPATGHAFPPPAPSSYFHPSKHATESWVTRPDQLAPGASSTPSSSRTATPL
                     KSAIKTKKTPKKKHISISESQTDIPFKLELGRPVDGTGSLGMDTTPAAESLAPALSYL
                     QVTAPPNQAAPDTEASEIYRAFLSEGIPTSTKEAPAPAAEAPPPAAPLAPAPLVREET
                     TPSPGPSTWNTRIGRRDADSSDEDDAALGGSDYYSARAAFGESTRHLGLATGAIQPSE
                     EGVKKKATRT"
     gene            complement(<169640..>170044)
                     /locus_tag="MRET_3875"
                     /note="MRES_15905"
                     /db_xref="GeneID:38740641"
     mRNA            complement(<169640..>170044)
                     /locus_tag="MRET_3875"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM13"
                     /transcript_id="XM_027630502.1"
                     /db_xref="GeneID:38740641"
     CDS             complement(169640..170044)
                     /locus_tag="MRET_3875"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM13"
                     /protein_id="XP_027486374.1"
                     /db_xref="GeneID:38740641"
                     /translation="MASRGSFLGSLHPSAVGVSEARRASRPFYLFAMAFSFTGSKSQA
                     SATNEQKEALKQRVSTEIAMANAQQLISKATDKCYTKCVPAPGSSLSSKEQTCAERCL
                     ERYFEAFNIVSATYVRRIAAERASGALATEAA"
     gene            complement(<170115..>170762)
                     /locus_tag="MRET_3876"
                     /db_xref="GeneID:38740642"
     mRNA            complement(<170115..>170762)
                     /locus_tag="MRET_3876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630503.1"
                     /db_xref="GeneID:38740642"
     CDS             complement(170115..170762)
                     /locus_tag="MRET_3876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486378.1"
                     /db_xref="GeneID:38740642"
                     /translation="MFVGGRYGRAWCACAVRQHKRVHVNGRTKGHADISAEARAPARW
                     CAGFRHDLVEAREPYRHDMRCGGRLENEPRYAPLEAAQACRAAQIDPALREDVYPRPR
                     AQARDRMIDSGLVDALAPEHFPSLSAMEEPAAELVFENNVTGAQAPAHGALLLKQRAG
                     QRAPHERLVEHGDVIRQGHDAAAFRGTLRIREKAHERIASQHTHTSAPQRQKPTR"
     gene            complement(<170921..>172981)
                     /locus_tag="MRET_3877"
                     /note="MRES_15895"
                     /db_xref="GeneID:38740643"
     mRNA            complement(<170921..>172981)
                     /locus_tag="MRET_3877"
                     /product="Bromodomain associated protein"
                     /transcript_id="XM_027630504.1"
                     /db_xref="GeneID:38740643"
     CDS             complement(170921..172981)
                     /locus_tag="MRET_3877"
                     /codon_start=1
                     /product="Bromodomain associated protein"
                     /protein_id="XP_027486253.1"
                     /db_xref="GeneID:38740643"
                     /translation="MSQDDAARASPGAERAHESDLDDDGRSSESWADSSSDDGRASPA
                     PQPPVRIKVKRSRTPSRPGDESASERPRALPRVPPADTLVSVRPLKQLRSKTLRAALD
                     ALIVGLKKRDSYLFFHEPVNADEVPGYRDVITHPMDLGTMEKRIHEGYYTHMDMFQHD
                     FMLVTQNAQQFNPPSSIYHTAARRLEVWGLRAIAREAMSVVDDDQLDAQQPEEPPARR
                     GRRKRSSLSIEAEPHAEHLSRRMMRIGSARSTTWSLQGVQTTDPDELLFRRTLAYAGV
                     GQHQLTGKSACSARVHAKPKRRLAPPLSTTATEDAVEDTEASPFAFHDDGSLDATQLA
                     DVREYLAQQTLLAPQVESLQHLPMMLAAQPPPNAAAASSPSSAAGAPPAPGEPSLVFP
                     PAQPGRPDALYAATRTYPEAASKNTSHSFEHTHVPDAQRALPYMLASVPGPSGLGTHG
                     TRPMRPIWPALPPPALQEARLRLNRRERELEQERDESNWTFFRPHMHRILAHEDVGLY
                     ASVPAWAACVSDDQPLQPYATASGEPLLHTLRECLRSLPYRAVGLPRTAQFVPRASLQ
                     HLPPALQVAMQGAQESERLIDTVYGSVDGLAYARSLAEFVGGASGDTHLHQHVRRAVL
                     EPMTGGLLGLLSDVGQSMQAHVDASDKLMQLLDDEDGSLAAALWQKSGAAPALDQVLQ
                     ALVE"
     gene            <173107..>174675
                     /locus_tag="MRET_3878"
                     /note="MRES_15890"
                     /db_xref="GeneID:38740644"
     mRNA            <173107..>174675
                     /locus_tag="MRET_3878"
                     /product="tRNA (guanine37-N1)-methyltransferase"
                     /transcript_id="XM_027630505.1"
                     /db_xref="GeneID:38740644"
     CDS             173107..174675
                     /locus_tag="MRET_3878"
                     /codon_start=1
                     /product="tRNA (guanine37-N1)-methyltransferase"
                     /protein_id="XP_027486327.1"
                     /db_xref="GeneID:38740644"
                     /translation="MSYIDKPRFHKPTHPARAKPVPEDPSLEPSTALRLPLLRSDHVP
                     SDAPPLQAHAQAGIEMQRRAMDDVRERDRQQAEQLEILMRAKAQLRKELPLCGVRCAA
                     AACSSLAHHPDVREHVFRSRRSKHIQPDPQGDAAVRVLQLSLQQDERVPQPLMAAVQA
                     WNGTLIPHPVVFDWDYWNVDQILRALLPDALEEGAPSAFSMVGHIAHVNLREEYLAYR
                     YLIGQVILEKTPRVETVVNKLDTIETEFRVFAMELLAGKPAYTAQVSESGCLFTLDFR
                     HVYWNSRLHTEHGRLIDQFLPFQVVSDVMAGVGPFAVPAAKKGCWVLANDLNPACHAS
                     LVHNARQNKVEAHCIPSCEDGRAFIRRSILQAWDAAFPAQDASLMSGRQKRRERKTPS
                     DTTPSALDPRPRRLIDHFVMNLPATALEFLDAFRGAYTDLAQHVGYEALEAEIQARQQ
                     APQLEPWPMVHVHCFTKDVEHAATDICARASAALGAHLAPSDVSLHLVRSVAPNKDMY
                     CLSFRLPRHVLYHP"
     gene            complement(<174755..>175204)
                     /locus_tag="MRET_3879"
                     /db_xref="GeneID:38740645"
     mRNA            complement(<174755..>175204)
                     /locus_tag="MRET_3879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630506.1"
                     /db_xref="GeneID:38740645"
     CDS             complement(174755..175204)
                     /locus_tag="MRET_3879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486326.1"
                     /db_xref="GeneID:38740645"
                     /translation="MITCENQHFPGRVGGGGGGVVGVWSCLPCEERRASALRRPSRVK
                     RLCVRAENGRRSSKLPPRPWHKQTRATGPTLQSYFSRLKVGHRSTSTIRATMLSGPAR
                     ARRWVSTRSTLRACTALSSSCVYSTSIRHTGRAWASPASSGGTVPRR"
     gene            <175455..>177224
                     /locus_tag="MRET_3880"
                     /note="MRES_15880"
                     /db_xref="GeneID:38740646"
     mRNA            <175455..>177224
                     /locus_tag="MRET_3880"
                     /product="cation efflux family protein"
                     /transcript_id="XM_027630507.1"
                     /db_xref="GeneID:38740646"
     CDS             175455..177224
                     /locus_tag="MRET_3880"
                     /codon_start=1
                     /product="cation efflux family protein"
                     /protein_id="XP_027486205.1"
                     /db_xref="GeneID:38740646"
                     /translation="MASEPPQRIVPALNPQRRVPRSAPTRTVPSSAHEARGAAQREHS
                     RRSSHIHARNLSAFFPRPGTDAAREYEAFRSQQPQILPKIVTQDAEPASPDTVSPVKR
                     RDQRRSERRASHILSPSMQLDPTQLISPDPMRASSAAWTSMPSRAVSESFVTPEEPLD
                     TLQPLPCGMYSLVAFSTVHFGLGATLWVMGQLRDSLALTGFGFLVVFDTLGLVNAICK
                     YRTKSAATEPLRRPFGMHRFESLLDFTLVLYLFFAGMYMCKENAEHALLASSAPHEED
                     RAGLVLPLGVLVLALGMCFGTNVVLRNHERLGMACGMGLDGWHESLDGRPRRPSHTRH
                     MSVLVRPVMAAQPLYHAFLNPFAGLILFFAMVLVASAVVLPPTQAASFDKLLAGLEGV
                     SMMYVSLTALRPLCKLLLQAAPPPNDAQLMQVQRALSKVESHPAVVGIPHVQTWQLTL
                     PSLGYTKSGIGTDGQRGLAHVLSMHRTIKSPPLVVTVHIKIKPDATAQEYEDVSRVAW
                     LHGSLALNVSPACQVGDAVRGSQCVGDLTVQVTREGQDAGHHHHHHDCHHHGHHHHDH
                     GHHHSHHHGHHHDHRHGHHVCQS"
     gene            complement(<177256..>177861)
                     /locus_tag="MRET_3881"
                     /note="MRES_15875"
                     /db_xref="GeneID:38740647"
     mRNA            complement(<177256..>177861)
                     /locus_tag="MRET_3881"
                     /product="20S proteasome subunit beta 3"
                     /transcript_id="XM_027630508.1"
                     /db_xref="GeneID:38740647"
     CDS             complement(177256..177861)
                     /locus_tag="MRET_3881"
                     /codon_start=1
                     /product="20S proteasome subunit beta 3"
                     /protein_id="XP_027486454.1"
                     /db_xref="GeneID:38740647"
                     /translation="MEYNGGSVVAMTGKNCVAIASDLRLGNQALLLSTQFDKVFKMTD
                     RTYVGLPGLATDVSTLHEKFRYRLNMYRMKEDRDIEPETFAKLMSSTLYERRFGPYFI
                     EPVVAGLNSRNEPFIAASDLIGCLNFAKDFVVSGTASDRLFGMAEGLWEPDLEPEDLF
                     ETISQTMLGGIERDALSGMGVVVRIITSDKVIERTLKCRQD"
     gene            <178027..>179174
                     /locus_tag="MRET_3882"
                     /note="MRES_15870"
                     /db_xref="GeneID:38740648"
     mRNA            join(<178027..178096,178120..>179174)
                     /locus_tag="MRET_3882"
                     /product="ATPase family AAA domain protein"
                     /transcript_id="XM_027630509.1"
                     /db_xref="GeneID:38740648"
     CDS             join(178027..178096,178120..179174)
                     /locus_tag="MRET_3882"
                     /codon_start=1
                     /product="ATPase family AAA domain protein"
                     /protein_id="XP_027486456.1"
                     /db_xref="GeneID:38740648"
                     /translation="MSGSWRKGLFQQISTFSMDSVAGAVLSSAAVAVSFYLVQAYFDP
                     HRQKKIDAKKISSKKLGQLGVNRREVKLTEYEEQIAVELILPEDIPITFEDIGGLDGI
                     ISSLQESVIAPLCLPDLFSGTNGLLGAPKGVLLYGPPGTGKTMLAKALAKESGATFIN
                     MHVSTLTNKWFGESNKLVAALFGLARKLQPTIVFIDEIDSFLRERSSGDHEAMAMMKA
                     EFMTLWDGLTSSTDRILVLGATNRPADIDSAILRRLPKRYAVGLPEASQRKKILSIML
                     ADVPCASNFDIDEIVRKTETYSGSDLKELCRAAAMVPVREVLRSREGRASVQKARENS
                     KAGLPTDSNLGMSVRPLKNSDFFQVDTAVPLPRPEPDTLD"
     gene            complement(<179179..>180117)
                     /locus_tag="MRET_3883"
                     /note="MRES_15865"
                     /db_xref="GeneID:38740649"
     mRNA            complement(<179179..>180117)
                     /locus_tag="MRET_3883"
                     /product="ATP phosphoribosyltransferase"
                     /transcript_id="XM_027630510.1"
                     /db_xref="GeneID:38740649"
     CDS             complement(179179..180117)
                     /locus_tag="MRET_3883"
                     /codon_start=1
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="XP_027486267.1"
                     /db_xref="GeneID:38740649"
                     /translation="MSQLLRPENLQDRLLLAIPKKGRLYETCISLLNGADIQFKRAHR
                     LDVALVTNLPIALVFLPAADIPRFVANGNVDLGITGQDMVRESGPDVSVSITEVMPLG
                     FGKCRLQVQIPEVGDKIQTVEDLIGKNVATSFEHLTSEFFRDLERKAGVLGENGQLKT
                     SIHSLSGSVEAACALGLADGIVDLVESGETMRACGLKPIDTLMSSEAVLISSSKPHEH
                     TNTSLISLITARIRGVIAASKYVLCQYNIQKDNLAEALSITPGRRAATVSPLRESNWN
                     AVSSMVNRSDVATIMDRLESVGASDILILSINNCRV"
     gene            <180251..>181978
                     /locus_tag="MRET_3884"
                     /note="MRES_15860"
                     /db_xref="GeneID:38740650"
     mRNA            <180251..>181978
                     /locus_tag="MRET_3884"
                     /product="transcription initiation factor TFIIIB 90 kDa
                     subunit"
                     /transcript_id="XM_027630511.1"
                     /db_xref="GeneID:38740650"
     CDS             180251..181978
                     /locus_tag="MRET_3884"
                     /codon_start=1
                     /product="transcription initiation factor TFIIIB 90 kDa
                     subunit"
                     /protein_id="XP_027486283.1"
                     /db_xref="GeneID:38740650"
                     /translation="MRCTNCGSLAIDFADSQAVCSACGVVLEESQIVSDITFAENTAG
                     GAVVQGSYLGADQVRARTSGPGFRGSSAGESRECTIANARWNINRMATARGVPAHVAE
                     RALRFFQLALDGGATTASGAQPKNFVLGRKSDYTVASCLYVACRMAKTTHMLIDFADV
                     IQVNVFVLGRSYLRLLRVLNLQMPLIDPSFYISRFAALLEFGDETQRVVTDATRLVTR
                     FKMDWMVEGRRPAGICGACLLLAARMNHFRRSVTEIVQVVKIADVTLRKRLEEFKSTP
                     SGQLTIEDFRSVWLEEEHNPPAFSRARIPKKDVRSVDSGAPAQPEEPLRSDIDQLADQ
                     ATEQEINSYLQQEDVQALDHDLAKQERQRVERAKLKHAAETPAAPAETPRSNEELTDL
                     DEAELDSFILTDEEVKIKERVWMEFNKDYLEAALARQLKLEADQKAGIAPAPRSRKRQ
                     KPRDGSTAPTNSAAESAKQMMQQKRWSRRINYDVLNSLFPSNKDKDSGGVAAPDTAHS
                     ALPAEEEDEDEEEDDNDDDDDEEGHTTKRARSTNDWMRLSGLASHADDEEDHLDDAAA
                     YADDNNDAW"
     gene            <182344..>184413
                     /locus_tag="MRET_3885"
                     /note="MRES_15855"
                     /db_xref="GeneID:38740651"
     mRNA            <182344..>184413
                     /locus_tag="MRET_3885"
                     /product="CobW domain protein"
                     /transcript_id="XM_027630512.1"
                     /db_xref="GeneID:38740651"
     CDS             182344..184413
                     /locus_tag="MRET_3885"
                     /codon_start=1
                     /product="CobW domain protein"
                     /protein_id="XP_027486284.1"
                     /db_xref="GeneID:38740651"
                     /translation="MAPAAATDSIRGTSAAPGAETAGHKAIYFSKFDVTDQTFYETEH
                     AVAIVNLKPVVPGHVLVIPRTPHKRLADIPAHELGALFEAVQSVGRVVESAYSGDSLS
                     IAVQDGASAGQTVEHVHVHILPRRERDIEPNDKVYDMLEAFGLELRDVHSGKQMDSER
                     RPRSKAQMQEEAKWLKEQCKQVLGSQRGGKLPVTLLSGFLGSGKTTLLRHILSSPDHG
                     LRIAVIVNDMSELNIDAQLIAGRKLIQGNENLVELSNGCVCCTLRADLLEHVAMLAQD
                     KHIDYLLVESSGISEPMQVAETFSAEFSDNAVEDERLAAILRKGGLPAVARLDTCCTV
                     LDAANVFHDFYTTDFLVDRHAGMVPEEDDRNISDLMVDQLEFADCVIVNKSDLVSPEA
                     LQQVVALVKKLNPSAHIIPASHGRVDIKAVLGTNSFSFEKAALSAGWLRSLVEEVQPE
                     TAEYGISSFVYRSRRPFHPERLWNTIRQCFVVIQEEFIDDGVEPEDATKEEAEDMDPE
                     DAPHDAAEDDDAQPALHPEARLQCKRESAVWSPLLRSKGFLWLATRPLLFGEWSQAGI
                     MLTLTGGARWRCEVPDEEWPEDEEICAAIRRDFDPSTPWGDRRQELVFIGRGIDHKLI
                     TETMDKCLLNDDEWAQWVDVMSRKDVSIEDKQNMLVDIFDDGFEDWVDGEAVDHDHDH
                     DHHMDES"
     gene            complement(<184414..>184914)
                     /locus_tag="MRET_3886"
                     /db_xref="GeneID:38740652"
     mRNA            complement(join(<184414..184496,184530..>184914))
                     /locus_tag="MRET_3886"
                     /product="DUF202 domain protein"
                     /transcript_id="XM_027630513.1"
                     /db_xref="GeneID:38740652"
     CDS             complement(join(184414..184496,184530..184914))
                     /locus_tag="MRET_3886"
                     /codon_start=1
                     /product="DUF202 domain protein"
                     /protein_id="XP_027486353.1"
                     /db_xref="GeneID:38740652"
                     /translation="MKLWYELENRGSVGRDHLALERTFLAWMRTSLTLVSIGIAIAQL
                     FRLPELILDRGSSSQRLFSWASTPIEGTPFAGGSFRMRTLQRLGSPIGILFVGFGILA
                     LLCGTVRFFHTQHSLIRGRFIPSRVEVFVLASVTGALLLVALGVMVSVATGVL"
     gene            <184970..>187507
                     /locus_tag="MRET_3887"
                     /note="MRES_15850"
                     /db_xref="GeneID:38740653"
     mRNA            <184970..>187507
                     /locus_tag="MRET_3887"
                     /product="SH3 domain protein"
                     /transcript_id="XM_027630514.1"
                     /db_xref="GeneID:38740653"
     CDS             184970..187507
                     /locus_tag="MRET_3887"
                     /codon_start=1
                     /product="SH3 domain protein"
                     /protein_id="XP_027486285.1"
                     /db_xref="GeneID:38740653"
                     /translation="MLECTDRQRQHKGPLTTMSFPWYARSIVKYKSPHPQDLSFPKDQ
                     DLRVLGYADRGAEEEEAEEEDDRWYVGEWLDGSRQGQFPASLVVRINSEEVDVPHSPA
                     MPAAEPISPPKDISSENASSVAPEHVQEKTPMNAEEPQEKVPVEGVQEFVHKEASGSA
                     EQPQEKVDVEEVTPQPEVTGMLPIEQPVVQTHTEQMPQDSERRAPVPREDVAEPVQER
                     APAPIKPSLSESVPDTQASATMPSHSPEDTPVGPAQGHAAPSSTADPQAAEPSIDPSA
                     MSLRDRIAAFNKPVEKGPPPPLPRGKPGGWKRPVPVHVAPKHVDARTDAAPSTMSASD
                     AQSSIKMSLKERMSALQRNEEAISRPTLTTERQTPSKLTNPLPTEPSGEDAEHRASIA
                     RRMAALGGRRVEPGLFGILPKAEASKQKDQQDVDQKEASEQDASEKAESQDSQTAVAS
                     TGEAPLVVPRRPVAPRTRRIKPAQETSKGPENSEVHHSTERQIPASESATDPPAPMDG
                     GASTVESPASCKAGEECPDGVLVMHKEPGEAPAAHNEQLSTLEGEVSNEFSVPARDTT
                     ESCVPAQQEAQTLPASDLLSTKPTLSSSEAPCKTEQDVQCASLTGSVDKPDVEPESQV
                     SKTVVPPIQEQEDTPLASEHDVYTGMETVPAEQPMIPSPSDPIEHIAYAMSTMPTRNG
                     VTEDSDQDFAEQHALLEHLLQHPGETSSIRQEPVSCLEERTSPAPPLIMGMPMPPRRS
                     THDNISPLSPMGHDTPSSHTSSPVHTETAPSARMPPRPTRRAPTLPVLEDSLTSPPNK
                     PGLPSNIIDVPIPNSDTRTEEATSPSSAVPDRPKRAPPRAPSSETAS"
     gene            <187561..>188208
                     /locus_tag="MRET_3888"
                     /db_xref="GeneID:38740654"
     mRNA            <187561..>188208
                     /locus_tag="MRET_3888"
                     /product="ribonuclease P/MRP protein subunit POP5"
                     /transcript_id="XM_027630515.1"
                     /db_xref="GeneID:38740654"
     CDS             187561..188208
                     /locus_tag="MRET_3888"
                     /codon_start=1
                     /product="ribonuclease P/MRP protein subunit POP5"
                     /protein_id="XP_027486229.1"
                     /db_xref="GeneID:38740654"
                     /translation="MVRFKNRWLLLTLASEPIPIPDDYGHQIPFANRAPNVTAHAITK
                     ALRTSLRVNFGDAASGAYAGPLMCKYYSPKSGIGIVRCARDGVRYVWGATTFLDSIDG
                     HRVRICVRSCGGTIRKIQRKAISIDKFYILRLEQAKMLNISALRHAAAELEKPTDTMD
                     VIDDDVGVPLDEDDDAASFDDNASLPCQETQDIPLSEECKTLLAKSQSDIMQVSH"
     gene            188266..188370
                     /locus_tag="MRET_t0063"
                     /db_xref="GeneID:38741257"
     tRNA            188266..188370
                     /locus_tag="MRET_t0063"
                     /product="tRNA-Met"
                     /db_xref="GeneID:38741257"
     gene            188577..188681
                     /locus_tag="MRET_t0064"
                     /db_xref="GeneID:38741258"
     tRNA            188577..188681
                     /locus_tag="MRET_t0064"
                     /product="tRNA-Met"
                     /db_xref="GeneID:38741258"
     gene            <188910..>189524
                     /locus_tag="MRET_3889"
                     /db_xref="GeneID:38740655"
     mRNA            <188910..>189524
                     /locus_tag="MRET_3889"
                     /product="Mob1/phocein family"
                     /transcript_id="XM_027630516.1"
                     /db_xref="GeneID:38740655"
     CDS             188910..189524
                     /locus_tag="MRET_3889"
                     /codon_start=1
                     /product="Mob1/phocein family"
                     /protein_id="XP_027486286.1"
                     /db_xref="GeneID:38740655"
                     /translation="MPQEHGTSAPAVDAAANEIQDTSLLGIQEHIASLLHQYPQAVTE
                     VVALPTKDGQPVISRDIWISEHLKRILRDINAPWISGILKECHNSNTCHAMRVGEDTY
                     MCRAHNDGRLCTAREYISHTIDAASEQLQSTKPISTSEDMRLPRPSHQLFSLVCKQLA
                     RIFSHIYLHHHDLFQRCEVTTSLYARFKKLTKTFNLMPDGLLLM"
     gene            complement(<189525..>191591)
                     /locus_tag="MRET_3890"
                     /note="MRES_15845"
                     /db_xref="GeneID:38740656"
     mRNA            complement(join(<189525..189568,189599..>191591))
                     /locus_tag="MRET_3890"
                     /product="zinc finger protein, C3HC4 type (RING finger)"
                     /transcript_id="XM_027630517.1"
                     /db_xref="GeneID:38740656"
     CDS             complement(join(189525..189568,189599..191591))
                     /locus_tag="MRET_3890"
                     /codon_start=1
                     /product="zinc finger protein, C3HC4 type (RING finger)"
                     /protein_id="XP_027486411.1"
                     /db_xref="GeneID:38740656"
                     /translation="MGAAHSRSVRERRERVQRQEEGMPPSTIPARRTREDDDSGQEHQ
                     DRGLRRRRLLSVPRGADDENMEVDEERALENGQARRSGWVQRTLGSLSSRRRLSSNNS
                     DLEPSISSRHTANDTNLSHDTSASIPNPDPLAAERQEAVSLIERVLGPRPAPPHHPSI
                     DPSSLSGTYRSRPSRFLRPENTPGGRPSSTLGTLLSEVLGATRGEPGAGAPGTPGAPL
                     SGTSVIVQGALVARTSASQGTDNTQTPTNDSASEHGPSLGTSHAGTESNGSTDSDIPH
                     VATLAEQGEMLGRILRIAAAATAASVVNQASANPTMASTAFAAPPQGSSQNQPSPSET
                     PQNHADTGESNFGRELLNRLMASRQATRHSSSAPRDRDTQSDSETVSNISRLMRDALR
                     ASLPQRGPSSQSQENRSASTGNTNNETVSSVLSTLESARQNEPLADGEPGSFDRFLRE
                     LLDDLNAAIHRMNGSDVESETTGDVRSRRDGDVVLGQLSFFRLHRFERPSDSSLIPCV
                     MVGVRSLRSDERLMGGDQAMPRDGDGNRPDVSRFVLFVSGGRYHEQHPLLVSRPRDAG
                     RDLMFMMELLGTIAAMSNKRPTTTAADIERSGLLKVKAKEIAALHREGRVTENTLDKC
                     LVCLDEWQEDDDCRVLSCKHVFHASCVDQWLENNSNSCPLCRKEAVSSSSASAP"
     gene            <191750..>194119
                     /locus_tag="MRET_3891"
                     /note="MRES_15840"
                     /db_xref="GeneID:38740657"
     mRNA            <191750..>194119
                     /locus_tag="MRET_3891"
                     /product="vacuolar protein-sorting protein BRO1"
                     /transcript_id="XM_027630518.1"
                     /db_xref="GeneID:38740657"
     CDS             191750..194119
                     /locus_tag="MRET_3891"
                     /codon_start=1
                     /product="vacuolar protein-sorting protein BRO1"
                     /protein_id="XP_027486410.1"
                     /db_xref="GeneID:38740657"
                     /translation="MQSPLIALPLKETKPVDLVKPLKNLIIQNYEQSPVSYMDELQRI
                     SQARQDATGQASTESLGRDLLFRYFHIIEMLELRFPELEAPFVWLDSFTHAPIEQRTT
                     AYEKACILYNTAAQITRVSMQLNRSDSSTDALKRAYTGLRQAAGLLQYIKNNFLYAPS
                     DDMKGPALESLSKLLLAQASEVFLEKSIHDTKGEALIAKLASHTAHTYSGLSVEWNDT
                     DNLRVPAMWCRIVACKADHFMSVAHLYRAKADRAAGKHGEALTRFRYALCKAQAASNL
                     TYLDTWSFATYLRSTAPSDVSESLHHLVSTQLTNASEACREAERDNDLVYHERAPELD
                     TLPHIDQVSMATAIPIRDVFSQPDIQKILGGDVLTSLIPLEVLKNTSVYTEEQAKMVR
                     AESTRICEANDRIDEAISALSLPHALDRYAALDGKPIPPCVPSQQVLDICEEVAVSHI
                     ISRVERVMESLPKQAPLIEATLSDAMADLDTDARECEHGRVKHAASWSQAPTASVARS
                     LRRDIHAARDALATARENDKGITQLWSDIRDDMALLCQGREAVEHAYSQHARLPPSMD
                     LLDHDFSDPEPARALLHETHAQIHALLSMPQEREAMLQELKRQVQNDDISRSLLLHRC
                     VQHMEETMFAQELRKYAPMQQRIRNHIALQTQRIEALRDSVDRLRTHPGAADVRRRWD
                     ASQGGAREWNARLVQAYDAYTDVQRAMNQAQVFYNDMSHTANQLATQAERLLAERRAE
                     RSSILMSSDTIPAATTAPRATTLAEDLAALRMSNPSSRGPPPPPRPPRI"
     gene            complement(<194121..>196961)
                     /locus_tag="MRET_3892"
                     /note="MRES_15835"
                     /db_xref="GeneID:38740658"
     mRNA            complement(<194121..>196961)
                     /locus_tag="MRET_3892"
                     /product="condensin complex subunit 3"
                     /transcript_id="XM_027630519.1"
                     /db_xref="GeneID:38740658"
     CDS             complement(194121..196961)
                     /locus_tag="MRET_3892"
                     /codon_start=1
                     /product="condensin complex subunit 3"
                     /protein_id="XP_027486474.1"
                     /db_xref="GeneID:38740658"
                     /translation="MRDSVLEQVQAQLPPHFQDAQFSVANHRKNCVSLYRLHARCTQV
                     TEQTERGTRLVGEKAFNETFFGCLHRVLGLKRGVKNADRICKFAATYAAYILGQFAAQ
                     DEDTETPAMRFVTILLKHLLKGFRAKNKHVRLRCCHCVSLLINVMDFLDDDLFETLLT
                     MLMERLTDREAAIRVQAVIALARLQTDEDGTEDHTLRLLLHILRHDSSAEVRRAALFN
                     IPPTPTTLPYLLERLQDVDATNRRCVYLGSLKMLLDTQPLIEREDGLTVREALGLGEV
                     SLSEVVRIGLHERDQSVRKAARKLVSMWLEATGFDILTLLNLLHVSRSANGEPVVLAL
                     LEDMPALRSQVTEMLSQQDVFWQDMSPAKALLARCFVMYCTTHALERELDTCIPVVTA
                     LVFRIQAEYDALNQVLEQQAEEEAQDDDMPILQDNRAMSRVFVVGEMLTIAMYCDYGD
                     EMGRQKMYMLVREILGNAWLPAELVPRCLDVLLRLSSGHRDFLQMVVELVQSLDEDMV
                     DPDASVRQALSWRQRVHADNPEMTPERAANKAALEARRLLIVQSMLERIACSLQDDTS
                     LEGLIQELIVPTIQSRDVALREQGIVCLGLCSILDGKAALVTFPLLLSQIQRAQGSIR
                     TRCVECLFDLTIVHGIDALCSQSAEVAAENEFDGDREQGLQYARQQMVNFLLSLLEHD
                     DPNVQTIASEGMAKLMLTGTLVEDDVLKSLILTYMSPYTADHSALRQCLSYFLPLFCS
                     SHVRHQHMVQRVFCDTMDVLVSVYEDASVRSQMITPSQMATQFIDWCHPSRLLLSEPD
                     EWIHMDLGIKLLEHALTSTSKELRKALVHVLGKLAWPARPLDSVRATKLDTLAKELRA
                     RADDASMRLALSRFEAALAKHTEGLPDAEALASLTPLLASLPPVKSAPASRSAQRRTA
                     RSPSTQAETEDEAEEDIEDEEDEEDDEDELAL"
     gene            <197068..>198189
                     /locus_tag="MRET_3893"
                     /note="MRES_15830"
                     /db_xref="GeneID:38740659"
     mRNA            <197068..>198189
                     /locus_tag="MRET_3893"
                     /product="lipoate---protein ligase"
                     /transcript_id="XM_027630520.1"
                     /db_xref="GeneID:38740659"
     CDS             197068..198189
                     /locus_tag="MRET_3893"
                     /codon_start=1
                     /product="lipoate---protein ligase"
                     /protein_id="XP_027486409.1"
                     /db_xref="GeneID:38740659"
                     /translation="MGSRPCARLCAHVRRYSTRPRIYVSHSNDALFNLAWEDFVFRTT
                     PGDVPACFLYINEPCVVVGRNQNIWSEVDPKAMCKHRVPIVRRLSGGGAVYHDLGNLN
                     FSFHSSKTHFLRATHTDLITRALRSPPISLPDRFGHAPVFRTQRNDLAVYDVHATHAS
                     DESVRKVSGSAYKLASGRAYHHGTLLLQANLQRMSMLKQRRNHIASKAVASVPSPVAN
                     LVDTFPAHAERLEWPCLFSAIRAEFERMYGASEMVDVDVSYLDARASDGRRQVTPRAT
                     YEDMQTWKWLYGSSPAFQVRASTKDVPYDVPLDLVLTCERGIIVRVDAESPDTPTRLA
                     AQALIGVKYDAVAQAPPSRVPPNAWHTHEKLGAWLYRAL"
     gene            complement(<198195..>203528)
                     /locus_tag="MRET_3894"
                     /note="MRES_15825"
                     /db_xref="GeneID:38740660"
     mRNA            complement(<198195..>203528)
                     /locus_tag="MRET_3894"
                     /product="chitin synthase"
                     /transcript_id="XM_027630521.1"
                     /db_xref="GeneID:38740660"
     CDS             complement(198195..203528)
                     /locus_tag="MRET_3894"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027486408.1"
                     /db_xref="GeneID:38740660"
                     /translation="MLVATNPCWDTSQLDADVAEAAYVHADLPSLPPHPYSLAARVYH
                     KMLCTHQSQSILYSGVTDAGKTHSMERVTEHLLTLSASHTQHESHIADQIRCAQHILH
                     AFGHAKTALNEQASRHATYWELHFSQKGRLRGAKVLAFGLDKHRISDVAPNERSFAIF
                     YQLLAGASPKERSEWGLDEVSLGSAVPTRDDARMFERTRRAFLVLGIKEKHIQGIFRV
                     LSAILHLKDVAFDDHVQITSPDALSRAADVLQVSVSDLQQSLVMDTQYIKSERITRML
                     DMHGANQQRNTLVQNLYAVLFAFVVEILNQKLVPREPAPRHIVQLDPPGFLLRGTLPK
                     GEHRAAHFDDLAKNYMADLIRHLSVRSILDADGEVGQQAQDGIAVPESRVPSDCMSLL
                     RGGPVPLHDTDIPPTEGILGNYERASQAVLDGSRGIDDDAALFRDLDVSHSSHRAFLA
                     TCQDETYAYEIQHALGTCAYSIVAHQRSELDLMPTQQLQTLRASRSPFVARLWAGPGL
                     AIESRLSEQQVLLRAQVLSSPLRRPTRLGQRLPSPEPHISGVLQQLDSTVITLLRTMW
                     QAETCWHVLCLRSMDLVKLSVFDKRRVATQVHALGISRILRAKQHSYIRVPLDEFQER
                     FGSVDRMVEMHEWTSPDDYALGTSYVYLAYNVWFSLDGYVGPIHAENAPAPTVDILPV
                     QSDMSMSQAPLLTHEPVDSKTDELDIPNETMGWDSGPLLLNRNVPFQPTEVEEIPVTP
                     MRKWWVYLTWGLTWWMPDSVLNHVLGKKRPDVRMAWREKVTICLLIFFLCAVILFYII
                     GIGRLLCPDFNNAWNEGQLSEHDSGKSFFVAVAGDVYDLSKFYKLDHSDIPSQPVTSD
                     VMMELAGKDLTSYFPVPLHAGCPGLVTDPSLELSQHQNLTAEIPQAIHKSGAAQTYDK
                     TKLKNENWYFHTFLPRMKPYRKGYYVYDRKSIRSESSWRKWAIVHHRIYDLSNYVYSQ
                     ERHPADDKYSFLPNDLVDLFDAQAGEDISSDFDALMDSLPSNRRHQTQQCLDNAFHVG
                     QTDFRQEPKCVVQNYLLLSFSVLIFCSIFAKFLSALQLAHRPTPEQQERFVICHVPCY
                     TEGEESLRKTIESLAVQEYDDKRKLLFIVCDGMIVGSGNEQPTPRIVLDILGVDPQVD
                     PEPLPFKSIANGSKQLNYGKIYSGLFHHEGHSVPFIVVVKVGRPSERSRPGNRGKRDT
                     QILLMRFLNRVHFDAPMFPLELELYHHMKYVIGVDPTLYEFVLMVDADTSIAPDGMNR
                     LVAASVDDPRTIAVCGETLMDNEGTTVWTMIQVYEYYISHNLAKAFESLFGSVTCLPG
                     CFSMYRLRSADKGRPLFISDRILDDYSENHIDTLHKMNLFALGEDRYLTTLLLKHFPL
                     YRTKFRNDAQAHTAAPESFSVLLSQRRRWINSTVHNLVELVRMKGLCGFCLFSMRFIV
                     FIDLIGTIILPATAVYMVYLIVTVATGSSPLPIVAIAMIGAVYGLQAIIFLLKRQWQY
                     IGWMIIYLIAFPIYAFLLPIYSFWHMDDFSWGNTRVVVGEKGNKKVVAGTDDEPYDDS
                     MIPRKTVTEYQHELYAHDADPTSAPNETLLYEAMQPSKSALSHSLTPMVESTDMDDYF
                     QHTNLLEGKGKRQSNRQSTASWMPMSSFGHDSYASHPSMMLGGMPMYPTPSMMPPPPM
                     YGMPSFMPSFSDVHASMLSGSGAGGIWGGSSSDHHSATSLPIDYTEDPTNEQIRSQIR
                     SYLAAQPSLIQVTKRHVRDAVAASMPNADLSTKKALMNRMIDELLSGRSYT"
     gene            complement(<203720..>204439)
                     /locus_tag="MRET_3895"
                     /db_xref="GeneID:38740661"
     mRNA            complement(<203720..>204439)
                     /locus_tag="MRET_3895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630522.1"
                     /db_xref="GeneID:38740661"
     CDS             complement(203720..204439)
                     /locus_tag="MRET_3895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486407.1"
                     /db_xref="GeneID:38740661"
                     /translation="MDVAFEGYQGAKLSGRWHTSPTECRGIAVITHPYGFLGGSQDEP
                     IVQLLVGHYLTQGMHVMTYNARGVQPSQGRVSWTMRSECEDMRLAVAYAMDRTTPDTR
                     TPYVHVAGYSAGSMQASTVRPALTGPWSHAHVSYLLLSYPLGVRWALTCLQTSFFAHA
                     LDDLVARISDRVSVHVIYCSRDQFTSAERYRAWESHLRTLSPQCVVDAVETDHMWSSR
                     RARAVLVELLERQSPTNQVRS"
     gene            complement(<204507..>206762)
                     /locus_tag="MRET_3896"
                     /note="MRES_15820"
