GenomeNet

Database: RefSeq
Entry: NC_040200
LinkDB: NC_040200
Original site: NC_040200 
LOCUS       NC_040200             405301 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome VIII, complete sequence.
ACCESSION   NC_040200
VERSION     NC_040200.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 405301)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 405301)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 405301)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030258.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..405301
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="VIII"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            <1511..>2682
                     /locus_tag="MRET_4050"
                     /note="MRES_16365"
                     /db_xref="GeneID:38740816"
     mRNA            join(<1511..1992,2021..2039,2066..2275,2305..>2682)
                     /locus_tag="MRET_4050"
                     /product="MFS transporter, DHA1 family, multidrug
                     resistance protein"
                     /transcript_id="XM_027630677.1"
                     /db_xref="GeneID:38740816"
     CDS             join(1511..1992,2021..2039,2066..2275,2305..2682)
                     /locus_tag="MRET_4050"
                     /codon_start=1
                     /product="MFS transporter, DHA1 family, multidrug
                     resistance protein"
                     /protein_id="XP_027486531.1"
                     /db_xref="GeneID:38740816"
                     /translation="MILRFISGFLGSPVLATGGATMADLWNLDGGLMNGIAFWSYAAC
                     AGPGMGPLLSGFAVQEKGWRWIIWPLLCGTGLTWLIIFFFLPETYGDAILARRAIELR
                     RMSGNKHIRSHGEEKDAQVSLSQLAIITLYRPLRMTFTEPVLFFSDLYIAYVYGIIYC
                     FFEAFPLTFQGRHHFSLGESSSAYITGWVVCAVALVLYCWYNLKLVLPWFRSGKWKPE
                     YRMQACFVGGILLPITLFWFGWTSFESVPPYSALAAYGVFQCAVFLLFQGFLGYLGEV
                     YPFYTASAFASNGLFRALAGGAFPLFSTQMFNRLTIQGGCSLLAGLAILLIPVTLTFY
                     LYGHRLREKSKMAGMVGAKKEPDESISV"
     gene            <4074..>4988
                     /locus_tag="MRET_4051"
                     /note="MRES_16370"
                     /db_xref="GeneID:38740817"
     mRNA            <4074..>4988
                     /locus_tag="MRET_4051"
                     /product="secreted protein"
                     /transcript_id="XM_027630678.1"
                     /db_xref="GeneID:38740817"
     CDS             4074..4988
                     /locus_tag="MRET_4051"
                     /codon_start=1
                     /product="secreted protein"
                     /protein_id="XP_027486533.1"
                     /db_xref="GeneID:38740817"
                     /translation="MLFRLTLLASVVAVALATEPIKVDRKVLFHSHNDYVHHRPVYDA
                     FDHGVLSFESDFWFDEHKKALYVAHTPLGIDHSKTFNTQTVDRVLNIVQGKYSDKYPA
                     SNVKKFYADPKNQPTAHPDWYKYFSEGFGGVRPIMILAEPKTSADPDMWKTVVDALGE
                     LRSQGLLTRYEYGKVHFGPVIVVGTGNTPYSQVVATPVRDYFMDCHADGLKDEHGQFQ
                     YNATACPISSAGYPSVPHSNLGLTPPPKAAIPYFAKYTCDAHIINSTVRFYGVPKTAG
                     RIDDFNMLLQQGADWLNIDHFDDVKRYS"
     gene            <5031..>7643
                     /locus_tag="MRET_4052"
                     /note="MRES_16375"
                     /db_xref="GeneID:38740818"
     mRNA            <5031..>7643
                     /locus_tag="MRET_4052"
                     /product="DNA replication licensing factor MCM6"
                     /transcript_id="XM_027630679.1"
                     /db_xref="GeneID:38740818"
     CDS             5031..7643
                     /locus_tag="MRET_4052"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM6"
                     /protein_id="XP_027486576.1"
                     /db_xref="GeneID:38740818"
                     /translation="MSSHAPLLSSRFHMDSASSVGLGSVPGTPRLDTDMGSYSQDRSG
                     GAETPAAPAPSGRARPSTIPKLDDIPIVTDETGERVRESFAAFLERYMGDRPSSPDSI
                     YVEQLYAMRDYGRTTLYVDFAHVLDHDEVLARAITEQYYRFLPYLRRALIECISVYIP
                     GYLYLNAHMASTASSGLVTRDFSVSFHHLPLQSGIRSLRSDKIGRLLCVNGTVTRTSE
                     VRPELILGTFTCVECKTSIPDVEQQFRYTEPLMCLNPMCQNRTQWELDVEKSRFCDWQ
                     KVRIQENANQIPTGSMPRSLDVILRSEIVERAKAGDRCEFTGTFIVLPDVSQLGVPGV
                     NAQIQRQTQFGSATDTVANQGVTGLKTLGVRDLTYRTVFLACMVQREFQRDDGRTDVV
                     SDDHEEDAETVLKDFTEEEREELEVMVASTDIYPRLVRSIAPTMYGHEIIKKGILLQL
                     LGGVHKQTKDGIHLRGDINICIVGDPSTSKSQFLKYVCGFMPRSVYTSGKASSAAGLT
                     AAVVRDEETGEFTIEAGALMLADNGICAIDEFDKMDLSDQVAIHEAMEQQTISIAKAG
                     IQATLNARTSILAAANPIGGRYNRKQTLRANVAMSAPIMSRFDLFFVVLDECNETVDW
                     NIAQHIVNIHRFRDAAIAPEFSTKALQRYIRYARTFHPKLTPEASDVLVEKYIHLRQD
                     DSGGSVGRNSYRVTVRQLESIIRLSEAIARANCRSDITPAFVREAYSLLRQSIIHVEK
                     DDIAIDSEDEEPAAPAPMEEPQAPTRRSITYDRYMELVNQLVLKVHAVERDTSQGVSR
                     EALAQWYLEAHEHDIDSVQQLHEESDLISRVISKMIKDGYLVHLPVEESERVPGGPEQ
                     VLMIHPQVDVDSLQ"
     gene            <7668..>8190
                     /locus_tag="MRET_4053"
                     /note="MRES_16380"
                     /db_xref="GeneID:38740819"
     mRNA            join(<7668..8103,8129..>8190)
                     /locus_tag="MRET_4053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630680.1"
                     /db_xref="GeneID:38740819"
     CDS             join(7668..8103,8129..8190)
                     /locus_tag="MRET_4053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486630.1"
                     /db_xref="GeneID:38740819"
                     /translation="MATVNHASTRGQRRGTIRTRPHERILASYPNCHVRVLFLPTQRA
                     LESRGGTCTVSSQRLVFTSNQASEELDTLSVPLETMSVGKYMLPIFCAPYWQATMTHF
                     TDGTSDHGQVIVRFPSGGGMSFQQTIRAAQAQWDVERHHEDILPRYDEQGITLDTSSS
                     PPAYQ"
     gene            complement(<8184..>9080)
                     /locus_tag="MRET_4054"
                     /note="MRES_16385"
                     /db_xref="GeneID:38740820"
     mRNA            complement(<8184..>9080)
                     /locus_tag="MRET_4054"
                     /product="ribosomal RNA-processing protein 7"
                     /transcript_id="XM_027630681.1"
                     /db_xref="GeneID:38740820"
     CDS             complement(8184..9080)
                     /locus_tag="MRET_4054"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 7"
                     /protein_id="XP_027486616.1"
                     /db_xref="GeneID:38740820"
                     /translation="MQEIHGFRVLPVTYDEGVQHYMYIRAHVSAQQDTKYPAGRTLFV
                     VNIPPDATQQAMRDLFRKAGTVEAVDVRRASDEEQPPADGPPAVEPLPPMEPADAYVA
                     TCSNAHVVFLDASSLDRALKLPARFQTKPYKWQCERMQGLSYLIERYRRHRPPHEAVK
                     KHVDTAVARYSWIRAHPQWLMEQRARGDTTTSVGVGIKAAGVGENGELLDEDGFVIVQ
                     RGNKYGRSGGEDNTFGAMTPAFEEELRQHPEKKKARELEDFYRFQFREKKRQQFASLR
                     AQFEADKQKIAQRKASVRFKPY"
     gene            <9196..>9945
                     /locus_tag="MRET_4055"
                     /note="MRES_16390"
                     /db_xref="GeneID:38740821"
     mRNA            <9196..>9945
                     /locus_tag="MRET_4055"
                     /product="small subunit ribosomal protein S35"
                     /transcript_id="XM_027630682.1"
                     /db_xref="GeneID:38740821"
     CDS             9196..9945
                     /locus_tag="MRET_4055"
                     /codon_start=1
                     /product="small subunit ribosomal protein S35"
                     /protein_id="XP_027486578.1"
                     /db_xref="GeneID:38740821"
                     /translation="MSRALACARVHTRAMHTSVRCAKEDITKEMNYVLRKDTMPLQQL
                     PKYRFDDVSTVGHMRLQKERQMLKYYRLLANEFPKLKELHVPFTPPPPSSFLTFKFTH
                     YQGEEHPDTSKVVLTLAVKDLFDAKALSTSLAKHKFLLLAGPRWQPPHTALVQRWNDA
                     LAQGPDALEALCQGEGDLGSVKIASQSFPNEAQNMKWCSDVLDRMVSESHAEPALHDV
                     PLDVRPYTSSNARGGRKSRPTKHDFPKEWLP"
     gene            complement(<9926..>10840)
                     /locus_tag="MRET_4056"
                     /note="MRES_16395"
                     /db_xref="GeneID:38740822"
     mRNA            complement(<9926..>10840)
                     /locus_tag="MRET_4056"
                     /product="putative methyltransferase"
                     /transcript_id="XM_027630683.1"
                     /db_xref="GeneID:38740822"
     CDS             complement(9926..10840)
                     /locus_tag="MRET_4056"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_027486534.1"
                     /db_xref="GeneID:38740822"
                     /translation="MTNDASGPTLHPSFGHPGSCFVYRPKAVNAKEPDADAPAIPIMV
                     PETAIYMLFAHRQWRAGMLLADAIYTHAFDLEDKCVLELGAGTGLPSLTAAICAKARK
                     VVVTDYEDETIIATLRANARYTKEINHDMAPLQVAGHTWGSRMDDVLDLLPPTHSHFD
                     VVVLADCVWERFSHDILLRSIKDLLSRSKDARIYMVAGLHTGRSTLVHFFRHALAIGL
                     CLVPVPPADVWPTCPQETTALPGSEHIMELEVGGTWDEHETPYLTGQRRPFLLHRGSP
                     DQEDEPIQVRNHWLTVSCMAWAATEATP"
     gene            <10943..>12322
                     /locus_tag="MRET_4057"
                     /note="MRES_16400"
                     /db_xref="GeneID:38740823"
     mRNA            <10943..>12322
                     /locus_tag="MRET_4057"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM50"
                     /transcript_id="XM_027630684.1"
                     /db_xref="GeneID:38740823"
     CDS             10943..12322
                     /locus_tag="MRET_4057"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM50"
                     /protein_id="XP_027486536.1"
                     /db_xref="GeneID:38740823"
                     /translation="MMLGALSIAARSHRTPTVRLASLALRTYSTRPHEDAATAPKKDE
                     EPEPLRKGIQLDIDASSLVDAQSISAPEEEGSSKKRTNAKARSDAPGASDGWARVRTQ
                     LSIAGALLFAAGTVWMLGRDLDEKEHEIFHGQEGLDSFLGRLRLRFKQLTNSMTEPKW
                     EVLLPDPLPYPYSRPYTLVLDLDQLLVASSWSPAHGWRTAKRPGLDYFLGYLSQWYEI
                     VLFTTQTFAQLEPVLDKLDPDRRYIAYQLFMESCRLHNGKLVKDIRHLNRDPRKVIMI
                     DINPDHVSLQPENAIVMQPWKGDKNDRELLGLVSFLDAIGIYGVSDVRTTLKAYEGKY
                     IPVEYPKSEMLSKQRQEEEWRAKKQHSGGLTSMFGSVRPGSTGSEPPTSFLDSERKRF
                     LQGYLEDQKFWRVNGETLRKQMREEQEKQMKEMSMSAWDGLSQLFRGPPPPPETAASA
                     SDSPQPATP"
     gene            <12362..>12730
                     /locus_tag="MRET_4058"
                     /db_xref="GeneID:38740824"
     mRNA            <12362..>12730
                     /locus_tag="MRET_4058"
                     /product="acetylornithine aminotransferase"
                     /transcript_id="XM_027630685.1"
                     /db_xref="GeneID:38740824"
     CDS             12362..12730
                     /locus_tag="MRET_4058"
                     /codon_start=1
                     /product="acetylornithine aminotransferase"
                     /protein_id="XP_027486700.1"
                     /db_xref="GeneID:38740824"
                     /translation="MSGAVQEVRRHLLKLAQTWPKDPLRPSMDFGEAIRRATEAELTG
                     PQAKRHLAESRKSLAALERIRTSESLREYPTPRHILQPASSPSHYAQLVETMNRITRG
                     QSVKPTMAQRVRRFFGLPVH"
     gene            complement(<12732..>13847)
                     /locus_tag="MRET_4059"
                     /note="MRES_16410"
                     /db_xref="GeneID:38740825"
     mRNA            complement(<12732..>13847)
                     /locus_tag="MRET_4059"
                     /product="glyoxylate reductase"
                     /transcript_id="XM_027630686.1"
                     /db_xref="GeneID:38740825"
     CDS             complement(12732..13847)
                     /locus_tag="MRET_4059"
                     /codon_start=1
                     /product="glyoxylate reductase"
                     /protein_id="XP_027486537.1"
                     /db_xref="GeneID:38740825"
                     /translation="MWWRGSVGQAVRRVSGRACYSTRPQVLLMDEVQLAKKDLERLSS
                     HAEVLRNHTQSRDELIRAFSPGGPFAQVRGMYRHFGGARSIRVSGRFDQELVDALPET
                     LKFIVHNGAGYDQLDVPALTRRGVQVANVPTVVNEATADTALFLLLGALRQFPRAMGH
                     MQQGHFHRHFSFMEASDPEGLTLGIVGAGGIGRTLARKAAHALGMHVVYYNRHRLSDE
                     LETQGMPEGARMEYALSLDALLGQSDVVSLHCPLTPQTRHMIGAAQLARMPSHAILIN
                     TARGPIVDEAALVDALDRGIIAGAGLDVYENEPEVHPGLLRLATSKALLLPHVGTLSL
                     QTQTDMEALCLRNLEHGLSTGRLLFTVKEQEGWDMSA"
     gene            <13893..>14690
                     /locus_tag="MRET_4060"
                     /note="MRES_16415"
                     /db_xref="GeneID:38740826"
     mRNA            <13893..>14690
                     /locus_tag="MRET_4060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630687.1"
                     /db_xref="GeneID:38740826"
     CDS             13893..14690
                     /locus_tag="MRET_4060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486527.1"
                     /db_xref="GeneID:38740826"
                     /translation="MWAGALECVVTTVVLVHAFRALATVPTPRTRSYDAWGQASHGTV
                     RRIGSVRRRASVAEALRIVAVWSAYQCVRPILTHPVVWLLPFVSTIHLLWLMWMLLHP
                     PMASHVVWASLLPWVRRHEVLIDEACLWGLGAWLFLGSQFRRLGRRSSPDAQEAREVE
                     KLCVESTAAPHDTQHAAYTPPTPPPPARRLPKRSAPAPQPPQPRPTTAPRAPPPTRIP
                     TLRRSKRTASAPHSPSKRRKRAPQTSRAPRASPGIRTRSQRAQAACP"
     gene            <14717..>15157
                     /locus_tag="MRET_4061"
                     /note="MRES_16420"
                     /db_xref="GeneID:38740827"
     mRNA            join(<14717..14773,14799..14852,14879..>15157)
                     /locus_tag="MRET_4061"
                     /product="peptidyl-tRNA hydrolase domain 1"
                     /transcript_id="XM_027630688.1"
                     /db_xref="GeneID:38740827"
     CDS             join(14717..14773,14799..14852,14879..15157)
                     /locus_tag="MRET_4061"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase domain 1"
                     /protein_id="XP_027486550.1"
                     /db_xref="GeneID:38740827"
                     /translation="MAAAPPLVMQLIVDRELIKSGWSMGPMMAQAAHASTAIVVQTRD
                     RKDTQDYVSEANLAHMHKIVLQAPKNVTLTDLSSQLHAAESDPSMPPHYLWTEQPENV
                     PTCLAMAPNRKPAVLTALLKKCTLLRS"
     gene            complement(<15175..>15591)
                     /locus_tag="MRET_4062"
                     /note="MRES_16425"
                     /db_xref="GeneID:38740828"
     mRNA            complement(<15175..>15591)
                     /locus_tag="MRET_4062"
                     /product="trafficking protein particle complex subunit 4"
                     /transcript_id="XM_027630689.1"
                     /db_xref="GeneID:38740828"
     CDS             complement(15175..15591)
                     /locus_tag="MRET_4062"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 4"
                     /protein_id="XP_027486510.1"
                     /db_xref="GeneID:38740828"
                     /translation="MASLWIINKAGGLIFQSEHFDYPHQRNHEAELTSNDYLILAGTL
                     HGIHAITSRIVPAPDKESQGFHMLEAENFVMHVKMTETGTKFVLLAPTTQTNAAGILQ
                     RAYELYVEHVMKNPFYIAEMPIRVEAFDREMHLLLR"
     gene            <15740..>17032
                     /locus_tag="MRET_4063"
                     /note="MRES_16430"
                     /db_xref="GeneID:38740829"
     mRNA            <15740..>17032
                     /locus_tag="MRET_4063"
                     /product="translation initiation factor 3 subunit M"
                     /transcript_id="XM_027630690.1"
                     /db_xref="GeneID:38740829"
     CDS             15740..17032
                     /locus_tag="MRET_4063"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit M"
                     /protein_id="XP_027486504.1"
                     /db_xref="GeneID:38740829"
                     /translation="MRPDLVAVLSDSTLRELTDECTILISRSFPEEQRGEWIDALGKE
                     ASQVDELADAASAIAPARELVGKLVKSTPGMIECTDRELEGLYNLLTTLLLRYYQPEE
                     APLEDLLMHMVHAIGDAQSPTAMERSVIKYRILANMFNMLPPPSPLRRRVFEVLLALV
                     SANDDMDFLETALQSVPHWLAQWDVSVQEKHECLSRIAEALVAPECGPSYNDKAYEFE
                     LLHLRFISAEPSLTNEVRHAAAERAIAHILRLPKLYEMEELLHVPVTLELASSPVLSL
                     LKIMVGGSRTDFESWAQTSEAQDAMRRLQLNEEQLLHKMRLLDLASLCARSVSAEVSY
                     EDLAQALHVPVDEVESWVIDVIRAGLVSGKLSQVQRTFRVYRSTYRSFEKAQWEALEQ
                     RLTRWQGSIQTLLNTMDQARTQMPAALVTEQAHEASEA"
     gene            complement(<17062..>17652)
                     /locus_tag="MRET_4064"
                     /note="MRES_16435"
                     /db_xref="GeneID:38740830"
     mRNA            complement(join(<17062..17083,17116..17518,17544..>17652))
                     /locus_tag="MRET_4064"
                     /product="actin related protein 2/3 complex, subunit 3"
                     /transcript_id="XM_027630691.1"
                     /db_xref="GeneID:38740830"
     CDS             complement(join(17062..17083,17116..17518,17544..17652))
                     /locus_tag="MRET_4064"
                     /codon_start=1
                     /product="actin related protein 2/3 complex, subunit 3"
                     /protein_id="XP_027486707.1"
                     /db_xref="GeneID:38740830"
                     /translation="MPAYHSSYNDEPNVRQIAGVSILPLNSKIRGPAPLPVDPSRPDI
                     VDEAIDLFRANSLFRNFEIKGGADRALIYLILFISDCLTRIAASPSWSQNEALKHLSS
                     HAVDAFALPGDAHFPLSTLYSVPSSRADADTLRQYLTQARQEVVLRLLDKMYVDDVPS
                     RWWLAFSKRKFMGKSLS"
     gene            complement(<17766..>19886)
                     /locus_tag="MRET_4065"
                     /note="MRES_16440"
                     /db_xref="GeneID:38740831"
     mRNA            complement(<17766..>19886)
                     /locus_tag="MRET_4065"
                     /product="ribosome biogenesis ATPase"
                     /transcript_id="XM_027630692.1"
                     /db_xref="GeneID:38740831"
     CDS             complement(17766..19886)
                     /locus_tag="MRET_4065"
                     /codon_start=1
                     /product="ribosome biogenesis ATPase"
                     /protein_id="XP_027486545.1"
                     /db_xref="GeneID:38740831"
                     /translation="MNAAITGAWGKQRSRISLNHEIPPGSAAAAALAREENKPADEAQ
                     AASDDAGPSDKRDKSAKRKARSVRDSVSKRGKKAADADKYAAPTTRLRDIGGMSHAME
                     KALELVAMPLCHPEIYAHTGVTPPRGVLFHGPPGCGKTMMAGALAGELDVPFLSISAP
                     SIVSGTSGESEKALRDTFDEAQSIAPCILFIDEIDAITPKRETAQREMERRIVAQLLT
                     CLDELAWEKNEGRPVMVLGATNRPDAIDPALRRAGRFDHEIALGVPDEQGREQILQVL
                     CAKMRLAGDFNVKYLAKRTPGYVGADLTSLTAAAGVIAVKRIFQHLRDADDAMQCEEP
                     PQEMTSDETHIVTGPAFLEGLPESVQSSSIAMFLKRFPHPLPDAQLEQLAIMNDDFLE
                     ALKVVQPSSKREGFATVPDVTWDDIGALHQIREELSMAVVQPIRRPELFRALGVSASC
                     GVLLWGPPGCGKTLLAKAVANESRANFISVKGPELLNKYVGESEKAVRQVFARARASS
                     PCVIFFDELDALVPRRDDTLSEASARVVNTLLTELDGLESRVQTYVIAATNRPDMIDP
                     AMCRPGRLDRLLYVDLPSPEERLDILQALTKASPLATEPGASPAYQPVQLDDIAYDHR
                     ADGYSGADLASLVREAAISALREKLVSPLHYPEDNEPVERVMMYQIHFWHAFDRVQPS
                     VTAEQRLKYEALRGRLAAGVTRRT"
     gene            <19964..>20699
                     /locus_tag="MRET_4066"
                     /note="MRES_16445"
                     /db_xref="GeneID:38740832"
     mRNA            join(<19964..20510,20535..20585,20614..>20699)
                     /locus_tag="MRET_4066"
                     /product="tRNA-specific adenosine deaminase 2"
                     /transcript_id="XM_027630693.1"
                     /db_xref="GeneID:38740832"
     CDS             join(19964..20510,20535..20585,20614..20699)
                     /locus_tag="MRET_4066"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase 2"
                     /protein_id="XP_027486542.1"
                     /db_xref="GeneID:38740832"
                     /translation="MLGQARYVPPEAQSAQDLYWMQKALDMAQEALEHEEVPVGCVFV
                     RDGHMIAQARNRTNELANATRHAELEAIDEILQKIPPKDTRFGTAPHAGPPDDNPMLR
                     TTLYVTIEPCLMCASALRQIGIQRVVFGAGNERFGGNGTVLPIHASRELPYNPPYESV
                     GGYLREEAIMILRRFYMTENVKAPKPKTKARRVLKTEIYPPGVSMHGYGPPAHHAPVT
                     EASPPAPNE"
     gene            complement(<20665..>21624)
                     /locus_tag="MRET_4067"
                     /note="MRES_16450"
                     /db_xref="GeneID:38740833"
     mRNA            complement(<20665..>21624)
                     /locus_tag="MRET_4067"
                     /product="arginase"
                     /transcript_id="XM_027630694.1"
                     /db_xref="GeneID:38740833"
     CDS             complement(20665..21624)
                     /locus_tag="MRET_4067"
                     /codon_start=1
                     /product="arginase"
                     /protein_id="XP_027486541.1"
                     /db_xref="GeneID:38740833"
                     /translation="MSFHSHILHEPSTVMIPVSYSGGQPRKGVEDGPEALVHAGLPKQ
                     LESLGWKYEQDDSISWDDIRSMERETKEGEKIHNVEASSKASQLLADVVEKHAKAGKL
                     PLTVGGDHSLGTGTMIGTSRVYPDVATIWVDAHADINTAQTTPSGNLHGCPVSFALGL
                     DGSYIEPYKSWLPAPTKNVHNRIVYIGLRDIDEGERKILKDHKIKAFSMHHIDKFGIG
                     KVVEMALDYINGDTSRRDRPIHLSFDVDAMDPSVAPSTGTPVRGGLTFREGHYICEAV
                     AETGSLVAMDMVEVNPHLEKHAAEQTIAVGCSLIRSALGETLL"
     gene            <21787..>22351
                     /locus_tag="MRET_4068"
                     /note="MRES_16455"
                     /db_xref="GeneID:38740834"
     mRNA            join(<21787..22246,22275..>22351)
                     /locus_tag="MRET_4068"
                     /product="cytochrome b5"
                     /transcript_id="XM_027630695.1"
                     /db_xref="GeneID:38740834"
     CDS             join(21787..22246,22275..22351)
                     /locus_tag="MRET_4068"
                     /codon_start=1
                     /product="cytochrome b5"
                     /protein_id="XP_027486588.1"
                     /db_xref="GeneID:38740834"
                     /translation="MDEMAPPAIRAILSEDDDDHVPMFPSANSAQRHAVSGSAPSSRL
                     HPSGMNSLRAPVEPAPSQLEVPMRRQKVILEPGHSPLDWARLKTTTDLRGGVSTLLRV
                     TPSQLKQHNRLDDAWTAIQGKVYNMTPYLKFHPGGVDQLMRIAGRDGTRLFFATHPWV
                     NVDALIDSTMVGVFVPES"
     gene            <22514..>23221
                     /locus_tag="MRET_4069"
                     /note="MRES_16460"
                     /db_xref="GeneID:38740835"
     mRNA            <22514..>23221
                     /locus_tag="MRET_4069"
                     /product="glutathione S-transferase"
                     /transcript_id="XM_027630696.1"
                     /db_xref="GeneID:38740835"
     CDS             22514..23221
                     /locus_tag="MRET_4069"
                     /codon_start=1
                     /product="glutathione S-transferase"
                     /protein_id="XP_027486568.1"
                     /db_xref="GeneID:38740835"
                     /translation="MPHFSLYVLKGLWGPNPLKIGIMLEALGADYEVKFVEFGSSDKE
                     TGVKGADYLNLCENGRTPTLVDHKRNDFVIWESGAILDYLCSAYDSENKFHGKTPEER
                     AIVMQWLFFQVTGHSPVQGNLYFAKMYWKTAYGEDPTQVTLNRFKNELDRVFHVYEHR
                     LQRQASLNGEDKAFLALDRPTIADYSALGWLGMLPDVAGKLEIDMQKYGILNKYIERM
                     RNLPEAQAATRRVASGH"
     gene            complement(<23229..>25536)
                     /locus_tag="MRET_4070"
                     /note="MRES_16465"
                     /db_xref="GeneID:38740836"
     mRNA            complement(join(<23229..25297,25323..>25536))
                     /locus_tag="MRET_4070"
                     /product="glycoside hydrolase family 55 protein"
                     /transcript_id="XM_027630697.1"
                     /db_xref="GeneID:38740836"
     CDS             complement(join(23229..25297,25323..25536))
                     /locus_tag="MRET_4070"
                     /codon_start=1
                     /product="glycoside hydrolase family 55 protein"
                     /protein_id="XP_027486665.1"
                     /db_xref="GeneID:38740836"
                     /translation="MVDWLERVLTSGRAPYQTRDYAVYRNVHDYGAKGDGLNDDTNAI
                     NSAISDGPRCGPQADSTTTAPALVYFPPGIYRVSKPIVSLYLTHLLGDATERPCIKPY
                     AHFEGIAVIDENPYGFSGKNWYTPQNNFFRSISNFCIDLSEMPPEYGTGIHHQVSQAT
                     GLCNVHFEMRTDPSTQQRGILMENASGGCMSDLTFYGGRFGAWMGNQQFTVRNVRFSQ
                     CQTAICLHWNWAWTLMDVHIHDCHVGLEMVGMLPERQGVGSLILSDWYIAHTKHAVQL
                     EREGTGRLILDHVRVSHVQSIVHGPYQSLLSPRDSNDLVKYWLKAPASLVTAPTALRR
                     QETLDGPIYVGDMTPPERPACLVDEHGRWFGREKPSYATWSDVVNIQQYGVKGDGMSD
                     DTAAMQSLLNENVGRAVFVPYGVYVLHDTLNIPIGTFLVGEAQPIFLGTGPAFQDVQN
                     PRPVVRVGRPGDSGDLLLADLVFSTRGHTPGAIVMEWNVHERAQGSVAMFDAHIRIGG
                     FCGSEQELAQCPKQASLTDLPRAAFLSLHLTKSASGYFQNVWVWTADHELDQGTPEQL
                     NVLTDRGVLIESQGPVWMYGTASEHALLYQYSLHHAANVLLAMIQTESPYFQGHNFEP
                     ASKSVVSHPKYPDPDCAKRYARGPNVPDWTYDTVMEDRALGLHISHGTDIFVLGSGQY
                     SFFDSYGQRSLADHACQRRLCVLERDLSNVWLMNLASVGAQVILSVDGADYVMERPHR
                     EGFCSTLALCAISAKHIYVV"
     gene            <25653..>27419
                     /locus_tag="MRET_4071"
                     /note="MRES_16470"
                     /db_xref="GeneID:38740837"
     mRNA            join(<25653..26148,26188..>27419)
                     /locus_tag="MRET_4071"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630698.1"
                     /db_xref="GeneID:38740837"
     CDS             join(25653..26148,26188..27419)
                     /locus_tag="MRET_4071"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486666.1"
                     /db_xref="GeneID:38740837"
                     /translation="MSAWKVDVGPLLRYDTVDNQGVYHAFALLVTQHPAGSVPVNPPI
                     LQYVTTANQQPTGPPLQTKGLLLWVYNDQARKSHAFWRFKFEVRMLKVPQQVAYIIPG
                     ASELLDFFVPAHHQNFRWSVYSCSGFSASVDQEEYGGMDPMWNDMLREHANNPFHVMI
                     GGGDQIYNDKVAEIDIVKSNIRPKNMNSEEEEIVPPEIIAAIDRFLFANYLECFNSPA
                     MARAMARIPMVNMLDDHDLVDGFGTYPDDLMMSGVFSMIGSRGYFFYLLFQQFMNDEV
                     DGIINENTKNPNPSEIKSLIIGGPGCYIPFPTHSFLIWLGPKQHMLLLDCRAQRKLNQ
                     VCGTDTYERVHEALEAMPDTVRHLIIQLGVPISYPRMVSLENMLSNRFNPFVSIAKAF
                     MPAFTNNYNGQVELLDDLNDHWCAANHKKERNQLIERVQELSKSRKLRVSFVSGDVHA
                     AGCGVFQSYDGMDPSRDYRYSLAVITSAIVNAPPPPAVISIVNRLASKHHKSMNYAHT
                     RETMLPLFEVDLDEKASKNKYIMGARNWCAVDYDESTNEVVFSLHIEKKPGTGRVKVY
                     SMKTPPPLF"
     gene            complement(<27459..>28460)
                     /locus_tag="MRET_4072"
                     /db_xref="GeneID:38740838"
     mRNA            complement(<27459..>28460)
                     /locus_tag="MRET_4072"
                     /product="DUF159 domain protein"
                     /transcript_id="XM_027630699.1"
                     /db_xref="GeneID:38740838"
     CDS             complement(27459..28460)
                     /locus_tag="MRET_4072"
                     /codon_start=1
                     /product="DUF159 domain protein"
                     /protein_id="XP_027486667.1"
                     /db_xref="GeneID:38740838"
                     /translation="MCGRFACNLNKDELLTAVTDTIPANVGLGPSDSGTQFSPSYNIA
                     PNMQCPVFRKNLDSMDVMMETMKWGVSSKSLFHADNEVMLINARDDTVLKPGSIWHDM
                     MAERRCIVFCQGFYEWQKDDTVPGQTHAPKRIAHFVGMGKYGRGRRTIDGQSRQLMPM
                     AAFWTQQKGSDQNAFAIVTTQANKQLEFLHDRMPVILPDTCAISEWLGITSYEHVSKL
                     LTPYQGTLDCYKVPPEVGSVGTSNENYIYPLHARKDGILAMFEKAKLHTQRQKMAVED
                     NGTEEERKTLPSTPKKHVKPAQSPSSVMRAKTRESPRKRMKGTPSLETYWLKGESEG"
     gene            complement(<28622..>30640)
                     /locus_tag="MRET_4073"
                     /note="MRES_16475"
                     /db_xref="GeneID:38740839"
     mRNA            complement(<28622..>30640)
                     /locus_tag="MRET_4073"
                     /product="MFS sugar transporter"
                     /transcript_id="XM_027630700.1"
                     /db_xref="GeneID:38740839"
     CDS             complement(28622..30640)
                     /locus_tag="MRET_4073"
                     /codon_start=1
                     /product="MFS sugar transporter"
                     /protein_id="XP_027486668.1"
                     /db_xref="GeneID:38740839"
                     /translation="MDTLSEKPAGLAETDCDRKVKLNDHEDETDYKMHEAILAEAMED
                     SASPELSAEVRLRNPLLGYSPAQIEARVQDFVSNKGLEEYHELFLKGAFCAQAQSTGH
                     YDKVPYLTSEDHEVLAKEKTKKWHQPFILYWLAICCSAAAAIQGADESVINGAILFFP
                     NQFGLYKSDCDFYQEDAAGNCNGPLKTGDKFIDTNWTSADVEREMSKNNWLVGLISSA
                     PYICCAFLGCWLTEPLNAFLGRRGTIFLTSFISFATCVWQGVTDTWWHLFISRFFLGF
                     GIGPKSATVPVYAAECSPPLIRGALVMQWQTWTAFGIMLGNAASLVLFRVKDPANVSI
                     TGLNWRLMLGSACIPALLVMLQVFICPESPRWLMKKGKYGKALQSFLKLRNAPLLASR
                     DMFLAHCLIEEENKHAAEHGFQNVTHLFTVPRNFRALVPTSILMFGQQFCGINVIAYY
                     SSSIIKEVGNATDLDSLLGSWGFGMLNFLFAIPAWYTIDTFGRRNLLLSTLPFMAIML
                     LIAGFAFWIDKEKTHARMGVVLTGIYVYGCLYSPGFGPVPLTYGAEAFPIRIREAGMA
                     LSTAVLWFFNAVLSITWFRMKQSFKPQGAFGFYAAWCVVLWILIYFLMPETKALTLEE
                     LDIVFSIPTRKFATHQLKQIPYFIQRYILRRNVRKHPLQAMNEGVGMA"
     gene            <30950..>31729
                     /locus_tag="MRET_4074"
                     /db_xref="GeneID:38740840"
     mRNA            <30950..>31729
                     /locus_tag="MRET_4074"
                     /product="23S rRNA (uridine2552-2'-O)-methyltransferase"
                     /transcript_id="XM_027630701.1"
                     /db_xref="GeneID:38740840"
     CDS             30950..31729
                     /locus_tag="MRET_4074"
                     /codon_start=1
                     /product="23S rRNA (uridine2552-2'-O)-methyltransferase"
                     /protein_id="XP_027486669.1"
                     /db_xref="GeneID:38740840"
                     /translation="MRRFFVRTEPLLFKCTPLHVSYVTSKTSWHYLPIRHASNRSKSS
                     SKYLARQRHDEFVRLKKADGTGYVSRSAYKLQQLSQKYPFLQPGRAIVDLGAAPGGWS
                     QAVVRQCPNSQVYALDLLPLQISEPNVVFLRGDFMNQQVRSDLTSLVSRKVDVVLSDM
                     MANTSGNAVRDAQASLDLCTAAFDFCLSMLQESSTVYKNPGDASVLPTFVCKYFMSPE
                     ADEFRKVLKQHFQYVRSEKMKASRSESREQYWVCIGFRKPL"
     gene            complement(<31724..>32876)
                     /locus_tag="MRET_4075"
                     /db_xref="GeneID:38740841"
     mRNA            complement(join(<31724..32127,32159..>32876))
                     /locus_tag="MRET_4075"
                     /product="protein-lysine N-methyltransferase EEF2KMT"
                     /transcript_id="XM_027630702.1"
                     /db_xref="GeneID:38740841"
     CDS             complement(join(31724..32127,32159..32876))
                     /locus_tag="MRET_4075"
                     /codon_start=1
                     /product="protein-lysine N-methyltransferase EEF2KMT"
                     /protein_id="XP_027486694.1"
                     /db_xref="GeneID:38740841"
                     /translation="MDAEASRKAQGQLYIQYQARLSPRSSLFQWPENLDLLAAQVGLD
                     TVLFNGKETHPSNDEYDRVFLKQLVKRIEQAIEACTDDQAASLDTEKQDLTVDDAILE
                     RYMRLVSMPETPSIMGTRVPSPLYVHHYFPITTAKHHHDILGPCESVTFRQEGTAISQ
                     GTTGLTTWEASLRLAAHVVASPHVWQKSDACILELGSGAGFLGLVCARLFDTLPHTDA
                     KLYLTDLEGQVLDRLRETAQLNNATRAHIEALDWNDISTGDRDALERLRNMRPTCVLA
                     ADVVYDPTLISPFVDTLWVALQKRAHSGPQPFALVASTVRNPDTYGQFLRTLESRQLR
                     WKMMDLKQTTWPNLDLVLFPSVHNQKLEGVVSILHIEVS"
     gene            <32960..>35176
                     /locus_tag="MRET_4076"
                     /note="MRES_16480"
                     /db_xref="GeneID:38740842"
     mRNA            <32960..>35176
                     /locus_tag="MRET_4076"
                     /product="DnaJ subfamily A member 5"
                     /transcript_id="XM_027630703.1"
                     /db_xref="GeneID:38740842"
     CDS             32960..35176
                     /locus_tag="MRET_4076"
                     /codon_start=1
                     /product="DnaJ subfamily A member 5"
                     /protein_id="XP_027486670.1"
                     /db_xref="GeneID:38740842"
                     /translation="MGARQSSEAAEDDNGFIDYYELLEVELNDSADVIRKAYRRLALR
                     LHPDKNPGREEEANKKFIRLQEAYDVLIDDHERAWYDKNRDRLMYGVEEDEQEEDVDA
                     KCRYFKSGGEAPKATSMAPGIGVPHLLRFHSPSLTKDTSDSNTSFYGTFRRLFERLAD
                     EDRIAAPYPGEDRTSDMADPWRDDAAMYPSFGHPDTPYVPTLPSNELSCVRAFYQFWS
                     QFSSRKSFAWKDLHDTRQAKDRRLKRILEKENKRARDSARREYNEAIHGLVTFIRRRD
                     PRVKAYHAQQQSKTASKPNEEWLRAEALRIQNEKRAQAASFQAQSWQITSEPEDDDFV
                     DDFGSGSSMDDEVSDEPFWDCVACHKRFLSEAAWSNHERSKKHKKEVERLKREMLEED
                     LELAEEIDEMEPSMTELNIHDTVEENVSASRKKDKKKKKQQMKMQAAVEEPDPPTPPD
                     FAFSKEKERMENLGKMLPHLAQLPVYQERPEGSFDIFGYGSILFKPPPHVISYTPGYI
                     QGYVRRFAQHSEDHRGTPERPGRVVTLVSAEHWHSLPNADEAPEGDIVWGISYTIDPV
                     HADEVRAYLDHREKNGYTAMWEPIYGFHEDDPQTPRVLVPEALVYVGLPENPAFVGPQ
                     PLDELAERIFLSQGPSGRNDEYLFRLADAVRALTPESADHHLFTLEQKVRTLAENTKG
                     TESSKSRRKTRNKVPPGTEICNVCKSTFPSRSKLFAHVREKDHAMAGPVMKSRKNK"
     gene            complement(<35193..>36554)
                     /locus_tag="MRET_4077"
                     /db_xref="GeneID:38740843"
     mRNA            complement(<35193..>36554)
                     /locus_tag="MRET_4077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630704.1"
                     /db_xref="GeneID:38740843"
     CDS             complement(35193..36554)
                     /locus_tag="MRET_4077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486651.1"
                     /db_xref="GeneID:38740843"
                     /translation="MHQLCTAWFKRSTASCLRTATATYATSHGAKSKNAPPQSVINFR
                     NMQRRRGGAFSKNVRVHRKSRHSPEDQLRQHMFETSHKIKELSSTEDNPMQLFKGAES
                     ILHEGMQGWRALARSMRAKRILDGHPTPQLSAPAWNQVMLLAINAESPTAAWHLFCDM
                     KKEGVRPTPRTFAGFFQALTRMIRAHKLETISSDVWKERLDKLYLGLTQLHALMGEGM
                     LPDTDGAGTSDAHFMDKDISSLATAYRMYISLQYALGRYQSAMEVFDTVCPDPYRTET
                     LLEEHDHLLRSHFATVETYTSMVRDLGICRAMPMNLRQQKIRQIWRRWQDEMVLTKRR
                     KKAQEWLDATAIKTLVWTLSIGKPATHVRDVCALLGTYMGIPFPPTQGMTDFMPVSKP
                     VRFTDPRLLVDVMVFFDERKMYQHVICCFNFAEQNKHGSVDPQRIPEALTLVQKAHQC
                     LMT"
     gene            <36680..>37214
                     /locus_tag="MRET_4078"
                     /db_xref="GeneID:38740844"
     mRNA            join(<36680..36997,37035..37094,37125..>37214)
                     /locus_tag="MRET_4078"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 8"
                     /transcript_id="XM_027630705.1"
                     /db_xref="GeneID:38740844"
     CDS             join(36680..36997,37035..37094,37125..37214)
                     /locus_tag="MRET_4078"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 8"
                     /protein_id="XP_027486664.1"
                     /db_xref="GeneID:38740844"
                     /translation="MATHREAKNPTFSYVEPMPWPKDVPKVDEVGTTSAPLKSIAFFF
                     GQFCKDYTEDFMLCKNEDRNPEHCLKEGRRVTRCAQDLIQKIGEKCGSEWDAHWQCLE
                     SNNQEYMPCRKLERPLNKCVLEQLNLVKKIPGSPEGQPQIHEKTNPVISRLQK"
     gene            complement(<37264..>37705)
                     /locus_tag="MRET_4079"
                     /db_xref="GeneID:38740845"
     mRNA            complement(join(<37264..37674,37703..>37705))
                     /locus_tag="MRET_4079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630706.1"
                     /db_xref="GeneID:38740845"
     CDS             complement(join(37264..37674,37703..37705))
                     /locus_tag="MRET_4079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486500.1"
                     /db_xref="GeneID:38740845"
                     /translation="MLDNEVTVIFKFSTTALYAQIVPTEVSVRELKAHLLHVLASTKQ
                     PEDQVLHRPFEEATPDDVELYHKKDDTYTLFASASTATHRASDGTPLCSSCQLEDNTV
                     LYVGFRAPNQDTPGEPVVREPSLDDIAEEEDVEAP"
     gene            complement(<37873..>40470)
                     /locus_tag="MRET_4080"
                     /note="MRES_16485"
                     /db_xref="GeneID:38740846"
     mRNA            complement(<37873..>40470)
                     /locus_tag="MRET_4080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630707.1"
                     /db_xref="GeneID:38740846"
     CDS             complement(37873..40470)
                     /locus_tag="MRET_4080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486689.1"
                     /db_xref="GeneID:38740846"
                     /translation="MGGQRRSPPEDRRHAFVAAVRRPSEGTPISEGRVRTHSRTKHAR
                     DPVSGIHHPSQSRRREVDDEEEAFRVKPPDYLNHPRFMRAVNHFDACSRPRVSRPNST
                     TPSPQQKAVAPPIRDVDEESLAPSLISCEEVEHDVELTDVQQSVYAYFASRHLSDHAC
                     TRPVQPFFVGADADANGTSAAYALYGGPDSFHNSAQFIGEADSMPAHMTRRTPLGSAA
                     LCRRAELRGIITALGMLMQSPHRPTCAHLCVSSAYVAKAWGVWIPRWETHGWPGEVVD
                     NHAQRSKNRWTQRMQLMSLDTSSSDSYSRKSDSPDNGSPTFRRTHRRLVDEDLLRELA
                     ALRTRLADMDARGGPSVYLYQIERKDNPADALAIHCVVSESPHLGSDVLRGSPPPVQG
                     YQPLRVVSPPRRASQAHAWKNASPLPDDVFVNSPLSHKLWKRAPKTPALNRTTSPNAR
                     AVSPLIGASPSRMTHASPTLSNTVSRASPVPSLGRSSDPFTARANSPSHLFPTSPASR
                     SISSSQSSRIPLQAPMNRVRPDSPPPMERVSLSPSDVEVYHNHFELSDHPQVEPRGKK
                     LTADALREHDRKTGFHIPIWRRGRRAGSSVKSESVHSFIQRITPKALKKNKSQPSSPE
                     SFFSTPRPVLRTSASQPALRKAADASQFARHADKMPSPTLKFEAEPTATLNLRKQIEE
                     VAEREERLARQEVELDRQRLVLEQKSPVLRAPAKSATLFNNSKSDDEEDFGDYVHKIE
                     DHDWFWESNFRRAPRVQERPGEQEQRPNASPSSIPREEHGESRAPRARHVSPVLRTRA
                     SKWQMLEEARGRNVLPHAPKQDALGLYVDGDGFGSAATLSKSSPYFDNLRKKRLQYPL
                     SDSEDSLSS"
     gene            complement(<40584..>42192)
                     /locus_tag="MRET_4081"
                     /note="MRES_16490"
                     /db_xref="GeneID:38740847"