                     /db_xref="GeneID:38740662"
     mRNA            complement(<204507..>206762)
                     /locus_tag="MRET_3896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630523.1"
                     /db_xref="GeneID:38740662"
     CDS             complement(204507..206762)
                     /locus_tag="MRET_3896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486350.1"
                     /db_xref="GeneID:38740662"
                     /translation="MYHSSSPIKGASAASSPRVRKRPSAYLEVSTIGSCPSVLSLDEM
                     AELEDSVASLRRKPSNDEFSRIVSEISMHRRINTSVRSRRSHQSLASSDDGRSGHSRV
                     GSVDGDVSSASAVTIPPCCCGQAECDVSRRITQQIHDMESDLQLSAEIGQALLQRQDT
                     IVHRSQQEAEEHAQQRDQLLARLSQTIKETQVLERQLSQANFNLEAADQSQHALLSEL
                     DEVRHQLKQMKMHRVKTSHLDAKLERAHNELEDMRAELAKERRRYAAAEAKHKQVISQ
                     RCDEMQSRWNEEHERWSCPTETRVWDQIRTHLASQDVETKETDWLSDDALRAMMEEHE
                     IMRRENEHLQALLRTTNDEVAELREMSEGPGPLVGVSLETDLGAQDRRSDARSDDTRP
                     SDCGMSEGTGITTPSTSSYAHFDEDAMSYDTGSLHRFDSDRHLPVSHNEHRTAMLSSF
                     IETASNTFTKIQKADIDSLASRLQRQKLAGDVGHLSRTTVQSSVRDIEEWRDHFRKAV
                     DKEARRGVPQDSSLVSRRDFFALLKLQRESLLELARLRQCINEVHLHPSAAAKLLHEH
                     LGAHTISTNRSWISRMFTGVLSSEPGPAPVEAPASTAASPASNETSFVRIAGAESAPM
                     AVPRNVPTSRLSGAPPSRVMPRSRAAALSTSVAVHAHGAYTKPGMLKTKASQPALMEA
                     AISAKRATSGAHGDTSMVAPPPWQEPSLRPRTRGLSDSSIHSTFLEHGATSDNVVDRV
                     ITPHTLTLSTD"
     gene            complement(<206957..>207673)
                     /locus_tag="MRET_3897"
                     /note="MRES_15815"
                     /db_xref="GeneID:38740663"
     mRNA            complement(join(<206957..207478,207503..207580,
                     207606..207625,207649..>207673))
                     /locus_tag="MRET_3897"
                     /product="charged multivesicular body protein 1"
                     /transcript_id="XM_027630524.1"
                     /db_xref="GeneID:38740663"
     CDS             complement(join(206957..207478,207503..207580,
                     207606..207625,207649..207673))
                     /locus_tag="MRET_3897"
                     /codon_start=1
                     /product="charged multivesicular body protein 1"
                     /protein_id="XP_027486239.1"
                     /db_xref="GeneID:38740663"
                     /translation="MYSSGGLENSLFQLKFTIKSLQRQANKAARDEATEKAKLKKALA
                     QGNSEGARIYAANSIRKKNESLNLLRLSSRIDAVASRVETAVSMRQVTGGMAHVVRGL
                     DRAMQTMDLERISLVMDKFEGQLEDVDVQTSYMENTMNATTATGMPQDQVDSLLQQVA
                     DENGIEVHQQLGEAGLAGKVSDLPAESSSARRNAPSADQDEALAQRLRALRPAT"
     gene            <207754..>208233
                     /locus_tag="MRET_3898"
                     /note="MRES_15810"
                     /db_xref="GeneID:38740664"
     mRNA            <207754..>208233
                     /locus_tag="MRET_3898"
                     /product="protein of unknown function (DUF2416)"
                     /transcript_id="XM_027630525.1"
                     /db_xref="GeneID:38740664"
     CDS             207754..208233
                     /locus_tag="MRET_3898"
                     /codon_start=1
                     /product="protein of unknown function (DUF2416)"
                     /protein_id="XP_027486238.1"
                     /db_xref="GeneID:38740664"
                     /translation="MADARGEPVTTWWVGLRQHAHDSRPAYALSALCAMSMPFGFGQA
                     IKMAGNEAAKKAPRLIPPFWQMLGFSVFFGTGAYMIDHGDTLNGSGVISAWSLTYVTF
                     HTLPKLRWLYRSPLSLLLSTAVTGMGLGVYANYYFDKSSWRGAVPGLLPQPRQEADK"
     gene            complement(<208248..>210356)
                     /locus_tag="MRET_3899"
                     /note="MRES_15805"
                     /db_xref="GeneID:38740665"
     mRNA            complement(<208248..>210356)
                     /locus_tag="MRET_3899"
                     /product="mitochondrial distribution and morphology
                     protein 31"
                     /transcript_id="XM_027630526.1"
                     /db_xref="GeneID:38740665"
     CDS             complement(208248..210356)
                     /locus_tag="MRET_3899"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 31"
                     /protein_id="XP_027486266.1"
                     /db_xref="GeneID:38740665"
                     /translation="MSSLWRSAAMAVGTRRMAWEVAHVHMSAVRRTLPPPRPEEDEKK
                     KHLEPSSSSGRELVDRPLFQNYPRTLRELALRVRRITGPKGEDSKTHLPHRPTRDELL
                     SMAHGFWTRMRIHFKWITIRGFRRFNIDDLSAFFTLGGLGTAIWVIVGTTTFVSVIFA
                     ALSLLNMQEWIALQLAKILSRQMGFTIVFGSAIVPKWKEGRISFKDVVITRRAEPTDP
                     VKLHAEHRDDAVSPSMSMQLGAEPAIPAYDTGDHVVQPFDDEHQVERDASTNFSMFEL
                     HIDSIDVQLSLSRWFDGRGLLHTMDVRGVRGIVDRRHVFWDPDRPYDPRKARRTAKTN
                     DIDLDSFTVEDFLVTLYQPGDFRAFNVSIFHARIPRLRAQWLFYDLLNADSITGQVDG
                     CLFSLHKPQSVYHTARDMYRKVADQHTPYIQNWSRLRVDGVNIDHVQKMAGLSGPLMW
                     IYSGRFDLVADIKFPRQYGENVDINTILSEIRDTLNATFAGERAATRDSGDALIPGQP
                     ELSGPAIVAPVTTVGPQAERARQERAGHDAAARRSRSTYPPRSDAADDDVASLDHTTD
                     IRPSVVIELDVRFKDIKASMPIFTRELNYSTYALARPIVAFMNANKTLIPVKCRILMD
                     LSEFDGSLDLSQTGLPPLVSQKIWEALAHHVASQQANHQRVRNVSLWTLDAIAHGLLR
                     LARHLRDTLTRATPPEVATA"
     gene            <210439..>211015
                     /locus_tag="MRET_3900"
                     /note="MRES_15800"
                     /db_xref="GeneID:38740666"
     mRNA            join(<210439..210484,210510..>211015)
                     /locus_tag="MRET_3900"
                     /product="centromere protein k"
                     /transcript_id="XM_027630527.1"
                     /db_xref="GeneID:38740666"
     CDS             join(210439..210484,210510..211015)
                     /locus_tag="MRET_3900"
                     /codon_start=1
                     /product="centromere protein k"
                     /protein_id="XP_027486204.1"
                     /db_xref="GeneID:38740666"
                     /translation="MAEERLASAILEVQRRLAAPPDSIRASYDREHMSQTLARCIAQH
                     RALLAEAEEALAWEKRMHAENAALLDDMSRMRDAPAPLPPSSHTESELLAALVRVTDR
                     AFDDRRQCQQLRQVLDLLLNALWDCPDDPYVSMRGLDTQVAAFLHQAGLVRAHPTEPD
                     AVRLVAFHEALPDARTSRPTVYG"
     gene            complement(<211026..>211961)
                     /locus_tag="MRET_3901"
                     /note="MRES_15795"
                     /db_xref="GeneID:38740667"
     mRNA            complement(<211026..>211961)
                     /locus_tag="MRET_3901"
                     /product="peroxisomal carrier protein"
                     /transcript_id="XM_027630528.1"
                     /db_xref="GeneID:38740667"
     CDS             complement(211026..211961)
                     /locus_tag="MRET_3901"
                     /codon_start=1
                     /product="peroxisomal carrier protein"
                     /protein_id="XP_027486268.1"
                     /db_xref="GeneID:38740667"
                     /translation="MSKQQQQVPLTPFENALAGALGGVFSNAVIYPLDTVKTVIQADH
                     KASSEKTKKQLGMLQTLVVIARAKGVRSLYRGFFANMANTFIQQFAYFYWYSLVRSVY
                     IKRVLRAATATPVLSVLTELVLGAVAAALAQLFTTPVGVIATRQQVGSASDGEEEDNS
                     ILGHIRDIYHQDGVAGFWRGLKPSLVLTINPAITYGVYERVKSVILAASGGHMTPGKS
                     FVIGALSKSLATVVTFPYILSKTRLQTKNTPHNTAFAVLYHIYEQKGVIGWYQGMHAQ
                     ITKAVLSQALLFFFRDYFEMWTRQLLVLSNTKSVP"
     gene            complement(<212133..>213691)
                     /locus_tag="MRET_3902"
                     /note="MRES_15790"
                     /db_xref="GeneID:38740668"
     mRNA            complement(join(<212133..213581,213617..>213691))
                     /locus_tag="MRET_3902"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_027630529.1"
                     /db_xref="GeneID:38740668"
     CDS             complement(join(212133..213581,213617..213691))
                     /locus_tag="MRET_3902"
                     /codon_start=1
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="XP_027486422.1"
                     /db_xref="GeneID:38740668"
                     /translation="MVDKLSSSLDSVGLRNERQRAGSHIDFKSATSAVASKAMRNELN
                     ALIEGIEDPNAKRAFEAEMSSFYHLFNRFLAEKAKGVKLDWDKIQPPAAEQVTPYASL
                     PQASDPSVLSKLAVLKLNGGLGTTMGCTGPKSIIEVREGMTFLDMSVRQIEHLNGTYN
                     VNVPFILMNSFNTDDDTARVIQKYANHNVEIMTFNQSRYPRINRDTLLPCPRSATSNK
                     NLWYPPGHGDLFDAMHNSGLLDSLLAMGKEYVFVSNVDNLGAVVDLNIYQHMIDTQAE
                     FISEVTDKTKADVKGGTLIDYEGTIRLLEIAQVPDEHVEDFKSIKKFKIFNTNNLWLN
                     LRAIKRVVENDELDLEIITNNKSLDNGEPVIQLETAVGAAIKHFRGAKGVNVPRSRFL
                     PVKSCSDLLLITSDLYSLEHGKLVMNPQRQFSQTPVVKLGDTFKKVANYQKRFKSIPK
                     MMELDHLTVMGDVSFGRNVVLKGTVIIVANEGNHIAIPDGSVLENKLVTGNLSIIDH"
     gene            complement(<213967..>214821)
                     /locus_tag="MRET_3903"
                     /db_xref="GeneID:38740669"
     mRNA            complement(<213967..>214821)
                     /locus_tag="MRET_3903"
                     /product="capping protein (actin filament) muscle Z-line,
                     beta"
                     /transcript_id="XM_027630530.1"
                     /db_xref="GeneID:38740669"
     CDS             complement(213967..214821)
                     /locus_tag="MRET_3903"
                     /codon_start=1
                     /product="capping protein (actin filament) muscle Z-line,
                     beta"
                     /protein_id="XP_027486269.1"
                     /db_xref="GeneID:38740669"
                     /translation="MSADALSLSLDMMRRLPPQHVTSNVEALMQVLPNDAEDLASSVD
                     QPLTLRVDDSPGGAGREFVCCDYNRDGESWRSWYTNTFHPPLDGEPIVPVGALRELEL
                     QANDAFDTYRKLYYDTGYTSTYLWDLEGDDPSKLPTKFAGAVLFKKALQGPASDAAKG
                     TGGAWDSIHVFEVHVTGRTAQYKVTSTVMLTLKRQAPGELGLVDLSGHLTRQGQDTQG
                     VTDSASHIVNLGRLLEDMESKIRNQLQEIYFGKMRDTVDQLRSTEDLEALRLAQQLQE
                     ELRGGWER"
     gene            <214890..>215984
                     /locus_tag="MRET_3904"
                     /note="MRES_15785"
                     /db_xref="GeneID:38740670"
     mRNA            <214890..>215984
                     /locus_tag="MRET_3904"
                     /product="protein phosphatase 1 regulatory subunit 7"
                     /transcript_id="XM_027630531.1"
                     /db_xref="GeneID:38740670"
     CDS             214890..215984
                     /locus_tag="MRET_3904"
                     /codon_start=1
                     /product="protein phosphatase 1 regulatory subunit 7"
                     /protein_id="XP_027486423.1"
                     /db_xref="GeneID:38740670"
                     /translation="MTKKVQVVGAPPMVQRPPATQESDSEAEAPHESEHIDGHGDDEE
                     HGDDEEHGDDDMDELMSAFEDDETDLDLTHLRIKSTKNMHLARFHDTLVRLVLRQNEI
                     RSMRGKDLGAVPHLQELDLYDNAIEHISGLENNLELEILDLSFNNIRHVSRVSHLPRC
                     HTLYLVQNKIAHIRPTDLQPPIAWSLRSLELGGNRLRSLENLSHLINLEELWVGKNKI
                     TSLQGIAPLTKLRVLSIQSNRLTKLEGLETLTALEELYLSHNGIKKLENLEHNTQLTT
                     LDFCANQVTTIEHVRHLSRLSQFWANDNLITDLNHLDAHLGPQYMPHLDTVYLEGNPG
                     QKSEGANYRRKVQLALPQIAQLDATLVRRS"
     gene            complement(<215999..>216438)
                     /locus_tag="MRET_3905"
                     /note="MRES_15780"
                     /db_xref="GeneID:38740671"
     mRNA            complement(join(<215999..216327,216354..>216438))
                     /locus_tag="MRET_3905"
                     /product="large subunit ribosomal protein L41"
                     /transcript_id="XM_027630532.1"
                     /db_xref="GeneID:38740671"
     CDS             complement(join(215999..216327,216354..216438))
                     /locus_tag="MRET_3905"
                     /codon_start=1
                     /product="large subunit ribosomal protein L41"
                     /protein_id="XP_027486399.1"
                     /db_xref="GeneID:38740671"
                     /translation="MFRATEPVWSKASRLPLTSKKANKDFYKGTRAANVLLRKRIALA
                     DPKGHQLYDDKDRPRTWNLRTHRIDEARMVSFVVPPGLADTRLKPYVYLGNASDGGTE
                     RPQPGQPGAPKMPAGGMNATYYSRLVDRALLSKAK"
     gene            <216584..>218470
                     /locus_tag="MRET_3906"
                     /note="MRES_15775"
                     /db_xref="GeneID:38740672"
     mRNA            <216584..>218470
                     /locus_tag="MRET_3906"
                     /product="ATP-binding cassette, subfamily F, member 2"
                     /transcript_id="XM_027630533.1"
                     /db_xref="GeneID:38740672"
     CDS             216584..218470
                     /locus_tag="MRET_3906"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily F, member 2"
                     /protein_id="XP_027486270.1"
                     /db_xref="GeneID:38740672"
                     /translation="MPPVSASKAKRQAEKAAKAAAKGEKTGSSKDSVSTGSTKGSSST
                     KGTSVDEEGPITDMKKLAIATERNASGVIVSDKQSRDLHIESFSMSFHGRLLIDNATV
                     ALNYGQRYGLLGENGSGKTTFLEALANRDVEIPEHIDIYLVRGEADPSDENALDYIIK
                     SAREKVARLEKEIEDMSVADDVDDVALELKMEELDELDPSTFEARAGAILKGLGFSQA
                     MMSKPTSDLSGGWRMRVSLARALFIKPHLLLMDEPTNHLDLEAVVWLEAYLSTYNHIL
                     VLTSHSADFMDNVCTNIIDLTIQKKFITYGGNYSIYVRTKSENEVNQMKAYQKQQEEI
                     AHIRKFIASAGTYANLVKQAKSKQKIIDKMEAAGLIEPVVQPKQLRFNFEDVRKLPPP
                     IIAFNDVGFSYSGKEEDFLYKDLSFGIDMDSRVAIVGQNGTGKSTLLNLITGMLQPVA
                     GSVQRHSGLKLGKYSQHSADQLPYDKSPLEYIESMNKEKFPDKDVQFWRAQLGRFGLS
                     GAHQTAPIRTLSDGLRNRVVFSQLAMENPHILLLDEPTNHLDMSSIDALANAIKDFEG
                     GVVIVSHDFRLISQVANELWEVKDRKIVNLTKQDISIQDYKKILMNNSAEAMERAKLT
                     AKTS"
     gene            <218676..>219377
                     /locus_tag="MRET_3907"
                     /note="MRES_15770"
                     /db_xref="GeneID:38740673"
     mRNA            <218676..>219377
                     /locus_tag="MRET_3907"
                     /product="nuclear transcription Y subunit beta"
                     /transcript_id="XM_027630534.1"
                     /db_xref="GeneID:38740673"
     CDS             218676..219377
                     /locus_tag="MRET_3907"
                     /codon_start=1
                     /product="nuclear transcription Y subunit beta"
                     /protein_id="XP_027486402.1"
                     /db_xref="GeneID:38740673"
                     /translation="MASAENGVAPTPGISSSENLSAVAVSPPSQALKDTSASDALASQ
                     DAIQTSFGMSSNESPDASKAGSEAGARPWPTGLPPLPPHLMGADLPIANISRIMKRAL
                     PDNGKIAKNAKECMQECVNELISFVTSEASDRCGSEKRKTINGDDILYSLRVLGFDNY
                     EQVLKVYLSRYRQAQEDNPRQRRRRAMKRRSSPSSRTGSGDGDLSTTEGAVDDDAQED
                     DDDEDAASDEGGDEE"
     gene            complement(<219544..>220080)
                     /locus_tag="MRET_3908"
                     /note="MRES_15765"
                     /db_xref="GeneID:38740674"
     mRNA            complement(join(<219544..219548,219578..219600,
                     219627..219749,219775..219956,219981..220042,
                     220068..>220080))
                     /locus_tag="MRET_3908"
                     /product="protein cornichon"
                     /transcript_id="XM_027630535.1"
                     /db_xref="GeneID:38740674"
     CDS             complement(join(219544..219548,219578..219600,
                     219627..219749,219775..219956,219981..220042,
                     220068..220080))
                     /locus_tag="MRET_3908"
                     /codon_start=1
                     /product="protein cornichon"
                     /protein_id="XP_027486271.1"
                     /db_xref="GeneID:38740674"
                     /translation="MNGEGWLFLFSILLTAILLFVMVFYVIMYSDLESDYINPIDLCT
                     KLNQFTLPEMSAHAVLTLLFLLNGQWIALAINLPLFAFNANKVINKTYLLDATEIFRT
                     LMSHKKESFVKLGFYLLTFFFYLYRMIMALVEE"
     gene            complement(<220172..>223321)
                     /locus_tag="MRET_3909"
                     /note="MRES_15760"
                     /db_xref="GeneID:38740675"
     mRNA            complement(<220172..>223321)
                     /locus_tag="MRET_3909"
                     /product="structural maintenance of chromosomes protein"
                     /transcript_id="XM_027630536.1"
                     /db_xref="GeneID:38740675"
     CDS             complement(220172..223321)
                     /locus_tag="MRET_3909"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein"
                     /protein_id="XP_027486331.1"
                     /db_xref="GeneID:38740675"
                     /translation="MPTHPALSFRPGSIVRVACEHFVTYDAVEFRPGPHLNMIVGPNG
                     TGKSTVVCAIALGLGWKPSVLGRAKDVASYVKLGHSQGWVEIELQGTESNVTIRRILF
                     RESNTSDWMLQGVPASARQVHQAVSQFNIEVGNLCAFLPQDRVADFAAMTPSKLLQDT
                     QHAAGHAQLSEWHAQLIDYGHQRAALDARLEQEQKEHDHLEERNAVLERDIRRYEERL
                     DLEKRVAALQVRIVFAQYYDVKAQYDAARAKREEGKRALERLLQDQAPLERAVELANE
                     KLEKAQVVMQTHKREADEAHTAILRLTASREELDTTLASLTEQEKQLEAHDAERHAAI
                     EDMRTKIAEMERIIASDTPPGPLEPLDGQLRSRKAEHRVACDELHDMDTQCLELRTRQ
                     QRLSSQMDEARRSLDAVDTARHRRLQIMARADRDTFEAVQWLEHHQDLFERTVHEPVL
                     LILQITRPEAARAIETCLSWPVQRTFVCETRADYDLFTRELIDKRKWRLNVVELESTR
                     STYTPPIPPSDLAALGFDAYAMDCVDAPNEVLKYLCSASNLHAIPISFRGDRVRPQDM
                     EQYRAIRRYIVADTVFTTTYSSYGRKLPQTMSRVLKPLRNFAYQQDSSERERAEESMT
                     SYQRQLDHLQSELERRQHDRTQHAQHCDALAQDLARIKDAHHELYTKHREWERREAKI
                     AAQRANLAQEEAKPSITIQRRRIHAERHKLACDMAKISERLCRCLLSMTRANASSDVH
                     GLAMLHVYADVEACRATLREHRTRVEEAETALRSVLDDFTAVKSQTKELQARAQQQWR
                     NATDEVQAMVQSQAEDESVAQLEAQLARLQAQLEVPWGVGPSVLETFRERKEKILELQ
                     RSLEGGRAERERCVSAMQRVEEQWLPALETLIQAVNERFSAAFDRMKCAGEVRLARDA
                     THYEKWGIDILVKFRDTERLQLLTGQRQSGGERSLATILYLLSLTELSRTPFSLVDEI
                     NQGMDPRAERAVHSQMVAMTCTPEAGQYFLITPKLLPGLAYHELMKVLIINNGEWLPE
                     RLPLRELIQKKRAAVAAGP"
     gene            <223367..>223918
                     /locus_tag="MRET_3910"
                     /note="MRES_15755"
                     /db_xref="GeneID:38740676"
     mRNA            <223367..>223918
                     /locus_tag="MRET_3910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630537.1"
                     /db_xref="GeneID:38740676"
     CDS             223367..223918
                     /locus_tag="MRET_3910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486310.1"
                     /db_xref="GeneID:38740676"
                     /translation="MAGAVAAWLEAMGVAEASWEAFVVWLDRMPPDVLREWGRRYSAQ
                     QRGTIARMRERRRQYVERAAPPELGVAALRALCPTLWQHLVAGADGEQESDDDTEPLG
                     QASEASTDALYELPSKYMEATDQDAIDPQTPRALVDVFRRTVLAQFVTGTLRVAPALY
                     EASDFDEQWDVASGDEDAWLEGV"
     gene            complement(<223921..>224346)
                     /locus_tag="MRET_3911"
                     /note="MRES_15750"
                     /db_xref="GeneID:38740677"
     mRNA            complement(<223921..>224346)
                     /locus_tag="MRET_3911"
                     /product="large subunit ribosomal protein L13"
                     /transcript_id="XM_027630538.1"
                     /db_xref="GeneID:38740677"
     CDS             complement(223921..224346)
                     /locus_tag="MRET_3911"
                     /codon_start=1
                     /product="large subunit ribosomal protein L13"
                     /protein_id="XP_027486382.1"
                     /db_xref="GeneID:38740677"
                     /translation="MSQRVGNTTLAFARVWHHVDARERVLGGLARSIAVTLMGKNKPV
                     YDPSRDVGDYVVVTNAEHITVTGQKADKKLYRHHTMYPGGLKEIPFKTMMQTKPEQIL
                     RRAVSGMLPKNKLRDRRLERLKIYPNDAHPYEANIIKRY"
     gene            <224456..>225310
                     /locus_tag="MRET_3912"
                     /note="MRES_15745"
                     /db_xref="GeneID:38740678"
     mRNA            <224456..>225310
                     /locus_tag="MRET_3912"
                     /product="clathrin light chain"
                     /transcript_id="XM_027630539.1"
                     /db_xref="GeneID:38740678"
     CDS             224456..225310
                     /locus_tag="MRET_3912"
                     /codon_start=1
                     /product="clathrin light chain"
                     /protein_id="XP_027486381.1"
                     /db_xref="GeneID:38740678"
                     /translation="MAFEQGASDLTADFLQREKQAAGVLLGDDEALFGAPSAGEHDFE
                     RRAREFPALDDDGAFEAALSKSEEATAAQPVPVTSDEDRFRASYPDIDAPVSGLDAED
                     AQHAWEATAPRMQKETLYELERDVPAPAPEAEPAPPVTEPVDVGPTPFTYEALDEETE
                     ALRSWRERQADDVARREAQAERERAEAVSRAEREMDEFYANYRAQKEKNIKKNKEDEA
                     QFQQQRQAELAEGTTWTRITKLLDLQHSQSKTIAKGGAGSSDLTRMKDLYLRLRREGD
                     KAPGAAGY"
     gene            complement(<225329..>226696)
                     /locus_tag="MRET_3913"
                     /note="MRES_15740"
                     /db_xref="GeneID:38740679"
     mRNA            complement(<225329..>226696)
                     /locus_tag="MRET_3913"
                     /product="DNA-binding protein"
                     /transcript_id="XM_027630540.1"
                     /db_xref="GeneID:38740679"
     CDS             complement(225329..226696)
                     /locus_tag="MRET_3913"
                     /codon_start=1
                     /product="DNA-binding protein"
                     /protein_id="XP_027486455.1"
                     /db_xref="GeneID:38740679"
                     /translation="MEQRAQRARQAMLSGPSLDGASWHAWPPAAEEHASAKRVAGDDD
                     DMALAKRPRSDDGAAVVAATVEQQQQALAAMRELHPPPFDQHAPPIVLDASLPFVLEA
                     PAPTPRTRKLRPEQEKARASFVAQHAGQTYEQMVLEHAYSSDRLYWLKEAYQLSWRTG
                     RWSADEEDRATAALDKFCQHHQLSQAALDELIWHRRPDQKQLHEELWKHIALSVGTRP
                     NYAVRMHIKSMRKDVLRGGHWTPEDVAALTSAVAELGHQWEKIGTRLGRSGNVCKHFW
                     REQIQSRKAGPAPQGAFHPDEEEALRRTVLACCAEVGCAPDGPNLPWTLIHERLGPSP
                     RRISVLSRKWRGMLSAERRSSDEQNARWYAPRDDHILLRRIRAQRKASAADIEFDKLA
                     SPDWQWPLYVIKKHWVVMLRKRAPPDPPASLDELLDTLARRVPSADQYKMLASGRRPG
                     TSASR"
     gene            complement(<226741..>228057)
                     /locus_tag="MRET_3914"
                     /note="MRES_15735"
                     /db_xref="GeneID:38740680"
     mRNA            complement(<226741..>228057)
                     /locus_tag="MRET_3914"
                     /product="NAD binding dehydrogenase family protein"
                     /transcript_id="XM_027630541.1"
                     /db_xref="GeneID:38740680"
     CDS             complement(226741..228057)
                     /locus_tag="MRET_3914"
                     /codon_start=1
                     /product="NAD binding dehydrogenase family protein"
                     /protein_id="XP_027486352.1"
                     /db_xref="GeneID:38740680"
                     /translation="MFVARALRPMLATAAMRRACTRTLCASPRVMRPTSQPTLSFDPS
                     AKTAMDKQEPPAPGADFRVVIVGAGNINFGSDEGPWNHSFRLEHKLGPRLKVVALIDP
                     DAERARRVLKTKCQSFVLSAYKDTVVYPTFKDYMASVCAETYPHAVWVGSPPAFRGGT
                     EPGRNLEQLLTAGLPNVPLFIEKPVSTGAVDQTFEVAKMLEQNGSLVSVGYMLRYLKV
                     VQKMKQIIAENDLHVMAVNARYIMAYEHTAKLDWWDKSKNPGPIVEQATHFCDLARYF
                     AGEVDLSSVMAQSLEHYEPAGQLRKIPVDESLIEPANRIPRVTCATWKFESGAVGSLT
                     HAVALQGTDYSTQIDVYADGYSLRLVDPYNAPMLYIRRPGDDHEEIVRYNDDDPFFSE
                     VSSLIDCIEHGEGTSPILSSYEDAARTYALTWAIREASERTMRPRP"
     gene            complement(<228182..>228598)
                     /locus_tag="MRET_3915"
                     /note="MRES_15730"
                     /db_xref="GeneID:38740681"
     mRNA            complement(<228182..>228598)
                     /locus_tag="MRET_3915"
                     /product="cofilin/tropomyosin-type actin-binding protein"
                     /transcript_id="XM_027630542.1"
                     /db_xref="GeneID:38740681"
     CDS             complement(228182..228598)
                     /locus_tag="MRET_3915"
                     /codon_start=1
                     /product="cofilin/tropomyosin-type actin-binding protein"
                     /protein_id="XP_027486363.1"
                     /db_xref="GeneID:38740681"
                     /translation="MSSTVDVAASLPAALRAFRLSKSSSQGAALIVKIDKKRLLLEKE
                     DEFDAISLDELQEELPEHSPRFVLLSYARQHEDGRTSYPLVLVYWAPATASMELSTLY
                     TSALPTISAHADIGKVIDVRDGTLSIDVLEERLGRR"
     gene            complement(<228666..>229853)
                     /locus_tag="MRET_3916"
                     /note="MRES_15725"
                     /db_xref="GeneID:38740682"
     mRNA            complement(<228666..>229853)
                     /locus_tag="MRET_3916"
                     /product="NAD binding dehydrogenase family protein"
                     /transcript_id="XM_027630543.1"
                     /db_xref="GeneID:38740682"
     CDS             complement(228666..229853)
                     /locus_tag="MRET_3916"
                     /codon_start=1
                     /product="NAD binding dehydrogenase family protein"
                     /protein_id="XP_027486349.1"
                     /db_xref="GeneID:38740682"
                     /translation="MCAPGLPPRPGADVRLVIVGASQINFGSPEGPWNHSIRLERKLG
                     PRLHVVALIDPVRENAEKVLRQKHASSAMSSYRDTAVYPDMHAYLATVTPDTRPHVVW
                     IGSPPAFRGSMHEGRDIEKMLADALPGVGVFLEKPVSTSSVDDVMDVDRYIDGKLGPV
                     SVGYMLRYLRVSQKLKQIISDNRLRVVAVNARYVIAYEHLTKQWWWNKSQSLGPVIEQ
                     ATHFCDLARYFGGEVELDSIIAHSLEHFEPPSGLSKLAFDEEACIPAEERVPRVTSAT
                     WKYESGAVGSLMHVIALHGRDFFTEIDVFADGYSLRLCDAYNAPVLYVRRPGDDREEV
                     YKYDDDDPFFSEVAGMLDAVEDPSQRHRILTSYDDAARTYAFTWAIRRASEACVAARH
                     HSP"
     gene            <229998..>230283
                     /locus_tag="MRET_3917"
                     /note="MRES_15720"
                     /db_xref="GeneID:38740683"
     mRNA            join(<229998..230189,230221..>230283)
                     /locus_tag="MRET_3917"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630544.1"
                     /db_xref="GeneID:38740683"
     CDS             join(229998..230189,230221..230283)
                     /locus_tag="MRET_3917"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486457.1"
                     /db_xref="GeneID:38740683"
                     /translation="MPVPFEAVIPMAIVGVLFAVTGTGYSAVSRLANEGKPLRHNLDE
                     WERMMMRRDLRLTGTKRGQSREPVAPEAFATNSGWTAERI"
     gene            complement(<230313..>231632)
                     /locus_tag="MRET_3918"
                     /note="MRES_15715"
                     /db_xref="GeneID:38740684"
     mRNA            complement(<230313..>231632)
                     /locus_tag="MRET_3918"
                     /product="RNA-binding protein NOB1"
                     /transcript_id="XM_027630545.1"
                     /db_xref="GeneID:38740684"
     CDS             complement(230313..231632)
                     /locus_tag="MRET_3918"
                     /codon_start=1
                     /product="RNA-binding protein NOB1"
                     /protein_id="XP_027486343.1"
                     /db_xref="GeneID:38740684"
                     /translation="MTDRPATGIESLVLDAAPLLVQARIAGLADKYYIPASVVAELRD
                     ARARDYLHTLHTTGQIDLEVREPGAEALKMVMEFAKQTGDYAVLSKPDLHVLALTYAL
                     EVEAHGTWRIRQTVGGKTGQQLHEERRLEEKRVAQPQEGPKDAIQQRGRTEAQHDVHH
                     GGHEAADGFTLVTKRAPRYHVADDEDDERAGEWITPDNIVQHKNKALGIVTEESSVEA
                     PKKARRRRRGKGTPARMSVACMTGDFAVQNVLLQMGLYLVSVDGARIERVKSWVLRCH
                     ACYRICKDPERKFCPSCGNAALLRTSVTTTAGGHGDAGTMQVHLKPNFQYRNRGTVYA
                     LPMPKPGSASGGRPSGQSKNSGVPILREDQLEWQRAVARQKQQRQREERALQRQLEKG
                     QDSLTARYADPDWLPDLLSGTHSQPLGELPAIGLGRKNPNERRRRRR"
     gene            <231706..>232395
                     /locus_tag="MRET_3919"
                     /note="MRES_15710"
                     /db_xref="GeneID:38740685"
     mRNA            <231706..>232395
                     /locus_tag="MRET_3919"
                     /product="DnaJ domain protein"
                     /transcript_id="XM_027630546.1"
                     /db_xref="GeneID:38740685"
     CDS             231706..232395
                     /locus_tag="MRET_3919"
                     /codon_start=1
                     /product="DnaJ domain protein"
                     /protein_id="XP_027486383.1"
                     /db_xref="GeneID:38740685"
                     /translation="MSVWRLATPAGRLMRGARAYSAQAGETDFYHVLQVPRHASKAQI
                     KNQFYRLSKEYHPDVSKSEHGKTMFQRVSEAYATLSDDHQRRAYDRTLGAVPAAAGAR
                     PYEADMSASSQYARAQQAWAYQRRTHQATHTGSPRYGARTPSPSMDTTTQHYARMAER
                     EAKQQEVRQRHGSSNAALHARPATNYRAWSEKRWSHEERQAEMASPLVRFLQVASVMS
                     AAVWLSYKLLS"
     gene            complement(<232402..>234672)
                     /locus_tag="MRET_3920"
                     /note="MRES_15705"
                     /db_xref="GeneID:38740686"
     mRNA            complement(<232402..>234672)
                     /locus_tag="MRET_3920"
                     /product="polarized growth protein"
                     /transcript_id="XM_027630547.1"
                     /db_xref="GeneID:38740686"
     CDS             complement(232402..234672)
                     /locus_tag="MRET_3920"
                     /codon_start=1
                     /product="polarized growth protein"
                     /protein_id="XP_027486370.1"
                     /db_xref="GeneID:38740686"
                     /translation="MSAPPVEYVYALYNFEAENPDEVSFRVGERVLVVEKDEAYGDGW
                     YQGTNERGETGLFPFSYTTTDESAALMMLNGGFQSEEGAAQTAPAAEAASQGTAAFGA
                     QDRGVMHSTMNDIENALSELHTAEPPQGMSRGLEDDVEREFQARAAARAELARNAQKS
                     LQSQEETAWQGPVGVGEPGTISNRQKTLATTGGGVKPLAMLELSDESEDEVEDEDALP
                     VEKTAPPTMPSETAHVPHLAGPAVPTAERSMPPGDAFTSQPWPAARETRPEPVPAPTL
                     PTVPAVPTVPVPAPTEQPAATGPAVVDASQWSIDDVVEWARSKDMDASVLEKLREHEV
                     NGASLLSLDINMLKEIDIIAYGRRFKLASAIDELRHGATTPAPARASAPMMPAPVPSG
                     APRSPPRGVPQGVATAMPSGAPTMQERPRVTSGPARPAPAIDMPQGLSPSAMAAPVTA
                     PVAAPTETDGHVPTKPSLYLRSPQREEAFQPRAAPPDTPVAPEPMPPSKEYVSEPVPP
                     SGYVPEPVPPSGYAPEPVPPSDGYAPEALPMSSLPLGDSASLRPVMPNEPIAQPSVPS
                     VSLDDPAYSGPTASDAADRQSVLNRIGSIARQGWVKKRGERYNRWNNRYLILHGMDLI
                     VLRDPGANKVKNLIPLHGYKVVSDESANAVGYTFKIVHDTQRTHYFSFEDATAMRGWM
                     KAIMKATIGRDFSQPVISSYSNVTISLEEAQRMRPRPPSPTSRMRVQLENARYNPGQL
                     TSKDAMVLTSLDKGTS"
     gene            complement(<234782..>235846)
                     /locus_tag="MRET_3921"
                     /note="MRES_15700"
                     /db_xref="GeneID:38740687"
     mRNA            complement(<234782..>235846)
                     /locus_tag="MRET_3921"
                     /product="metacaspase-1"
                     /transcript_id="XM_027630548.1"
                     /db_xref="GeneID:38740687"
     CDS             complement(234782..235846)
                     /locus_tag="MRET_3921"
                     /codon_start=1
                     /product="metacaspase-1"
                     /protein_id="XP_027486369.1"
                     /db_xref="GeneID:38740687"
                     /translation="MYGGYMPQGYYDQRGVPTSYQAPSGPVGPPQYQGYVQTQPHGGM
                     MNGNMPYEYSNMRGKRKALLIGINYVGTSSQLNGCWNDTHNLANFIQHHAGYHPDDMV
                     ILTDEPSDNPRTYPTRENMVNAMHWLVSDARPGDALFFQFSGHGGQERAVEMDEEDGY
                     NETILPLDYAQTGQIPDDELHARLVRPLPVGCRLTALFDSCHSGTALDLPYVYATSGN
                     IKETNITMNVGKGILGAAMDYARGDIGGVVRGLFDTFKSATVNSHAAQYTRDTRSSGA
                     DVIMLSGCKDSQTSADAVEAGKATGAMSWAFITVLSQWPQLSYKQLLNATRDCLAAKY
                     SQKPQMSASHPIDMDLLFVM"
     gene            <235951..>236652
                     /locus_tag="MRET_3922"
                     /note="MRES_15695"
                     /db_xref="GeneID:38740688"
     mRNA            <235951..>236652
                     /locus_tag="MRET_3922"
                     /product="tubulin-specific chaperone C"
                     /transcript_id="XM_027630549.1"
                     /db_xref="GeneID:38740688"
     CDS             235951..236652
                     /locus_tag="MRET_3922"
                     /codon_start=1
                     /product="tubulin-specific chaperone C"
                     /protein_id="XP_027486368.1"
                     /db_xref="GeneID:38740688"
                     /translation="MSHAARAQAFYASFPQQLERVRQLYQEHASERALEALLDARHTL
                     QRAAAYLPAHDIQSYEAAWSDVHRELSQPTRTFRFAAPHEQVASLPREAPTTAPAPTY
                     RTHDIIHVSDNAVLAHLDACIIHTNLAGSVLLEACTRCAVIGTVGQCRLTRSSHMLVC
                     VDTPTPVTLEECDAILMGRRSDMEPAETCAAPAVQDFDDVFDEQRHYTPLDPEYAARL
                     RPHLQNPSALASMLR"
     gene            complement(<236649..>238109)
                     /locus_tag="MRET_3923"
                     /note="MRES_15690"
                     /db_xref="GeneID:38740689"
     mRNA            complement(<236649..>238109)
                     /locus_tag="MRET_3923"
                     /product="ubiquitin carboxyl-terminal hydrolase 36/42"
                     /transcript_id="XM_027630550.1"
                     /db_xref="GeneID:38740689"
     CDS             complement(236649..238109)
                     /locus_tag="MRET_3923"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 36/42"
                     /protein_id="XP_027486367.1"
                     /db_xref="GeneID:38740689"
                     /translation="MAHVVPGPPRASKMARRESKQAMDEAIKPAALLRSLLDDPIRFV
                     GSSRDELKASMSLDAARAAHFEVVNAEDDEKQPQPKEKEEAPAPRMLYAHRIIPRLPR
                     AHTAGLHNRGNTCYMNSVMQALLHTPPLASALLSQSTPTLLGRYGVPHTQKQALKAAH
                     MFNAMGVLKDFFERAYGSSSAISPTAFINNLRKFARPLRPGRQEDAHEYLRLLLEALQ
                     HASTCFAPKDIKPQDPELATTLVQRIFGGRLRSRVTCHSCRHNSDTYDPVMDLSLDVR
                     KGIHSVKQALEAFTAPEELADKYRCDQCHKSVNATKRFSIEQTPMVLTVHLKRFGIFG
                     NKINKPISYAERLQLGRYMSERTADTDAYRLYAIVHHYGSGPNVGHYVASVRTPEGRW
                     LRMDDSYVSTLSQCPLDDPSAYILFYARDAATTPSSPRKRKDHSDVDAVVGEAVPRSA
                     AWDDDEDEEDASRSPPHSKKDARRRKRRKRAVARLA"
     gene            <238203..>240518
                     /locus_tag="MRET_3924"
                     /note="MRES_15685"
                     /db_xref="GeneID:38740690"
     mRNA            <238203..>240518
                     /locus_tag="MRET_3924"
                     /product="vacuole morphology and inheritance protein 14"
                     /transcript_id="XM_027630551.1"
                     /db_xref="GeneID:38740690"
     CDS             238203..240518
                     /locus_tag="MRET_3924"
                     /codon_start=1
                     /product="vacuole morphology and inheritance protein 14"
                     /protein_id="XP_027486366.1"
                     /db_xref="GeneID:38740690"
                     /translation="MDHASRMEPSLPKALFDRAYDKRKAAALELERQVRDTVSRGDRT
                     RIDHIVQQLCAYLTQNPAPHANARNGGLIGLAGVGIALGQEVAAYLDQMMIPILACFS
                     DPDPKTRYFACESFYNLAKVCKGEMLVYFNEIFVVLARLAADSEVSVKNGAELLDRLF
                     KDIVCEAAPHYLSQYQNVAHIRARQDQDVGAEGGQNELDVAREKAAHEVQEHQGANRA
                     FSLARFVPLLAERMQVVSPLTRNYIIGWIAVLDAVPDLQLVSYLNAFLPHLFQYLGDP
                     NTDVRVATAEVLANFLREIREAAQHEREEPVRTEDCDQDEWVHSRRVRIEYDAILESL
                     LEQVQHHDEEIQATTFEWITEFLHVVPAMVVRFTPRLISAVLPCLAHPAPAIQTAAIK
                     ANTELFAAVEHQLPDGGGGLDYFVTTNALKQHLQDQHDQTRLQALEWLMMLHAKSPTK
                     LFSIQDGSISVLLRVLSDPSEEVILCDLRLLTQICSRADEHHFRLFLTDLLERFAADR
                     RLLESWGSLIIRQLCVHLQTERVFPVLADILETYEDLEFASIMVQNLNMILVASQELK
                     PLRRRIRALDTREHQQLFVRLYRCWSHNAISALCLCLLTQSYEHAYNVLRIFADLDVS
                     LSMLLQVDKLVQLIESPIFTSLRLQLLEPEQHPFLVKCLYGMLMLLPQSSAFATLRNR
                     LQAVHGLGHLTMPNDERPHTRYARQATPDVPWNELLQHFRTVQLRHERLRLATERHTD
                     NEPRRRVQQREPAPFARMSFTANAGTRSARE"
     gene            complement(<240481..>241974)
                     /locus_tag="MRET_3925"
                     /note="MRES_15680"
                     /db_xref="GeneID:38740691"
     mRNA            complement(<240481..>241974)
                     /locus_tag="MRET_3925"
                     /product="beta-catenin-like protein 1"
                     /transcript_id="XM_027630552.1"
                     /db_xref="GeneID:38740691"
     CDS             complement(240481..241974)
                     /locus_tag="MRET_3925"
                     /codon_start=1
                     /product="beta-catenin-like protein 1"
                     /protein_id="XP_027486365.1"
                     /db_xref="GeneID:38740691"
                     /translation="MDASPAHRTGKRKEAPVAARSVDDVGKRTRVEETDALEVPSDDE
                     GRLDGSGLNAEQQQILDILGHDPADAVPDHPRDQVAHARKLFVALERAMNANQAMRLK
                     HADEPRAFLPSEADLDAAIRDVAFLATDARLLYPEFVRHDMAATMATLLTHDNPDIAA
                     AAIDVIAELVDDDDGDALRDALHAHDVPRILLSNLQRLNDAPDSDRYEDDARVVYAIL
                     SALESFGRYDTYADPLVAWLVSRIVRGRMDQNQAYAAELLAASVAENEAVREALARHD
                     GMDALLRALSRYLHTSPRDTDEHEFFRNVVDTLQYMLLDAAQRDVFLACEGVELMLRL
                     LKQSRRVRRGALAVLLAAAQYAAGAATCVRIVEAGGLRALGALLDRPDDVLLHLLHAM
                     LYNLASDSAPRLRLLSKFLDPRKVEAVVEARETGASVDGRVSANAVLAWLAMEDDTLQ
                     ALVTTRVPAAELAEALEGAEFDPRCVAASGDTLEAITHALTAYLRSL"
     gene            <241995..>242726
                     /locus_tag="MRET_3926"
                     /note="MRES_15675"
                     /db_xref="GeneID:38740692"
     mRNA            <241995..>242726
                     /locus_tag="MRET_3926"
                     /product="poly(A) RNA-binding protein"
                     /transcript_id="XM_027630553.1"
                     /db_xref="GeneID:38740692"
     CDS             241995..242726
                     /locus_tag="MRET_3926"
                     /codon_start=1
                     /product="poly(A) RNA-binding protein"
                     /protein_id="XP_027486364.1"
                     /db_xref="GeneID:38740692"
                     /translation="MEPPSGGDIYTPFYYWDGVANQWAFDYEGFYKTHGYPESATAAK
                     QRAEPTSAELYQQQLQSSVYDYVPTRAGRSTQVKVAGHLKKGETRETVIRRAGGKLWE
                     DRSLLEWDPAHKRLFVGDLGNDVHDEHLVQAFQKYPSFSRARVVRNKGDGKSKGYGFV
                     AFADPEDFLRAWKEMDGKYIGSRPCRLKKAQDTIKPVEIGARKDKFLAANAKYTDYLN
                     KARRGGTVGRHLPRASGLPKPYSKK"
     gene            complement(<242734..>243201)
                     /locus_tag="MRET_3927"
                     /note="MRES_15670"
                     /db_xref="GeneID:38740693"
     mRNA            complement(<242734..>243201)
                     /locus_tag="MRET_3927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630554.1"
                     /db_xref="GeneID:38740693"
     CDS             complement(242734..243201)
                     /locus_tag="MRET_3927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486421.1"
                     /db_xref="GeneID:38740693"
                     /translation="MVSDGFRVQDVDDIVYEVDAAMITVQDGEVDIGGNPSAEEQQEA
                     LDNGAEQVINIVHSFRLQATSFDKKSYLTYLKGYMKTIKQSLQETNPDRVPEFEKKAA
                     EFAKKVVGKFNDWEFYTGESMNPDGMVALLNYREDGVTPYFVFWKDGLKEEKI"
     gene            <243380..>244228
                     /locus_tag="MRET_3928"
                     /note="MRES_15665"
                     /db_xref="GeneID:38740694"
     mRNA            <243380..>244228
                     /locus_tag="MRET_3928"
                     /product="nicotinamide-nucleotide adenylyltransferase"
                     /transcript_id="XM_027630555.1"
                     /db_xref="GeneID:38740694"
     CDS             243380..244228
                     /locus_tag="MRET_3928"
                     /codon_start=1
                     /product="nicotinamide-nucleotide adenylyltransferase"
                     /protein_id="XP_027486372.1"
                     /db_xref="GeneID:38740694"
                     /translation="MSRWPVARSLALRDALDHVSRGEPWRIAYTTHQDGVRLSGPSPA
                     HIAVLDASFNPPTRAHAALASLPRTPSQPFDAHLLLFSVRNADKGRGRAGDASPIERL
                     EMMELLAHELEAQHLQVVVALVDEPLVFAKSTLVHAHMHLSVPYRLYWLVGSDTLTRV
                     FHPRYYDSEAHLEACCERFFGVQGSRMICAERSAASVQGTITTPTTAASDAWQFVHAP
                     GPARTWYERGAIELRPISTDAAQLSSTAVRRFLHEAAPEAQRPQLCTMVPPSIADYLI
                     SHSMYH"
     gene            complement(<244225..>245103)
                     /locus_tag="MRET_3929"
                     /note="MRES_15660"
                     /db_xref="GeneID:38740695"
     mRNA            complement(<244225..>245103)
                     /locus_tag="MRET_3929"
                     /product="pre-mRNA-splicing factor ISY1"
                     /transcript_id="XM_027630556.1"
                     /db_xref="GeneID:38740695"
     CDS             complement(244225..245103)
                     /locus_tag="MRET_3929"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ISY1"
                     /protein_id="XP_027486371.1"
                     /db_xref="GeneID:38740695"
                     /translation="MSRNQEKAQSMLYRFRQAQAEELGVSSRRHERRPKVITTVNSVR
                     DCDRWRGEVMREITRKVARIQDPGLTDYEVRDLNDEINHLFREKTQWERQIAALGGAN
                     YRSGVPRILDDHGEEIPGMRGYRYYGRARELPGVKEHLNPVALQEEEGKESIKVQRYK
                     RFQHQPGPYFGNDDEKDGGVLLGEERQSEQRGWDAGWERVHAALGTSRPVPPMPQPEP
                     VVLDLDAAASDVLAQPRKEAQRETQDTPETDARRYMPALPAEELVMPVMPGRKDMEAF
                     LLQSKKAALRREYGVH"
     gene            <245259..>245909
                     /locus_tag="MRET_3930"
                     /note="MRES_15655"
                     /db_xref="GeneID:38740696"
     mRNA            <245259..>245909
                     /locus_tag="MRET_3930"
                     /product="large subunit ribosomal protein L10Ae"
                     /transcript_id="XM_027630557.1"
                     /db_xref="GeneID:38740696"
     CDS             245259..245909
                     /locus_tag="MRET_3930"
                     /codon_start=1
                     /product="large subunit ribosomal protein L10Ae"
                     /protein_id="XP_027486388.1"
                     /db_xref="GeneID:38740696"
                     /translation="MSKIQVSSVRSSVRDLLQGSEEKRRNFNETVELQIGLKNYDPQR
                     DKRFSGTVRLPHVPRPRMSLCILADAADVDRAKLISLDFMTVEDLKKLNKNKKLVKKL
                     AKKYDAFLSSDALIKQIPRLLGPGLSKAGKFPSPVSHAEDLEKKVTDVKSTIKFQLKK
                     VLCLGVAIGHVQMTEDQLTSNIMLAVNFLVSLLKKNWQNVKSLHIKSTMGKPQRLF"
     gene            complement(<246196..>246759)
                     /locus_tag="MRET_3931"
                     /note="MRES_15650"
                     /db_xref="GeneID:38740697"
     mRNA            complement(join(<246196..246293,246331..246543,
                     246594..>246759))
                     /locus_tag="MRET_3931"
                     /product="small subunit ribosomal protein S11e"
                     /transcript_id="XM_027630558.1"
                     /db_xref="GeneID:38740697"
     CDS             complement(join(246196..246293,246331..246543,
                     246594..246759))
                     /locus_tag="MRET_3931"
                     /codon_start=1
                     /product="small subunit ribosomal protein S11e"
                     /protein_id="XP_027486334.1"
                     /db_xref="GeneID:38740697"
                     /translation="MSNVELGVQTEKAFQKQPLFLNSKVARKSTRAKRWYKDVGLGFK
                     TPNAAVTGTYIDKKCPWTGLVSIRGRLLSGKVISTKMTRTVIIRREYLHYVPKYNRYE
                     RRHKNLAVHVSPAFRVEVGDIIVAGQCRPLSKTVRFNTLKVIKNKSTERAKMFHRY"
     gene            <247057..>247503
                     /locus_tag="MRET_3932"
                     /note="MRES_15645"
                     /db_xref="GeneID:38740698"
     mRNA            <247057..>247503
                     /locus_tag="MRET_3932"
                     /product="small subunit ribosomal protein S12e"
                     /transcript_id="XM_027630559.1"
                     /db_xref="GeneID:38740698"
     CDS             247057..247503
                     /locus_tag="MRET_3932"
                     /codon_start=1
                     /product="small subunit ribosomal protein S12e"
                     /protein_id="XP_027486389.1"
                     /db_xref="GeneID:38740698"
                     /translation="MSDVEETPVDVQVEETEAAPAPQGGAMSIEDALQQVLKKALVHD
                     GLARGLREATKALDRREAHLCVLCETCNEAEYIKLIEALCNKHDINLLKVSDPKTLGT
                     WAGLCKIDREGNPRKVVGCSCVVVRDYGEDSEGLNVLLEYFKSQRA"
     gene            complement(<247558..>248033)
                     /locus_tag="MRET_3933"
                     /note="MRES_15640"
                     /db_xref="GeneID:38740699"
     mRNA            complement(join(<247558..247897,247932..247978,
                     248010..>248033))
                     /locus_tag="MRET_3933"
                     /product="histone deacetylase complex subunit SAP18"
                     /transcript_id="XM_027630560.1"
                     /db_xref="GeneID:38740699"
     CDS             complement(join(247558..247897,247932..247978,
                     248010..248033))
                     /locus_tag="MRET_3933"
                     /codon_start=1
                     /product="histone deacetylase complex subunit SAP18"
                     /protein_id="XP_027486390.1"
                     /db_xref="GeneID:38740699"
                     /translation="MASQAQDDLAPFVVRCVVSRSDFRSLADMRSGRPLPGTLSVYAW
                     PSTTLREVAHLLYLADPALSRPHTIHDFRVVYFDPTSDRFEADAPVRGITRLPTGDAR
                     AEAAATLTLEHLRLTSHAYLECAMHTGRHRLYEP"
     gene            complement(<248098..>249966)
                     /locus_tag="MRET_3934"
                     /db_xref="GeneID:38740700"
     mRNA            complement(<248098..>249966)
                     /locus_tag="MRET_3934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630561.1"
                     /db_xref="GeneID:38740700"
     CDS             complement(248098..249966)
                     /locus_tag="MRET_3934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486391.1"
                     /db_xref="GeneID:38740700"
                     /translation="MHKHEHDAIRHGRGPLSTSTSVRGRGGGGAFDPAKTGADRCASG
                     GLFAQAAAPAETQRAAAGELVALHLRNRPRGIALVRKLDEATVLAPRDVDRVDRAEWR
                     KQRMQHRLCRQREQAADKHRRVRGVEGAGCVRYSESGCEVRLVLRRDVALALGHERQG
                     RRHALDRGVRGCRRRVRTARRGWHVRARGTRRLRRGSTRRVAHDRRGRHDGTGRRLVM
                     RAAMRLCALGVGARRRGRCAERQAQRRVRRLMRHHVRVLHLNQRTVAFVLAREPHEAK
                     HAPASLRGRRRLAHDACRVHTERRGTRGPCAQRASDVLDAHVHAPHGMVLWPAGRVRK
                     VPDKVLVRDVLVQAAHKHAVERRRRTARRKGPARAWHGRVRPPGRRMSGRRGPRRRVP
                     LILVSVRRRGRRRAWRVERRRELRRDARKAIMSRIAIRAERRRRDLHVRHDIGEPRRV
                     KELARRREWRRMRPCIALTSFGIVPTIALLVIVAQPCIAQRRKQAGGCRAETRWLCAH
                     EDNSAESACHARADTCVRGPSTGSLPLYIRLARCASRSCVRRWHVPQLRVSHPTRVPT
                     CHVLSLVRMSIPTHSRPVPHATRLHAGLRSDNLVAPPTLLAHDAARTLAGPAMIGT"
     gene            <249934..>250890
                     /locus_tag="MRET_3935"
                     /note="MRES_15635"
                     /db_xref="GeneID:38740701"
     mRNA            <249934..>250890
                     /locus_tag="MRET_3935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630562.1"
                     /db_xref="GeneID:38740701"
     CDS             249934..250890
                     /locus_tag="MRET_3935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486392.1"
                     /db_xref="GeneID:38740701"
                     /translation="MPYGVVLVFVHGFRGRAEQTFGAYPARLRHLVRETHPGVPVEAV
                     IYPTYETRGSLGDAVDAFVAWLTTLVAERESTQGHRFCVVLCGHSMGGMVCLDAARAI
                     RAQGRGAWPRVGGVIAYDTPFLGIHPHVFKHQLTTYQQYVDSAVRASSMWAPVTGGLA
                     AWWSAPPSSATRLSTATWIGLGAAAATAVGTAATAAVHRSEAIQDACRWVGDHLLFVR
                     HVWDRDALAARMTSCDVPFHCFYTQLADEQRTFLLVPPPAAPYAPHFSPLTSHAKDEV
                     AAHTSMFALSTNPSYLAMGVASASLVSAWTAPSLVDDDEHVA"
     gene            complement(<250861..>252234)
                     /locus_tag="MRET_3936"
                     /db_xref="GeneID:38740702"
     mRNA            complement(<250861..>252234)
                     /locus_tag="MRET_3936"
                     /product="tubulin-specific chaperone E"
                     /transcript_id="XM_027630563.1"
                     /db_xref="GeneID:38740702"
     CDS             complement(250861..252234)
                     /locus_tag="MRET_3936"
                     /codon_start=1
                     /product="tubulin-specific chaperone E"
                     /protein_id="XP_027486393.1"
                     /db_xref="GeneID:38740702"
                     /translation="MLVGTRLARHRHTGTLLYEGPLPPYPGTFYGIAWDSAEHGKHDG
                     TAPDGTRYFACAPGHGTYLAATARIEWGVTFVEALREKYGDRSDLRTVSLVGPPPHGP
                     SDPSCVYVAKAVPDGYDGALPRTITTLDLSRSLLSSWDEVARIVRAMPLTSLTLQHVR
                     LRPAACVPCVFAHLEHLSLGDSGTDWAQMAVLARAMPRLASIELARNGITTLASVDAD
                     MPHVHTLQLEGNALGAWPDVLRGVRRLPRLQKLVLTGNPLERMPRASAPTLPALCDVH
                     VDDTPLDWDDVQALETHLASPAWSLVYDRDDRIEAIGRLAKLTCLNHTPITPEERVDA
                     ERYYVQRPRPGDARYEALVRVHGPPAPASVASMHDKLLTISYVHAATPYEAAWDKATS
                     LALLKTMPMRLVHRRLVQLCGASPSAAIWAVLRSDREPIVIPLDDMMRDLAWFGVASG
                     DMLVVVD"
     gene            complement(<252266..>255979)
                     /locus_tag="MRET_3937"
                     /note="MRES_15630"
                     /db_xref="GeneID:38740703"
     mRNA            complement(<252266..>255979)
                     /locus_tag="MRET_3937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630564.1"
                     /db_xref="GeneID:38740703"
     CDS             complement(252266..255979)
                     /locus_tag="MRET_3937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486335.1"
                     /db_xref="GeneID:38740703"
                     /translation="MTRTTLLDSILGRPSQTYASSHEGESSWQPSSESSVIKAERPPY
                     SASVTSPSQRSASRDTHRPPSRASRAAAAPQTHTLVRDMNTVNPFSHWWEHRQHMEKT
                     RPATPSDVHSPFSEQWRRELASRDRPASRQTTATPRQAPRSVTPMNTSQSCVWVPYTK
                     DESGMDMSAVGVALTQDTTTDLPPLLQGASVIGKGPLRSLAHAQEPITSSTPPPGRGG
                     MPRTVSAASTIPSQSDVSEAREDVDDELIGLSRDAALYVAQGDETLEAPTREPPALKP
                     PLAVPALRVPSPDLRREREDAMKPASLIRRPTVAPYAQRTQAPAWSAVPKREHLQSLA
                     DHRMSSVSVSDSLMADLPVEPWILGSEVGHMNRSELHDTPPIRPEDLEPLHRTPTLQG
                     KPYRSVLDRPRQRGPRPTVMGGIEIAQGQLHAPTPGATPKRSVSDRPRRTADAPPVPT
                     RMVSDSSVRAESMPTYPVSQPAQPALSLPSSQPLAYLQASPQRMDLAASAVVTETQRA
                     PPAWTETPSKSAFSPYATAFVETPPAPLKPPSPTPAPLPRPLIQAPMSPPLPFHGHVQ
                     PGLASPVQAAPPSPTRAPAAPYHGPAYSPRPPPGPHQGASSWQAVPGPYLGPWPSQGS
                     PTPYHGPSSPYLAVPAVPYQGPSSPQGAPPASYQRTPSPHAPPPAPSHSPALPYARPP
                     VPYQRPPPAMHPMQPPMPWPGMRSTPRPPPGPAPVAAAPSMRAASQPASPVAMARPLP
                     HAQTPPAAPMPRSLSQPGPWLAQPPMVRPPALSASYAPGHSTPAASTMPSPMQPGMIV
                     PPAPRLHAPPRAEHMGRAQSPVESIRVAPAPVVPPVPPAPAPAPAPAPPSPSVPLTPM
                     GRVRNVNTSFRRKPTMLTVDVVAGSSDAASTNGSTSGKSGSIARRASRTRVGSASEGS
                     TGVIVLGSHMTPPRKVSSSGVIVKVIAVAIDNVDRAMVRNVLRDAPSTPFVPGRSFCG
                     RVVDCGLDVKRLRPGDLVFGLQDLRKCGALAEYIMVHQDVVAVAPEGRLVPEQIAALP
                     ATGVMVHQIVQNHCMVLPRGSRILVLNAHDMIGRLTMQEASRLGMVTVAQVPPGVPHA
                     EALCRQNGAVEVLTGDPLWTINLLHESSFNLVVDTIGSRHIYDACRRVLANYGQFVTC
                     YGDDSLVASPMYRSHMRSLRRSFFRKDRKAIGYEWIGVDTSADTRQALESIRSAVQHG
                     ALTPQIRAILPVEMAAQALGASIDPDLVVLRLP"
     gene            complement(<256130..>259174)
                     /locus_tag="MRET_3938"
                     /note="MRES_15625"
                     /db_xref="GeneID:38740704"
     mRNA            complement(<256130..>259174)
                     /locus_tag="MRET_3938"
                     /product="ribosome assembly protein 1"
                     /transcript_id="XM_027630565.1"
                     /db_xref="GeneID:38740704"
     CDS             complement(256130..259174)
                     /locus_tag="MRET_3938"
                     /codon_start=1
                     /product="ribosome assembly protein 1"
                     /protein_id="XP_027486377.1"
                     /db_xref="GeneID:38740704"
                     /translation="MPPPTRAFASEHVRCCTLIGHVDHGKSSYADSLLAANGIISSRA
                     AGQVRYMDSREDEQERGITMKSSAVSLTFKLRKIQEGQVEGIDDYTLNLIDTPGHVDF
                     SSEVSTAARLCDGALVIIDVVEGVCTQTVHVLRQAWMDGLRTVLVVNKMDRLITELRL
                     TPNEAHHRLLQLIEQVNAVIGGFYAAACMEQDQRWHEAGADATTRDTREDADLYFDPS
                     RGNVIFASAVDHWAFRLERFSHMYAHKLGIKEQTIRQFLWGHYYFDPKTKRVLTHDRD
                     KRGLKPMFVQFVLDNIWQVYQNTVIERDQAMIDRIISALQLSIHARDLRSKDPTALMH
                     AIMSQWLPLPACTFNAIVRCLPSPAEAQKERVPRMIRPDLGFFATDADLAPKNDLERD
                     LFASRSGPDATAVAYVSKMFAVPRDDMPEHRRVQLTADEMRERGRLQREAMTSTGAEA
                     AAEAPADEAPADEAPTDEAPEVMLGFARLYSGRLSVGDTITAILPKYDTTRAPTDAAN
                     EPYVRTCRVQALYMMMGRDLVSVQRVPAGNVFAIRGLDGVVLRNATLICGPEELRDVV
                     NLAGVRRFATPMVRVALEPRSAADMPKLAAGLELLNQADPCVEVLVQDNGEHVMMTAG
                     ELHLERCLRDLRERFARCAIQASPPLVPFRETCVKAANMAPPKTPGEPRGTMHGTALQ
                     GALSFTIRAVPMPPLLVDFLVVNVPTIRRLRRRHHDDDDDDDDAGEVGEVRDAEAVRR
                     VPVRAFWDELQAVLQRVGGEWADVASQICAWGPKHVGPNLLLDPQHVLRRVRQDEAPR
                     LEREWCDAIEAGFQLATGAGPLCAEPMHGMAFVVQHVEMDHDALSEARAKVSQLASSV
                     ISGVRESCRQGLLDWSPRLLLAMYSCDIQAAPDVQGKVHAVLQRRRGRVVSEEMKEGT
                     LFFTISALLPVVESFGFAEEIRKRTSGAASPQLFFAGFQLYDQDPLWVPRTEEELEDY
                     GEKGDRENIAKRYVDMVRKRKGLATSRRLVTSAEKQRTMKSA"
     gene            <259247..>260296
                     /locus_tag="MRET_3939"
                     /note="MRES_15620"
                     /db_xref="GeneID:38740705"
     mRNA            <259247..>260296
                     /locus_tag="MRET_3939"
                     /product="Prp8 binding protein"
                     /transcript_id="XM_027630566.1"
                     /db_xref="GeneID:38740705"
     CDS             259247..260296
                     /locus_tag="MRET_3939"
                     /codon_start=1
                     /product="Prp8 binding protein"
                     /protein_id="XP_027486387.1"
                     /db_xref="GeneID:38740705"
                     /translation="MTTTLDKRKGPPAPSDGLLVKRMRPGDDRGALTARTDRTSSLAA
                     PVMALTEAHTAEILDVRFSREGDRIAAASADHTVSLWETFGEHRNLGLLRGHKGAVTC
                     LAWCEYESRTLLVSGSADHTLVLWDPQTGERVRRFRGHRGIVNGVACTRSRDGRIASV
                     SDDGRVLLWDCGASRYPIDAIELGYPITCIEFSDDATHLILGGLDNAIHVVDLATHER
                     RFSLLGHTHTVTSVALSHAGTRLVSAGMDDTVRIWDVQPFAASSRLLRTLHGMASGFE
                     NLLLRARWSPDDEYVGSGSADRTSNVWHVDKATLQLKLPGHRGTCTAVDFHPHQPILV
                     SSSTDTTLLVGELDT"
     gene            <260323..>262017
                     /locus_tag="MRET_3940"
                     /note="MRES_15615"
                     /db_xref="GeneID:38740706"
     mRNA            <260323..>262017
                     /locus_tag="MRET_3940"
                     /product="vacuolar protein sorting-associated protein"
                     /transcript_id="XM_027630567.1"
                     /db_xref="GeneID:38740706"
     CDS             260323..262017
                     /locus_tag="MRET_3940"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein"
                     /protein_id="XP_027486416.1"
                     /db_xref="GeneID:38740706"
                     /translation="MTTPPAPPSRDERAAWYVRFEHVVVTRSVHGVGVQFDCATNIPS
                     FHRTSYQGVQRTYAELARYFLALTCYGPRVIVPALPLPTPWMARASSELEDLQVLLRR
                     WFAYIAQDSVLRMHRETLRLVEADYSYEPLRPDDTAPAPLIKQFGHMDARIRSLQHVW
                     DGSVWETEPEAAPPTRRRPRLFRTNAAPRRETPAALVPAPSAAPSAVPVSDPDPHFSH
                     ARSDITRLEKQLADVSLASAGVSQARQDVNKAFDDLVRKLPGLATLEEARPASLQGRL
                     PRTLRSAHTHLQHIVHTSTALMYADQVTLGDAMAYYAHTMRMARQTLQERMSVVVERA
                     LARRVVANKQQDAQQLQYGRHPHPDRVEAAKEEVQEAQQQLSALDDYLAKVHDSLQDS
                     LQRHSIHTHQDLLASIQRHACTSRAIEQRLADELASLAEACRASAADAQQAAYEAAHA
                     PRRITPAQAAAARMTGRSVPEQPDAADQLSKPRERGPEAAPPSDERGPEAAPLGDERG
                     PEAAPLGDELNPEPAGDEPSPEAPSFPSLAFQRDRERGPWTRLSASAAAQALGGPW"
     gene            <262057..>263505
                     /locus_tag="MRET_3941"
                     /note="MRES_15610"
                     /db_xref="GeneID:38740707"
     mRNA            <262057..>263505
                     /locus_tag="MRET_3941"
                     /product="lysophospholipid acyltransferase"
                     /transcript_id="XM_027630568.1"
                     /db_xref="GeneID:38740707"
     CDS             262057..263505
                     /locus_tag="MRET_3941"
                     /codon_start=1
                     /product="lysophospholipid acyltransferase"
                     /protein_id="XP_027486415.1"
                     /db_xref="GeneID:38740707"
                     /translation="MASAVFVRLADLLGLPVDYAKLAACLVMSFVLSPILPRLPRAWM
                     RHMMNMGVSALFLLGVLQLYRGVVHLLGASLFTYAAVYFRLGGAKYMPWIVFVACMAH
                     MLYTHCVRELNHVPLTTIEISSMHMVLVMNLTSFAWSCRDGQLVAIDTLDEVQKAVRI
                     TQMPSLLAYLGYCFYFPGVLVGPSTRFRDYELWSTGELYAPATRPPRGRWAESLREVG
                     TALVSLVLMVGFSEPFSYDRLIRADDVLHTWPLWHRILFVQGAGLVARFRFYGVWSLS
                     NAACILSGLAYHGIDPATHHARWTRCKNVFVMQIELAHNWKEVLDAWNANTNMWLREA
                     VYKRLAGQRKPGFGSFMGTFLASAIWHGIAPGYYLSFVTAALGQWLARRLRKSVRPLF
                     YADVRRPDPSWTNMSEYTLAQIVYACVSNIVTMSSVCYAVIPFFVLTLRGSLQAFHAV
                     AWHYHILIFGGLLAFQLGADKLLRPFSKVKRS"
     gene            complement(<263492..>264475)
                     /locus_tag="MRET_3942"
                     /note="MRES_15605"
                     /db_xref="GeneID:38740708"
     mRNA            complement(<263492..>264475)
                     /locus_tag="MRET_3942"
                     /product="palmitoyl-protein thioesterase"
                     /transcript_id="XM_027630569.1"
                     /db_xref="GeneID:38740708"
     CDS             complement(263492..264475)
                     /locus_tag="MRET_3942"
                     /codon_start=1
                     /product="palmitoyl-protein thioesterase"
                     /protein_id="XP_027486417.1"
                     /db_xref="GeneID:38740708"
                     /translation="MRWTWLVALLLVGPCWGLPLLEWAMRWVPRLPDTPPLPVVIWHG
                     LGDSAYAPWLRDLKAELELTYPGMYVHLVALESRSMADRAATFVGDVNAQVARVAEQL
                     AQVPELRHGFDAVGFSQGGQFLRAYVERFHAPVRRLITFGSQHMGITALPGCRDDDRL
                     CEAVMRHIEQATYTDHAQTHMVVAQYFRDTRTPERFEEYVAHSRFLRDINNEGAAKNA
                     SYKEGLQRLEQFVMVRFSDDTTVRPPESAWFGAHSVPEAGQPARPVPLRQSDVYVRDW
                     LGLAALDKRGALRFHTCDGMHMQLSPACKELVFGQYVGRPRSPGRWLAMNA"
     gene            complement(<264502..>265507)
                     /locus_tag="MRET_3943"
                     /db_xref="GeneID:38740709"
     mRNA            complement(join(<264502..264534,264559..265328,
                     265353..265431,265460..>265507))
                     /locus_tag="MRET_3943"
                     /product="phosphatidylglycerol phospholipase C"
                     /transcript_id="XM_027630570.1"
                     /db_xref="GeneID:38740709"
     CDS             complement(join(264502..264534,264559..265328,
                     265353..265431,265460..265507))
                     /locus_tag="MRET_3943"
                     /codon_start=1
                     /product="phosphatidylglycerol phospholipase C"
                     /protein_id="XP_027486199.1"
                     /db_xref="GeneID:38740709"
                     /translation="MSSSSPAMPDCWGHRGASAEFPENTLRSFAQAIQDGSEGIESDV
                     HITADDVIVMFHDTTLDRTTDGHGPIGAYKYYGEGGLEHVRTTQEPVQQIPTFEQLCA
                     LLMEPGHRHVKLNVDIKPNNDADRLFRIMREVVQKFPDYETQLAPRLILGLWHPSFIA
                     PAKKYVPALRRAHIGASPADARRYFWQDCDAFSLCFPSLVGADGQRFLRDARAANKDV
                     MVWTVNRQDEMVEATRWGVKAILTDYTADLRQLREAMSADFDATYRKYVSPWFSWGSL