     mRNA            complement(join(<40584..42038,42067..>42192))
                     /locus_tag="MRET_4081"
                     /product="succinate-semialdehyde
                     dehydrogenase/glutarate-semialdehyde dehydrogenase"
                     /transcript_id="XM_027630708.1"
                     /db_xref="GeneID:38740847"
     CDS             complement(join(40584..42038,42067..42192))
                     /locus_tag="MRET_4081"
                     /codon_start=1
                     /product="succinate-semialdehyde
                     dehydrogenase/glutarate-semialdehyde dehydrogenase"
                     /protein_id="XP_027486524.1"
                     /db_xref="GeneID:38740847"
                     /translation="MITCIVRRIAPPCRAFSTSTNVWKNFPNMPKGIIRSGKSSLGLA
                     NPVLVHEKSYIDGKWVNALNGQTQPVYNKATNEVLAEVVDQGRQDTEMAIKAAEEAFQ
                     TWSKTTPHERHNYLLALFAKIQENAEDFARLIVAENGKAISDARGEVNYANSYVQWFA
                     EEALRIQGYTTPSPNPSNRTTVIRQPVGVAALIAPWNFPLAMITRKVAPALAAGCTTV
                     VKAPHEAPLSALALAYLAEEAGIPKGVINVLVSSRGKNESEMGKALCESTLVDKLSFT
                     GSTRVGKILMGQSVNTLKKFSMELGGNAPFIVFDDADVDAAVSNAVACKFRCGGQTCI
                     SANRIYVHEQVHDEFVSKFVERVKKLRVGYGLDENINIGPLVNEASQDKAESHVRAMQ
                     KVGSEVVLGGDKGEGLFFEPTVVLVKPGERVPTDDEETFGPVAAIYKFQSEEQVLRLA
                     NDVRVGLAGYFFSENVHRCYRVAEALHVGMVGINTGMISSSTMPFGGVMESGFGREGG
                     PTGIHEYLYEKALSFGGI"
     gene            complement(<42286..>43605)
                     /locus_tag="MRET_4082"
                     /db_xref="GeneID:38740848"
     mRNA            complement(<42286..>43605)
                     /locus_tag="MRET_4082"
                     /product="PA domain protein"
                     /transcript_id="XM_027630709.1"
                     /db_xref="GeneID:38740848"
     CDS             complement(42286..43605)
                     /locus_tag="MRET_4082"
                     /codon_start=1
                     /product="PA domain protein"
                     /protein_id="XP_027486691.1"
                     /db_xref="GeneID:38740848"
                     /translation="MHLNPILALFLSLVPLALALEHAGVDMDLYTSVDSDVRAGKSHF
                     RAPPRENLSDDMRRRVEWPGNKILIPSAHQSYFTRPAAFGLRRVEDEGLWGTLIPIQA
                     FLETNNNYGCIPKASGVHLANKVHWEKSIDQTVKGKPKNKHPPSDWVALMERGVCSFE
                     QKVRLAQSMGAKAVVVGDYMEQDYEDDPMNIRVWGDISQQDASIPLVMFPDGDASDIS
                     IPSCFVIRSSYLELMEFASSGVRVGLYLDASLDGSMWEEVGLLIFLLPSIFALSAILL
                     QNAREAVKRFRERASVYMIKSLPCYRWHSNGTWDRLLPSEIPDQQPRSYALWSMHQMD
                     MVVLYMKRMFSRGSAEQELFIPDAEGTIYDTASHRQSGGVISITNASNPRWYVQDDCP
                     ICLSNFEDGDRVRVLPCGHIFHQDEIDDWLTGTRRLCPTCKQDILIR"
     gene            complement(<43788..>45191)
                     /locus_tag="MRET_4083"
                     /db_xref="GeneID:38740849"
     mRNA            complement(join(<43788..44971,45001..45049,45090..>45191))
                     /locus_tag="MRET_4083"
                     /product="Sec14 cytosolic factor"
                     /transcript_id="XM_027630710.1"
                     /db_xref="GeneID:38740849"
     CDS             complement(join(43788..44971,45001..45049,45090..45191))
                     /locus_tag="MRET_4083"
                     /codon_start=1
                     /product="Sec14 cytosolic factor"
                     /protein_id="XP_027486525.1"
                     /db_xref="GeneID:38740849"
                     /translation="MSEPMSSNQQQALPGRPGNLDPGQQHKLSKMRDQLKQHGFYAPE
                     RHDDAYLCRFMRARKWDFEAAKSMLFESETWRCEFKVDELYENFSFPEKEAVNELYPK
                     FYHKTDKDGRPLYIEQLGKLDLNKLFNVTTPERLIQELVYEYEKCLHERLPVCSAINQ
                     NLIETSCTVMDLKNVGIGQFWKVSSYVQQASKIGQYYYPETMGRFYIINAPYIFTTVW
                     TVVKAWLDPVTREKIQILGSNYIGELAKQIPMENIPSLIGGKCQCQGGCMMSDAGPWN
                     TPEGEEIIRTRNEEKRKIKNEYLGMGGKEPPARVEAASHDQSSTALASVNESKDAKEQ
                     KESNNQAEDHAPMVSASAALSKKKVSNSNGVDESSESKKQEDDAQSTKQANSSGEIAS
                     HDILNESVATARISSKDSEPHAAPSLSEPGSDGLAPPTTAQPLSNAIASTKH"
     gene            <45425..>46011
                     /locus_tag="MRET_4084"
                     /db_xref="GeneID:38740850"
     mRNA            join(<45425..45445,45484..45553,45582..45669,45702..45808,
                     45836..>46011)
                     /locus_tag="MRET_4084"
                     /product="N-alpha-acetyltransferase 10/11"
                     /transcript_id="XM_027630711.1"
                     /db_xref="GeneID:38740850"
     CDS             join(45425..45445,45484..45553,45582..45669,45702..45808,
                     45836..46011)
                     /locus_tag="MRET_4084"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 10/11"
                     /protein_id="XP_027486683.1"
                     /db_xref="GeneID:38740850"
                     /translation="MNIRQATMDDMMGMQNCNLHNLPENYTMRYYFYHALTWPQLSYV
                     AEDENGNIVGYILGKMDEDPEDGVPAGHVTSISVLRSHRRLGLANKLMKLSQTAMRDV
                     FGANHVSLHVRESNRAAISLYTQALGFQVQGTEASYYADGENALSMRLLLK"
     gene            complement(<46177..>47892)
                     /locus_tag="MRET_4085"
                     /db_xref="GeneID:38740851"
     mRNA            complement(<46177..>47892)
                     /locus_tag="MRET_4085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630712.1"
                     /db_xref="GeneID:38740851"
     CDS             complement(46177..47892)
                     /locus_tag="MRET_4085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486521.1"
                     /db_xref="GeneID:38740851"
                     /translation="MTLGHLLRGIIALQACLFLFFLISGSKANDHVMVRRHLEKKEFY
                     KRQYAYDGDVQGNQNIMSEYAERAFEASKNHDTNALRSVINDVLNTPNLNQPTEGTWA
                     KASLGQIDTQYGGDVPQVGWYNGFPTNPTPNVDPAQVNGDLAWKGLPSTLDCKVEQMS
                     VAPNSPAFLLDDTSLNVTDEKSPAGNPIVQPFYVSHPNTYDRDQVKRVIITLPGKPRD
                     AWNYVNLHFNAREFLIHNRTLPKDEAILAAPVFLNQNDKEAGAVKENYLYFKNSHWAN
                     GGASHGPEMSHSVTSYRVLDLMAQHFIKTFPNLNQIVFAGHSMGAQAVQRYAVVKNPK
                     WYDRALRFWIGNPGSWAWITSDRPNNNPSNLDGESCEDKIDAWPFGIGDADAMPKYVK
                     DSGNPDLIRNRFLKRNVGYSLGLLDNGQGNTQCAAQYQGYSHLQRGSYFMKMLCELPG
                     GFPKTHTLAYIAGVSHQDYEMIAATETTDFVFMQGRDAPPISSLRPHRSHHHRPHPRP
                     PPSKGSNPYDWEGPHYRNAAWGIIAGIAAVLIIGFFGCHYLFKANANDWDRDYWEYDS
                     KRRLL"
     gene            complement(<48807..>50978)
                     /locus_tag="MRET_4086"
                     /note="MRES_16495"
                     /db_xref="GeneID:38740852"
     mRNA            complement(join(<48807..50667,50696..50727,50760..>50978))
                     /locus_tag="MRET_4086"
                     /product="nucleolar GTP-binding protein"
                     /transcript_id="XM_027630713.1"
                     /db_xref="GeneID:38740852"
     CDS             complement(join(48807..50667,50696..50727,50760..50978))
                     /locus_tag="MRET_4086"
                     /codon_start=1
                     /product="nucleolar GTP-binding protein"
                     /protein_id="XP_027486523.1"
                     /db_xref="GeneID:38740852"
                     /translation="MSATLKASIAPVPTANDFLDIVLSKTQRKTPTVIHPGYKITRIR
                     AFYMRKVMFTKDAFTEKLQAILTEFPVLENMHPFTSSLMNVLYDKNHYKLALGQINTA
                     RHLIEQVAKDYVRLIKFGDSLFRCKQLKRAALGRMATIMRRNKDPLAYLEQVRQHISR
                     LPAIDPNTRTLVVCGYPNVGKSSFLNKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQ
                     VIDTPGILDHPLEEMNTIEMQAITALAHLRSAVLYFMDLSEQCGYSVEAQVLLFNSIK
                     PLFNNKPTFLVINKIDAAKLEDLDEDKANMVRSVIEESHGKIKMIEISTFTDHGIMDL
                     KQQACDALLSSRVDTKIRGPKADSILNRLHVATPLKRDDIERAPYIPESVRDGSRKKY
                     DPEDPERRITERDIQERHGGAGVHNIDMKKNYILANDEWKYDKIPEIYEGKNVADFID
                     PDILTSLEKLEREEEKLEADGFYEESDEELDDEDAEIRKVAQAIQQRKDKAKSLAQAK
                     KALQTRPQIPRKLQHRSLSQMTENMRASGIDPSNIEMRAEILAKAKGLIGKRKTRETQ
                     NEDASMDEDDDGEAENDETMSVDDTPEPASSRKKIRAAPTKQGVSLTRGKTSTTATTN
                     KSGGAISARAGAARIPARNRQAEGLRSKAQEHKARELHSMAIRDRNREARAGESDRRI
                     QASKPKWLYTGKRGLGTSRSR"
     gene            <51686..>54169
                     /locus_tag="MRET_4087"
                     /note="MRES_16500"
                     /db_xref="GeneID:38740853"
     mRNA            <51686..>54169
                     /locus_tag="MRET_4087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630714.1"
                     /db_xref="GeneID:38740853"
     CDS             51686..54169
                     /locus_tag="MRET_4087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486522.1"
                     /db_xref="GeneID:38740853"
                     /translation="MATNSAVSTLAASPPNPDMISQRPRDSALVSRESTGYSSANEND
                     DDKNSDLGEVVSTDDYNARTQSSAASSQATESDDSDMARKIEAAREDESLIGSDDSGD
                     DTYLFNEEQYMIEDETKRQNNTVRKDVSKNPSAQPDVFENEDDFWDSFARTDGWTDDD
                     DIVTNELFKPQRGFASTPEPLFSDFYGSSDETDRPGSNEDGDDEDALTTDEDITSLDD
                     GSSTISDVESLSVPLIAHVGTAQDMDGHGSQQDMTNKEELGEKALKNAIPLLVIEDLD
                     GRLIYARAGDGEAVFGSDGEFEFEGESDEQSSDDDMVHGDSPKVGIRSHAHEPPASEF
                     DASGADDGDTTDELPDSDMPYPRLLVGSIAPRGGRNARRAREIAARSRHSSPRVSSPA
                     PRSSAVCTTPLRNGPSSLSNALSLHNESNDQGVDPSQTSEDEGSSEKTADHASPSKES
                     QLSLSEPPKPVMGQFMPAYSKSIHRAVIDGSHRTPSPFSTLHNMQRGLRQKRSRQHPN
                     REFLDHAQNNGPLFLRKRKHRDISDSSVFKGVQPCLEQSNDGLDSSPEAQPQCPTDIM
                     DIGDVLDEGLLYPGSSDDSSIDDSTSKARHEPRRSKSSQNGTYDRAIARWTRIPMGAF
                     RSAQENGTPSSVPPISNAYLTHQRPGGTFLLTQALRDPRQALGSSRSPANGISHFGRT
                     PFRRSVSMLDDPGSPSASPLHRTLADHVISDPANRPDKGRHEKHRLQRLSNKFGEHAV
                     VGGKFLISPVLRPVKHRERNTSSNNVDATSPISALGDIAPSDHGYHTSGTPRKVTKRE
                     KRERMARREASKRHDTASPQPHDSALHMA"
     gene            <54933..>56312
                     /locus_tag="MRET_4088"
                     /db_xref="GeneID:38740854"
     mRNA            <54933..>56312
                     /locus_tag="MRET_4088"
                     /product="zinc finger protein"
                     /transcript_id="XM_027630715.1"
                     /db_xref="GeneID:38740854"
     CDS             54933..56312
                     /locus_tag="MRET_4088"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027486490.1"
                     /db_xref="GeneID:38740854"
                     /translation="METGALYDSNIDPVVKRYQENPHHDVQITPFSSQQGQGASGIDS
                     VTTSDDQHIGKDKETQITDNANYPKKRRYSTKEPRFSINVDGKRRYPCLFPDCDKTFS
                     TSGHLSRHNRIHTGEKPYNCTYPGCDAHFSRYDNSLQHYRTHFFSATSKKGHRKSKEL
                     SHVSLSNDNRENMEYTRVTDPTTSREDSCDKVLVSQTPLSGRNGKAASQISLGHNARD
                     SLKASVCSHHMQDESSKKYAAMSNAVNSSEKFNGDASQECLSDRFSDAPPRVVSSPNK
                     MSSPDAISSVPNINDRTPILGPGALKNQATVHPPQKWNKRTSHHHDSCINDFDSASSN
                     SESIPHLNQPLHSLTSTTYIQDPLYTPKSIDTFSSASFPDQRINPVYSRKRKNASSLL
                     SLDLSRCDSAYSLCKYSLSSGTSSLTSSASTRSQPASSTMVSEMGYISPEPTYIVHDQ
                     AKDGVKNAR"
     gene            <56670..>58313
                     /locus_tag="MRET_4089"
                     /note="MRES_16505"
                     /db_xref="GeneID:38740855"
     mRNA            <56670..>58313
                     /locus_tag="MRET_4089"
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /transcript_id="XM_027630716.1"
                     /db_xref="GeneID:38740855"
     CDS             56670..58313
                     /locus_tag="MRET_4089"
                     /codon_start=1
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="XP_027486526.1"
                     /db_xref="GeneID:38740855"
                     /translation="MSVAPTLGVYKLPTIDNEPMRNYEPNSKDRQELQKAVDELLACN
                     PFEIPVIIDGQEFRSGKLAKQVNPGDHARVVCYYHEADERMVSIAIEGALKAKKQWMN
                     MPWSERAAISMKAADLIAHKYRYQLLAATMVGQGKNVWQAEIDAGAEICDFLRFGVKY
                     VDDMYQIQPPRNSPGVWNRTEYRPLEGFVLAISPFNFTAIAGNLVMTPAMVGNVVVWK
                     PSPMAIYSNYLVYKILEEAGVPPGVIQFVPGPAEPIAKAAMDHRDFGGLHFTGSTFVF
                     KALWKQISSNLDVYRGYPRIVGETGGKNFHFVHKSANQDVVVTQCIRAAFEYQGQKCS
                     ALSRLYVPKSMWQGGLKEKLIERTMSLNVGPVQDFKNFVGPVIAKHSFDKIMGLIEEA
                     KAEGGKVLVGGYGDDTKGYYVQPTIIETHDPRSVTMVKEIFGPVITVFAYPDDEVDET
                     CALVDSTTEYALTGSIFASERNALLHISNLLRNASGMMYYNDKCTGAVVGQQPFGGGR
                     ASGTNDKAGSMNIFFRFVSPRTIKESMLDPATHLYPSNM"
     gene            complement(<58364..>59077)
                     /locus_tag="MRET_4090"
                     /note="MRES_16510"
                     /db_xref="GeneID:38740856"
     mRNA            complement(join(<58364..58862,58889..58986,59015..>59077))
                     /locus_tag="MRET_4090"
                     /product="trafficking protein particle complex subunit 3"
                     /transcript_id="XM_027630717.1"
                     /db_xref="GeneID:38740856"
     CDS             complement(join(58364..58862,58889..58986,59015..59077))
                     /locus_tag="MRET_4090"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 3"
                     /protein_id="XP_027486559.1"
                     /db_xref="GeneID:38740856"
                     /translation="MSTRQYKSLGEELWRQNPSKVNSELFSLSYGALVVQLVKDYEDY
                     AQVNVQLEKMGYNIGTRLIEDFLARSNLPRCTDVREMAEVISKVGFKMFLNITPAVSF
                     QNVSSAASPSYTEASMPKSKVSTESAVAPETRAAPQEFTLQFAENPLAEFVALPEDAL
                     QGGLWYSNVLTGVLRGALEMVQIQAECTFVTDVLRGDETTEIRVKLIRFLDEGAPPAD
                     D"
     gene            <59829..>63503
                     /locus_tag="MRET_4091"
                     /note="MRES_16515"
                     /db_xref="GeneID:38740857"
     mRNA            <59829..>63503
                     /locus_tag="MRET_4091"
                     /product="axial budding pattern protein 2"
                     /transcript_id="XM_027630718.1"
                     /db_xref="GeneID:38740857"
     CDS             59829..63503
                     /locus_tag="MRET_4091"
                     /codon_start=1
                     /product="axial budding pattern protein 2"
                     /protein_id="XP_027486560.1"
                     /db_xref="GeneID:38740857"
                     /translation="MHRETLSRKFQVLAATISFLFVLVHHNYVFADVRVDLELADQLP
                     PLAHADNKYHWQFSSETFNTDETGDLTYEIKGLPGWAHFDAEERRITGNPSLQGKKDA
                     VNDVTVTARDSDSEVSSTFQLTTISAPPPKLSVPLQEQLPQAASMGSGNMLANKVLHM
                     PLGWSFSIGFLGDTYLLPDNDRVYYSSRLVGGKPLPDWLRFSPDEITFSGIAPTEAGK
                     NGTLFDIELIASNRKNAGGPSSTFSLLLGQGFVTLNNTAAALPLGNLTEGEAFQYHIS
                     PNLFLLDGFSQSPQDFKFKLDAHAPKWLRLDQDSHNLIGKAPVLKDHTQAQQTSFQLH
                     VSHPKAFDTDVNVTLDVFPSPFKQQVLPNVTVQTGKDFQISLEKYMNDPKSGVNVTFE
                     SSMLRRSMHFYRSQLRHKLLRRASPSWIHYDEKSYSLVGQAPDQEKNVTVHVSATSPV
                     KDAPVSPVSKTFQLSVLNTTHVTPTEPGQHHSGLSGGEKGAIAGSILGAALLALLGAS
                     GYWAWKRSENKELDSKTPASTLGNDTSMFEMPSANEAHLSSQPTNLAGLGADAHMPSV
                     PEAASMSGVAGGGMATGAFAGAAGVGAAPFHSPHTAETAHILPTEQPYASTQESEVAS
                     SRQDSSPTSGHRGVTQELPYQEPEWQREDDSIVVTPFLAQSTWQPPSFTQIWATSSKE
                     QRNMDSFAYPEEETSPSPGPIRQPSMSSMPRGPTSTTLRTGRREASHTSMQPPRDASL
                     SQALIQYKSTSNNAPLMEEKDSVDTARSGSSPPALSSHARDASFGSDPDTHTNLKPMD
                     IPASISKQSQESWEENLWYDKPTPPSKRTSAASARTQGSQVPDKEVGAGHVSTGPSEP
                     LKTAERAHTIKRAKSTTSSTKSPTTSPPLDSSAWESAPQLAPIATSVVRSPIVPGLGD
                     PPQLSVPLRVGQMSPLDTFSELPTQPMQVRETKHVPSYTPHLEAGAFDRRSLTLEPEQ
                     LESAGIYDDADEPVLDPFADYDQYPDGTILFQGRPSTSPVAETESTDHLHDYLTTEGG
                     MYSIMEDDESAVDEGAAEAVADWSQPPRSSTLASLHMARARSVTFTPAKPPRLQLASC
                     RPGQLVSLPLLTSDASFPRHLADAIHEASSPAQYTVQLYAPTRPDLHGTWPSWLEWLE
                     WEAASQELTGTVPESWPSELRLPLQLPIHILLSNGAQILAESGVSRRNMPEPGSPFLV
                     ARILLTILPAAEANSPRPVS"
     gene            complement(<63556..>65226)
                     /locus_tag="MRET_4092"
                     /note="MRES_16520"
                     /db_xref="GeneID:38740858"
     mRNA            complement(<63556..>65226)
                     /locus_tag="MRET_4092"
                     /product="nucleoporin GLE1"
                     /transcript_id="XM_027630719.1"
                     /db_xref="GeneID:38740858"
     CDS             complement(63556..65226)
                     /locus_tag="MRET_4092"
                     /codon_start=1
                     /product="nucleoporin GLE1"
                     /protein_id="XP_027486557.1"
                     /db_xref="GeneID:38740858"
                     /translation="MVMATGRVSHIVHPRPTGRYVYESSSEEDEYDGGARYVSMDALA
                     SDDDSDSEWDAPDRATRQSMAHIRLANELDPWERWENVCEKRAWERVRRARTLEPSVR
                     ASAPTYQQDTNVDEVQNMLARFQIQQRAVEQKEREGFEKRNAKLWEGIELAIRQAELR
                     AADEAKQLAEARKKQEEAEVKAKLARDAELARIESEKKEQEAKKREEEAKVRAQAEQN
                     EKERAANVYRGGSHVWETAQTEYAHWQERMKYVKQNILPNVAQRSDWRKQCFAAKRAI
                     TPKIGQLTNSSTEIARITAAISDVLQQARDVPDPDAATCLYFWMLNHLAKCLIRQAEQ
                     EVAARQQTAFPLARLIMGLQLRGHAAVGDVLMARLVKKCPWVLAYLPNRGGEDDASYR
                     KRLGFKTVDEPMQTYSARIAGISALYFACLQTNLESVAACVALPPGVSVRDAAQHIPD
                     ALRPGRLWTWQIRSMTPPLTEQRLVMPLWCTFLEMAGPVVLQRYKRQQAKILTLLLQE
                     GVQNNRLGVQEADDTQKAARVRLTLLLDTWSAKQSFGEHASPGRDMDT"
     gene            <65325..>66526
                     /locus_tag="MRET_4093"
                     /db_xref="GeneID:38740859"
     mRNA            join(<65325..66187,66215..66377,66404..>66526)
                     /locus_tag="MRET_4093"
                     /product="N-glycosylase/DNA lyase"
                     /transcript_id="XM_027630720.1"
                     /db_xref="GeneID:38740859"
     CDS             join(65325..66187,66215..66377,66404..66526)
                     /locus_tag="MRET_4093"
                     /codon_start=1
                     /product="N-glycosylase/DNA lyase"
                     /protein_id="XP_027486558.1"
                     /db_xref="GeneID:38740859"
                     /translation="MGVGRVPAGYQRLPLSYAGQVALPLTIAHQCGQVFRWRQVAWLD
                     PVSDEIEAEWSLCLANRVILLRHDAVTNALLYRILYPTEKKEHDTESWLRDYFNLDVP
                     LDAWFQEWCARDPIFAKHANRFNGTTILRQDPWECLCAFICSSNNNIPRISQMVHKLC
                     EHFSEPLLSHTYPEGARLCTTFHPKKQDFSDVADKPLTITYRPFPPPTTLAQPDVESK
                     LRALGFGYRAKFLTRTAQALCEKVQCGSDAKPADINEAVYKHLLSLRSQTYEDARSEL
                     MTLPGIGPKVADCILLMSLDQASSIPVDRHVFNFADRWYHIRSKRYEDVAEKLRAIWG
                     ERAGWAHTVLFYADLRSLEQYQPVLQDHAPDAKLTGIKRARSSSPLCT"
     gene            <66609..>68889
                     /locus_tag="MRET_4094"
                     /note="MRES_16525"
                     /db_xref="GeneID:38740860"
     mRNA            join(<66609..68821,68847..>68889)
                     /locus_tag="MRET_4094"
                     /product="SNF2 family helicase ATPase"
                     /transcript_id="XM_027630721.1"
                     /db_xref="GeneID:38740860"
     CDS             join(66609..68821,68847..68889)
                     /locus_tag="MRET_4094"
                     /codon_start=1
                     /product="SNF2 family helicase ATPase"
                     /protein_id="XP_027486555.1"
                     /db_xref="GeneID:38740860"
                     /translation="MEAMRQRLLAQQLESQSPSPKQRKDKMEPGASTPTDSNKNRPVI
                     QPWRSEPRVKMMPFKAPTPVGTPEKSSQGSGTSLSTPTKAALMRRGFPASPGWPQTPN
                     KSMSSAFGSPAGSLSGTPLDSKHVPTAEREKQLRDMLEGIVSVAEKVDMNQSRVPGMQ
                     CTLLPHQVQGVEWMKKREQGKGKGGILADDMGLGKTIQTLALVLQHRCIDDLYSGQQE
                     EDLDMNDDLIGLTRKSVFRSRTRTTLIVAPVAVMEQWQREALEKSRHKLSVYIHHGPR
                     RTTNVDELKKADIVITSYATAANEYEQYLKATESESSLPSTRANKQLREASANDLDDS
                     DDSDWGMLNDDDVSSPSKIKAANNHTKYPLFQMYWLRIVLDEAQNIKNYRAKCSLACY
                     QLSSCAATRWCISGTPVQNNALEIFSLIHFLRISPFDDFRHFEEKIHDPLKSNKQTYV
                     DLGLQRLGVVLKSIMLRRTKDAMYEGRRVLDLPLRSIEIVSREFSSENERDFYRELED
                     RIQTHWKKSQKAHINYMGALVMLLRLRQACNHPALVTGRTALPLHDLSEPTAEENVQD
                     EDEELASLLSGLSVKTRNCDRCQISLLEQQARYCSGCKAQISREKKQGINWGTPGTMS
                     TKLEMILNLLDTFDKTSKGDKSIIFSQFTSFLDLVQDALNDCGRNFVRYDGSMRRNAR
                     EEALQKIRSDEGIKIILISFKAGSTGLNLTCCNRVILCDLWWNPQIEEQAFDRAHRLG
                     QSKNVYIQVIH"
     gene            complement(<70405..>70683)
                     /locus_tag="MRET_4095"
                     /db_xref="GeneID:38740861"
     mRNA            complement(<70405..>70683)
                     /locus_tag="MRET_4095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630722.1"
                     /db_xref="GeneID:38740861"
     CDS             complement(70405..70683)
                     /locus_tag="MRET_4095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486556.1"
                     /db_xref="GeneID:38740861"
                     /translation="MFKAFVVLAAAAASVVVASDRVSVKGYTADSKGALDCKFGSGDI
                     LKKCGTCAKSITECASSNPNKTKQVCVSDIASFALDCGGCAVDILECL"
     gene            <71581..>72750
                     /locus_tag="MRET_4096"
                     /db_xref="GeneID:38740862"
     mRNA            <71581..>72750
                     /locus_tag="MRET_4096"
                     /product="secreted aspartic endopeptidase"
                     /transcript_id="XM_027630723.1"
                     /db_xref="GeneID:38740862"
     CDS             71581..72750
                     /locus_tag="MRET_4096"
                     /codon_start=1
                     /product="secreted aspartic endopeptidase"
                     /protein_id="XP_027486553.1"
                     /db_xref="GeneID:38740862"
                     /translation="MQLGIKIFAAAIALTTLVSAHEGVVINVDRRGGSEPINDIRKLK
                     GVFQAILHKYESGIRSYKRRTGKDHIWHTPKMSKRADVTSINMKDISDETQWIGEVCL
                     GKPSTCVLAHFDTGSADFIIVKDPYDPAKSNTSVDTKKTFSQGYADGSKAEGGIFIDS
                     FSVGEIHAKNLSIGVSKKNFLQSFEKNKAIAGLSFPSIKSFDDEHLTLMEAFKQQNKL
                     KKNLFQFTLKSGKGSSLNFGDIDSSKFCGELTWVDVNPIWGFYIVGGRINGQKAITAI
                     DSGTTFIMGSRRQLKKLIEKTPGVSYLESDGMGYGVFDCNITPNVTISYGGTDFKLSR
                     EHVARGTAGKKCLLSIVGVDSGLPLETWIMGDPFFQTTSIVFDHDHKRLGFAPQK"
     gene            complement(<72994..>73287)
                     /locus_tag="MRET_4097"
                     /db_xref="GeneID:38740863"
     mRNA            complement(<72994..>73287)
                     /locus_tag="MRET_4097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630724.1"
                     /db_xref="GeneID:38740863"
     CDS             complement(72994..73287)
                     /locus_tag="MRET_4097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486554.1"
                     /db_xref="GeneID:38740863"
                     /translation="MRAATFFTLLFLFAACLTVLAGTPHGKALDRRLNCYDSIQQAPH
                     MCLDFVYGLMKCLKDSVKEKALCVDDYWKYVSSFDNCAYDFFSCLIPPGVKWS"
     gene            <74026..>75435
                     /locus_tag="MRET_4098"
                     /db_xref="GeneID:38740864"
     mRNA            <74026..>75435
                     /locus_tag="MRET_4098"
                     /product="secretory lipase"
                     /transcript_id="XM_027630725.1"
                     /db_xref="GeneID:38740864"
     CDS             74026..75435
                     /locus_tag="MRET_4098"
                     /codon_start=1
                     /product="secretory lipase"
                     /protein_id="XP_027486561.1"
                     /db_xref="GeneID:38740864"
                     /translation="MYIRFFLIVALFCTFTTYAYEVKRIRRHIQKPVSPTKDSFYVPK
                     EGWEKAKPGTILASRKIQAGFTERRKIHLDGAYQLLYRTSGVDDKSPSFTVTTVLVPK
                     NARTNKLVMVMPYEDSNFVDCAPSYKIQLGAPNEVNPIQSVEELMWTSILNDGWILTL
                     PDHQGPLSAFSSSFIHGHASLDALRATLNFDTLKLQPDDPIVGIGYSGGAMAGGWAAS
                     LHDSYASELNVVGWALGGTPSNLTGTFRGVNGGLFAGFSVAGIAGLVDSYPEVNDYIG
                     SVITPAGNDALQYTREHCMIGIVVGLQNVNMTLDSFVSNGNTLLTDEKIAPLLNKLTM
                     GTEKRYTPRAPVYMYHARNDEIIPFERANQTANIWCNNGANVLFQDYTSISMGHVSTE
                     VMNTPFVLKFIRDRMSGVDFVQGCHWKSDLNPLWKPDILGARLIEVFNSLLNVLGAQV
                     GRTDEVFKESIKRRNFTKS"
     gene            <75694..>77103
                     /locus_tag="MRET_4099"
                     /note="MRES_16530"
                     /db_xref="GeneID:38740865"
     mRNA            <75694..>77103
                     /locus_tag="MRET_4099"
                     /product="secretory lipase"
                     /transcript_id="XM_027630726.1"
                     /db_xref="GeneID:38740865"
     CDS             75694..77103
                     /locus_tag="MRET_4099"
                     /codon_start=1
                     /product="secretory lipase"
                     /protein_id="XP_027486562.1"
                     /db_xref="GeneID:38740865"
                     /translation="MLPPRFSLGLVVVLVSIFQVCAGYNSAGSLRWEHHRRFFDDDRF
                     YNPPNGWENAKPGEILSRRKVDVAPVGLFKLGVTAYQLLYRTTGLHDGDATTSVTTVL
                     IPDNHDRDKLISASVYEDSISPLCAPSRRFKLGNNVVKNLAISYQSLFITSLLHEGWI
                     VTVPDHEGPESAFTAGPLEGHIILDAVRATLSFDRANLHSDAKVIGYGYSGGALANGW
                     AASLQDSYASELNVVGWSLGGTITNLFTWLRYIDGTSGAGFAFGSVMGISAVDNDFKW
                     IRRGLTSRGQAAYDVARHACMYENLVPLLYQETISDNFFRGGSSFFVDSNVREAFGKY
                     HLGGDNVPTPKAPVFMFHAIADAVVPYGDAYQTAQTWCRNGAKVKFVTNVGAEMGHTS
                     TEITNLPSVLWFMRDRFRGKNWYNECQFTQTLDPWFNIVNAATSLGKFWQQMLDLLGG
                     RIGKADSLLLSKLKKHQIP"
     gene            complement(<77110..>78429)
                     /locus_tag="MRET_4100"
                     /note="MRES_16535"
                     /db_xref="GeneID:38740866"
     mRNA            complement(<77110..>78429)
                     /locus_tag="MRET_4100"
                     /product="Jumonji domain protein"
                     /transcript_id="XM_027630727.1"
                     /db_xref="GeneID:38740866"
     CDS             complement(77110..78429)
                     /locus_tag="MRET_4100"
                     /codon_start=1
                     /product="Jumonji domain protein"
                     /protein_id="XP_027486681.1"
                     /db_xref="GeneID:38740866"
                     /translation="MSASPSYAGWEPSEHDADVPRESAGISAQAMWEKYIQKRKPAAF
                     DGLLDDDTWHGERLADLDYLRQRAGQAQVKVEPINTTKQMFGTAEKREAMTFAQFLDV
                     VQDKRQGGKYYLTTQYEQEEEQGEDEDWPDMDPILPSPVHLLQKDFPLHPRILGNLVL
                     QQCNLWVGGTQEPKSSGLHHDFHDNLYLLLSGYKRFILFPPTAYPYLRLRGHVEHLHK
                     NGLLVYEPDHRIRADGLDEIDAAHWRVASRSHQNGKKRRNHAQHDVHGSYEEAKQALQ
                     EMRAKYDPEEDEDDDEEDDDDEEDDEVLQDPESDNDAFEQDEDEYEQLFESDEPPSFS
                     YIAPSVLHEHFRIPSPIPAPKDVDKTMIPLQGCPKPLVVDLKPGQMLYVPASWFHEVT
                     SYGSHGSPHIAFNYWMHPPDGQDAKEPYVDTEVWNTIRNRVILHNHN"
     gene            <78540..>79211
                     /locus_tag="MRET_4101"
                     /note="MRES_16540"
                     /db_xref="GeneID:38740867"
     mRNA            <78540..>79211
                     /locus_tag="MRET_4101"
                     /product="protein RER1"
                     /transcript_id="XM_027630728.1"
                     /db_xref="GeneID:38740867"
     CDS             78540..79211
                     /locus_tag="MRET_4101"
                     /codon_start=1
                     /product="protein RER1"
                     /protein_id="XP_027486575.1"
                     /db_xref="GeneID:38740867"
                     /translation="MRADDQGIGAPAQGAAAILPMLSPKNIVAKVSNLNMRLQHMIDI
                     TAPFPIQRWGITGGLLFLFMLRIILMHGWYIVCYALFIYLLNLFLAFLTPKFDPAFES
                     DLAAQDVEEGEPGLPTTLSGAGGSGLMSDVFHPTDAKDQDEFRPFIRRLPEFKFWISA
                     TQAILVSLGATMFRVFDIPVFWPILVLYFATLFVITMRRQIEHMIRYKYLPFDMGRKA
                     RYGRG"
     gene            complement(<79208..>81901)
                     /locus_tag="MRET_4102"
                     /note="MRES_16545"
                     /db_xref="GeneID:38740868"
     mRNA            complement(<79208..>81901)
                     /locus_tag="MRET_4102"
                     /product="ubiquitin carboxyl-terminal hydrolase 25"
                     /transcript_id="XM_027630729.1"
                     /db_xref="GeneID:38740868"
     CDS             complement(79208..81901)
                     /locus_tag="MRET_4102"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 25"
                     /protein_id="XP_027486688.1"
                     /db_xref="GeneID:38740868"
                     /translation="MTSWRECLRTPAALAQSGLVPYGHAYAVHTNGEADALPHEHAVF
                     LPERMTWVSTVRCDQPAPSPCPAPAPGMHGPIWYSDAHEDGLCHTDVIRRDAWVSRTY
                     EAALPSALWEAFHAARAQAPAPGQTPTSEVARASASLARILGNALRGETRPVPLDGKV
                     MTQMLRWDASLEALMRHFGWHVAPMEDAPHRLALHPPPSMSWRIYTELAVWCTHLGHA
                     PPAPPPGWRIEAHASVLMPANVPTADAQTHLACARLGVSTQEDAGVVCDMYRMNTACF
                     PHRRQELFLALECLHDLRHAGEPLTTLMAIEQSQGLYAYKDVRASYARLGVAMPAVAP
                     SPASLWDPSPSPPPAPVDKVIAAYDRAVKEALDHGTDEDLRSARQALRTVAQYHAPAP
                     ALEERERRNPIQHPDDAYQLLQTNADVDDALLLVGYQVYAAESHARSELLRAALERVA
                     EARHSAYLLRFLRGEADAGPAHDMPRGLHNLGNTCYLNSLLQYLGFIAPIRDAVHRAG
                     TEAKSAEHQRALSLAHELDALFRDMATSKEWALTPRKELAYLALVPLAWEQAYACSKD
                     ELMSQVTTQQDVCECLGNMTTLLDQACPSDEVQRLFLGTSIQTLDPPPKDSPRTTEQT
                     FTSVPVTLLPDVRSMYDALDTFFNDEQVPWDNEARLQRRITLKQAPPLLQIHVQRVQY
                     DRKAQRIVKHQAALDLPDTLYLDRYMDASCAPPERFDALQALHERTLALRRERAALLE
                     QVHQLQGDELMALERITRRLNVWKHAAEQNQDTEWHALLNEHAPSELESVSLIMRAKA
                     QALTTQADALHSDLETLWSEETHLPYRLASVCMHRGEATHGHYFVNQRDFAKNEWMTL
                     NDTHVAPITEGEVSKDPTGATSYLVVYVRQDVQHILSSPRH"
     gene            <81948..>87599
                     /locus_tag="MRET_4103"
                     /note="MRES_16550"
                     /db_xref="GeneID:38740869"
     mRNA            <81948..>87599
                     /locus_tag="MRET_4103"
                     /product="HEAT repeat protein"
                     /transcript_id="XM_027630730.1"
                     /db_xref="GeneID:38740869"
     CDS             81948..87599
                     /locus_tag="MRET_4103"
                     /codon_start=1
                     /product="HEAT repeat protein"
                     /protein_id="XP_027486577.1"
                     /db_xref="GeneID:38740869"
                     /translation="MTAEARAEEARRPMPLLPEEADVVEAVQQGRADVFLVPWLTRVQ
                     CLLEEGEVRGVAALVDRLLSLCGVRPGTPPWHQIEVGRSVRYLVARCMVLVYRTDAPK
                     PPLFEVMGLLRDVFAADIPTPAHVAAMHVSRELVRAFPPHVGSQSSAIPPCLRLIRPS
                     SHTVVVRFYALRLLACLTPPPAMLKDVLKVLKSGLSDKAGAVVRGCAACLEALAPTSR
                     AEIEAWLALVVKSIHGVDAHTRASLARLAAVLLCQTASSAAADEGKDPVVQPVYAVSE
                     QLHLLYGHLSRASTQEARTEMLSMYDALLTRHGSAWLEQHLDVVYTHLVQEIATRLPN
                     GAELVRRLLDPHWPALSEPAQERAAAYLGTHVLAMWPPSTPTQPVPSEAALCVTLDAT
                     AVLVAQLGELSATLHEALYEVHRRLLTHPALAVQVRAAWWLSVACSVEPWLLAPTYAE
                     LLGCMRRDTEALSKPQHDRGVSLRARLVGHSAALAALARVAAQHPLYMRNDDVDEVCL
                     LAMDLRTRYSETPAAPHASAAVGSAWMLVGSLMALGPEFLRAQVPTLLHAWRQAWADR
                     PWREMDEGAYLVTERLGALSSMHAFFLHGGHALLTPETARRLVALQSQALAFLAAWER
                     RAPGTSEASLLRARMLRCCTHLAQAPAMETLAPALLRLCVEWLTRAEYASPSGAAPPV
                     HAPGATPWTVQDGVAMGVTSLLAQDRVALDAWTPSFVSAQCQAGPRVGTPVSGALEHD
                     TMALYALPVEPDAGWGLVPRAPAPMPAHVAEVDAAAELFAALFPFACRDVQIGASEGL
                     QAAQRRPALDKQPGRRMAVMANSVVALLGAVRTAAQPVHRASGFANERINAAIRGVAQ
                     TALQQGPAVLRRAAAELYGYLASLAGSVSLSAQVACMVEQIGDARHADARAACVLALG
                     EMYARLGGLRAAPLTKSVHTLALSLAHDPHPAVHCCALEALASVAEAAGVAYEPYVES
                     TLRLMTRLCAAATHEPEGGSVGSSNLRVHLPAYPGVARVLSALVGVLGPDLQAAEATR
                     HWLYALLLHLAHDGGDAVPEAIVGLQRLELVVPSMLATRVWADVLRDAVQQPRLAPTA
                     AGAYGQMAQRGSAWLARYGGPSLLVTLLRQLDAHPHLDGIRALIHAWLRDTAPMRPCA
                     WMDLCCTVLLTPEALRTQRVAGAGGDVDEAAMALAPDDTETQALSVRWRTQRFVLTCM
                     HDVLACVHTRAEHVGRGSDARDRRVLSSRVSDMLRAACSASTATHRAVRSQGLQVLRD
                     VLESFAETPDPDFGEARLLEQFQAQLTAALTAAWGADTPPDVRAAAIAVSGVYLSAGI
                     DASPTSRMGRRMVSALEGAPSADASLTAQAAAYVHVAVIRAWARMALTPGLATLVAPH
                     VPTLARAWVHMLTAYATLRADRTASVASAWLSPDSALAPLVQAHMRGTLAQAYPTLLQ
                     ALTSVFASHPDVVQAALAQDLGDARRAFMALYGLALETLWEALDRPAAPSLLSVVLRS
                     LHVLVDVRYSGSFLLQDAPFDELVCVCQRALLGTDTAVQRGVVQLIRAMVRSMRERLL
                     LHDDGTVQDMPSSKLGRLWRLLSHVMELLPSQPTPRTERATLLQMVWCTLADMIAVGS
                     ASLQLELVAVSLHMLVAYARREDEAAWMLTPALSVLREICAAACASAHADANLAHRAV
                     QGFLSAMIDMSDALRARSGDMVSRRSGHALVSASLVLTHLDASITISSEVTERLAFLL
                     AQKLDTDDDAPIALQCLRSMVHAQPPRHSLHLCLGACLPSLVAHALRTHADAALDVLV
                     ALVHAMPPDAALRVCVPVAVTYLERPAPSPHVVHAVVELARTHADAFRTATRALDDDA
                     RTRLQQTFRTAIGAPAAPTAAPSGEGRIALRTFGAAEWRSS"
     gene            <87642..>89780
                     /locus_tag="MRET_4104"
                     /note="MRES_16555"
                     /db_xref="GeneID:38740870"
     mRNA            <87642..>89780
                     /locus_tag="MRET_4104"
                     /product="NLR family carD domain protein 3"
                     /transcript_id="XM_027630731.1"
                     /db_xref="GeneID:38740870"
     CDS             87642..89780
                     /locus_tag="MRET_4104"
                     /codon_start=1
                     /product="NLR family carD domain protein 3"
                     /protein_id="XP_027486573.1"
                     /db_xref="GeneID:38740870"
                     /translation="MATEADDDDETHGAVRPLPPSKARTQPGRSILRAAPPLANDTLW
                     AGREWLYSVNARLAQKNVAVQVPVPDGHLLGHMLRRWHGQQPSTPPEHMHDAGLRHVH
                     FRTEDLSHTYPISRTRAPAHEAETRERIESEALDRARRLCGRPWSACELESLYRVCCR
                     AREDAPHASIIHVLAQAALWPQARARTLDFADTALAPHAVALADMLCAPTGVQVLRFD
                     RCGLDTDAVRALAAAVFTSHSVHTLSLADNPGIQTRGWRAIGALVQDDRVLRHLDLSH
                     HALSTSSWRAVLSPLTRGHSTLQTLRLDHSALRPAHLECVAEAVRASSLQHVSLRHSG
                     LGDGSAPRLSRMLMDWDEHARPAIEDIERVGVVTVPATDDLYGDESQLHVITSLLHGH
                     DAPHAPSRRHERREAIIARAQAFQHALSDIPARGHLLTLDLRGNALHDADAAILATAL
                     RRNRTLRVCSLADNHITPHGLACIADALRYNTTLETLDLSGNPCGGPALDGVLRLRVA
                     LAVHPRLKRVVFADTQLAAEGALVLAECLPDAEHLVHLDLTRNPLGLVGMLGLAAGTR
                     RNASLRCLDVSLQDDPAFVEAARDVYTHCAHNTHTALAHAPPGVHVQRPLDKSALARA
                     LLDKEQRSTTETSQPASETEPSEYSEPADANEANDATPTTEPSPAAAPNERAASPQSE
                     ENIGLDAPDPPGEPARHAPPDAAHTDDPAP"
     gene            complement(<89791..>92154)
                     /locus_tag="MRET_4105"
                     /note="MRES_16560"
                     /db_xref="GeneID:38740871"
     mRNA            complement(<89791..>92154)
                     /locus_tag="MRET_4105"
                     /product="mannosyl-oligosaccharide alpha-1,2-mannosidase"
                     /transcript_id="XM_027630732.1"
                     /db_xref="GeneID:38740871"
     CDS             complement(89791..92154)
                     /locus_tag="MRET_4105"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide alpha-1,2-mannosidase"
                     /protein_id="XP_027486574.1"
                     /db_xref="GeneID:38740871"
                     /translation="MPVRQVHYAPLPGHNALQRLRFELMRKPRLFFILYLIIVLLIAR
                     AMIFVLYLFIHTESMAPHRGSNWHRLNKSLIQDAISIDPTSASTLTNEAFPAATDPTI
                     KWPSLDLVYPRYNPHRGEIPPDVMALLNAPPALMHPRARFNGTSRTAWTHPPWSPTRN
                     GSRTQPEDAMHPSKQPKEHDGRPYPYNRWTSPLADMDTLYPERQERVQFGFEDASQYS
                     GKRFDPKRDQLLKKRQKLVKSAFIRAWQGYKDYAWGADEVTPVTEKYNNHFNGWGATV
                     IDSLDTLLIMGLDKEYHLAREHVHDVDFYFVGGSRSAYSSADGRIPVFETAIRYLGGL
                     LSAYDLTGDALMVERAEELAQLMLPAFNTLTGVPLGRMRPGENVTYASDLALLYSGEV
                     VLAEATSMLLEYTRLWQVTGNRTYFDRVQRVTDFLDRNMTKLSQFGTLLPAVLYPEEG
                     IVSSKYSFGGGLDSYYEYLVKEHQLLGGVLPQYERMFTEAMDSAEQHLWKNVTVVPHA
                     PSLSVVVSSMGHGRSQVSLEHLACFSGGMMALGSRIVPDRRHYLNIARMTTETCYWGY
                     NSSLTGLGAEALEFYHPQDKDMYRVVTEADGTRHRGPPVGDPFVGVRYIWHEDYRNRP
                     EVIESVLYMWRTTGDPVWQERGWQMFASWMTHCLTRSGTSTIYDVNAVPVRHSDSMES
                     FVLAETFKYYYLLFSPPDLVSLDDFVFSTEAHPFLLPRAGRWARAGDVPASFPRVDRR
                     FPAILRPRGQGTPMQRGLWEAQRQASGKTARLLEVLWAEVNDTGAVV"
     gene            complement(<92274..>93058)
                     /locus_tag="MRET_4106"
                     /note="MRES_16565"
                     /db_xref="GeneID:38740872"
     mRNA            complement(join(<92274..92892,92925..>93058))
                     /locus_tag="MRET_4106"
                     /product="pyrimidine and pyridine-specific
                     5'-nucleotidase"
                     /transcript_id="XM_027630733.1"
                     /db_xref="GeneID:38740872"
     CDS             complement(join(92274..92892,92925..93058))
                     /locus_tag="MRET_4106"
                     /codon_start=1
                     /product="pyrimidine and pyridine-specific
                     5'-nucleotidase"
                     /protein_id="XP_027486644.1"
                     /db_xref="GeneID:38740872"
                     /translation="MSLDKPWHEYVGFESLRREPVDASDSECILWLDIDNTLYSHAET
                     RMMDLMVERIHNYFRSLGLDDEEATSLHMRYYKEYGLAIRGLVQHHAIDPLDYDQKCD
                     ASLPLEEILRPDTRLIDMLKSLKSRKTSIFSLTNAYRVHARRVLSLLQLDSIVEGIVY
                     CDYTNPEFSCKPEAEFYLAAQEAVHAAPTAQHYFVDDSIANVRQAIKLGWSKSVHYDE
                     HGDFHEPFTTPDGILTISHLLQLPTVWPELFS"
     gene            <93170..>93776
                     /locus_tag="MRET_4107"
                     /db_xref="GeneID:38740873"
     mRNA            join(<93170..93473,93498..93642,93671..>93776)
                     /locus_tag="MRET_4107"
                     /product="beta-1,4-N-acetylglucosaminyltransferase"
                     /transcript_id="XM_027630734.1"
                     /db_xref="GeneID:38740873"
     CDS             join(93170..93473,93498..93642,93671..93776)
                     /locus_tag="MRET_4107"
                     /codon_start=1
                     /product="beta-1,4-N-acetylglucosaminyltransferase"
                     /protein_id="XP_027486678.1"
                     /db_xref="GeneID:38740873"
                     /translation="MPRENTILVTVGSTRFDALVYKALSESFLACVCLALGPQAEVWI
                     QYGHSAFALPSGAKKGTLRNTEGVWIDTQGQAKTFAFAFTPKLRSWIDHAGLVISHGG
                     SGTIIEVLRSDHAPKLLVMPNTTLMHDHQRELVQQLSQEGYLSMGHIDNIDQMIPQVL
                     SRNYVRFPAQNTVAVKRVVESVWC"
     gene            <93871..>98949
                     /locus_tag="MRET_4108"
                     /note="MRES_16570"
                     /db_xref="GeneID:38740874"
     mRNA            <93871..>98949
                     /locus_tag="MRET_4108"
                     /product="GTPase activating protein"
                     /transcript_id="XM_027630735.1"
                     /db_xref="GeneID:38740874"
     CDS             93871..98949
                     /locus_tag="MRET_4108"
                     /codon_start=1
                     /product="GTPase activating protein"
                     /protein_id="XP_027486663.1"
                     /db_xref="GeneID:38740874"
                     /translation="MDSDPPKTGASGKTGLGVPFLLSFRSRSSAGSSSDSARSSNIRA
                     QSDVLGELRSAIEQLLQPKVSFQNQRSCIRLVIDTLKRDPSELDSILDPAIATPLVSS
                     LVVLCSRLLRDTFAYEIRLLSCELLTSTLKYADVSTQSVSSELSKEEAMATGWNAVMP
                     SRAMSMLDRALLYRLVVNLHRYDHWNVPLIVDEPELAFQTLSAQLSALLVLTRDGRDI
                     FAFKGILNVLMKWLRYTCGAMLMLRTRSESNVTALSEHCMCTLVNLLASICKFNASRL
                     DKKQMEQFVNGLCGIVLYPRIPRYQAPANTSKGYSYYDTQGLNIFLTTPTLKPVDEEP
                     KWIPPTEMLGIPIGVDDVDFPPFREQDIRVFVKVLDAVFCYAFIPSECLTQCVLSFCR
                     VIGLPIAQADQKELIFRLAERSVDIQAELEGILNNFLSSHFVHSVIQRLYEILCGPRH
                     GPRSIRVGAFLFIYATMIWSMQRRIEQGAHVKQQYPILPQSVFEGIVHGALLEGDDVI
                     DLISLFLIDDYLPQREACPEAIVFDNVPARNRQTPKPLCTLYPDSGQSCWNVVLDLTL
                     VMNRHLSRHRRGVKELSLSSFVLHMLVFLLCTRTDRYIISMPFVSSSFWALAPFIPDC
                     VLLSVIKENEQQHMYLPSSHDWLDKLTELVDTFYPRAQSDILASRALPSVNSRHYALQ
                     IITKVYECVQDLPHLLEPLIDQVIMPLTKRASRQETNMEIGVSLRRIMRHAMTTTVCH
                     PSIGKNRPFFHMLHDLSDAVFRAEPSLADSTQAVAQHSRQRSLGPHNVSDVRDGRLRF
                     TRATRSTRDLIVLFMQLSFGITDPADMSPELDITSNGSHARLRECSVAIFRELLRMVR
                     SNTPFSSGSNDANASCCVPPQLRQVILRWMLRLRSDRQHRIYFQDHVEDFSKSLMTIL
                     SRTEESDLLSTLSYDPRHSELKMPSWSSRIWTVFENEELHTADGSDHAESCPLLFPVS
                     EYLNTVVHVLQTETDWDVLSTLLVHLPSQLNNMHLFCGKKASAEICGLRNWLCPLLLE
                     QKPLSNLILPEDVRRTDLTAVLYATLKVLISYHRHFTRTQQDELVETFVVGLSHSQTV
                     AQPCVRALVVAGYEISKSFTRQWTNILVKLSTIMSSITMSVHILELLAEFSSVQALYA
                     NFTEADYRRVFGIALQYIQFHESVAAGSTRENLRSSAAKFVLAQYVLLLAYNNISQWF
                     MTLRLSERAKHASYITQGLVLANEGRDSLSDQTIVCLDFLARFTYSNALPKPSRSLLH
                     MLLDQKGQEPPGPGFTWIVGKGLVTVRPMARNGTYELVVRRPSGTVSFVSRMENMTSD
                     DRTAEERTADILAAAIEHWKQQGSIAKPVIRAPGETEPTVTPSSKPDHSEEASPEPNL
                     EKEETTHGTHELEKPTLHRTSGMEPIFLALQFSGYPDKSQDKPPVLLPQDASTDRLLR
                     GMDLTPVYDFHKIGLLYVGFEQTKEQEILSNTHGSMAYMRFLSCLGDLIPLRGQEDVY
                     TGGLDRQADEHGKYAYVWRDYSRQIVFHTSTLMPNHENDVNRASKKALIGNDYVHIVF
                     NDSGLPYEFGTIPSQFNFVNIVVSPHSSVRDGVDYAVSDDTYFHVTLQLRPGLPDFSP
                     AGEGCLVSSATLPHFVRNLAMQSDIISQIYLDTAESMVPFANNRVIRLHHIERYQQQL
                     MTKRAETESLDDITIYDFTKTLIK"
     gene            complement(<99617..>100177)
                     /locus_tag="MRET_4109"
                     /note="MRES_16575"
                     /db_xref="GeneID:38740875"
     mRNA            complement(join(<99617..100132,100175..>100177))
                     /locus_tag="MRET_4109"
                     /product="alkyl hydroperoxide reductase 1"
                     /transcript_id="XM_027630736.1"
                     /db_xref="GeneID:38740875"
     CDS             complement(join(99617..100132,100175..100177))
                     /locus_tag="MRET_4109"
                     /codon_start=1
                     /product="alkyl hydroperoxide reductase 1"
                     /protein_id="XP_027486488.1"
                     /db_xref="GeneID:38740875"
                     /translation="MATQKGAVIPNTKFGLIPWAPELDSGEVCGIPTTFESHNEWKGK
                     KIVVVSIPGAYTPICHQQHIPPLVKRADELKAKGVDAVYVIAVNDPYVMSAWGVFNHA
                     KDKVVFATDINAAFSKALGATIDLSFKDMGERTARYALIIDDLKVVDFASDEGDTGKL
                     QNASIDTILQKL"
     gene            <100418..>101348
                     /locus_tag="MRET_4110"
                     /db_xref="GeneID:38740876"
     mRNA            join(<100418..100525,100575..100682,100721..100732,
                     100793..100814,100858..100966,101076..101112,
                     101154..>101348)
                     /locus_tag="MRET_4110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630737.1"
                     /db_xref="GeneID:38740876"
     CDS             join(100418..100525,100575..100682,100721..100732,
                     100793..100814,100858..100966,101076..101112,
                     101154..101348)
                     /locus_tag="MRET_4110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486648.1"
                     /db_xref="GeneID:38740876"
                     /translation="MSLFATVMNFATTSSATESTSTSTWLDCFFPVALNEEETKEAEG
                     DKGGDEKEDQTEEEGDEEEEEEEEEEEEEIEDPYPAIYEQCQNSSACESVRHHFEECQ
                     ERVTGGKGFEGEDCVEEFPPCSLRSGMCCTQAVRQAGIDSKGLSWALMQMLSVATPME
                     ISEPHSQGVLHAVLLSCHTDDARPSTSFGYVGMCGP"
     gene            complement(<101361..>101762)
                     /locus_tag="MRET_4111"
                     /db_xref="GeneID:38740877"
     mRNA            complement(join(<101361..101389,101420..101533,
                     101574..101627,101666..>101762))
                     /locus_tag="MRET_4111"
                     /product="lSM6 protein"
                     /transcript_id="XM_027630738.1"
                     /db_xref="GeneID:38740877"
     CDS             complement(join(101361..101389,101420..101533,
                     101574..101627,101666..101762))
                     /locus_tag="MRET_4111"
                     /codon_start=1
                     /product="lSM6 protein"
                     /protein_id="XP_027486647.1"
                     /db_xref="GeneID:38740877"
                     /translation="MSDTASAKVQQPADFTSSEQQVKAGSPNDFLKSVIGKKVIVRLN
                     SGIDYHGTLSCLDGYMNIAMEDTEEFVDGALKSAYGDAFIRGNNVLYITSLDA"
     gene            <102230..>104196
                     /locus_tag="MRET_4112"
                     /note="MRES_16580"
                     /db_xref="GeneID:38740878"
     mRNA            join(<102230..102266,102293..>104196)
                     /locus_tag="MRET_4112"
                     /product="DnaJ subfamily C member 11"
                     /transcript_id="XM_027630739.1"
                     /db_xref="GeneID:38740878"
     CDS             join(102230..102266,102293..104196)
                     /locus_tag="MRET_4112"
                     /codon_start=1
                     /product="DnaJ subfamily C member 11"
                     /protein_id="XP_027486646.1"
                     /db_xref="GeneID:38740878"
                     /translation="MASLRGESSLPFVDNTRQNRTDTEDEEPLFGGTPFRDAHANTTD
                     AFESSARSYYSLLNVDEDASEAQIRDAYKTLAMAFHPDKHPDPHNKELAEEAFRDIHK
                     AYQVLSDPEQRSVYDHFGEEGLQSSWALAAPGRSPAEMRAEFERQSRLRQAADAESLV
                     NSHGEFSAVINASPLFVRNARIVSPLNPAIQTRLTLAKRLALVSCPQIVGEHGFDIPL
                     TQSSTLAVSGQLIKNGQMGAGNLIGTLKTHWNPRFYSEINASLLQPQTLTVRGQYMVD
                     PNLIFNWIIASQSWSVPPTVQLVWSQRLSSKSSLTGFAQVKTGAYTVGSWGADENGEP
                     LTDDMSALVVGVTKPHEDGTEWTCHYQFTNDLSIHYEWSMKVLSGMRVKSGVSCGLLS
                     GLAAYSNSERRVTENIRVLLGVKCGTSSGISLKIRVTRLGQRIVFPIVLSPKFRVDLA
                     MGAAILPALAIAGSHYFYFMPKRRLATSERLHSIRKDRMTDIEQRRTSAEQTCALLRP
                     QATKRAEAEYGRSGLVILQAYYGRHDVFPPPMDLDIHMLADKEQLFSMLSQYEALHQV
                     KDNNQPLWCNVRVQLQMLVNQSQLVIPAGRSKSKLLGFFDPCVGERKQLYIRYLFRGR
                     LHELTAHDDDAVAAPLRSQQIT"
     gene            complement(<104230..>105114)
                     /locus_tag="MRET_4113"
                     /note="MRES_16585"
                     /db_xref="GeneID:38740879"
     mRNA            complement(<104230..>105114)
                     /locus_tag="MRET_4113"
                     /product="phosphoadenosine phosphosulfate reductase"
                     /transcript_id="XM_027630740.1"
                     /db_xref="GeneID:38740879"
     CDS             complement(104230..105114)
                     /locus_tag="MRET_4113"
                     /codon_start=1
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="XP_027486645.1"
                     /db_xref="GeneID:38740879"
                     /translation="MSDASMPNASQRVPHDADVDDQIQRIIADLPKINAKLENAPPAD
                     IIRWSIDNLPHLYQTTAFGVTGCVTLDIISRISAERSEKNHTELRHLVPLIFVDTLYH
                     FPQTLDLAERASKHYHAPMYVYKPKGSDTVADFERTWGSQLWQRDEDTYDYLVKVEPA
                     RRAYEELDVRAVFTGRRRSQGADRASLQAVEVDETGLIKVNALLNWEFADVDKYVKEN
                     AVPYNVLLDLGYKSIGDWHSTSLPFGKDGADERSGRWSDKAGKTECGLHKDYFKFKVL
                     AEKKIREAELNRIDASNP"
     gene            <105481..>106707
                     /locus_tag="MRET_4114"
                     /note="MRES_16590"
                     /db_xref="GeneID:38740880"
     mRNA            join(<105481..105598,105704..>106707)
                     /locus_tag="MRET_4114"
                     /product="large subunit ribosomal protein L4e"
                     /transcript_id="XM_027630741.1"
                     /db_xref="GeneID:38740880"
     CDS             join(105481..105598,105704..106707)
                     /locus_tag="MRET_4114"
                     /codon_start=1
                     /product="large subunit ribosomal protein L4e"
                     /protein_id="XP_027486657.1"
                     /db_xref="GeneID:38740880"
                     /translation="MAARPTVNVRGIDGAATGSLPLPAVFNAPIRSDLVQIIHSNLAK
                     NKRQPYAVASNAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMARGGHMFAP
                     TRVWRRWFVKTSQTQRRHATASALAATALPALVLARGHRVEEIEEVPLIVSSEIESFT
                     KTKQAVAALKALNAYEDVMKVSNSRKIRAGVGKLRNRRHVQRRGPLVIYNQDNGIVKA
                     FRNLPGVEIASVHSLNLLQLAPGGHLGRFVIWTEDAFKQLDTIFGTYETASDVKKGYH
                     LPSAKITMPDVTRLINSDEIQSVVRPAGPKQTKRPFTQRKNPLRNRGVLFRLNPYAQS
                     SIRREIREQAQRRAGKLKKNTKTPRIPTSEAFFEQLFAP"
     gene            complement(<107071..>108921)
                     /locus_tag="MRET_4115"
                     /note="MRES_16595"
                     /db_xref="GeneID:38740881"
     mRNA            complement(<107071..>108921)
                     /locus_tag="MRET_4115"
                     /product="carboxylesterase family"
                     /transcript_id="XM_027630742.1"
                     /db_xref="GeneID:38740881"
     CDS             complement(107071..108921)
                     /locus_tag="MRET_4115"
                     /codon_start=1
                     /product="carboxylesterase family"
                     /protein_id="XP_027486482.1"
                     /db_xref="GeneID:38740881"
                     /translation="MMKAGQHVVLAGLLLLSFFVIGAVADVAKPQHLSTLHHAKMARR
                     SKAMSTSEKWGKYCEDDTQGHNGNDQKSDHYLVVKTNEGRVRGLYNSTADTYSWRGVP
                     FGDDTSGENRFMPPRPAGKWYDVRDASKKPKICPQHGSDVSKAAIALFGFSGSIFEED
                     AQSEDCLNANIFIGRKNWEKYRDSNGKAKKLPVWLNLYGGSFEWGSNTVETYQSHKLV
                     HDNDIITVSINFRNWILGFPQAPQLHTSKNQHNAHFKGSNPGLSDVDLAIEWVYNNIE
                     KFGGDPEKITIGGTSTGACIADNWAYVHYQKPTSKYVKGIILQSGSMTSLGKYFVTKP
                     EDDFTEKKSVWNKVAAYLGCGTNGDNKQMKCMQRKKWQDVIQATFATNTSFMLTSDNI
                     TAYNDYSERLVQRKFANTPMLIGNCKDEGNAWLIHDAQLTAAVGPLITAEVWVCPSNV
                     QAKHRMGYASTWRYRFSPSFYLPDTPEKYQSLLTYHGSDTAYSWETWQDLRYIPTKQA
                     EEDKGPLLKAPRATDDDKIRAPVAHMYSAAFVEFVKDPDNGLYDFESGWPVYSPQSLS
                     IGDFGYKNSPQFRLASHHDVDGLCPFTDAEIKENNEKWRETAQRMRPFMF"
     gene            <109425..>110432
                     /locus_tag="MRET_4116"
                     /note="MRES_16600"
                     /db_xref="GeneID:38740882"
     mRNA            <109425..>110432
                     /locus_tag="MRET_4116"
                     /product="thioredoxin reductase"
                     /transcript_id="XM_027630743.1"
                     /db_xref="GeneID:38740882"
     CDS             109425..110432
                     /locus_tag="MRET_4116"
                     /codon_start=1
                     /product="thioredoxin reductase"
                     /protein_id="XP_027486650.1"
                     /db_xref="GeneID:38740882"
                     /translation="MPPVDNKNDAGSKQPHNVVIIGSGPAGHTAAVYLGRANLEPVMF
                     EGFLANGIAAGGQLTTTTDVENYPGFPDGIGGSEMMDKFRAQSVRFGTVIHTETISKV
                     DLSSRPFKLWREGHENEEPELAKVIIVATGASARRMHLPGEETYWQNGISACAVCDGA
                     VPIFRNKPLAVVGGGDSAAEEATYLTKYASHVYVLVRRDELRASKIMAKRLLSHPKVT
                     VLFNTVATEAKGDGELLNAVHIKNNQTGEEKDLQVNGLFYAIGHIPATSVFKGLVDLD
                     EDGYMLTKPGTSLTSVHGVFAAGDVQDKKYRQAITSAGSGCIAALDAERLLAEEEAEG
                     A"
     gene            <110996..>113407
                     /locus_tag="MRET_4117"
                     /note="MRES_16605"
                     /db_xref="GeneID:38740883"
     mRNA            <110996..>113407
                     /locus_tag="MRET_4117"
                     /product="aconitate hydratase"
                     /transcript_id="XM_027630744.1"
                     /db_xref="GeneID:38740883"
     CDS             110996..113407
                     /locus_tag="MRET_4117"
                     /codon_start=1
                     /product="aconitate hydratase"
                     /protein_id="XP_027486649.1"
                     /db_xref="GeneID:38740883"
                     /translation="MMLSTRAMRSPALRAVAFRAHRAAATRGVVTVAEDAPPLNEEEL
                     KRKVELSIIEKGKGYYLPYEKIENNLKIVRDRLKRPMTMSEKIVYGHLDQPETQDIER
                     GVSYLRLRPDRVACQDATAQMALLQFMSAGLPKVAVPTTVHCDHLIAADVGGSQDLAN
                     ALDLNKEVYDFLASCSAKYGIGFWKPGSGIIHQIIIENYAFPGGLMIGTDSHTPNAGG
                     LNMIACGVGGADAVDVMADIPWELKCPKVIGVELKGKLSGWTAPKDVILKVAGELTVK
                     GGTGAIVEYKGPGVSSLSATGMGTICNMGAEIGATTSIFPFNARQAKYLEATGRADIA
                     KAASQFSRNLLPDRDAEYDTHIEIDLDKLEPHINGPFTPDLATPLSQFKDAVIKNDWP
                     EELRVALIGSCTNSSYEDMSRSASIAKQASDHGLKVKSGFTVTPGSEQIRATIQRDGQ
                     MEILNKVGGMVLANACGPCIGQWNRHDVKKGEKNSIITSYNRNFSGRNDANFATHAFV
                     ASPDLVTAMAFAGSLTFNPMTDSLKGADGKEFKFEAPTGDELPSRGYDPGENTFQSPP
                     PDGSGVEVIIRPDSERLHVLEPFKKFEDKDPKDLPILIKVKGKCTTDHISAGGPWLRY
                     RGHLPNISNNCLIGATNSANGETNKVQNYYTGEWGSVPSTAVYYRDNGHPWVVIGDDN
                     YGEGSSREHAALEPRFLGGMAIITKSFARIHETNCKKQGLLPMTFQKSSDYDLVRPDD
                     LIDLEGVTTIAPGSIVTLVCKHRDGSQDRIPLVHSFNENQIEWFKAGSALNLMSANAA
                     AKRGE"
     gene            <113719..>115707
                     /locus_tag="MRET_4118"
                     /db_xref="GeneID:38740884"
     mRNA            <113719..>115707
                     /locus_tag="MRET_4118"
                     /product="aconitase"
                     /transcript_id="XM_027630745.1"
                     /db_xref="GeneID:38740884"
     CDS             113719..115707
                     /locus_tag="MRET_4118"
                     /codon_start=1
                     /product="aconitase"
                     /protein_id="XP_027486498.1"
                     /db_xref="GeneID:38740884"
                     /translation="MTYPQDILNSPSCLDHNFRIPLINSDTQDIHSGSLSLNGLPRSP
                     SPPINYKALRYVVNKHLPKESWPYDDQDDAVYSVSYDPDADLLESDIPKIYRKFYGSK
                     DTQHGLDAPIYASPLEHERSTFRSAFETALKPTSFRNEISHKGPYKNDLGSPLRVDLA
                     LSDMAITHNDPNNLASYASESFVLGSDSTLGNNEPDFPLLNSSSLAHASMPLGTAVQA
                     ESSHDTPQNVKMDDYAREITYIPESIAFSESSHPNDRTHRRGLTLDNDLVFRRVSLSP
                     PVSGPSLLQLSLQHADSSKEDMEFAKYIRIGRNDHDHGFRVLLYYPGQVDPQTKALVS
                     PIQVWVQPESTMEELIGYGVYSFVRKFGRVPMHPKEDKAEALISPRSWMLRMVENGII
                     DDDFPVIDYGLIVGHFGEHEFALCPVTSGSKQSDTLESTYSIENVTHAPEFSNTKPRA
                     FMMLHIMVVPMANSQIQVQISPDATISNVLEQVCHDCNLGPMDLYALLCQKTAEILSP
                     NEVASKLECTSHNLVLVERTSLGKAFVPARDSHAQAVLEEPKYKTAMDMISSYKAYSV
                     SRRHHIVMGRHERVISLDGEWLHIIRPAEKRVSHAKTTSYLLTSIIQCELNPRLPHVF
                     RLVAHRVHTQDTKRYEFEAEDAVRAQEIVNEINQQRRQ"
     gene            complement(<115792..>116388)
                     /locus_tag="MRET_4119"
                     /note="MRES_16610"
                     /db_xref="GeneID:38740885"
     mRNA            complement(<115792..>116388)
                     /locus_tag="MRET_4119"
                     /product="Hsp90 binding co-chaperone (Sba1)"
                     /transcript_id="XM_027630746.1"
                     /db_xref="GeneID:38740885"
     CDS             complement(115792..116388)
                     /locus_tag="MRET_4119"
                     /codon_start=1
                     /product="Hsp90 binding co-chaperone (Sba1)"
                     /protein_id="XP_027486659.1"
                     /db_xref="GeneID:38740885"
                     /translation="MSSAAVPEVLWAQRSSATEDEKNIIMLTINVPNMTADATKCDLT
                     STSLKFESTVQGDASKGIEGHKYTFNIDFFENILPAESKQHLTSKCLYLVLRKEKKQE
                     EYWPRLTKEKVRLHNVKTDFDKWVDEDEQDEANEAGDMPFPGGMDMNALMSQMGGGAG
                     GMDFGGMDDDAEDDDDEDEAQPPAAEADGASAKTEEAA"
     gene            <116594..>117589
                     /locus_tag="MRET_4120"
                     /note="MRES_16615"
                     /db_xref="GeneID:38740886"
     mRNA            <116594..>117589
                     /locus_tag="MRET_4120"
                     /product="nucleolar protein 15"
                     /transcript_id="XM_027630747.1"
                     /db_xref="GeneID:38740886"
     CDS             116594..117589
                     /locus_tag="MRET_4120"
                     /codon_start=1
                     /product="nucleolar protein 15"
                     /protein_id="XP_027486614.1"
                     /db_xref="GeneID:38740886"
                     /translation="MAERPDTRLKAKTKKASTDIAKGKPVKKVVKQPVKQVKKQKAST
                     NTEKPAIAKKSKSVRIHEVPNVVQFPSDKSASSLSVPRKAKATTVVDADEDDENEMLS
                     GFPGDPEHEDEDDEEEDDEGEEDDEEDEEEDDDLFSKHAIPTLDEVVKLPSSRDDASV
                     RKRLEKAKSKKRLAPNDEEPEETGVVYVGRLPHGFFEDQLRAYFSQFGDIKRLRLSRN
                     KNTGRSKHYGFMEFESPDVAEIVVDTMNNYLLDGHLLQLAMIPSQEVDPNLWIGANRK
                     FRRVPMDRVERKRRSKSRSAEERAEVNRKLLQRQKKRRAALARAGIKYDFPGYQF"
     gene            complement(<117633..>120284)
                     /locus_tag="MRET_4121"
                     /note="MRES_16620"
                     /db_xref="GeneID:38740887"
     mRNA            complement(<117633..>120284)
                     /locus_tag="MRET_4121"
                     /product="type II protein arginine methyltransferase"
                     /transcript_id="XM_027630748.1"
                     /db_xref="GeneID:38740887"
     CDS             complement(117633..120284)
                     /locus_tag="MRET_4121"
                     /codon_start=1
                     /product="type II protein arginine methyltransferase"
                     /protein_id="XP_027486628.1"
                     /db_xref="GeneID:38740887"
                     /translation="MASTGAQSAPRTWPHVPVSLFVSSGAWHVPVQGSDLSTLQSSLH
                     PLHEAAHANALNTLAVPNPASIGLQVPNSPEDEKNMTNVEKCRHWALADGYDGIAIEL
                     ANARWHERWEHLCLRPDSDTPGLPRSTSRANFSSLPGDMDARIQLEAETWRAQPHFLR
                     PELNILHARETPYVTAIISQWLELDSLDEGVRFDSELALRQELAYASYVGVTQIILPA
                     PSSDPERRPFLADYARIVRSCLEGMADQPPLVHASMKVAVRLPVSSTYILTSMLMHQA
                     TSKGPNGAAAMPAAAYLRTKDNWAWETWERLQDLCGYHSQLHIALDLSMPLPPTSSMM
                     RWIHEPVSHILLPSSSFLANAKGYPVLSKSAQTLVRSLIPHTPHIILSDITNPPIQHV
                     RGGPIAYIQYIRHLIKTMQPPTKLEHLASTFGDCLQAPLQPMSDQLAAGTYDVFEADT
                     VKYNLYEEAMFQAFAQHGSPGTRLQVWIVGAGHGALVPRCLNAAERASRVVHITALEK
                     NPGALIALQDRQLREWGSDRVRILLGDMRAMPVPPNVADRADVVVSELLGSFGDNELA
                     PECLDGAMRFLKPNGISIPTSYMPYIAPVTTPALHSAIKTGMSQTSSAQAGQGMGMAQ
                     DTVQFDAPSVVLFKRMNLLSGLDSASQYPRVQACWRFEHMSMDESGLACDVHGLPLTN
                     NHNARSSLNTFYIPQAGVCHGLAGFFEAHLFGNVMLSIFPDPTRASRDMLSWFPIFFP
                     FRTPLYVPANSELDVHMWRLTDNKHVWYEWSAEAFMLLDTIHGQSSTTALSPQGHALH
                     MFQDESNHSDSLPPFTNAPHTPMMPSTGVMSPVMDNTSADASSSVHVPNTNGVSVAPN
                     AAGRRIKVGQTDLMNPGACGSKSIIST"
     gene            <120416..>121332
                     /locus_tag="MRET_4122"
                     /note="MRES_16625"
                     /db_xref="GeneID:38740888"
     mRNA            join(<120416..120427,120453..121144,121170..>121332)
                     /locus_tag="MRET_4122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630749.1"
                     /db_xref="GeneID:38740888"
     CDS             join(120416..120427,120453..121144,121170..121332)
                     /locus_tag="MRET_4122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486509.1"
                     /db_xref="GeneID:38740888"
                     /translation="MGSSFEELKRAALEQSQKQRSQLDKALEERARKKRDDERVQSER
                     ANQRAEWMARERLRREKQRALDQERIEMQKDAQKRREAAARAAEKAAIEKAVGRTAKR
                     APALDKARSVAVQHRSQVRRPRETVTALTREEKRMKRMAKDMGVPFRPQKVRVRSDAS
                     EAAPSQVHTLAPRRQNAREEFIAQERRRKELRHQQREEEDEEEDEDSDEDDVEPGPSH
                     ASIRDQIWQLFGRNRQAYMARDIDSDDDMEAGADAVLREELRSSAFGRREDEREEQHL
                     LEEKRRKQNALH"
     gene            complement(<121342..>121914)
                     /locus_tag="MRET_4123"
                     /note="MRES_16630"
                     /db_xref="GeneID:38740889"
     mRNA            complement(<121342..>121914)
                     /locus_tag="MRET_4123"
                     /product="N-alpha-acetyltransferase 50"
                     /transcript_id="XM_027630750.1"
                     /db_xref="GeneID:38740889"
     CDS             complement(121342..121914)
                     /locus_tag="MRET_4123"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 50"
                     /protein_id="XP_027486626.1"
                     /db_xref="GeneID:38740889"
                     /translation="MSWKLPATAYFPRTVPSTNAPVRSHIATRSNVCVTAVTPNNVNQ
                     VRRINAALFPATVNEEMYDGALKDDTNALFQIALFNDIPVGAICCRLEDGSDATKCKV
                     YVMTIGVLGPYRRLGLATALIKYILAAATPGSLFAGRSVECVYLHVQTSNQGARAFYE
                     QLGFTLTETIPAYYTHADPASAWVFEKRAN"
     gene            <122053..>123414
                     /locus_tag="MRET_4124"
                     /note="MRES_16635"
                     /db_xref="GeneID:38740890"
     mRNA            join(<122053..122078,122104..122133,122160..>123414)
                     /locus_tag="MRET_4124"
                     /product="actin-related protein 3"
                     /transcript_id="XM_027630751.1"
                     /db_xref="GeneID:38740890"
     CDS             join(122053..122078,122104..122133,122160..123414)
                     /locus_tag="MRET_4124"
                     /codon_start=1
                     /product="actin-related protein 3"
                     /protein_id="XP_027486546.1"
                     /db_xref="GeneID:38740890"
                     /translation="MSRSNVIVLDNGTGYTKMGFAGNSEPSFVFPTAIATASSSAGGQ
                     SSIGGRPSVPSKPSGMSTSSLVSKRGIDDLDFFIGDEAYANAKTYQVHQPIRHGVVEN
                     WDLMERFWEQSIFKYLRAEPEENYFMLTEPPLNPPENREATAEIMFESFNIKGLYIAV
                     QAVLALAASWTSNKVTDRTLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPLAGRDIT
                     YFVQQLLRERGESANIPAEDGRRVAEKIKEDYSYVCQDIVREFRRYDEDPYKYFERYQ
                     GENTVTGRPYTVEVGYERFLAPEIFFNPEMVSSDFLTPLPEVVDTVIQQSPIDVRRGL
                     YKNIVLSGGSTMFQHFGQRLKKDLSSIVSERLAASEAASGNLARSSGLDVNVISHRMQ
                     RYAVWYGGSLLGSLPDFYSFCYNKHDYEEHGPSIVRKFSVFGGV"
     gene            complement(<123417..>127523)
                     /locus_tag="MRET_4125"
                     /note="MRES_16640"
                     /db_xref="GeneID:38740891"
     mRNA            complement(<123417..>127523)
                     /locus_tag="MRET_4125"
                     /product="phosphoinositide-3-kinase, regulatory subunit 4"
                     /transcript_id="XM_027630752.1"
                     /db_xref="GeneID:38740891"
     CDS             complement(123417..127523)
                     /locus_tag="MRET_4125"
                     /codon_start=1
                     /product="phosphoinositide-3-kinase, regulatory subunit 4"
                     /protein_id="XP_027486547.1"
                     /db_xref="GeneID:38740891"
                     /translation="MGNTVSGTSHRIAGAAELLQDPSLQYEGSLGSSRFLRATRVRHE
                     HGLLVVKTFLKPDAGMRLRGLLRRLQLERDALENVPNVLAMQEVIETEVAGYLIRPWL
                     AYSLYDRVSTRPFLTDMEKLWITYQLVYALHATHERKVAHGDLKCENVLVTSSLCVYV
                     TDFASLFKPTYLPLDDPTDFSLFFDSSARRVCHIAPERFYESVTEVPSSASVKRTSGT
                     EVENVSDVLTLEPYHEMLGLGRPHGRITEAMDVFSLGCVLAELWRDGSPLFSLSQMYR
                     YRTGDYDIRPKLDEIPHTGARDMIARMLELRPLERPTLEQLLADTHVFPDSFSACLHL
                     YLVDLQRPSSVLHEKRPPLPSLEPDDRMEKLYQDWPTLLGFIGDVEPVGGDDVCLNVS
                     IPGVSIPCHARRHAPAPDSEALLVLNVVLAHIRHAIRPSSVCHALALIVHMSWAWLSD
                     ETRLDRVLPYLVALLSHAHPHVRAMALHGVAALFECLTHLTHANEHVLQECVWPWLAP
                     LVRDESVHVRCMAASCLARLARQAFRLWHASPSLDTDLAALRACLGEYLGALAVDTSS
                     SVRRELLAHAPWALLGTERIESDLLPHMLTYLNEDDSQLRMSLFEAVVPMAPLVDVDT
                     YLHPLMIQAFGDEDAHVQACALHAFGMLIEVWRPVVLWELALYVASLLCHPNAWVREA
                     SIDALVRAADTVRDADRWLRLYALLRPRLACDVARLSSATLREHVVPPIPPSALEACI
                     ASDVPAPRTDPAKPAQEAIDELVYPPAKPPTVDPDWAAQLPPMPAGTAPHLAALWWYV
                     ESRRRSAPRTRGRGPDASLDGVPQRTVFFTAHTTDLAPSPFSLRTAERRLQTLAPVQL
                     RPVPSEAPSQAPAAVPLSDSLRSARRSSDTLSTRSFKLPFLGMPSATAQTSTTLVHAQ
                     AERARAERLPEPPAPQSPMHTYEGVDPFIHAHLRAVYHQLASIPAVHPPTKPRRLDSS
                     SNQRPQGALIASFGEHQGAITSVCVSHDHLFFVSASMDKTVRVWDTARLEKNVNSRSR
                     LTYATHTAPVTCVLVLSGTHCIMSASMDGAIHVWGLNVSLGASLPRYAKPYILGRHTW
                     TGDHVRCMAQWSGGTDPVVLLGTSRGRMVFWDVRHMREINTLSHPAAHGSIEALALDP
                     QRHWVCVGTSNGYVALWDTRFHVRLQTWRTSNHARIRACALHPTRPHVLTVATSAVVS
                     LDLGTGAVLETFYSREFGEHVPNITLESCADEAPSDTCWDGSYALCVGADGYMSSPAE
                     SPRGWIVTGGSDRVVRFWDLGRADTCTAFGSQIHGEFTMTHHRYIHTFQCIEAPPKRS
                     PLHIHQQVKDAMGTLTSHQDTITALAVIEAPYRCVVAGDRSGVLCVWE"
     gene            complement(<127577..>128329)
                     /locus_tag="MRET_4126"
                     /db_xref="GeneID:38740892"
     mRNA            complement(join(<127577..127604,127633..127801,
                     127827..128137,128166..>128329))
                     /locus_tag="MRET_4126"
                     /product="nucleolar protein 16"
                     /transcript_id="XM_027630753.1"
                     /db_xref="GeneID:38740892"
     CDS             complement(join(127577..127604,127633..127801,
                     127827..128137,128166..128329))
                     /locus_tag="MRET_4126"
                     /codon_start=1
                     /product="nucleolar protein 16"
                     /protein_id="XP_027486543.1"
                     /db_xref="GeneID:38740892"
                     /translation="MANPRQRRKARSGKWSGATKSAKRSQQRRLKRAPTVMGPEVLRE
                     NWDPKLTVRQNYAKLGLVPTLASQSGGLDRNDPYAQVAPAEPSSSTDRPRKGMARVIR
                     DESGQIVDLIEYSEEDHVETTPWGKQLNADEEEPVDQAASLLPPRLNEGRDTDTVQAL
                     EKIAAEHQPVERFASAGEHAWLVDLVKAHGSDVDSMAQDLRRNVWQKTPGEIRRALKK
                     AGLAT"
     gene            complement(<128418..>130112)
                     /locus_tag="MRET_4127"
                     /note="MRES_16645"
                     /db_xref="GeneID:38740893"
     mRNA            complement(<128418..>130112)
                     /locus_tag="MRET_4127"
                     /product="retrotransposon"
                     /transcript_id="XM_027630754.1"
                     /db_xref="GeneID:38740893"
     CDS             complement(128418..130112)
                     /locus_tag="MRET_4127"
                     /codon_start=1
                     /product="retrotransposon"
                     /protein_id="XP_027486544.1"
                     /db_xref="GeneID:38740893"
                     /translation="MAGPVRVRVRSAHPLPPAQFWVVIDRADDIDVVRERIARILQTR
                     YDAPVTATALCLSVLDFEVWDYVGDVLQDDGLVTVSMIKRRKVCEAPSENTDMVVHPD
                     AERQIMAEAHKISLLMCSECGVQPRKTLGVKRKKPEASRFVHDISQDLEQAELDEEPD
                     ELDYEDEVDYDDVMDENEVIDEVDYDDVVDDHDELEEVVRAKDEDENQENDEEENEGE
                     REEEESEESEDEEEESEEEEGGDEESEEEESEEEEGGDEESEEEDEEEESEEEDDGES
                     EVEDNEEESEESQEEEERKDEDDGGDDEQGDSEPSVYSSSIPSVWVPPGQGKDRTRHK
                     NQKRRERRKAARNTQFALDHQGSMSCPRPATDVRVDAVPHLPPGGGSLDITSSTPETS
                     PLESIAQRMLERTTVGHRKRRKRNQELALPSIHTPAFVSASDVLKAHQPEDPPKLMPI
                     PSKLAPEELPANVSVTSTDCEQWYYEQPYYQNEEDDDASTQAYYDMQRQVRASLEQEK
                     QQEDVQDSVLDEEHDPLRESLPRSFGRSSDHRHDEGAPRHPILDRIQAIRASIYGA"
     gene            <130218..>131036
                     /locus_tag="MRET_4128"
                     /note="MRES_16650"
                     /db_xref="GeneID:38740894"
     mRNA            <130218..>131036
                     /locus_tag="MRET_4128"
                     /product="FAD synthetase"
                     /transcript_id="XM_027630755.1"
                     /db_xref="GeneID:38740894"
     CDS             130218..131036
                     /locus_tag="MRET_4128"
                     /codon_start=1
                     /product="FAD synthetase"
                     /protein_id="XP_027486632.1"
                     /db_xref="GeneID:38740894"
                     /translation="MADERLRAWVSSIDATYELVENPEVRKTCPDLASKVERALWACE
                     SAWHDYGVDGCAFSFNGGKDCTVLAHILAASLRRLQKKQGTLDLVPIRTLYVACDDPF
                     PEVEAFIGYAATRYHMQLRTEHGPMKQALDSYMKSTDGKGVRAMFIGVRHDDPHGSKA
                     RVRVPCDPTWPQIMRVHPILEWDYRDVWAFLRCPLLRSREEHVPACVAGQEAGVPYCV
                     LYDQGYTSLGDRYHTTPNPQLHDMSKNRFQPAYLLQDGSKERCGRLSHSTKPTT"
     gene            complement(<131070..>135299)
                     /locus_tag="MRET_4129"
                     /note="MRES_16655"
                     /db_xref="GeneID:38740895"
     mRNA            complement(<131070..>135299)
                     /locus_tag="MRET_4129"
                     /product="5'-3' exoribonuclease 1"
                     /transcript_id="XM_027630756.1"
                     /db_xref="GeneID:38740895"
     CDS             complement(131070..135299)
                     /locus_tag="MRET_4129"
                     /codon_start=1
                     /product="5'-3' exoribonuclease 1"
                     /protein_id="XP_027486633.1"
                     /db_xref="GeneID:38740895"
                     /translation="MGVPKYFRWLSERYPLIMQLVEENRIPEFDNLYLDMNGIIHNCS
                     HPNDGEATFRIAEEEIFLGIFAYIEHLFSKIRPRKVFFLAIDGVAPRAKMNQQRSRRF
                     RTAQEAKEGLQKAISRGEDIPASPPFDSNCITPGTVFMRKLSIQLEYFIAKKVNEDSD
                     WRDVQVILSGHETPGEGEHKIMEFIRTIKAQPGYNPNTRHCLYGLDADLIMLGLLSHD
                     PHFALLREEVVFGPRRAKKSIGLESQTFYLLHLSLLREYLELEFSHLRKTLPFSFDLE
                     KIIDDYILLHLFVGNDFLPHLPGLHINEGAIELLFRVYERVLPRAGGYINQQGRLQPR
                     RLELLIKELASVDHSNFVGAHLPKVKAAMDKSRRAQESMQLEKRIELTPRQAEAVRRV
                     VDLITSFLDNPGGASHHIKFSAIPAADETDILQIMATKLQLEFETMAYDPEDDTLHSL
                     FGFPSGRAQALRLNQSHNGATREQTKKWMLSKIAAFIEALASHDPQEDALDMEGSSDG
                     PTRQVERMYRDEKAVYYHSKMSIDSKDPEQLHDIVYNYIEGMQWVLHYYYDGIASWGW
                     YYHYHYAPHISDLTHIGDFTFSFDQGRPFLPFEQLMGVLPPLSKQLIPAAFQPLMTDP
                     TSPILDFYPATYESDLNGKKNSWEAVVKIPFIDQDRLTQALERRQGGLTNEERERNSH
                     GHPHRFWYDASYRHTMPSSLPGFLPDLLDTHTRIETYTLPSMSGRRFIKTLPKGVSLG
                     LNAMPGFPSLKTLPFTHKLEKTGVEVHSQPSRDLSMILHMNNPGMTQDVAAYAKDLIG
                     QTTFIHWPYLFEGLVVGVSDSHREYRAHWKDMDVVTQCTESPYGSQSFERQQRALKEQ
                     YLKRHGMALDRIDVLLHVRPFKGLSHGYDGSIIKQYEPSSQSEVVHPLQLLVSQVRHP
                     DARFMERPPMTVSEEYPEGTKVFFLGVPGFGCPARVIGTAGDQITVEMAFFHDMAKEH
                     AILRKIVQQRAQVKYFTTQEVTAQLRVSSLVLAKLASGVAVYHGNQRMNIGLNLKFEA
                     KGRKVLGYSRRTSQGWEYSERAVRLMQDVLTKFPELRRGLSKRLASGEFYSSEDIFEQ
                     NTAQRIKDLRTWIHENGLRDMDIVPLYVDRLERSVISLLESATSIMAQKRAQHGLAVK
                     RQILRGLPRGALLKPEQARYRVPEQTFDMGDRVINVFDFGPLPLAAKGTVIGLGANKC
                     IDVVFDAPFLAGTTLGDACSNHRGATVSTSSVLNLSTPQIATRWGEESVKEAHLSPLQ
                     RTLKVREQPASQDIKGTLFYQPAAPKAQKERPRSAATPQQGPVDATAQHLKALSLQPL
                     AHQRPPPNAWKPRGAPSSGPPKKQAGPDKTGPLKQSGPPKTGAPKKQPGPSKTGPSKQ
                     SGPKKTGPARQGSKKAGPPKHGPKQPSPPKN"
     gene            <135706..>137094
                     /locus_tag="MRET_4130"
                     /note="MRES_16660"
                     /db_xref="GeneID:38740896"
     mRNA            <135706..>137094
                     /locus_tag="MRET_4130"
                     /product="ribosome biogenesis protein NSA1"
                     /transcript_id="XM_027630757.1"
                     /db_xref="GeneID:38740896"
     CDS             135706..137094
                     /locus_tag="MRET_4130"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA1"
                     /protein_id="XP_027486695.1"
                     /db_xref="GeneID:38740896"
                     /translation="MVDGGSGSGSRDPMSTAPVPEVRVFVGDSAGRVKVLYTQSKRYE
                     TLTVPGCRVGSAMACQALACGLFSLPEPACVLVVARKNGTLDVIHVDQDAETGKLLCT
                     IHEDRMRVGLERWVGLRLSVNGLFACTSGGSFRHVDLAACLHENAFEKDRVSDATCTW
                     TIPSPLHHVAFYPPDASQPVTHVASGGEQVLLSIWSVERWWAHYRQPTEALETPSTPP
                     TSKKRAAPTSSKHRELAPGEVWRAKNLPNDHLSLARPPMIRCIGFARHTPPDGAQDAL
                     ASMRVMVGTKDGLLRVYEPSKKPRHVQEWPVVPKGQGSIRVLHAMPHTLLVSDTSRHL
                     YMLDGRTGHVQFQYKDMTGTVSDVLTLHDSQQGRTWVLSASLDHLIRLFGTQRSTMLE
                     QYFTGTDHAVSLVVDPQWTPPVPHNDDEDVWAHMSTVGQDASDDDSDTDADEASAQRA
                     EKRHRRTVEKAV"
     gene            <137124..>140618
                     /locus_tag="MRET_4131"
                     /note="MRES_16665"
                     /db_xref="GeneID:38740897"
     mRNA            <137124..>140618
                     /locus_tag="MRET_4131"
                     /product="cullin-associated NEDD8-dissociated protein 1"
                     /transcript_id="XM_027630758.1"
                     /db_xref="GeneID:38740897"
     CDS             137124..140618
                     /locus_tag="MRET_4131"
                     /codon_start=1
                     /product="cullin-associated NEDD8-dissociated protein 1"
                     /protein_id="XP_027486639.1"
                     /db_xref="GeneID:38740897"
                     /translation="MAVSRSGSTPRLEVLLDDMRSTDSDVRYMALHDLLGVVRQHTSE
                     LRGSRQEHEAVERVLELLQDTHSEVKNLAVTALGVFATRLRDDHVTRMMEVVCAGMRS
                     SLEEERDICASALRTLLHDLSQAGDKAARWKEGIVHYVTPLLASQLEVRDYGLQATAL
                     SALHDVLLQAGPLVAAQAPLEQVVAETLLSKLAADHSSLVRRAMQGLGVLCQLCSAHT
                     YDAVLERGLAGQPLSAHTSVQLLGVLARETPQRLSPHVPTYVPRVLSVLRHALGTDDD
                     VGETCLATLQALVCIGSMDASCVSAATEAALAALTYDPNAMDMDEDDDITTDDDELEL
                     DDVSDDDDMSWRIRRAACRVLGTLYEHGTMDASHAPHIAASLTDRLNEREETVRLEAL
                     AALMQVLRVAPRALGPHTQMVSALSSWRSATAQVAALQALTALVASLGADLPQSDTAL
                     RMALSVIEDDAAASHYSQGRCMAGLELLKQMCLSAPSVVLTDVDRVSSTLAQVSCQPY
                     HRTALEALAVGPPFFVHVAPQAPAACAERLCEVLCRPWDHATALDASLVALDAALCSV
                     GPRLASLPRLLQVISTRLQDPVTRARCVQAVQDVMTCRSLQTCMPVHELGRQSLPLLA
                     SLAHHRDMGAAALHALHSVAVVLPSDAQPTVLELLQRPMPPLDAPTLPPTLALAQQAV
                     QYDPPVAHHVAKWVLPAMLPALADVPPPALEAFFALLTSLASAEDALAPRLVEALEQA
                     WEAHCAQRSVHMPLVFAQCLVAAATASASIDVVLARVEALMNMPDAVPQTLAHYTIGV
                     LGQRSLLAGWPHAKTVYERMGSMHGQGTGSMFALGGMLLGDQHFLAPVAERLAEDEPG
                     VLPILREAFAMASETQTRELAPSVWSYLIRPKLLSAEPDACTECIARIVYADTSLLTE
                     LAQLVHSQHEQHRAMALGALRTLLSLDRQQALDIQPHFSAFMERLSDPCLSVRHASVL
                     ALHAALNSRAALVMQHADLVLPLLYETTVVREELKRSVRMGPFTVIQDDGLDLRKNAH
                     ETLFTLVDTCLDQVRTRDVLDCVLRALSDDDSIKLLGCLMILRLADLECADVAAYLDA
                     IAPKLHAVLTRKLRDNATKQEVEKASEITHASLRVLARLSPMASSHPAWSDLITQTRA
                     SPQGPAFLALLAEQEDLT"
     gene            <140690..>142063
                     /locus_tag="MRET_4132"
                     /note="MRES_16670"
                     /db_xref="GeneID:38740898"
     mRNA            <140690..>142063
                     /locus_tag="MRET_4132"
                     /product="homoserine O-acetyltransferase"
                     /transcript_id="XM_027630759.1"
                     /db_xref="GeneID:38740898"
     CDS             140690..142063
                     /locus_tag="MRET_4132"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase"
                     /protein_id="XP_027486642.1"
                     /db_xref="GeneID:38740898"
                     /translation="MSGCFEIPGPTSPLAVGQKQRYLCVPTFQIDAGDVLHNVPVAFQ
                     TWGTLNPDKDNAILACHPISGNANVEEWWTPLFGPGHVLDTSKYFIVCCNAIGSPYGT
                     LSPLTRKGGEDVSGGTWKCSPHVHAPDEQTEQLWWGPDLPKTTIRDDVRLQKHVLDFL
                     GVEQLACVMGGSMGGATSLEWPLCFPVRFPSSPDALVTMAPEQKPYVRSIVVLAASAR
                     HSAWCIAWCEIQRQAIEADTRYQHGRYLLRDPPSGGLAAARMCALMTYRQPHSFERRF
                     SRLRGKSNMTSAPNDSQASTLMEEGGEGDIEEDVAKIREPQAQEQYAVQSYLHHHGAK
                     FLTRFDALCYIHLSDKLDSHDVTRDRASWSQDTSSESATLNGVLRHLGKAPNSPRMLV
                     LSVTSDMLYTSAEQKAIHDAVPASELVHIESSEGHDGFLIEYPQIDRAIREFMERLNV
                     SHNSSAL"
     gene            <142174..>142656
                     /locus_tag="MRET_4133"