                     RYYTPSVWMYQYLCRAEVEKNAGATYGSAVTSP"
     gene            complement(<265638..>266333)
                     /locus_tag="MRET_3944"
                     /note="MRES_15600"
                     /db_xref="GeneID:38740710"
     mRNA            complement(<265638..>266333)
                     /locus_tag="MRET_3944"
                     /product="vaculolar membrane protein"
                     /transcript_id="XM_027630571.1"
                     /db_xref="GeneID:38740710"
     CDS             complement(265638..266333)
                     /locus_tag="MRET_3944"
                     /codon_start=1
                     /product="vaculolar membrane protein"
                     /protein_id="XP_027486413.1"
                     /db_xref="GeneID:38740710"
                     /translation="MPRQPIDERHCQLFGWVSIVTQLAMGVVVIAALLYKRHRERPRR
                     AWQIWMLDVSKQLTGQLFVHVLNVTLSAVGVQDGNNPCSLYFLNILLDTTLGIGILYG
                     LLHALFFTCQHVLGWSGFVSGEYSAPMRYGRIASMLECWVRQTAVYVLALVLMKLIVL
                     GLLYMMPFLTLFGSWLLGLFQTHRAMQVIFVMALFPMAMNMLQFWIVDSMLLYQRPPP
                     GYEPAPPVETARP"
     gene            complement(<266359..>269580)
                     /locus_tag="MRET_3945"
                     /note="MRES_15595"
                     /db_xref="GeneID:38740711"
     mRNA            complement(<266359..>269580)
                     /locus_tag="MRET_3945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630572.1"
                     /db_xref="GeneID:38740711"
     CDS             complement(266359..269580)
                     /locus_tag="MRET_3945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486412.1"
                     /db_xref="GeneID:38740711"
                     /translation="MPTDARDVLRAAAILTGDRDYELLIEKPLRGPENVDAVIQRRLA
                     VFLELTIPLQPSETLRSMNDSVRWQTGVWGLACLVHIHQVAMSYSEPSDGAPLLGARD
                     LSMLKKLVAVTFAWLVVPATSAFDRTYPSNVDLSDLVTAFHVLLHKSDAAPAADTALP
                     VSPLAHTDVAVLVMRVYLVDVLRILIRMAYGSASALALSMVQDMLDTLPTTTMLSALR
                     SVPTRSVFAASPSSDDTSPSITPSVPAFVGETCARLLSQQLLRPAGVRSLMIGMLGAN
                     EDDLLECEVDFDSNAISQRLDGLARLLSTPPKDMDRPTYYMKITPHILDVLDPVTPPG
                     TTPVHGTHRRAAAFTCVRMYEADAKSMQAALDTNLWRVLEPASDPPSPAQIDMVLRRM
                     FAAVTLAPPSPPWIHAACARMMHRFLALDTHLHMPTLTPRSVDALRDTQAANLQETLL
                     TWFRVCSEDEIVSTLHSALRRSLDDTWHWYDVPEGGVGLVERPIFLPDVTTLLDAVDI
                     STHEGDVPPPPKGLTRSFGWAIDPARMCVLIKQAERPPLASALLLNAMDEHRRTRSRM
                     SSGLMHDETVSLDRRAIYYLQLVFQLFDAFGDVMMEEGDIDRVLHFIDFACHDDESVL
                     DADLCNTALELLLSLLERHATLTPVSTPMLRVMADRLERFRDMPNPTTQALSQELLMT
                     LSARSKFEGLPPSATAKPEYLQVYHEALQYLQDPILPVRAHGLHLLTRLVSRVARNHS
                     AKCYGDELDHALIPEIFDLFLHAIQDDESFLYLNAVQGLAQMAMSWRDAVLRPLMAMY
                     VGGDKTQDGMSHALSYGQELTQRETDQRLRIGEAILQVLQHLGEAVVSELDRIVPPLL
                     TAVRNPLFSATLRSSFISILGTCVEIAPTALAADRSSVHMVHMCTELIQATTERRAIR
                     QRSRVRASVQGVGAGGEVTERSLDDEDEEEAMWEREATSGTDRDVHRPQLRRAALLLL
                     LMLLRATQEQLDDYRESCERDLDDIDAPLSALRLPGGGVLPDVHGRAKPTLPPLLVPV
                     DVLGSVMPVVTYMAQEEADNVVRVQAQDCIDHIRLVELAYIGL"
     gene            <269689..>270289
                     /locus_tag="MRET_3946"
                     /note="MRES_15590"
                     /db_xref="GeneID:38740712"
     mRNA            join(<269689..269727,269752..269854,269879..269892,
                     269916..270059,270083..>270289)
                     /locus_tag="MRET_3946"
                     /product="peptidyl-prolyl cis-trans isomerase-like 3"
                     /transcript_id="XM_027630573.1"
                     /db_xref="GeneID:38740712"
     CDS             join(269689..269727,269752..269854,269879..269892,
                     269916..270059,270083..270289)
                     /locus_tag="MRET_3946"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase-like 3"
                     /protein_id="XP_027486198.1"
                     /db_xref="GeneID:38740712"
                     /translation="MSVTLHTTLGDIKIEVFCEAVPRTAENFLALCAAGTYDHVKWHR
                     NIPGFMIQTGDPTGTGKGGQSIWGDVFPDEIRATHKFHARGVVAMANRAPNTNQSQFF
                     ITYSRQPHLDGKYTIFGKVIDGAELGGTLDAMEKVPVDAKHRPLQDIRMQGVTIHANP
                     IAHNAATD"
     gene            complement(<270320..>270713)
                     /locus_tag="MRET_3947"
                     /db_xref="GeneID:38740713"
     mRNA            complement(join(<270320..270591,270617..>270713))
                     /locus_tag="MRET_3947"
                     /product="vacuolar transporter chaperone 1"
                     /transcript_id="XM_027630574.1"
                     /db_xref="GeneID:38740713"
     CDS             complement(join(270320..270591,270617..270713))
                     /locus_tag="MRET_3947"
                     /codon_start=1
                     /product="vacuolar transporter chaperone 1"
                     /protein_id="XP_027486414.1"
                     /db_xref="GeneID:38740713"
                     /translation="MSTQPLLQRSAGKRIALPVRVEPKVFFANERTFLSWLSFTVTLS
                     ALAAGLLNFGDRVGRVSAALFSLVAVAIMLYALVTYHWRAQAIRNRGSGPYDDRLGPT
                     ILSVLLLTAIIVNFVLRFNE"
     gene            complement(<270847..>271415)
                     /locus_tag="MRET_3948"
                     /note="MRES_15585"
                     /db_xref="GeneID:38740714"
     mRNA            complement(join(<270847..270951,270978..>271415))
                     /locus_tag="MRET_3948"
                     /product="modifier of rudimentary (Mod(r)) protein"
                     /transcript_id="XM_027630575.1"
                     /db_xref="GeneID:38740714"
     CDS             complement(join(270847..270951,270978..271415))
                     /locus_tag="MRET_3948"
                     /codon_start=1
                     /product="modifier of rudimentary (Mod(r)) protein"
                     /protein_id="XP_027486477.1"
                     /db_xref="GeneID:38740714"
                     /translation="MRGGSGGASRLATDFPCIASWSRDDLSAIADNTDAALTDAAVHA
                     LPDVQAWAKAHAALLEEVERAAARNEARRPELESLRSETRRAYEHARTLQAQWPAVER
                     ALHEARKRFMPFAMQSQLQMAANQLHDESEAFANAYVEGLTPMDDTVFVRQYLDLRTR
                     HHVHSMLQEQCAQRRVQWQA"
     gene            complement(<271996..>273954)
                     /locus_tag="MRET_3949"
                     /note="MRES_15580"
                     /db_xref="GeneID:38740715"
     mRNA            complement(<271996..>273954)
                     /locus_tag="MRET_3949"
                     /product="Myb-like DNA-binding domain protein"
                     /transcript_id="XM_027630576.1"
                     /db_xref="GeneID:38740715"
     CDS             complement(271996..273954)
                     /locus_tag="MRET_3949"
                     /codon_start=1
                     /product="Myb-like DNA-binding domain protein"
                     /protein_id="XP_027486476.1"
                     /db_xref="GeneID:38740715"
                     /translation="MVAEPSRADHDRPDMMHLLPASSTASSSSSDSRAAMAHTDTASE
                     PTSPPSPRTPSPILGSRHAAHTYSEADGHLTFPQVGVGLGTMEQEMNMLMDLENLDHD
                     DDACDVGRANVADVMAELERLGYAPPAADHEALPLVSDDAQTRDARLADLVWQLGRRV
                     QKHEQAREHLLHRLRVTRLASLSLFSSLRISYSHMLQAERDIKARLEVELSGSKIQSK
                     MLSDMVSRASIAQEADDDDVRRTPDTERSKLLADKRYLRQRVKDAEAQVARLEKELRD
                     LRPMLLRATIEDEAPDSTPRSKLPQRPRRREAVMGDATAEHLILATRMLRTLRHAAPH
                     GPDTSPSKSLTSTPRRPRETYPPTTPQHRRDELTSPEAPASTRSMPSSTYSSGIDDLL
                     HAAQSLSSHYHQPDMSPTRPTPWHRRVSHDELPLSAPVLGSPKRRRVLSMDVDETPSV
                     SALDVLANQAVSEQHPPSPTTPRRYYDHASYPYMPSGSTSLPSSTRTTPSKPKSMGGQ
                     SPEKRLPYVRWSTDEDIKLRRAIKEHGQRWEYVARAVGTRSYHQCRQRYLLMRRKEAA
                     ANGLTSPSKSQAGSARPSGLAPPPASRDDKSPSSSSDTEALPPPTASSSSTALETAHL
                     FHAQHHHHHPPHVALPPPLSMPQQALHS"
     gene            <274204..>276639
                     /locus_tag="MRET_3950"
                     /note="MRES_15575"
                     /db_xref="GeneID:38740716"
     mRNA            <274204..>276639
                     /locus_tag="MRET_3950"
                     /product="coatomer subunit beta'"
                     /transcript_id="XM_027630577.1"
                     /db_xref="GeneID:38740716"
     CDS             274204..276639
                     /locus_tag="MRET_3950"
                     /codon_start=1
                     /product="coatomer subunit beta'"
                     /protein_id="XP_027486442.1"
                     /db_xref="GeneID:38740716"
                     /translation="MLLDIQRKFFSRTERVKSVDFHPTEPWLLAGLYDGTVFIWNYET
                     GAVVKTFEVAEVPVRCVRFIARKNWFIAGSDDFFLRCYNYNTHEKVTAFEGHPDYIRS
                     IAVHATGPYVLTGSDDMTIKLWDWERNWRLVQTFEGHTHFVMDLCFNPKDSNSFASAS
                     LDRTVKVWTLGSATANFTLTAHEKGVNAVDYYHGADKPYLVTTSDDKTVRIWDYLSKS
                     CVQTLSGHTSNVSFAVFHPSLPLVISGSEDGSVKLWHANTYRLESTLDYGLERVWCIA
                     CRKSSHDIALGYDEGAVVVKLGKEDPCMSMDQSGKIVFARNAEILGANIATASESELI
                     DGERVRLTTRELGTTEVFPQLLEHSPNGRFVTVCGDGEYTIFTALAWRNKAFGAALGF
                     AWAADSNTYAIRENSSTRVRVFKNFKEQSGLVPVNYVVEDIAGGALLAVIGVGFVCFY
                     DWTTGALVRRINVEAKQIFWSQTNELVAITTADSFYVLRFHRAAYDEFAASGMPSDGD
                     GFEDAFEVLAEISETVRNGRWTGECFVYTNGANRLQYFIGEQTYTIRPCDAELYVLGY
                     LPQLSRVLAADKDMNLYSFALSLAVVEYQTAILQGDMAHAESLLPQVPSAQRGKIAKF
                     LEAQSMPDLALSVATDPDHRFDLAVQLGQFDVALDIARHGPASGAEMRWRTIGDQALA
                     HWDVALAQECFKHANDVHSLFLVATAQQDEALLRHVAEAARAKGELNLAVAALVQLQD
                     TRGVVDVLMQAQRLPEAALFARTYAPHLVPETVRAWKASIRAQSSQKQQELADRIGEP
                     HTMPELFPEGGYT"
     gene            complement(<276663..>278426)
                     /locus_tag="MRET_3951"
                     /note="MRES_15570"
                     /db_xref="GeneID:38740717"
     mRNA            complement(<276663..>278426)
                     /locus_tag="MRET_3951"
                     /product="F-box and leucine-rich repeat protein GRR1"
                     /transcript_id="XM_027630578.1"
                     /db_xref="GeneID:38740717"
     CDS             complement(276663..278426)
                     /locus_tag="MRET_3951"
                     /codon_start=1
                     /product="F-box and leucine-rich repeat protein GRR1"
                     /protein_id="XP_027486443.1"
                     /db_xref="GeneID:38740717"
                     /translation="MDAASGVRVWSPVRVVREVPAYGDASPVSSISDSDTPESDEMAP
                     PPPMDEPLSASSGVRGTSLAELPHEILLHVFRYALTSQQDLQSCLLVCRRWCASAVQV
                     LWHRPSFHKLSALFQMIHVMIQPDAYFPYASYIRRLNFSTLAGELDDQLFGRMALCHR
                     LERLTLSGCTQVTEETLSRVLQNTPQLVAVDFSGVTCVTDHTLQVLATTCPRLQGANL
                     TGCLRITSQGVCDLARHCPMLRRIKLGACERVGDDALLELLRRCPTLLEADLMQCTSV
                     HDQSVQDVWLRPTQLRELKLAHCNALTDLAFPTPSMRRALPLSPPFRVCEHLRMLDLT
                     CCTMLTDEAVRAIVSHAPRLRNVSLAKCSRLTDQSVYAISELGRNIQHLHLAHVSHVT
                     DRAIIHLAHHCTRIRYLDLACCVQLTDESVVVLASQLPKLRRIGLVRVAQLTDRAIYA
                     LVERYTNLERVHLSYCENIHVPAIFWLTLRLPRLTHLSLTGVPAFRCAELQAMCRPPP
                     KEFNQHQRQSFCVYSGRGVHELRRFLQHVYADETLVRQFGPLHPDRHRIFQAGLARQQ
                     QQQQQWLLQQEAVGSILPSSV"
     gene            complement(<278489..>281425)
                     /locus_tag="MRET_3952"
                     /note="MRES_15565"
                     /db_xref="GeneID:38740718"
     mRNA            complement(<278489..>281425)
                     /locus_tag="MRET_3952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630579.1"
                     /db_xref="GeneID:38740718"
     CDS             complement(278489..281425)
                     /locus_tag="MRET_3952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486440.1"
                     /db_xref="GeneID:38740718"
                     /translation="MTDHTQGSCEAWASPDHVEWQMIRGIVPPDSASATMCRKVVVGE
                     FSDVLKSRAARPLFEAIAKVVHTTVQGKTSSEQVIIPFSAVHIPVSESPLDSLCVAIA
                     ALHGFVQLNWTGPDMPLHPMELLRYHAPQHFKQRDVHDEDNSDAAYARVLHVSSLEYL
                     TWQGEPAYHLCQSPFFLVVALLILDALQTSSLVTVPWWRMRARSVHIRILDEPVACEE
                     ALQEAVMAMTHALTQRSQQASTDTEQRAWAHLHARALLELALARQRAGQDRLASEGLV
                     EAAKAHGLEYELSGALGKRTKWQKQDKTQLVLLAESREAGAERAEEDEASTSYKHGHE
                     TSSDASGWQASIDPSKQVDHQPATYSLNDDTLLEQTQFTQTGPDTGRRLSHLDPGNQP
                     PLAVIDQCILLALCLNIHNTQPSHGLTSEQMSAFVERVIQHPLNWSVHTMSLLLRSRL
                     EASRTRTVERSTLQLQALIDQMPTNDSSVRERLRFFHALELPAKWAMQSELAHRYVSI
                     GVLRSALETFERVEMWENVVQCLGLLGRQQEGIEVVRDLLEGRKTEAEAQLQAKRIAT
                     SVSRVPHTRFARAREAKLWCLLGDLEPMHAEMHYLRAWDVSERSSARAARSLGGYHFA
                     LHAYEQASVWLRRAVRINALYTRSWFMLGCCYMRLEHWLEAAAAFRKCTALEEEDGES
                     WNNLASCYMRLHQSHVRRLDTVLEQDVDEEDGAESVVSGTDSGVDVMSQETHTETTAP
                     ALELRLLAHRALGVSLKFQFESWRVWANYMIVSVDVGMLREAARALARVVEIRTREKS
                     FSASDKAVNVHDMVDMGVLNKLVDAVIRPANVEEEATQEGAGLRPTVERLFEQTLLPR
                     FSTDAPIWQSYARLTFASGHYRKMLDARVQAFQCGLGAADRLDVVTAKDVWLLAKDEL
                     LELCDVLANLATRPAEPGSDEESMPDWRFRARTLVRAFMSRTRDSFEDEPAWEELVAC
                     LEELKR"
     gene            complement(<281507..>282184)
                     /locus_tag="MRET_3953"
                     /note="MRES_15560"
                     /db_xref="GeneID:38740719"
     mRNA            complement(<281507..>282184)
                     /locus_tag="MRET_3953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630580.1"
                     /db_xref="GeneID:38740719"
     CDS             complement(281507..282184)
                     /locus_tag="MRET_3953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486441.1"
                     /db_xref="GeneID:38740719"
                     /translation="MSRSPENGLCSAFSDDEEEVEAQRAMEEWIDEVNLLLCGLPKHA
                     SKQKQTTVSKRNRGSVLLGSLSSPVPNKAAATATRRHSGTPSSRPKLLHHPGSISPDA
                     AAEWFKPGRSPPPPKAGSPVLKPSSPLLPEQPVTSPLVPWRRYVVPLPERPEPPTIPL
                     PERPPATEVPVDMEDWYDAYSLPSPGPCRLSPLPTYLFRTCTVFAPPMTQAPPAITGP
                     TPSMRAL"
     gene            <283353..>285839
                     /locus_tag="MRET_3954"
                     /note="MRES_15555"
                     /db_xref="GeneID:38740720"
     mRNA            <283353..>285839
                     /locus_tag="MRET_3954"
                     /product="transcription initiation factor TFIID subunit 5"
                     /transcript_id="XM_027630581.1"
                     /db_xref="GeneID:38740720"
     CDS             283353..285839
                     /locus_tag="MRET_3954"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 5"
                     /protein_id="XP_027486438.1"
                     /db_xref="GeneID:38740720"
                     /translation="MKLDDYDAVGARQKQMAGSGTSVKDGKPNRLESATVMEYLRSHG
                     YAKALGALKAELEASEKGASPAKSAEERDAHLGAQDVSMEELSSKNVPRDPRDKDAPE
                     TGPSSALERAGAQALLLDPTDTARGFSMIKTWCTGSLDIYQPELLPLLLPLFVHSYLN
                     LVDMGLGAVAAELFALHSSFFQPTHASLLAHIRSLCLPSQIGSDELAQRFRTERYVLK
                     MSPNVFGLLIGWLTDGTSPVGFSSIDDPSIVDNILEPSRRGREAMLKIINEHCRIQVL
                     RSVMFQLDPFELEEGTGLTGAGPSFLSKSASKYHSAVEAAAISESDVIADFNAQAAGP
                     QLKLHPSIPLADDLKNEVDHVLREKQAPAPAQEENFSAGEANPDKEGKDTTHVAPSPR
                     SRSSSVVPDETHPQGQDQASDLLGPTLADLPPQPSMFRTVDLLREVERVRDARKCLRI
                     DPKLAPEPATAGDAKPPSEWEGVPRTVGLPSVCMYTFYDAEDGLTSSSFSPDLTLMAA
                     GFEESYVQVWSLKGEALRPLESDFNLSDVRDRKTLNKHRVPHGDSTRKLIGHSAPVYN
                     VSFDPVGGSGSSPRHLLSCSADGTARLWSLDTYAALVAYRGHQYPVWDVTWGPLGTYF
                     ATSSADRTARLWSAERIHPLRIYAGHLSDVDCVRFHPNSLYLATGSSDRTCRLWDVQR
                     GACVRLFVGHQSPISCVRISSDGRYLASASAGSTMSRLGHPRSTMSDAFSISLWDLAS
                     GRRIKKMWGHNAPIHEMDFSADGAVLVSGSEDATVRCWDVRTAQQESGALDAEASADC
                     VVTYYTKNTPVYDVHFSPRNLCLTAGVYTS"
     gene            complement(<285860..>287431)
                     /locus_tag="MRET_3955"
                     /note="MRES_15550"
                     /db_xref="GeneID:38740721"
     mRNA            complement(join(<285860..287164,287192..>287431))
                     /locus_tag="MRET_3955"
                     /product="serine palmitoyltransferase"
                     /transcript_id="XM_027630582.1"
                     /db_xref="GeneID:38740721"
     CDS             complement(join(285860..287164,287192..287431))
                     /locus_tag="MRET_3955"
                     /codon_start=1
                     /product="serine palmitoyltransferase"
                     /protein_id="XP_027486439.1"
                     /db_xref="GeneID:38740721"
                     /translation="MTKTESIDQESLHGLFGWITWVFKSIPGRDIILRYIASSYQNDP
                     IRSLLELILFIFAVRTILQNRTRARGTSHFIQFSEDEIDYLVNEFEPEPLCAPLDAKE
                     KDELDSVPMVVGHASAHPMVQAPWMTGTTPRRVMNLASFNFTGMLNEPELQKQAKEML
                     HEYGVGSCSPPGFYGISDQHIRLEASVASFFRKDASIVYSQGFSIMSSVVPAFCKRGD
                     VIVADVGVSFAIQKALELSRSHIYWYDHNDMDSLEHVLSYINRAHQQSRKPLTRRFIV
                     TEALFEADGTVTDLPTIVDLKKKYKFRMILDESYSAGVIGATGRGLTELQKVDPDDVD
                     IIVGNLAVAFATAGGFCASTQEIVKHQRINGLSYVFSAAMPVMLANGSTVAMKLLDAN
                     PSVYDKLHENVSILRKALDPITSIIIPSAPESPLVHVQIKSKRDDMDASAQKELLTKI
                     ERLALNQGVWITQTPHLPSIRLQLDQGPWARPSLRIAVTSALSVGEMAQAADIVRASI
                     VSVVGP"
     gene            complement(<287713..>288260)
                     /locus_tag="MRET_3956"
                     /db_xref="GeneID:38740722"
     mRNA            complement(join(<287713..287848,287875..288230,
                     288258..>288260))
                     /locus_tag="MRET_3956"
                     /product="ubiquitin-conjugating enzyme E2 A"
                     /transcript_id="XM_027630583.1"
                     /db_xref="GeneID:38740722"
     CDS             complement(join(287713..287848,287875..288230,
                     288258..288260))
                     /locus_tag="MRET_3956"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 A"
                     /protein_id="XP_027486436.1"
                     /db_xref="GeneID:38740722"
                     /translation="MSTPSKRRLIRDFKRLSSDPPGGISGAPCADNLLVWNAVIFGPS
                     DTPFEDGTFKLLLTFDESYPNKPPSVKFLSKMFHPNVYANGELCLDILQNRWSPTYDV
                     AAILTSIQSLLHDPNPNSPANAEAASLYRENMKEYVRRVKLTVEQSWIDETEEAQAYA
                     DADA"
     gene            complement(<288765..>289182)
                     /locus_tag="MRET_3957"
                     /db_xref="GeneID:38740723"
     mRNA            complement(join(<288765..288878,288920..289072,
                     289180..>289182))
                     /locus_tag="MRET_3957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630584.1"
                     /db_xref="GeneID:38740723"
     CDS             complement(join(288765..288878,288920..289072,
                     289180..289182))
                     /locus_tag="MRET_3957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486437.1"
                     /db_xref="GeneID:38740723"
                     /translation="MDFCFCIPIVFGCPNKIKQEGDGTPYVCPRCNNAQVVEAKSRMW
                     LELCWIPVIPCSSQHIWLCGICQWQIPRNGGYQPMPAGYSMPPKM"
     gene            complement(<289375..>290311)
                     /locus_tag="MRET_3958"
                     /note="MRES_15545"
                     /db_xref="GeneID:38740724"
     mRNA            complement(join(<289375..289713,289743..289752,
                     289782..289938,289966..>290311))
                     /locus_tag="MRET_3958"
                     /product="trimethylguanosine synthase"
                     /transcript_id="XM_027630585.1"
                     /db_xref="GeneID:38740724"
     CDS             complement(join(289375..289713,289743..289752,
                     289782..289938,289966..290311))
                     /locus_tag="MRET_3958"
                     /codon_start=1
                     /product="trimethylguanosine synthase"
                     /protein_id="XP_027486434.1"
                     /db_xref="GeneID:38740724"
                     /translation="MNGCATAWRSQEVERLAEERAIRSKDDLRENMLKYWRFRESLFT
                     RFNEGILLDEESWFSVTPEALAYRTAVECKCEVAMDGFCGAGGNIIQFAMTCDHVLGI
                     DIDPVKLEMARRNAQIYGVEHKITLLWGDFCEFARDVEKVKQARLCGEEPEDTGKWGG
                     WDRKKIDVIFMSPPWGGVEYRDPSKLKGVIPTNKKYVNAYPFAALQPVGGKKLLELTF
                     LICDKLVMFVPRNMDLTDVADAVNEVEFGTMVHVEEMWMGQRLKALSLFFEKKGTNNK
                     PEVPQSS"
     gene            complement(<290371..>291392)
                     /locus_tag="MRET_3959"
                     /db_xref="GeneID:38740725"
     mRNA            complement(join(<290371..290631,290659..290983,
                     291009..291087,291116..>291392))
                     /locus_tag="MRET_3959"
                     /product="exosome complex component MTR3"
                     /transcript_id="XM_027630586.1"
                     /db_xref="GeneID:38740725"
     CDS             complement(join(290371..290631,290659..290983,
                     291009..291087,291116..291392))
                     /locus_tag="MRET_3959"
                     /codon_start=1
                     /product="exosome complex component MTR3"
                     /protein_id="XP_027486435.1"
                     /db_xref="GeneID:38740725"
                     /translation="MATSFDRRRANGPENTYPLLHNIRVSKMSTGTEPVWNVDPHHAL
                     QNPKSTCSDNLVLHTMKIDNENLNITRLAQKNVCMRPDGRETMDSRSLYLQTGLIPSA
                     SGSALIEAGNTKIVCAVHGPRQVRGRQYAGKAELNVQFEMAPFCERNRRASKDSEVAS
                     AAAFVHQALFPSIRIDLLPKSSIDVHIMVLDADTSILGCCALATMAASAAVAQAGVQM
                     YGLVVGTAASATPSLPTDDHPTQQQWLVEPTKSESANASTELLLCGMPSLNATTCYVL
                     QGPVHSMDAVKEVSHTLMQVITKHHASMAQSLFNEHT"
     gene            complement(<291469..>292593)
                     /locus_tag="MRET_3960"
                     /note="MRES_15540"
                     /db_xref="GeneID:38740726"
     mRNA            complement(<291469..>292593)
                     /locus_tag="MRET_3960"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_027630587.1"
                     /db_xref="GeneID:38740726"
     CDS             complement(291469..292593)
                     /locus_tag="MRET_3960"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_027486462.1"
                     /db_xref="GeneID:38740726"
                     /translation="MKLLLISLVQLLWISLVSCVGWKLDDSIVGEDYFNKFNFYAGPD
                     GAENMTHGMVQYVDMPNAKRLNLSYANGDSFVMRVDTTMKQPNGRPSVRLHSKKTYED
                     SVIVLQVAHVPTGCAVWPAFWTVTENRPLWPKGGEIDMLENANDQYPYNLAAVHVNTS
                     CAVTNPEQTGTTVFDQCNAYANDSSGCRIAMNGTDAGATWGHKLNEKGGGTVAMQRDF
                     SEGGKGIRMWFWENCMEPSELKKPGESVDPDSWGTPAADFGLTQCADQFDNHNIIFDI
                     TLCGDWAEETYTETSCPSNYKSCGYQVGNLGNTFENAFWDVKGLYIYTPDASGSSSSK
                     SKRSSKDDKTCAIKNMPSSAMSHSPSALLLLVTLFFSIFL"
     gene            <292715..>295189
                     /locus_tag="MRET_3961"
                     /db_xref="GeneID:38740727"
     mRNA            <292715..>295189
                     /locus_tag="MRET_3961"
                     /product="DNA repair and recombination protein RAD54 and
                     RAD54-like protein"
                     /transcript_id="XM_027630588.1"
                     /db_xref="GeneID:38740727"
     CDS             292715..295189
                     /locus_tag="MRET_3961"
                     /codon_start=1
                     /product="DNA repair and recombination protein RAD54 and
                     RAD54-like protein"
                     /protein_id="XP_027486461.1"
                     /db_xref="GeneID:38740727"
                     /translation="MRRSAIVAALNELNENTSKPPHEPPRQLATGGGYGILQEQKPFK
                     SPLVRSRNGNQSLRKRPRLNYAVFGDHVTDENDACYGELEEPRQKKSLEGVYKGIDAS
                     GVSFNVDRRKWQVYDAKPDAIRRKFSIPSLRNDKGEVFKANSTNAALGVRRPVEVPPR
                     PLHDPMGEHAIVLYDPTVDDKNIEKERERLRAAFEEEQQKAKEERGPHKSLASILGLN
                     KPHVQLDEKVPVVIDPRLGKTLRPHQVEGVKFLYRCTTGMISENANGCIMADEMGLGK
                     TLQCITLLWTLLKQSPNAGKSTIQKAIVVCPSSLVRNWANELTKWLGAAAPGALALDG
                     RLSREQMFESVQRWADCKGRAIVHPVMIVSYETLRNLQELLGNTEIGLLLCDEGHRLK
                     NTDSLTFQSLDLLKVKRRVILSGTPIQNDLSEYFALINFAIPDVLGNRNEFRKRFELD
                     ILRGRDAGASEKEQMVGREKLQELSALVSQFIIRRSNDILSKYLPIKYEHVVFCHLSP
                     FQLALYDLFLRSPAIARLLRGNGSQPLKAIGILKKLCNHPDLLSLPDDLEGSEELFPE
                     GYKPGDRRHVAVELSGKLSVLTRFLASIRSTTDDKIVLISNYTQTLDLFERLCRLRRW
                     GFFRLDGTMNINKRQKLVDRFNDPTAPEFIFLLSSKAGGCGLNLIGANRLVLFDPDWN
                     PASDQQALARVWRDGQKKACFVYRFIATGSIEEKILQRQSHKQSLSSCVVDDDLDAER
                     HFSGEDLRALFQFKYNTDSDTHDTYKCKRCRDGKQVVASKAMLYGDTSTWNHVSKHEF
                     GKLHDDLLRAEVMHDDVSFVFQYCSH"
     gene            <295295..>296718
                     /locus_tag="MRET_3962"
                     /note="MRES_15535"
                     /db_xref="GeneID:38740728"
     mRNA            join(<295295..295398,295442..296523,296552..>296718)
                     /locus_tag="MRET_3962"
                     /product="transcription initiation factor TFIIH subunit 4"
                     /transcript_id="XM_027630589.1"
                     /db_xref="GeneID:38740728"
     CDS             join(295295..295398,295442..296523,296552..296718)
                     /locus_tag="MRET_3962"
                     /codon_start=1
                     /product="transcription initiation factor TFIIH subunit 4"
                     /protein_id="XP_027486460.1"
                     /db_xref="GeneID:38740728"
                     /translation="MSATKLPIETFLNAQPRTVLIRLYEKPASCLAVFRLLPMTARQI
                     IMDLVFLDKPLTLEECQQLFRSHNDEAYSVALERMQRLSILMVRDETYMYMNEVFRRG
                     IIGAMTGSGDVSSFGKLCELSPENIVSTEFLDGYARAQWETILYFMVGSEQTTAPRKT
                     VLFLLQRTGLMQRDATDNDSLNITSLGFQFLLQDVNSQLWALLLHYLSMAEERNMDLV
                     EVLAFFFTVGGLEVGRAYETRGFSQTQIQTLEELGDYGLVYRPTKTAKYFFPTRLAST
                     LTSTASPMLSRLNDQEEQGYLILETNYRVYAYTANLLRIAILNLFVTLKSRLPNLVIG
                     QLTRHSVKSALKKGITADQIIAYLTHHAHPQMYKNEPLLPITVSDQIRLWEREQNRVT
                     AVTGNLYTDFTSSFDFVQVRDYAKSLGVLQWENEQKRMLFVSADGHEAVRDFIQRRRV
                     "
     gene            <296904..>298235
                     /locus_tag="MRET_3963"
                     /note="MRES_15530"
                     /db_xref="GeneID:38740729"
     mRNA            <296904..>298235
                     /locus_tag="MRET_3963"
                     /product="acyl-CoA dehydrogenase"
                     /transcript_id="XM_027630590.1"
                     /db_xref="GeneID:38740729"
     CDS             296904..298235
                     /locus_tag="MRET_3963"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="XP_027486240.1"
                     /db_xref="GeneID:38740729"
                     /translation="MSMRTFARSTNALRPASRSALSARFIASARVPQVVRAPAMRSFS
                     TSVQRAEEFENPFGPNSLYKLTEEEQMLRDVVRRYAESQVKPLVQKMDENEKMDPSII
                     KGLFEQGLMAIETSPELGGAGSSFLSAIIVIEELAKVDPSVSVMCDVHNTLVNTVLRK
                     YANEHLQKKYMPSLSTDKLGSFCLSEPNSGSDAFAMKTSVKKSDDGSHYIINGSKMWI
                     TNSGEAEFFIVFAQGDPSKGYKGISAFAVEKEMGVEIGKKESKLGIRASSTCTVNFDN
                     VKVPAENLIGEEGRGYKIAIEILNEGRVGIGAQMVGLAQGAFDRALAYTHDREQFAKP
                     IAKFQGLQFQMAQVATEIEAARLMVYNAARLKEEGRPFTKQAAMAKLYSSQAAERAAG
                     RAIEWFGGIGFTREQGIEKYWRDSKIGAIYEGTSNIQLNTIFNLTAKEHGF"
     gene            <298290..>299382
                     /locus_tag="MRET_3964"
                     /db_xref="GeneID:38740730"
     mRNA            join(<298290..298313,298341..298455,298482..298553,
                     298582..298598,298625..299029,299056..299143,
                     299171..>299382)
                     /locus_tag="MRET_3964"
                     /product="putative phosphomutase"
                     /transcript_id="XM_027630591.1"
                     /db_xref="GeneID:38740730"
     CDS             join(298290..298313,298341..298455,298482..298553,
                     298582..298598,298625..299029,299056..299143,
                     299171..299382)
                     /locus_tag="MRET_3964"
                     /codon_start=1
                     /product="putative phosphomutase"
                     /protein_id="XP_027486465.1"
                     /db_xref="GeneID:38740730"
                     /translation="MCHRWEFEALPVFVHQDASIHELPAVAKNMGLSEGMTWDDVREE
                     LQRLPRQDNSYSYKLVYLARHGQGYHNLAELKYGKQAWEDVWAKKNGDDTYEWGPDPL
                     LTPLGMKQAQHVHDTWTSFLQLPASLHPPLPELVCSSPLRRSLSTLCISWQGILAHET
                     KVHVREHLREVIGKNTCDQRVTRTDLERHMQFHPFRIAIHGDFTEHDSLWTPRRETDD
                     AMRQRVHGVLEEIWENEAKDKQVISITCHSGVIQRIFEITSHIPRPLPVGAILPMMIR
                     ARKKDIICPNTTELECEHMKPSSSRQDTGCAPTS"
     gene            complement(<299294..>300133)
                     /locus_tag="MRET_3965"
                     /db_xref="GeneID:38740731"
     mRNA            complement(<299294..>300133)
                     /locus_tag="MRET_3965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630592.1"
                     /db_xref="GeneID:38740731"
     CDS             complement(299294..300133)
                     /locus_tag="MRET_3965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486464.1"
                     /db_xref="GeneID:38740731"
                     /translation="MEALFGWVRSYLNGDHKERESPTSRRSNRDVHARLPRHELQHPS
                     SPERFPPDVSVPQRWDDASTDPEIDIEAQQHRYTQIRSMLLSKGLPHHLIAYIFRLAQ
                     DGIELSIERRVYAMYSNNANTRYLRTPPLESNHARHFVLQVIVEIYSHDQGWSTDPHR
                     EWFGTYNGSHTWWDLTLDRPNAASYSKDKFANVNGSSDSECESVLTPVTYNEIHRREL
                     CRNLHASDKFQLHTIVLSSDDPLVRDAQPGDVFSLWARTQYPAWMNLVSYARIRARLC
                     WDI"
     gene            complement(<300291..>304760)
                     /locus_tag="MRET_3966"
                     /note="MRES_15525"
                     /db_xref="GeneID:38740732"
     mRNA            complement(<300291..>304760)
                     /locus_tag="MRET_3966"
                     /product="phospholipid-translocating ATPase"
                     /transcript_id="XM_027630593.1"
                     /db_xref="GeneID:38740732"
     CDS             complement(300291..304760)
                     /locus_tag="MRET_3966"
                     /codon_start=1
                     /product="phospholipid-translocating ATPase"
                     /protein_id="XP_027486314.1"
                     /db_xref="GeneID:38740732"
                     /translation="MADVENTAAEKRGGAERLRSCASYVWHKLKQIDLNPETAFRRKR
                     PPPASRRIMINMDLPKEAYDTRGRIRRQWLFATNQVITAKYTVYNFVFKNLLEQFRRV
                     ANIFFLVLVILQFFPEFTTISPGLAMLPLLIVLFITMVKDGYEDVKRHQSDRAVNRQR
                     TRVLTGASYKNHNKTEGKSRSLRLIWQMMVRYVMPPWLIEKFSKRKNAVSVQELESGE
                     AVPSGRPGSPSQQNNGRMSSMSFDSLRPRSRLSHENHRFSSSSEHRMNKNAPHWESKH
                     WDDVVVGDIVCLRNNDPVPADLIICATSEEDGSCFVETKNLDGEINLKSRFAVQQLSD
                     LRSPEDCMDRQFDVEVEPQSTDMYRFNGCVNLYDETDEEGKPLACPVTLNQTLLRGSA
                     VRNTEWVIGVVAMTGADTKIVLNSGDTPSKRSLMEFQMNKMVYVNLAIIGVMAVVCAI
                     ADSRIEQYYFDRQAPWEYLATFNDDNPSLNGLVSFANSLITFQNIVPIALYISFEVVR
                     TVQALFIFEDHDMYYEKMSRRTMAKSWNLSDELGQIQYIVSDKTGTLTQNLMIFRGCT
                     INGVVYHGGGQSPTLDGKLRVLPIMEDVPRFYDDDLTKAIQDTSSQQHKYVHEYMRCL
                     SLCHTVHLSRTENRNEISYRAESPDEQALVETAGANGYVYCGRHINTIRLQVPGASDY
                     ETYEVLQLIEFSSARKRMSVIVKRQTDGRILVYTKGADSMIYSRLASGQDEMCATTDK
                     SLEEFANHGLRTLCVAKRELDPTWYQRWSREYQHASVLTEGREERMEELASEVEQQLT
                     LLGATAIEDRLQDGVPETIADLKRAGIKIWVATGDKLETAIAIGYSTMLLAPDMNLII
                     IRGGEYGSMNSAFTQLEKAMDRFFGGIDVSDMKHPPPPVSMDAAGGDVRSIMSAGSLV
                     GEENGSRPGGYALVIDGHALEYALKEPHSRELLIHISRHCRAVVCCRVSPLQKALIVG
                     LIKDGLKGITLAIGDGANDVSMIQAAHVGVGVAGEEGMQAVNSADYSIGQFQFLKRLI
                     LVHGHWSYYRNSTMVNVFFYKQMVHTGTLFWFQIYCGWSTSQAMDYVYLLLYNAIWTV
                     ASVVGIGMFDRNVSDHVLMQVPELYTASRERRYFGIWRFLGYMMDGVVQSVVLFFLLM
                     YFYDTTTPRNDGYDIDLYEPTTNMVLATVLAANLYAGLESMAWTWWIFGVVWIPTMLL
                     FVFEPIYAAFPPTLIWTYSWGNNYYLYRSAQFWVGGLLCAFLSLIPRFMYECVRLHLF
                     PNDIDILHFIDAKYPNHDYVNDPRMPGLRAAQSYESEVDGDISRAPLNDTYPLMPTQS
                     RTSSIYHDMSTGENRPYRGFTFSASDTPVPRPKKAIRRLKKLFKPHKRHSYSYVPTSQ
                     RASESNPMSEPKERTGAQTAVSYESKRDSFTHESSMPDQMDEIDYNRFNTASEQLPPF
                     SYTDHDEAIMSPRHESRYMDPPSFMTSPNTTYSAISDHFYTALENPNVRQPHF"
     gene            <305023..>306210
                     /locus_tag="MRET_3967"
                     /note="MRES_15520"
                     /db_xref="GeneID:38740733"
     mRNA            <305023..>306210
                     /locus_tag="MRET_3967"
                     /product="SUN domain protein (Adg3)"
                     /transcript_id="XM_027630594.1"
                     /db_xref="GeneID:38740733"
     CDS             305023..306210
                     /locus_tag="MRET_3967"
                     /codon_start=1
                     /product="SUN domain protein (Adg3)"
                     /protein_id="XP_027486463.1"
                     /db_xref="GeneID:38740733"
                     /translation="MMRTPGPPGGATVRAGSGTSVQPVDPAVQIAVSHAEFLLVQARQ
                     IVNQLAGTKTLDPLLCRQMQSLLDQAQVRPPPTPKRDIAHGEVVKKDAKKDVKGKNKW
                     AREVMADTPLLPTLVDTALSATAGPFLSSAQREAIVDIVGLSQNRIANALTDPERQAA
                     AQRWAQTTAKSAHQGLKGGLAGTSENWDKWYMKQLVDTDTRSQKRKDDADLRDELRHE
                     REPFITGRGGLRAARVTGGPAQVSAFQDNPAVASVACLPSDQMADASQGAVSQAGAVT
                     TTFSPWPGLVLTMSTVASSVTLDHVPDEALDDTSARIVPPPPSQVPPPPPSSSSLAPP
                     PPRRMAAPSSPTTSMSIPPPARSAMAPSMAAHASQPLPPVPPYAPPGQDPRSNVPHSL
                     RPG"
     gene            complement(<306260..>306811)
                     /locus_tag="MRET_3968"
                     /note="MRES_15515"
                     /db_xref="GeneID:38740734"
     mRNA            complement(<306260..>306811)
                     /locus_tag="MRET_3968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630595.1"
                     /db_xref="GeneID:38740734"
     CDS             complement(306260..306811)
                     /locus_tag="MRET_3968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486241.1"
                     /db_xref="GeneID:38740734"
                     /translation="MENFVNMGRQFLQNQSGATAGAENDHHAFGFHPEQVANYAQNHD
                     QQAGHGGMNMGIFSQVANAMHSRHQQGQISNDVDHNQLLSAFKKVQGGQPASSQEAGQ
                     ASAVDAVKQFFGNNEHKNEGGLSALMGKAMSIAGKNAPNGQKEDAMHHASETVMKMAM
                     KHKMHSMFSGYNEGVSELMDLYT"
     gene            <306996..>308741
                     /locus_tag="MRET_3969"
                     /note="MRES_15510"
                     /db_xref="GeneID:38740735"
     mRNA            <306996..>308741
                     /locus_tag="MRET_3969"
                     /product="hexosyltransferase"
                     /transcript_id="XM_027630596.1"
                     /db_xref="GeneID:38740735"
     CDS             306996..308741
                     /locus_tag="MRET_3969"
                     /codon_start=1
                     /product="hexosyltransferase"
                     /protein_id="XP_027486466.1"
                     /db_xref="GeneID:38740735"
                     /translation="MTGIRSTREQLSLIDDAYSVAGEAVYTSDPDDQLPSLDGYQLPP
                     SFKARKRQSTSITRHYLTSSLWHAFDCTGPFLWPQKLYIWISAHALCEPLICSCAAAL
                     SSFILVLCIALVVSCVRHIQDPDKALMPWRQMCASQPAFLNSAVDHLDPVDFLIGVMS
                     VDHLAERRNVIRNTYVRHTLPLHAQTGRPLSQAQVKFVLGRPRKEYEHAIAMEMEMYN
                     DLIVLDIKESQWSDKTLGFLRWAAENATVPVLVPSSSPSAVHIGHKTYEVRQKFVNYV
                     LKADDDAFIVLEELERRLRAIPRQLSHWGYKIADWFMGGELYALSHDLVQFIAASPEI
                     SKWPALKEDEQVPRWLALHPRASDIVWTTEHCWIYDHPRAKTPYAHGFLFPQHVETIR
                     REYAQGLSPDELSRRGGPRKADAYSTTTRWGQAYTPPSPGLTPEESVEALVEGGGRWR
                     DQWHRQAHEPDAPLDVPRRTVWPGNATHDLQPTYEPEAGLAVVEREPSIGAQRHEAGT
                     FPVWGPPLRAYSHQLYNERYVNGTLGGTVAVHFLKQNAWFYETALALIGSQRTWALGG
                     AATEWRMHESPVRIR"
     gene            complement(<308752..>311148)
                     /locus_tag="MRET_3970"
                     /note="MRES_15505"
                     /db_xref="GeneID:38740736"
     mRNA            complement(<308752..>311148)
                     /locus_tag="MRET_3970"
                     /product="inner centromere protein"
                     /transcript_id="XM_027630597.1"
                     /db_xref="GeneID:38740736"
     CDS             complement(308752..311148)
                     /locus_tag="MRET_3970"
                     /codon_start=1
                     /product="inner centromere protein"
                     /protein_id="XP_027486212.1"
                     /db_xref="GeneID:38740736"
                     /translation="MLARRGAAAQGASRALSTQHKDAAEPQFMHAQILRNAYIVAQSQ
                     LLQLAKQMEYDVDISEWEDEMQEKMQEFWEQTRQHVDEFCARMRTQEEDKPRIAAEVV
                     KSPRKKRDDVRFPVSPSPRPKKVADALCSDDEEEEGHDHRDVKAHDALQPPSSGAVED
                     TEPSDKVASSSASPPLPALTPGTGLRPKRTLGSTLRSTKKPEPKEPVQVKAPSRFRSS
                     FLNKSLRHAMEEKQTSMSPVAALDEPSPFHDAVSEPPKEDMEPRPTRPSLAQAGGLDA
                     LRTRLEHVRRASTTPSANALSTAVADHRSTAARAPLDTHASEVPSDMGPLSEALEPAP
                     EEPVPSSSRPIETSPAKPLDEPPNASATPPRPVSRPVSPTRSPSREGVGKVHVPPPFL
                     QRSAASATSNIPTPTTRSPGRLREELLSPFRARAADTTPSASPTRVRPSPSRQGVSKI
                     PSPVRKPVPALSSSSPAPIRRPASVADMRSTQQNGFGSRLKGLLGLSTSRPASVLQQS
                     TPRPAPNKEPEVSEAMPGSFTTEAPRPAKAATPIKTKPWQSSSVSRPGMRPVSVAAMA
                     RPGSSASVRPGTRVSSATRPMYTYDTEGKRRKLSQHPLSESTNHEERVQSEDALKSKL
                     TTQAVRPITKQVRASNTAVRPPGTRVWSNTASRPPPPRSSAHSSHNVFQQVPTGEEDR
                     GDVADVDLPDVASEYSDSDDETAIRKRKLEPSWTRGRELEEILLQQSTIDPDEIFGCQ
                     NVGPVPLDTMLPARKGDRRRMRHRTSSANWNGPDGLAQWEIDRYNERMGIQSASTTGL
                     "
     gene            <311286..>312032
                     /locus_tag="MRET_3971"
                     /note="MRES_15500"
                     /db_xref="GeneID:38740737"
     mRNA            <311286..>312032
                     /locus_tag="MRET_3971"
                     /product="SNARE complex subunit Vam7"
                     /transcript_id="XM_027630598.1"
                     /db_xref="GeneID:38740737"
     CDS             311286..312032
                     /locus_tag="MRET_3971"
                     /codon_start=1
                     /product="SNARE complex subunit Vam7"
                     /protein_id="XP_027486213.1"
                     /db_xref="GeneID:38740737"
                     /translation="MAGVPIQQIAVPSFEYKEHPTQHVVYAVQITMPDRTWTVYRRYT
                     DFCNLHEQITPPIPPAPLPPKHRLKQTWRMITGLGGLLANTEIQKHEDKLDLEIRRAG
                     LEKYLRAIVASPSPHWRESDAFMTFVDVQEPAWPEPSWNPRMTQRPPQPKIPLRPWRD
                     AAEPARETNTTRPMTDAELLRYQTNTLMHAQDEQANALSAILRRQHDLGIHIHHELNV
                     HHELLEDLHNDVQHTQGRMDAADARMKLMK"
     gene            <312319..>314267
                     /locus_tag="MRET_3972"
                     /note="MRES_15495"
                     /db_xref="GeneID:38740738"
     mRNA            join(<312319..314010,314043..>314267)
                     /locus_tag="MRET_3972"
                     /product="general repressor of transcription"
                     /transcript_id="XM_027630599.1"
                     /db_xref="GeneID:38740738"
     CDS             join(312319..314010,314043..314267)
                     /locus_tag="MRET_3972"
                     /codon_start=1
                     /product="general repressor of transcription"
                     /protein_id="XP_027486214.1"
                     /db_xref="GeneID:38740738"
                     /translation="MVSVGSLGTVAAGSAPTSARASSSQSMAHAQPMAASPPPASVHP
                     LSSAASMPPPPSQALWSTRLVDLLNLVRHEFDVIGNDAMHFKSQRVELEHRISQQINE
                     VALMQEHVYELEKRHFEMVEQYEDEIKRLHALLEDRAVSSVGAREAPPHSTTRAGAPV
                     DSRSAYVMPPASQAYDREERERMLPAMSSVSGDAAWHPAKRTKTANGAPLVPSDAPRL
                     RPDDREPKHLAPSPTSSRERNEEEEASPPESMQEQLQSTPPESTLSASRKVPRAESGS
                     APQEGAASAQSAKDGGEAEPSAPPAKKEDWSVMHNPSTKPMLDVGLVHTFTHNSVVCC
                     VRFSPDGKYLATGCNRSAQIFTTDSGEKVCELQDPAVSGPGDLYIRSVCFSPDGKLLA
                     TGAEDRQIRIWDIAEQKITMLLTGHKQEIYSLEFSQDGQILASGSGDKTVRIWEVASG
                     KELHVLHTSPGQNYGPGVTTVTLSPDGGLVAAGALDTFVRLWDTKTGKLRCRLKGHRD
                     SIYSVCFMRDGQSLVSGSLDKTLKLWDLAPILQSADSPDDEVTNASLCKATFTGHKDY
                     VLSVSCSPDSRWIASGSKDRCVQFWDAERCQTQLVLQGHKNSVIAIHLSPAKRLLATG
                     SGDFNARIWTYEDK"
     gene            complement(<314292..>314960)
                     /locus_tag="MRET_3973"
                     /note="MRES_15490"
                     /db_xref="GeneID:38740739"
     mRNA            complement(<314292..>314960)
                     /locus_tag="MRET_3973"
                     /product="serine/arginine repetitive matrix protein 1"
                     /transcript_id="XM_027630600.1"
                     /db_xref="GeneID:38740739"
     CDS             complement(314292..314960)
                     /locus_tag="MRET_3973"
                     /codon_start=1
                     /product="serine/arginine repetitive matrix protein 1"
                     /protein_id="XP_027486215.1"
                     /db_xref="GeneID:38740739"
                     /translation="MPARGVSLEQDSRFSDKDASLIKTTKFPAVFSERVDMSKVNVSV
                     MRPWIATRVEQMMGFEDDILAELIMSLLESDSHPDPRRMQITLTGFLEKRAAPFMNEL
                     WRLLLSAQASVGGVPRAFVEQKKREMQATREENTRAMSEMQRRHGRDHSADDRPKSSR
                     RWDRGRSPIERDAPRGESWRRDRRDQGWATRAHFHRERAADASPEYSPPPPTHYRQRS
                     HSPR"
     gene            <315140..>316324
                     /locus_tag="MRET_3974"
                     /note="MRES_15485"
                     /db_xref="GeneID:38740740"
     mRNA            <315140..>316324
                     /locus_tag="MRET_3974"
                     /product="ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_027630601.1"
                     /db_xref="GeneID:38740740"
     CDS             315140..316324
                     /locus_tag="MRET_3974"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_027486208.1"
                     /db_xref="GeneID:38740740"
                     /translation="MLNSIKLITGNSHPELGELVSRRLGVPLTECVCRKFADQSIDVR
                     IGSSVRDQDVYVIQSGHSPYIDPNDSLVELLIILSACKTASARRITAVIPSFPYSRQT
                     KKDKGRVPITAKMIANMITVAGAEHVITVDLHASQIQGFFDIPVDNLTCEPSIARWIR
                     HKVEDWRDAIIVSPDAGGAKRATSLADSLSIDFALINCSRHQRNRRAHSSTSDSADLC
                     FAAQHHTSSSEVANGVHSLSESGEWFITDEGGGRLRSGGARKASAGDDSATDDVDSKM
                     ELLVGNVTGKTAILVDDMIDTGRTLALASKTLEAAGAKRIFAISTHGLLSGRAVDLIA
                     RTQIEKLVVTNTISNTEKAAQSNGKIEVIDMSAVMGETIRRAHHGESISTMFRQDAEI
                     MF"
     gene            complement(<316347..>318287)
                     /locus_tag="MRET_3975"
                     /note="MRES_15480"
                     /db_xref="GeneID:38740741"
     mRNA            complement(<316347..>318287)
                     /locus_tag="MRET_3975"
                     /product="ATP-dependent RNA helicase DDX55/SPB4"
                     /transcript_id="XM_027630602.1"
                     /db_xref="GeneID:38740741"
     CDS             complement(316347..318287)
                     /locus_tag="MRET_3975"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX55/SPB4"
                     /protein_id="XP_027486209.1"
                     /db_xref="GeneID:38740741"
                     /translation="MSTEASPAPMAAGAWSQIRPALSTWVLGVLASMKFEQMTPVQAS
                     AIPLFLSHKDVVAEAVTGSGKTLAFVIPILEILQRREEKLKKHELGAVIVCPTRELAQ
                     QTAGVVQQFLDAKPASSPLHGMQLCVGGTGISPADDFHAFREHGPDLLIGTPGRMEEL
                     LRRPGVKTSELEVLVMDEADRLLDLGFTPVIRALISHLPKQRRTGLFSATMTEALSEL
                     VRVGLRNPVRVVVKVEYKQRGKSQDIRMPATLANFYHISRPEHKLAQLLRILQREAHG
                     QQGTSKSIVYFATCAQVNYLFSLLARFARQKPEALHGLRFFSLHGKQTPKRRTATFAA
                     FAHANRQQGESDEAGVADARMNVLLCTDVAARGLDLPDVDVVVQYDPPSDPKVFHHRC
                     GRTARAGRSGRAIVMLHAGREEGYVEFLQIKQVLLGSYPYIESDGHAGTEPEHDARAH
                     ELFAALRATVREDRALYELGLRAFVSWAKAYSKHEVAFIFRLTDLPLDGMACQFVLLH
                     LPRMPELRTWQRQGTLFTDDVPDLPTFAYADKQREKQRQASLARRAAEPAAPPRATPR
                     AKSEAWSEQKRRKATRQVRREKKQRKRQWLANQAASQPEPDEEGEDDDDDDFDAEERA
                     AKKLKKGTLSQEAFDHAFFDSL"
     gene            <318448..>320985
                     /locus_tag="MRET_3976"
                     /note="MRES_15475"
                     /db_xref="GeneID:38740742"
     mRNA            <318448..>320985
                     /locus_tag="MRET_3976"
                     /product="GRAM domain protein"
                     /transcript_id="XM_027630603.1"
                     /db_xref="GeneID:38740742"
     CDS             318448..320985
                     /locus_tag="MRET_3976"
                     /codon_start=1
                     /product="GRAM domain protein"
                     /protein_id="XP_027486210.1"
                     /db_xref="GeneID:38740742"
                     /translation="MTPSFMSKRSDSTKRSHHASKFKMNRHALANEAFGYKEMIAPYL
                     PSKSTLESSLHLARSHSLNKHSGDESMSSSASAPLPRPVSVAGFENVSPRNSRVAETP
                     SVSVGTVTPDLHRHPTFNIDSKNDAQQAAAQVPKYDGTEPVFISPRQGPTSEPHGARP
                     PSPSTDMLHCKSNPATGAYRDLSKGSVVETDQEGNMAEPTIHPGIASPQLSHSSGFHQ
                     PLPNLEMPGLNAAAGFLPHEGRSQKLPQFTSPVSTFDPDASAQWNHDMSGQVTGFAVA
                     SSKRNADFHALFPTLPEDDYLIETYTCAVNRDLLIQGRMYVSEAHLAFHSNIFGWVTS
                     IVVPFAEIVSIEKRNTAYLIPNAISVRTLHARYLFSSLVSRDLTYSMLVCIWRMSTPS
                     EAAQQVAKALSDESDEEAASENEEHDSEQAKNAASGDAAGSDDDIDASVSTSDKLPNV
                     GSKIMTKREKLRRHLSKARKKIRNSNTIGAGVSGGADDSDSEESDSSMSDSAPNENEE
                     HAETTCDCEKKHAHLDHVVLDDVFNATPQQVFDLMFVDDFMKRFLEDNQMLQDVQIGE
                     WRSGEDASPEATATRSVTYVKPLNGPIGPKQTKCLITDEQLHIDFDDFCTAVTTTRTP
                     EVPSGNNFAVRTRLCFTWAERGRTRLYVTCTVDWTGRSMIKSVIDKASVDGQKDYFHA
                     FADSVRQYIIDHPKVYGKRRASASKAHKVEKIVNENTNPRDRADSIGSQLQNAMPSTS
                     VVVLTTLIIVLLISHVWVYLRGAPGAMRDPHNPHRLISTARPKQLTMRQAKVILQDEV
                     QQLLDTLANSRRVTEEIELELRELQEYIHEQTKLEETSKRKNGGNHV"
     gene            complement(<320987..>321409)
                     /locus_tag="MRET_3977"
                     /db_xref="GeneID:38740743"
     mRNA            complement(<320987..>321409)
                     /locus_tag="MRET_3977"
                     /product="AN1-like zinc finger protein"
                     /transcript_id="XM_027630604.1"
                     /db_xref="GeneID:38740743"
     CDS             complement(320987..321409)
                     /locus_tag="MRET_3977"
                     /codon_start=1
                     /product="AN1-like zinc finger protein"
                     /protein_id="XP_027486211.1"
                     /db_xref="GeneID:38740743"
                     /translation="MSLLDGEHCALPTCGTLSFLPIACPECRAQFCERHAQPEQHACA
                     QPTRIPTPSDTMRKRCEMLGCPRWSLQVEGAALTHRAPRCERCHGLFCMHHRSAIAHK
                     CTAAPPPTAYQQRQASAAARRAKAQAVLSQHFPLYHRN"
     gene            <321454..>321795
                     /locus_tag="MRET_3978"
                     /db_xref="GeneID:38740744"
     mRNA            <321454..>321795
                     /locus_tag="MRET_3978"
                     /product="component of the endoplasmic reticulum-
                     associated degradation (ERAD) pathway"
                     /transcript_id="XM_027630605.1"
                     /db_xref="GeneID:38740744"
     CDS             321454..321795
                     /locus_tag="MRET_3978"
                     /codon_start=1
                     /product="component of the endoplasmic reticulum-
                     associated degradation (ERAD) pathway"
                     /protein_id="XP_027486216.1"
                     /db_xref="GeneID:38740744"
                     /translation="MRWMAVGVMALLCSGAACAQFFQHLFHQDGFGSFFEQDEEPEAH
                     NVGDATWYQDRVQHAECSAYLCSDTLACVETPNACPCPYREQQRCAVGDTHVCIQGQD
                     CGRISSMYQLQ"
     gene            complement(<321805..>322959)
                     /locus_tag="MRET_3979"
                     /note="MRES_15470"
                     /db_xref="GeneID:38740745"
     mRNA            complement(<321805..>322959)
                     /locus_tag="MRET_3979"
                     /product="golgi phosphoprotein 3"
                     /transcript_id="XM_027630606.1"
                     /db_xref="GeneID:38740745"
     CDS             complement(321805..322959)
                     /locus_tag="MRET_3979"
                     /codon_start=1
                     /product="golgi phosphoprotein 3"
                     /protein_id="XP_027486217.1"
                     /db_xref="GeneID:38740745"
                     /translation="MSSSGLLQRRRGTQDADDDADAPKRSGSAVSTVQKTSGSGSVSN
                     IDLRTGHRLAYDPRDLTDEHEEQRYPRFTLMEEVLLLGLKDTQGYLSFWNDKLSFSLR
                     GCILMELALRGRIRIASGAEQKRKDVSERHIELANPKLTADPLLDETIRHIQNSPPTS
                     VAEWMDLLSGETWNMMRLHLQLKQVRERLCKCLVEKGVLRTEKRNFLLFDMPTHPIAD
                     MSVKDAIRRRVLAFTTAQSIHPDSLYKDNKSGRSICMPATRALCVVTAAHCGNVLENV
                     LQHLSLGLQESATEHVEHLMDEFAQWPMAPSAYSGGIPPQGSMEAMAAAPMRPPQLVS
                     SSKKQRNKVGVSINDLVRIMCQEYEAGGTPSAYEVIAAVLSVFVQMDAIL"
     gene            <323040..>323738
                     /locus_tag="MRET_3980"
                     /note="MRES_15465"
                     /db_xref="GeneID:38740746"
     mRNA            <323040..>323738
                     /locus_tag="MRET_3980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630607.1"
                     /db_xref="GeneID:38740746"
     CDS             323040..323738
                     /locus_tag="MRET_3980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486470.1"
                     /db_xref="GeneID:38740746"
                     /translation="MARTARVREQAAALVRAGEVRTPLDALAMLVHAMAVEYGVAPPA
                     MPVRWRSSPDMHELTYDAIHFVVVRLAAHTVVLASRTHAADAQSPCALSECPTSDFVD
                     NDSEYIPDRVDALVRMWERDLWDKVLRVSEVREVTDVKGVHAPLCTRGDAPQLRPVPA
                     LGDVDRDPLAASPAVPFGGLFQPPRLFPARGDGMWMGPQHPLFDRPRARYDPVTPLGA
                     GEPDFDEFAPPHIL"
     gene            complement(<323739..>327335)
                     /locus_tag="MRET_3981"
                     /note="MRES_15460"
                     /db_xref="GeneID:38740747"
     mRNA            complement(<323739..>327335)
                     /locus_tag="MRET_3981"
                     /product="U3 small nucleolar RNA-associated protein 22"
                     /transcript_id="XM_027630608.1"
                     /db_xref="GeneID:38740747"
     CDS             complement(323739..327335)
                     /locus_tag="MRET_3981"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 22"
                     /protein_id="XP_027486469.1"
                     /db_xref="GeneID:38740747"
                     /translation="MPGAHKFQRTERGAEPVEDMEMYSDEDLEGGFEDVEDAEDDVVD
                     AEPDDVTERVPSTSSHYAIPSNEEIHGLKETSDLYMNNVFKLQLDEMRKHMPPSATHK
                     PAMDDFLRHVQQCLVAIEAVEPQPLSAAIRALERRVGCRVHVPFAEPVPRGDPAYAIG
                     FEAPRTLHLVGSWPLQTAVRRPGDMDVDVEAVMPSTLFQEKDTLNARYFTKRAFYLAV
                     LAAHLRQEKHDVSYAFVGGDRRRACVVLRPKALSKLRAVVRIHLAHEPGLFPVARLAP
                     DRNNLRGAAVGASEQDTHALPPTPMYNTCIAADSLRLAHLVYLNATSEMCAGFREACQ
                     LLKIWAAQRGFGALLLHGDAKHVARRTLAGTDDARFVLSMLLAHLLHGDPKGSWTRTS
                     KLSAGMSSVQLFRGVLEFLARHSFSTPVWMKAQPRFGLAASDHAPAAFAVCERVLVEP
                     SGCVNLLAHWPASSVDMLQHEAMQSMHMLSDGDDHFADLFLVPHDVPLQRFDEVATLR
                     LVKTTTPAVPCMDAGHAALWAVHRTLQVSAQALGQRAWCVAICTPTSVIHPIDEPLDQ
                     PPVVELGVGLRAEHAWHQVEHGPPPESDDAPTFRAFWGDVAELRRFRDGRVLESVVWP
                     VASLAQRYALPRRILRHALTYHVCAKRIRFAGDALATGYTDIPGALASRAYAQDPGVH
                     GFQLVQSAYDTLARELRAMDELPLSVIGVSPTSAALRHMSVFAPGPIRLAELGHDVPD
                     VASYLPVHDVLITLESSGQWPDDLAAIQAMKAALYERMADVLSRRIPGAYARVAYDDD
                     MAKDREAIHDHVALQLVLPAGFAFSLRIHHDREQVLLHRLLSDAHVRPRAQAALTRYD
                     TRFVHAPAHHAALSALQDRHAALAPTVRLVRRWFGAQLLLGHVGPETLDLLCAAVFLT
                     NAHAVPATGLHGFVRVLTLLAHWDWREVPLLLPLENATRLAHQRKAALSDGGVSALPS
                     ERAPTFPAAQRADAEQHFRAMRARDPAYRHYTWVVATEHDTDAKAWMHAAPSAMVADG
                     VRQLARRAALALEHDALHAMPALFAPAYDAYDFVVHIRPSVHVRYAEALAPEARHWLE
                     PKRKKYANDEVLRPSVYGSELRPGFDPVGAFVRMLKTLYGDTFTLFYDEFGGTAIGGL
                     WNAAYTKPHAFKVWLAHSARPHAKDAVVLNKPAILAEIRRLGQGIVERIDTI"
     gene            <327443..>327976
                     /locus_tag="MRET_3982"
                     /note="MRES_15455"
                     /db_xref="GeneID:38740748"
     mRNA            join(<327443..327914,327942..>327976)
                     /locus_tag="MRET_3982"
                     /product="ankyrin repeat domain protein"
                     /transcript_id="XM_027630609.1"
                     /db_xref="GeneID:38740748"
     CDS             join(327443..327914,327942..327976)
                     /locus_tag="MRET_3982"
                     /codon_start=1
                     /product="ankyrin repeat domain protein"
                     /protein_id="XP_027486228.1"
                     /db_xref="GeneID:38740748"
                     /translation="MTDDAGANANKILLHAARTDHLEMLNSVLNAQPPMPYDINCVDG
                     LGNTVLHYACENMSTHVLDAILEQEIDVDAQNRIEGDAPLHVACKVENEAARNWLVQQ
                     LLDAGATTTTLNRAGLRPVDLIVGARAETPLGKELIQMLTMTQAENALGADDIAYDDG
                     DIEGEVSE"
     gene            complement(<327979..>328320)
                     /locus_tag="MRET_3983"
                     /db_xref="GeneID:38740749"
     mRNA            complement(<327979..>328320)
                     /locus_tag="MRET_3983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630610.1"
                     /db_xref="GeneID:38740749"
     CDS             complement(327979..328320)
                     /locus_tag="MRET_3983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486471.1"
                     /db_xref="GeneID:38740749"
                     /translation="MARHTRIAPRKKKEKEAEVKVDEHNRLRMLLWILMATTVVLIAQ
                     QVYRYWHRVPTPPPTSDEQYLPVQFDEQGEMDMGTMERMLDILYKRPNDMEGYESMEA
                     EPGSYRFRKQA"
     gene            <328495..>328837
                     /locus_tag="MRET_3984"
                     /db_xref="GeneID:38740750"
     mRNA            join(<328495..328692,328727..>328837)
                     /locus_tag="MRET_3984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630611.1"
                     /db_xref="GeneID:38740750"
     CDS             join(328495..328692,328727..328837)
                     /locus_tag="MRET_3984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486473.1"
                     /db_xref="GeneID:38740750"
                     /translation="MSRNASSKAEVIQEWADFDANGATFERGRMEANIQSLCFHEPAG
                     VSDEMKDRHKGVKVKGSDVTSLTSELLVEPEVAEAALVKAGGDLDEAFHLLLQHTSVP
                     "
     gene            <329027..>331063
                     /locus_tag="MRET_3985"
                     /note="MRES_15450"
                     /db_xref="GeneID:38740751"
     mRNA            <329027..>331063
                     /locus_tag="MRET_3985"
                     /product="acetolactate synthase I/II/III large subunit"
                     /transcript_id="XM_027630612.1"
                     /db_xref="GeneID:38740751"
     CDS             329027..331063
                     /locus_tag="MRET_3985"
                     /codon_start=1
                     /product="acetolactate synthase I/II/III large subunit"
                     /protein_id="XP_027486472.1"
                     /db_xref="GeneID:38740751"
                     /translation="MRMYASRMSAMRSAIQHSRSAPRCAVPVRTRKLYTSSPVAQKAR
                     PEPAPSFQSVRKSPSQLLSYRPEELDHTFIGMSGGQIFHEMMLRHKVHTVFGYPGGAI
                     LPVFDAIYQSKNFDFVLPRREDGAGHMAEGFARVRGVPGVVLVTSGPGATNVITPMQD
                     AMSDGVPLVVFCGQVATSAIGSDAFQEADVVGISRSCTKWNVMVKDVAELPRRINEAF
                     KIAMSGRRGPVLVDLPKDVTASVLKHPIPYSWTSPELSEMPSRETAMQRKSRLGGMLT
                     PADIQSEIEHAARLISIARRPIIYAGHGVLSHEDGPTLLRELAISHNIPVTTTLHALG
                     AFDEEHPLSLHMLGMHGSAYANLAMQSADLIIALGARFDDRVTGRVDKFAPMADAAAA
                     EGRGGIIHFDIMPKNINKVVQATCAVEGDVTENLRRTMPYIASPPDRSEWLEQIQVWK
                     KRYPFTYEPSKPENRELMKPQEVIEALDVAVQSHKDRVIVTAGVGQHQMWAAQHFRWT
                     HPRSWISSGGLGTMGFGLPSAIGAKVARPDGLVVDVDGDASFSMTAMELATASQYSIG
                     VKVLLLNNEFQGMVLQWQDLFYDRRYSHTEMHNPDFVKLAESMGVKALRCDSLDELPA
                     KMKEFIEYDNNRPILLEARVVKTEHVYPMVPAGKSLEEQVLHPSFAPPPPRDPM"
     gene            <331138..>332106
                     /locus_tag="MRET_3986"
                     /note="MRES_15445"
                     /db_xref="GeneID:38740752"
     mRNA            <331138..>332106
                     /locus_tag="MRET_3986"
                     /product="cyclin"
                     /transcript_id="XM_027630613.1"
                     /db_xref="GeneID:38740752"
     CDS             331138..332106
                     /locus_tag="MRET_3986"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_027486428.1"
                     /db_xref="GeneID:38740752"
                     /translation="MTMSADVAATQWLFSRDDLQYTPSVTGTYELPAPADTESSSAMV
                     KHTAQTMTSEQERILRGKGVHLIYKMGEFLQVGQHVMVAAATFFHRFFMRRPLQVNRA
                     GSGWSHYEVAAACVFLACKAEESLRKLSSVVDAVMASLDKSPEGQMRWADRSFRANHG
                     SHEFAKWRDCIILHEEALLTTLCFDLVVPQPHELLVRAARTLEVETPLARLAWTILND
                     AFRDPTCLFFDAPVLASGAFLKACTERNVDPAMYYAARPSDAPRRPDDEGDDYFDWLD
                     VFDVDLDEARDAMQAIEKDVYDFHLPLQRVSSSRSAPQPPPTTASS"
     gene            complement(<332123..>334327)
                     /locus_tag="MRET_3987"
                     /note="MRES_15440"
                     /db_xref="GeneID:38740753"
     mRNA            complement(<332123..>334327)
                     /locus_tag="MRET_3987"
                     /product="tuftelin-interacting protein 11"
                     /transcript_id="XM_027630614.1"
                     /db_xref="GeneID:38740753"
     CDS             complement(332123..334327)
                     /locus_tag="MRET_3987"
                     /codon_start=1
                     /product="tuftelin-interacting protein 11"
                     /protein_id="XP_027486427.1"
                     /db_xref="GeneID:38740753"
                     /translation="MARRKSMYMDEGTDSDDSAASDEHTSVRQAPSFVPSTTAHVQTE
                     EEQTIERRAFGAGLGAQPESMDIESAPRAGLGATPVPKTAGPALSRTSGSGGFDPAAL
                     MRQMGWTGGGLGKDGSGIVDPIQVKMRPSRAGVAFGGKETLKAQAAEPEQVQEAPPKV
                     WKRREKKPRVVYRTYDEILAQAADQPVPILDATGAEIQAASLSEALARHPVPTSAHES
                     LPELRHNMSLLCDGTKEKLGKLARHAAGLGERMHILERSLATAHAQTSHYEQERSSLA
                     SVLETVAALQHASHACLSLSELVPAMEQVAALPRDTIQRYGLDEAMAGALVPALKHMT
                     SQWDPLREPHAGTRELSLWIPILLTTSTEAERPMTPYESVMWNIWMPAARQALVNAWD
                     VYDAAPAVAFIEAWRDLLPPFMLDNVFDQLLLPKLERAVQTWTPRADVPMHVFVLPWL
                     TLSEARMASVVSETRRKWRSVLSAWHVSQGIPAHLEAWRGIYSTKEWDALLLERIVPS
                     ISRALRTQFRVDPSQQDMQVLEQVLAWAGVLRDSVLSRLLHVELGTPWLQVLHAWITQ
                     PDADLREIAAWHEFWRSWFPPHVARLPGLSHMFMQGLRHINAALDRGADRVHMPAPVV
                     AALHSRTESAPAPTKPRHAPPTLEEVSFRHVIEERAVEADLFVRSLNTLEPATGMALL
                     RISHHMDGKVGTTFYLDDDVIFVAPQKQRSAEGQRLEYEPVSLAELLERAAA"
     gene            complement(<334406..>336934)
                     /locus_tag="MRET_3988"
                     /note="MRES_15435"
                     /db_xref="GeneID:38740754"
     mRNA            complement(<334406..>336934)
                     /locus_tag="MRET_3988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630615.1"
                     /db_xref="GeneID:38740754"
     CDS             complement(334406..336934)
                     /locus_tag="MRET_3988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486468.1"
                     /db_xref="GeneID:38740754"
                     /translation="MRRSSVLSLPSAAHDTGPPPVLTASPAPAREGLSFVSDTPSQSF
                     ASFRTQRSHQTSITSPQMHSPHTHSGAADDADASFAKDGTRPSYLDVSALSPREFDVY