                     /db_xref="GeneID:38740899"
     mRNA            <142174..>142656
                     /locus_tag="MRET_4133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630760.1"
                     /db_xref="GeneID:38740899"
     CDS             142174..142656
                     /locus_tag="MRET_4133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486489.1"
                     /db_xref="GeneID:38740899"
                     /translation="MYCMRWWIPIFLLPFPAAPPAFVLLFLLCYTLYTRPCVYCGAIV
                     LGLVLSSCYFTTPYEPASLSVPASWMHTRIGFGLSRFVDWLVSPASKGAPHVIEPHAG
                     CSSCFATLNWTHFFTPLARRPYCETGAVYPQPRTSLTQFIGVPGTALGFELDWSLFIS
                     "
     gene            complement(<142642..>144264)
                     /locus_tag="MRET_4134"
                     /note="MRES_16675"
                     /db_xref="GeneID:38740900"
     mRNA            complement(<142642..>144264)
                     /locus_tag="MRET_4134"
                     /product="transcription elongation regulator 1"
                     /transcript_id="XM_027630761.1"
                     /db_xref="GeneID:38740900"
     CDS             complement(142642..144264)
                     /locus_tag="MRET_4134"
                     /codon_start=1
                     /product="transcription elongation regulator 1"
                     /protein_id="XP_027486637.1"
                     /db_xref="GeneID:38740900"
                     /translation="MDEPDKPKDKVPIPGTDGWLRVTTTHGHVFYAQKKTKRSEWTMP
                     EEIRPAVLAWEASLEPAPKKMRTEAPEDEATTPEPLPVEADEFAHLSFEEGKVLFMDM
                     LTSLNGTPREVNPIAPWDRELPKFVHERAYRALPTLEDRQDVFNEWCKYRLREKRAKK
                     PSASQDAFRALLRAQVASTRTTFAAFRDAFQRDPAYEAMVRDHAESGAASLFEAWLSE
                     LKQRKLQQAEAAEQDFLALLTEKISSKDEWAVAKKTPGLATDPRYDAVGSATRRSELY
                     QAWCRRPSQRLSKEERQAQALEHREAQVRREHAKHARHAHSARSDALEEQYETYLRQR
                     LVDTVRDPWMAWEDAKHLVDGRRALFDEHMEHLRGKRRDLLAKLFAKHAQDALQTGGD
                     VILPLVRADPAYIESALPRFVGDTHQGQQHTTLEAEFDAWDQWRHAQARREFQDMLRE
                     NAFVDFWGRLQKRDKGEADTVEAEDEDDEGTMVSLLDMASQLDIQAMESVLKMDKRYK
                     VFAHVPEQRTAWVRAYLQSLSVPKRAVRLRNE"
     gene            <144313..>145020
                     /locus_tag="MRET_4135"
                     /db_xref="GeneID:38740901"
     mRNA            <144313..>145020
                     /locus_tag="MRET_4135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630762.1"
                     /db_xref="GeneID:38740901"
     CDS             144313..145020
                     /locus_tag="MRET_4135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486640.1"
                     /db_xref="GeneID:38740901"
                     /translation="MESDDDDFIGPMPASEPTPSTHNGAYALAEREARQKEAVAREAR
                     QDTSSPRRPDWMLTLPSGPTGPSRLSARGFQQSRGRAQHVAGENAAEAQRLWTETPEQ
                     RRHRILRGETAADEQPPTNTAQHARDAAIRERLGHRAKSLVEQHKDRRREDSRRERHH
                     HRRHRSHSPHRHKTRAEREAEDRQLYGDHAPLLFDKDKVLGAGSRLMDERARAKSIAD
                     ATQLSTRFSNGRSGSFL"
     gene            <145191..>146909
                     /locus_tag="MRET_4136"
                     /note="MRES_16680"
                     /db_xref="GeneID:38740902"
     mRNA            <145191..>146909
                     /locus_tag="MRET_4136"
                     /product="vacuolar protein 8"
                     /transcript_id="XM_027630763.1"
                     /db_xref="GeneID:38740902"
     CDS             145191..146909
                     /locus_tag="MRET_4136"
                     /codon_start=1
                     /product="vacuolar protein 8"
                     /protein_id="XP_027486518.1"
                     /db_xref="GeneID:38740902"
                     /translation="MGICYSCCVGSRSPQYEPLLLDNERDAVADLLQYLENRSETNFF
                     AGEPLRALSTLSFSDNVDLQRSAALAFAEITEKEVCEVGRETLEPVLFLLQSHDVEVQ
                     RASSAALGNLAVNAENKLLIVKLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDDNK
                     SKIAKSGALVPLTRLARSKDIRVQRNAAGALLNMTHSDENRQQLVNAGAISVLVSLLS
                     SADTDVQYYCTTALSNIAVDSVNRKKLAQSEPRLVQNLIGLMESGSLKVQCQAALALR
                     NLASDEKYQIEIVRSNGLPPLLRLLRSSFLPLILSAAACVRNVSIHPINESPIIDAGF
                     LYPLIELLSHEENEELQCHAISTLRNLAASSERNKAAIIDAGAVERIKELVLHAPLSV
                     QSEMTACTAVLALSEDLKPQLLDMGICEVLLPLTDSPSIEVQGNSAAALGNLSSKADD
                     YAPFNAVWDKPAGGLHGYLVRFLESEDTTFQHIAVWTLIQLLESGNHELEQHIRDSPH
                     LLDLVRQLQSRIGTFESEHEQADTSTAADTSGQDVSPEREIAALSRRIEEILFEESDD
                     GTSDAK"
     gene            complement(<146985..>147389)
                     /locus_tag="MRET_4137"
                     /note="MRES_16685"
                     /db_xref="GeneID:38740903"
     mRNA            complement(<146985..>147389)
                     /locus_tag="MRET_4137"
                     /product="cytochrome c oxidase subunit 6a"
                     /transcript_id="XM_027630764.1"
                     /db_xref="GeneID:38740903"
     CDS             complement(146985..147389)
                     /locus_tag="MRET_4137"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6a"
                     /protein_id="XP_027486680.1"
                     /db_xref="GeneID:38740903"
                     /translation="MLALRTMIPRAAALRAAVKPSMRRYNSSLTPNPEAAKEFIEQRQ
                     HAFEHAGKSAELWRKISLYVLIPGAVVLGAYMYKIESEHHAHHEHILEENDGQLPERP
                     DYEYVNMKSRNFPWGQQSLFFNPKVNYPAPEM"
     gene            complement(<147467..>147853)
                     /locus_tag="MRET_4138"
                     /db_xref="GeneID:38740904"
     mRNA            complement(join(<147467..147479,147651..>147853))
                     /locus_tag="MRET_4138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630765.1"
                     /db_xref="GeneID:38740904"
     CDS             complement(join(147467..147479,147651..147853))
                     /locus_tag="MRET_4138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486620.1"
                     /db_xref="GeneID:38740904"
                     /translation="MHGRPWPTAKTKQHGKDATMCSTSHLVLRASLTPVGVFAKHAHE
                     IIRIKTSSGFGSALWMTSWHGNPRHIT"
     gene            complement(<148016..>149191)
                     /locus_tag="MRET_4139"
                     /note="MRES_16695"
                     /db_xref="GeneID:38740905"
     mRNA            complement(<148016..>149191)
                     /locus_tag="MRET_4139"
                     /product="short-chain dehydrogenase reductase"
                     /transcript_id="XM_027630766.1"
                     /db_xref="GeneID:38740905"
     CDS             complement(148016..149191)
                     /locus_tag="MRET_4139"
                     /codon_start=1
                     /product="short-chain dehydrogenase reductase"
                     /protein_id="XP_027486619.1"
                     /db_xref="GeneID:38740905"
                     /translation="MSDVRGPVTLDVVLRALDQIPFSWPFVGILPLLALVYERRGAES
                     WSGLVFPWPTVSEWHDVLMVRHPFVVGCIIFILLRYTSMHMSRLALNLGEPRPDKPDW
                     KEDVIVITGGSMGIGKELVQILSREHKARMAVLDVLEPTYAAASHGAPDILYIRTDVT
                     SEQAVAQAQAQIIERFGRSPSYVVSCAGVAPAGALLTSPVKMFTRAFDINAAANVVLA
                     QAFLPAMISNNHGHFMTVASSASYFSLPNLCAYSMSKTAALAFLESLRAELRAVYKAC
                     RVRTSVVTPTKVRTVLAEGLNEGDDDFLMPVLEPIQVARAMADTLNSGLSRNISLPLG
                     SALLPYLRALPEWYRGALRAMGNTDALVTPESISRGQQALRGHQSNLDHMKKLGVHS"
     gene            <149257..>151092
                     /locus_tag="MRET_4140"
                     /note="MRES_16700"
                     /db_xref="GeneID:38740906"
     mRNA            <149257..>151092
                     /locus_tag="MRET_4140"
                     /product="Sec20 domain protein"
                     /transcript_id="XM_027630767.1"
                     /db_xref="GeneID:38740906"
     CDS             149257..151092
                     /locus_tag="MRET_4140"
                     /codon_start=1
                     /product="Sec20 domain protein"
                     /protein_id="XP_027486600.1"
                     /db_xref="GeneID:38740906"
                     /translation="MDQAQTALPAEALRLRDAVSRRLHDVYHVQIPRLSECKDVSEYE
                     TELHETLQRIASLVQQMADDIDDAESAAERAALKTLVDTNRHELMRVRQASRRALLAA
                     HRATASRQEASARSALLSHAARQNSGVRAAPMDRASATSEQVTGALQRTVKLMSSELE
                     KSGYSTQLLTESSETIAQVSNKYASFNDLLRDSVSMIRQMERAELVDLGILGASITFF
                     LACVLYILYARIFSRGIHALSLTWHASSSIGSSALGLFSALQHREPQHVSRERDPIEE
                     AIRFASSQEAVPRRHRKHAPKSADKPWVDVVELTASPTPPSRSESPGSFSESSASPLP
                     ADLPDSAHADDRLAETSPAFLSPTEKAVTASAAPGKVLTESQSEASSASADKRFTDES
                     ATLSVSSADAGSASISAIPAPVSSEDILTAESPASLVPSEDASSTSSGSSPQPMPTDD
                     LVPEKSATFLAREEDAISASTSALSEPISTKERLTAKSTTFLVHEDPSSAATSTGTES
                     VPTDKEVSESTAAGQKRTDSDPTSTIPEPIASETPATMATSTALDSSGNHDDAATIDS
                     VPSSSSDSTLHAEPTSSEATEMSSPTPPHDLPSSSERRRRPWDEL"
     gene            complement(<151094..>153055)
                     /locus_tag="MRET_4141"
                     /note="MRES_16705"
                     /db_xref="GeneID:38740907"
     mRNA            complement(<151094..>153055)
                     /locus_tag="MRET_4141"
                     /product="Rab6A-GEF complex partner protein 2"
                     /transcript_id="XM_027630768.1"
                     /db_xref="GeneID:38740907"
     CDS             complement(151094..153055)
                     /locus_tag="MRET_4141"
                     /codon_start=1
                     /product="Rab6A-GEF complex partner protein 2"
                     /protein_id="XP_027486601.1"
                     /db_xref="GeneID:38740907"
                     /translation="MSAPYASAIVVSITPKEPSCFAGEELQCTITFTNTNAPPRSDPR
                     RRSVRSASGPQRRGLVAVGTDAPSPIQASASPVAHRKPKTFPYSHPHARQKSVVAYQV
                     EDLSRAFGLLQSEEEEEPMFQPSPHPDMFVSHNEAMDAAMRDSVMTWAGDSVSPLFPS
                     RDTLPVGYEKLLWTFAQFGGTMELEHSLIRPTDFDRLRMRLARGELPRSVPSSPASSN
                     GTPRTLGGGEFGYDAEYEADGLEFDKGLSLANLRERHAPAMATIAALLFGRSTTPRSR
                     HVRTGSTLSDIQTRALMSRTLPTYSTPPSMLGIDMVLAPGEQRSFTFSLKLPADLPPS
                     FHGHSVHFDYYLTVGTSRLDARTGTQPSRLLHVPIRVYNHVAPGVGALARFDLLNPIV
                     TPHADDGAVVAEASRVPHGDAEAERELTAQWIEQLLQDHQPSTERTDPLPAPTCMDAV
                     LDLTLRAGKVSYDIAKNGHVAAVLTLARAKYRLGDSVQALVRMNAPDAMVRIVRIAAS
                     LESHEEIDASMALLPTGRIQKATTQVYATHHENTLDTRQTSFALVIPSGATPEFVTSG
                     IRHGWSLRLSLLTQTSHQGAVAVQPPPHIEARSEGYAAYHHSYHGAPALCGHKGPIST
                     RLEIVECSVPVTVLPNRSKRRTGPVELYA"
     gene            <153158..>155278
                     /locus_tag="MRET_4142"
                     /note="MRES_16710"
                     /db_xref="GeneID:38740908"
     mRNA            <153158..>155278
                     /locus_tag="MRET_4142"
                     /product="replication factor C subunit 1"
                     /transcript_id="XM_027630769.1"
                     /db_xref="GeneID:38740908"
     CDS             153158..155278
                     /locus_tag="MRET_4142"
                     /codon_start=1
                     /product="replication factor C subunit 1"
                     /protein_id="XP_027486602.1"
                     /db_xref="GeneID:38740908"
                     /translation="MDKKRAGASDGGDAKRIKSEPVWRQMAQRRAAGPVAPGSKAIPE
                     GKPHCLAGLTLVFTGELSSISRDDAVDLAKRYGAKVTTAPSSKTSYVILGEGAGAKKL
                     EMIQKNKIKTLDEDGFLGLIAERGTQKLDPAVTKKLEEEEKKVQAAAKALDTPNTTPG
                     QLWTSKYAPRQLRDLVGNKAQIEKLQAWLRDWPKSLKANFKKPGPNATNTFRGMLISG
                     APGIGKTTAVHLVCALEGYEVLELNASDTRSKKLLESELSDTIHNRSIGSWMRGQPTK
                     GRLAIVLDEVDGMSGGDRGGVGAINALIRKSQVPIICICNDRRNPKMQPLYTTTFNMT
                     FSKPTVQAIRSRMLSIAFREGLRVPAEVMDQLILAAQGDLRLVTNMLSTWKLSQKTMS
                     FDQGKAFGAMHQKPTMHTPFSLYSELMSPQRFGPLNKQSLNDKLDYYFQDHSIVPLMV
                     AENYIKSLPAPVQKESAAPLREWKHLHAIAQASNSISDSDLIESLMRGAQQHWSLLPH
                     HGIASTIRPCSLTYGGHSSFPAFPSFLGQNSKRMRLQRQLVELQTHLRLRTTGSKDDV
                     RQSYVSGLLGQVVDPLLDRGQEGIRDAMQAMDEYYLMPQDRETLVELELTHGREDRLK
                     KLPASAKSAWTRAYNAATHPVAFQPGATGAAPKARALASESIPDNEEAYVDDEPDDVD
                     DPPKDDQRDALIRPTKPRKSKGAT"
     gene            <155435..>157330
                     /locus_tag="MRET_4143"
                     /note="MRES_16715"
                     /db_xref="GeneID:38740909"
     mRNA            <155435..>157330
                     /locus_tag="MRET_4143"
                     /product="member of the PUF protein family"
                     /transcript_id="XM_027630770.1"
                     /db_xref="GeneID:38740909"
     CDS             155435..157330
                     /locus_tag="MRET_4143"
                     /codon_start=1
                     /product="member of the PUF protein family"
                     /protein_id="XP_027486636.1"
                     /db_xref="GeneID:38740909"
                     /translation="MIPHPPRSRDSMSSTDPKSASVSATPRGASAVMPSAERIVPAFH
                     EPFLFDDELEATDDSFIRRYNLAAADDDFPLLLKPQETQGLSPHPGQPSPIAPQLSTF
                     SSALDLASLSRMTKRPTHDSMALSPWLHAERLQTPSRDSLSVTSAPPAATAAAAASLL
                     LPHDTPTASMAASFAPPVPDLSMDARPMPGTSPLVSSLPSLGNMGCRVPEPDASRMNG
                     RRAERKRTRAVDEVPRSMRRSDVDLASMQLDELRGDIAQLCRDQFGCRFLQRKLDERI
                     PAQCDLIFAETFPYFAELMTDPFGNYLCQKLLEHCTNAQRDLIVESIGDDLVSISLNM
                     HGTRAVQKTIDFLSTRTQTLVIIQAFAEHVVELIKDLNGNHVIQKCLHRLDAQDNQFI
                     YDSVAAHCVDVATHRHGCCVLQRCIDHASHAQRLQLVREITMYSLTLVQDPFGNYVVQ
                     YVLDLNEPAFTAAITHEFLGHVYQLSTQKFSSNVMEKCLRVAEPSMRHKLVAELLDAH
                     RLELLLRDSFANYVVQTCLDYAEPAQRAQLIECIRPILPSIRHTPYGKRIQSKLQRGT
                     NDEPKSRRESRQQGVYRAPTSRPARRSEPVGHEEMVSALDRMHLGTYAAPSGDMALAT
                     AATQRPW"
     gene            complement(<157381..>159237)
                     /locus_tag="MRET_4144"
                     /note="MRES_16720"
                     /db_xref="GeneID:38740910"
     mRNA            complement(<157381..>159237)
                     /locus_tag="MRET_4144"
                     /product="alpha/beta-hydrolase lipase"
                     /transcript_id="XM_027630771.1"
                     /db_xref="GeneID:38740910"
     CDS             complement(157381..159237)
                     /locus_tag="MRET_4144"
                     /codon_start=1
                     /product="alpha/beta-hydrolase lipase"
                     /protein_id="XP_027486603.1"
                     /db_xref="GeneID:38740910"
                     /translation="MESASASLRNSLRGRRRGYESVLGSSSRAPSLLDEGTHDDWNDD
                     DEFEDAVQTRSSYDETDPYAESDGYSEADPYDMNESAYARRDSWHDYDDEWESDFHRE
                     EDSELLSHSDGSDPAGVAGIGTRRSGRTAPDSRSRGVYVEHPHTAFEDVAVAEEPDQE
                     PLPFHPDELDPETAKVEDFPAFFHHKVGEYGDFNWFSRFYLEIRQLFMLLLTTIGLSM
                     VMGLAILRYMNPFRKNYPKARVDFEYERRITGERYSERVQYYAEFWGYQCEEYDIITR
                     GGWILKAHRISDPRRPGGRGYPVVLQHGILCTSLFFFTSEERSLGFWLVDQGFDVWST
                     NIRSNFGAGHTTYKRWDPRFWAWSLIELGDDLVDVVDFVLRETGYRQLAFVGHSQGTG
                     SMFLALEKYKELGTKLSSFTALGPAVYPGKSLNRLPFRVMRMVPSRWAWSLVFGVREF
                     MPPLGIVRQILPKFLFGHMAYIVFGYLFDFHDHNWVDRHKPKVFCATGVLTSSELLYY
                     WLHCFVARGCVFDPRLRRPWFPPTFPPLTIAYGTIDHLVVGKPLIDRLLAYESNVQIV
                     HILELQGYEHMDMVLGCDAFKVVYPKIKDTIVRTIDPEDVPFVEVPRTGRYI"
     gene            complement(<159579..>160293)
                     /locus_tag="MRET_4145"
                     /db_xref="GeneID:38740911"
     mRNA            complement(join(<159579..160071,160100..>160293))
                     /locus_tag="MRET_4145"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027630772.1"
                     /db_xref="GeneID:38740911"
     CDS             complement(join(159579..160071,160100..160293))
                     /locus_tag="MRET_4145"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027486706.1"
                     /db_xref="GeneID:38740911"
                     /translation="MTKKKRASELDAWCWYCDREFEDEKVLIQHQKARHFKCPFCPRR
                     LNTAGGLAVHLGQVHKAEPDRLENTLPGRDSFEIEIYGMVGVPDSDLISWQVRRSERM
                     AQHTSRASHGMPSQSKRPRIEKGPIPADHLRAQLEAHKALMSGATTTSAPPHITQPAI
                     SATPPPPPPPPSMPSVSAQGIQAPEAPPTHKPTAQRGEKVRLVYTDTIRCPEENMASL
                     PKYAYVEPVL"
     gene            <160610..>163147
                     /locus_tag="MRET_4146"
                     /note="MRES_16725"
                     /db_xref="GeneID:38740912"
     mRNA            <160610..>163147
                     /locus_tag="MRET_4146"
                     /product="bromodomain factor 1"
                     /transcript_id="XM_027630773.1"
                     /db_xref="GeneID:38740912"
     CDS             160610..163147
                     /locus_tag="MRET_4146"
                     /codon_start=1
                     /product="bromodomain factor 1"
                     /protein_id="XP_027486604.1"
                     /db_xref="GeneID:38740912"
                     /translation="MEVSQSTQNHDQNRDATQPTNTATDTAAPQERDSTNTAPVTESH
                     APAPATNAEAQDAQPQSETSAASVPAAAPAQPTEAAPSKEEQPTDAKIEAPTSEQPAQ
                     PSQSEQPTDAKVEAPTSEQPAQPSEPEQPKDAEPEKNESQASQQSTSAPQESNPTPAA
                     APTNAPQDANVNHLETGAQQEDDGLTHQDIAMPHVKYAQNTIRSLKSRREAGAFLQPV
                     DPIALRIPHYTQIIKEPMDLGTIDLKLALTSHRIKLATSTNSSQTRMTDKLKHAIDSK
                     RIDPEKDYYTTVDQFERDVFRVFNNCVRFNGAEHIFSKNAEVLRSVFEKQRKGLATAV
                     AVAEEQNSPEARARRNSSALPTIRRSATGGRPKREIHPPPSRDLPWTEEYMNPASKRA
                     VAARLGRSMENISQREQSYWAKVISDELKFCYRVIDDLLKPAHQDVAWVFYDLPAKDF
                     DWAPAYYSIIKKPIALIPIQRKLKSGGHPDLAAFDADMQLMFRNCFTFNPPDSDVYIM
                     GATLKDVYEAKMQKKPVPPPFPADDDDEDEDDDEDDDDDDEDDDDANAVLVQQLQKQI
                     GELESTLETLESGKNKNPLLITSTRVALNSVQAALAGAMSVTGMSKRKNKKRSASSLD
                     KKSKAGDKKRKSPAAKKPRTSGSSPTSRKRGAGAGSDEDDVRTVTFDQKEELAAKITE
                     LSDERLEGAIRIINEDKPPDAQGAEDEEIELDIDELSPQTLYKLYKYVVRPKKKSASS
                     AEIGPNGKPVPASAPIDGRKRGTGGLKKKNLDEDEEAARIARLQQQLQQFNDVSSGAA
                     SAPAATSGTSDAHTAGADTATKHDDLVASESSSNEDESESESESDMD"
     gene            complement(<163158..>163817)
                     /locus_tag="MRET_4147"
                     /note="MRES_16730"
                     /db_xref="GeneID:38740913"
     mRNA            complement(<163158..>163817)
                     /locus_tag="MRET_4147"
                     /product="trafficking protein particle complex subunit 6"
                     /transcript_id="XM_027630774.1"
                     /db_xref="GeneID:38740913"
     CDS             complement(163158..163817)
                     /locus_tag="MRET_4147"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6"
                     /protein_id="XP_027486658.1"
                     /db_xref="GeneID:38740913"
                     /translation="MEFDPPRVSSRDERDDVGTWRANATACALSDIRSHMIDRNCMDL
                     FMMEAALTLQTSAARKARQANDVVALLEAQDPGSHIPPRLSASDEADMAAGRMESLGR
                     HVGANLTEILLRDKPRLPDTLDRVKFVCKELWSVVWNKQIDNLRTNHRGVFVLQDQAF
                     RALMALGQPDAAHVYVSMQLSFASGLLLGALERLGIPCSVQADAEYPPVCSFHVRLMS
                     I"
     gene            <163967..>169543
                     /locus_tag="MRET_4148"
                     /note="MRES_16735"
                     /db_xref="GeneID:38740914"
     mRNA            <163967..>169543
                     /locus_tag="MRET_4148"
                     /product="E3 ubiquitin-protein ligase UBR1"
                     /transcript_id="XM_027630775.1"
                     /db_xref="GeneID:38740914"
     CDS             163967..169543
                     /locus_tag="MRET_4148"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase UBR1"
                     /protein_id="XP_027486599.1"
                     /db_xref="GeneID:38740914"
                     /translation="MSEASAVVELLPRIATMPTRGNADTYRMTPERAREVRERLCHEL
                     LSVVPVSYLFPASVVPSVPEAYALLDKYDWHISQAQQRADALANMQDSASEPLQPEYS
                     KNRRGMACGHVFRKGEPIFRCHDCSYDDTCVQCAMCYRHSIHALENHDVVFSVADDGD
                     ACCDCGDDEAWHSDLGCEFHSLHPWNERDQEASTASNHASSEQTLDDIMAAVPDSVRH
                     ALSEFCAMLMAFLLETLLHAPKQTQIVIGPDVVDSIKRQPTYESAFPAKGKARLDGDD
                     GQESPPLFVALLWNDEKHSFNEVSDKILEVCSSLTPKDARHFAEMVDRQGRQVVSMSE
                     DVRRLVIMARRIGVIYLLVTVQHAFDYFVEEVAGCVLSFIAELASASLYNTSGPSPNG
                     RAIKALITSTFMRPWHVAEWTEAPATMRRDLFDPSHLCMLDTLLLLDTKMWKGARLQM
                     RHLILDLLACREAKRQIALQFSVVYPRLIETFILHDREPEHSVYHMAVQLFSVPSIAS
                     QLVIERRMLVVQLYILQALFANDHDSRITSLVLPSPPPSHGQANPDTALLRQQKCYHV
                     FYDIRYLLSPQAVQLDIVKHAETYMGMWLEFFAMFHGIAPEKRAVHAHVEFESEMWIQ
                     VFHINSHLGRIAKLLGEALASASEARLCEILAFIGTTMLRHMARLSALNPQVHPANDM
                     HIVTFGECQELVHAYDVASQPVSFHHPMHWLLAEAMKHMHVLTEAHPLRDALSEDDML
                     RLVEHPVRVAVKLAQIRCNVWVRNGFAIRSQAYHYRDSMWMRDIMYDQDLFLQQCGLA
                     LISPERFLLTLMDRFQLLRFLSEESEDHPVYDPHQLVFMAEELFLLLTVLLNEISVPA
                     RWPIEAQVRHELIHYLALGPCTYSDLTKQIPERLTDHGCFDRELAHVALFRKPDGSAD
                     HGLYELRSAFLADVQPFFHHYSRNQREQAEEMLAEKRKQGCTLPLYPSSQLHVLANTP
                     FRTLADVFTCGVLVDMLFHALHYASSKPEPPDTLMNVVLHLVAQGLEERGEAFVDALR
                     SPGRHVDDHNDASLLSLLLGISDKAQTAAYKPKITYILEKAAVWAPEAAELMNHVKKP
                     TEAASTDRDARRKAARARQEVILQKFSAQQQSLLANLEEELGSDDEVDEENSFGTCIL
                     CQEHLDHTRTFGTLVHVQTSRLVRTSVPRDAAALSDVLATPLNLDRLAEGVHDQRMRG
                     RYERMDQQRGPLQLGYPAEAHETGLVAVSCGHSMHVACFHTYLQSTEQRHAMQVARNH
                     PEDLSRFEYVCPLCKSLGNMLLPQPGVSGLSSSADFHADGARFGSITPSETPLSEWVR
                     TANIAILKDTPADTTVYSDYQDMSHGSGCFLPWLVMGSLQPHNPDLGVDFYAADECHM
                     LQRYVNVVQLLASETVEPRMQDRSATVLDALGPSHTALYVPDSLVAYTLAQLEISQRG
                     TPQSVAHSLSPTQVCLVQMLLESLGAMAKLSTAGHEEGSGVSSLRHALYKRLLPHWAS
                     EPSVRRPLLLRNLLGVLVEAAVLVPDELRQITALLYYAHLVQCVFGLAQPMMTPAKSA
                     CKSKEQDLDAALRIFPHARWLVTSIVSLVGYVRGNMTLGFDHLSDAELAKALCMYTLP
                     FLRRAAMLLRVVLGEHAVTGVDAATEYESLLASLHIPSPAEALPGHAQTNELLTMLME
                     GWTKHAYTELAPLFRPLPIQPTPSSNVCNLLLEHPHIYELLPLPNDLTFLLQQTHECT
                     CRRCGTLPPTFSLCLFCGEVLCEQSYCCSDPEDESHGECHQHMEHCGGPVGLHFRVSS
                     NMVVILYQDNGTFSSSPYLNSHGEVDRYLLKSRPQRLHPQRYDELRKQWLTHGLANVV
                     TRRIESTMDPGGWITF"
     gene            complement(<169555..>171325)
                     /locus_tag="MRET_4149"
                     /note="MRES_16740"
                     /db_xref="GeneID:38740915"
     mRNA            complement(join(<169555..171277,171318..>171325))
                     /locus_tag="MRET_4149"
                     /product="E3 ubiquitin-protein ligase HUWE1"
                     /transcript_id="XM_027630776.1"
                     /db_xref="GeneID:38740915"
     CDS             complement(join(169555..171277,171318..171325))
                     /locus_tag="MRET_4149"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase HUWE1"
                     /protein_id="XP_027486598.1"
                     /db_xref="GeneID:38740915"
                     /translation="MTEERNPSSGLPDIGGSSDGLAQMLSQLQNYGPNPFTLLLPSAS
                     GLTLTRNRSGFGPWNAQEHGEAQEEKQEDSEKKREMETKLSRVYESFDLEMLWKRLSE
                     ALSRLQSDPASAQVLLPSIESLMVVSQHVMGTRSPEDEPLECVTSEPGTRRAQMESDF
                     LSFTEKHRKILNLMVRQNPALMSGSFSLLVRNPKVLDFDNKRNYFSQQLHKGRREHYT
                     PLSLTVRRQHVFYDSFQYFNRKSGPEIKHGKLNVRFHNEDGVDAGGVTREWFQVLSRE
                     MFNPDYALFQPCAADCTTYQPNKMSSVNDMHLAFFKFIGRVIGKAIYDGRLLDAYFTR
                     SFYKHILGRKVDYRDLEAVDPEYYNSIQWMLNNDITDVLDLTFAVEEDVFGETRTIEL
                     KPGGSSIPVTESNKHEYVRLVTEQSLTNSIRSQIDAFLAGFHEIIPPSLIKLFSEREL
                     ELLISGLPDIDVDEWKNNTDLRGYKSSDPMIQWWWRAVRSFDQTEKAKLLQFITGTSK
                     VPLEGFAHLQGVNGTQRFNIHRAYGEDRLPAAHTCFNQLDLPAYESYEKLRSQLLLAM
                     KEGAEGFGLA"
     gene            <171509..>171949
                     /locus_tag="MRET_4150"
                     /note="MRES_16745"
                     /db_xref="GeneID:38740916"
     mRNA            <171509..>171949
                     /locus_tag="MRET_4150"
                     /product="MAPEG family protein"
                     /transcript_id="XM_027630777.1"
                     /db_xref="GeneID:38740916"
     CDS             171509..171949
                     /locus_tag="MRET_4150"
                     /codon_start=1
                     /product="MAPEG family protein"
                     /protein_id="XP_027486572.1"
                     /db_xref="GeneID:38740916"
                     /translation="MPLFVLSPASLVHSAIFAGYYSYLSTKTAIRRHVTGKDNTALSE
                     KDDAVYRASRVHGNFAEYTPFTITLLFLAELNGAPTAWVHAAYSTLFVARVAHSFALT
                     RPHTKFSKPMRAIGFFGTIAVILGAGLYNLGLGYEPLKSFLGIQ"
     gene            complement(<172013..>173866)
                     /locus_tag="MRET_4151"
                     /note="MRES_16750"
                     /db_xref="GeneID:38740917"
     mRNA            complement(<172013..>173866)
                     /locus_tag="MRET_4151"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027630778.1"
                     /db_xref="GeneID:38740917"
     CDS             complement(172013..173866)
                     /locus_tag="MRET_4151"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027486571.1"
                     /db_xref="GeneID:38740917"
                     /translation="MHHVFSEYTKENSPQSARVAHTGVPAAATYTKPAVPHVGVDVAP
                     PATASPQQPLQRHLQTYTSSHSPSRPMRPDVTGVPPVAAMTRTPVRSLHPADTLQAWE
                     KDIVQLPEVQRKATLAQMYFLNHYFDSLRYLSDRRARLAQFEQSMKKRGCSPTPSVSC
                     TADQLSESLQNISIGKPAQQRILPSSSEYQKERAKLMAYERELLHKRRTKLRLQQFHI
                     VTQVGQGGYGEVFLARKRDTGELCALKRLRKRVLIKMDEVRHVLTERDILTASKSPWL
                     VHLLYAFQDATHVYLAMEYVPGGDFRTLLNNSGVLREEHARFYISEMLVSVNELHKLG
                     YIHRDLKPENFLIDATGHIKLTDFGLAAGAINPGRIDSMKRRLDQVKDTDVIYRTPAE
                     RSSLYKNMRAQNVRYADSVVGSPDYMAPEVLRGREYGVSVDYWSLGCILYEFLCGFPP
                     FSGAHPDETWTNLKNWTKALQRPVYEKPEDLQFNLSDVAWDMILRLINTPERRYHSLS
                     EVQAHPFFRYVDLMRMRQVKAPFIPHLEHELDTGYFDNFDDPADMAKYKEVQEKQRHV
                     EAMEAKNGMSDGGRAMWVGFTFGKNWGQKVQGGHTTVEPDPEMSGKLSTMF"
     gene            <174060..>174809
                     /locus_tag="MRET_4152"
                     /note="MRES_16755"
                     /db_xref="GeneID:38740918"
     mRNA            <174060..>174809
                     /locus_tag="MRET_4152"
                     /product="kinetochore protein Spc25"
                     /transcript_id="XM_027630779.1"
                     /db_xref="GeneID:38740918"
     CDS             174060..174809
                     /locus_tag="MRET_4152"
                     /codon_start=1
                     /product="kinetochore protein Spc25"
                     /protein_id="XP_027486570.1"
                     /db_xref="GeneID:38740918"
                     /translation="MQAEEAADSALDASVSAPSNVLDFSKLEASIQSFTRRFDQYVQT
                     TVAACDEARLSADAHRADLQEHIKALERERENTKHEQKELWEQVASERDADGKLRTSV
                     QNLAAQREALVQRTASIRNEVSEIRAQMESRKEHKQIQVQRLREQVRRNAPELAQLEY
                     LTGCSLTPSVKNGVVTFSFSLLSSTHPTRTASISLDVSKAQYKVPTYDSLLSAATVKA
                     LVQELSKSGDLYAFLKNIRQALVESLLSADA"
     gene            complement(<174835..>177033)
                     /locus_tag="MRET_4153"
                     /note="MRES_16760"
                     /db_xref="GeneID:38740919"
     mRNA            complement(<174835..>177033)
                     /locus_tag="MRET_4153"
                     /product="aarF domain kinase"
                     /transcript_id="XM_027630780.1"
                     /db_xref="GeneID:38740919"
     CDS             complement(174835..177033)
                     /locus_tag="MRET_4153"
                     /codon_start=1
                     /product="aarF domain kinase"
                     /protein_id="XP_027486569.1"
                     /db_xref="GeneID:38740919"
                     /translation="MRPIVCMTGGIHRLVANARVAQHSLALPVWVPHSKMHVRFASHE
                     ASERRKTLGRLALAPPRYPPKEAPEPIVFDEPAVPFPHRAANQQAAFYRSSRVASYVL
                     AAAIVLGGTAYFGSHALSADDGSPKDRSPPSTLESLYMELKKGLSDSNASQTAQFMVL
                     ALKRSTIIIKAVALCVLDYRRTLNAKYASKEEENESLRECHLRSAQRLLEALQANGGL
                     YIKLGQHLSSVILLPPEWTATMRPLQDQNEPTPLPELEIMFHNETGKTFEEAFSWMDE
                     KPLGVASLAQVHRACDRETGQVLAVKMLHPNVERFSDIDMRMVTILVRWVKRMFPQFS
                     FEWLADEMNKNLPLELDFRHEAGNSLRAQKDFAQYKSTCVYFPKVPWVHKRVMAMEFV
                     NGHRPDDLVYLAEHKIDRNRVSQELSRIFAQMLYMHGFFHADPHGGNVLIRPRQPGSR
                     SSENFEIVLLDHGLYFAIDEELRANYARFWLSLLSRTTPKVTQERRKYAKLIGNIGDD
                     LYPVLESAITGRSGLEGSDNNNPSGVKGRPRKSSLLDLDSNTSISDEEKDHIRKTVLE
                     KEGLLLDVMELLRRVPRVMLMVLKINDLTRGLDAHLHTTHGTARPFIITARYCALAAR
                     RNDKEKLAQCRREHGVSLHWLRDNIVSWWNYVYFNHGLMLLERLSDIKARIAKYTLYA
                     RAMFSDGFDTRAAHLAATGVSAQEHEEQRDREASEKAKRALRSDASSSTA"
     gene            <177242..>179239
                     /locus_tag="MRET_4154"
                     /note="MRES_16765"
                     /db_xref="GeneID:38740920"
     mRNA            <177242..>179239
                     /locus_tag="MRET_4154"
                     /product="MFS multidrug transporter"
                     /transcript_id="XM_027630781.1"
                     /db_xref="GeneID:38740920"
     CDS             177242..179239
                     /locus_tag="MRET_4154"
                     /codon_start=1
                     /product="MFS multidrug transporter"
                     /protein_id="XP_027486709.1"
                     /db_xref="GeneID:38740920"
                     /translation="MHEWENPRHFTLGHEVDGDYVTEVPEYAVDDSSSENEPPHENGA
                     RKKTQRERSRSTADPKMFVYYFRRPSHPAPPLAEAMNAHTAVQGTSPFSLVANATSMH
                     RHHDHDGNFIKRAYTGIHDMLEDYEVRDAKEGAQFEYRLARTRNGLPENVQEAEDIRD
                     SHFGDIETPATPCSKRRGSTTCPDPDPPEKEGAPDPFLVTFESTNSVHDNPRTWSYPQ
                     RVATLAMYAFFSLLGPYASSMVSPAAKVIGEKMDVHSKLVQNMFVGLFMLAFVAGPLC
                     SAPISEAYGRRIVVFTGTVFFIVFNIGCAVTNKLREMLVLRFITGFFGSAILPMGGGA
                     VSDLFELHERGTAMALYTAAPVLGPTIGPLISGWIIQGWGEDRWRWVFWIGTILAGLV
                     FMCGIVFARETYAPFILYLKARKLRKETGDKRYRTVFEKKSETVWQKVKRILLRPVIF
                     LFTEPLVFLPSLYMSIIYACFYLCIASLPRVYNEKYQERVGIAALHNLALAIGLICIG
                     QLGGRFIDYSYKRLSAKHGCRRPEFKLPLMMITVFVLPAGMLLFGWTAQYETHWIAPD
                     IGLVVIGGGVIGSMLLTQMYLADLMTIYASSAISAVASMRSLFAFLFLLFSNAMLDRL
                     DVGWTLSVLALIVAVVGIPAPFLLYRYGPALRARSNYCVKG"
     gene            complement(<179291..>180064)
                     /locus_tag="MRET_4155"
                     /note="MRES_16770"
                     /db_xref="GeneID:38740921"
     mRNA            complement(<179291..>180064)
                     /locus_tag="MRET_4155"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630782.1"
                     /db_xref="GeneID:38740921"
     CDS             complement(179291..180064)
                     /locus_tag="MRET_4155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486567.1"
                     /db_xref="GeneID:38740921"
                     /translation="MKWLRGSNESESQGPMAGYTFQSRMGSLSLHESDRIRFIGFPDD
                     ITNSARATIAHSWPRGISWERFYAGSYEFKLHGRPWDGKAESGIFARRLVRNLLASLY
                     GAGWVMIFSTDVSKKARDKDTFIFRHQSPPPPPAEWISIAFSNYNKIRLIDAPPDLAW
                     ALDRSISVARAPRAMYEYSPGVAELLLNSFYWLAQGSTTMHARQLLLQLVLTLEEHGF
                     TVYASVDQKNTYQDDRSETDTWHLCRPTGWRPGMPVFHR"
     gene            <180183..>181016
                     /locus_tag="MRET_4156"
                     /note="MRES_16775"
                     /db_xref="GeneID:38740922"
     mRNA            <180183..>181016
                     /locus_tag="MRET_4156"
                     /product="delta3,5-delta2,4-dienoyl-CoA isomerase"
                     /transcript_id="XM_027630783.1"
                     /db_xref="GeneID:38740922"
     CDS             180183..181016
                     /locus_tag="MRET_4156"
                     /codon_start=1
                     /product="delta3,5-delta2,4-dienoyl-CoA isomerase"
                     /protein_id="XP_027486704.1"
                     /db_xref="GeneID:38740922"
                     /translation="MTYQGLEPKYFNVSWLAEHVLGVGIRRSPVNAFDTATWTEMHAI
                     FSRIRGDGDVRAVVLYGEGRCFTAGLDLHDPAIMDVVQSGGDPARRSMAIREFVERFQ
                     NAISSIEQCERPVIGVSHSYTIGLGVDILSAVDVRYASKDARFSIREARIGLAADIGT
                     LQRFPKVVGNESWAREVALTARDFGADEARAMGFLSQVFATQEEALLRAVETAKQMAS
                     LSPVAVVGTKLAMVHARDHSVDEGLRYMQYLNGAFLQTEDLVQSMSATMSKTKPTFAK
                     L"
     gene            complement(<181017..>185075)
                     /locus_tag="MRET_4157"
                     /note="MRES_16780"
                     /db_xref="GeneID:38740923"
     mRNA            complement(<181017..>185075)
                     /locus_tag="MRET_4157"
                     /product="elongator complex protein 1"
                     /transcript_id="XM_027630784.1"
                     /db_xref="GeneID:38740923"
     CDS             complement(181017..185075)
                     /locus_tag="MRET_4157"
                     /codon_start=1
                     /product="elongator complex protein 1"
                     /protein_id="XP_027486566.1"
                     /db_xref="GeneID:38740923"
                     /translation="MRNLSTLAWRVYDAPTKPWHGVVADTEGDDSVYVMRVERRDGVS
                     QLTLAHITPTGTEELAVLEVASAPPHVPDVADFRLLADGGSSVNHMPAICVIGSGGDI
                     VLMPVDEEASAPAEVVGSVDQGILAAAWSPEEDVLVLITGGEKRLIVMTREFEVMSET
                     MLSTEAFGDDQPVNVGWGSKSTQFHGSEGKQAAMAAANAPEESDPRGPLVPEDDGLPR
                     ISWRGDGAFFVTSSAEASHDTVHRILRTYTRTGTLSATSDRSVRGISHVLACRPTGNL
                     IATTQRMGGPWAPGRHGRHDVVFFERNGLRHGEFSLREEHGSVPDVPGVSAEPLPPWS
                     CEHQIRLVSWNADGSVLAVVLQRAGLHVLQLWTSGNYHWYLKHESTYEHLHAMTWHPE
                     QPLTWYVSHARVEKRTMCLETACSRGMPPHDAACASVVDGHMLYLTPFRLQNVPPPMC
                     AVAIVDTPQHTVPHVPPATPVHVAWTTQSVEDQTTDIVAILYPDASVHIWSIAYGPLG
                     AAHPRPRPPLKPQRVATYTRPDASHAYQVAVTLCDHVPRVAVLCMEGENTALWTQCGS
                     DTSYQLLDGQGPWRLVSVPNSTSFALHDHRGDVTLFSPTLKPTPLDPLLSFCPTLHIL
                     PAEHEGTWQAIGLTSDGRLLAPHRVLAKDATSFTCTDHLLIWTTHAHEAMFVPLTCLT
                     TTPQVSQLSRRVERGSRIVTAVPSAMSLVLQMPRGNLETTYPRPMVLDVIRDRLDRLA
                     FGEALRVSRAHRVDLNLLHDHCPTAFLERVPEILAQIHHVDHINLLLSNLRNEDVTQS
                     LYRPWDASTRAPMAHLDTKVNQICDRFLEAMQAADERYYLSSILTAHVRKVPADYESG
                     LRVLLKYMHTDMALAEEACKYIIFLVNADQLYHVALGMYDFELALLIAQQSPRDPREY
                     VPFLREMRAKEPLAYQRFCMDDYLGRHAKALAWLAQAGSEHTEAAMSYMVQHKLFREG
                     LVAWAKDPVLLADAYGRFADYLSSHQRPAEAATAYELAGRIDEALNAHKEADQWQRAL
                     TLALEQRMSAQALLHLTRELADQLEEQHKFEQAARVLLRIPDLERAVDLLCRANAFVD
                     AQYECAVHARWDLVETHVAPATLEAHSSLIDEADEIEEQLSKQVARLFELDAKRTHDP
                     AAFYVEDDLPGMDNIDVMSDMSQVTQFTRYTTATSVAPSMSTLSLGSKSRQRAKAKKE
                     EKKKNAGKKGSIYEEGYLHESLQKLLHTRLGTLQQDTKRLLPLLVTLGEKHRNAAQRL
                     QDRLLALEAHAHKAVADLTERHARQVQERAEMAQTLATQVTQLAHAPGAQAEAASAVL
                     ATVWRWRHMQEPPKAVPRVSNEAWKLHFLERA"
     gene            complement(<185110..>188391)
                     /locus_tag="MRET_4158"
                     /note="MRES_16785"
                     /db_xref="GeneID:38740924"
     mRNA            complement(<185110..>188391)
                     /locus_tag="MRET_4158"
                     /product="valyl-tRNA synthetase"
                     /transcript_id="XM_027630785.1"
                     /db_xref="GeneID:38740924"
     CDS             complement(185110..188391)
                     /locus_tag="MRET_4158"
                     /codon_start=1
                     /product="valyl-tRNA synthetase"
                     /protein_id="XP_027486512.1"
                     /db_xref="GeneID:38740924"
                     /translation="MLIRCCARSFQSSLARPRTLHRLIPLIPAAYLRMSQPTEQPPAA
                     PAPPAGGDPPSEGPSKSALKKAAKLAEKQAKSSAKNALKAEKGPAPASGSGAKKEKAK
                     KETKDEPAWVDTTVPGEKKDLSSPMENGYNPLHVESSWYAWWEKRGFFTPRDDEPCDP
                     AKTFVIPLPPPNVTGLLHIGHALTISIQDALIRFYRMKGYRTLYVPGFDHAGISTQTV
                     VEKRLAKTEGKSRYDYGREAFLEKVFEWKDQYQSRISNQMRRLGASFDFSREAFTMDE
                     SRSAAVTENFCKLFEDGILYRENRLVNWCVYLNTTLSNLEVVQKTLPGRTLMNVPGYP
                     PNERIEFGVIVSFVYPVVGSDEKIVVATTRPETILGDTAVAVHPDDERYKHLHGKMLQ
                     HPFIPERQVPLVTDSIAVDMAFGTGAVKITPAHDPNDYDVGKRHNLPFINILNDDGTL
                     NANAGEFQGMKRFSARRAVVEALKAKGLYVETKDNPMVVPVCERSGDVIEPVMKPQWW
                     VNCQPLAKAAVEKVQSDNMVIEPPQSKREFFRWMENIQDWCVSRQLWWGHRVPAYFVD
                     MEGVEQDPADGQWWVVGRTQAQAEERATEMAQGRAFTLKQDEDVLDTWFSSGLWPFST
                     LGWPQKDAKDMQHYYPTSMLETGWDILFFWVARMIMLGVHHTGQLPFKEVFCHAMVRD
                     AHGRKMSKSLGNVIDPIDVIEGISLEGLHQRLREGNLDEKEINKAAQGQKKDYPRGIP
                     QCGTDALRFTLCAYTAAGRDINLDIMRVEGYRKFCNKLWNATRFALLKLQDGYQPLCL
                     ADQDKFVPQSLVEKWILHRLNQTAQQLNQDMLQRSFMSATSCVYNFWLYDLCDVYIEA
                     IKPITDAGADPSARLSAQHTLYACLDAGLKLLHPFMPFVTEELWHRLPQRPQETAETI
                     AHARFPEWQAVHDFGKEAAHFDDVFATVRAVRGLAADYGLTSQIQAFVEVPNNEYRAV
                     LESQCSVMHTLIKGCEKIVCVPAASDVPPGCVVASVSSSIQVHLLVSGLVDFDQELSK
                     LAKKLTLNETQLQRTTALTQKPDWSKTPEDVRAHTQKRLDDLEAEKAALLQAQANFDK
                     LRSSA"
     gene            complement(<188607..>189227)
                     /locus_tag="MRET_4159"
                     /note="MRES_16790"
                     /db_xref="GeneID:38740925"
     mRNA            complement(<188607..>189227)
                     /locus_tag="MRET_4159"
                     /product="histone H1/5"
                     /transcript_id="XM_027630786.1"
                     /db_xref="GeneID:38740925"
     CDS             complement(188607..189227)
                     /locus_tag="MRET_4159"
                     /codon_start=1
                     /product="histone H1/5"
                     /protein_id="XP_027486613.1"