                     TRWASRIKPAHSRRQGFLDEHAAVKFLRCELGISVDHEVQILSLFERLPLGIKYGHFY
                     AMLRLAAWAQRGHAITRDLLFVQTEPAESRRRRRGRPSSTLTAAPMADADMTPMVTAM
                     PVSLEVPKAPPRQLPDDHELVRHPSGSDLDHGKVVYSPPESHLVRPMPVVARPATNKA
                     PPLDDADAQRPERPPLMTESHPLLRPSAPMPLAQQVSPLIQASLNARSQFKKASRTSR
                     PKTFTVLSSSSGQFQRDKPHLLNGEEISPHALSPDTKRRSTSATKLSSLIASQDFKPG
                     TPPLRAGMSGQTIAPKPSYFGRERGVLPAWLREQYEEGNVLYPPPDPADPSVTSVYDA
                     LDNKAHNTMNGSERAAASINRHTPFFPPHRRDLERAELTTLSANGPAQYKKLNEETSV
                     GKRTSNDSLTQERGAKLLGSRSKSTLNTKGRRLEHSPSQNWGTQLESGTYAGFKSTPS
                     SRDLRLQPLARVSAKRSFQIRPTQEFQPILAPLPTETAVHHAQESTGDTDNRPPAPLR
                     TQDDLRTEWLLRAHDLPPRLTRSHSLNMRQPEVHRFKLQGDATRSQLTYKHERKPSGS
                     MAFGTPMARRVSQKHMTSHDESSAERASRPLPQAPDAPHESKPEAAVPYKPRHASAAK
                     LNAVIRKHEEDEARQKESSAPQEAMTMDHAKDDEPHETKEEPNVPPEPPARRESEEPS
                     TADDPPTPGDLNQHEEESPPSQPPADPVETSTTKEAAPLSDRES"
     gene            complement(<337214..>338914)
                     /locus_tag="MRET_3989"
                     /note="MRES_15430"
                     /db_xref="GeneID:38740755"
     mRNA            complement(<337214..>338914)
                     /locus_tag="MRET_3989"
                     /product="establishment of cell polarity"
                     /transcript_id="XM_027630616.1"
                     /db_xref="GeneID:38740755"
     CDS             complement(337214..338914)
                     /locus_tag="MRET_3989"
                     /codon_start=1
                     /product="establishment of cell polarity"
                     /protein_id="XP_027486467.1"
                     /db_xref="GeneID:38740755"
                     /translation="MKRPSAHDECQFCVLATFHSDNGAVLERSVPTHTGLAEQALAEQ
                     MIPDGLHDQDEDWTVLIRPVAHLALPHIPRRPAHVQSKLPYAHGHEAGDCIYILSLAR
                     TMRREEEPRGACLVAIALATMHPHLSIFQPVLVLAMDAYMATRDASVVEQLYDAVNTL
                     HWQSLPCLSYSEKMRMRGDSALHALYHPPPALMDAHTSLSADHAASAPRQTRRHSSLG
                     LTRRSRARYTISPPQHARPQFLGYATCLQFGSTCLPIHIPLHVFPEEIGEYSLSNLFA
                     TFGHAKLLSRTQHPHLHSNGIHTHPMTLLFNALVTHKRVLFVAYHAPAKVVVDHVLAA
                     CAFVSGCGAVLRGFVASAMPYATLVNIDALSHQRGFIVGTKHPRLAELGLWDVLCHCE
                     AQSITVSPHLSPPRPLPPFLDTRHPARPSLRHTLRSMPECMLGDERPHAPDVLFMQRL
                     TRALQQHASEPFLRYWCQRYVRDFVALATRHEQTFYGSSLFQPTIHLSHDARDTYMLR
                     CHALRIEGWRGTPSYRSFLWDMSHLYGQASRTAASFCLAHSSSGTALRVDSSAPSTPR
                     "
     gene            <339063..>344018
                     /locus_tag="MRET_3990"
                     /note="MRES_15420"
                     /db_xref="GeneID:38740756"
     mRNA            <339063..>344018
                     /locus_tag="MRET_3990"
                     /product="separase"
                     /transcript_id="XM_027630617.1"
                     /db_xref="GeneID:38740756"
     CDS             339063..344018
                     /locus_tag="MRET_3990"
                     /codon_start=1
                     /product="separase"
                     /protein_id="XP_027486222.1"
                     /db_xref="GeneID:38740756"
                     /translation="MPEGHRRVASRRAEVRALEDVLACIKAGRRIQRTDIASLIVHMN
                     ASSIARAMSLYTSRSTAPTDAGVGWRTHSGPPDAQRTRTAKLVVNAVLSALQSRRASP
                     QDIVPWVDAFRLAMGTLVACGTAATELAPVALSVIRRLADAHMPDHALTELVALRACV
                     QATWSYDASVHEPGAAARRLRASLTYTCTEVSAADVSIVLDAYACALYVAPSVLDTPT
                     PLWEAWTSVQAWSQHARAVRLDAACDRVAFMAERAVAQLAPPTSVDALSLRMSSLQLL
                     MPVADVDAEALWDRAAALVTQRGIDASHDALAQMHEAAKQYHRAHGPAFERVMAWCAR
                     AAHAAEAVSAPLNSPAPSWSACLEALATRTPGPIPTTSAPRDMVPLVTPHIRAMLRAS
                     SVPATLYALRVLRRVDCEATCREGVRAACALAQRVFRERDVSSLDTCIEAFACVQHAP
                     PSAQRTLSAHLFHYGSRLYADKAYAQAARFVEMACACLAHAHDEASRLTLVRQYHVLA
                     GAYQHMSQFRGAYDAYVAGLRHAKPTDDALELVRRVVRGAHHVSVFALLDPHRLLAEL
                     EAWPAAPRVALHAYLLDELLPMLQRDGAQRAYEAVCAASLPLLSHAEPSVQLHILLRH
                     AELLLLQRADVDWAPIEQRLRGAPADLVSTYHMLAALHAIHAHAYDEAVSHVRRAQPA
                     PDAPRPRARRAGATIPAPTPATPPPPGGELREPSPSRAASSLMLLVADAFLHAGQLLP
                     CLATLRHAREPVRLAEVLVSLDAADAAMDALHGHETSSARARLVHAHIEAVRGHAARA
                     ASLYDAAIDAADAPLPEAPAWERVGDKAALWDMQAYAADVYAAVSMAHGDMPEALQGA
                     LHALRTRLRLAMLLAQTAAPPPQDDDDDVFSAPSTSTSTPSARPPAGRLMARRMAGLL
                     WRTAYALCASYERLSRLYARRGAVRDAEALAKECVDMARGTSPGLLAGAQAWHAEWAA
                     SCGDTAQAAQLAADVADHPHAAFVLDTLAGDGAFDRTAACLDRLQREAGVRLLRALHE
                     RLVCARAMLAHDPAMVTGLDAAPALAVYAQLRLAEARAALQSDPVYGMLPDMARCLPQ
                     PAMTKRATHRHVHALLTDAHTAGARVMADASADVATMRTALACVRDAVVLAASIGRPL
                     RDDSAAYACALTHAAVSVSVRRACADAATRRAARPAARWLRRADAPPPCSEVVAPPAP
                     PLDAHTAALVVSLSSDERELIVARYGDAYEPSVHLLPLHRQSRRDADDDDEAVLSVEA
                     VMTELRRLVHDSNVGVQGAKDVTALDARKAWWSHRRALDAELCALLTQVQDAWFSGLQ
                     GLLAPLPRQHTLPGLHRRLEAIVRRACPARTRTPIALPDMAVATLAAMPATYRDDDLE
                     DWLHYALDTLQLSGVPVAQDEVDLDELCVDVRSALDEYHAKQAAPHPHHTYLVLDRHL
                     CELPWESLPILRSQSVTRLTALDACPTAPLELRACSTAYLLNPSGDLTRSEDRFAPAL
                     RAHPSWHGTIGHAPLPHQVAQDLASHDTFLYFGHSGAEMYVHPARLRELERCAATMLW
                     GCSSGALEVHGVYDPIGTPYQYAVAQCPALLAALWDTTDRELDGVCEAVLEYVGLFST
                     NDPHTRMSLPEALVAARSQCKLPYLTGAACVVYGAPVVWSS"
     gene            complement(<344015..>344545)
                     /locus_tag="MRET_3991"
                     /db_xref="GeneID:38740757"
     mRNA            complement(<344015..>344545)
                     /locus_tag="MRET_3991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630618.1"
                     /db_xref="GeneID:38740757"
     CDS             complement(344015..344545)
                     /locus_tag="MRET_3991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486223.1"
                     /db_xref="GeneID:38740757"
                     /translation="MDPDPVTALAQAVQGCVDASADVRMRVLAKATPLVGELRSWNRE
                     AHEALADRQSHVQRSQRALDEAVLVYESLSYEHRELEAQIAAHMELERLDHRVLTHED
                     QAQLASLPASEQHEAERTRLQDMLSERRHLELEGKKLAEEVAQLQKQSRLAHRHLVRL
                     EQGVASLHQSVQRHAS"
     gene            complement(<344570..>346015)
                     /locus_tag="MRET_3992"
                     /note="MRES_15415"
                     /db_xref="GeneID:38740758"
     mRNA            complement(<344570..>346015)
                     /locus_tag="MRET_3992"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630619.1"
                     /db_xref="GeneID:38740758"
     CDS             complement(344570..346015)
                     /locus_tag="MRET_3992"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486220.1"
                     /db_xref="GeneID:38740758"
                     /translation="MSGEAASTVFVGSISPGVSDRWLVQLFQACGGYRSFKRVSKAFG
                     FADFSTLRDALRVLAVLHDLELPCMGTHRHEPRKKLIVRADEKTSAFLGEFEKTMVRT
                     EADAMQDAAARARVDYVIRAMSNPNAEAGDEPERYEIPSHLKDLSMSEIPAYRRKQVL
                     SEIEKFRLGAVASDAASRRRELELERQRAAVLQARSSPLAGKESTPDTPGASMDTSDV
                     ADDPEQADEAAERERQRAEDARRDVDARHAEQAYVEREKARIAAWTERAPADHDPSRR
                     TMEAWISLDEDQELAEELFWTDRRRWTQLRAEARRREDEADRADREAEAAEQSDSMRQ
                     ADAFLASLAPMARGSSAWRPSGGGAPIKLHVQHGDVPPGVQRRLQLEEKIRADPSKRA
                     ELVDALPRDELWHTTPAWTRIDLAHVAPIIDRGIEESFGEPVPDLLEAVLDKLRERAS
                     AQDVADVLAPVLDEDEAPALVERVWRFLVAT"
     gene            <346172..>349550
                     /locus_tag="MRET_3993"
                     /note="MRES_15410"
                     /db_xref="GeneID:38740759"
     mRNA            join(<346172..346227,346265..>349550)
                     /locus_tag="MRET_3993"
                     /product="protein transport protein SEC24"
                     /transcript_id="XM_027630620.1"
                     /db_xref="GeneID:38740759"
     CDS             join(346172..346227,346265..349550)
                     /locus_tag="MRET_3993"
                     /codon_start=1
                     /product="protein transport protein SEC24"
                     /protein_id="XP_027486221.1"
                     /db_xref="GeneID:38740759"
                     /translation="MSSQPARPPQLPPGWTLQWDAAAGRNVFVETATGRKSWNPPMGT
                     TPQRQQGPRAHPSAMKRMSMPVMPVSRPVPGPGGASAPQGRPVRPGLGHGRMPSMQAP
                     GAPRVLSGPARPPFRTLSGAQHARSPTMVRSPVMPSSPTGAMRGAAPSARPMPGTHVA
                     RPQAMRSISHGPRPPPKNPMVEATAGTTAPAQAPASTTASAPAAPTPQSPPMPGPRAH
                     PASRRRAYPTAHIAAHSISYSGNEVPAATPADQANSVFTPAAMGHTPTRSVSTTMHAP
                     AANATPVSPMNQPMMGLPAQVPNPLADATSSLITPGLQGAAPPVPGVSDVTQQMQQMG
                     MQPMGAARVGNQLLNAVVGAQPPIMSDLDAPPPPIVLPPNATVTPSSRANVDPSYQRC
                     TLKAIPTTNSLLTKSKLPFGVVLSPMRSVRPEDGDEPVPVVSDSVIARCRRCRTYINP
                     FVTFVDNGQRWKCCMCYITNEVPQLFDWNQETNQPADRWQRPELNSGIVEFVAPREYM
                     VRPPQPPVYVFLMDLTYASVSSGMLTTMATTLLNTLDTMPNKDNRAKVAFIGFDSQLH
                     FFRMLPGGTDVSMFVVSELDDVFLPQPNDLLVNLTECRACVESMLRSMGDLFANAAVT
                     PSALGAALRAAHKLTSATGGKIEVFSSSLSNLGPGALKMRDDKKLYGGPRESSLLSPQ
                     SSFYKSFAIDCSRSQVSVDMWLFGPSYVDVATLSCLPRYTGGQTFYYPIFDPQHPEVV
                     SKFSHELRSVLSSPISFEAVLRMRATRGIRPISFHGNFFVRSSDLLALPSVPSDQSYM
                     IECEIDEPLHTHVAVLQSVVLHSTADGERRIRVMTTAVPTTTSLSEVYASADQVAIAS
                     FLANKAVEKSLHSRLEDARSLIRSRLIEIFTAYRNTMTNTRGGNAAHLTIASNLSLLP
                     LLSLGLLRNRSLRISTQIPSDVRAYNQTLLTTLPAQRLIPFLLPVLYSLHNMPADAGT
                     VDPTSQMLIMPPRLNLSSERFERHGLYLIEDGMSIFLWLGRAAVPALTMDVFGAPDYA
                     SLASGPITLPVLDNSMSQRLRAIVDRIVVQRRGPYLPLLYLVKEDGEPGMRQLALSRM
                     IEDRYEQTSGYLQFLGQIRDKVNGA"
     gene            complement(<349588..>350526)
                     /locus_tag="MRET_3994"
                     /note="MRES_15405"
                     /db_xref="GeneID:38740760"
     mRNA            complement(<349588..>350526)
                     /locus_tag="MRET_3994"
                     /product="GDSL-like lipase/acylhydrolase"
                     /transcript_id="XM_027630621.1"
                     /db_xref="GeneID:38740760"
     CDS             complement(349588..350526)
                     /locus_tag="MRET_3994"
                     /codon_start=1
                     /product="GDSL-like lipase/acylhydrolase"
                     /protein_id="XP_027486226.1"
                     /db_xref="GeneID:38740760"
                     /translation="MRFQAGWLGVCAAFMSALAAQMPMDTRIDRSYSSVVVFGDSLVD
                     NGNGTYQLTNREWPAPCCTWQGRFSSGPTWPEELAGLLQVSQVQDFAYGGSTSNNKNV
                     QGKSGYNESIPVPDLVTQVSKYLHTAKDQRADPHAVYILSTGSNDLYYGSQKSLHLLK
                     MADQAVDTIKCEAKKLIDLGANTVVLTSITDMGLTPSFRHYGNLVMRGGSNAYMLRFN
                     QNIREAVKELQQPNIQVMLADLYKYSEDIYKSAKRHGIKNTTDACLQGFSKTEKQHGV
                     KKHKCDNPDEYLYWDLFHPTNRAHQLLAQAVKSDLF"
     gene            complement(<350808..>351375)
                     /locus_tag="MRET_3995"
                     /db_xref="GeneID:38740761"
     mRNA            complement(join(<350808..350849,350881..350962,
                     350992..351262,351291..>351375))
                     /locus_tag="MRET_3995"
                     /product="Got1 family protein"
                     /transcript_id="XM_027630622.1"
                     /db_xref="GeneID:38740761"
     CDS             complement(join(350808..350849,350881..350962,
                     350992..351262,351291..351375))
                     /locus_tag="MRET_3995"
                     /codon_start=1
                     /product="Got1 family protein"
                     /protein_id="XP_027486227.1"
                     /db_xref="GeneID:38740761"
                     /translation="MHASCVDGIQASASQPFVPSSMWLTDQQKIGVGLVSGGVFFLVL
                     GLIMFFDATLLAMGNVLFVSGISLLIGPQKTLLFFTRKQKIRGTVCFFTGMALVFLRW
                     ALIGMVVEMIGFLNLFGDFFPVILSFLRQVPIVGRVLSLPGVSQVMDQLAGTRRSAV"
     gene            complement(<351409..>352697)
                     /locus_tag="MRET_3996"
                     /note="MRES_15380"
                     /db_xref="GeneID:38740762"
     mRNA            complement(join(<351409..351511,351540..351701,
                     351729..351842,351868..>352697))
                     /locus_tag="MRET_3996"
                     /product="cyclin-dependent kinase 8/11"
                     /transcript_id="XM_027630623.1"
                     /db_xref="GeneID:38740762"
     CDS             complement(join(351409..351511,351540..351701,
                     351729..351842,351868..352697))
                     /locus_tag="MRET_3996"
                     /codon_start=1
                     /product="cyclin-dependent kinase 8/11"
                     /protein_id="XP_027486224.1"
                     /db_xref="GeneID:38740762"
                     /translation="MSSSPYRNDVPSKMPTSASASAVMSAYRATRNAQRKPVLARYEV
                     LGYLSSGTYGRVYKAKELVANGSTTDARVFAIKKFKSDKNDDAQVLRGISQSIIREIA
                     LNRELHHENIVSLHEVLQEKTSIFLVFEYVDHDFLQIIHHHVFVLRKPIDGVVVKSLI
                     WQLMHGIEYLHANWIMHRDLKPANILISNRGVVKIGDMGLARVYSNPLVPLYSNDMVV
                     VTIWYRAPELLLGARHYTTGIDIWAIGCIWGELLALRPMFKGEEVRPSTQKGVRMPLQ
                     TNQLSKIMDILGTPTTKEWPKLSSMPDYTAWIAERRTDTIVSSLQQWYVDRAFTSHGF
                     DLFAKVLAYDPERRFTASEALKHPWFHEEPLPLKVIFPSKSPYPPGRMVQPDTQSSVA
                     AASRSRKPRV"
     gene            <352837..>353796
                     /locus_tag="MRET_3997"
                     /note="MRES_15375"
                     /db_xref="GeneID:38740763"
     mRNA            <352837..>353796
                     /locus_tag="MRET_3997"
                     /product="translation initiation factor eIF-2B subunit
                     alpha"
                     /transcript_id="XM_027630624.1"
                     /db_xref="GeneID:38740763"
     CDS             352837..353796
                     /locus_tag="MRET_3997"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     alpha"
                     /protein_id="XP_027486225.1"
                     /db_xref="GeneID:38740763"
                     /translation="MSSDFSIVSAFNHALQSDLDIPMPIAAIFALSEMIAQSKAETTS
                     ELMESIKMASEEVKASLANPIPATAGLELFMRFVTTKNWAGGDFEAHKQNLIHAALEF
                     ANNTVPNCRERITHLLMPFIKDDSVILTHGYSRVVMQVLLSAAKVHGKRMSVYVTESR
                     PTGQGLQTYKRLREEGIPCTVVLDSAVAYLMHRVDMCLLGGEAVVESGGIFNAVGSYQ
                     IGIIAKAAKKPVFAVAESFKFLRLFPLSQYDVPITARHLPLPTSEESYEAPEDNRMTP
                     AMEAMNPLIDYTLPELLTFIVSDVGILTPSGVSDALLAVYGDN"
     gene            complement(<353837..>356242)
                     /locus_tag="MRET_3998"
                     /note="MRES_15370"
                     /db_xref="GeneID:38740764"
     mRNA            complement(<353837..>356242)
                     /locus_tag="MRET_3998"
                     /product="ATP-dependent RNA helicase DDX27"
                     /transcript_id="XM_027630625.1"
                     /db_xref="GeneID:38740764"
     CDS             complement(353837..356242)
                     /locus_tag="MRET_3998"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX27"
                     /protein_id="XP_027486218.1"
                     /db_xref="GeneID:38740764"
                     /translation="MVKPKPETKPRPARDDFIMTLDSEDEGMDLEPSLDHEEQEQQVP
                     KRKVKARIGEREKILDDGRNPKQRDQNRDDVLEVAEMDFEFEPSQMTESMQGWNFYMD
                     GASGRHSSEASKSTVDDLIDRHRAGIEIPNELKDADEEEVEEQVGEQSLAPLSDSEDE
                     DGFGSGMRSAKRKALDNEEESQDDEESAMDHLGEEDEEEEEEEEEAEEDMPDDASDVS
                     DATRERQEAYFAKETTETPVAASFASLQLNRALLRGLAALNFSKPTPIQARTIPIALA
                     GKDIVAGAVTGSGKTAAFLIPILERLSYRQRGTDDAKSRVVVLCPTRELAIQCHSVGV
                     ALAKFMNVRFCLCVGGLSLKAQEAELKMRPDIIIATPGRLIDHVRNSASFGMEDVEIL
                     VMDEADRMLEDGFEDELNEIVRMCPTQRQTMLFSATMTEDVDQLVRLSLEKPVRLFVD
                     PKRSTSSKLIQEFVRVRTQAGLAGRERQKAEDEHRAALLLTLCMRTFRDQVIIFLRSK
                     KLAHQLKIVFGLLGLSAAELHGDLSQEQRLQSLSQFRDGKVDFLLATDLASRGIDIRG
                     VQTVINYDMPAQIEPYLHRVGRTARAGRQGRAVTLVGESDRRLLKTVLKRTPPEQVKH
                     RLMPSDMVQQLSDTIESLKSEVEQILLEEKEEKAIRQAEMEVQKSENMLTHHNEIYSR
                     PARTWFQSEKAKSEAQNASREQQNTKVDATKARDRLAGLSRRKKRNRLMREEDAKSSA
                     KHETDAAVRAAKRSQRPSGLGEAVSAKTQKQKKSNKKFKMTKALRSSGKGGAFGSDMS
                     SRK"
     gene            <356463..>357725
                     /locus_tag="MRET_3999"
                     /db_xref="GeneID:38740765"
     mRNA            <356463..>357725
                     /locus_tag="MRET_3999"
                     /product="FHA domain protein"
                     /transcript_id="XM_027630626.1"
                     /db_xref="GeneID:38740765"
     CDS             356463..357725
                     /locus_tag="MRET_3999"
                     /codon_start=1
                     /product="FHA domain protein"
                     /protein_id="XP_027486219.1"
                     /db_xref="GeneID:38740765"
                     /translation="MSTQSSDTNQLHAEGSSGNLGWRISSAIRRHSHTQSTFSPPNPS
                     FLSGFSSSAGSSSRQSQDTEPSTSYPSTENRFLYPRFIGTKCMSSSPQASDASSASTS
                     HKSQMLSSSDMQNTTSKEPFQYKTRKVRLSPHIDSTRKLLFFPTEFEIEEGGRPIQIG
                     RFSENSKNLDDSNLTSQDESNMTETVSTSMQRTATHNSHRQPVVVGRRKICIAFQNKV
                     VSRLHAELWCDTNGILYLRDTKSSSGTFVNRCRLSPPGVQSDSFRIHDHDLIQFGVDY
                     RGGSVDEYRAIKLRFETNYNVNIPKRSIEYGQSVLQKLESEHMQKIQNGSSESTSPQS
                     STEKGKLSECCICLLKIRVSQALFISPCSHMFHFKCIRPMLQLHHPGFSCPLCRSFFD
                     LEQDAQDDTDEECSSKEGVPLTLVKEPE"
     gene            complement(<357968..>359108)
                     /locus_tag="MRET_4000"
                     /note="MRES_15365"
                     /db_xref="GeneID:38740766"
     mRNA            complement(join(<357968..359019,359045..>359108))
                     /locus_tag="MRET_4000"
                     /product="ribosomal RNA assembly protein"
                     /transcript_id="XM_027630627.1"
                     /db_xref="GeneID:38740766"
     CDS             complement(join(357968..359019,359045..359108))
                     /locus_tag="MRET_4000"
                     /codon_start=1
                     /product="ribosomal RNA assembly protein"
                     /protein_id="XP_027486320.1"
                     /db_xref="GeneID:38740766"
                     /translation="MSEDKAGDVLVNKNKRFRKDKPWDTDDIDHWKIDKFTQEDNPHH
                     FLEESSFATLFPKYREKYLREIWGHVTTALEKHGVACTLDLVEGSMSVRTTRKTFDPY
                     IILRARDLIKLLSRSVPFVQAVKVLQDDMACDVIKIGNIVRNKERFVKRRQRIIGPNG
                     NTLKAIELLTGCYVLVQGNTVSAMGTYKGLKEVRRIVLDCMKNIHPIYHIKELMIKRE
                     LAKDPKLANESWDRFLPKFKKQNVKAKKPKETIKKKTYTPFPPPQQPSKLDLQLESGE
                     YFLKPQEKKKNELAKKMQAQAEHAVKREQEREKMFIAPEEPLPGQETKKKKHSKHEDH
                     DANESKAEKKARKAEKQARKADKERSKSKKRKHADDD"
     gene            <359235..>362558
                     /locus_tag="MRET_4001"
                     /db_xref="GeneID:38740767"
     mRNA            <359235..>362558
                     /locus_tag="MRET_4001"
                     /product="SNF2 family helicase"
                     /transcript_id="XM_027630628.1"
                     /db_xref="GeneID:38740767"
     CDS             359235..362558
                     /locus_tag="MRET_4001"
                     /codon_start=1
                     /product="SNF2 family helicase"
                     /protein_id="XP_027486318.1"
                     /db_xref="GeneID:38740767"
                     /translation="MLEACSVSSWDDNDTIPLGVVTVHVRPPSPSTVELDTPGTRWQY
                     LDMDVLHQLEAHEQGCIVPILRSLVEKRAAKVALEQDVFALWVAGMYQGSLHVRVFAV
                     PESTPLPPPRERQVSEAAYEWTKILPKTCTDAAAWHAMSRDMDTNGNDWPFWQEDARY
                     WTLAELYRQLPSPPIVLSYMHGKSLLAPAGLRCTLYAYQERSLAKLLQRELWPGTYTN
                     PYLLSCESPCVLPHGDNMYAFDPECFTFYRWPDIPVYPDVRGGILCDEMGAGKTLVCL
                     ALILATLEQISSPDHDSIMSCTTSEMAMQFPDEKYQDKDPAAGIMGRIVTAPFGAPSP
                     GERLGRRPITHIPKSESPTFHRSRPMAGSVSLAKIAAHRLRTTNACRPDLLDTLPSQI
                     RAILGKDSAPFGLLWPPLPHRVSRVNHNRTPLRVYLTCATLVLVPPTLIMQWLDEMEK
                     HCEPQLLRVLCISDIGSEIPAASQLSQDYDVVLMTHARFGKEAGDDQSIRSDLDKSPL
                     MQVYWKRLIIDEGDMVAGDSLLVRLCTYLHVERRWIVTGTPTQALVGASALHVVGDGS
                     GVPTHTKEMNWSASDRKNLDKLKHLLVRFLRLQPMYGSHLNTHSATNASNLPSFKERD
                     WITLMGSGINDMGEWPAKRRLYNMLSRLMVRNRAKDVEHECPLPPLERRIVSLSMSSL
                     ECMTYNVLQLLIMLNAALSQEKDKDYYFHTGNKKTLASVMENVAMACFHFAGFEFLRQ
                     VQRAHDHILQQLNKPHGVAEQFKQEAVEALYQISAALQDQTWREHVQQGDVLYKAEHP
                     EERLLLSWSRRGSIWLTSEELLFLRNEYYKKSAHVLDARGLFEELLRCGAQYKHRKTG
                     CTVSSATHRSPKTISTPKRNEPFLSEPSRVPALPAAFDDVLVHTSTSTKLNGILQEIL
                     EAVPGEKVLVFSTLHQVLNEIAKALELCRVPFLIYVSGMPQHLRNTYVNAFTHESQFR
                     CLLMSTAIGGSGLDLHCASRIILTEPIWQWDLESQAVKRAWRIGQTRRVLVSTYVMRH
                     TYEERVIERKKARFLNGTDAAEQLQTLTDDPGMREFLARPHLVQAPSKKREITWTRPL
                     LGDPAKLSFVHASKRARHT"
     gene            complement(<362564..>363731)
                     /locus_tag="MRET_4002"
                     /db_xref="GeneID:38740768"
     mRNA            complement(join(<362564..363206,363232..363353,
                     363379..363425,363456..363571,363601..>363731))
                     /locus_tag="MRET_4002"
                     /product="geranylgeranyl transferase type-1 subunit beta"
                     /transcript_id="XM_027630629.1"
                     /db_xref="GeneID:38740768"
     CDS             complement(join(362564..363206,363232..363353,
                     363379..363425,363456..363571,363601..363731))
                     /locus_tag="MRET_4002"
                     /codon_start=1
                     /product="geranylgeranyl transferase type-1 subunit beta"
                     /protein_id="XP_027486329.1"
                     /db_xref="GeneID:38740768"
                     /translation="MVTPPRDDSRTTGACSLPISRHVKFWKLHLSMLPAPYVRGDDQR
                     MTFAYFCLGALDLLQQLDTVVSQSDREAYTSWVYGQQISSELGGGFRGSPAACRGHIT
                     MTYTALLILAILRDDFSRLDREALRTHISQLQQPDGSFACAQDSPEKDVRFSYCAFAI
                     AYMLHDWSMMDKQAAIQYLLRCQHYESAFAQEPGLESHAGSTYCVVAALCLADNLNRI
                     PCQPALERWVLSRQCQGSGFQGRPEKEPDTCYSFWCGASAKILGCHDKIDGMSDVNWI
                     LSAASPMGGIAKVPSEMPDILHSYLSIVALAMHAEDGVWAQDAPFARASGALNLSYAS
                     LNWIYAHLWSAPPEELIP"
     gene            complement(<363845..>365671)
                     /locus_tag="MRET_4003"
                     /note="MRES_15360"
                     /db_xref="GeneID:38740769"
     mRNA            complement(<363845..>365671)
                     /locus_tag="MRET_4003"
                     /product="ATP-binding cassette, subfamily E, member 1"
                     /transcript_id="XM_027630630.1"
                     /db_xref="GeneID:38740769"
     CDS             complement(363845..365671)
                     /locus_tag="MRET_4003"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily E, member 1"
                     /protein_id="XP_027486419.1"
                     /db_xref="GeneID:38740769"
                     /translation="MAPSAAPASKEERIAIVNSDKCKPAKCRQECKRSCPVVRMGRQC
                     IEVAPSSKIAFISETLCIGCGICVKKCPFEAINIIKLPTNLENETTHRYSANSFKLHR
                     LPTPRAGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPDWQEILRYFRGSELQN
                     FFTKVLEDNIKALIKPQYVDNLPRALKSRATVNQLLEGKLQRDNKDEVIAACDLQNIL
                     DRDVHNLSGGELQRFAIAMSCVQKANMYMFDEPSSYLDVKQRLNAARTIRTLLDTDSY
                     VIAVEHDLSVLDYLSDFICCLYGVPSVYGVVTMPSPVRDGINIFLDGYIPAENMRFRQ
                     ESISFKIAETADEIELERSSNFTYPNMTKKLGSFELSIDSGSFTNSEIIVFLGENGTG
                     KTTFVKMLAGKLEPDTGADRLPQLNVSLKPQTITPKFQGTVRMLLLKVIKAAFMHPQF
                     QTDVVKPMNLDNIIDQDVQTLSGGELQRVALVLALGKPADIYLIDEPSAYLDSEQRIQ
                     ASRVIKRFILHSKKTAMIIEHDIIMATYLADRVIVYEGQPSIKAHARSPESLLTGMNS
                     FLSMLDVSMRRDPTNLRPRVNKHNSIKDKEQKANGQYFFLED"
     gene            <366120..>366686
                     /locus_tag="MRET_4004"
                     /db_xref="GeneID:38740770"
     mRNA            <366120..>366686
                     /locus_tag="MRET_4004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630631.1"
                     /db_xref="GeneID:38740770"
     CDS             366120..366686
                     /locus_tag="MRET_4004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486324.1"
                     /db_xref="GeneID:38740770"
                     /translation="MLAPAHRGRIVAVEVLMLSLTSFDIKRLLIAVKTTRFDDGHFIA
                     WCIEQNGTHSCWPTRVRLDPSLLRSDAGHAESGMRVIYRKSLDMGPKHMCLDELELIC
                     LRAPLPDLELGEDQCSWCLDVLLKLERLQCLAFGETLRLEQDLAEFQLIDDFNANRDD
                     LVCNNKRTSRVMISQDEHISKHTSVWVY"
     gene            complement(<367041..>369269)
                     /locus_tag="MRET_4005"
                     /db_xref="GeneID:38740771"
     mRNA            complement(<367041..>369269)
                     /locus_tag="MRET_4005"
                     /product="RING-14 protein"
                     /transcript_id="XM_027630632.1"
                     /db_xref="GeneID:38740771"
     CDS             complement(367041..369269)
                     /locus_tag="MRET_4005"
                     /codon_start=1
                     /product="RING-14 protein"
                     /protein_id="XP_027486323.1"
                     /db_xref="GeneID:38740771"
                     /translation="MKFGKYYIELLETSHFLPEWKKSAIQYNKLKALLNDVPAELRAY
                     GLTPDVIDDLLYASGSNPPNRPNTERKRSTPGQVLQLMSPSKNHGNSHHSSAAKWVSS
                     LPHDERYEQKTKTRKHRARSIDAAALYLMHSQTSPDTFLATSNWTNSVLSQSPKSHVP
                     SRRHSSSGGHVFNANEHFDLPPLILPVGILHHPDEPNIPNTRRKLSHDEFATRWMEKR
                     IPDFLPEDTSTIAPSTDNATEDYKTPQKHWIQGKGGRRAWGEYELFDENFTLQPRIVV
                     HTESPNSLTYTDSPGTPNQNSSESSSSSVSNTPHMPFSAMRPARGSMQRLDLGSPAQE
                     IPTIASKQYMEARSDSTPPGYHERRIIIPLKAEERFFDALISSIRTLLQLHMSQQRTL
                     TNHVEALCQAISEVSSPVHSPADMYVWREIFSLWLEFDIFESSREKDRGELSVAASEA
                     RLHKYLEQLEKRGLLTPHQTFERAGRTLAGTLDSWAIQAFNPTNPLSDIRSIATLEHF
                     LRLNVALVSIKRFERLNIETIRKLLKKHGKKTALHVNENISRISMSSNAQQLLSAASL
                     DSPIPELNWESASGGDVLKSLAALAPANVNSSFQLSLPRIVSCLLTKALMPVLPSVDD
                     YSCLVCVSIAWHPIRLRCGHLFCIRCIVKLQKQGTNDCPLCRAPNAVRDADEHNLDVE
                     MTKYLQEWFPREIEEKTSENKSDRLLQERKEKEIRKKNRWARFRTRYHSENERERDCV
                     IA"
     gene            complement(<369502..>372375)
                     /locus_tag="MRET_4006"
                     /note="MRES_15355"
                     /db_xref="GeneID:38740772"
     mRNA            complement(<369502..>372375)
                     /locus_tag="MRET_4006"
                     /product="coatomer subunit beta"
                     /transcript_id="XM_027630633.1"
                     /db_xref="GeneID:38740772"
     CDS             complement(369502..372375)
                     /locus_tag="MRET_4006"
                     /codon_start=1
                     /product="coatomer subunit beta"
                     /protein_id="XP_027486317.1"
                     /db_xref="GeneID:38740772"
                     /translation="MPSDPISYTLVAPNAGYRLDMSTQELRSNLQSQNDEVKLETLRA
                     IIVSTLNGEPHASLLMPIIQYVLPSKDKNIKKMLQFYWEVCPKFDAEGKLKQEMILVC
                     NAIRNDLQHPNEYIRGSTLRFLQKIKEPEILEPLVPSVRQCLDHRHSYVRKNAVMAIW
                     CIYHAHEYLISDAPELIESFLVAESDATCKRNALMMLVHTDMPRAVEYVMNNITQVPV
                     MDELMQMAVIELIRMDAKRDSEHMSDYIQILSELLTTSSHAVKYEAAVTLAGLADNVL
                     AVKAIASALIELTVQESDNNVKLIVLDRLNALRLRHEHVLDPLVIDLLRVLSSSDMDV
                     RKKVLDMALDMISVRTVEEVVLVLRKELTKMSQTQESSNLSYRHLLIKSLHSCAVRFS
                     EVAGDVMLELMNFLSDSVSTSAVDVIAFVREVVERFPDMRNDILVKLIQSFPDFRNGK
                     VYRGAMWIVGDYATTIANVNDAMQQIRKVIGEIPILASEEQYMEQPESSQSDDSAPTM
                     KHSTATRVRADGTYATESAFTADTTSDKPQASRSKPPLRSLILFGDFYTASVLAVTLV
                     KLVLRFMSLSSDEGAKNMLRAEAMLIMTSILRVGQSKYVATQIDEDSKERIMTCLQIL
                     GRATWSEQDAHEFARVFLDESREAYAMMLQHEHQRASKITEIKQHAPIQQPHEQLSFR
                     QLGGTGSFEDEVDYEAELNRATGMSAVSKDDFISKLQRVVQLTGLSDPVYAEAYVDVH
                     QFDIMLDVLVVNQTDETFQNLSIELATLGDLKLVERPSPCTIAPYSFQSIKATIKVSS
                     TETGVIFGNIVYERASVGSKHSLDSSYVVLNDIHIDIMDYISPSYVSETQFRSMWTGF
                     EWENKVNVKTDISDVREYLNHILKATNMACLTPEASLAGDCGFLSANLSAASLFGEDA
                     LANVSIERLDNGSIQGHVRIRSKTQGIALSLGDKLSMAQKSSA"
     gene            <372562..>373800
                     /locus_tag="MRET_4007"
                     /note="MRES_15350"
                     /db_xref="GeneID:38740773"
     mRNA            <372562..>373800
                     /locus_tag="MRET_4007"
                     /product="peptide chain release factor 1"
                     /transcript_id="XM_027630634.1"
                     /db_xref="GeneID:38740773"
     CDS             372562..373800
                     /locus_tag="MRET_4007"
                     /codon_start=1
                     /product="peptide chain release factor 1"
                     /protein_id="XP_027486325.1"
                     /db_xref="GeneID:38740773"
                     /translation="MARRVAAHLARRLPVQLRTFSLSRCKSNVVEKLASSMMAEREKL
                     LENMHATSVPAQRIKDLEAVHKAWTAWSERMRSLQETQKLFETEKDKDLLEMAESELA
                     SVREEAEARYEALKRQILTNTRSIKSKGAIMELKQGVGGQESCLFLGEMLRMYMKFCE
                     TRSQRALEENDPGMLGAGWSTELLAATPADVSTTSGSGDAFKEAILQVHGPNAFEALR
                     FEAGVHRVQRIPATQNLGKLQTSTMAIIVLPMQEENDAKDIIDPKDVRIETMRARGSG
                     GQHVNRTESAVRLTHEPSGITVSMQDSRSQHQNRTKAWEVLRARLLDQHLQKEASENR
                     AMRRSQVASADRSERVRTYNFPQDRVTDHRIGVSLSDIHGFMDGDDSSGTGLAYLIEE
                     LMAKEDDLHLHALLQAQETI"
     gene            <374025..>374955
                     /locus_tag="MRET_4008"
                     /db_xref="GeneID:38740774"
     mRNA            join(<374025..374224,374252..374605,374634..>374955)
                     /locus_tag="MRET_4008"
                     /product="SAGA-associated factor 29"
                     /transcript_id="XM_027630635.1"
                     /db_xref="GeneID:38740774"
     CDS             join(374025..374224,374252..374605,374634..374955)
                     /locus_tag="MRET_4008"
                     /codon_start=1
                     /product="SAGA-associated factor 29"
                     /protein_id="XP_027486386.1"
                     /db_xref="GeneID:38740774"
                     /translation="MRADRGTGATTEEAQVWQAVRAQLRSLDSARSSSLAAYEKLLKA
                     HADAKNIDALYDATEHAVHEEQKYIVGALEQLDVLLALRKASTGDVRRRKRKADDELD
                     MDTKPKSDVKKSRSPAKQESSHVARIKSQLPLLRGRKVAFCQALRGDDTHEEEWIMAT
                     VISTIQGDKMRYIVQDAEDDTAHGPTWNTSIDSIVPLPVDLDSLPPAPYAVGTRVLAL
                     YPDTSCFYWATIQGGGPAMNGSVPRSKVCMLYLYAARKARVRAAHDAVPPHVLRRRRG
                     RQAGAGVFGSGASVV"
     gene            <375119..>375721
                     /locus_tag="MRET_4009"
                     /db_xref="GeneID:38740775"
     mRNA            <375119..>375721
                     /locus_tag="MRET_4009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630636.1"
                     /db_xref="GeneID:38740775"
     CDS             375119..375721
                     /locus_tag="MRET_4009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486385.1"
                     /db_xref="GeneID:38740775"
                     /translation="MPSSPLPTSEPRNLTWQQELLTQSWKADRKKAKPKPKKKDTPPA
                     KKVEPVSTGLTWQQELFQQGKRPGATFDHAETARDVETFGAAISQPKQPPAQPPKPQK
                     NKNAPKKSKSTKPPETPSKTSSGTPLAYAAPGFHNSPSAASLPAPRFLSRAKEAPRAP
                     AEGAPASAATRPAQPETVDHLLTQILHATSIQSGPTAAKS"
     gene            <375988..>377874
                     /locus_tag="MRET_4010"
                     /note="MRES_15345"
                     /db_xref="GeneID:38740776"
     mRNA            <375988..>377874
                     /locus_tag="MRET_4010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630637.1"
                     /db_xref="GeneID:38740776"
     CDS             375988..377874
                     /locus_tag="MRET_4010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486340.1"
                     /db_xref="GeneID:38740776"
                     /translation="MQRYHPGIYVPARLLALSVMEDEQTRLAQSQAGDDLVGQTIAMV
                     SCGAATLVLGVGGPMRTDVYVTVLEPGASWSASAQTSAALSTKAPIVQLVAYRDEAPR
                     VLIRTITSLLYGTIVHGDGFRIRLHAQVHTGTHLPARQVDARPVPGAMHRAYAVDTHG
                     TVREWDAATRRLTELASIEPVPEDRWWMLAPREPHTLFAASCYDVYTLDVRDPSPHAL
                     WSMPYSTDTLSRTHMTSMLASHLDAHLLAIATTDYVQYYDVRYAHVPWHTWRHHRGFD
                     RTLALQAAQLDETEYLFLSSQSNRLHTAYAAHPDPTRMLSFDAPTIVAHAAPPGPSPS
                     PPCWAASNSLVWQVEQTTQGALWMQAHGPQATSRVGLAASLHKPPLARPDDGPFGGTE
                     VTHMDFRAVYQMGLLGWLGLTDPLGTEAQTPARLEALEHVPAPLVERPHTRMERVFYA
                     QAKHAPGASYLHAEYAVHARWTRPSTEPSSGTGPGNECVRDAEEQEALDMSLSESITN
                     PLPPRTDEIPRNENWRWDQRSTPSCPPVAAPVALSDAARLLLSEWPVGASTETYVYQS
                     PYRGLDFDAPPERHDGPSASQPLPTVRPVIGKSATAQTQQARGRYAAQRSSAPPRKKR
                     LGGF"
     gene            <378187..>379515
                     /locus_tag="MRET_4011"
                     /note="MRES_15335"
                     /db_xref="GeneID:38740777"
     mRNA            <378187..>379515
                     /locus_tag="MRET_4011"
                     /product="metallo-beta-lactamase domain protein"
                     /transcript_id="XM_027630638.1"
                     /db_xref="GeneID:38740777"
     CDS             378187..379515
                     /locus_tag="MRET_4011"
                     /codon_start=1
                     /product="metallo-beta-lactamase domain protein"
                     /protein_id="XP_027486333.1"
                     /db_xref="GeneID:38740777"
                     /translation="MSSTHGSLDAMQDITRLNTRTVRILGQNPSAFTLNGTNTYLITP
                     PSYWNLDERQSLLPAILVDTGDARDDYAPILECVLRGHLHVSEDKQPVSLAITDIVLT
                     HWHHDHVGGVPYVLRMLQRLRREVPQLPVPRVHKIPEPKTDPSLFERVQSVSDDAYVH
                     APGATGLARLMWPLRDQDQIQVRDPDNAHLTSTLRVLYTPGHAADHAMLLLEEDHILL
                     TADNVLGKGSTVFEDLVLYMYSLQRGLSLLQTCKSTPLGVSGTPTTGMAGENVLFPGH
                     GPVIPKGKETLRRYMRHRIEREEQLLALFMCHPSDKQGLMQATAYPQAYLEKTRGRVR
                     PGQHLWTLRQFVHTLYENYSLTAYPAVARGLLLHLQKLATPTSDYANPPFPLTEPLLS
                     SSFASHPPVVQCIRIPSYQYSGIRHYPDLARNEKEWGELLDVPWQLVSLM"
     gene            <379666..>380991
                     /locus_tag="MRET_4012"
                     /note="MRES_15330"
                     /db_xref="GeneID:38740778"
     mRNA            <379666..>380991
                     /locus_tag="MRET_4012"
                     /product="enolase"
                     /transcript_id="XM_027630639.1"
                     /db_xref="GeneID:38740778"
     CDS             379666..380991
                     /locus_tag="MRET_4012"
                     /codon_start=1
                     /product="enolase"
                     /protein_id="XP_027486301.1"
                     /db_xref="GeneID:38740778"
                     /translation="MSIQKIEARMIIDSRGNPTVEVDLHTEKGLFRAAVPSGASTGVH
                     EAVELRDKDSSKWVGKGVDQAIANVNNVIAPELIKSGIPVTSQKEIDNFLIKLDGTPN
                     KGKLGANAILGVSIAAAKAGAGEKNVPLYKYLSELANTGAPYILPAPAMNVINGGSHA
                     GNALAFQEFMIVPTGAKSFTESIQIGTEVYHTLKKVIKSKYGIDATNVGDEGGFAPNL
                     QSADEALDLLVDAIKMAGYEGRVNISLDVASSEFYKEGKYDLDFKNPNSDPSKWITGA
                     QLADIYKGYLQKYPITSIEDPFDQDDWEAWSVLRETGVTIIGDDLTVTNPLRIKTAIE
                     KKACNGLLLKINQIGTITESIQAAQLAQSDNWAIMVSHRSGETEDTTIADLAVALNAG
                     IIKSGAPARTERVCKYNALLRIEHIEKDATYAGIDGFVRNHEAPKVIRK"
     gene            complement(<381018..>384491)
                     /locus_tag="MRET_4013"
                     /note="MRES_15325"
                     /db_xref="GeneID:38740779"
     mRNA            complement(<381018..>384491)
                     /locus_tag="MRET_4013"
                     /product="insulysin"
                     /transcript_id="XM_027630640.1"
                     /db_xref="GeneID:38740779"
     CDS             complement(381018..384491)
                     /locus_tag="MRET_4013"
                     /codon_start=1
                     /product="insulysin"
                     /protein_id="XP_027486244.1"
                     /db_xref="GeneID:38740779"
                     /translation="MLVPRPIHSRAFLLGRIVSRSIQTKAPVLAKRSVSTLERYRALM
                     SKPTDMHRAFATEAPLVASHNYVAKRTAGFQQEKVRLDDGTSLPYYVYEGPMDTPMVD
                     KRTYKLIRLANDLEALIIHDPEADKASAAMDVRVGHLSDPEGLYGMAHFCEHLLFLGT
                     KKYPRENEYSEYLSNHSGSSNAFTSLENTNYFFDVGHNHFEGALDRFAQFFLEPLFDP
                     SCTEREIRAVDSEHKKNLQSDLWRSFQLEKSLCRASHAYSKFGTGNLETLWNKPRDMG
                     LDIRAELLKFHEKYYSANMMKLVVLGRESPEQLTKWVAEKFSRVPNKENQVPVFPGSP
                     LGQEQLGTQILFRTIKDVRLLDITFPFPEQVHLFRSKPGQLLSHFIGHEGHGSLFSCL
                     KQRGWANLLSAGQAISAAGFELFKINIDLTNEGYEHYQDVVAAVFQYLDMLRANPIEE
                     WMYEEVRRLSELRFVFKEKSSPAMYSSSLASQMQHPLPPAWLLSGPYVYREFDAPLVS
                     STLECLRPDNCRLMLAGREPPKGVSLDHKETWYGTEYTIQPFSPDMLQSCETLEGLAM
                     PRKNEFIPSNLDVAGTPNASLSPTDRPQLLEQSPKARLWHKQDDRFFLPKATVALLLR
                     TPEVNSSPRNAVLSRMLVELVKDSLCEYSYDADVAGLHYDIDSHLDGIDIVLGGYNDK
                     LPHLLESVLNALTKLQVDPKRFAIVHDQVRRNYENFDLEEPYQHAVYYSTYLLTERMW
                     TQHEKLRVVNDVSPHEMQEYIGKVFSRMHVDMLVQGNVTSEQARSLLDAVQEHIAYDA
                     LPPQDNVPPRSLVLAPGTNIAWRMPVANKDNNNSSLEYYCQVGDPSDVRLRATLALFA
                     QIANEPCFDQLRTKEQLGYLVFSGTRTSVGQMGFRIIVQSERDSEYLQSRINAFLDQL
                     MRQLLAMSDDEFEAHRASLIHKRQESVKNLAEETQRFWKSIHSGYFDFLHRQRDVQVM
                     ETLRKDDIVAFMQHYIHPSSTHRAKTVTHIQAQAVPSSTKPLSSDALDSFFAFLSSQG
                     VEVPAEARESLGVQLTSVESLQVFAKDVAASGELPPSLTEDALLACIAQAVEKHPKEA
                     DASAMSLPEAPPEALPSVDVREVQSLKQSLQCSQHALPVLPWDVYASEPHAPIDESQY
                     TPAATSMRANI"
     gene            <385004..>386068
                     /locus_tag="MRET_4014"
                     /db_xref="GeneID:38740780"
     mRNA            join(<385004..385540,385568..>386068)
                     /locus_tag="MRET_4014"
                     /product="lariat debranching enzyme"
                     /transcript_id="XM_027630641.1"
                     /db_xref="GeneID:38740780"
     CDS             join(385004..385540,385568..386068)
                     /locus_tag="MRET_4014"
                     /codon_start=1
                     /product="lariat debranching enzyme"
                     /protein_id="XP_027486315.1"
                     /db_xref="GeneID:38740780"
                     /translation="MGAAGCVNVEGITIAAASGIYKQRDYSRGRYEQQPYSPDDLRSV
                     YHTRQFDITKLGLLSRPDIFMSHDWPNGVEQFGDTESLIRCKPFFREEIQTSTLGSPP
                     LQALLHDLQPRYWFSAHLHVRFTATVVHGAAPLKTSIAESNPESIPLGDEEEEPRIPT
                     QTTNFLALGKCASRNEYLHFFDISSPRDDFLREQTEQRPDLTLEFNRDWLAITRATQE
                     YFTFHRRQTPLPSPRDPALLARVEQERDAIDVKARNIGPAFFCIRRMQPFQRTALTQN
                     EIKTLPASSYIFSNPQTEAFCQLVGIPNLINTRTPYLPQGKSKETNASEEIARIRAMA
                     HERKRRRRAGS"
     gene            <387105..>388445
                     /locus_tag="MRET_4015"
                     /note="MRES_15320"
                     /db_xref="GeneID:38740781"
     mRNA            <387105..>388445
                     /locus_tag="MRET_4015"
                     /product="fatty acid desaturase"
                     /transcript_id="XM_027630642.1"
                     /db_xref="GeneID:38740781"
     CDS             387105..388445
                     /locus_tag="MRET_4015"
                     /codon_start=1
                     /product="fatty acid desaturase"
                     /protein_id="XP_027486321.1"
                     /db_xref="GeneID:38740781"
                     /translation="MVSDATEKAADKKRYAPRKAKLYDSEKLYQYKVPDFSMQDLLSA
                     IPAHCFHRSTLFSSMYMLVDFLQAALLFYCASWIDPLTENLQWSLLSLSPETSRSFLR
                     IGLWSVYGFMQGLVFTGFWVIAHECGHQAFSPSKNVNNTVGWILHSALLVPYHSWRIS
                     HARHHAGTGHMTRDEVFVPSTREERGLLPLHPANDDSPVETKNTTWGEWIGELLEDAP
                     LFNLIELLIQQLLGWQLYLLTNLSGQKHYPKYTNHFLPSSVIFAKHHRDQVLVSDLGI
                     ALMSCLLCFWAHKATNGWFDVFRYYIVPYMWTNHWLVMITYLQHTDIRLPHYHASMWT
                     FPRGALCTIDRNWLGFVGPWFFHGIAETHVLHHVCSKIPHYHAWEATEALKARIGPHY
                     MKSTENVFVTLWKTIRNCRYVEKEPVTFYRNADGVPGSVAVYSAGTDSGVALSE"
     gene            <388540..>389046
                     /locus_tag="MRET_4016"
                     /db_xref="GeneID:38740782"
     mRNA            join(<388540..388571,388607..388695,388731..388769,
                     388797..388933,388958..388975,389008..>389046)
                     /locus_tag="MRET_4016"
                     /product="cytochrome b5-like heme/steroid binding domain
                     protein"
                     /transcript_id="XM_027630643.1"
                     /db_xref="GeneID:38740782"
     CDS             join(388540..388571,388607..388695,388731..388769,
                     388797..388933,388958..388975,389008..389046)
                     /locus_tag="MRET_4016"
                     /codon_start=1
                     /product="cytochrome b5-like heme/steroid binding domain
                     protein"
                     /protein_id="XP_027486296.1"
                     /db_xref="GeneID:38740782"
                     /translation="MGLTPATTPTQPPKDDPMTPEELKQYNGTDDTKPVYVAVKGVIF
                     DVSPRREMYGHGKGYAIFAGKDASRALGMSSLNPEDAVSDYSTLKPDQMKVLNDWFEY
                     YKKRYNIVGKVVEEK"
     gene            complement(<389049..>389526)
                     /locus_tag="MRET_4017"
                     /db_xref="GeneID:38740783"
     mRNA            complement(join(<389049..389112,389141..389272,
                     389300..>389526))
                     /locus_tag="MRET_4017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630644.1"
                     /db_xref="GeneID:38740783"
     CDS             complement(join(389049..389112,389141..389272,
                     389300..389526))
                     /locus_tag="MRET_4017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486300.1"
                     /db_xref="GeneID:38740783"
                     /translation="MSPIGERRPKLFAYYCLCGEFVLACDVMLEQLPRRPLDQSYVLR
                     CLDSAPRQDGSRSLAPMYKINASQGPGQILQRTDGLVERQYDFHCMRCQLPIGYEHTP
                     PPLKNGGKFTFLLPGALTDQQGKAPPDVMLDEMANTPT"
     gene            <389588..>390835
                     /locus_tag="MRET_4018"
                     /note="MRES_15315"
                     /db_xref="GeneID:38740784"
     mRNA            <389588..>390835
                     /locus_tag="MRET_4018"
                     /product="H/ACA ribonucleoprotein complex non-core subunit
                     NAF1"
                     /transcript_id="XM_027630645.1"
                     /db_xref="GeneID:38740784"
     CDS             389588..390835
                     /locus_tag="MRET_4018"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex non-core subunit
                     NAF1"
                     /protein_id="XP_027486405.1"
                     /db_xref="GeneID:38740784"
                     /translation="MGLEQSKLRRAAPEPEQEDQVEPAPPSDVSHILATGADEQPLSS
                     SLSAHRERVQQLRAQQASEPSTDAQVREELQRAGVLDQPDTHAQDSSSLDDSDDDAND
                     SDSTEEEVGPVLGKHALDEAEEPGVDDSAPPKTRHEMDEDDIPVPSISQVDTQDLHKL
                     ERLGHVHSIVDNVVLVEQDKSAQESESVYDVLDSESLLCMEDGRVLGLVYETFGSVLQ
                     PMYTVRFRSNTDIDHEMVAIGRSVYFLPSNSTYVLTRSIRTKGSDASNMWDEEVAEDE
                     VEYSDDEEEQEAKRRAKKSRSGRWQDDADPATASLGPLGPTRGQKRRGPRRPQAMAYP
                     SVSQQGWPLPTRPWYTQSDMSTSAVPHFNPRFTEQWLFPRPSNTPFGIPAPFMPPYSP
                     HEPSMSHDAYDPNAPGPGYTRPQ"
     gene            complement(<390885..>392486)
                     /locus_tag="MRET_4019"
                     /note="MRES_15310"
                     /db_xref="GeneID:38740785"
     mRNA            complement(<390885..>392486)
                     /locus_tag="MRET_4019"
                     /product="malate synthase"
                     /transcript_id="XM_027630646.1"
                     /db_xref="GeneID:38740785"
     CDS             complement(390885..392486)
                     /locus_tag="MRET_4019"
                     /codon_start=1
                     /product="malate synthase"
                     /protein_id="XP_027486406.1"
                     /db_xref="GeneID:38740785"
                     /translation="MSVEGVRILAPVLGEHAQILTPEAIKFLTVLHRNFETERQERLK
                     ARAVRQVELDGGKTLDFLPQTRHIREDPAWRCAPPSPGLRDRRVEITGPVDRKMVINA
                     LNSGAYTYMADFEDSNSPTWANNLDGQVNLRDAINRRVDFKASNGKHYKLRPVHELAT
                     LIVRPRGWHLNEESFLVDGKPISGGLFDFGLFFFHNAHQLVKNGFGPYFYLPKMESHL
                     EARLWNDVFNLSQDYIKMPRGTIRGTVLIETITAAFEMEEILYELREHSSGLNCGRWD
                     YIFSFIKRQRYNKSAVLPDRATVTMTCPFMQAYVNLLIQTCHKRGAAAIGGMAAQIPI
                     KGNEKANNAAMDKVRADKLREVLAGHDGTWVAHPALVPIALEVFNKHMLGPNQYHVRR
                     EEVRVSALDLLNPNVDGQITEAGARANVSALLAYCANWVRGNGCVPINHLMEDAATAE
                     ISRISLWQWVFHGSKTVEGKPVTPQFIDQIIASEAAKLTSLDPNAVDLSRRYLSQQVR
                     AKEPSEFLTTDLTAHLDNSISQSRI"
     gene            <393261..>396611
                     /locus_tag="MRET_4020"
                     /note="MRES_15305"
                     /db_xref="GeneID:38740786"
     mRNA            join(<393261..393505,393539..>396611)
                     /locus_tag="MRET_4020"
                     /product="SIT4-associating protein SAP185/190"
                     /transcript_id="XM_027630647.1"
                     /db_xref="GeneID:38740786"
     CDS             join(393261..393505,393539..396611)
                     /locus_tag="MRET_4020"
                     /codon_start=1
                     /product="SIT4-associating protein SAP185/190"
                     /protein_id="XP_027486433.1"
                     /db_xref="GeneID:38740786"
                     /translation="MFWRFGLASSSTIDSLLEKEDVTLEDVLNDADVLQESKANNEKL
                     VEFFQRPGIVPRLLDYIVGNVEISDVSNSEAEQNVGFKYPFIASEVLSCEIPGVSKIM
                     LDDANTLLGPFWDAMLSADALFQRGPVPLHEHPLTMGAYTGEKQDDEASDKKTNEPSK
                     QHRISARTHGPGFSVLAGYWSKVNMTLLERHPNEMLAFVKTQPNVVEGLTNHFETPAM
                     VELLYRLIQCEDTIPDSGIVAWLAEHGLIPRIVSLLSPFVSPDSHKAASEFLKTIISL
                     SAPSPSSLNQVTIQETFGGPGEMLIGAGGVNNLLVRELASQENVDKMVSFMLDYEVGA
                     SCRNSISQDLSRKLDTPLQTLEEDTAVEEEEEEQDVWEFHQAMKNLQNRHLSMSRNLS
                     MSGNGIRDSTATIRPSILRRCSSIKSTLSPKALVSSFVCCAGVFIELIRKNNSDYFEQ
                     HLFHTLRNYLVIRQQEVSSQRQKDQVSDPTSPEVSGPESERKPELLLDDLPMEDDADT
                     EGLDEAMDEVAEKMGIVHLGPLLHALADKIPDFQEKMRHPFESTDKIMTSLGEIEPLT
                     QTRYCIAELYAELLHCSNMALLNRPPNSGPKYSSSGSLLGGLEGLHALARSLQGEDDY
                     DQSNPNTQSSAEWSPDEASSTNEAEVSGQDRSPSFLSSENDQEDDESDAESIASALSS
                     MSLADMIAQFARPRSSQKDSDVQIVGNFLKTQFQTFQVIPTLIDMMLSYPWNNFLHNV
                     VYDIIQQLFNSDIDVAINRKLIISVFKDAHLVEAILEGARRNRISSEDVRRIRLGYMG
                     HLNLIAEEIIRLLERFPMEIGNLVQDHFTEGWDQFMKEELSESRAKESMPLAGGRPSA
                     GGMGMQNWSSLDSDNWYSNNDNHSFAQYLSSQMRTDADEEEADGNVLSFIGDSDAMVM
                     QGDTDQDEWGPFADSRSAFEFTSTASVDNHQPEKQENLTPADWAAEFRRGNMGEIPSE
                     SAVDNDSDSDDIPSSHGPAGHGTDDSDENGDDDSPYVDLHKPATLRHCTQSLDRKHPE
                     RIPESETDEQHWPTANAARHVRTLSGGGEDKAPVLAAEQLHEAVEATKEGLLRRRLSD
                     GTVVTVPLDDAELTQSS"
     gene            <396855..>398039
                     /locus_tag="MRET_4021"
                     /note="MRES_15300"
                     /db_xref="GeneID:38740787"
     mRNA            <396855..>398039
                     /locus_tag="MRET_4021"
                     /product="acetyl-CoA acyltransferase 2"
                     /transcript_id="XM_027630648.1"
                     /db_xref="GeneID:38740787"
     CDS             396855..398039
                     /locus_tag="MRET_4021"
                     /codon_start=1
                     /product="acetyl-CoA acyltransferase 2"
                     /protein_id="XP_027486432.1"
                     /db_xref="GeneID:38740787"
                     /translation="MTNAFIVGSKRTAFGSFGGKLSNITAAQLGGYAAKAALAQLPAN
                     TPVSSTVFGVVAHTDHTAPYTSRHVGHYAGLPINVPALTINRLCGSGFQAVINAIHEI
                     KVGDSDVVLTGGTENMSMSPYTLHGVRFGNTRYGVDLKLVDSLAIALVDQVPVPTPMG
                     ITAENLAEKYGITRQQCDEFALRSQQRWAKAHEDGAFKDEIAPIEVKVKKATEIFEVD
                     EYPRPKTTIETLAKLPSVFKKDGVVTAGNASGICDGAAANVIASEEAINKHGLKPLAR
                     IVSYGVTACEPSIMGIGPVEAIKLALKRSGLSIADMDLIEVNEAFAAQFLSVQKELEL
                     PMEKTNVFGGAISMGHPLGASGARILSNLTYNLHRLNKKYALGSACIGGGQGIAVIIE
                     RV"
     gene            398253..398351
                     /locus_tag="MRET_t0065"
                     /db_xref="GeneID:38741259"
     tRNA            398253..398351
                     /locus_tag="MRET_t0065"
                     /product="tRNA-Val"
                     /db_xref="GeneID:38741259"
     gene            complement(<398429..>401181)
                     /locus_tag="MRET_4022"
                     /db_xref="GeneID:38740788"
     mRNA            complement(join(<398429..399002,399035..400744,
                     400772..401072,401097..>401181))
                     /locus_tag="MRET_4022"
                     /product="conserved oligomeric golgi complex subunit 5"
                     /transcript_id="XM_027630649.1"
                     /db_xref="GeneID:38740788"
     CDS             complement(join(398429..399002,399035..400744,
                     400772..401072,401097..401181))
                     /locus_tag="MRET_4022"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 5"
                     /protein_id="XP_027486431.1"
                     /db_xref="GeneID:38740788"
                     /translation="MATTDMSPRHVPLHEYVHSHVLTEDSTFDITALYKQNFNAQDYV
                     KKFLGPDSPDHPPSESPGKASVDSKLRVALSRLNISIKEVDQKIHELVTQHSNEFLDS
                     ITDISALHERAQNIHKDSAALNKSALIARQMIHEPLETIRKHQEDLKQMHGMDELITR
                     VESVMHVFHRLIGIMDDVAECDITVHMQDAAVLDQHATKVVTASLLLEELDSLLPHGS
                     IYGHQNAPIDTSKSAQGVLDLDIVKPYVSQIHPMKTTLREQIENLLLCGLRNLSPSLL
                     GAALQAACSLGLLNTVMQNLLNDLTDVLTDRTSTTLDLFSIGKELGETQPPLISSSNG
                     TPLYSARDNKMSAHDMQERLQKWSTLVWQRIRTLIVDELAPIYIKVYMLERVLSLKQG
                     KTLSETYLGMISKELKQSPTDLLWTSFCAHLESVSNKCMQESDFWKYIFVRSFPKLLS
                     IFHELLSRVSMFSDHSKQIHNPIPKPIHEYLTNLSREYLTCFIKRCEEAEQHICSCVT
                     SSNKNPQNREKVEHFIAMLRADIEECVFDRILLQELTQTATDVICKFINQLRAMICQD
                     ENAFTLTTQQFTLSQSTNVCVAQILKQIFESMSEMNKLNYLEVKSMASESIRMVTQTM
                     QDALRGPLLLSFGLEMSAILGRIHRLRSESSAIDQRPEAKGTDTSAYMLEFCNRTRNL
                     RTKFLPSYILPDGHYQWTLDVASNILTTFVMHASLLRLSASFDRHQIISDMTALELTL
                     SQFLSDTSRFLSCKSLTLHDCDVPFQVARSFRTLLFEPTAAWKQPANFCRKWHLPKVI
                     IVQHLLSRSSTLPLANDIRGMGKHAYVDWAISTSRVKHAFFSERVDKTMIQELHHWLD
                     LEGRKMDASTLDKMDKEVLCCLVEWDTFLIKTL"
     gene            complement(<401321..>401823)
                     /locus_tag="MRET_4023"
                     /db_xref="GeneID:38740789"
     mRNA            complement(join(<401321..401529,401561..401601,
                     401631..401716,401749..>401823))
                     /locus_tag="MRET_4023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630650.1"
                     /db_xref="GeneID:38740789"
     CDS             complement(join(401321..401529,401561..401601,
                     401631..401716,401749..401823))
                     /locus_tag="MRET_4023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486430.1"
                     /db_xref="GeneID:38740789"
                     /translation="MNNSTYHELKRGKMEHADLAYEIQKRGALRGAAVWTIVGFSCVF
                     VAHHLLPSFKRHTLALKGLLTVSSTCIGIVFGAERELQKYEHDKRSYDNLIRSRAMRE
                     LGQRGILASETEINKWREELINSKIAAHSHFNSS"
     gene            <402007..>402772
                     /locus_tag="MRET_4024"
                     /note="MRES_15295"
                     /db_xref="GeneID:38740790"
     mRNA            join(<402007..402058,402087..>402772)
                     /locus_tag="MRET_4024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630651.1"
                     /db_xref="GeneID:38740790"
     CDS             join(402007..402058,402087..402772)
                     /locus_tag="MRET_4024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486281.1"
                     /db_xref="GeneID:38740790"
                     /translation="MTHSHAPEASSSVSLSAETVTLVHAFLHTHVPKLAAKLAAKFPN
                     LSLEEQTQNAEARSNALVSTVHSALQVKGSDIYKSFSEDMHVEEERVKKRKVPKASHD
                     QESASKKKKSKEKQPKDQIEKEEKEPVANPPVQEPGASDAERPQGVNMDETPSPPKKS
                     KGPKQGERFQRVRSDKVEFQDDRLRDMSYDAKSGAGDWGARANADLIVTRGKSFTKEK
                     NKKKRGSYRGGVIDQGSHSIKFTYDDE"
     gene            complement(<402774..>404591)
                     /locus_tag="MRET_4025"
                     /note="MRES_15290"
                     /db_xref="GeneID:38740791"
     mRNA            complement(<402774..>404591)
                     /locus_tag="MRET_4025"
                     /product="hydroxymethylpyrimidine/phosphomethylpyrimidine
                     kinase/thiaminase"
                     /transcript_id="XM_027630652.1"
                     /db_xref="GeneID:38740791"
     CDS             complement(402774..404591)
                     /locus_tag="MRET_4025"
                     /codon_start=1
                     /product="hydroxymethylpyrimidine/phosphomethylpyrimidine
                     kinase/thiaminase"
                     /protein_id="XP_027486242.1"
                     /db_xref="GeneID:38740791"
                     /translation="MPIQASESPVVPRVLTIAGSDPSGGAGIQADLKTFLALHTYGLS
                     VITSLTAQNTMGVTSIHTPPAAFVKQQFDTVTEDIDINAIKIGMLSNASVVSQVAELL
                     KEWRQANSGPVVLDTVMVATSGALLLEHDAVRVIKEELLKYASIITPNISEAVHLLKE
                     TQFASVVPTSSPTLSDLQSMAKALGELGAKNVLVKGGHAAMPLSSIRSELLAKGVDVF
                     DEALDSEVQAYDRERNASILLRSECNTTLSKLAFALNASVYSLNGADICFTRSASDLM
                     CLHAPCDSYTADVLYETERGHFTIFIKPTIPTTATHGTGCTLSSAIAAMCAHGYPIRL
                     AVAYALQFMQRVLASGLDKVGHGHGPLNHDANLMSRGVALRTPSNPAPLTTMLASRSW
                     KAWRSYTRHPFVQQLGQATLPKESLCWFMLQDYAYLKQYARALSKAVAHPASNLEDMK
                     SCAAMSKAVLEEMQLHVRVCERLGISSKDMESTMESRATVAYTRFFLDVADEGLLPLM
                     ISLASCAVGYAEVGLWLEKERDTGRMHPSSVYNEWVSEYAGDAYQNSIANYVELVEDY
                     AQRIAVSESQAARLQQVWDAATRFEIGMWDEALSVGSQA"
     gene            <404679..>407030
                     /locus_tag="MRET_4026"
                     /note="MRES_15285"
                     /db_xref="GeneID:38740792"
     mRNA            <404679..>407030
                     /locus_tag="MRET_4026"
                     /product="AP-3 complex subunit beta"
                     /transcript_id="XM_027630653.1"
                     /db_xref="GeneID:38740792"
     CDS             404679..407030
                     /locus_tag="MRET_4026"
                     /codon_start=1
                     /product="AP-3 complex subunit beta"
                     /protein_id="XP_027486243.1"
                     /db_xref="GeneID:38740792"
                     /translation="MSLSTLTSSRAWTYFSERGEDALHAVKGAIGGSGSGKYLDIRDD
                     KLVQVRTKLESTQDVDRLDGMKSVVAMISKGRDATPYLASVFKLSSTTSLEVRKLVYL
                     VVLRYAPLHPDLALLSINSFQRDLTDPNPLIRGMALRTLSGIQIDTVSEIVMLAVSKA
                     VRDPHPYVRRIAAFALTKCYDLDEEYYNRIVGSFQVLLQDRSPSVLGAAMSVFKDICH
                     DRWDLLHRHYRKLCLALGDMDEWSQPLCIHVLTRYARTNISKPSDEHVDADLELLLTS
                     LSTLAASMNPAVVMAVVHAYDALLPESVPMVFPALLRLLRASPDVAYLATRSALALAK
                     AKKVDMVPVMSSFYVRASDPAYLARSKLRVLVCVSPSSHASVLANELGAYAHAPSIPL
                     ALDSVTALGILARRHGEVSELCLQLLMDLAQEAAIPTLVLSRAIQIIKALVRVSSPSM
                     AATIVTRFCLRLFVPLARRGRSLDAPKIRILTDPASRASVLWMLGQYAELKVTGTSLL
                     VLLVPDILRCLVAHWQKEHIQVQCQALTLSAKAYAHLSSVSDAHIRMAITVLHYEILH
                     RASQSLNADVRLRARFYSGLTRGLSDTDEELEAAPTEDIRAYLASHQKLDLLRLPGVR
                     LRRTQVQHILGAHDKIQSDEDFALSNDIFPTIQLRGSHASQLPDWSNPHTLLPAIVRA
                     PDTNSIQQQDTWMENQRSISSDMFSKNQTSPEFVVLRPSTPSVPSGATSSTANARYKD
                     LDSFLDEESESEDDNESIHIDHPAPEDDEYMLDSSGTEYDEDD"
     gene            <407179..>408699
                     /locus_tag="MRET_4027"
                     /note="MRES_15280"
                     /db_xref="GeneID:38740793"
     mRNA            <407179..>408699
                     /locus_tag="MRET_4027"
                     /product="essential nuclear protein 1"
                     /transcript_id="XM_027630654.1"
                     /db_xref="GeneID:38740793"
     CDS             407179..408699
                     /locus_tag="MRET_4027"
                     /codon_start=1
                     /product="essential nuclear protein 1"
                     /protein_id="XP_027486280.1"
                     /db_xref="GeneID:38740793"
                     /translation="MPKAPSSQRRGARATAQHRPLGQEIREDEIVSRFGRVRAPTQRH
                     KKSKLEHDEGEDNSAPGSSLKITGSRTGTSFVDPKLSRNILRLARQQQEEIEREEAEL
                     EADDDDETPSAVRPLEASFRDMEELEDEDDEDDDENVSLASDADGEEFNDPDYEQLDI
                     LPEDQALLERHDEEEEQALADEDAGRPRTKTLADLIMAKIEASEASSGETAQYLTEDD
                     SRLLPPGINPKIIEVYTKVGDLLSRYKSGPLPKAFKIIPSLPAWEDVLYITRPETWTP
                     HATLAATRIFVSNFKPAQCERFYRLIFLDKIRDEIHENKKVSYHTYEAIKKSLYKPAA
                     FFKGILFPLCDGGGVTLKEAAIIGSVLSKVSIPVLHSAAALLRLAEMEYTGPTSLFIR
                     ILLDKKYALPYKVIDGLVFHFLQFADKSKGVEVTHTRQGIIGERRMPVLWHQSLLVFA
                     QRYKRDLTPDQKLALLDLIRVQKHPGIEPDIRRELSTGESRGEMLPEPDYDDDMSI"
     gene            complement(<408846..>410942)
                     /locus_tag="MRET_4028"
                     /note="MRES_15275"
                     /db_xref="GeneID:38740794"
     mRNA            complement(<408846..>410942)
                     /locus_tag="MRET_4028"
                     /product="molecular chaperone HtpG"
                     /transcript_id="XM_027630655.1"
                     /db_xref="GeneID:38740794"
     CDS             complement(408846..410942)
                     /locus_tag="MRET_4028"
                     /codon_start=1
                     /product="molecular chaperone HtpG"
                     /protein_id="XP_027486255.1"
                     /db_xref="GeneID:38740794"
                     /translation="MADKQETFGFAADISQLLDLIINTFYSNKEIFLRELISNASDAL
                     DKVRYQALTDSSVLDSEKDLYIRITPDKENKILSIRDTGIGMTKADLVNNIGTIAKSG
                     TKAFMEALSSGADISMIGQFGVGFYSAYLVAERVQIITKNNDDEQYIWESSAGGTFTI
                     TQDTSGYSIGRGTELRLFMKDDQLEYLEEKRIKEIVKKHSEFISYPIQLVVTKEVEKE
                     VDEPEAEKVEEDDKKPKIEEVDDESADKKEKKKVKETVKENEELNTTKPIWTREPKSI
                     SNEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKALLYIPKRAPFDMFESKKKRNNIR
                     LYVRRVFITDDCEELIPEYLNFVKGVVDSEDLPLNISRETLQQNKILKVIRKNIVKKT
                     LEMISELAEDKENFGKFYDAFGKNIKLGIHEDATNRAKLAEFLRFHSTKSGDEMTSLA
                     DYITRMPEIQKNIYFLTGESLTAVKDSPFLEVLKKKGFEVLLMVDPIDEYAVTQLKEF
                     EGKKLVSVSKEGLELEETEEEKKQREEEATKFEGLTKSIKDILGDKVEKVTVSNRIVG
                     SPCVLVTGQFGWSANMERIMKAQALRDTSMSQYMASKKTMEINPQNAIIKELAAKVAN
                     DKNDPTVRDLTMLLYESALLTSGFTLEQPQDFANRLFKLISLGLSIDDVDAPAEASEE
                     TKADEPAGESAMESID"
     gene            <411535..>413826
                     /locus_tag="MRET_4029"
                     /db_xref="GeneID:38740795"
     mRNA            <411535..>413826
                     /locus_tag="MRET_4029"
                     /product="CCR4-NOT transcription complex subunit 6"
                     /transcript_id="XM_027630656.1"
                     /db_xref="GeneID:38740795"
     CDS             411535..413826
                     /locus_tag="MRET_4029"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 6"
                     /protein_id="XP_027486282.1"
                     /db_xref="GeneID:38740795"
                     /translation="MYSPSPPAVTAGANPYVYLNHHQTMPSGQFASRAQPSAVSAMGV
                     APSATGNSAAPAYGHSPAMAPLGATRFGSGASVGWMSRQPQQPQTQQASHFVPHYGTP