                     /db_xref="GeneID:38740925"
                     /translation="MAPTKAKSAVAKAPAKKSTSTRKPSSMTYEDMIIEAIISYGEEG
                     RAGLGRPTLKKVILAKHPDTGKLPLSSFSTHLNSAIVRGKDKGVFLLPKGVSGKVKLA
                     AKAKHAAGTSAAPKKITAAKKAAPASSSTKKAKSSTSRAASAKKTAIKKAPAKTTTKK
                     TPAKKASAKTTTAKKTPAKKAPAKKAPAKKAATTKKTTTKSSASKK"
     gene            complement(<189710..>191308)
                     /locus_tag="MRET_4160"
                     /note="MRES_16795"
                     /db_xref="GeneID:38740926"
     mRNA            complement(<189710..>191308)
                     /locus_tag="MRET_4160"
                     /product="regulator of chromosome condensation"
                     /transcript_id="XM_027630787.1"
                     /db_xref="GeneID:38740926"
     CDS             complement(189710..191308)
                     /locus_tag="MRET_4160"
                     /codon_start=1
                     /product="regulator of chromosome condensation"
                     /protein_id="XP_027486589.1"
                     /db_xref="GeneID:38740926"
                     /translation="MPPKAAVRKNATQRKRAVDEEDAPRVKRVRTSTLNRPPAPIRAL
                     HAADLSSHTAGTASMQAVYATRTETEASSGSVVPRKLFVWGTGEAGQLSLGGPDDDNI
                     NKLTKPKPFGNKDISVQTDAGQLGTGGAEMIVAGGMHTLLIDAHGRILSCGSDDHGTL
                     GRKYREGSNESEDDVYYVLRPVDGISPTGKDAAPGDDGKVHRFRATRAAASDGCSLAL
                     DAEGRLVAWGHFKDGEGKVCFADTDADGAPREQWSPLPIPALEDVRFAQLACGENHVL
                     ALTLDGRVYSWGLNSMSQLGRFASPYHVRARFTKRDPPASMLLTPELIPELRNIVHVA
                     CGMNSSFAVDAEGRVFAWGLNTRGQTGTGLKKEKVTRPTRVKALDPTRLDGARVVQVD
                     GGEFHTAFLLSNGHVWMCGDSDEGKLGLPHEVLASQGEEGPVLMRTPVHVPIQSDSPE
                     PASIVGIAAGMRFTFALAASGVLYSWGTTSDEAMGQPAESWGDDQSKTTPTPVPMPGE
                     PGAWTIASVATAGQHSLALAVRAP"
     gene            complement(<191390..>192748)
                     /locus_tag="MRET_4161"
                     /note="MRES_16800"
                     /db_xref="GeneID:38740927"
     mRNA            complement(join(<191390..191538,191569..191749,
                     191801..>192748))
                     /locus_tag="MRET_4161"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_027630788.1"
                     /db_xref="GeneID:38740927"
     CDS             complement(join(191390..191538,191569..191749,
                     191801..192748))
                     /locus_tag="MRET_4161"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_027486590.1"
                     /db_xref="GeneID:38740927"
                     /translation="MSAPVEFFTLRLLPGEIYHLDTIRDLQITNVSYSEPENLKGKKR
                     SVLRVHYAGNPIDLEDDEDVEIEDDDEDEREDDEDEEDDDEDEDDDDEEEEDDDDEDD
                     IVDMEPRVPIFTDDDSYVVCSLIPEKVEQVTLNLQISEEEEVGLSVSGDEPVDIIGNY
                     LLPTSLNDLDPELLGELEDEDDEEAPRDRKLIEGPRDDDDEEDDDEEDDDEEDDDEED
                     DDEEDDDEEEDEDEDDEDEDGDIVIEDDDEDDDDEDDDEVLVEEDDDNDDDEEDIVIV
                     PSKKRSVSDLDEDEPKLSRSQRKRLNKKLKAEASGQKQDKTKLPSGLIVEDKKAGSGP
                     AAKPGNRVSMRYVGKLQNGSTFDSNTKGRPFSFRLGKGEVIKGWDEGVKGMQVGGERR
                     LTCPPHLAYGKAKLPGLPPNSTLIFDVKLLEIK"
     gene            complement(<192851..>194245)
                     /locus_tag="MRET_4162"
                     /note="MRES_16805"
                     /db_xref="GeneID:38740928"
     mRNA            complement(<192851..>194245)
                     /locus_tag="MRET_4162"
                     /product="regulator of Ty1 transposition protein 109"
                     /transcript_id="XM_027630789.1"
                     /db_xref="GeneID:38740928"
     CDS             complement(192851..194245)
                     /locus_tag="MRET_4162"
                     /codon_start=1
                     /product="regulator of Ty1 transposition protein 109"
                     /protein_id="XP_027486511.1"
                     /db_xref="GeneID:38740928"
                     /translation="MSLVAWCQAAVEAQRPHVCEKGTLRIHALHSCPRPVCSLYPLAH
                     VHPTDARADEAVPTWQEHVIVTAAYRSQDAWRLAYALELYVYTLPRERAGLVYVSKLD
                     SSGYGPPTPSPAARAHLPPARSLTSTLTAAALHYFLVHDHWTTPIDHISLHVLARAQN
                     AYLFPSSHQHPNKRVLSDAALIRWWQTCLSHVALSVQARAFYIIPGYTRLDSHAIVPL
                     HPAKDSAVSRAQWQYGHPYHVADVPLPLHPCSWEHRHAATRSEALAARVVPTMIPVFP
                     DDPKGRFVNEQAATAHEPGASMKPIPRAASLAHREAMAERQALERLSVDGFWERMGFR
                     QECCSGNAVGIFVLSTTRQGSAAPSPPPKARPCSLPHPMLEDLLLKHMMQDACVWHDP
                     SEAATCTQRLFDAMDRAIQRKGGGDAAPYADVTLPAISTDVLERAPTHPPAHAPPSPA
                     SVRVLPVKKKARRS"
     gene            <194266..>195813
                     /locus_tag="MRET_4163"
                     /note="MRES_16810"
                     /db_xref="GeneID:38740929"
     mRNA            <194266..>195813
                     /locus_tag="MRET_4163"
                     /product="DNA mismatch repair protein"
                     /transcript_id="XM_027630790.1"
                     /db_xref="GeneID:38740929"
     CDS             194266..195813
                     /locus_tag="MRET_4163"
                     /codon_start=1
                     /product="DNA mismatch repair protein"
                     /protein_id="XP_027486702.1"
                     /db_xref="GeneID:38740929"
                     /translation="MHRLPPDTACRVRASARLPTLECVVHELVARAVEAGARRVHVDV
                     DLQAWRVVCMDDGQGDVDAWELRPDAHGLRHTPPMACLPWLSLLEVHGQRRMLVQREH
                     RVLHRGPSKHRDTRVVLHDVFGGVPVRRRYLARRRQRTMHRLRMRLYAWAHARPSVRI
                     TGLGLRDAVPAGRSIHASLTFRTRQDEAWTATLDGTVGDARAYHFVALNGTPHGFACR
                     DDVPWSGSWWTPLYGVLRSSFALRLEVHRAQTLPELVLPGWTALWERLCQAPPVPRAQ
                     GPRAVPLMTREPTASLVLPASLDRVRAIAQVDNKYVLCLCDASLLCVDQHAVDERIRM
                     ERDLTAYVMACLGGEGHSRAIEPCTVPLPAHVVETLRFWGWDAVRGHDDTWHVRAVPA
                     IVPRHADVAQVVTQCATWTAEHADDIRTWLRTAMHAQHGAMSALRYLPPVLRGMLASH
                     ACHTALRFEQSLSREQCDQLVAQWRHTTLPFVCAHHRPSAVCVARVPAAGPTPFPVRW
                     HVLSQLA"
     gene            <195898..>196458
                     /locus_tag="MRET_4164"
                     /note="MRES_16815"
                     /db_xref="GeneID:38740930"
     mRNA            <195898..>196458
                     /locus_tag="MRET_4164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630791.1"
                     /db_xref="GeneID:38740930"
     CDS             195898..196458
                     /locus_tag="MRET_4164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486594.1"
                     /db_xref="GeneID:38740930"
                     /translation="MDLTNLRESLESPVHPAPSRVHDERLTNEFRIAALQLTNLYKQG
                     RKNAREAFMDGYSQALGDTLECVRTAAQGASAHDAQTRLAGLCDYIQRRLDALQSDVQ
                     DQEEAAQAAAVHDPVDDSVSRTRRKARHAHDAPKRATRPPGAAEAPPPSSQSACDSDM
                     DVAPLAHDRSHPRKRRRALRDPRQRV"
     gene            <196585..>199107
                     /locus_tag="MRET_4165"
                     /note="MRES_16820"
                     /db_xref="GeneID:38740931"
     mRNA            <196585..>199107
                     /locus_tag="MRET_4165"
                     /product="phosphatidate phosphatase LPIN"
                     /transcript_id="XM_027630792.1"
                     /db_xref="GeneID:38740931"
     CDS             196585..199107
                     /locus_tag="MRET_4165"
                     /codon_start=1
                     /product="phosphatidate phosphatase LPIN"
                     /protein_id="XP_027486596.1"
                     /db_xref="GeneID:38740931"
                     /translation="MQYVGKLMSSVYNTITPNINPSTLTGAIDVIVVERDVVVEETTT
                     QPDGSTATQKRTTTEMASTPFHVRFGKMSVLRPDERKVTLHLNDSPDPLPYAMKVGEN
                     GEAFFVIKVENPDEPVPDALVTSPVMSPTPGTGEPVPLRLDESHAEPPAPEAAPVELD
                     LDIEGYKFSNSNSQVALKQGQKFANELPLNRQHGGNNPLVLSERLDHHNLRWQHQFLG
                     SVSKLMAVTPGPDKPKTPPARSRRMSDSYSEAVPERPRLAASLSDSDLYARRGADAAT
                     EAVASEVTEQPDMEDEVAGTLTCAPADPYLFQLRVDDNTVYSFELSLCSLPAQDQEAE
                     YVFDEGRVSFQRFLEDASIVRDPRLCIRHNDAYHYRERESDMFTTLAYYRDVLVQNGT
                     PVPKSSAWSRFWRRPAASSDAATPTEAPAPAPAARPETYVKTLRLSSDQLKQLGLQKG
                     VNTLTFSVTSSYSGVATCRARVFLWDCDKPVVVSDIDGTITKSDALGHVFTLMGRDWT
                     HLGVAKLYHDIAKNGYRLMYLTSRAIGQADITRDYLRGINQNNYQLPDGPVIMSPDRL
                     IASLHREVILRKPEVFKMACLRDIARLFGDDPSQPDHKTPFYAGFGNRITDALSYRSV
                     NIPSSRIFTIDSNGEVKMELLELAGYHTSYPNMTDLVDQMFPPVPSMRRNEHIAAYTD
                     FNYWRDDGRASDIALPPDEELVPVTLPSSPPQRGVRSPKSPASSIGSPSSPPLPPRDD
                     ATERPSRIRRLLGLSGRQRSKPLDPAPDAPATSPPPAPPSEPSSLAALDEQDMSPEER
                     QRDRRRQQLLYGTSSFSRNDAKQEADEDPLLEAGDIQFEWRG"
     gene            complement(<199109..>200449)
                     /locus_tag="MRET_4166"
                     /note="MRES_16825"
                     /db_xref="GeneID:38740932"
     mRNA            complement(<199109..>200449)
                     /locus_tag="MRET_4166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630793.1"
                     /db_xref="GeneID:38740932"
     CDS             complement(199109..200449)
                     /locus_tag="MRET_4166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486591.1"
                     /db_xref="GeneID:38740932"
                     /translation="MALDSAPTVRVPPGSILLNRRARKPAYRGVSILQPPDGGGGGSP
                     CHTWVVLPQADVFASALYPLSSHPHLYLTLSMPPCSKWRKRRTRTIQRRSSKDQDAPM
                     DPLELADLNSIINTRKSMASAEALAKQETDAARPTPAHASRLVKFAPLPQVEEDMDED
                     DDASSYDTPSERTLHRYLSVPRRDRLSDAESEMRGRSLVRSWSPFRRHSNDAMSRSPS
                     PTRVTFAEERNRCRELVRATRPGGTGMVTLLDGQRIPARQVGEAPGDSLSPDLWGFAA
                     LERRRTSPKTKSEQAEEVQRRYQQEMAALGAEVLSHVRGKATRLRRSQSLPPSTSQRI
                     RVDPTVSIPSPSPRLPRRPDARGIAVVPLPELGLRPRYPREGRSCVSDLLDDDDDDED
                     EQEEEPKPARRRATTQAAGQEVYMSHKPRKDEWDDEYWPKPSATRHIRTGMHGT"
     gene            complement(<200649..>201344)
                     /locus_tag="MRET_4167"
                     /db_xref="GeneID:38740933"
     mRNA            complement(join(<200649..201091,201119..>201344))
                     /locus_tag="MRET_4167"
                     /product="unfolded protein response protein Orm1"
                     /transcript_id="XM_027630794.1"
                     /db_xref="GeneID:38740933"
     CDS             complement(join(200649..201091,201119..201344))
                     /locus_tag="MRET_4167"
                     /codon_start=1
                     /product="unfolded protein response protein Orm1"
                     /protein_id="XP_027486593.1"
                     /db_xref="GeneID:38740933"
                     /translation="MSTKPFGSLEPPTVREEKEAKAKDASEGGTEPGARRRQHRRSNS
                     FIMVKHVRETPDEVVDQSVAPNVNAEWVNMKGAWVIHVVLITLAKLIINEVPGISDAV
                     KWSIVNLGYMLVSYCIFHYVKGAPQDLNSGAYDELTLWEQIDQGYQYTPAKKYLTSLP
                     IAMFLLSTHYSHYNPWLFSLNLAGLLLVLFPKLPILHRLRFLIFPPAPASRSISGTAT
                     PVHS"
     gene            complement(<201458..>204073)
                     /locus_tag="MRET_4168"
                     /note="MRES_16830"
                     /db_xref="GeneID:38740934"
     mRNA            complement(join(<201458..201582,201610..>204073))
                     /locus_tag="MRET_4168"
                     /product="pre-rRNA-processing protein TSR1"
                     /transcript_id="XM_027630795.1"
                     /db_xref="GeneID:38740934"
     CDS             complement(join(201458..201582,201610..204073))
                     /locus_tag="MRET_4168"
                     /codon_start=1
                     /product="pre-rRNA-processing protein TSR1"
                     /protein_id="XP_027486597.1"
                     /db_xref="GeneID:38740934"
                     /translation="MSFSHRPTLQQKNKPFKSGHATKGARKRAAKGNVAPDPTASRGP
                     KTPVLRTSGSAEGSRKNRRNEARQVSQQKRAALVESTRIFGTGLRGENRGGTGRHSKA
                     GAPRICAILSLTPDVNEWDVVRALERDGEALGVRPMAGKSADEAMAQRVPICELDATR
                     FRQAVQFLPMPYGALLPAMDACRCADFVILLLSAETSIEPGSWGELCLRSLQAHGMPQ
                     ILAVVPSLGIRSDSKKKKNEEQSVRKSLLSFVQYFCPDTNKVHVLDEAASRSVLVRTL
                     VTTAPKRVAWRDFRAWCVSEQASYVPEDDGYGTLKVQGWIRGAPLSANRLVHIPDYGD
                     FMVDQITYAPPGVDMDTVPEETMQAQSDDVLVPGAVLQRRQDDEADDLVSENEPDALA
                     NEQTWPTEEEMAEGEARMAEDDLPPALPGTTPREIQKHSAGKKYQAAWIIESDDDDDE
                     EEEEEEEEDDAMEDDDEEVQTEEEEQSQEDDASVSGAENEDADEDEEIRAIEAYREQR
                     RKEQHTAREEAAEAEFPDEVDTPMDVPARQRYARYRGLESMYTSYWDPYEDLPEDYAR
                     LFQFDDFSKTRKRVESHALLDGVAPGIRVCIWIRHVPRDAAARAVYAETNPKKREVLP
                     FVLFGLLRHEHKKSVVNFTITRNTEYDAPVRSKDPLVVCLGFRRYHARPVYSQHLRRV
                     GRDGNQVYKFERFLPHGTGAAVGSVYAPVTFGGANVPVVLLRMRSEGQEFGYDDDGVS
                     AEQTPHLVGAGSVLDIAPTRIITKRIILSGHPYKVHKKTATIRFMFFNADDVRYFAPI
                     TLRTKYGRTGHISESLGTHGYYKAHFDGPLSQMDTVLMSLYKRVYPRWSTLFRGSRDQ
                     LPLVEP"
     gene            complement(<204145..>205086)
                     /locus_tag="MRET_4169"
                     /db_xref="GeneID:38740935"
     mRNA            complement(<204145..>205086)
                     /locus_tag="MRET_4169"
                     /product="26S proteasome regulatory subunit N8"
                     /transcript_id="XM_027630796.1"
                     /db_xref="GeneID:38740935"
     CDS             complement(204145..205086)
                     /locus_tag="MRET_4169"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N8"
                     /protein_id="XP_027486592.1"
                     /db_xref="GeneID:38740935"
                     /translation="MPTTSEEMSMISAATTVIVHPLVLLSVTDHASRVSLSARKRCVG
                     VLLGQDNGKSVNVANSFAVPFEEDENDPKTLFLDHDYIEGMLEMFKKVNAREKMIGWY
                     HTGPKLRSSDLEINEMLKRFTPRPVMVIIDPRREDVGIPTDAYIAVEEIKDDGTATQK
                     TFMHVPSTIEAEESEEVGVEHLLRDIRDTSTMGSLSDRVSQQLASLHGLHRRLLDIRE
                     YLSAVLRGELPVNHEIIYELQNVFNYLPDLEKPETVRSFRVANNDRLLIVYLSSLIRS
                     VIALHALVNNRLEMARGEHSATTAPASHKHDEEHVKT"
     gene            <205146..>206966
                     /locus_tag="MRET_4170"
                     /note="MRES_16835"
                     /db_xref="GeneID:38740936"
     mRNA            <205146..>206966
                     /locus_tag="MRET_4170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630797.1"
                     /db_xref="GeneID:38740936"
     CDS             205146..206966
                     /locus_tag="MRET_4170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486513.1"
                     /db_xref="GeneID:38740936"
                     /translation="MHLAPHPAPRRRVSGAVLTARSLPHALRCARTHGDECIEALRAA
                     EIIDAPCMLGMVGVATDRRVPTVTRVAVLDALATCRATPEAQMVLRRSYGVLFSCDTH
                     ESIRHVLFPLLCVLTERRHVRAFRIRALLALYDDTKDACVYDLLDTYAMYEPSLLLPA
                     DAPPRPMAPVSWHAWRQALGRWNVPEVVPGLSMPYVGSRVPRCIRAAAMMGHDAALGK
                     CLAASFGRLLAAHYAQHRHRKRSVDVPPYEPRDLSLLEGLCVYVEPLPCLPLPLVPIL
                     AHVIRCMGHEALRHLSDHVPLQEWERAWTPTLHALARLFRRLPPLAWDDAFPMLIRPL
                     CHLAVMDGVSDVVSAMFMRVLVHALEGWRNLDAPGTQALLACLVELQDALLLDGDPSI
                     AMYVETLHLHAVVPQAGTFPCPFIQLATPTAMQGSILTLDRLCAHVLQMRRSVLASEP
                     HTLDAHVVDAMATALIDMVWSGRAFGQFVQRGLVVDGVMTCDRSAMAVIKQACDELRI
                     VPFVLVASLSHGALLAPLFEQYCNTVLLPGHDIRAPITPSALRGARGAGGLPEHVQYA
                     DIRRGFLEWLAGRGAPHLLALLEAFVPSLSHPMLHGNYAR"
     gene            complement(<206954..>207775)
                     /locus_tag="MRET_4171"
                     /note="MRES_16840"
                     /db_xref="GeneID:38740937"
     mRNA            complement(<206954..>207775)
                     /locus_tag="MRET_4171"
                     /product="RNA-binding protein PNO1"
                     /transcript_id="XM_027630798.1"
                     /db_xref="GeneID:38740937"
     CDS             complement(206954..207775)
                     /locus_tag="MRET_4171"
                     /codon_start=1
                     /product="RNA-binding protein PNO1"
                     /protein_id="XP_027486612.1"
                     /db_xref="GeneID:38740937"
                     /translation="MAPTMKKHAAKAVHTEASASPLPERQPFGQEDSDEAEFQPDNDD
                     DEELIIDEDMAEAHDAAQPMDGDDDKLQFAPISASALAASHASVDQRIKSQLRKVPIP
                     PHRMSPLKRDWPKIYTPLVEQAGLMVRMNVRTRTVEIKSSKHTEDLGMLQKACDFVKA
                     YALGFDADDALALLRLDDLYVDSFEMKDVKTLHGDHLSRAIGRIAGKDGRTRFAIENA
                     SRTRIVLADTKIHILGAYQNIRMAKDSIVALIMGSPPGKVYAKLRTVSARMRQRA"
     gene            complement(<207909..>208627)
                     /locus_tag="MRET_4172"
                     /note="MRES_16845"
                     /db_xref="GeneID:38740938"
     mRNA            complement(join(<207909..208287,208318..208334,
                     208366..208458,208490..208501,208574..>208627))
                     /locus_tag="MRET_4172"
                     /product="protein YOP1"
                     /transcript_id="XM_027630799.1"
                     /db_xref="GeneID:38740938"
     CDS             complement(join(207909..208287,208318..208334,
                     208366..208458,208490..208501,208574..208627))
                     /locus_tag="MRET_4172"
                     /codon_start=1
                     /product="protein YOP1"
                     /protein_id="XP_027486615.1"
                     /db_xref="GeneID:38740938"
                     /translation="MASQAQVIQQKVDRFMAQLDGELSKYPALNRFDKHLPVPKSYIA
                     VTGLAILTILIFFNIFAGFLTNFIGFFIPMYFSLNALETPKPQDDIQWLTYWVVFGFF
                     NFVETFVSFVLYWFPFYYTFKTLAIVWLMLPQTQGAKIVYHRVLRPAFLSMTGSSPAS
                     RVPASAADINKTGFSASSTGVHTE"
     gene            <208895..>209569
                     /locus_tag="MRET_4173"
                     /note="MRES_16850"
                     /db_xref="GeneID:38740939"
     mRNA            <208895..>209569
                     /locus_tag="MRET_4173"
                     /product="molecular chaperone GrpE"
                     /transcript_id="XM_027630800.1"
                     /db_xref="GeneID:38740939"
     CDS             208895..209569
                     /locus_tag="MRET_4173"
                     /codon_start=1
                     /product="molecular chaperone GrpE"
                     /protein_id="XP_027486514.1"
                     /db_xref="GeneID:38740939"
                     /translation="MLTAASRSTMLGVFSRPMLLRSVRAPMVRRMYSDKAAEDQKQEA
                     ASEASAPESAEAEDPVAKQLQEKDARIKDLTDDLLYCKAELQNVQRRTAEEKKTMGDH
                     AISRLAKDLTESVDVLDLALRSVPEPLRTTKSEDNEASRALVELYDGVSLTRKSILDM
                     LRTHGIEAFDPLGEKFDPLLHEALYQAPVPGKEPGSVLDCSKIGYMIKGRLLRAAQVG
                     VVQDTA"
     gene            <209917..>211851
                     /locus_tag="MRET_4174"
                     /note="MRES_16855"
                     /db_xref="GeneID:38740940"
     mRNA            <209917..>211851
                     /locus_tag="MRET_4174"
                     /product="polyadenylate-binding protein"
                     /transcript_id="XM_027630801.1"
                     /db_xref="GeneID:38740940"
     CDS             209917..211851
                     /locus_tag="MRET_4174"
                     /codon_start=1
                     /product="polyadenylate-binding protein"
                     /protein_id="XP_027486516.1"
                     /db_xref="GeneID:38740940"
                     /translation="MSSEVAATQQPATSQAAPSEAAAAAPPAPAPSKPADVAADDKEK
                     SAKEEKEKSKGSGQVNTSLYVGELDQNVNEAILFEIFNMVGAVSSIRVCRDAVTRRSL
                     GYAYVNFLNAEDSERALEQLNYTPIRGRPCRIMWSQRDPGQRRAGQGNIFIKNLDEAI
                     DNKALHDTFLAFGKILSCKVASNEHGSLGYGFVHYESNDAAEEAIKHVNGMLLNGKKV
                     YVGHHISKKDRQAKIEEARAQYTNVYVKNLDPAVTQEEFEKLFEKYGKITSVALATDQ
                     EGKSRGFGFVNFAEHEQAAKAVAELNDTEFHGQKLFLGRAQKKAEREEELRRAYEAAK
                     NEKLSKYQGVNLYIKNLPEEFDDERLQEEFAPFGTTTSAKVMRTPTGASRGFGFVCYS
                     APEEANKAVAEMNGKMIENRPLYVALAQRKDVRHQQLAAQMMQQNQLRMQQQQAAAAA
                     AAQMYPGAPGMYYPQPPGAAPVVGLNQFPGQVRPPYAPGMMQGMPPMAPGQAPYAPGQ
                     FPPPGGMFPQGYRPPRPPRGGAAPPPAGALPAGVPAGAPRGGNAPAAPAQPEVLTAAA
                     LANASPEEQKQMLGEAIYPKIAASQPQLAGKLTGMILELPVGELLHLLEDDEALASKV
                     DEALTVLREYETREGTQAPN"
     gene            complement(<211870..>214143)
                     /locus_tag="MRET_4175"
                     /note="MRES_16860"
                     /db_xref="GeneID:38740941"
     mRNA            complement(<211870..>214143)
                     /locus_tag="MRET_4175"
                     /product="nucleolar complex protein 3"
                     /transcript_id="XM_027630802.1"
                     /db_xref="GeneID:38740941"
     CDS             complement(211870..214143)
                     /locus_tag="MRET_4175"
                     /codon_start=1
                     /product="nucleolar complex protein 3"
                     /protein_id="XP_027486515.1"
                     /db_xref="GeneID:38740941"
                     /translation="MAKRGKAAPQREPKRPRTEDEDVDDAWAHDAQAMAADDASHLQF
                     LSQARLPDVSAAGAQGRAKERVQAEKRRQRKMLEKEVVPDESDVSTDMEGASESEDDL
                     AEEASDLEEEASDLEEEASDLEEEASDLEEDASDQDPLEAAYLAKMERRERRAEAERR
                     ALAQMPLPIRTEKGVIERVERPSHSRAVYSDEEEEEPEPAVLPTERSTAAEIAQRCLH
                     PDTAMLAIAEAREEIAQLASRITADPEESQGLLRQLLVFAQRRVSLDGQRVNMHPYIR
                     QLALLSLLAVFVDILPGYRIRALSDAEQRERVSRDVARRREWEQALVSLYREYLECCE
                     ADVRDASSPIAPIARRCFCTLLVRAPHFNFRKNLLASVIALLSRRAWTDASQQCFDAL
                     VELLRQDRDGEMGLELVMLLYRMIRERHLAVHANVLDVLVHLRLRSELSRHVRQGPMG
                     APTAAESRRADPRQVRKGLAVHRSKKQAKRDRHVRQIESEMREAEATLDLEEREKRQS
                     ETLKLVFALYIRILKTDDVPVPLLASALEGIVHFAHHVSADFFRDLVGVLRSHVASAM
                     EAGDVRHALLCIVTALELQTGQGGALELDLGAFYAALYQLLWPLSMHPNIEATLGEGG
                     LRTHSLSALLFRAMDLALVKAPRHTLHVSLERTAAMLRRLLTAALQWPTTTTLHALQT
                     AHAILARTTAMDTRFEALLDNRDAVHDGTYDACAEQPDSARVLASGEPCWELLLLCRS
                     HANAQVRATADALLSGR"
     gene            <214214..>215869
                     /locus_tag="MRET_4176"
                     /note="MRES_16865"
                     /db_xref="GeneID:38740942"
     mRNA            <214214..>215869
                     /locus_tag="MRET_4176"
                     /product="carboxypeptidase D"
                     /transcript_id="XM_027630803.1"
                     /db_xref="GeneID:38740942"
     CDS             214214..215869
                     /locus_tag="MRET_4176"
                     /codon_start=1
                     /product="carboxypeptidase D"
                     /protein_id="XP_027486618.1"
                     /db_xref="GeneID:38740942"
                     /translation="MPGSSAYAVPFLPGEQPEQERRFDIEAGYIPARAPEKGQTAPKD
                     EAHLYFMLHRAMHPQQPRRKLVFWLNGGPGCSSFDGALMELGALRIQEDGRLALARPG
                     YAWNEYADVVYVDQPVGTGFSYVANEAYATSLTQVADEFVYFLEQFMQVYPAYTNDTD
                     VYLAGESFAGQYIPYMTDALLRHPTPPVRLSGLLIGNGDLNPAYQSGSQVETLVHAGI
                     WPKHGPSHQHVQPYIDACRAAIAKDTVPRAEYHECNAIDSDIVELTRQKVSGVEHCIN
                     VYDMRYTDTVPQCGMNWPPEVGAMHAYLRREDVKAALHVNTHMHPEAWVECRPNVGSV
                     LRHDSFKAPASGTLLPSILQRGVPVLLYAGDQDLVCPALGIQHLVDQMEWLGQRGMGR
                     AKRAAWTVNHAPIGTWQTARNLTMATLMNASHMAPYDAPYAAHDMLLRFMDVQIPLPS
                     PASPSVSSQVDGKDTRILVPMMPHDFAAPPKAASATSADLAGSLVAWVLIGMALALCL
                     YMRRRLGRQRRETPTWSYEAVAQPEQERDVEMDAFTLGDEDDT"
     gene            complement(<215870..>218068)
                     /locus_tag="MRET_4177"
                     /note="MRES_16870"
                     /db_xref="GeneID:38740943"
     mRNA            complement(<215870..>218068)
                     /locus_tag="MRET_4177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630804.1"
                     /db_xref="GeneID:38740943"
     CDS             complement(215870..218068)
                     /locus_tag="MRET_4177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486517.1"
                     /db_xref="GeneID:38740943"
                     /translation="MSRSGRAAPLLSTPIQLCTYSIPRTKHTYHLCSTSSSTMRRSHI
                     AVGDVVRLSSRGSLRRRRGLVVVLEQGVEVALVDMHTQTPVHTYTIAPSDRVCTPPLV
                     VERSVPTSKQLVRTTYWGVLQADHTQVRAFTESLDSRGKPMPGAEAHAPITWDVPGAL
                     TGLYALGDGRLLAAAQGALHLISDPLAGAQVLATHTGLPTDLHDVQVWDADGIARVVA
                     IAATTDKGAHLSLLHVDEASFRVVQGTLPLDEAIVSCALEQHGSLAVLTRRHVLHTVS
                     WRVTDDRLVLDEPHAVPLRPLEEARLVYVSPSHLLMVVAVPGDAERVRASALLWDTDL
                     DAVLAVTEWSAQGAPQISTTRAMDGYVFVQLDPKASRAGKCTVAALPVSVPATGLLLH
                     ALGASSRTAPWLATPPPEPMGRAPDLMAALSSLPPDASSRAAAVDAHVRSWLDAQSEA
                     LREASHTKAGRKAPKVPLDAAVVTHLLDAALPPLGSETRVYARDTVRYLVENGAVSTS
                     LMPDLVPRARQTRDWSLAFLLLRHVPDMSESHAVLLLRDALHAARRHDEDAPAFPRVL
                     QHVLLPPAFSKPALRVALRTHLQHDDDALLLLDVLRLWIDLHLSRPWDAVPRSADTQR
                     AVPTTSLTYRTGSVQPPSLDVCVSFMEDLLDTFFPQWLSAPAMHPILREWTRSLHTHT
                     HMLQQLSRLKAPLASVAQARAPEHDARSRRLALHEASLLVPTYSVETLDM"
     gene            <218180..>219031
                     /locus_tag="MRET_4178"
                     /note="MRES_16875"
                     /db_xref="GeneID:38740944"
     mRNA            <218180..>219031
                     /locus_tag="MRET_4178"
                     /product="NFU1 iron-sulfur cluster scaffold protein,
                     mitochondrial"
                     /transcript_id="XM_027630805.1"
                     /db_xref="GeneID:38740944"
     CDS             218180..219031
                     /locus_tag="MRET_4178"
                     /codon_start=1
                     /product="NFU1 iron-sulfur cluster scaffold protein,
                     mitochondrial"
                     /protein_id="XP_027486520.1"
                     /db_xref="GeneID:38740944"
                     /translation="MTVSAALWRLVPRRIGSRAVGTAAVRVQRSYSWIAGASTRPRAS
                     VVSSSSVAWHATHVPSRSMFIQTESTPNEDSLKFLPGCTVMEKGTAEFLDQRASMTSP
                     LAKNLFALEGVRGVFYGPDFVTVSKDADTPWSAIKPEVYSAMMEFFTAGHALFPDPST
                     AQPGSDTTILETDTEVVAMIKELLDTRVRPAIQEDGGDLEYRGFGEDTDGIVRVKLKG
                     SCRGCDSSTVTLKAGIERMLMHYVPEVQGVEQVLDPEEQVAMDEFTKLEERIKKQREE
                     RERGFSP"
     gene            complement(<219028..>222723)
                     /locus_tag="MRET_4179"
                     /note="MRES_16880"
                     /db_xref="GeneID:38740945"
     mRNA            complement(<219028..>222723)
                     /locus_tag="MRET_4179"
                     /product="DNA-directed RNA polymerase I subunit RPA2"
                     /transcript_id="XM_027630806.1"
                     /db_xref="GeneID:38740945"
     CDS             complement(219028..222723)
                     /locus_tag="MRET_4179"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA2"
                     /protein_id="XP_027486519.1"
                     /db_xref="GeneID:38740945"
                     /translation="MSVSSMSSDESTGPSTPPESVQGDDAWKMPHTFRTLDMQRRFMK
                     PSKSGWDVPALREITRPHIESFNALWAEDPSVDAPGSADKLGMEGVGLLERSVQSLAP
                     RVVFDNTGGEGSASRGNRLEMRIDAVSLSRPMVPDRAKDALDRRVYPDECRNRLVSYR
                     GRLTARVTWSVNYGPEQSELRDMGLVPIMVGSNRCHLRGMTSEELVAKHEEPNEMGGY
                     FIINGNERLIRFLILAKANHVMAIERPSFTRRGPSYTNKACTIRCVSRHDLISVTNSV
                     HYLDNGGVTLRFSWRKQEYMVPVVMVLKALVSATDKEIFTSIVQADTDNTFLTDRVEL
                     LLRGFHQYALWTGEQCLAYLGDKFRVVMRAPEDWSHAQVGEELINRLVLTHLDMPRDK
                     YRLLVFMIRKLYAFVAGECCADNPDSPQHQEVLMPGLLYGAMIKERLDEYLINVRQLI
                     ARDVRTGQCDFFDARYIQKALAKVNGDIGARLSSFLATGNVSSPSGLDLQQVGGFTIV
                     AEKLNFYRYISHFRSVHRGAFFAELKTTTVRKLLPEAWGFLCPVHTPDGSPCGLLNHF
                     SHTCQLTTRDLPLGHIPALLTSLGMTEVVAAHISARTHVCVQLDGVLIGYATPALARH
                     MATALRVWKTEGRHGVPLDLEIGFVPTSHGGQYPGLYLFGGRARMMRPVRYLFNGERD
                     HVGPFEQVYLDIACQPHEIERGVSTHMEYTPTQVLSVVANLTPFSDFNQSPRNMYQCQ
                     MGKQTMGTPSGALQRRTDNKLYRLQTGQTPVVRPALHNKYAIDDFPNGTNAIVAVISY
                     TGYDMEDAMILNKSAHERGFGYGSVYKSEVVHLRDLVGGRLATGALPVHFGFGPDVRA
                     DDPRRTQLDVDGLPFVGAYMTKGTPMYACYNEATGRTIVKRYKGDEAGYVDTLRVIGG
                     DAGDTECQHIQIMFRIPRSPVIGDKFSSRHGQKGVCSQKWPAVDMPFSESGMQPDVII
                     NPHAFPSRMTIGMLIESMAGKAGAVHGIAQDATPWAFHEHDTPVEYFGEQLRAAGYNY
                     MGNEPMYSGITGRELRADIYLGVVYYQRLRHMVNDKFQVRTTGPVHALTRQPVKGRKR
                     AGGIRFGEMERDALLAHGTSFLLQDRLLNCSDYTTAFVCRTCGSLMSLSYDDAAGVHV
                     PGLGVVQTIERSHTPLGPHGEYCRVCRHAAEAQRVHAPHQRVQVPPSHVLRRAGDLDV
                     IAVPYVLKYLVAELAAMGLRMSFAIAP"
     gene            223101..223185
                     /locus_tag="MRET_t0067"
                     /db_xref="GeneID:38741261"
     tRNA            223101..223185
                     /locus_tag="MRET_t0067"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741261"
     gene            223255..223339
                     /locus_tag="MRET_t0068"
                     /db_xref="GeneID:38741262"
     tRNA            223255..223339
                     /locus_tag="MRET_t0068"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741262"
     gene            complement(<223417..>224706)
                     /locus_tag="MRET_4180"
                     /note="MRES_16885"
                     /db_xref="GeneID:38740946"
     mRNA            complement(<223417..>224706)
                     /locus_tag="MRET_4180"
                     /product="protein transport protein YIF1"
                     /transcript_id="XM_027630807.1"
                     /db_xref="GeneID:38740946"
     CDS             complement(223417..224706)
                     /locus_tag="MRET_4180"
                     /codon_start=1
                     /product="protein transport protein YIF1"
                     /protein_id="XP_027486496.1"
                     /db_xref="GeneID:38740946"
                     /translation="MNAQRTGPPGTRPPPLQRPVPMHPSGSTAVPGRPMRPGAGVRPA
                     RPMAPPAARRPGTMGVRPGVRAARPPAPQAYQRIQSPSPHQLDASGSYTPPPYRASPA
                     QHTPVQPTWDVQQDAYGSEMPRAWDGYPQAKDIPGFGASDMMNDATAQMGMQFGRHVA
                     QVGGEYMQRNFRALLPMPILKYYFNVSNSYVLHKLRIILYPWQHKPWSRRLRYSTPYG
                     GTGIMSPGQGSSAIYAGMSTPDRPSSVASDRRMSASEPVSYCPPREDVNSPDMYIPLM
                     AFVTYVIAASFIYGLRGRFHPEVLGYTASRALAIMLIEFSIVKLGCYLLNIQGDHTVF
                     DLLAYSGYKFVGTLVVLAVSCLHVGRWLYWLTFLYMFAANAFFYLRSLRYVVLPDPAS
                     PSSVTVTPGQRAARIQFLFGIAMSQILFGWLLTVGIN"
     gene            <224816..>225271
                     /locus_tag="MRET_4181"
                     /note="MRES_16890"
                     /db_xref="GeneID:38740947"
     mRNA            <224816..>225271
                     /locus_tag="MRET_4181"
                     /product="translation initiation factor eIF1A"
                     /transcript_id="XM_027630808.1"
                     /db_xref="GeneID:38740947"
     CDS             224816..225271
                     /locus_tag="MRET_4181"
                     /codon_start=1
                     /product="translation initiation factor eIF1A"
                     /protein_id="XP_027486631.1"
                     /db_xref="GeneID:38740947"
                     /translation="MPKAKGKGGKNRRRGRNDDEAKRELVFKDESQEYAQVVRMLGNG
                     RLEALCFDGEKRLAHIRGKMRKKVWINNGDIILLSLREFEDGKADVIQKYTPDEARSL
                     KQHGELPEATKISEDQFGEEGDEIEFQEASDDDAEEGEAEDDDEDLDDL"
     gene            complement(<225292..>228975)
                     /locus_tag="MRET_4182"
                     /note="MRES_16895"
                     /db_xref="GeneID:38740948"
     mRNA            complement(<225292..>228975)
                     /locus_tag="MRET_4182"
                     /product="paired amphipathic helix protein Sin3a"
                     /transcript_id="XM_027630809.1"
                     /db_xref="GeneID:38740948"
     CDS             complement(225292..228975)
                     /locus_tag="MRET_4182"
                     /codon_start=1
                     /product="paired amphipathic helix protein Sin3a"
                     /protein_id="XP_027486497.1"
                     /db_xref="GeneID:38740948"
                     /translation="MATLNVRDALSYLDQVKVQFTDHPDVYNRFLDIMKDFKSQAIDT
                     PGVIERVSMLFRGQPSLIQGFNTFLPPGYRIECSFDQHEGNVITVTTPNGTTTQTLSG
                     GGGLIPPPPPPPVPPRLPRPSSDMPGSAAPPAPSSSAPPPPPGPVPRGEYVDRVPSSV
                     RPPGGLGLPPSMPSPPGAYAPPMGYDPLGRGPPGQAPPPPAAGPPLEPVSRPPVEFNH
                     AISYVNKIKQRFSGDPDTYKQFLEILQTYQKEQRPIHEVYAQVTVLFDHAKDLLEEFK
                     QFLPDTGAAAHDGPGGSGGLFGMLGHMTNGGPPPPPPGMGVEGSGMPPYDPMPRPPPP
                     PSKKRMVHEAPAAVPEPKSSGRKRSKKSDMPSQPRGTFLPPPPGTGVHGEVMGDAVYP
                     HGAPLPPGYEALPPEGYLPAPGPPSYAPPHMMGGEMMPPLAPQMATVDEVAFFERVKK
                     HLDDRTTYLDFLKLLNLYAQDMIDVATLVDRAALFLSGRPELLSMFKGLVGYDMGRHG
                     WLENEDPVLDNVPALERERFDLSVQKSCGPSYRKLPESEVNLSCSGRDALCWEVLNDG
                     WVSYPTWASEGESFNPHKKNVYEDALYRSEEERHEYDYHIEANLRTIALLEPIAARIA
                     AMDAEERAAFRLKPGLGGQSKSIYQRIMKKVYGRQHGLEVIAALHDNPSIAVPIVLAR
                     LKQKDEEWKRAQREWNKVWREVDARNFYKALDHQGVNFKSADKKAITTKALVHEIETL
                     VATQQQRRLAMDPSLPRLAPRSQLSFVMDDPGVCADILRLVAHYMDRAALSDQDRHRL
                     EHVCKTILPRMLGAGPDALADLLKRSDDEEEAEDVDNEEGDGDDEEEERARAPAVETW
                     HVHMPSTSTPHAVPTSVQLFGNTTMYVFLRLWCLLYARLHRLKHKDMASEHSPKVNPL
                     AADLGLMDTASGPAGLVNSIAMRLPGSKRPEHTAHLSEADQAALALQPSQYYAVLLEV
                     MARHLDHELDQASFEEAVRYMYTHDGYVVYTVDKVIQALVKSALSISTDAKCQELLDN
                     YTSTLRDCDALCEGPAEARDVQLYRRLIAARMAAEQTVGRDEHLFRIEARPQDGTPLS
                     ATLHIQLLSHDDLTLDEPHDREQRWLQYIASYCLWTPTEGLPAKTSAPFLHRNLPPTP
                     EPEAEGTRFIVKNALDIRVCIQTYRLFFVQDTEDVFVRLQTPPSPDETARRDARRRDR
                     WHAWLSARHEAMSSPEAAEQPST"
     gene            complement(<229160..>230365)
                     /locus_tag="MRET_4183"
                     /note="MRES_16900"
                     /db_xref="GeneID:38740949"
     mRNA            complement(<229160..>230365)
                     /locus_tag="MRET_4183"
                     /product="dolichyl-phosphate beta-glucosyltransferase"
                     /transcript_id="XM_027630810.1"
                     /db_xref="GeneID:38740949"
     CDS             complement(229160..230365)
                     /locus_tag="MRET_4183"
                     /codon_start=1
                     /product="dolichyl-phosphate beta-glucosyltransferase"
                     /protein_id="XP_027486611.1"
                     /db_xref="GeneID:38740949"
                     /translation="MELGLGYATHNLTMTIHVMLTLCVGVVLMYVALVLATPKALHTS
                     AEERRYVSAAHMDEPRPLPSLEEPAQVQLSVVVPMYNEEQRLESMLDDALDWLESVRA
                     SHLPLGEGVESRYAVTMPLREPLRTYEVLMVDDGSRDKTVDVARRYTQRRTLPDGAEL
                     RITCMHPNRGKGAAVRHGVLHARGAFILFADADGATQFSELAKLAREMVRVMTPAGQG
                     MVVGSRAHLVTSEAVVKRSFLRNLLMRCFHLTLSLLMRPPTLSGLWPRIRPAGATVMR
                     LPRQPEIRDTQCGFKLFARATAQRLFPLAHIDRWIFDVELLLLAEMACRMSEADHVAR
                     PEAMRGDGHDTLLRLPLPVAEVAVHWTEIDGSKIHLLTDSLRMGRDLIVIRLNYWLGR
                     WRGPPSVYA"
     gene            <230609..>230987
                     /locus_tag="MRET_4184"
                     /note="MRES_16905"
                     /db_xref="GeneID:38740950"
     mRNA            join(<230609..230848,230877..230934,230962..>230987)
                     /locus_tag="MRET_4184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630811.1"
                     /db_xref="GeneID:38740950"
     CDS             join(230609..230848,230877..230934,230962..230987)
                     /locus_tag="MRET_4184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486493.1"
                     /db_xref="GeneID:38740950"
                     /translation="MVTVIRYKFPPEAYQVLFLLSAFLYVDQAGPNTMGAWIRQALGG
                     PSVMRKIKNLAIGIHILEALVMLCVNIRRGAALSVTLKWVITTLILGGPTWGTFSKIN
                     HGVWG"
     gene            complement(231046..231152)
                     /locus_tag="MRET_t0069"
                     /db_xref="GeneID:38741263"
     tRNA            complement(231046..231152)
                     /locus_tag="MRET_t0069"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:38741263"
     gene            complement(<231190..>232028)
                     /locus_tag="MRET_4185"
                     /note="MRES_16910"
                     /db_xref="GeneID:38740951"
     mRNA            complement(join(<231190..231314,231340..231406,
                     231433..231798,231823..231846,231872..231903,
                     231931..231978,232004..>232028))
                     /locus_tag="MRET_4185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630812.1"
                     /db_xref="GeneID:38740951"
     CDS             complement(join(231190..231314,231340..231406,
                     231433..231798,231823..231846,231872..231903,
                     231931..231978,232004..232028))
                     /locus_tag="MRET_4185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486699.1"
                     /db_xref="GeneID:38740951"
                     /translation="MVLFFTSTAYKEPVKIFMGRDKVENEDLLAHGFPEDVWFHVDKF
                     SSAHVYLRMPEGMEWTSIPEGILEDCSQLVKANSIEGNKKNNITIIYTPHANVKKTGD
                     MAVGTVMFHNDRLVKRFHVKERKNEIVNRLNKTKEVRAVDFEAERQERERAVGRKKKE
                     HALQQQKETLEAKRMYKEQAEARDYSKLFSEEAIAEEQRAKERRARIRAAQKTQGEAD
                     EAYESDDSFM"
     gene            <232132..>233430
                     /locus_tag="MRET_4186"
                     /note="MRES_16915"
                     /db_xref="GeneID:38740952"
     mRNA            <232132..>233430
                     /locus_tag="MRET_4186"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027630813.1"
                     /db_xref="GeneID:38740952"
     CDS             232132..233430
                     /locus_tag="MRET_4186"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027486494.1"
                     /db_xref="GeneID:38740952"
                     /translation="MSEHDRLESRMSSMSLHGSTTDKSKSATALLNTTWMTSQHRKAA
                     PHPFQPRPLKVKAEQPTYPRAPLTAKHAQDTVPSVRTSSVSRMPESAVGSSRPGPESA
                     RLDLGRYDGGLERDEKKGRRNTSTEAQLLAMDSSMEGLHHQPTRPWGLPDFEIGRPLG
                     KGKFGRVYLARTKSVTSARLGNQGYVVALKCVYKKELMENKVDLQLRREIEIQMNLRH
                     PNVLRMYGYFHDRGRIFMMLEFAGRGELFKILSKLPERRFDESTAAKYIAQIADALQY
                     LHSKHIIHRDIKPENLLVGIRGEVKIADFGWSVHAPGNRRATLCGTLDYLPPEMVEGK
                     PHGGAVDLWAMGVLTYEFLEGVPPFEELSGASMTYKRIAAVDLHMPEHFSPDAKDLIR
                     SLLRYNPADRLPLSKVLRHPWIMRHDPQASVRAGRYVRAN"
     gene            complement(<233505..>233962)
                     /locus_tag="MRET_4187"
                     /note="MRES_16920"
                     /db_xref="GeneID:38740953"
     mRNA            complement(join(<233505..233545,233571..233841,
                     233867..>233962))
                     /locus_tag="MRET_4187"
                     /product="histone H2A"
                     /transcript_id="XM_027630814.1"
                     /db_xref="GeneID:38740953"
     CDS             complement(join(233505..233545,233571..233841,
                     233867..233962))
                     /locus_tag="MRET_4187"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_027486495.1"
                     /db_xref="GeneID:38740953"
                     /translation="MSSAGTGGKSGPAGQKPEARKPVSQSVRAGLQFPVGRIHRHLKN
                     KSQNNIRVGAKAAVYLSAILEYLTAEVLELAGNASKDLRVKRITPRHLQLAIRGDEEL
                     DSLIRATIAGGGVLPYIHKSLIKTPGKKKGASE"
     gene            <234094..>237564
                     /locus_tag="MRET_4188"
                     /note="MRES_16925"
                     /db_xref="GeneID:38740954"
     mRNA            <234094..>237564
                     /locus_tag="MRET_4188"
                     /product="WD domain, G-beta repeat protein"
                     /transcript_id="XM_027630815.1"
                     /db_xref="GeneID:38740954"
     CDS             234094..237564
                     /locus_tag="MRET_4188"
                     /codon_start=1
                     /product="WD domain, G-beta repeat protein"
                     /protein_id="XP_027486491.1"
                     /db_xref="GeneID:38740954"
                     /translation="MRRADALLVPLGVPRAPPPVPVPAPATRSLDEEDAWSDSEDDDP
                     VWSSTWFHVPPPGLDDDEPTRGHACFATGHADGTVSIYARHAVRVTDVPPAPAERPQG
                     GMTRRAHRRHLERLVAHLSPHASDDAPQAATVGMSQATSAPAELDENTAHQAEDSLES
                     QASGAVRHTPPAPTSRWPPPPPRSSPSPPPTFLQETSAPMVPTTRWTLDDGVWTRLLR
                     LHPQDASRVLSMHAQDSFLIVYQASERLSVWDVRTMSLVGESTCRRPAAIHASRDFVV
                     LHGQRLATLLRIDRAAQRLVPWASVPLPSASALAWDMSALAFVYTREHEVRSVSLSGT
                     ERVLGTFEGQVVDLLLRDTWYLATSDHVVCADITQAMPSPVERLVDLGSATGVVCDKH
                     MVHLRSTLHVEDRPTVPHVVVPIPGALAAPLLPASCAPGPLPWTCVWPQSLHRLIVAL
                     SHGRGVADMSLDDMLMSTSPAPAPASASRWDSDVSLLQIVTNPRTGTRHLLGGTPCGD
                     VGVWNASTLRLEAAWSCFTAPVQTFVPLTGLAPASRFFGCVMCVASDGTAALLALDDV
                     RLVHLFPSAGALTHVAVRDHAMALVYADAVHSWDMTTGHLQRTAVVPEHTWPLSERTV
                     PSGMLVPSGCADASAVLLANVHRAMDVACRHLHVSLDACERAVLASVPLPPPTVRDAD
                     VLTPIITVLAPLELDPVFRLGAATTTTPLVGYVSGHTVCLPCDAAAHVRFTTSPEATA
                     EHLVLTTALGLLYAAAVDAQAAQQLLHALLTPAFMSRIVRPASFVFPSLPRIAHLVLD
                     DNEAIRAAARLVFVTYARAAPPHVLAHLEHVWAPHLPTVPLTDVARVEEEAVLVLGLV
                     CSERYAYFPPALLRHVARLVLAFLAHATPGTRQAHIALELCAGCHVWQHYIDTVDLVR
                     RIFCLATQDEGHGLRGLARRATLALAEKHSTLFMSTLAMDILHAPSVEQSQVTQRLVA
                     FMIHQKPLVLYPSLPRLAEAVVRSLDPTHVGVRSSLAKSATLMINELVRTYPMIAFHG
                     ASQRLAVGTPDGFVVMYDLKSGTRMYVLDGHKRAVTACTFSPDGRRFLSMSLDEQVVL
                     LWRLHGGFMDMFRPTSATTHTYRTIELHLGAAAQLSPIDTLRHVSFEWHDEHSVRLGI
                     GHAHVNVGVV"
     gene            <237649..>238980
                     /locus_tag="MRET_4189"
                     /note="MRES_16930"
                     /db_xref="GeneID:38740955"
     mRNA            <237649..>238980
                     /locus_tag="MRET_4189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630816.1"
                     /db_xref="GeneID:38740955"
     CDS             237649..238980
                     /locus_tag="MRET_4189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486492.1"
                     /db_xref="GeneID:38740955"
                     /translation="MSGSMLNWLSQPGLPVPPAYNPAHLFVAHLPRVLEVLPQLRTSH
                     NVFATIAQPLGASVYTFPLPAIALEDIADEIGRLIADTFVITLLLIALYRLTAARATP
                     VRRTVTLALSTLLLLWPTFLDRGRSCMISYVRAAVAFRASLMTWDMFIMRTRAEVESW
                     SFRLVYSHLWLLPVETVDLEYRAAHGIRSTPRLTCLYKLGIALVRSVFSFALAPVFPP
                     AQMLGQQSWFSYRINLLLMNLALYFMLSSGGALSLNAFGLVFGVEQLPMFENPFFTTS
                     IRTFWSRWNRAIASVLHRVIFQGKNTNVRQAPEKKHEHKSPPRLDKRFFFHSLQAIMT
                     FLVSGLLHEYLLHFSPPPRLHGSQTLFFVLNGFMTVASTYVSKFHPALVQRTPVVIRY
                     MLLMSFFLIFAPLFFIPIQANNMLAEGQCLLHHLLFPRNETPTQGTFLYYP"
     gene            complement(<239003..>240106)
                     /locus_tag="MRET_4190"
                     /note="MRES_16935"
                     /db_xref="GeneID:38740956"
     mRNA            complement(<239003..>240106)
                     /locus_tag="MRET_4190"
                     /product="mitochondrial import receptor subunit TOM40"
                     /transcript_id="XM_027630817.1"
                     /db_xref="GeneID:38740956"
     CDS             complement(239003..240106)
                     /locus_tag="MRET_4190"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM40"
                     /protein_id="XP_027486486.1"
                     /db_xref="GeneID:38740956"
                     /translation="MATPVAQVPVPPAAPAAPQVHAVPEKTVSNSSLTGFFASFDPIM
                     RPIANVCSTMREIRRSLALPNLGTVEKMQNEVKMVQTANFQFEGARADLTKALSMNPI
                     FQVTHAFTLGGAGKNAYNFGAVYGDEKRFYQAGLDDAGNVTMRLNRLLFPGHISKIQA
                     QFAPAGGQSFVQLEHDFQGADYSMNFKALNPSPTNLTGIYVANYLQTLTPRFALGAEA
                     VYQHPSPEIEEATVGYMAKWVGPAKEWIATAQWQPQGIAQLTYWHQLSEQVDVAGDLQ
                     MITLPQRRDAQASLAARYSFRMASLRAQIDSLGKLTSVYEARISPAFALTFSGELDHL
                     SGGAKFGLGVSIESGVEPVDPMALPPTPPTVPM"
     gene            <240266..>242572
                     /locus_tag="MRET_4191"
                     /note="MRES_16940"
                     /db_xref="GeneID:38740957"
     mRNA            <240266..>242572
                     /locus_tag="MRET_4191"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027630818.1"
                     /db_xref="GeneID:38740957"
     CDS             240266..242572
                     /locus_tag="MRET_4191"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027486552.1"
                     /db_xref="GeneID:38740957"
                     /translation="MGVEADAPLRRGSRIKRPAARYVPEAESTDTRAAGRKRVHTETR
                     EDTKRAKSSTDDEEEEEEDDDDEEDDSEYCICRRGNDGSPMICCNRCGEWFHFRCVGL
                     SKRAAEQMQEYVCQACEGTQSKDTDYEEEGGVSEEEDESDEAPLPPPRKTRTSPRTPA
                     EDHPVRQHVLTTFTSILEPLYAAKKLEVEAAHTYAHDLEAELFHAHGQDVALRAYKER
                     FRSLAFNLKDQRNVSLHERITSGQLPAQDMVHLSNEALANDSIRQATEKAKRQALEQA
                     ILHEHADGPARKITHKGEVDIEREQGDARPAPEPAPEPPKAMVSETAPETAPETALAT
                     APETAPEPDNDETPCPTTSSEGVKEDEAAQPPEPISFTDVWHTAPKAAPTDTEVDAVS
                     DLDDTEALPEADTCIDSFLGDSAEPSSTTPPGTPPPDAFVVRATQKATVSLQPVVWDG
                     VVTMPEYTSAYVHVRQLTQPAFVPEAPIWQDFFPAQERIIEGRLPSQTAIDYLGQVRL
                     SPRNDIVVLVMDAGGAASSDTTTLHSSPALDKLVHYFADKERFGVLTPAPGAQGSLVK
                     DFYLAPLLSHMPVPDWLKDIHPDGLGEAWDAQRPANILLVVLVLFKTGLEGRTAPPAA
                     PPSAPPGPPPSLDAILNVKPDAIQNLLSTLNGGGGASPQVAAPAPGPPPPMPTSLLPP
                     GPPPIPPGPPVAPPGPPPPQPMRPWGGVVRNSVLPPPAYGPVSPAYGGAGSGAPHPFP
                     VGPGGWYGGHADRVKDKSRRRRNGGGRR"
     gene            <242707..>246597
                     /locus_tag="MRET_4192"
                     /note="MRES_16945"
                     /db_xref="GeneID:38740958"
     mRNA            <242707..>246597
                     /locus_tag="MRET_4192"
                     /product="osomolarity two-component system, sensor
                     histidine kinase NIK1"
                     /transcript_id="XM_027630819.1"
                     /db_xref="GeneID:38740958"
     CDS             242707..246597
                     /locus_tag="MRET_4192"
                     /codon_start=1
                     /product="osomolarity two-component system, sensor
                     histidine kinase NIK1"
                     /protein_id="XP_027486485.1"
                     /db_xref="GeneID:38740958"
                     /translation="MATLLRPALRYSPTSVPSQEAAEGGGDAGLDYVANLLQSIVQAT
                     RVPVTSSHDQHTVHRGSDAQYDELHLVHLPIGGSSNPKIAEIQQLIDVLARRLWCAED
                     RHAVDMRSRPYIQTRNLPDPVSRLTAERADPVLRSPHIAPILAAVAPTGMDPNEMLDY
                     ASAESGLSAEEELHLLRAQVRDIARVCKAVALGDLSQHIMVPVQGPVMVELKEIINQM
                     VDRLGNFASEVTRVSLEVGTQGKLGGQADVPGVQGTWKELKDVVNRLAENLTNQVRGV
                     ALVTKAVARGDLSKKIDVQADGEILELKVTINVMVDQLRHFANEVTRVSREVGSQGRL
                     GGQAYVPGVKGVWKELTDNVNRMCLNLTEQVRSIGMVTTSVARGDLTKTIEITAEGEM
                     AELKDTVNSMVAQLRVFASEVVRMSLEVGTFGRLGGQANVPNVEGIWKDLTLSVNKMA
                     DNLTSQVREIARVTKCVAEGVLTEFITVDVQGEILELKDTVNNMVRQLRTLSDEIIRV
                     SVEVGTEGRLGGQANVEDVKGQWEVLTKRVNMMASNLTTQVRSIATVNTAVARGDLSK
                     TINVEVRGEFLDLKNTVNNMVESLRTFSTEVTRVATEVGTEGKLGGRANVLGVDGTWK
                     DLTDSVNTMAANLTLQVRTIAHATTAVARGDLTQKVTISVSGEILDLVNTINNMIDQL
                     SFFASEVTRVAREVGTEGKLGVQAQKKDIEGTWDEITDNVNIMANNLTSQVRAFAQIT
                     AAATDGDFSRFVTVEASGEMDSLKTKINQMVYSLRDSIQKNTAAREAAELANRSKSEF
                     LANMSHEIRTPMNGIIGMTSLTLETVLSRTQRENLVTVSTLASNLLAIIDDILDISKI
                     EAGRMNIEEIPFSLRGIVFSVLKTLSVRAAQKKLNLVYEVAPEVPDPLIGDALRLKQI
                     ITNLIGNAVKFTESGGIVALRCKLNSPPDAAETVLEFCASDSGIGIKQDKLDMIFDTF
                     CQADGSTTRKYGGTGLGLSISRRLVNLMGGDMWVRSHLGKGSDFFFTMVVRRDKFTTE
                     QLNERMHPYKGRKVLFLDTKGEGADVARMIDQLGLKPIVFHTLKETMQHSSSFNRIDA
                     IVTDVLYVVSHLRTIEQLRYIPINLVTQETLTLNLTYCLDYGISSYINTPMSLEDLYY
                     ALLPSLESSAAIPSEGNTDVTYHILLAEDNLVNQKLACKILQNQGHKVDVVDNGEQAV
                     EATQRCRYDVILMDVSMPVMGGIEATMAIREREQSLNLEPIPIVALTAHAMLGDKEKC
                     LQAGMNAYVSKPIRRVELVSTLNQLLSQKQPKQS"
     gene            complement(<246725..>248914)
                     /locus_tag="MRET_4193"
                     /note="MRES_16950"
                     /db_xref="GeneID:38740959"
     mRNA            complement(<246725..>248914)
                     /locus_tag="MRET_4193"
                     /product="helix-loop-helix DNA-binding domain protein"
                     /transcript_id="XM_027630820.1"
                     /db_xref="GeneID:38740959"
     CDS             complement(246725..248914)
                     /locus_tag="MRET_4193"
                     /codon_start=1
                     /product="helix-loop-helix DNA-binding domain protein"
                     /protein_id="XP_027486484.1"
                     /db_xref="GeneID:38740959"
                     /translation="MDSFEFGSEYTSLEELPAFYHASKTTGPLEAANSPDKNGTLMYA
                     HNDVLVPVHLEGHNNVPLHMVGDNAVQQKDIHTPDPISSEDIHASSHFYQMLHEHMPA
                     DIQRPDNANMQGHSNYETFVTQDKSSAQSIAGMQTFDLPAFPMHGKLPPTESQSYMSS
                     NNVVSSEPAAGSQGITHMSSFSDKSCPPLDSSGVTPASVFSKVSSSSANDFLPPITSP
                     MLQPQGSQQHVYGLNEVKDVQMTPDLLHMSSASSGANVPGPPDLMTGNVMMPNGFTHS
                     ITPSPTLSAEQRPPLRRSRGTDSKISRVRPSPLIKPVQSPKNVWQGRKRGGSLHSSPS
                     LGAIESISNAMQDSSNGFSISSPALSPASMSLPRSNTVAKPLPARSSTMDETKSGASN
                     PGHGDTQEHAERTPFLKSPSPIELANSDPTQPATQPATPGTLMGLAYSPRPSSAPVET
                     VGSVTSTPALPPSTSSQQNIYYPPSYGGMNSYQTQNAVSAVTASALINASQPPHGIFF
                     QGGAVPHKSFYPSGVSQDGPASWFNMRRAENFGLDQRRTSHKAAEQKRRDSLKHCFDE
                     LRVLLPSITVDHNSPGGSMLGPDGSNEDRLAEGFGLMEMSDRNGDQPSAQGEGVSDSN
                     LDPNRTIAKVLLLRHSNEYLIRLKKRIERRDVALQTLSEEVVRLRSILSKQGISFDGE
                     DAKVSSELSSLSIKSEKREPPTRQDVPVGHPENQDASSGDVERPLNP"
     gene            complement(<249207..>251723)
                     /locus_tag="MRET_4194"
                     /db_xref="GeneID:38740960"
     mRNA            complement(join(<249207..249339,249365..249420,
                     249449..251590,251618..251670,251696..>251723))
                     /locus_tag="MRET_4194"
                     /product="DNA topoisomerase III"
                     /transcript_id="XM_027630821.1"
                     /db_xref="GeneID:38740960"
     CDS             complement(join(249207..249339,249365..249420,
                     249449..251590,251618..251670,251696..251723))
                     /locus_tag="MRET_4194"
                     /codon_start=1
                     /product="DNA topoisomerase III"
                     /protein_id="XP_027486539.1"
                     /db_xref="GeneID:38740960"
                     /translation="MRVLCVAEKPSMAKSLAQILSHGSYTNRPGRDKYCRNYDFAYKL
                     PRHVFGSHAPSVGPSMISAEITFTSVRGHMMELDFPEEYRWGKCNPSALFQAPITTSI
                     SKEAEKLAQNLSAEVRGSDMLIIWTDCDREGENIGYEVAQHCLSKRRNLVVKRARFSA
                     VIADQIHRACMNLVDLDLHAVHAVDARQQIDLRIGAAFTRLQTARLVPLLHVDRMVIS
                     YGPCQFPTLGFVVDHYRRVQAFVPEPFWFIDLRHKTDTHSSAVEFIWDRKHLFDEHIV
                     KILHGRCKEAVEAQVTCVQCRPTSKRKPSPLTTVELQKNLSRLTGMAPKKILDLAEAL
                     YQRGLLSYPRTETDQYDNDFDFVGLLDKQRQDAQWGALVSELCASAAGATVAPGALKY
                     ERPRNGRKNDKAHPPIHPTAHANDLRADEKKVYDYVTRRFLASCATDALGEETKVCIE
                     MGGETFHTSGLFVKDTAYMKLFTYEHWSNKSIPEYRERQRFRPSTLTVKQGCTSAPKL
                     LTEADLVHLMDKHGIGTDATIAEHIKKVMDRQYVVTQKQGNTNYLLPSTLGMGLVEGY
                     EGLDTSQQLCKPKLRHDTETQLGLISAAQRTKDDTITECMEEYKKIYDVVERDFDRIG
                     RAVSTYFQALPSSSGPSFPSLAQNTETARAATTSHDIPKCHCAHVCKSSTDARSGRSY
                     WSCGKQGHANDDCGFFKWCSAPPPSSSEPRMKRQRTSATCPERIMCHCDLTAKRCETR
                     KGPNTGRVFYACPKESARARCKFFAWADENDTAVASSAPSRPRTSSKRTNGRRNSRRT
                     PNRMR"
     gene            complement(<251823..>252962)
                     /locus_tag="MRET_4195"
                     /db_xref="GeneID:38740961"
     mRNA            complement(join(<251823..252219,252247..>252962))
                     /locus_tag="MRET_4195"
                     /product="diphthine methyl ester acylhydrolase"
                     /transcript_id="XM_027630822.1"
                     /db_xref="GeneID:38740961"
     CDS             complement(join(251823..252219,252247..252962))
                     /locus_tag="MRET_4195"
                     /codon_start=1
                     /product="diphthine methyl ester acylhydrolase"
                     /protein_id="XP_027486535.1"
                     /db_xref="GeneID:38740961"
                     /translation="MLSIAPSLYQESTELCADSIESHPYLPYVFAESTYQVDQDKTTD
                     APSPSYTRRGRCRLRRADVQGDAVSCMTLDTWDGAAILDTKWCLASSEKQAQHGYGIL
                     GIADASGHVHLLHLQDYESAYRLAPWKSWRMNHHDALCLSLDWSDRCRPGADDARMIL
                     SQSNGTLCMVPSLNSAAPLPQACETWLAHDFEAWITAWDCWNDGVVAWSGGDDLALKG
                     WDMRMPLYNGQRASTFTTRKCFEGGVTTIQSHPHKQHYWAVGSYDEKIRLFDARNTRS
                     PLSETEVGGGIWRTKWHPDESQKLLLACMHGGLVVLDCPGLDAGAPSPDPMRILTKFQ
                     GHNSIAYGCDWERGSPQDHLVYSCSFYDASMHIWKW"
     gene            <253189..>254202
                     /locus_tag="MRET_4196"
                     /db_xref="GeneID:38740962"
     mRNA            <253189..>254202
                     /locus_tag="MRET_4196"
                     /product="meiotic recombination protein SPO11"
                     /transcript_id="XM_027630823.1"
                     /db_xref="GeneID:38740962"
     CDS             253189..254202
                     /locus_tag="MRET_4196"
                     /codon_start=1
                     /product="meiotic recombination protein SPO11"
                     /protein_id="XP_027486538.1"
                     /db_xref="GeneID:38740962"
                     /translation="MEGVRMVPKNHACHTVAVGAPRAKNASRHSRVFWEFPSKCPERM
                     VQWARFFCVLRHTHAALASNTVITKRDIYYRDPNLFQSQCRVDSMIVRICMTLSCTRA
                     SLNITASARSVVVGPIRFHTVQNSTIRPERYAKDTLEQLIPDPSMIRGVTCHANWILM
                     VEKHAVFQTLCSLRFLDKVQQYGITCPGLLMTGKGYPDHAARWLLHELVRSKQCHCVY
                     FLVDSDPHGIDIIRTYCEALDPSDWARMYWLGIKTRQWMQHTTCTQMLPMSRADRNKA
                     MHVLNHRTHLPPLLRREVAAQLHAGYKCEIEALGEAGGDNMIEFVCHEMQQCTPVLGL
                     DGV"
     gene            complement(<254182..>255054)
                     /locus_tag="MRET_4197"
                     /note="MRES_16955"
                     /db_xref="GeneID:38740963"
     mRNA            complement(<254182..>255054)
                     /locus_tag="MRET_4197"
                     /product="diacylglycerol diphosphate
                     phosphatase/phosphatidate phosphatase"
                     /transcript_id="XM_027630824.1"
                     /db_xref="GeneID:38740963"
     CDS             complement(254182..255054)
                     /locus_tag="MRET_4197"
                     /codon_start=1
                     /product="diacylglycerol diphosphate
                     phosphatase/phosphatidate phosphatase"
                     /protein_id="XP_027486487.1"
                     /db_xref="GeneID:38740963"
                     /translation="MSIRSFLADFARSPSHKRWFIDWAACTLMLLLYRGILHHRSDGF
                     HQQFTLNDPSIQHPHTDNQRVPEHLLTLLSVVLPISCIIFCSMLLKQRWARLNMGLLG
                     FAMTIVITGCITELGKNLVGRPRPDFLARCKPTQSSIQSSKYHSLLVDYTICSTPITS
                     HTLADGFKSFPSGHSSMAFSGLTFLAWYIRGFFTAIMRKLTCVVYEQVPDEEPIRLEE
                     GLDREAEEVPQHLVLSSLVLPLVPVILAAYISVSRLMDYRHHPTDILAGTILGASVAT
                     AVYHVYHKSHTIKA"
     gene            complement(<255135..>257192)
                     /locus_tag="MRET_4198"
                     /db_xref="GeneID:38740964"
     mRNA            complement(<255135..>257192)
                     /locus_tag="MRET_4198"
                     /product="mitochondrial ABC transporter ATM"
                     /transcript_id="XM_027630825.1"
                     /db_xref="GeneID:38740964"
     CDS             complement(255135..257192)
                     /locus_tag="MRET_4198"
                     /codon_start=1
                     /product="mitochondrial ABC transporter ATM"
                     /protein_id="XP_027486643.1"
                     /db_xref="GeneID:38740964"
                     /translation="MLINAYRGSFAGIHVVHRAAHILPRYAVRQASIPMALMPYGRMA
                     SLVQGRFHSHMTSTPPEPPRTDKHQLVKRNSTNWEILSTLLTYVWPKNDFGTKARVIL
                     ALSLLLAGKLLNVQVPFFFKAVVDRMNDVASQPLDLANPNTVWVVAGASILGYGVARI
                     GASAFSELRNAVFANVAQRSIRKIARSVFTHLLNLDLSWHLSRQTGGLTRAIDRGTKG
                     ISFLLSSIVFHIVPTALEISLVCGILSIKCGPSYASVAGLTMLAYAWFTIRTTSWRTH
                     FRRDANLADQRGATTSLESLLNYESVKYFNNEQHEIQKYDSALQNYEKASVRVSTSLA
                     ALNSGQNAIFSTSLTIMMLLTAHGILTGTMTVGDLVMVNQLVFQLSLPLNFLGSVYRE
                     LRQSLVDMETMFNLQKQQQKICDKPNASVLPPVRGDIRFENVTFGYHPGRPILKNCSF
                     TIPAGQKTALVGPSGCGKSTIFRLLFRFYEPQTGKIYIDDNDISQFSLESVRKAIGVV
                     PQETALFNSSIWDNLKYGKLAASDEEVRRAAHLARVDHVVEQLPDGFDTIVGERGLMI
                     SGGEKQRLAIARMLLKDPRIMFFDEATSSLDSHTETELMRNINTLLRDMSRTSIFIAH
                     RLRTVEDADHILVLDHGHVAERGTHEALLEQHGLYYDLWLAQSERINKDPEEKDEESL
                     KTE"
     gene            complement(<257339..>259564)
                     /locus_tag="MRET_4199"
                     /note="MRES_16960"
                     /db_xref="GeneID:38740965"
     mRNA            complement(<257339..>259564)
                     /locus_tag="MRET_4199"
                     /product="nitrogen regulatory protein"
                     /transcript_id="XM_027630826.1"
                     /db_xref="GeneID:38740965"
     CDS             complement(257339..259564)
                     /locus_tag="MRET_4199"
                     /codon_start=1
                     /product="nitrogen regulatory protein"
                     /protein_id="XP_027486641.1"
                     /db_xref="GeneID:38740965"
                     /translation="MKASDTINTTLLDNLFSSKDGGRSHNGASEDTDPAALAKEDPLA
                     TQIWRMYAKQRDQLPNAARMENLTWRLMSLTLRKQRNQTTTMPTPTPVPATSHTEQDV
                     DDATDTRRGRDQAVRKIEASALPFPVHSTVNARCMGRSRSRSTSMVNVDAGRSPRNTS
                     HSRQRSAGLTSELFGISGDAMEAGLNPQHPPFLLNETMDEIPGVTRALESNIDVLSAL
                     PPDMRQATWDVHAEGTKISSGPPSPPPNKLGRESVKQRLIDEFTMAAYKNLFDQSEPN
                     AWRAVSDLEEHAQVVMEMSAKRANYVNLNQDRDDVFLSNHHVLDSVPGIGDYVGHKAN
                     QHPEYGFLPRLVRKTSFDHKVRERSESRGPRNHTPAISQTPSDESLQQSRKRLRDASP
                     MPFGMRMPRTGDQRVASGLSRELPQMFSQNIVQSVPSLPFEFSMPSPTSASHAPTMLG
                     NATASIQANHVPPLMPLSTSYTTPISPVGTSASAAPVSNIDLPPAASSAFSDSADVSP
                     SILHLDPSQIFAQQSSMPYSMVGHGGIPTNAAPSQAETTLSSQPDLFQQSDPQAFFAS
                     IFHTAHMLNSAQGGILPETVQNTYSSLSNTGLNPSSPYMNMTYESPATQDYSTDGISP
                     SQSYVPSSLAASVSTSSSLPSNNTDPSPSTVCFNCQTTTTPLWRRDPEGNALCNACGL
                     FHRLHGVMRPLSLKTDVIKKRNRSGASSRDTQSRASGRNTASGRSSGANEKNPSALPN
                     T"
     gene            <259831..>260379
                     /locus_tag="MRET_4200"
                     /note="MRES_16965"
                     /db_xref="GeneID:38740966"
     mRNA            <259831..>260379
                     /locus_tag="MRET_4200"
                     /product="ADP-ribosylation factor-like protein 1"
                     /transcript_id="XM_027630827.1"
                     /db_xref="GeneID:38740966"
     CDS             259831..260379
                     /locus_tag="MRET_4200"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein 1"
                     /protein_id="XP_027486587.1"
                     /db_xref="GeneID:38740966"
                     /translation="MGVTFSSLYESLFWWRRKAPMRILMLGLDSAGKTTILYRLQLGE
                     VISTIPTIGFNVETVEYKNIQLQVWDLGGQSSIRPYWRCYYADTAAIIYVVDASDHAR
                     LPTARAELLAMLSEEELAKCKLLVFANKQDLENAMDEAQVGKAIGLDELRDRQWSIWR
                     CSAKDGTGLQEGLDWLVDALRN"
     gene            complement(<260432..>265873)
                     /locus_tag="MRET_4201"
                     /note="MRES_16970"
                     /db_xref="GeneID:38740967"
     mRNA            complement(<260432..>265873)
                     /locus_tag="MRET_4201"
                     /product="COPII coat assembly protein SEC16"
                     /transcript_id="XM_027630828.1"
                     /db_xref="GeneID:38740967"
     CDS             complement(260432..265873)
                     /locus_tag="MRET_4201"
                     /codon_start=1
                     /product="COPII coat assembly protein SEC16"
                     /protein_id="XP_027486586.1"
                     /db_xref="GeneID:38740967"
                     /translation="MAQPPRQRAPGAMPPRPTPVQRGPRLGARMQPQPTQLLPPQPVK
                     PPAARPTAPRSVGSKPAPPAPITPAASVHRHMPASKPASAPTSQPPAAAPRRPPASGH
                     ASSLFGATDVFGVVQSSPSYHAPPRSRPAQKLPNVPQVKPRPSQAPPSAPRAPQAPIT
                     QRPTSSMSAQHTGHSIQSQPTGHGAPFQAIQPMAKQQTGPIPRASVPRSRPLPPPAPE
                     PQPWDAWEAPVPQATQWQTEYDSLASVPENQYGSVPFDVQDNMQYGADPQQGQYEEYA
                     QWDEQYASQEQVTNEWDYGYEGQDDGFLDPSQYDAEFNDMLGDMTAAPPLETQQPNYD
                     SAYQEGYEFGPEETYGQQSEGAYEHPNDTQQAFQENIQQGTFPEGEYQDWTFPEEEYQ
                     EGDYPAQSEYQAEYLAEGQYPEGVFPEGEYQGEYAAEGEYQEGVFPESEYQGGYAAEG
                     EYQHDTVPEEQYQGDYAAEGEYQGEYAAEGEYQGEYAAEGEYQEGTFPDGEYQHDTVP
                     EEQYQGDYAAEGEYQAGTFPEGEYQGEHATEGEYQEGAFPEGQYQEGTFPDGEYQGEY
                     AAEGEYQEGTFPDGEYQHAAVPEEQYQGDYAADGDYQEGAFPEGEYQDGTFPDGEYQQ
                     DAVPEEQYQEDYAAEGEYQENMHLGDEYQKEVIPESEYQDYPTEGPIASPGKPLGDYP
                     EGEYPQQYLSEDIPEGEYAAESYAPESDVAREDSVKDMGKTMSPPKEPRFDSTVALPK
                     GSAQRTKPALSKPPVERQAPSLPPPVMEPEDDAWGWNEEADDQDDVYAHDAYASQDYG
                     TQPAQVSMPDHAKASIPIAAFGIGGQLAIHLPHAKPQGDAFEYTSPHMQRTVQIHSLA
                     QFVGARPFSTLDMHKFPGPLLDGVRPNKQKKAQVVQYLQDQINESASGIGYLRRKSVI
                     QATGMQQNDANEWRRTEDKVLLLKLLVLLVEHDGKLADDPSLSATIGDLLQNRNETAD
                     EFSAFNVPTYPRSSSQSAMKRPIRTYTLRQAFLEELQTLLQQGQVSRAVEWALQEKMW
                     AHAMTLSRQLDKATQDRVVTEFVNYELGGADVDDAMRKDYTSIKVAYSLYTQQTPEQI
                     AALFRGPSTLLPDAQHVQWRQAVATLLSNRDSSSSHNSVLRAIGDGLMASGLPEAAHV
                     CYLLAHQHRAWFKSPENPTCILLGTMSDSPIHTVLNDMDALLMTEVMEYAYALNQPKS
                     TEPYVGIPALAPFKIVMAAVFDELGDAKRAKKYCDALANLSRTKNATPILTPQLQMEL
                     HQLTSRLNGQPMHGDSLSWKARRPTLDGVWGALEGRLTKFIAGEEGNEQKGSELDSKK
                     AAEEPVGAFTHYSAITPEAASLTSDAPQPIDSTEGSYSADAYAQTYAQDPSEELPDQD
                     QYAESDFKGDYQGDLAGGDDGYQGYNHDQGEYAQEYPEGEYPEDNYEGDFAQENYPED
                     AYAQEGYNEGEYPLDNYAEGDYAQEGFAEDAYAQEDYHEGEYPPQEYGGDYAQDGHPE
                     NPYDQEGYNEGEYPPEEYAEGGDAQEAYPEDQYAQESYAEDEYNEGEYPTEEYAEGDV
                     QDAHPEDEYYQDDAGGEREGRSEGQNHAENDAGQNDLEGPETNEDAPPPVFHKVDSTV
                     DEDGLLSTMPAPTLEPAASPAPSKAPPKKPVEDDEDDDLGFGNTSHNKTVEKEPEQKQ
                     DTTPKESEPKPADKPSSNSSWLGRLLGSRSSHASSQQNEKEGKAVRAHLGEETSFYYD
                     KELKRWVNKKAGDDANAKPAPLPPPPKKAPAPAKPEAPAAAPPPSSSGGSTGPPSARA
                     GAPPPRPPASGGGSGGGKKRTKPRYIVVD"
     gene            complement(<266015..>267343)
                     /locus_tag="MRET_4202"
                     /note="MRES_16975"
                     /db_xref="GeneID:38740968"
     mRNA            complement(<266015..>267343)
                     /locus_tag="MRET_4202"
                     /product="peptide chain release factor subunit 1"
                     /transcript_id="XM_027630829.1"
                     /db_xref="GeneID:38740968"
     CDS             complement(266015..267343)
                     /locus_tag="MRET_4202"
                     /codon_start=1
                     /product="peptide chain release factor subunit 1"
                     /protein_id="XP_027486585.1"
                     /db_xref="GeneID:38740968"
                     /translation="MSAPMSETDQNIQIWKVKKLIKSLENARGAGTSMISLILPPKSQ
                     LSQATNMLTQEYGTASNIKSRVNRLSVLAAITSTQQRLKLYSRVPDNGLVVYCGTVLT
                     PEGKEKKVNFSFEPFKPINTSLYLCDNKFHTEALSELLESDARFGFVIMDGNGTLFGV
                     VSGNTRTVLHKFSVDLPKKHGRGGQSALRFSRLREEARHNYVRKVAELASQHFITDNK
                     VNVTGIVLAGSADFKSVLSQSDLLDYRLRPKIVQLVDVSYGGENGFNQAIELAADSLA
                     NVKFVQEKRLIQKYFDEISTETGKYCFGLDDTFRALEMGAVEILIVWENLEHMRHVFK
                     DSEGREHVFMLSKEQEDDEDRSRFIDKETGTEMEEVGEPMPLLEWIAENYQQFGTNLE
                     FVTDRSQEGMQFCKGFGGIGGILRYKVAFDDLALYDEQEDEFMSDDEDIY"
     gene            <267555..>268035
                     /locus_tag="MRET_4203"
                     /note="MRES_16980"
                     /db_xref="GeneID:38740969"
     mRNA            join(<267555..267819,267848..>268035)
                     /locus_tag="MRET_4203"
                     /product="large subunit ribosomal protein L43"
                     /transcript_id="XM_027630830.1"
                     /db_xref="GeneID:38740969"
     CDS             join(267555..267819,267848..268035)
                     /locus_tag="MRET_4203"
                     /codon_start=1
                     /product="large subunit ribosomal protein L43"
                     /protein_id="XP_027486584.1"
                     /db_xref="GeneID:38740969"
                     /translation="MFASALWQRAPRIVRSALSTQPRLGGPSGVFVMPCRKVVVEYCE
                     KSIASKGTRDFLLQHAASLAHANPSVEFVIIPRPQRAPVLRGFYLNGRTKVISTHNMQ
                     ATQIMPKMQLILDSSGAKTHRLKRTPVASTSESARGIWSPMHDDLPQH"
     gene            <268285..>273336
                     /locus_tag="MRET_4204"
                     /note="MRES_16985"
                     /db_xref="GeneID:38740970"
     mRNA            <268285..>273336
                     /locus_tag="MRET_4204"
                     /product="cytokinesis protein"
                     /transcript_id="XM_027630831.1"
                     /db_xref="GeneID:38740970"
     CDS             268285..273336
                     /locus_tag="MRET_4204"
                     /codon_start=1
                     /product="cytokinesis protein"
                     /protein_id="XP_027486583.1"
                     /db_xref="GeneID:38740970"
                     /translation="MDSLFGLRRWGRQQHDDRSSSSSSRRTVDLSDDAPSAFAMSAPT
                     ITPVRTGSGSSAQTPRLSMDRQYGAVSPVPSAPLTPTTASTSTLGPQVPLVPLAHRSV
                     PETDVAALRKSLLSRLPELRTTRPPDVEVELMFADLITRRDMLSGPSAPPPTAVSNMF
                     DFSLDKKWTLVYNDLLTTQASERDRVKRFVPNAATAAAASSVTPMVLVRNSPEWFIKK
                     FMDNSVTTKHIESLAVTLRTCAIGWLQSFVEAKGTHVLSSYLIALQTRGSMNEQDLAQ
                     EYEVLKAFRSLFNSKPGAHDALQHPKCITGISRSLVSQQLSTRKQAADILLFLCHWEK
                     PRGHSLVLQGMDELRVAFDRHGRFDAWFTALEAAIDGRGRMGSLVGASDEVRRLQMSA
                     MPEAGLPEYVVNNMFLVNALVNSDIVDALNIRVHLRSQMAASGLLRIMEKMRALSTPD
                     LDMQVSVYEKNAAADQEDMLETFEQSVVKDLTDPHDVLRLVLDRLQNSRAKDFFMSAL
                     QHLLLIQRDGADLVHYYQLIDSMVSTVVMDRDGAATGGDMESLLGTSVNNVLGRFADQ
                     DLLERVQHELKVARTTLRARDEEMQKMKQQIQDASGGLVGQLQSQIRELQQDLGISRE
                     NSATLQQNMEEMERSYVDRILGLELELRESSSLLRQAQESKQADPTFSQFNRQVLRES
                     LERQVERSRTIRKLVSKTSNDSFMPLDTALPHSPPVPPRSLSRTQHDASPNTTDVSDR
                     IGRAALQLDPSSVSPSTDSIEAFPSSRSSLDESNEWGMQAILASRMARNSDMQERMRD
                     VRASRARRRAEAEQSEVRNTSAHASSSDQRPVSPSHLPSTPTRHPRRVVTPVSSDPSS
                     THRPPECDPRAPRSRERSSSVNVSPHIEQQALADKTSKPTDAAPEPTPEPAPEHPPTS
                     PAKSPASVPPPPPPPPPGAPGRQDTIPPPPPPPPPLPPTAPSAPPTDDTIPPPPPPPP
                     PPPPPPGSAAPPAPSHENAFLSALKGKVAQRAEKQGPEASGPSIEPRSSLLNMRASFE
                     PSKLGPPGPVHAPPAPPGMLGASNMRKGVLDMAKTRMKQLQWDKLSAEHASSTIWGRN
                     ASNELVLRDIVVQQGIFSEMDEEFKAKEASKRVISMKRDKNELQTYLNYATRQGIEMV
                     LKRLKSQLTGGKQCTPEEVAHMLIQCDAQIFDQSVLTELLRYYPESETKGRLGEYKNA
                     TDEQLRLLHPADRLVVLLMTVPHLKDKVKGMLYMTRYNDTIDLIRHGLTKIREGSESI
                     MNAPKFAQLLNLILLFGNYLNATGIKGGAYGFRISSINKLVDTKASDGTTLLHFVERT
                     VSRCFPELEGFVDELAGATEACRVQLFDLKHDLSELKTANNQHKKILDRLHSEQEENI
                     EAPYSKIMLPFLNQATGELQRLTDQIQYTERMFDEALKFYGEGSDPIRRSFTGVKTMP
                     TEEFFGIFKEFLAAYRKAKNDNAQLAQQRAMEAARLAAAEEREKERQEAMARRKAGVG
                     DSAVLESLLSSLRSSGGASSRQRRKNRRRMRLPSSELAPSSDKEQADQNPSSLAAEML
                     KKLQGDEKLDPVGGAASSTAQAVEAARADRRRERLERNSVPVLQDIPRPPSAASRTPS
                     FSDTQDTVPSVPTTPVETDHETKSMCQEHDDNDDETMNSAVTATSGFDSPPSSYSASS
                     GDDAERPSTEPQTST"
     gene            complement(<273375..>274169)
                     /locus_tag="MRET_4205"
                     /note="MRES_16990"
                     /db_xref="GeneID:38740971"
     mRNA            complement(<273375..>274169)
                     /locus_tag="MRET_4205"
                     /product="V-type H+-transporting ATPase subunit D"
                     /transcript_id="XM_027630832.1"
                     /db_xref="GeneID:38740971"
     CDS             complement(273375..274169)
                     /locus_tag="MRET_4205"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit D"
                     /protein_id="XP_027486582.1"
                     /db_xref="GeneID:38740971"
                     /translation="MASSGQREAVFPTRMTLGTTKIRLKGAQNGHSLLKRKADAISKR
                     FRTITGKIQDAKRQMGIVLQQAAFSMVEVGYTTGDIGYAVRENAKRATFKVRSRQENI
                     SGVVLPSFAIQSLDGEPKSESSKDGAGSGEFSLTGLSRGGQQVQKARDTYSKALRVLV
                     DLASLQTAFVILDEVIRLTNRRVNAIEYVIIPRLENTIAYIVSELDEMDREEFFRLKK
                     VQGKKKRVAEEQAAKAALEKEHLAESHSAVGQQDMLSAEKDADVIF"
     gene            complement(<274363..>274723)
                     /locus_tag="MRET_4206"
                     /note="MRES_16995"
                     /db_xref="GeneID:38740972"
     mRNA            complement(join(<274363..274482,274512..274632,
                     274662..>274723))
                     /locus_tag="MRET_4206"
                     /product="protein FAM32A"
                     /transcript_id="XM_027630833.1"
                     /db_xref="GeneID:38740972"
     CDS             complement(join(274363..274482,274512..274632,
                     274662..274723))
                     /locus_tag="MRET_4206"
                     /codon_start=1
                     /product="protein FAM32A"
                     /protein_id="XP_027486581.1"
                     /db_xref="GeneID:38740972"
                     /translation="MSSPYTFKPGGALKLKGDKSKKKKKSSTSAKPPHQTADKSSSTK
                     YATTKAEQKFEEVQRKRLREQARTEAHKSHKDKVDSFNAYLDSLSEHHDMPKIGPG"
     gene            <274852..>275538
                     /locus_tag="MRET_4207"
                     /note="MRES_17000"
                     /db_xref="GeneID:38740973"
     mRNA            join(<274852..275350,275378..>275538)
                     /locus_tag="MRET_4207"
                     /product="UMP-CMP kinase"
                     /transcript_id="XM_027630834.1"
                     /db_xref="GeneID:38740973"
     CDS             join(274852..275350,275378..275538)
                     /locus_tag="MRET_4207"
                     /codon_start=1
                     /product="UMP-CMP kinase"
                     /protein_id="XP_027486580.1"
                     /db_xref="GeneID:38740973"
                     /translation="MSTAEYDPSKVVVVFVLGGPGAGKGTHCANLVRDYGFVHLSAGD
                     LLRAEQARPGSQYGQMIAEYIKEGKIVPMEVTISLLRNSIQNAIEQNTDSTAEGWGQG
                     RGRFLIDGFPRKLDQSEKFEQSVCPAQLVLFLHCTEEIMLKRLLRRGETSGRADDNMD
                     SIKKRFHTFIETSMPVVDFQRAQHKVVDVDATNSVEQVYSDICAAMNAKFTQIKDAVC
                     M"
     gene            complement(275617..275699)
                     /locus_tag="MRET_t0070"
                     /db_xref="GeneID:38741264"
     tRNA            complement(275617..275699)
                     /locus_tag="MRET_t0070"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:38741264"
     gene            complement(<275747..>277066)
                     /locus_tag="MRET_4208"
                     /note="MRES_17005"
                     /db_xref="GeneID:38740974"
     mRNA            complement(<275747..>277066)
                     /locus_tag="MRET_4208"
                     /product="protein BTN"
                     /transcript_id="XM_027630835.1"
                     /db_xref="GeneID:38740974"
     CDS             complement(275747..277066)
                     /locus_tag="MRET_4208"
                     /codon_start=1
                     /product="protein BTN"
                     /protein_id="XP_027486705.1"
                     /db_xref="GeneID:38740974"
                     /translation="MTETIPMDSLDEHPSAVPQGATLLRRHAVAFFILGLLNNMMYVV
                     ILTAALEILPSHVPTGILAFVNIAPAVVSKALFPYYFKGEIWYGWRVWACTLGSFCGM
                     MCIAFFPGLFLRLVGIGIASFASGLGEITFLQYATRYPHQVTTYCIGWFASGTGAAGL
                     IGASAWWIVRPLGVRGGLGLLSLLSFGTALSFFVILPLPSIMSRSTDETTEALMQDSD
                     REPERNLSLSFSDKVQLLKPMLIPYIMPLICVYFAEYTINQGVAPTLLFTVPDSKQHK
                     LLSMIIHSLRDYYPLYQLVYQAFVFISRSYTSILPLPPIPKAWLWSPAILQVCLLVLL
                     SSESIYDWFKASIARSLVIVLVAVEGLAGGSSYVSVMSHIGGSDRAHTMPQEYSARTI
                     QEYEFKIGSVSLGDSLGIVLATLVSIPLQVSLCHMQVGRGRDLCTRV"
     gene            complement(<277136..>277877)
                     /locus_tag="MRET_4209"
                     /note="MRES_17010"
                     /db_xref="GeneID:38740975"
     mRNA            complement(join(<277136..277279,277311..>277877))
                     /locus_tag="MRET_4209"
                     /product="charged multivesicular body protein 2A"
                     /transcript_id="XM_027630836.1"
                     /db_xref="GeneID:38740975"
     CDS             complement(join(277136..277279,277311..277877))
                     /locus_tag="MRET_4209"
                     /codon_start=1
                     /product="charged multivesicular body protein 2A"
                     /protein_id="XP_027486579.1"
                     /db_xref="GeneID:38740975"
                     /translation="MTWWEALFGRTVTPAERLRQHLRSLQRAQRELERERTKLEAQEK
                     KLTADIRRNARQGQMAACKVMARDLVRTRRSIHKFYQMSTQLQAVGLRMQTLRSTQQM
                     AETMRGASRALGTMNKSMNIVAVQKILQEFERESGAMDMKDEIMNDTVEDAIGIDEDP
                     MSEGVGEDSESDAILREVFDEIGLDMHQQLQQVPESTLTMSTKTSAPDRVAIGEGSPP
                     ANEDMVLQERLDRLRKAT"
     gene            <277982..>279268
                     /locus_tag="MRET_4210"
                     /note="MRES_17015"
                     /db_xref="GeneID:38740976"
     mRNA            <277982..>279268
                     /locus_tag="MRET_4210"
                     /product="mitogen-activated protein kinase kinase 2"
                     /transcript_id="XM_027630837.1"
                     /db_xref="GeneID:38740976"
     CDS             277982..279268
                     /locus_tag="MRET_4210"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase 2"
                     /protein_id="XP_027486605.1"
                     /db_xref="GeneID:38740976"
                     /translation="MASIIPPKRPVRAGMPKLVMPTSVTSDVPEDTSRIDSTTGETDA
                     TIMPRAIPSQPSLGLETQMDEIKRMLDDTRTPASMSYEYGGVDMHAQASGESGMTSSS
                     NSSSWHMHHDSSSVPFMRSNSSLELESSIPPASEHANDIEVLASLGEGASGEVKKARI
                     KSTGKIIAQKVIPTSPDPMIHRQLLRELNVNKSCKSEYIVNYYGAFFEPETASITICM
                     EFCEAGSMDSIYRRVKSRGGRVGEKVLAKLAESIIKGLEYLHQCRIIHRDVKPSNILV
                     RRDGQMKLCDFGVSGELINSVAGTFTGTATYMAPERIMGHSYTITSDVWSVGVTILEL
                     ALNRYPFSEDGETPMGPIDLLSYLLSSPLPTLESNDQIRWSRSLRDFVDRCLERDGTK
                     RVSPRMLLQHPLVRRAEMIPNSDMARFVASVWNWPS"
     gene            <279356..>280321
                     /locus_tag="MRET_4211"
                     /note="MRES_17020"
                     /db_xref="GeneID:38740977"
     mRNA            <279356..>280321
                     /locus_tag="MRET_4211"
                     /product="cytochrome c heme-lyase"
                     /transcript_id="XM_027630838.1"
                     /db_xref="GeneID:38740977"
     CDS             279356..280321
                     /locus_tag="MRET_4211"