                     PMSSLPHSMNHHNVLANIAPSSPSYTNLGSPHTAAFVRSSVSPVAPTQPSTTSNSSSN
                     IANASPEWLQQMMCAEISRQSFAPHHHARAAALAARSSANHGQDPKKGIVLPAGVVAN
                     GLSFPMKGSDSTAQSADSSLSMSPTKSSSMRTQEADPKDSDKSWSIMDMGGLKLKNIG
                     VDIFRYTFLTSLFINHNNLTTLSPAILQLRNLSVLDASGNQLVAIPPEIGMLTSLSAL
                     FLFDNQLTILPPEIGTLYQLEMLGIEGNPLQPNLYEIIKQEGTQALVAYLRDSCPVPV
                     PPPEREWISLDMDLPPMSAEEDEAYTFAVLSYNILCEKYATAQMYGYTPSWALAWDYR
                     KECILQELVSYNAEFFCLQEVEMGQFYDYFEPKLNQHGYEGIYWPKSRARTMRDDERQ
                     HVDGCATFFKTDTFELVDKHLIEFNQIALQRPDFKKTQDIFNRVMTKDNVACIGMLEH
                     RKAGYKIIVANAHMHWNPEFRDVKLVQAAMLMEQLEMLGNQFAKRPSQVKCHENFKPP
                     NYTSGQQIPTLVCGDFNSTPDSGVYEFLNKGSAPGNHEDFMDHVYGTYTSEGLKHNYA
                     LRSAYSNIGEMPFTNLTPGFQGNIDYIWYTSNTLAASCLLGEVDSTYLSRVVGFPNAH
                     FPSDHVCILGEFKVKRLGIEATS"
     gene            complement(<413924..>414826)
                     /locus_tag="MRET_4030"
                     /db_xref="GeneID:38740796"
     mRNA            complement(<413924..>414826)
                     /locus_tag="MRET_4030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630657.1"
                     /db_xref="GeneID:38740796"
     CDS             complement(413924..414826)
                     /locus_tag="MRET_4030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486429.1"
                     /db_xref="GeneID:38740796"
                     /translation="MDWDTASISAGPPRYEWESDDEDDARVLEHKSCDLRVYLEGNPA
                     WMQRDLVVLLGDVGTAIMLAAQRDFTQTACVACDKLGHLASIHIPEDIAMPCVVFIPL
                     PDNLPRAIPSGIAQCVIQRMQPSCVTIVQSYVPALYLTRESSNTNAVHESLRYLCNVP
                     ADRRPSGWQSLDRWSKPWEAPNIFTGCGAAFFMMATYAKIPAQMLCVPIKRAASHANY
                     QQLKYPIILTHGKESVPTSELRRRLATLIDDVDEPHLACILPLLGNRPEACQGHSSLL
                     AHALLASLAKRASSESIGEGGMYV"
     gene            <415118..>419974
                     /locus_tag="MRET_4031"
                     /note="MRES_15270"
                     /db_xref="GeneID:38740797"
     mRNA            <415118..>419974
                     /locus_tag="MRET_4031"
                     /product="chitin synthase"
                     /transcript_id="XM_027630658.1"
                     /db_xref="GeneID:38740797"
     CDS             415118..419974
                     /locus_tag="MRET_4031"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027486316.1"
                     /db_xref="GeneID:38740797"
                     /translation="MNSAHGPQVVSPVNGRQSTARPLVTTSDTPSISPTHTLPREFVR
                     PLTTKPPSPAMVQPNVPQPNLRMDQNIPRLPASHSFAGMPTIRPGTGNGSLVPSTSFN
                     QLHTPLQPNVAGRGPPSFLRPDMAANARPGAISVSPPPKEGISPPSRARSPNSFAPSS
                     TVPMTHPSAPRARSNGKEPEKEEPRRVHPDLTPLNVKDLDNKSSSAITNENVSSPTLL
                     PFTERLSAIQPQIPNLLALKEPENGKNKHPDSEQDDGDMKEQRSKNLSPESDDPLLDH
                     RHLQPGDTVSLLSHKATLQMYRDNAKKTNDPMLSYELAVFMLDVSRSLEFSQQMLSRG
                     QDPAAESEQLAKEAMSILRRLADRGHVESQYLAGDCCMNGYGMSKGRPDLGLAYSYFV
                     QAGKRGHPDAAYRAGTCYEKGWGCRRDPAKAVQFYKMAASRKHPGAQYRLGTAELNGE
                     LGLKRLAREGVKWLKRSAENATPEFPHALHELALLHEKGIYNVLFVDNEYSCELLAQA
                     VEMGYAPSAYKLGVNYEYGRMGCPQDSGLSIHMYNIAAQQNHKEACFALTSWYLVGVP
                     GILPQSDTEAYLWAKRAAEQGLAKAEYACGYFCENGIGTPRDLGEAKGWYQRAVEHGD
                     NRASSRLNTLSGYTAKPVGIAADEASAKNLPQAIPVQPLSAPFPSAAPISTMRTLGVA
                     NYPTPKTMKETQAMQRDLHQQALVAAIEEREKPKTATPTSPQGPSFFGQKGSQGRPSE
                     KPFSPSQPPKEGGKPMSLIAAGPRAGFPKPPTPPPPPPEPEPDADAQLAANPKSFKSR
                     LLRLGKMGKIRKGAASEGAEGEDAENVAGLEVPEGEEPLSATEKVPDGNEAPKSAPDA
                     DADKETGLNKDPAGVGEGAPSPKPETGAMVLSGPKPLGQARGQPPALTPGPSGPSSAA
                     GADGAPRLPGEPKQHTLGDSSKPEAADKMSQEATEKSKDVNNEKSKNKKSEKSGGLSF
                     FGLGKKIMNKGSDKPGSEDKKNQEVPKPSDEASPSIAKPTDTPAPLSPRPDEKNFSLV
                     ERSKDSESTSPSSPKPTTGSAEPSVPPMPAMPPSTVVRPSPSMALVPGRLPAIGAPDR
                     TESNPVPASPQIGGIVPSRPPPPGVRPVMPGTMMTSRPFPPGARPGMPPNAQPGARPG
                     MPPNAQPGARPGMPPNAQPGLRPGMPPNAQPGARPGMPPNAQPGLRPGMPPNAQPGAR
                     PGMPPNVQPGARPGMPPNVQPGARPGMPPNAQPGLRPGMPPNAQPGARPGMPPNVQPG
                     ARPGMPPNAQPDTLSGLPLNVNAPEANNMLQLHPSAASGVRPPAALQPSLRPGPRPFS
                     PTFPSPAGPSRPNPHLLPGVSSSSDGATPRANGHGVKPGSPPSMPEQHSFAPPAMQPG
                     RPPSPSSPFGRPPTGPFSPSAVRMPRMPSQSSMHQSGNGPSPPKPGQMMNVSLPARTN
                     QPHLGGASPRPPRPTSPPPFLTSQQPNRPPVPRGVMPPGSGPSMRPPQPPAIIPPPPR
                     SPPARVNQPSLGPPGSSMPQGRMDMPSGPTAQGQSPLSKAMVSPPKMSSPDRPPFAPP
                     THVTPPKTPAKASGFSTPDSSSSKIMEFKDAESDNLNFGSATTTENAAAVGEDGDKSV
                     RKKWLGFL"
     gene            <420435..>421382
                     /locus_tag="MRET_4032"
                     /note="MRES_15265"
                     /db_xref="GeneID:38740798"
     mRNA            <420435..>421382
                     /locus_tag="MRET_4032"
                     /product="lipase"
                     /transcript_id="XM_027630659.1"
                     /db_xref="GeneID:38740798"
     CDS             420435..421382
                     /locus_tag="MRET_4032"
                     /codon_start=1
                     /product="lipase"
                     /protein_id="XP_027486265.1"
                     /db_xref="GeneID:38740798"
                     /translation="MACFRVILYLSVIFFVQCVFAAPKGITKVAPENHNFFGRITSYA
                     HPKDVPDPVPMYQQFAALAQQSNCHNYHINISVGDATLLYSWGDNDRNQRLQLFHSKS
                     LGIVASWAGMNPTKINSILGAADVFLVDVDRRYFPHAEKGAKLYKGFQDAYKRVAPTF
                     IKELQYYQELYNEDRVSLTGLSYGAALANIALLHVKKNLKRGSIYRTVAFGLPRVGNQ
                     EWANSIDKHADGKFFYVANGNDLVVRAPPRELGYQHPSGQIWINPSNSSKWKFYPGQE
                     NVHGANSEFGYSIPDHTGVYFRTEIASLWGHCPATVGKD"
     gene            <421678..>423159
                     /locus_tag="MRET_4033"
                     /db_xref="GeneID:38740799"
     mRNA            <421678..>423159
                     /locus_tag="MRET_4033"
                     /product="nitrosoguanidine resistance protein"
                     /transcript_id="XM_027630660.1"
                     /db_xref="GeneID:38740799"
     CDS             421678..423159
                     /locus_tag="MRET_4033"
                     /codon_start=1
                     /product="nitrosoguanidine resistance protein"
                     /protein_id="XP_027486404.1"
                     /db_xref="GeneID:38740799"
                     /translation="MHPVKVVDPPNSNMVLRQGNVSQEEVQDMSYLGTNGGEDTGNDQ
                     TNPVEASLHEKEEKPQVGKPQPFSHHIWDPEVRPMLIAYLKPVFMMTLIVMVMVWLFC
                     SIYWGSMYGYNENSPRIVGAIVNRDNGLIGQSIAQAFLDLNGNDNELPHSTWELHDTS
                     EFPDHTSLVNAVQPKEKFYIALEIVEGATDKLIRARGAGDSSYDPRVVNIIFATAMNP
                     TTVPRYITGPAQKTFGKAQVKLNAQLTSQFLSENVNNPEAIETANRAPLTLVNPVASN
                     MMDLRPWKSNVGMAPTFVGMIYLVILSFQIVMAEYMGRFAIQPYLHFKAFAILRIATP
                     MVASFFVSVMISLLNIPFDLPFDAMFTYGAGFMVYWMCTLCGIVVFMLCLESVITVTT
                     PKFIGVFLVLFIISNVSVSNSELKLQPSFYLYGYAMPFYNLRRIYLAIMFNVGERLKI
                     LKYIGIIWAWIFAVAASFALIIWSEYLKRFKAHKKSLEQNKSP"
     gene            <423349..>427058
                     /locus_tag="MRET_4034"
                     /note="MRES_15260"
                     /db_xref="GeneID:38740800"
     mRNA            join(<423349..423436,423478..>427058)
                     /locus_tag="MRET_4034"
                     /product="structural maintenance of chromosomes protein"
                     /transcript_id="XM_027630661.1"
                     /db_xref="GeneID:38740800"
     CDS             join(423349..423436,423478..427058)
                     /locus_tag="MRET_4034"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein"
                     /protein_id="XP_027486247.1"
                     /db_xref="GeneID:38740800"
                     /translation="MPLKHVEVENFKSYRGKQIIGPFNTFTSVIGPNGSGKSNLMDAI
                     SFVLGVRSVHLRASELKDLIYSENALNDNHEISYHEDVPTRASVMAVIEDTKHTEHRF
                     QRIVNANASTEYRYNGRITTYASYNAKLEQLNILVKTRNFLVFQGDVESVAEQCSKDL
                     SDLMDQISGSRTLKNEYDEARISYEEAAEQLTALVSKRKLLQNELRQVRQHKEAFDRF
                     GALKNEVHNHTIQKILWRLYHINEIIEIHTDWIEAHASRGEQAQKRLHEKEQMLSEAR
                     SMLGSVQQKKLDLENERKQANRSLDGIRPEKDRLIERIEHVNRKLQQAQFLYKQAEKD
                     HDTLKESLKRLESDAELVQTCSDKMKAEQEAALAATSIKLNETDLQNYHDLKLKSQST
                     VVQERSQMEQLQRKIREKQTSLDVHQDRIQDMESKLERLEQLLASLSETQAELATREP
                     ESAEKLGRAKSILSTLQSKKESISSREKQLNEALVGCYNRLLRMGQDQRVHEREARLR
                     ESLRSLRTIFPGVHGRLLDLCKPTQRKYELAIATALGRNAEAVVVNHEKTAVECIEYL
                     RNQRAGQATFIPLDTIQTKPINDRLRSLSPQARLAIDVIQYAPVIERAVSYACGNAMV
                     CDTLDVARNICYERAQRVKAVTLDGTIIHKTGMITGGPSMQETVKKWDDQELQGVQRE
                     RDRCMSELKELQQQKYVLEEEDELVASVTRAQASLQSIRAEQADVMRQTQDAQSECAA
                     IISQKKKTQDMIDKLNEDMSQLRSQMSDIEHTIHAADDDIFTEFCERIGVANVREYEA
                     NQLHISQALNVATQQYQRQLARIAHQRTFAEQQLKNTADRLAFIQASMEKERQRIPRL
                     EEELQNCENSIQKYREIKARIQASFEAMQEEHDEKTETVNERRKALFHVMRDVEAHRK
                     EVAERNDEIAQLDTERANLFRRCRMEALDLPLESGDLANVPLEEDVSMPVSEADNAVQ
                     TCRQYDITVDFSRLSDAERTDRGSGKEYELQSRIDLAREEMEKLTPSTSTAERLDKLE
                     KELKMCEHEIDSGREQVRESRDEFQLIKKQRSDLFMKAYHHIADRIDGVYKDLTKTKM
                     APMGGVAYLTLEDTDEPFRAGIRYHAMPPMKRFRDMDQLSGGEKTMAALALLFAIHTY
                     QPAPFFVLDEVDAALDAQNVANVSHYIREHASDRFQFIVISLKASLYERSQGLVGVYR
                     DQEAHSSASVTLDLEQYA"
     gene            complement(<427030..>428616)
                     /locus_tag="MRET_4035"
                     /db_xref="GeneID:38740801"
     mRNA            complement(<427030..>428616)
                     /locus_tag="MRET_4035"
                     /product="conserved oligomeric golgi complex subunit 8"
                     /transcript_id="XM_027630662.1"
                     /db_xref="GeneID:38740801"
     CDS             complement(427030..428616)
                     /locus_tag="MRET_4035"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 8"
                     /protein_id="XP_027486248.1"
                     /db_xref="GeneID:38740801"
                     /translation="MAQDTGIALDATQSTLAKLKLLDKHHETISRETARYLRELTQNP
                     LDVIEHQPAQQQTSVFSLEHQLSDLCVRNTSAFVSAQEAFDKIPQICSYSDDKLASLT
                     NSHVSRIQQAIETFGQQANFALTLRNSASSMKDTMETSLLQLLRLPQFVSTSISNANY
                     EEALQLTEHFFQNLPPKEKEVKHVVQALLDNMYSVLLHAQHLLMQAFRDPNAELPEAR
                     ACVTYLLRLKSFARIQYPGTELDQHSADMCFGFLHARFLRVHTCLDPNADILLNIESW
                     KDTVMSACATATSLYLENRVDQAQPIDTISVQLISMFATHAIDVLYEYLSLYLHNYTH
                     APIGPAPHLEEMSKRISLIYSKLCFVSDSLASIGISLELSLVPSTGRIESSLDAFGFA
                     ALSLWIAALHTIHPEEISATCPENESHNKMPRALSSHPLCIGTARQVVAALNVLRHFA
                     PLNIHQAAVDALGKRFAHILSDLPSKEQHCFVNVLAPWASSALVQGVFDQPKESYSLS
                     TCAEWRQACTTVKHTALNPT"
     gene            <428713..>429384
                     /locus_tag="MRET_4036"
                     /note="MRES_15255"
                     /db_xref="GeneID:38740802"
     mRNA            join(<428713..428790,428816..428912,428939..>429384)
                     /locus_tag="MRET_4036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630663.1"
                     /db_xref="GeneID:38740802"
     CDS             join(428713..428790,428816..428912,428939..429384)
                     /locus_tag="MRET_4036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486250.1"
                     /db_xref="GeneID:38740802"
                     /translation="MPKRTYSGAGNHASSKKSRPAPMDPRVPKGADPTRSIYYDPVFN
                     PYGAPPPGLSYKERPRTPDPYEENKQRKISEIQVKAPSSPPLGQENDSDDDIVMPAGP
                     PPFANVTPHKPVSQSFETISAPVKYVHSEFVEKSQPEPEPEPEPEPVYDPDLMNKELH
                     ELDSPASKVETSTVFESKPQMRDFRKEAASFVPVSVLRRQRHKPKP"
     gene            <429518..>431422
                     /locus_tag="MRET_4037"
                     /db_xref="GeneID:38740803"
     mRNA            <429518..>431422
                     /locus_tag="MRET_4037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630664.1"
                     /db_xref="GeneID:38740803"
     CDS             429518..431422
                     /locus_tag="MRET_4037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486424.1"
                     /db_xref="GeneID:38740803"
                     /translation="MGANENDNNHSCIRAHTPVRFERRSIRTPSPQHRQMVGNTRLVQ
                     SERTCRVDNLDRLPVKQLPPAAPVLQSDVDSSRIFFGTPTSAERHATYDLVSQGFCDQ
                     DTPGHDPDESSPGIARCGSPLENVRARQYLVRDVLGDVSNLSPMSGHGYLKSSLSPSN
                     NVRSTPLRHSTNLISCSSPTKMTPVQSALHDWASSRFERSISKQDNDKNASLFSEKCK
                     PLQNLSSTSTFSPSSSKTHEAENLPMDVVFDVSDPEKSPSHTLSNYQSTKSVRPDTRR
                     LGSSPYGPAQRVPGFVPGSATPAKRVKMGVSTMSPGTKPWNTAFQSARVPVNSPMKQK
                     ETSMTTAGISRDASAPSPTKATRLVRPIKYTNHAPAMRVWDSPDKGCTKKRVLPVKSA
                     PKKEIASVSEKKAAAPSVPVEVLNSSTRSTRMSNDASRFPQAFAESDAAATLKESSSS
                     AIANSNDSIARNRVPRTARRAPAPRHPPITALELARLTTKHTKQNEMYNVQLETRTQR
                     IPGPRPPSPSQHFVTGHGQRARVQFRPNEVKTDERGEPMCHTRGAGDEEVYTTPPGKD
                     VRWDKRLVVSPSEEKQARSEKPSSGCLVHKPLTLDAFGNVACPPLKGITRRKILVKRF
                     VYDDDDNVDV"
     gene            complement(<431475..>434614)
                     /locus_tag="MRET_4038"
                     /note="MRES_15250"
                     /db_xref="GeneID:38740804"
     mRNA            complement(join(<431475..433555,433582..>434614))
                     /locus_tag="MRET_4038"
                     /product="trehalose 6-phosphate synthase/phosphatase"
                     /transcript_id="XM_027630665.1"
                     /db_xref="GeneID:38740804"
     CDS             complement(join(431475..433555,433582..434614))
                     /locus_tag="MRET_4038"
                     /codon_start=1
                     /product="trehalose 6-phosphate synthase/phosphatase"
                     /protein_id="XP_027486458.1"
                     /db_xref="GeneID:38740804"
                     /translation="MTTVRPESRPHECPQFSSLHINKGTESPQIDIPNPSTGEYQEYT
                     SIQDLWESVRRLQHELEMARPKEPLSGRIIQVVYSLPFTFTPRKEHDYIQRKAHAEAA
                     KNSVARMAATAQARKLEREQQGLLESKREEKTSISYRMNVDPLQRNQEHCGRVAGRRA
                     WMLSELVDDDMSEEDQLSAVHSHIHKASSSDFKEIPSSSSKCTGFSEQGSTSSCTSGS
                     TKLRRPSWILSLSRGHSALNSGIYSLCASHKQTYIGAPIHMRFFQQSELDTRSEVSQT
                     MPEERKEIEDVLASLENRSAWSLHEGGLAMRPPALDSDNSEEIAGIRYVPTWLDHQSA
                     YSHYEAYCKATLWPLFHYMMWRDDEDRTTWDQHSWQSYVKVNQAFAERVAAEHKPGDI
                     VWVHDYHLLLVPLLVRRMIPDVHIGVFVHSSFPSSEFFRCLPQRHDILEGMLGADLIC
                     FQNQTYARHFLSCCVRICGLEVQGNFVESANGRVTKVGHSTIGIDVERVRYEATQSGI
                     GSRMHQLRNLYKDKRIIVGCDKLDVVRGVIQKLQAFYELLLHYPRWRNNVVLIQITIP
                     AMHSSPKLERQVSELVSLINGDFGSLSFTPVQHYHQLIEREEYYALLSVADLALVTSV
                     RDGMNTMSMEYVVCQNEHGQSPIIINEFTGTAVHLQAAIQINPWDIGGVAAAIHHSLC
                     ISDQERYDRNKQCHEQVVSKTSHTWALSLVQQMLHRLRHRYSAHSTPIFNLEHMLKCF
                     TPAKKRLFLLDYDGTLTPIVKDPSAAVPSQRLLEALQILSNDDRNIMYIISGRDEAFL
                     SKYFSQFPAMGLSAEHGSYFKEHGSQSSWQNLSAELDMSWKQDVLNVFRYFTDRTIGS
                     NIEEKKSSIVWHYRNADPDFGSFQAKECQSLLDNILSQNDLQVEVVVGKKNVEVRPLA
                     INKGEIVHRLLYAIPDVDFVFCVGDDKTDEDMFRFLSKLAYDASNEEPLSSDRVSTMV
                     VSPPAPLSRNSYVNASSRNLNIRHEQIFTLTVGPASKRTRADWHVGDVNGIIDSLVAM
                     AHQDEQE"
     gene            complement(<434689..>436500)
                     /locus_tag="MRET_4039"
                     /db_xref="GeneID:38740805"
     mRNA            complement(<434689..>436500)
                     /locus_tag="MRET_4039"
                     /product="mannosyl-oligosaccharide alpha-1,2-mannosidase"
                     /transcript_id="XM_027630666.1"
                     /db_xref="GeneID:38740805"
     CDS             complement(434689..436500)
                     /locus_tag="MRET_4039"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide alpha-1,2-mannosidase"
                     /protein_id="XP_027486459.1"
                     /db_xref="GeneID:38740805"
                     /translation="MGNKKAARQRPPAPPKKSWNKCYFFISATLLAFGAYIVRQIWLA
                     SLFVPPYVPVDIPANFYDGERPTTVPFQLPPARKIPTHPIQEQDKEKLHAIRVAFQSS
                     WGAYKRNAWGMDEYHPLSKSGTNLLLKDESPVGFTIVDALDTLIILGMEEDYMDARNW
                     IRDELSWDVDGRLNVFETTIRILGGLLSASALMLDPPAGTLRASHEDSIFFLTRAQEL
                     AARLLPAFDTPSGIPKREINLHTGESFYDEDNHGSSSLAEVTTIQLEFKYLAERTGDQ
                     KYWRIAERPMQAALKTVKEANFGILPIFLSPHDGEFYLSEIRLGSRGDSYYEYLVKQF
                     IQTNRTEQVYRNMYEYAFDDIKAKLLKHTPWLSPPLVHTLEIYPRNRGKEWRAITKQD
                     HLVCFLGGTMMLGASVMVNGTLLPPKQKYGGTRAMREDWRVGHELIRTCVDTYTNSAT
                     GLGAEIVFFRSTENATDRRAWVVKQANRQTNPEAGPPIDARNILRPETIESLYIAFQL
                     TGDPIYREWGWQIFESFQHWCQVDGGVGGYAGIDNVDDVNHNQIDRMETFWLSETLKY
                     FYLLFSERNILPFHTWVFNTEAHPLPIFTPSFLTKID"
     gene            <436637..>437902
                     /locus_tag="MRET_4040"
                     /note="MRES_15245"
                     /db_xref="GeneID:38740806"
     mRNA            <436637..>437902
                     /locus_tag="MRET_4040"
                     /product="AP-2 complex subunit mu-1"
                     /transcript_id="XM_027630667.1"
                     /db_xref="GeneID:38740806"
     CDS             436637..437902
                     /locus_tag="MRET_4040"
                     /codon_start=1
                     /product="AP-2 complex subunit mu-1"
                     /protein_id="XP_027486303.1"
                     /db_xref="GeneID:38740806"
                     /translation="MLSAFFLVNANGNALITRMIRDDLRPEIIDQFRVYVIQNPAIHT
                     PMLTLGGITFLWIRHMDLCIVAGIMSNTNPTLVFEFLFRFVSVCNASIGELNEEAVKK
                     HFMLIYEMLDEMMDFGYPLNTDIQRLETYIVSENIHGLVPVRHNVRRVTTEYPTDVAW
                     RQRDVKYRKNRCFVDVIEKLNLTVSSQGMIVKADVEGVIRLRPFLSGMPHCLLSLNCA
                     VGPSEGHTALFVKVDECKYHPCVGFTTSNGDSCLSFVPPDDEFELMRYTAKRNVRLPV
                     RIHAVIKKKNENVWQYQLNLRTCTEQQLHVTDVVIRIPTPNNAVHASCDVQLGKVKWD
                     ANEQVILWRIPRVQGMTEWMLRANVHMTSEAITPRERLPLQVDFTVPSLTASGIAVRY
                     LQITERSNYRAMKWVRYETHSRQSYLVYI"
     gene            complement(<437899..>439317)
                     /locus_tag="MRET_4041"
                     /note="MRES_15240"
                     /db_xref="GeneID:38740807"
     mRNA            complement(<437899..>439317)
                     /locus_tag="MRET_4041"
                     /product="tRNA-splicing endonuclease subunit Sen54"
                     /transcript_id="XM_027630668.1"
                     /db_xref="GeneID:38740807"
     CDS             complement(437899..439317)
                     /locus_tag="MRET_4041"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit Sen54"
                     /protein_id="XP_027486302.1"
                     /db_xref="GeneID:38740807"
                     /translation="MEDDKVARATPAQGDSDEEEDMPDYRVLSALSSKHLSAGGMSTD
                     ASAPSIPKRGEKDFEPTGFGGQTKVLEQSRHALFTTISLPRAHSSKTLCTATWDPHFQ
                     RAFVHAQRGQSCTHMGVSQRRRVESGQKQTCLELFPEEAIYLIERGALDCRWTQTPGT
                     VPSADAFLSCIPISVSQAFSHLMGQEGCTMARYQIYAYLKRLGYIVQRASLVDQLRAP
                     DPSKLSTPKKSVLVGLLLGWWRTCTRICSMIYQFLRWCIRKLCTRQRGLLGISATDSF
                     DTVFDTLRIVATDEPKSPTKLVQDESLQPFFYAWRPASHFKRTHPPPPEFRICVLETD
                     QHPMLNGHDFDTLFSHIPIPSSTGSQGDDRELAEVRAQNRRAYGKQRTARVPPATTRN
                     PSRLRSLISRLTWILHVLQTFLSKWGISCAKVKQTRTNVYIPLKAGRRNVVVAIVDQG
                     TMSLLRFGEAQFNEWRLAGHVP"
     gene            <439469..>441889
                     /locus_tag="MRET_4042"
                     /note="MRES_15235"
                     /db_xref="GeneID:38740808"
     mRNA            <439469..>441889
                     /locus_tag="MRET_4042"
                     /product="calcium permeable stress-gated cation channel"
                     /transcript_id="XM_027630669.1"
                     /db_xref="GeneID:38740808"
     CDS             439469..441889
                     /locus_tag="MRET_4042"
                     /codon_start=1
                     /product="calcium permeable stress-gated cation channel"
                     /protein_id="XP_027486395.1"
                     /db_xref="GeneID:38740808"
                     /translation="MDFDDRVPERPGPRGKTFVGPWLEQQVVLSFVIGLLAVLVFGVW
                     KRHYPSVYLARHHAQGSALPYDRMRNSMFGWILPTLLYSDHSVLHTVGLDGVTALLFF
                     KMGFMYLTLTSIWALFVLMPVHFYTNGWVDGVKPGESLGDSIFYPMRRLRKPKEPLPL
                     LPLPTIVTRDTLYENTQLVSTFAYSLLAMFMLWRAYRVFISFRQSHSGSLEQSDTSRT
                     VEVHMLPDHLSTDEALISYFESIRLPVESVCILKNTSSLDKLLRQRARGLFRLERLWY
                     SWLGDDSAVENYDPAAIEDQTLAMSEPPKPGDAPMIGTHIRANRPRPRAYVPLWNWAG
                     EHVDAIDQASYEFATLDRAVRALRDSLFPHTHTAFVTFQHTWSAQIAGQVVHYPSPGR
                     MLTEPAVEPRDVIWEHQETAVWDRRVRQCIMALSMAIFLSITLSLDLILASLVNLNGI
                     KVYFPWLGDLIDENLRLRAFVQNSLPTLLLISINALVPVAMRYSTWFQRIRAYSHIEH
                     SVLGMYYLYLLFSVVFVFLFTSARDMLNELSESPMHMIDKLAQSLPVARNFSLAYVIF
                     QGLAIQPFQLVLLPNILLRQFESLFCVMTPRRWAHLLSAPTLTIGTLYPQALLIFTLC
                     VLYSIVSPCINVFGALYFGIGYVVVKYQLLNVFDRPYDSHGHAWPLAVRRCIWAVVLF
                     QVFQLSLFSVRKQVLNSLLIVPLIGYTIWFAFHVQKTFLPLTSFVNLHDIYAAEEELR
                     HRNEAYQDEPHSHIPSGEEHPGRSSVMTSRSCLLSVSQRTYKQPSLTGPLPTLWLPHS
                     RPTFLEPV"
     gene            complement(<441919..>442623)
                     /locus_tag="MRET_4043"
                     /note="MRES_15230"
                     /db_xref="GeneID:38740809"
     mRNA            complement(<441919..>442623)
                     /locus_tag="MRET_4043"
                     /product="nucleolar protein 6"
                     /transcript_id="XM_027630670.1"
                     /db_xref="GeneID:38740809"
     CDS             complement(441919..442623)
                     /locus_tag="MRET_4043"
                     /codon_start=1
                     /product="nucleolar protein 6"
                     /protein_id="XP_027486394.1"
                     /db_xref="GeneID:38740809"
                     /translation="MTSEALGDEAKPNASNISQHTPPKSLDATKTIFDDDGTSHSSKA
                     LRSNDAGIRYIVFVGNMSYDVTADDLAKHMSDTCGEMPRVRLLTKKGDPSALEKLSNS
                     KKKSIAKGKAQDPSAPVSKGCAFVEFSNAASLQKALRFHHTIFRGRQINVELTAGGGG
                     KSERRKEKIKAKNADLDKERRKIFEKYVKPEAEAHKRKQSERSEQAPDQSKPDRTTRP
                     AKQPKFASGANAVRLG"
     gene            complement(<442725..>443353)
                     /locus_tag="MRET_4044"
                     /db_xref="GeneID:38740810"
     mRNA            complement(join(<442725..443075,443102..>443353))
                     /locus_tag="MRET_4044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630671.1"
                     /db_xref="GeneID:38740810"
     CDS             complement(join(442725..443075,443102..443353))
                     /locus_tag="MRET_4044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486305.1"
                     /db_xref="GeneID:38740810"
                     /translation="MIAKNSGSSFVSYYHLSTYVQFMDTIEPCPTIRNVEVKEIPRDI
                     IATKSCTKASSSGNDITVLCQQFVDRIFVSVSQKGKVGYLLQAHVQLPFAQAYSNEYN
                     SHSTDEAREPTVTFVPLFGAPPKGMEDIYLLYTKQLALHIYSDLCRLEPMKGGDTCKP
                     MVIALALDRIPTENVDDIDFVSERQRLNQICSMMQECRVW"
     gene            443388..443495
                     /locus_tag="MRET_t0066"
                     /db_xref="GeneID:38741260"
     tRNA            443388..443495
                     /locus_tag="MRET_t0066"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:38741260"
     gene            <443633..>444781
                     /locus_tag="MRET_4045"
                     /note="MRES_15225"
                     /db_xref="GeneID:38740811"
     mRNA            <443633..>444781
                     /locus_tag="MRET_4045"
                     /product="oxidoreductase"
                     /transcript_id="XM_027630672.1"
                     /db_xref="GeneID:38740811"
     CDS             443633..444781
                     /locus_tag="MRET_4045"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_027486304.1"
                     /db_xref="GeneID:38740811"
                     /translation="MPDQSRHVVIVGGGIIGASIAYFMSRRSDCPKVTLLESSKTLAP
                     GASGKAGGFLALDWHGTSTASLAALSFELHRELAEKENGAERWGYRFVETHQLSLDTS
                     RKARHRPKIDWLNPDVFISTSLIGGGGSTAQVTPGPLTEFLCERAQEAGVQIHLQTKA
                     TGLDLTEDGKVRGVKIQQAGEDKVLPATDVIVAAGPWTGKLLKSWFPSDKMPQFLRSA
                     SMIEGSRSHSVLVQAAKKHQLSADCFFSEMRYGSSAGAPEFYIRPKGRAYVSGGSDDA
                     PVPELADDVTFDPRRTAELQKQLAVLSPEYLDVNRGAELLAEQACYLPISPRTAAPIL
                     GGSAEQGIYVAAGHAVWGISNSLGTGKVMSELLLDGKAHSANIQQLRP"
     gene            complement(<444797..>446413)
                     /locus_tag="MRET_4046"
                     /note="MRES_15220"
                     /db_xref="GeneID:38740812"
     mRNA            complement(<444797..>446413)
                     /locus_tag="MRET_4046"
                     /product="cytosol aminopeptidase"
                     /transcript_id="XM_027630673.1"
                     /db_xref="GeneID:38740812"
     CDS             complement(444797..446413)
                     /locus_tag="MRET_4046"
                     /codon_start=1
                     /product="cytosol aminopeptidase"
                     /protein_id="XP_027486307.1"
                     /db_xref="GeneID:38740812"
                     /translation="MSGLLGKVVRIDAEGAAPSLAALPELAAQVASQWKVSRANAAKP
                     GECRVLYPSSFHPVAAVASGEQAGAPQTGPDALPSANVFLRNERLEETRLAAAKGVRA
                     LRDLGKVNEEGQCIEVDSFASAHAAAVGATLGLWNVNHFKTRGSAPAWSLPLEKQGGR
                     HIEAVPIHGPVSSEQKKSLRDDGDELASSATPLSWYTGEVYARAQNWSRELQETPANL
                     LTPTIFAHRIMDAFKHVPHTKVVVHDADWAREQNMNLFLSVAQGSEQPCKFVEIQYHG
                     APDAKAAPLALVGKGITFDTGGTSLKPSAGMDLMRADMGGAAAVVASTLAMAQLGLPI
                     NVVTVTPLTENMPSGRATKPGDIFQARNGLTVLVDNTDAEGRLVLADALSYVTDVYAP
                     HTVIDVATLTGACVMALGDVYSGVFTEAESLWQELKTAGEAEHDLCWRMPLTDRYLPQ
                     ISKLNADLVNTGGRPAGSCTAAIFLKQFVHGLEDRAKGEAARVRYAHIDIAGSMEAAA
                     NTLNDYQSKGLTGRPVRALIEFARRLAFSS"
     gene            complement(<446486..>449206)
                     /locus_tag="MRET_4047"
                     /note="MRES_15215"
                     /db_xref="GeneID:38740813"
     mRNA            complement(<446486..>449206)
                     /locus_tag="MRET_4047"
                     /product="DNA excision repair protein ERCC-4"
                     /transcript_id="XM_027630674.1"
                     /db_xref="GeneID:38740813"
     CDS             complement(446486..449206)
                     /locus_tag="MRET_4047"
                     /codon_start=1
                     /product="DNA excision repair protein ERCC-4"
                     /protein_id="XP_027486306.1"
                     /db_xref="GeneID:38740813"
                     /translation="MELPPSRHWLLPFHRSILHRLLPDDEELRDLLVILAPGLGLRRV
                     VSTLLRVYARPQSLVVVVNASAQDVKGINHDLGTLGLGHNAIRDVHHHMSSKQRTDLY
                     LSSGIISVTSRILVVDMLQKRIPTSLLTGMVVLNAERVSPTSIEAFIVRLYREQNNDG
                     FLKAFSDNAEHLASGYHKLQTIMSQLRLRQVDIWPRFQEEINQDLGQRRADVIELHQP
                     LTPRMRSIQNAIIQCLEATLHQVKLSKLVTDLDDLNVEQAMYRAFDVTVRRHLDPVWH
                     RLSPATRQLVGDLYTLRQLLHALLSYDSVSFYEYLETILASNAPTSEPGAPQRQSQWL
                     MSDEANLIFHEARARLWQEKQDDEGMSFELEELPKWKLLAKVLDEVEQDIYRDDSSSS
                     HTILIMVQSERTVAQLRTWLSLAEGNTASPGRPYLTACLHNYLAWKKSLLSFQKERHV
                     RSNTPESPNPSSSIHEALRHKMMRTGAPAHKRRRMRGGMSQTSRPSLAEDNPFSELDH
                     VAAAMDPPPALHGMDESKEEQDPGSTDFFGLLDLDHVIVVQSYQGDNNDNILQELRPG
                     YVIMYDPNASFVRQVELYRATQSLSSELRIYFFLYVDSVEEQMYLGGLRREKDAFERL
                     IREKATMVIPLTTNGLPAEEDADQRMVRMLSTRIAGGQRLVSGRRPRVVVDMREFRSS
                     LPSFLHAAGMEVIPCTLQVGDYVISSDMCVERKTLTDLMQSLNSGRLYTQCEAMSMHY
                     PYPILLIEFDQDRAFTWQSMGDVRSAHGRAQAARSTPSDLDVQSKLVLLTLTFPRLHI
                     IWSSSPYASVEIFADLKQNYDDPDPERAASVGLDDSLQRQGQREASLNITPYEMLCSM
                     PGVTLKNAAYLAQHIPNIQALCETPLSDLQSLIGAEAGRKLHQFLHRSLA"
     gene            <449444..>450037
                     /locus_tag="MRET_4048"
                     /note="MRES_15210"
                     /db_xref="GeneID:38740814"
     mRNA            <449444..>450037
                     /locus_tag="MRET_4048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630675.1"
                     /db_xref="GeneID:38740814"
     CDS             449444..450037
                     /locus_tag="MRET_4048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486397.1"
                     /db_xref="GeneID:38740814"
                     /translation="MYMHKLISFALAGAASAMASGLSCKAYGVAGNLVSLDFFHHDSQ
                     LLEFTHDKTVDGHPALAPTQHSKQLFQFFSCNSPSKHYKKGGQVRSLTNTSLCLTPGT
                     VYLPSDKMGDAVPYPDNADNRISLQPCESEHSLQLRKQWFMETETNRAGLVQVSQQGW
                     RSDSTSDTLIITDDGVALTSHPHKGTEPKHLHIKARV"
     gene            complement(<450230..>451141)
                     /locus_tag="MRET_4049"
                     /note="MRES_15205"
                     /db_xref="GeneID:38740815"
     mRNA            complement(<450230..>451141)
                     /locus_tag="MRET_4049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630676.1"
                     /db_xref="GeneID:38740815"
     CDS             complement(450230..451141)
                     /locus_tag="MRET_4049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486396.1"
                     /db_xref="GeneID:38740815"
                     /translation="MDQGSAVVSAKMSSIMKILFASLLLWTVLLQVSATPLHRTVKKN
                     ALDVTSAQVEKRLRTESLQRRSAVCEPVEDKTVTVTHWKTRHIGNGKQPGVTRITETS
                     WIATTVYTSSTPTSPKETTKGPKPDDSFPPVTKSLEHAHDTKEPYTSVTAASARETHS
                     RSSQTVQHDTKQQSSSSVSRMSTKSSTIVTTSHLASKDASPTESTPAHSHRLSTGPRP
                     ACSAEYHDEPKEHTTKTGSSQTTKHSRTKNAGPSPTTVIKTQVSGTDLTITATSLAGG
                     KFDCGKYNIFGIEVCINGSGNGNQIKF"
CONTIG      join(CP030257.1:1..453862)
//
DBGET integrated database retrieval system