                     /codon_start=1
                     /product="cytochrome c heme-lyase"
                     /protein_id="XP_027486606.1"
                     /db_xref="GeneID:38740977"
                     /translation="MGAAPSMDAARPCNNQDAVKALLLYHHHLALQKSPAKDQRATCP
                     VPHGPRGAMGPASDAPLNPLNNMPALSQDRAHTQKMELSRERVVSSIPRAKTSAAPGD
                     SPYGAPQCPIPHDQRSAPRREGASCPVSHEKGDETPGYWEYPSPQQFYNALVRKGWET
                     PEEHVDMMVLIHNFLNERAWQEIVDWEAMAGSDVSQLQLARFQGRPGTLSPRARMFMW
                     LAWLFPDKFSSEPPFDRHDWIVRRGPTEAYPEGEEVRYIIDYYSSEEDDDPNSNEANF
                     NLDVRPAITNLSMVQLRWKKLRQEYESGALLAPFRSAPPPTPPSA"
     gene            <280404..>281096
                     /locus_tag="MRET_4212"
                     /note="MRES_17025"
                     /db_xref="GeneID:38740978"
     mRNA            <280404..>281096
                     /locus_tag="MRET_4212"
                     /product="arabinose-5-phosphate isomerase"
                     /transcript_id="XM_027630839.1"
                     /db_xref="GeneID:38740978"
     CDS             280404..281096
                     /locus_tag="MRET_4212"
                     /codon_start=1
                     /product="arabinose-5-phosphate isomerase"
                     /protein_id="XP_027486696.1"
                     /db_xref="GeneID:38740978"
                     /translation="MMQAEVDDGAASVDVAHAVLLHEAQAMARLSDKFSQNRLAMQRA
                     VHATRAARGKLVLVGVGKSGLIARKIASTLTSLGTLACFLHPVEALHGDIGVVQPGED
                     VIMALSYSGESPELLTFMQLPQSQRCVRIVMSANPRGRLVPLGDIWLDCGSSIEVTDA
                     ASGPFSTSSSEACPYIPAPTTSTTTMLALGDAFSMALTHAKGIQCQTFFANHPGGNLG
                     QVFPMQQRLSKN"
     gene            complement(<281093..>282271)
                     /locus_tag="MRET_4213"
                     /note="MRES_17030"
                     /db_xref="GeneID:38740979"
     mRNA            complement(<281093..>282271)
                     /locus_tag="MRET_4213"
                     /product="YTH domain family protein"
                     /transcript_id="XM_027630840.1"
                     /db_xref="GeneID:38740979"
     CDS             complement(281093..282271)
                     /locus_tag="MRET_4213"
                     /codon_start=1
                     /product="YTH domain family protein"
                     /protein_id="XP_027486701.1"
                     /db_xref="GeneID:38740979"
                     /translation="MTRRAPEPGQWRAPGQRQAEYADDAAHASATPSPHLSVPNSETS
                     DTPTSQTRTQSVSALPDVWRSQLSLSSALSSITQEAVSLHPGTSSVPRHSAPHVLLTH
                     DTSPRSFSSAHSSPLHGTQRRASYAHDPLGQRRGSDTFSASGAGAASSLWSPIDDPKL
                     AYRRSTLHIGDVIPSIAPGPWPRRMSSRRMSWDDAEPPVDVEPPVPMPPPQPRPPSPW
                     FYLDPFSQYRPLPMTWPMPERAFVIKSFTAIDVQLSVTHGVWTSTEKGNHRLNKAWMR
                     SSQRGPIYLFFSVNGSGRFCGVAQMVSGLDYTQSSNIWAEGDRWKGLFHVHWLILKDI
                     PNARLRHMTLLNTAERKPITQSRDTQELLPEAATELLHIFQTHQSVSSLFAEQDHLPP
                     "
     gene            complement(<282324..>287783)
                     /locus_tag="MRET_4214"
                     /note="MRES_17035"
                     /db_xref="GeneID:38740980"
     mRNA            complement(<282324..>287783)
                     /locus_tag="MRET_4214"
                     /product="cytoskeleton-associated protein 5"
                     /transcript_id="XM_027630841.1"
                     /db_xref="GeneID:38740980"
     CDS             complement(282324..287783)
                     /locus_tag="MRET_4214"
                     /codon_start=1
                     /product="cytoskeleton-associated protein 5"
                     /protein_id="XP_027486607.1"
                     /db_xref="GeneID:38740980"
                     /translation="MADTDDVSRMPLEERLASKLWKARLSAYEELAASFARTPSSDDA
                     LILAYARQPDTLRGMALDANAAAQEKGVECLCAFVRYGAHHAGRTRDVVMPSVAEKCL
                     GSMRTGTRKAALELVLLYAEHEDTMGCDGLVSDISDKLAAKQPKVVAANVAALTALVR
                     AFGGEQVNVRLVAQCVPKVFAHADKQVRAEGADLAVELHRWIGAGLAPVLAQLKDIQA
                     KELEQRFAEAPAATAPTRYLASRQPTEAPAREPTPPPAAVDEPPPPAPSVDPYDMAEP
                     VNPLQSRRLSPTFFDMVTSTKWQERIEALESLHAALTESPRLVRDPGLDEYVQALHVR
                     IQKDANINVVLHASRCLEALARGLRQDGAPYTYVLPTLLDKLKERKPATLEVLHATLD
                     AVYLCSALPEILEPVSKAAVHKNPAVKAGTIRFLGRCLASARPSPQDIAVAAPILVHA
                     MSDGTGDVRDAAASSMGALLQVVGERPLLPYLDKLDDLKRAKVREEANVRSSTAPAPK
                     AAPVPQASPAPKAVPAPKPAAVPRAAPLAKPAAAHKPMPASKAAPLAKSAAKPTPPTA
                     SRGAPAPKAAPRTAPKAAAREETRPRFAPEEADALARDLIPPRIQEQLASSQWKERLE
                     GAQALTAWLDDADADVLAHFLAQRPGWRESNFQVMGEVFRCMQRMTQLPTFGRATVAL
                     TVQPMCEKLGDMKLKALAGETLLQYAEVTSLSAVLTHGVPWIGALKAPKAQADALVWM
                     DQAILAFGAVGLDVPALVTFLGTCLASANPAIRTSATAVVVTLARFAGPSVVSLLPDI
                     TPQLRSTIETQVQTAPPPPPPTRSARAAAPVPEDEPAEAVPAAPLDDALPRVEIDTLV
                     SPATLASSSDSAWKVRKEALERIRDALRPHARLRGGMELAQTLRPRFLDTNLMVRTLA
                     LDMVIMLAQGTQPFEPLARVLGAPVTQVLADSKAPLRASAKAALSAMAHGRALGPLLA
                     PMGHVLDGKHANPTLRQELFAWLHTYMTETPGSPGDVHPLIPSVVASLDDRAAPVRQA
                     AQSLLPFLVQYAGPKALYEAAAQLKGASRATATPLIDAARGSAPSTGRAVSTASTASS
                     ASSAKEPSRGAARRPLPPRAPETPRLSAVNRSLAPRAPRPHTETALLLSADAKGKAAR
                     ERASRTPLVVDGTVRPAEIEALRHQMDLCCAPTLVAALFSQDHHAERDYLQGTSDLLA
                     YLAKAPSAPVLAQSDVLIKYACVRVLDRHTSVALRCMELLSTLMDVLSAHGTHLTESE
                     AQALLATLLVRLGDAKPMFREQARDLLRRSTVLFPPSRVFSVLLEHGVTAKHVRTRAE
                     SLQELAFLLGRQGLGVCTPSKAFPVMASCISDRDAAVRGAALSALTEAYQLQGDALWR
                     LLGPLSARDQALLEERCQRTMTRPARRAAPEEDDVLAQICRDDKEESIAGLKSLQAQL
                     GERSLPASDTVHALLHAWDAVGREPELDHRYIKHILQSILVLLDTHMRLDASQLAPLL
                     EGLLRRLMYVSAQDHEASQTLSKQLNAVVLRILSMSHGDDVYQALFSLLVSTTADVAA
                     GDQAQLAELVVKCLWKVARKLPAALEAKQVHAEALLRSVEGFFEAIPPSEWAQRAQKH
                     VPLRDIPLITATNVLKQLTDTLGEGALAATDAWTEPEKTHVYRYLLRLLHGPSPPPAA
                     DAPSSPPPRVPSPAPPAASDDAPTEELRAIFDAISQKDKSRAAIRDLYEFQKRHPSMH
                     ASIERSLQNTGPIFQRYIKRALANHAAEDEAPAPPTPSTSVDARLAELKAKFRREPSR
                     DAPERMQKRMSMSTEALRTRLATMRTDDAAPSSTM"
     gene            complement(<287880..>289433)
                     /locus_tag="MRET_4215"
                     /note="MRES_17040"
                     /db_xref="GeneID:38740981"
     mRNA            complement(<287880..>289433)
                     /locus_tag="MRET_4215"
                     /product="permease"
                     /transcript_id="XM_027630842.1"
                     /db_xref="GeneID:38740981"
     CDS             complement(287880..289433)
                     /locus_tag="MRET_4215"
                     /codon_start=1
                     /product="permease"
                     /protein_id="XP_027486608.1"
                     /db_xref="GeneID:38740981"
                     /translation="MTRQEKEQTHAEAEEHGEHGRTSMGEKLDQVLEPHLDEKSDNKL
                     VGMLNKRHWRRFAWLEWGNIDPIKPEEQQMRHPYVIALIWVSMNLNVLSFSTGMVAPD
                     MGFEFRYFSYTTLGFLIGWAIFPAAFTIFGHKLGMRQMVHARYSFGYFGAPVPALLTA
                     LTGLGYGILNAIVAGETLQAVSPHGSMSATVGIVIVTVMALAVSFCGIRVLNVLDMVF
                     WLPVLISFAILAGEAKTGPEGLHVLPQEPRPTARNVLGLGSLLSGFYVSYASMSSDIS
                     MYYHRDRSSWLLFVISWIALLFSAPPILMLGAAFATSSQRVPAWNDAVSNNPSPGPLM
                     NLVLSTHLGNFGKFLTVLIALSAASNMMTSFYSIGLCFQTALPPLRILPRFLFPLAAT
                     AIVLPLAIVGQTSFYSTLSNFLSVIGYWSALYVGVVIADFVVIRRCRMSSYDVSIWND
                     WRQLPPGIAAMTSCVLSLGLVVPFMDQAWFTGPLGKHVGDLGFELGLAVTFVLYCVLR
                     PVEQRLFRR"
     gene            complement(<289620..>291053)
                     /locus_tag="MRET_4216"
                     /note="MRES_17045"
                     /db_xref="GeneID:38740982"
     mRNA            complement(<289620..>291053)
                     /locus_tag="MRET_4216"
                     /product="homocitrate synthase"
                     /transcript_id="XM_027630843.1"
                     /db_xref="GeneID:38740982"
     CDS             complement(289620..291053)
                     /locus_tag="MRET_4216"
                     /codon_start=1
                     /product="homocitrate synthase"
                     /protein_id="XP_027486609.1"
                     /db_xref="GeneID:38740982"
                     /translation="MCDCENSRPSKMQRIEGEASQEVKNSHEAVDNSSAVSRTRVANQ
                     AQDNVQPFGASRYSDFLSNVSNFKIIESTLREGEQFANAFFDTETKIRIAKALDNFGV
                     DCIELTSPAASEQSRKDCEAICKLGLRCKVITHIRCHMDDARIAVETGVDGVDVVMGT
                     SKFLREYSHGKDMTYITKAAVEVISFVKSKGIEIRFSTEDSFRSDLVDLLSIYQVVDK
                     VGVNRVGIADTVGVANPRQVYDLVRTLRGVVGCDIECHFHNDTGCAIANAYTALEAGA
                     THIDTSVLGIGERNGIPSLGGFIARMYAANREYVMSKYNLKALRDVEDLVADAVQVQI
                     PFNNPVTGYCAFTHKAGIHAKAILAEPKTYEIITPEDFGMNRYVHIGSRLTGWNAVKS
                     RSKQLGLELTDDQVKAATNRIKVMADIKDQTMEDVDAVLHVFHRAIKNGQDVGHDSTF
                     NRLFQQHIEARGTDAIAEEEAEAQAAK"
     gene            complement(<291423..>291783)
                     /locus_tag="MRET_4217"
                     /note="MRES_17050"
                     /db_xref="GeneID:38740983"
     mRNA            complement(join(<291423..291503,291535..291645,
                     291680..291723,291765..>291783))
                     /locus_tag="MRET_4217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630844.1"
                     /db_xref="GeneID:38740983"
     CDS             complement(join(291423..291503,291535..291645,
                     291680..291723,291765..291783))
                     /locus_tag="MRET_4217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486610.1"
                     /db_xref="GeneID:38740983"
                     /translation="MAGGHHRSVKIDPAIERWQQMHNTMYQRFRWTPKNAPVIAFWGL
                     AVPFAAFFAFSKTNTAWDFSGKGFDEKLLRVSPAAQEESE"
     gene            <291915..>292431
                     /locus_tag="MRET_4218"
                     /db_xref="GeneID:38740984"
     mRNA            join(<291915..292259,292291..292367,292395..>292431)
                     /locus_tag="MRET_4218"
                     /product="U4/U6.U5 tri-snRNP-associated protein 3"
                     /transcript_id="XM_027630845.1"
                     /db_xref="GeneID:38740984"
     CDS             join(291915..292259,292291..292367,292395..292431)
                     /locus_tag="MRET_4218"
                     /codon_start=1
                     /product="U4/U6.U5 tri-snRNP-associated protein 3"
                     /protein_id="XP_027486671.1"
                     /db_xref="GeneID:38740984"
                     /translation="MTERRSRVRYDEDTPPDPVHEERAYSRWHRRDRDWTEGRDRRDG
                     REARSWRSAPHERQDSWRRRREQSPIRSHDARPRQSKQPLSPVQHDTPSIQDADADQM
                     AAIMGFGNFGSSKGKPVENNSEGYAHIRKEHSWRQYMNRKGGFNRPLDKV"
     gene            complement(<292428..>292790)
                     /locus_tag="MRET_4219"
                     /note="MRES_17055"
                     /db_xref="GeneID:38740985"
     mRNA            complement(<292428..>292790)
                     /locus_tag="MRET_4219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630846.1"
                     /db_xref="GeneID:38740985"
     CDS             complement(292428..292790)
                     /locus_tag="MRET_4219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486679.1"
                     /db_xref="GeneID:38740985"
                     /translation="MALQDAHRAWLRRMVLVVDPEYQLPPPITYPEDLHPLPDDIEAY
                     CKYSFRSEDLVSQSPHLSSAQFRAMCDRHAAVLTERDIAPANSRTDLTGHTHTHSPIP
                     NADGSAVSGETRPTSPTC"
     gene            <292905..>294062
                     /locus_tag="MRET_4220"
                     /note="MRES_17060"
                     /db_xref="GeneID:38740986"
     mRNA            <292905..>294062
                     /locus_tag="MRET_4220"
                     /product="tRNA-dihydrouridine synthase 2"
                     /transcript_id="XM_027630847.1"
                     /db_xref="GeneID:38740986"
     CDS             292905..294062
                     /locus_tag="MRET_4220"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 2"
                     /protein_id="XP_027486529.1"
                     /db_xref="GeneID:38740986"
                     /translation="MSEPGEQAPKRIKLDAQDVLPPPAHDKMPRFDRGVFLAPMVRSG
                     ALPCRLLALEYGADLVWGPEVVDRAIMGTERRVHPSTGLVEFIKDGKQVFSCHPIERP
                     FLIYQVGSSTPENAAEAVRIVTEHDDVAGVDLNCGCPKPFSTLGGMGANLLTMPDLLC
                     EILKAMRRAAPPHVSVTCKIRLLPTQAQTLDLVERIVRTRTIRALTIHCRTKPMRPRE
                     PALLDRFRDVAAHVAKVAQETGQDVPVVCNGDCFGVTDIPRLQTLTGAQAFMMARGPE
                     ANMSCFREHRECVGTVVAPKWLRYAVYFDNPFGNTKYCITQMAFTTTAGAKEHDAPRV
                     SPLKKRELVDMRMELNRAKSHEDMARALRMPWPVDTSDIATSLPGRLGPRT"
     gene            <294108..>298868
                     /locus_tag="MRET_4221"
                     /note="MRES_17065"
                     /db_xref="GeneID:38740987"
     mRNA            <294108..>298868
                     /locus_tag="MRET_4221"
                     /product="pentafunctional AROM polypeptide"
                     /transcript_id="XM_027630848.1"
                     /db_xref="GeneID:38740987"
     CDS             294108..298868
                     /locus_tag="MRET_4221"
                     /codon_start=1
                     /product="pentafunctional AROM polypeptide"
                     /protein_id="XP_027486528.1"
                     /db_xref="GeneID:38740987"
                     /translation="MSRDEDVHDKVPSYHAPPFESPISGATIHELRCLDTKIQLGYHL
                     VPHIVQTLLSELPSSAYVLVTDTHLAQLGAVDKFRDAFQQSKGAHQRFLTYEIAPGEE
                     SKSRETKAAMEDWMLEHRLTRDTVVLACGGGVIGDLVGFVAATFMRGLKYVQIPTTLL
                     AMVDSSVGGKTAIDHPHGKNLIGAFHQPHYVFIDAAWLLTLPAREFSNGMAEIIKTAA
                     IWDVQDFEKLESQSDAIRAAVMSEAARAHGTSQGHTLETRTTSQTLLLDVIRGSVGVK
                     AWIVTVDEKETGLRNLVNFGHSIGHAIEAVLTPDMLHGECIAIGMVLEAEIARLVCGL
                     PQVAIGRLTRCLQLYDLPVSLADPRIVALSKARELTTARLLDIMRVDKKNAGAQKKVV
                     LLSRLGATAEERASAVPDSLLEHVLAPAMLVRESTHMPREPATIPTPGSKSISNRALV
                     LAALSGGTCRVRNLLHSDDTRVMMQALVQLGVADFAWEDNGHTLVVHGHGGQVQASEA
                     PVYLQNAGTAARFMTGVASLVRQGSISLTGNARMHERPIGPLVDALQSNGVHIDYQGK
                     PACLPLRVEGTGMGLRGGRIELAANVSSQYVSSILLCAPYAQAPVELALVGGKVISQP
                     YIDMTVAIMRAFGVHVERVGEYVYRIPQQTYTAPPTYEVESDASSATYPLAFAALTGT
                     TVTVPHLGRTSLQGDAAFACQVLAPMGCAVEQTDTTTTVTGPPVGQLRALGSVDMESM
                     TDAFITASMLFAVAPGPTRITGIANQRVKECDRLRAVVTELGKLGVRASEHEDGIDIV
                     GAPISQLTSNAELSSYDDHRIAMSFSLLACVVPGSTTILEKRCVEKTWPAWWDVLHGP
                     LHASVSGAHLHEALVHARTKRTGAWPTPSAYASDATIVLIGMRASGKSHVGQRLAGLL
                     HRTFLDADEVFAQLHGDLGAYVQSFGWDAFREAEAQILASLISQHPTGHVLALGGGVV
                     EYAPSRALLEHVREQVGPVVHIVRSYEAISAFLATSDRPAYGEPLSDVYARRQPLYTR
                     AACMETVNASDTTAEALARQLATPLGLGRLPASPSFFLSLTMADMHEARPLMTQITPG
                     VDVLELRVDLLRECTPAFVREQVAELRRITPLPLLYTVRSASQGGRLPDESEDLYFEL
                     LYLGLRMGCDYIDLEMHRPAARLAAVAEARGRSLIVASHHDTAGELRWTAPVMRRMYD
                     RGRQLGDMVKLVGVARSWQDSMDLETFRATVARDAPHPLIAINMHEMGRLSRIVNPLM
                     TPVTHELMPSSAAPGQMSVRAIHEARHLLGLLPRRRLFLLGSPIAQSQSPLIHNTGFQ
                     VLGLPHVYERFETSTVDERLVQLLHAPDFGGASVTIPLKLSIMQLLDSISPEAQVIGA
                     VNTIVPRRDSDTGRVALHGENTDWHAIYDRARAAHVRSDGLVALVIGAGGSARAALYA
                     MHRLGASCILLYNRTYDKAVALAEQVPVEWHVEAIPSLASVGARADHAQLRVVVSNVP
                     AAATSLSPEQGADIVLPKELLPAQSGVAIDMAYGVEHTPLLVLAQMHGWHTVRGIDIL
                     LSQAYRQFRLWTQLPPPCAAIEHEVLPAYAASLP"
     gene            <298936..>301377
                     /locus_tag="MRET_4222"
                     /note="MRES_17070"
                     /db_xref="GeneID:38740988"
     mRNA            <298936..>301377
                     /locus_tag="MRET_4222"
                     /product="ATP-dependent permease"
                     /transcript_id="XM_027630849.1"
                     /db_xref="GeneID:38740988"
     CDS             298936..301377
                     /locus_tag="MRET_4222"
                     /codon_start=1
                     /product="ATP-dependent permease"
                     /protein_id="XP_027486506.1"
                     /db_xref="GeneID:38740988"
                     /translation="MVRIAVAGLSRLGVPLMHACAVRTGMAGPCGVAMMRAQIPMARP
                     VAPLTALFRASLHTSRVVMDKKPARQSSGVLSQVVSALRDMASSRPTQGKSSQYPAVR
                     RLMELMRPELRGIVLALGLLLIASLVSLSVPFTIGKVVDFFSQPDARFPFGLTMPTVA
                     TLLLCVFATGALARASSNILLELTGVRVIQRIRERAFSNALRQDVSFADKGAGDTVSR
                     INMDCNLVGGAITTDLADGLRSTVTVLASCSAMFYISTKLTLVMMLVIPPAALCAAYY
                     GRFLRNLTNKTQDAVGVMTRTAEERLSPAAFRTISASGTQRAEEKRFDARVQEIAALQ
                     TKEAYAGGIFHSGLGFVGNCTIVTLLTYGGHLVSLGQLTVGDLTSLLMYTAYLGGGLI
                     LMTNFFTSLMKGVGAGARVFGLLDQQPRIPLGQGVKLDVASMDRRGARIQFDDVHFRY
                     PSRPEKAVLNGVSLDIQPGTSVALVGSSGAGKSSVHALLLRFYEPDSGRVMMDGRDIR
                     TYTPESLRSVMSVVPQEPVLFEGTIAFNIGYGTPHATREQIERAARAAHCLEFVRTLP
                     QGFDTVIGPRELSGGQRQRIAIARALVREPSVLLLDEATSALDSASELLINEAITSII
                     NEGRTTVWIVAHRLSTVRAADTIMLLEDGRIAEQGTFEQLDQPGTRFRALMQSQLTAP
                     PPPAPAAVPDGRRAYSTAACRRHVPAAPVWSVREATQAADTAPLLDPARLAHMHRLAA
                     LPQPATAEEMERLRAELEPLVAVMHSTQATGEYDAVPETAWSGWRATDEAPLTRSELE
                     AGGGHWRAGYVVSSK"
     gene            complement(<301387..>302106)
                     /locus_tag="MRET_4223"
                     /note="MRES_17075"
                     /db_xref="GeneID:38740989"
     mRNA            complement(<301387..>302106)
                     /locus_tag="MRET_4223"
                     /product="cardiolipin synthase"
                     /transcript_id="XM_027630850.1"
                     /db_xref="GeneID:38740989"
     CDS             complement(301387..302106)
                     /locus_tag="MRET_4223"
                     /codon_start=1
                     /product="cardiolipin synthase"
                     /protein_id="XP_027486505.1"
                     /db_xref="GeneID:38740989"
                     /translation="MLAVALHRGVLARRLGLRTLATSRVVWSRPPPVKLSEDIVTVPN
                     LLTMSRMALCPAIGWAVMTHQSPLALGLLGVAGCTDLLDGWIARRYGTQTVFGSIADP
                     AADKLLMGTMVVSLGLGGAMPWPLVGLILGRDVFLVGLAFVMRYRSLAPPRTLARYFN
                     PRLPSVHVTPTRISKGNTFLQLVLVGVLTLLPLLPESVQTHPHTTRAVRVLEGIVAGT
                     TLWTGIDYAISRRSIRFLHVT"
     gene            <302212..>303993
                     /locus_tag="MRET_4224"
                     /note="MRES_17080"
                     /db_xref="GeneID:38740990"
     mRNA            <302212..>303993
                     /locus_tag="MRET_4224"
                     /product="translation initiation factor eIF-2B subunit
                     gamma"
                     /transcript_id="XM_027630851.1"
                     /db_xref="GeneID:38740990"
     CDS             302212..303993
                     /locus_tag="MRET_4224"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     gamma"
                     /protein_id="XP_027486507.1"
                     /db_xref="GeneID:38740990"
                     /translation="MVLPTPSLHAQRFQPVIFSDEGTNLYPLCDSMDETMPKALVPVM
                     NRPMIAFPLQWLVSAGFRTCLLVAPVAQHAAFYDALRSLYLVPSSSDREAEQAEQAAT
                     QVALGSSSASNVSVTFGSSTSSVLSGTGALVDPQPSMPVMHVELVPYGPKPGELVRSV
                     REPSKSVSRTRWGTAQLLYWLAATRQLTQDPLVVPVDLMAVHMPLSNFLMAHLGAVPD
                     VPTVSCLLYERSASEGAGKERERDGPANLFVAYDRRPLRSHEGIRSQRHGAKDTLHIH
                     EPLFLMDSDDVYDKNASDLELRMSMLWTHPHVRVTTALLDSHVYALHLQPLLPLLEAH
                     PELNHITEQLVPFVVKCGWQKRLSHKAEWTTDAPSAEGPCSATDAVVDTTHGTPFHPH
                     CEMMLAHMRPEPRRPCAPQHVLEADKLRSADDAFMARANTVPTYLDCSRYLLRLASTS
                     MPLPAPFPLPAMLGCGVVPFEAPKSDDGPIHPRAQLSNDCLIGSHTRIDERATLKHSI
                     VGRQCTIGKGARILRSVIMDGVRIGDNAKVENCILGSHADIGERAQLRETDVGPHYVM
                     APNTESKNEKLVAEEEEHLDEPVSDSM"
     gene            complement(<303996..>307037)
                     /locus_tag="MRET_4225"
                     /note="MRES_17085"
                     /db_xref="GeneID:38740991"
     mRNA            complement(<303996..>307037)
                     /locus_tag="MRET_4225"
                     /product="regulator of nonsense transcripts 2"
                     /transcript_id="XM_027630852.1"
                     /db_xref="GeneID:38740991"
     CDS             complement(303996..307037)
                     /locus_tag="MRET_4225"
                     /codon_start=1
                     /product="regulator of nonsense transcripts 2"
                     /protein_id="XP_027486530.1"
                     /db_xref="GeneID:38740991"
                     /translation="MDQPQLVAPSHGQVVDEAKTAAPSRDAADLAKSAEREKWRASLR
                     EANQHVWLHGPHGSGDNLDASLKRNSAFIKRLKQTNLADAKDALVKEVQLLSLTKYLD
                     ELIPSIPEILWKATTLKDRYAVIEILCALHARFGGSEFTEPLLKVMEQEIVPPPPKSQ
                     DASNEQAQKEAALVARQRSLLRGVTEMVLVGLVGPMTLSEGVCAPGLNWLYEQLRKML
                     SQDRDLVYTSVAQAILRSYGSLLLVPMETHEAGQPGVPMGKLAEDAVISEAQSLKFRK
                     LFEAYYAMLARRAQREHEQLQEQEQRNSDAYIRSGVVFDDRQSAFERRVSDVHTMIEA
                     MHAMAASLQVELPELRESDKDPSAPRFGVNLEATSTLAEMSAKMEQEYASGKSPWEDE
                     EMRKFYKDLCPLDELLPASVLEAAAASSDETDARVQQSLQHSLDRLPTMCNQGTVDDV
                     AIELGFQLKSMSARRLSAALLHVPKHRWDMLPYYARLIATLQPYRPGLAEAVVEHLNQ
                     KLRQQQSFRKPDRQLQSHLIIYLGELTKFGLVPEHIVFHLYKVLLDDFSPTSIEMLAL
                     SIETCGRYLHRMPATAARMQHVLDLLRRKRLAHNLSEQHTLLLDNAYYKCVPPDRPIV
                     TYREPSAMEQFITHVFTHMLGHGSFDRTQALVKMLNWSDESIRAHIFTLFTSPWLLTH
                     DTLPLLARLLSRIQQCHEAFVCEVLDTLSEDIEADLLHLDFAGHQRRLARVRYLGECH
                     ACFLVKPDAMLQQLYRLCVPQPQRKDAPNDYTRVRMACTLLPYFGKAFQKPPYKQRLD
                     HVCAVLQHYILSKDEPPVEVAYLLQDSFSHLGVSRDGRVNHKRLAKRLREAQPYLVKL
                     DLGKRMAGKRPAHRGDGDNDDDNDDDHDDEEDDDDDDDDPERQAAQQAALDERAEADV
                     EQELAMLMADTGGPSAAPSGMALEQTRSMLARAHVPRRRLEANDQHMVFSLVSRKQTQ
                     DIHVPTDASISMHARQQQAEAEAERQQLKAYVLAYREREES"
     gene            <308081..>309073
                     /locus_tag="MRET_4226"
                     /note="MRES_17090"
                     /db_xref="GeneID:38740992"
     mRNA            <308081..>309073
                     /locus_tag="MRET_4226"
                     /product="heterogeneous nuclear rnp K-like protein"
                     /transcript_id="XM_027630853.1"
                     /db_xref="GeneID:38740992"
     CDS             308081..309073
                     /locus_tag="MRET_4226"
                     /codon_start=1
                     /product="heterogeneous nuclear rnp K-like protein"
                     /protein_id="XP_027486499.1"
                     /db_xref="GeneID:38740992"
                     /translation="MYTSAPALSSLASPANVSQSPSLYTQPPAPGPIVMRALIITSDA
                     SVIIGKQGRHINEIRELSGARLNISESIPSNPERILTVSGALDAVSKAFGLLVRRIND
                     EPFDQPSLPGARAASFRFIIPNSHMGAIIGRQGSKIKEIQEASGARLHAGETMLPGST
                     ERILNITGVADALHIAVYYVGATLLEHPDRGANNLPYRPAAMNRALGTSLMGSPIGTA
                     SPNSSMLSAGGSPKVLGSVLTPGFQTQQIFIPNDLVGCIIGKGGQKINEIRQLSASHI
                     KIMERNAGIAAGGSGTERLVTITGPPPNIQMAVTLLYQRLEQEKMRLAQNTPIL"
     gene            <309303..>309797
                     /locus_tag="MRET_4227"
                     /db_xref="GeneID:38740993"
     mRNA            join(<309303..309313,309346..309434,309475..309509,
                     309562..309576,309743..309753,309785..>309797)
                     /locus_tag="MRET_4227"
                     /product="small plasma membrane protein"
                     /transcript_id="XM_027630854.1"
                     /db_xref="GeneID:38740993"
     CDS             join(309303..309313,309346..309434,309475..309509,
                     309562..309576,309743..309753,309785..309797)
                     /locus_tag="MRET_4227"
                     /codon_start=1
                     /product="small plasma membrane protein"
                     /protein_id="XP_027486532.1"
                     /db_xref="GeneID:38740993"
                     /translation="MPITGSDTIKLIAAIFVPPLGVFLERGCHSDFWINVLLTCLGYI
                     PGIIHASFVIAKY"
     gene            complement(<309915..>310721)
                     /locus_tag="MRET_4228"
                     /db_xref="GeneID:38740994"
     mRNA            complement(<309915..>310721)
                     /locus_tag="MRET_4228"
                     /product="diacylglycerol acyltransferase family"
                     /transcript_id="XM_027630855.1"
                     /db_xref="GeneID:38740994"
     CDS             complement(309915..310721)
                     /locus_tag="MRET_4228"
                     /codon_start=1
                     /product="diacylglycerol acyltransferase family"
                     /protein_id="XP_027486503.1"
                     /db_xref="GeneID:38740994"
                     /translation="MPSARSIPSSPVNFSFRNLELSPNVSTASTPTIADGSMLEKQML
                     SAHAVAQMQDPVKIWMDRAMMDSKRVLYLNMGSIFFYNREDYDNIVASLEMLHEQVPD
                     ILVLWKIGNHPQSVQPIPTLEECNLPSYIRREHWIADVETVLSHPALAAFMHHGGGNS
                     YNEALAHGVPQFCISQWVDTHDIGLYIQHSGVGLWAEKSPKFDPSDMVPKLVRLLKDD
                     YKRFRHSALSWKLKCIQAGGTIGTVDIIENLLKSYDFPDNNSKARIPDAI"
     gene            complement(<310771..>311613)
                     /locus_tag="MRET_4229"
                     /note="MRES_17095"
                     /db_xref="GeneID:38740995"
     mRNA            complement(<310771..>311613)
                     /locus_tag="MRET_4229"
                     /product="diacylglycerol acyltransferase family"
                     /transcript_id="XM_027630856.1"
                     /db_xref="GeneID:38740995"
     CDS             complement(310771..311613)
                     /locus_tag="MRET_4229"
                     /codon_start=1
                     /product="diacylglycerol acyltransferase family"
                     /protein_id="XP_027486502.1"
                     /db_xref="GeneID:38740995"
                     /translation="MSSLVLTPKRYLILTNPATGQVNPLLSIAEELVNRGNQVVFMSS
                     EPIFKKLKKIQSRMGFIVQPESTPSPEYVMRMPLVFYTLGDNEVVADYTDKAAKLSDH
                     FHEVLRSKPGQIWAWLSMFAEHVPGATDSYGEVVFMIRDLIESLDPDMIIVDNFSAFA
                     VDGVRLTKRAFIETSPAAASAVASKVNIFRNPMPMSGGRSATGGIFVFFHNLLFILIW
                     LHFIFFNRHPAQRRRYRKEVLGLKPTDIICDSIMTPTPGMLPQQIATISFNVANMDIS
                     FGCV"
     gene            <312379..>314229
                     /locus_tag="MRET_4230"
                     /note="MRES_17100"
                     /db_xref="GeneID:38740996"
     mRNA            <312379..>314229
                     /locus_tag="MRET_4230"
                     /product="cytochrome p450"
                     /transcript_id="XM_027630857.1"
                     /db_xref="GeneID:38740996"
     CDS             312379..314229
                     /locus_tag="MRET_4230"
                     /codon_start=1
                     /product="cytochrome p450"
                     /protein_id="XP_027486564.1"
                     /db_xref="GeneID:38740996"
                     /translation="MADMPFFSVKDALYAVLGLAGLALALPVIFVAHQLLLSLYRMTI
                     GEMIHPWRHIPKVKSTDPLKILFGDFRAIKKAEPGEQHVKWMNELGPVYRYHHTFNVP
                     RVLLADPKALLHVLSPSRAYQYPKPEYTSTFLRSVLGDGLVSIDGQNHARQRKIIAPA
                     FAPSVVKDFQPAVHRHAHKLVKKLQAITRQEIDRHTGKIPKDTEITGQAPSDRDVALA
                     HPENQAVVDVLFWLSRTTLDIIGEIGFDFDFQSLEHGNKDRLAGAMNTLMEAVLNVDM
                     AVALYLILSEKPSMSWLRKIPTKRSTTIHNARAIVDEQAAIIVERLRNDILSENQGVS
                     KDSFDDDTSGRNKSLVSRMIRANMATDLKASERMSNEELMGQMTTLIIAGHETTATQN
                     SWALWLLAMNPDVQERLRKEVQEAHAKEMAELDSLSEEEREIYNTQPVRDIYSLHYLD
                     NVVKESIRMMPSIPSTIRVALKDDVVPLSRSYKRADGKGTYNSIVMPKGHELFIPLNV
                     IQLSKDLWGEDAQDFNPDRWDNLPKSVIDAKLPPGQLFAFLAGPRSCVGKQTAILETL
                     VLLAHLLLHFRFDVVPDWTLVQRQQIVRRAFVEGQWPEGIRMPLILTPLN"
     gene            complement(<314307..>314782)
                     /locus_tag="MRET_4231"
                     /note="MRES_17105"
                     /db_xref="GeneID:38740997"
     mRNA            complement(join(<314307..314446,314473..>314782))
                     /locus_tag="MRET_4231"
                     /product="dUTP pyrophosphatase"
                     /transcript_id="XM_027630858.1"
                     /db_xref="GeneID:38740997"
     CDS             complement(join(314307..314446,314473..314782))
                     /locus_tag="MRET_4231"
                     /codon_start=1
                     /product="dUTP pyrophosphatase"
                     /protein_id="XP_027486479.1"
                     /db_xref="GeneID:38740997"
                     /translation="MSVRLLVKRNPAYPLAKLPVRGSAQAAGYDLFACEDAVIPKGGR
                     AVVQTGIHVALPEGHYGRVAPRSGLAVKHGIDVGAGVVDSDYRGLLGVVLFNFGSDDF
                     QFRAGDRIAQLVIEKISTPDVEEVDSLDDTTRGSGGFGSTGGFSSAK"
     gene            complement(<314839..>315744)
                     /locus_tag="MRET_4232"
                     /db_xref="GeneID:38740998"
     mRNA            complement(<314839..>315744)
                     /locus_tag="MRET_4232"
                     /product="putative methyltransferase"
                     /transcript_id="XM_027630859.1"
                     /db_xref="GeneID:38740998"
     CDS             complement(314839..315744)
                     /locus_tag="MRET_4232"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_027486540.1"
                     /db_xref="GeneID:38740998"
                     /translation="MTSSPQGLFQLTGPDAYRVEDADEEVYLLHVRSGENTEGLGVVD
                     SKHDTLCVTLRISSQAGRSCPEDIQVVLHQNCTALRSRAGDTGSVAWRCSTFFAEHML
                     QQLWGTWPGPSLFHAQSFSACRVLELGAGTGVLPACLFAHPGWLHPSSRPIRWIATDR
                     ADNMPLLTKNVGGGRYDHAHAQVSVRELDWLDVQAASGRVLDRLRTDILSAYEGAYPD
                     LILCLDCVYNPALHRPLLSTLHAFCQPQHTAVLLVMQLRDVDNTLEFLTSWLSASWTV
                     YHVPESLLPPPMQTAYVAWVAWRTV"
     gene            complement(<315810..>317099)
                     /locus_tag="MRET_4233"
                     /note="MRES_17110"
                     /db_xref="GeneID:38740999"
     mRNA            complement(<315810..>317099)
                     /locus_tag="MRET_4233"
                     /product="peptidyl-prolyl cis-trans isomerase SDCCAG10"
                     /transcript_id="XM_027630860.1"
                     /db_xref="GeneID:38740999"
     CDS             complement(315810..317099)
                     /locus_tag="MRET_4233"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase SDCCAG10"
                     /protein_id="XP_027486563.1"
                     /db_xref="GeneID:38740999"
                     /translation="MSTLYVTEPPTDGKVLLHTPKGEIEIELWSKEAPKACRNFVALA
                     LEGYYDQCVWHRIVPGFIIQTGDPTGTGHGGESFYGAPFENERHQRLRFHRRGLVAMA
                     NTGEHNTNESQFFITLDATPELQNKYTIFGCVGGSTIYNVLSLADVEISATEPDRPVY
                     PPKLLRAEVIHHPFTDLVPRITPAERQAQQEARALAAQRQGTMERQRKRPKKNTTLLS
                     FGDEEDAPLVTEKKPMSSHDLLHDKRLSKATMLSSKPATKPQPPPRLEPAPEPEPTPS
                     PEPAPEPTAQPSHELTAPRPPTSSAPAPSSVSSLAALLQAYKKDRGHEHDTLSRLDAF
                     QKRMRSEAPAPQRHARSREAESEDEQDMREYGDDEDDDADWRSHTFQSDGRPLQGNDP
                     LSVHDYQVVDPRASRGSLPASLSSHRERQAHEKARAP"
     gene            complement(<317154..>319604)
                     /locus_tag="MRET_4234"
                     /note="MRES_17115"
                     /db_xref="GeneID:38741000"
     mRNA            complement(<317154..>319604)
                     /locus_tag="MRET_4234"
                     /product="RalA-binding protein 1"
                     /transcript_id="XM_027630861.1"
                     /db_xref="GeneID:38741000"
     CDS             complement(317154..319604)
                     /locus_tag="MRET_4234"
                     /codon_start=1
                     /product="RalA-binding protein 1"
                     /protein_id="XP_027486638.1"
                     /db_xref="GeneID:38741000"
                     /translation="MHPKQHQHHPSEDQGSRRDDARQLSPQAMTLPELFSEAQTSDAH
                     AALAYLLHQYNHLVSEYTHLASLVPGLEHSEPIGLGVDMAPATSLTGRIRNLRRRSTR
                     GLRNDSNKAVVYPAEASMDVPNIVETMHTVSPKREGTPVHFGSQVHHHSPRIWRKSSA
                     PSMSQRIPDSPSQRIVSRQAASPRLSTRSPTIARPQPRKPSSRPTTPLEDATPHPDVV
                     PLAQAEVHVYGSVVRSLQGPDAVGFRVKLLPQPDVRRRCRTARAVMTWSDLVALHERL
                     LLRTHAPPFALPDRSLFEAPYTPSRLSDRNKAVATYLRSLQLASSVSDDLLSQCFAAH
                     TAVEPDVDPVYGTCLLQDDLLRVMSDAWLFCHCALYHHVLTIHDPSSHHQPIVFDLRR
                     TRIGRQYEVPLHARDPNAHTTLIVLQRTQQPSSAPVKLATESSRHHSEWMSALLRESE
                     DRSPDSAHETELFYTPKDTDEGAFPSSPRLDRPTVSVSPASDQGRSSLLSRFWYGTEP
                     SSTALQPEKRRFLFGILPLGSSEEAPTSQSVFGMPLAEAVKHTGMSMDSAPSPVPVVI
                     KRCIEFLDQPSVASEEGLYRVNGSMSAIKSLQDKFTASGDVDFVETQPSGNLDAHTVA
                     GLLKMYFRALPENLCGDTLPDAMLALQSDSQDDRLCALTSVLDSLPPENYAVLCVLCK
                     HLHNVYSFEHANKMTLQNLSIVFSATLDLPTELVLTLLQECQHLFTYPGYLVVNDYAD
                     ENPPTALPERIQSMSLQPPPEPQPRRGHYQRLSDAPLYDPRHHAPRADDAHDGTSIAS
                     ERSTSSNPFPPASTVAPS"
     gene            <319731..>320702
                     /locus_tag="MRET_4235"
                     /note="MRES_17120"
                     /db_xref="GeneID:38741001"
     mRNA            <319731..>320702
                     /locus_tag="MRET_4235"
                     /product="Ran-binding protein 3"
                     /transcript_id="XM_027630862.1"
                     /db_xref="GeneID:38741001"
     CDS             319731..320702
                     /locus_tag="MRET_4235"
                     /codon_start=1
                     /product="Ran-binding protein 3"
                     /protein_id="XP_027486625.1"
                     /db_xref="GeneID:38741001"
                     /translation="MAAEHESPAVAPRASKRGLDDAAPVQDDAAKRQRGAAGASEASP
                     KDQASGDASAKEAPHNQASADASANESPHNQTSTDASAQESPHNQASTKTSEAPKDQS
                     SRETCATSHASPPAVAPKEKGDDKSSATEHTAPSEGTKSKGPALGFGAFASRSAPFQS
                     ATALTAKADAASDQKEKDWATDKAAAPIKNDGDNVVRMKEVPKPDVELTTGEEEEETV
                     ASARAKLYSLAENQVWKERGTGAIKINVHRPSASARLVMRLDAVLKLILNVKLFPGMQ
                     CHLDQERFLRVVAMESDGLTHFLLKFGNAADAHAFLTHLQEHIPASS"
     gene            complement(<320730..>322001)
                     /locus_tag="MRET_4236"
                     /note="MRES_17125"
                     /db_xref="GeneID:38741002"
     mRNA            complement(<320730..>322001)
                     /locus_tag="MRET_4236"
                     /product="universal stress protein"
                     /transcript_id="XM_027630863.1"
                     /db_xref="GeneID:38741002"
     CDS             complement(320730..322001)
                     /locus_tag="MRET_4236"
                     /codon_start=1
                     /product="universal stress protein"
                     /protein_id="XP_027486481.1"
                     /db_xref="GeneID:38741002"
                     /translation="MSFYASDADDTSIHGRRGHHLRVGSFSRLGLGGRHSVSRRSSVD
                     PNADDDNSVHVVVNADDDESVLSSDDESVMFSNEPEDAEEDEILFDDSTIQNTRANAQ
                     MLYGAPSQSHITNYEDEDLLDPAADEFQTAPNIVYARSEKELMEQRTLLIKNGLPATQ
                     PGRPPLVTHGPVLEPHQCTVRMTYGDYEGCARQSKRPKRYIVASDSSEGSQYAINWAT
                     GTVLRDGDEMLVVSVMDADAKGEQYTEDTAPPNLAPPSRALQDMAIFLCHQVFVLLQR
                     TQLGVRIACQAVHSTNARHMLLDIADFYSPTMVIVGSRGVDGIRGMLGSMSHYLVQKC
                     SVPVMVCHNKLQLPRLPRGKADVVNNVRKRHMRLDQAAVEKLSSRPEPQDEEEEGEHV
                     QADREQREQRDSERMERLNRESLARRSTLSE"
     gene            complement(<322066..>325227)
                     /locus_tag="MRET_4237"
                     /note="MRES_17130"
                     /db_xref="GeneID:38741003"
     mRNA            complement(<322066..>325227)
                     /locus_tag="MRET_4237"
                     /product="ATP-dependent Lon protease"
                     /transcript_id="XM_027630864.1"
                     /db_xref="GeneID:38741003"
     CDS             complement(322066..325227)
                     /locus_tag="MRET_4237"
                     /codon_start=1
                     /product="ATP-dependent Lon protease"
                     /protein_id="XP_027486565.1"
                     /db_xref="GeneID:38741003"
                     /translation="MMPTRQSIRRVWTTATGARIKRCAPVGKKLYGVRATHLRATQIM
                     TPVAHMNTSTRCMLPRSKNPTPRVVIVREDDEKRPTSVKASDRGDDDPAQNDQAPASQ
                     SGDEGEGSSASGSSGHDGDNNNNNHDDDSKGEGKGSLLLSRNSVPSVYPQVLALPITR
                     RPLFPGFYKAVVIRNPHVCAAIKDAMKRGQPYVGAFLLKDEEEDSDVIVSMDRVHRVG
                     VFAQITSIFPAHSGSKMDDSEEGITAVLYPHRRIVIDELITPMPKDQPVPSQPPEAPK
                     AVAEQENQEDESDDTSSIPSHNPPFQTAFLHQYEVSLVNVTNLQMEPYDRKPSQYTRA
                     VMSELISVFKDIANLNPLFRDQIANFSISQGAGNVFEEPEKLADFAAAVSSSDTEELQ
                     GVLESMNIEDRLQKALLVLKKELVNAQLQSKISKDVENKIQKRQREYYLMEQMKGIKK
                     ELGIESDGKDKLIEKFKEKASKLNMPEAVRTVFDEELAKLQTLEQAASEFNVTRGYLE
                     WLTSIPWGVHSPDNYAISRASDVLDEDHFGLKDVKDRILEFLAVGKLRGTVEGKIICL
                     VGPPGVGKTSIGKSIARALDRQFYRFSVGGLSDVAEIKGHRRTYVGAMPGKAIQALKK
                     VGTENPLILIDEVDKLGRGYNGDPSSALLEMLDPEQNSSFMDHYMDVPVDLSRVLFVC
                     TANTLGTIPQPLLDRMEVIEVSSYTAEEKRHIARGYLAPQAKEASGLKEADVSLPDES
                     IDFIIRRYARESGVRGLRKLLEKVYRKVAFDIVKEHGEEVFPEPSSEAETKPSPTSAK
                     NESIQVTKQERSPMAVPPKVSVVINEEQLRDYLGPPIYHKDRMYTNTMPAGVALGLGY
                     LGNGSGSLMPIETTLMPGKGNLHLTGKLGDVIKESASIALSWVKSHAYELGLTKEPGD
                     TLLDHRDVHLHMPEGAIGKEGPSAGVAFAVSLISLLTDRSLPTKLAMTGEVSLRGMVL
                     PVGGLKEKLLAAHRAGITTVILPAHNRPSVEADVPKSVLDDLEVHYVTNVWAALDVAF
                     GHGPWSAQARVWSSNETPEAASQ"
     gene            <325384..>328542
                     /locus_tag="MRET_4238"
                     /note="MRES_17135"
                     /db_xref="GeneID:38741004"
     mRNA            join(<325384..325483,325514..>328542)
                     /locus_tag="MRET_4238"
                     /product="DNA polymerase delta subunit 1"
                     /transcript_id="XM_027630865.1"
                     /db_xref="GeneID:38741004"
     CDS             join(325384..325483,325514..328542)
                     /locus_tag="MRET_4238"
                     /codon_start=1
                     /product="DNA polymerase delta subunit 1"
                     /protein_id="XP_027486629.1"
                     /db_xref="GeneID:38741004"
                     /translation="MSMADDASHKRRKIHAQPGSFTDTLANLDDAQTDPSATWERPPL
                     APLDATQHSVVFQQIDVEECQLSHAVPEIRMYGATQEGHPVLVHVHGFLPYFYVHAPR
                     GFFASTCADLKNSVNASFGMNVVADVALESKKNLMQYTGPESIAFLKITVSDLRSLPR
                     VRGAFERGEISFRDLFVAGEPNVSFDNVAYTLRFMIDHQVVGMNWIEIPAGRYTLRAP
                     NERISRCQIELDCGPDAIVSHAPHDEWLKMAPLRTLSFDIECAGRKGVFPDPNVDPVI
                     QIANMVTRQGESAPFVKNIFTLGSCSHIVGCHVMSFDTEVELLEAWSDFVQRVDPDVV
                     IGYNISNFDFPYLLDRAKALKVTTFPFLGREKNARSEAKDTHFSSKAYGTRDSKHTEL
                     QGRIQLDMLQVMQRDYKLRSYSLNSVSFEFLKEQKEDVHHSLITELQNAGPETRRRLA
                     VYCLKDAYLPQRLMDKLMCLINYTEMARVTGVPFNYLLSRGQQIKVISQLFRKAREDG
                     YLIPAYKNEGGDDQYEGATVLDPKQGYYDKPIATLDFASLYPSIMMAHNLCYTTLIDK
                     RTIERLALVEGQDYVVTPNKNYFVTTSRRKGLLPDVLEHLLAARKAAKADLKKETDPL
                     RRAVLDGRQLALKVSANSVYGFTGATVGRLPCLEISMSVTAYGRQMIEETKRQVEARY
                     TIKNGYAHDAVVIYGDTDSVMVKFGVSHVEEAMALGAEAAEYVSKSFVKPIRLEFEKV
                     YFPYLLINKKRYAGLYWTRPETHDKMDTKGIETVRRDNCRLVRTVIETCLRKMLIDRD
                     VRGAEDYAKQVIADLLQNKIDMSQLVISKALAKADYAAKQAHVELAERMRKRDAGSAP
                     ALGDRVAYVIVKGTKGSAAYEKSEDPLYALEHNIPIDTRYYLDNQLSKPLLRIFEPIL
                     GERANSLLSGEHTRVLQVATSNVGALMKFAVKTVQCLGCRTPLKDQHAAVCSNCKPRE
                     TELYFDKVRRVSEAEMEFNRLWTCCQRCQGSLANDVLCSNQDCPIFFKRKRAQMDAED
                     ANHVVQRFDLSW"
     gene            complement(<328543..>330522)
                     /locus_tag="MRET_4239"
                     /note="MRES_17140"
                     /db_xref="GeneID:38741005"
     mRNA            complement(<328543..>330522)
                     /locus_tag="MRET_4239"
                     /product="25S rRNA (cytosine2870-C5)-methyltransferase"
                     /transcript_id="XM_027630866.1"
                     /db_xref="GeneID:38741005"
     CDS             complement(328543..330522)
                     /locus_tag="MRET_4239"
                     /codon_start=1
                     /product="25S rRNA (cytosine2870-C5)-methyltransferase"
                     /protein_id="XP_027486627.1"
                     /db_xref="GeneID:38741005"
                     /translation="MGRRAKSKQPPPAPLPEPKRIKEQPPKAPSKRETGAAHAPRPRG
                     KEPAGQASSQPAKAAPRTRPPADAPPDISADQILESLGLPKDKKLTERQKKKVLAEVE
                     RLELLLKSSGYSVDEGSDDAQDQHADDEDLEEEAEDEDLDEDAQGDLEGEDNEDEDLE
                     EEADDEEIDEDAEDEDLEEEAEDEDVEDNEDDLAGEDFEGDDPLEGEDAEGEDLEGEN
                     LEGKDLEDEDLEDEDAVEGEDPEDDEANQFLLPTVEEEEEEQRQPLNLQLVHMRIQEV
                     VRVLSNFAALAEPDRSRADYMDRLCKDVQTYYGYNEFLAEKVLDLFSPEEAIAFFEAN
                     EVPRPVTIRANTLRTRRRDLAQKLINRGVSLEPVGPWSKVGLQVFESAVPIGATPEYL
                     VGDYMLQAVSSFLPCMALAPQPHERILDMASAPGGKVTYLSALMQNTGCIFANDSNKA
                     RIKSLTANVHRMGCRNIVVCNYDGRQFPKVLGGFDRVMLDSPCSGTGVISKDASVKTN
                     KSKRDLILLTQLQKQLILCAIDSVNPKSETGGYVVYSTCSVMVEENEEVIEYALRKRP
                     NVRIVPTGIDFGRDGLKRFRSRTFDERMTLCRRIFPHVHNMDGFFVCKLKIEPINKGD
                     KRRMAQEPDDAVFDNAQDDAIIQRAHERMAKKRRT"
     gene            complement(<330630..>334286)
                     /locus_tag="MRET_4240"
                     /note="MRES_17145"
                     /db_xref="GeneID:38741006"
     mRNA            complement(<330630..>334286)
                     /locus_tag="MRET_4240"
                     /product="RHO1 GDP-GTP exchange protein 1/2"
                     /transcript_id="XM_027630867.1"
                     /db_xref="GeneID:38741006"
     CDS             complement(330630..334286)
                     /locus_tag="MRET_4240"
                     /codon_start=1
                     /product="RHO1 GDP-GTP exchange protein 1/2"
                     /protein_id="XP_027486483.1"
                     /db_xref="GeneID:38741006"
                     /translation="MPSRRRGEPPTADKRAAAFESIFGPRMPSKPPPERSASFSPPSA
                     RTAFSHAPAYPQTYVYTAVSPTSSTTDLPWQASYAPSTSAAHYVAPSAPHAYSAADTS
                     LASSMSAVSIESPPPPTPARSAPWPTRTLSTSVATHVYPSHDRRPPTRYAPRASMEST
                     ESFDEERHRPSDLRTVPSIVSMRRQPSLASTSAPAIESAAALAQPMSPTRTSRTTAPL
                     VRHASGRTVPSTVHPALLSQVAQALEAVLRPRFDGKEAVDRLVELTHVSDRNMVLLLG
                     RALDAQHFLHHAAYTHRLRDSEHELYEFTHDHSHLRGSFSSTHQPTLSLLGADGGALD
                     AACATYPTGVFTLLTGCYSPTCTRDARCYSITCPYRLERQSQLVVHPSLQHHDSHESL
                     VDISSQLWAESVSSDVYESVSPTERKRQEVIFEIISTERAYVQDLEYLRDLWLTPLST
                     QHILPEARRAEFVRAVFRNLLDILAVNARLVDMLTRRQRHRSVVEHIGDMYAEVVPDF
                     EPYVYYGAHQAAARLRLEEERAINPVFAMFVEDTERKAVSRKLPVNGFLTKPTARLAR
                     YPLLFEQMLKYTADDNMDKIILPKVIHQIKGLLSLVNDETGRSENRLQLGFLSQQLQF
                     KPGELVDLKLGDARRELVFKSALKKRSAQSDSSEIQLYLFDHALLMVKIKVVHKNEVY
                     KVYRRPIPLELLQVTMYEDVATSKGPRTRAVLSRSSFGHRTCLAPGVGSPPLRQDAKS
                     GYALTFTYLGKQGYSLTLWASTLASRDKWIEHIELRQHRLRQQSCVFDLLPVAPRGAP
                     VVVTCAVPFDGGRQVFLGFPDGVYLQDLRDRSRSPTLVLPLRHVLQMDVLEEFQILLV
                     LAEHVVYTFTFDALDPSDPVASMRHGRRIASHTSFFRAGMCLGRTLVCVVKSGAASST
                     IKTLEPIDVHARAKKHPTFGKMLPSGQDTLRVFKEFYIPTESSSIHFLKSKLCIGTIK
                     GFEIVDLETLDTQGLLDPADASLEFVQRQENLQPIAIFRIDGEFLLCYNEFAFYVNKN
                     GWRARASWLLRWEGTPTAFALHYPYVLAFDPQFVEVRHVETGALHQVITGYQVRCLFS
                     DTAASTLSTLSRLHHARAHKARTLSTVTAPGTPPTAPYAVASLDGYVSSTYASSPPSF
                     VAARPPGPWTASPSPYASPSMPTPPLAYASAAAPPSHVQTPLVDSLLSSRHEILMSGD
                     SAAFLLRPHTPAPP"
     gene            <334893..>337379
                     /locus_tag="MRET_4241"
                     /note="MRES_17150"
                     /db_xref="GeneID:38741007"
     mRNA            <334893..>337379
                     /locus_tag="MRET_4241"
                     /product="calcium permeable stress-gated cation channel"
                     /transcript_id="XM_027630868.1"
                     /db_xref="GeneID:38741007"
     CDS             334893..337379
                     /locus_tag="MRET_4241"
                     /codon_start=1
                     /product="calcium permeable stress-gated cation channel"
                     /protein_id="XP_027486684.1"
                     /db_xref="GeneID:38741007"
                     /translation="MASRLSARDAADEILRDLKSNVSGHLTVSAVGLFMAIAFGAGLV
                     TLCVFLVCRRRHRTLYAPKSYAISIKSLITMRSSHGGFFKTVLRLRDEDLLRMTGTDA
                     VVFLEFLRLTARILTAVALPLCVILIPIDITYKQDLSTDDDVPDTLMYLTMGYVQGPR
                     LWAHVILSYGVTISGLVMIYMSYRKVIRLRQAYLASSEYQTSYFSRALMATDLAPEIQ
                     DDASLRAALMAEGIVYPLCEVQLGHGMHNLPDLLARHTAAVHKLERYLDKALRSHKRP
                     LIRLAWTAPKMDAIAHYAGVVESLEQDIATARSERSEGAPQSYGFASLAMPAYAHATA
                     KMLTKKPSRRVKIRLAVSPCDILWQNLMKDPASRRRSRHWARVLLLLLFLFNIVPLLA
                     VSLISNLNAFSRISQTLSDWQTNRPLSFALCTGVLPPLISFANSLLLPMCMRRIAMYR
                     GVRTRQSRDRSLTNQYFTFLFTTQFVIFSLIGVVLDLVIMIMAAFRHKDKPSRALSDM
                     AREMLNQVSKRFQFQSAYWMTWLCLRGFLFLLELAQIRRLGFLMVDRYLFSHNPRDLH
                     EYTKAPSFSYWKGYAEMLFLVAIGLIYAPLAPLVAAVAAGVLWIAVFVYKNQLYYVYA
                     TKSETGGRLWSSVVTSLLAMMTVMEVIVALAIGLLQNWIKAVICLPPIVLVVLFGWYC
                     RAKLEPLFLWYNPSPMDLARARVHVPRSDRARLARQFGNVFLHCPLEQPIVDVKLMGR
                     VHEFYDGPVMPSHHVVEPVIPYETSPMASVDSLPVDEEGLASDVEWKDEEEGTWDGES
                     KEEEAYPMKTRVPPSKAEFDDIMEMYAEHV"
     gene            complement(<337380..>338108)
                     /locus_tag="MRET_4242"
                     /note="MRES_17155"
                     /db_xref="GeneID:38741008"
     mRNA            complement(<337380..>338108)
                     /locus_tag="MRET_4242"
                     /product="NAD(P)H-hydrate epimerase"
                     /transcript_id="XM_027630869.1"
                     /db_xref="GeneID:38741008"
     CDS             complement(337380..338108)
                     /locus_tag="MRET_4242"
                     /codon_start=1
                     /product="NAD(P)H-hydrate epimerase"
                     /protein_id="XP_027486653.1"
                     /db_xref="GeneID:38741008"
                     /translation="MLLRYLGSSVAQQLDRDLMSPSGGFSIDQLMELAGLSCAEAVYR
                     SYPPQPDRQRILVACGPGNQGGDGLVAARHLKHFGYTPIVWYPKRKDASLFHGLVQQL
                     HNLRVEFADTEHLPASALDDAHLVLDAIFGFSFHGEPREPFKSTLENLVQRTLPIVSV
                     DIPSSWNVDDGPQTSALARSFMPDVLVSLTAPKRGSAFFTGGKHWLGGRFVDAALDAK
                     YDLRLPPYPGTSQVVDITGAMPLD"
     gene            <338905..>340455
                     /locus_tag="MRET_4243"
                     /note="MRES_17160"
                     /db_xref="GeneID:38741009"
     mRNA            <338905..>340455
                     /locus_tag="MRET_4243"
                     /product="flavin-binding monooxygenase-like protein"
                     /transcript_id="XM_027630870.1"
                     /db_xref="GeneID:38741009"
     CDS             338905..340455
                     /locus_tag="MRET_4243"
                     /codon_start=1
                     /product="flavin-binding monooxygenase-like protein"
                     /protein_id="XP_027486652.1"
                     /db_xref="GeneID:38741009"
                     /translation="MTCVCALLDAIRIYLYQLLQVLINVLFTPLPPSADAPKMGRVAV
                     IGAGLTGLSSAAQLKSHGFDVTIFEERAREGGIWCDVNSTSNLQTSSIMYRFHPLVFY
                     RSIYPCRDDILAQQRKVWNTYRLSENARFQTRVTKVDRNKAGRWIINGNASETFDGLV
                     VTVGTCGKPNMIPLPNQKSFRGEILHSSQLDEHDFEGKRVVVIGGGASGVEAAETALE
                     RGAKKATILARKDHWIIPRQLLVDCFITLFPYGSRFLAWLVPEQLIRRLHYRELDEKM
                     SPTTPLYSGTPVVNNDFLRLVRQGAADYQRGETTLLHHDGLEYNFRTRHQSKDERGET
                     RFMSADMIVLATGFERPTIDFLPKDLFPPGYARPNMYLQCFPVTDASVVCTNATYVNG
                     IGSVGHFHIGLYVRLLALFLHRPETRPSPAGMRKWVDSLRHSKRHCTGGPLEFFAYGE
                     LFMWFFLRMLSPVRLVYIFFVLFGFGEWTQNKQGQAQYRYTIMDFVPRLITLLHSVPL
                     ESPRFPRM"
     gene            <340547..>341522
                     /locus_tag="MRET_4244"
                     /db_xref="GeneID:38741010"
     mRNA            join(<340547..340605,340632..340637,340675..340704,
                     340769..>341522)
                     /locus_tag="MRET_4244"
                     /product="putative vacuolar membrane transporter for
                     cationic amino acids"
                     /transcript_id="XM_027630871.1"
                     /db_xref="GeneID:38741010"
     CDS             join(340547..340605,340632..340637,340675..340704,
                     340769..341522)
                     /locus_tag="MRET_4244"
                     /codon_start=1
                     /product="putative vacuolar membrane transporter for
                     cationic amino acids"
                     /protein_id="XP_027486655.1"
                     /db_xref="GeneID:38741010"
                     /translation="MTAMDGALAATDRWSFVMGWVSIACWVIVYTPQMQENYVLKSTE
                     GISIWFILIWLGGDAFNLVGGLRQEVLPTMIGLAAYYCFCDMVLIWQWWYYGTYYREG
                     QPIATRDAEQTPFLPHASRSTTRRWMPTWDDVMALLPSHHLTLLKYALALSFVLVTAV
                     AAYVAADSHPPSSDPGPGMRWDAQLLGWLSALLYLSSRIPQILKNRHTKCAGLSLALF
                     IFAVGGNVTYVLSILLKDTSVPYLVENMSWIVGSVGTIFLDGIVFYQFVRYAPERAAL
                     EAASYP"
     gene            <341585..>342892
                     /locus_tag="MRET_4245"
                     /db_xref="GeneID:38741011"
     mRNA            <341585..>342892
                     /locus_tag="MRET_4245"
                     /product="amyloid beta (A4) precursor protein-binding,
                     family B, member 1 interacting protein"
                     /transcript_id="XM_027630872.1"
                     /db_xref="GeneID:38741011"
     CDS             341585..342892
                     /locus_tag="MRET_4245"
                     /codon_start=1
                     /product="amyloid beta (A4) precursor protein-binding,
                     family B, member 1 interacting protein"
                     /protein_id="XP_027486654.1"
                     /db_xref="GeneID:38741011"
                     /translation="MEMDRAPLVGSMGGERVSSSTAHSDDEHYGCPSDDEAPRRLSNA
                     VTSLRVAPAEDDAPLLHDDARRTASAVHERIIREEKARQKDKTLEILEGRRAPMQRSR
                     TLPHGRGPRWPAPPPPPPPYDAVAEVPRPSTSRRVITAPVPDGRPAMTQRPPHGSQVR
                     VFLQTVQRYRLVPLNEHTLAWHAMQFVQAQGALPSLPGAHDTWAMYDVIPDVGMERPV
                     RDYERLEEVVQARGSPGYFLIKPSEWPELLRSDAIPTYSSVLGGYVQVQLDDRTWTRR
                     WLELREHAVFLAKSETSRPEVCVCTLLDVDVYMVDRQRVPKGYGFALRTQTRPRTVLL
                     ATQSSEAAHHDWIKSLCRARSYVLCQERPDILASAHSLERAEQRAASDRRAKNIRKQA
                     ALQRSKSVGKQHAHGPLIQSDAFDVPFQKGSLLDTRPSTTAGR"
     gene            <342961..>347193
                     /locus_tag="MRET_4246"
                     /note="MRES_17165"
                     /db_xref="GeneID:38741012"
     mRNA            <342961..>347193
                     /locus_tag="MRET_4246"
                     /product="DNA polymerase gamma 1"
                     /transcript_id="XM_027630873.1"
                     /db_xref="GeneID:38741012"
     CDS             342961..347193
                     /locus_tag="MRET_4246"
                     /codon_start=1
                     /product="DNA polymerase gamma 1"
                     /protein_id="XP_027486686.1"
                     /db_xref="GeneID:38741012"
                     /translation="MRGQRGVSCAAPALRRVVRRMHTQEAPCNAVGVQLLERTLHRQV
                     FPPASTQIPPVDPCALDLCQDHLHQHGLHASKASKLSPTSFALPPLLGKDLGEHFWTM
                     GRRLVHPWMEYAETLARTPMPRPPRPEADIDADADAYWDADSWLALDESLQPSVPLRP
                     AALSMEPGWSKYAFLRTSQGTVAGLAPPEPVAYPDVEDAALVFDVETMPRVSSYPVMA
                     SAVGQHAWYTWISPWLVQRGERHTSMAHLIPMGPRDGSAPPRLLVGHHAGFDRAAVLE
                     EYSLHMTQIRWLDTMSLHVATNGISSPQRAAWTEHARRRAMRRLDAWLTTQRRERDTQ
                     EQIKAVLDEGDLDEDAFAALRMHVHDAAADAPEEEDGQVLWQDVTSQNSLADVAALHC
                     GIHLDKDVRNVFVESTSREEVASQLAPLLAYCASDVHTTCAVFAKVWPAFLRSCPHPA
                     TLAGVLGLGSTFLPVDASWQTYRRATQAKFEQMNARVVSTLKHLATTLMESGVAAIDA
                     QTPDRWWETDPWYAQLDWSPKRPKVHEEASLVPLWWRDKIAHAKRALGARSHIVVQLL
                     QLRCDGDAVVYDAAKRRWAVEREGELHALPSSPLSQAMRQRHTITSEAGADVLAAVLR
                     GEGDAAVRALALRVREAPGPHPALAQLDWTRVPYTDANERAPWWPKWYWDLYDARAKE
                     IDVTIRAKIAPLLLKIAWDGMPIYRSREHGWIYESVQRVEGQTPLVFSHAADAALQRG
                     VFYKLPHADGDGSNVGNPFSKGFLPLLESGRLQSLHPSRASGDAARGALEMNAQCSYW
                     ISARDRIERQVVVWDGEAETRMGFAPHDERRGLILPQVITMGTVTRRAIEKTWLTASN
                     AKRNRIGSELKSMVKAPRGWSIVGADVDSEELWICSVMGDAQFGIHGATAIGWMTLEG
                     AKAQGTDLHSKTASILGTKRDQAKVFNYSRIYGAGIRHAMHLLLKANPSMQVDEAARR
                     AKQLYAATKGQATRGDAYFGRRFWYGGSESFVFNKLEEIALSEHPRTPALDCGITAAL
                     SRQYLPRARGEQQDYMPSRINWVVQSSGVDYLHLLITAMGYLCATYGIEARFMLSVHD
                     EVRYLARDDDKYRAALALQIANLWTRAMFAFKLNMDDLPESCAFFAAVDIDHVLRKEV
                     DDPCVTPSQPDPIPPGESLDMAGVLAKAGGSLHRTRGVELADPGWPAYVPSMQQHRCV
                     GEAGLLFLQAQAATDMDEIRALHRRWQRLPSNVRSYATSARTPPALRTLAALEALLPP
                     RPRRRVARPRRRPRRKRAMPAMAPRPMPRIHLSGALLPPSLYNKPMLRYKPTQPLRMT
                     MMIRARRRARQRRLQRWDELQEIKFLLGDDDAWYDTYKPYERELQAQFQRERERAQMV
                     FTPEQLRVAKAARRARLAQYMARRTRQDTPRD"
     gene            complement(<347050..>348039)
                     /locus_tag="MRET_4247"
                     /note="MRES_17170"
                     /db_xref="GeneID:38741013"
     mRNA            complement(<347050..>348039)
                     /locus_tag="MRET_4247"
                     /product="nuclear envelope organization"
                     /transcript_id="XM_027630874.1"
                     /db_xref="GeneID:38741013"
     CDS             complement(347050..348039)
                     /locus_tag="MRET_4247"
                     /codon_start=1
                     /product="nuclear envelope organization"
                     /protein_id="XP_027486685.1"
                     /db_xref="GeneID:38741013"
                     /translation="MTSAYERGTQAPMDITELGPRKPSVFDVPDLSMASPDASLMDID
                     PDVPTVPPPAMATLPLVPPQIEAPRPSEAPPPPLDVAPVPRSKPAPRDPVTRSEAPRP
                     ALSLGSLPRPETLLTYAQVVFNLSILVVFLYLLLNIVLTIQHDVSQKVREYELDYLGE
                     ISSCEARYTSNRCGSDMQAPALSEACEAWRRCASRDPTVVGRARVTAETFAEILNGFV
                     DVVSWKTMLFSLLTLSIVVGATNSTLSFFPRPDGSAARHDAAATAAPCVHAPAYTLHG
                     GRGRRPLVSRGILPRAACHILCEPRASRGLRYTQLLGCEHHLRTLALALKLRL"
     gene            <348142..>349440
                     /locus_tag="MRET_4248"
                     /note="MRES_17175"
                     /db_xref="GeneID:38741014"
     mRNA            <348142..>349440
                     /locus_tag="MRET_4248"
                     /product="tyrosine phosphatase family"
                     /transcript_id="XM_027630875.1"
                     /db_xref="GeneID:38741014"
     CDS             348142..349440
                     /locus_tag="MRET_4248"
                     /codon_start=1
                     /product="tyrosine phosphatase family"
                     /protein_id="XP_027486480.1"
                     /db_xref="GeneID:38741014"
                     /translation="MPPTLLCPPMRFGTVAFPLPMSEWDAESSASPSTSSRITSFSEC
                     VYRGAYPKHRNLRFLETLHLRTIVSLTPKPITDDPVLAEWARAQNGGAGIQVLHVRTE
                     KPKEDTGGLTREGAARALMEVLNSENLPLYIHCLDGVDVTSTLVACLRKIQGWSEAVI
                     LAELTRGVHAWAAKSAGMQDTAPKHLAHFVERFGQPNGVLLPQRDRIPCWLWPRSSVP
                     PLAPHDTWDARPVSVQHPTLQIYFERSESYIASQQARFGAVWSVFDHTRSRTPSSLSI
                     SDSSEIPDMPGSPDKRTVTRRFSDVTHAKPVRSLDETWAYTSVDDQDLRTPRAKPQHV
                     DGDIPPLSDVTRGMALDMPSTSPFDDRTPLVMARDAPQRAGDVVDDDIPLLGPPVQLD
                     ESDESEPVVEDVVDDEDDEDEFAYEPMSESLEALDLEGYS"
     gene            complement(<349448..>351622)
                     /locus_tag="MRET_4249"
                     /note="MRES_17180"
                     /db_xref="GeneID:38741015"
     mRNA            complement(<349448..>351622)
                     /locus_tag="MRET_4249"
                     /product="SUN domain protein 1/2"
                     /transcript_id="XM_027630876.1"
                     /db_xref="GeneID:38741015"
     CDS             complement(349448..351622)
                     /locus_tag="MRET_4249"
                     /codon_start=1
                     /product="SUN domain protein 1/2"
                     /protein_id="XP_027486478.1"
                     /db_xref="GeneID:38741015"
                     /translation="MSIHNEMANSASPAAASPLRRSARLNRDVGIGSGLRSQPEAMDA
                     SAWSSSLYSTRDPSQVSSYYLRPYEEEKKDASMDDSLTGLGSLLRGAQRPTHTPRSYV
                     RDRSAFPDYSEEDKFMERVESEWRKRSGHEDDPPSGTPELEQADDPVFETQPTTPQVP
                     GLFRSVLHSAKRAASPASPARRPIVWPTLLWCAIAVLIAYVWYAHFPTFLSASDPLVT
                     SRPWTSPASGSSQELRERIVTLEGALNKVWRSVGDLSQELRTSQDKVLQRLSTLEQKS
                     VLRSSFDALERDVRALKKQHAESVSHWQAEKARIEALLSQSKDTNSAAFRARLADLDT
                     RLSRAEVQAREASEAAKQAKQAWEPLRGFLPERMPVRYDARTQQVRIDPAFWHEFRKV
                     VPAQHQGTAPMSWEAFLAEHRHELDAWIADLLHHSRDDNAVMLDRSTFFKLMEAEITR
                     AKTELSTQFNEHVHGLESDVLAKVQYRLEQQQKQEGASSSAVHVEDVRAMIDAALAVY
                     TADQIGRADFAQYSAGARVIPSLTSPTHEVRVQGANVHSLSSMLAHMLPLPVLWRHRS
                     ASDSYTVRGRMPVVALHHDTSPGMCWPFSGSHGQLGIQLVRRVRVEAVTLDHVPSNLS
                     LDGQGSAPRDVEVWGLLESPHDRVQTVPDDPTPVPPSPLHVFLGSFTYDAQPGAPPIQ
                     TFPVRDVGVAFRVVQLSVLSNHGLRDFTCLYRVRVHGDPVSL"
     gene            <352437..>352936
                     /locus_tag="MRET_4250"
                     /note="MRES_17185"
                     /db_xref="GeneID:38741016"
     mRNA            join(<352437..352535,352561..352828,352854..>352936)
                     /locus_tag="MRET_4250"
                     /product="nucleoside-diphosphate kinase"
                     /transcript_id="XM_027630877.1"
                     /db_xref="GeneID:38741016"
     CDS             join(352437..352535,352561..352828,352854..352936)
                     /locus_tag="MRET_4250"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="XP_027486676.1"
                     /db_xref="GeneID:38741016"
                     /translation="MELTLALIKPTVCAFPPHILHAVRRIQAHPSLAIARSTSFHWTP
                     DAAAAFYAEHQGKFYYERLILGMTSGRAIGLALAGPHAIRDWRQLIGPTKAYRTAWEQ
                     PECLRAQLGLGDTRNGFHGSDSTASAMKELGLVFPEWDAAAWLQSCT"
     gene            complement(<352967..>353938)
                     /locus_tag="MRET_4251"
                     /note="MRES_17190"
                     /db_xref="GeneID:38741017"
     mRNA            complement(<352967..>353938)
                     /locus_tag="MRET_4251"
                     /product="L-glyceraldehyde reductase"
                     /transcript_id="XM_027630878.1"
                     /db_xref="GeneID:38741017"
     CDS             complement(352967..353938)
                     /locus_tag="MRET_4251"
                     /codon_start=1
                     /product="L-glyceraldehyde reductase"
                     /protein_id="XP_027486677.1"
                     /db_xref="GeneID:38741017"
                     /translation="MSYHKSITLNDGNQIPQIGLGTWLSKPEEVTNAVETAVKCGYRH
                     LDLAVIYQNHEAIAKALKNLIPNVVKREDLFITDKLWNNAHKPERVEKALDKTLQELG
                     LDYLDLYLIHWPVSLDSDLDTLLPVENGKVKLDLETSLVDTWKAMVELKKTGKVKSIG
                     VSNFSTAHVDAITKATGVPPAVNQIEAHPLLPQDDLVAHHKQHNIHITAYSPLGNNLR
                     GEKKLTESPQVVEVAQKNNVDPAQVLIAWGVHRGYSVIPKSVTDSRIKKNFEQITLSD
                     EDYQKVTDIGKDRHVRFNVGFLYTPQWDINVFNEEAEKQATHSIKIE"
     gene            <354109..>354776
                     /locus_tag="MRET_4252"
                     /note="MRES_17195"
                     /db_xref="GeneID:38741018"
     mRNA            join(<354109..354157,354193..>354776)
                     /locus_tag="MRET_4252"
                     /product="ER membrane protein SH3"
                     /transcript_id="XM_027630879.1"
                     /db_xref="GeneID:38741018"
     CDS             join(354109..354157,354193..354776)
                     /locus_tag="MRET_4252"
                     /codon_start=1
                     /product="ER membrane protein SH3"
                     /protein_id="XP_027486710.1"
                     /db_xref="GeneID:38741018"
                     /translation="MGFRTGFVIGSVLFVYGILYITSTYDYPLLFQNGFTAEDVEKSA
                     SFYLSVYHAPLSVKVLIHSVFAIGMIGIVAKIIRWGEEDKYFGSISLLLYFSSLLMYV
                     SIEIPNMRVLARPTERNIVNRAVYDADDKRKLENYEFYPLTSRERVSVVQVIGATNVI
                     ITALLAGVLLMQVGEWYATRLDRISENKHRQEMIAKHLGAERTANDKKEE"
     gene            complement(<354789..>356705)
                     /locus_tag="MRET_4253"
                     /note="MRES_17200"
                     /db_xref="GeneID:38741019"
     mRNA            complement(<354789..>356705)
                     /locus_tag="MRET_4253"
                     /product="zinc finger protein"
                     /transcript_id="XM_027630880.1"
                     /db_xref="GeneID:38741019"
     CDS             complement(354789..356705)
                     /locus_tag="MRET_4253"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027486697.1"
                     /db_xref="GeneID:38741019"
                     /translation="MMDSSIPSSILEGVPVPVDTSHLASQVVSVAAATAPPVHAISIQ
                     VGDLFPDMKAFRARLGLFGITNKCPYRARRSDNSRFVGVCPTVMNELKQNKEGNRSSH
                     TESKEPCPFHVIARRRKEGGVFVTRAILMHSPDCAAPITFSTSATSAYMSQLMEDSAS
                     FIAPREIGKFVHEATGTKLSYSTLWRTSHQLQTKERERQDASFKLIVPFLNAFCEANP
                     NTAAVVEQHSNGRFYRLFLCPGPTGSALDDCPSGVHVESMCIRSCYEGYVLLAYAKDG
                     LGALLPIAMAITPQADEDNWRFFFHQLLAALPVVSYPSTTISYDKDMSIHAAQISVLP
                     ASRSTTDASYVDWSSSGALSEFHAQMTHLCAGSYYSIMVGWITHVAVLMYARYVELDA
                     EHSVFPGGLLSGSAVALGWDVASFGPSDYLVVNAREKQQVNLAIRSCSCGHWLDQAFP
                     CVHAIRCLPLERLVNPAQFVHPSYFTESLRRCYSRRLMLINTNSIKPQGSSATPGNAA
                     YLNEQGPEGEAGVTLSAELPLLPPTSFEPVKRGRGRPRVVRTSSGRASGVGSGYQCGH
                     CHGKGHNSRTCPMNPKDAARSTAAVPGTTANLSPPAPSPVTLGAAAPSPNVFVDSTVP
                     FALDSSLSTSTTTV"
     gene            complement(<356878..>359085)
                     /locus_tag="MRET_4254"
                     /note="MRES_17205"
                     /db_xref="GeneID:38741020"
     mRNA            complement(<356878..>359085)
                     /locus_tag="MRET_4254"
                     /product="DNA excision repair protein ERCC-3"
                     /transcript_id="XM_027630881.1"
                     /db_xref="GeneID:38741020"
     CDS             complement(356878..359085)
                     /locus_tag="MRET_4254"
                     /codon_start=1
                     /product="DNA excision repair protein ERCC-3"
                     /protein_id="XP_027486672.1"
                     /db_xref="GeneID:38741020"
                     /translation="MDDSSTAAVSSILQRDFSRMPLKLDHSSRPLWISPDDGHIILEG
                     FNALAEQAQDFLIAIAEPVSRPTHVHEYKLTPYSLYAAVSVGLEPEDIIEVLNRLSKV
                     PVPKPVFDFIREYTMSFGKIKLVLKQNRYFVESSHPEILQLLLRDPIIGDSRIRPTES
                     ADRDEHRQAQGAEQPPKDGEQDLFSAVIGVYDADELDEDDAVHSFEIREEEIERVKRR
                     CNDLGFPMLEEYDFRNDKLNPDLDIDLKPITHIRPYQEKSLAKMFGNSRARSGIIVLP
                     CGAGKTLVGITAACTIKKSCLVLCTSSVSVMQWRQQFLQWSNVQDSQVSVFTADEKQK
                     FSGAAGIVVSTYSMVANTGKRSHTSQKMMNFLESREWGFILLDEVHVVPASMFRRVLT
                     KIKAHAKLGLTATLVREDEKIDELNFLVGPKLYEANWMDLAAKGHIATVQCAEVWCPM
                     TAEFYREYLRERSRKKMLLYCMNPTKFQAAQYLIHYHESRGDKIIVFSDNVYALEAYA
                     IKLGKPYIHGGTPQIERMRILQNFQHNPIVNTIFLSKVGDTSIDLPEATCLIQISSHF
                     GSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSRDTAEMYYSTKRQQFLIDQGYAFRV
                     IMNLVGQENMPGLVYATKSEQIELLQSVLIASESAADLSTDTKLASDDVKAATSTSAA
                     PSAKRMMSSLNALGGAQHMSYVERNRSMNKTLTHDQPRHKAFQKRAANAKKKV"
     gene            <359138..>360253
                     /locus_tag="MRET_4255"
                     /note="MRES_17210"
                     /db_xref="GeneID:38741021"
     mRNA            <359138..>360253
                     /locus_tag="MRET_4255"
                     /product="dynactin 4"
                     /transcript_id="XM_027630882.1"
                     /db_xref="GeneID:38741021"
     CDS             359138..360253
                     /locus_tag="MRET_4255"
                     /codon_start=1
                     /product="dynactin 4"
                     /protein_id="XP_027486673.1"
                     /db_xref="GeneID:38741021"
                     /translation="MSVGTAACPCAVALYGYQHAPTEALTELYYCEECCSLRCNDCIA
                     WEVSCTYCPHCLFEVPNTSVRAQKARCSRTCFECPVCMHVLSIVGSDPPRRDLPLTAP
                     EASMGVEPFYLSCACCRWDSKRLGLVAEKPNELGSVLDAMERSAWPTETWEHLVEHML
                     ERRPPPPPPMSRSLAKHIARVERSSGLVRHDMARVSTLAQRWTMQPCEQSYAVSALRP
                     RRVALLCKYSKRCATCRHILVRPEPRSSAFKIKLLASHFLPQCVVFRGAHGLWTLVLT
                     NPLMDAMDVTLRCVAGDVSAQHIQVPAHVDVLDMDEDSGAPGSDWDAFQHGTKTHRNH
                     AYLSVRVHPSTSVLVLQIQWQSAAYRPHTFWTHIPLS"
     gene            complement(<360256..>362781)
                     /locus_tag="MRET_4256"
                     /note="MRES_17215"
                     /db_xref="GeneID:38741022"
     mRNA            complement(<360256..>362781)
                     /locus_tag="MRET_4256"
                     /product="actin-interacting protein"
                     /transcript_id="XM_027630883.1"
                     /db_xref="GeneID:38741022"
     CDS             complement(360256..362781)
                     /locus_tag="MRET_4256"
                     /codon_start=1
                     /product="actin-interacting protein"
                     /protein_id="XP_027486674.1"
                     /db_xref="GeneID:38741022"
                     /translation="MSSAHEGGGQPSTSMRRGVPHVAEQHSDNKAMPRKATQANHMES
                     SVTRLLVATKLLLESLTQWAQRKESETNVSRVYVRLGNDFNASITAFMGAGIDMTDLY
                     SVPADLRVCLESCLSEEASTATLERHLPRIRDIIVRLLQGLKTKQAYYKQLQMESNPS
                     SGSGVPGYSVPASRAEGPSGPRAPGSAYPLPTPVSAPPQMDSTTLPEESSQVRSQTPH
                     QTPHPLPARSPRQVPPTPQERPASRTSPALSTRSASLPQPPPVAAADDSTPPTPASTA
                     EQAQREDINVRLRNSDTLERRASKRFSAYTFNKIGAGLMSSVGSTPTSLHSYTERRTP
                     QSAGLRSVKQVAAADLEVPSPTKQNHASHTLLTSLPEADTGESKAEVSSAYSHDEPFM
                     VYLQVNRQTRKVTLPVDHAQPDRGLNLAMLRMLFVDQFSYSSGKSDFPDIYIKDPSNG
                     VAYQLEDMSDIQPKSVLMLNVEPLDQIKEHVDFSISALSRELHELKAMIRDNAAREAT
                     RPAPVAPVETTPIADAEFQKAGDRMSTQLGAPTVPQDKGNDYATDLKTHYEALQKLRH
                     DFAILRQVQDEGEHDMRQLMANLREKAKEMSRVVSLGPSAGRNLIESGKTHLDAQSQQ
                     VLTNVEDLQDLIEDLKLDVSHRGVKPKAAELKRATVDIATATQRLTELEQYIQSVRPH
                     WKKTWENELQFIVDEQEFLNYQEGLLADLKQDLTAVQDVFGNIQQIVKLRDVGQARGD
                     DPGRGPRYVPPPPDGEHEGLPTVMVEVRGQSIDHERRLRALQAAERSREKAKAGRTDE
                     FADELQGFVDNRTLRRTGGHLEAERVRQKRDQSTLRAMFEQAP"
     gene            complement(<363225..>364550)
                     /locus_tag="MRET_4257"
                     /note="MRES_17220"
                     /db_xref="GeneID:38741023"
     mRNA            complement(<363225..>364550)
                     /locus_tag="MRET_4257"
                     /product="DUF500 domain protein"
                     /transcript_id="XM_027630884.1"
                     /db_xref="GeneID:38741023"
     CDS             complement(363225..364550)
                     /locus_tag="MRET_4257"
                     /codon_start=1
                     /product="DUF500 domain protein"
                     /protein_id="XP_027486675.1"
                     /db_xref="GeneID:38741023"
                     /translation="MSSNEPLEPPPHRTVSVTLPAKKPKEKSKWQVWGESMANKGVAW
                     NDWAAKKVNGAVERLGGERFWPSSKDFELEVAKCVRILRTFTTDGIAVKEDKLKKVKV
                     LKKIPPEVLRNAKGICIYTCMKSGIPPFGGMNGTGLLLGRLPDGSWSAPSAILPNYYS
                     TGLMFGMDVVDIILIINSEELLKSFRTHKFALTAETVTSSGPLGTPVSGGLEFNKKVA
                     PIYSYVNSRGFYAGIEVTGQVFLDRFDENERVYYWPGIKAGDILDGKVKVPECAKPLH
                     RALYEAEIGMAQAGELERTQLLKNIPSISAENMDEVLNSLQEGEHILIPPTPEQLDAM
                     EHAGYKDEYDEALEEEEREEIRNLPPPPSHPLARKGQRNSAEGSDDISPTKPPKSAAR
                     RSIQKVETVTSAPEEPTESHAKAKSDPVEEPAKVEPSDGNNSDIENKNM"
     gene            <364686..>367757
                     /locus_tag="MRET_4258"
                     /note="MRES_17225"
                     /db_xref="GeneID:38741024"
     mRNA            <364686..>367757
                     /locus_tag="MRET_4258"
                     /product="Rho guanyl nucleotide exchange factor"
                     /transcript_id="XM_027630885.1"
                     /db_xref="GeneID:38741024"
     CDS             364686..367757
                     /locus_tag="MRET_4258"
                     /codon_start=1
                     /product="Rho guanyl nucleotide exchange factor"
                     /protein_id="XP_027486708.1"
                     /db_xref="GeneID:38741024"
                     /translation="MSADAAGLGGQGDGAHVLPPIVAKLCDVVLNDLTQSQLPRLEVL
                     LQQMGTQIYSANDDKRQGSTDFVPISGNPSPVLSDTASMHSNGEVRVTRALEYALAEL
                     VTTERNYVARLDALHSRYAVPLLQLAKDKDTEIIPLAEAECIFGNIGEILAANKVLLC
                     ELEVEYDQGPAQLASTVGSILARNIYTFGCYDTYLAGFERAQRTYNQMLKHRPLREFI
                     LRTQHSMSELGNAGLRELMVEPMQRIPRYQLLIGNLIKHLPPTSPQIERLQDASAAAT
                     IIASRRVTDGERLVAVLWSCQRTINRFPPELVSAPRELLGCIDVDEVTADTVQSRAMQ
                     TLGTVLGRKPRSSYALLVFTDVLVLIQRHSSIPTHILLGLHEPDRLADQMRSAHISAP
                     SNRRTDLLFAGMSSLHDIRVTGQGAELSIEMDRPMRGAPSKSAQLVRRFVDAMPDAHS
                     THIPLFLGCLWQAQAVFRARGHALAARKNITHSSRGPITLLWTLFTRSQYESFAYRDR
                     LLVILGALDTPSRQDMSHASELFVNVELQDDADTCMIYMSRAWGSQARRVSTSLADVP
                     RLCADLHVLSTLPPTAEPLPPAEPVQRTPSLRSDEKREVPRVHRARSLMSERVRASIQ
                     ESLEVVQEESKQHEQAELQLGRKRHVPMADRSNEPPHTDSPKRRAVPSQAPGEENVVP
                     VRVADEAAEPMDERGTPIKRAPGISMYTDDTLDLPNPFDEGDAMPSASPVLPEPTKVE
                     RPPHSQEEHMVEEPLDEPPASVPRPPPKATPRKETISIPPSKTVTEDEMHEMLKPLLE
                     HIQVAPAQQPVLVHAKPSQAARSAEVVMPEPLDVSIRATEDSSCALMKQAIESLNVRI
                     ATLRQKLPSSALPAQCADDWNAFKQAVKDVNATWTKMERAYENKQMDLASLRLAQPEH
                     DTRVHLSQEEYADLQNQSNMVLPLQLQIEKLQKQCASLQELEKDTRLENAELYNVFNE
                     ELSKLYQHSFRPANEEIDMLRANLVSAKTQIHELRQENRLLRLHNTVGSGV"
     gene            <367865..>369046
                     /locus_tag="MRET_4259"
                     /db_xref="GeneID:38741025"
     mRNA            <367865..>369046
                     /locus_tag="MRET_4259"
                     /product="chitin biosynthesis protein CHS5"
                     /transcript_id="XM_027630886.1"
                     /db_xref="GeneID:38741025"
     CDS             367865..369046
                     /locus_tag="MRET_4259"
                     /codon_start=1
                     /product="chitin biosynthesis protein CHS5"
                     /protein_id="XP_027486656.1"
                     /db_xref="GeneID:38741025"
                     /translation="MSSNDGYTFTVGKLDAGVAILIGERASLIEFPSVLLPRGLTLGS
                     VVDVRVTRNEAQEQKKREDFIGLQDEILQTYGVKAPTAPVIRLRGVTQTTIAIEWDAL
                     DIAHADLHSLDVVRNGQQIGKIPNPRTSRSTKLSGLEMDTEYAIQLILHTSAGSFTSN
                     ELHVRTHTLDNMSGVFVCLGTIPDQRLYDATIQVVESLGARWSTQIQLETTHLLCSML
                     PDPSNAEQMRLYEKAEQLTLPIIQPHWLFACESKKRMVNVSPYVMDGMPPNALEVQEL
                     VTRRQKPEPPVPEDPEESREPEEPRAPEKPVAVPAKDELEAQEKSAPLQDDTVHVWQS
                     EPKVSETPSEAETQEEQEPAVSGEAPETSSSQDAANPSEARDPDPSPRPDNDMENIDL
                     A"
     gene            complement(<369052..>369612)
                     /locus_tag="MRET_4260"
                     /note="MRES_17230"
                     /db_xref="GeneID:38741026"
     mRNA            complement(<369052..>369612)
                     /locus_tag="MRET_4260"
                     /product="Vps51/Vps67 family protein"
                     /transcript_id="XM_027630887.1"
                     /db_xref="GeneID:38741026"
     CDS             complement(369052..369612)
                     /locus_tag="MRET_4260"
                     /codon_start=1
                     /product="Vps51/Vps67 family protein"
                     /protein_id="XP_027486687.1"
                     /db_xref="GeneID:38741026"
                     /translation="MSKSQSLKTYYGIETGEPPAAPAPQPTLDEWTTDKPLHALLKAS
                     NELMDGIRDLYADRQSLVYNHHQELVNASETVGHMRHGIEALRPNREALEVQLKEMQA
                     KRAMPPVYIASDADASIPWVRDVAPIAELPLKLRYMLDQNQLAEAVALFDTYKPTIHA
                     WAQAGVHGAEELGKDCEYILKEAHST"
     gene            <369611..>371602
                     /locus_tag="MRET_4261"
                     /note="MRES_17235"
                     /db_xref="GeneID:38741027"
     mRNA            <369611..>371602
                     /locus_tag="MRET_4261"
                     /product="transcription initiation factor TFIIF subunit
                     alpha"
                     /transcript_id="XM_027630888.1"
                     /db_xref="GeneID:38741027"
     CDS             369611..371602
                     /locus_tag="MRET_4261"
                     /codon_start=1
                     /product="transcription initiation factor TFIIF subunit
                     alpha"
                     /protein_id="XP_027486595.1"
                     /db_xref="GeneID:38741027"
                     /translation="MEVQGTRRILGKKRCTERRFFWTMKQEVKAEDTKPSVARGYRDI
                     PLFSSGASDSVTHLMKFGSHTRIDPNNEAQFTPPVKLNRKTPLRLKMPPAKPGDQVID
                     KWGKPVMTTEGKPLLWPSHDVDLEHIRPYLDLDKPQSSDAAADGAGFTRHRLFRKRVR
                     EVHKSTSAARRTRNEEFYPWVLEDFDTAQEWESSREPLPNSLRALEAWYVAEQERRAE
                     GREPKPSVIEEPRITSGLAPHAPWVGQLEGESDEHSASHHVLFVFDDRNAGGFKVVPV
                     RRQYKFMPLQKHMLNSEQVEEEFARHQKSAETERWLLRDRYKTGAGLGSSSGGASRGG
                     DGRRLPMLSLPGQPSLGWQSSAHLVAVRGEPERSQVDDDDLFGPVVKNETTYDELDYE
                     DTFADDDERAEVQDDAEDAEARELEERLKREMVADRLDDGDDVQIKMEPDDAIAVNRR
                     SGADNLLGSAQYGRHDDAMLTGSGRQMRRIMKALSRREGLDTYDSDEEAKNPYASDDD
                     SDDNDDDLDVLHPERAILEAREEKARREREAKEQASTPRAASPEADGGVKRKNDTASR
                     PDAKKARVDSPPRSASPVRSPLEAEIVQLISSGQVATTSDLVQHFRARLKQDLSLKEQ
                     LSAAVKRIAYMDKKENKLKLKESAKVSDAAATSPRDSRP"
     gene            complement(<371541..>373457)
                     /locus_tag="MRET_4262"
                     /note="MRES_17240"
                     /db_xref="GeneID:38741028"
     mRNA            complement(<371541..>373457)
                     /locus_tag="MRET_4262"
                     /product="protein involved in negative regulation of iron
                     regulon transcription"
                     /transcript_id="XM_027630889.1"
                     /db_xref="GeneID:38741028"
     CDS             complement(371541..373457)
                     /locus_tag="MRET_4262"
                     /codon_start=1
                     /product="protein involved in negative regulation of iron
                     regulon transcription"
                     /protein_id="XP_027486690.1"
                     /db_xref="GeneID:38741028"
                     /translation="MGCVSSRPQVDDALDEKRALLIEYASRVTHTSQVDTSERLHALR
                     EAMRACCVDAYVIGTEDAHASEYSAACDQRLTYISGFTGSTATAVVLADSAHLFTDGR
                     YHVQAAQQLSRAWTLHRVGEPHVASWREWLQGPDVPRGAYVGMDASLVSYKDAVTLKA
                     ALASRGVTLVFPEANLVDDIWGEARPEPMLEPVYEYKLQFAGVHAAEKLAKLREWLRE
                     QGTSSAYVISALDEVAWLLNLRGASIPCHPVFPAYMIVTQHAAALFLDPRLIRPPIQT
                     YLAKLQVSIYDYDAVWRSLREAEYERVFVDVRASYALVHAAGEDRTIVQTAASPVALA
                     KARKNAVEILCMKRAYKRDGAAWAKWAAWMEDEMKRGANLSERRAADALERIRAKDPL
                     YAGMQAYDAISATGANAALPHYETPLEDAPLIDRVSPYLNDSGPQYYDGTIDTTRTMH
                     FGTPTPEQKRAYTRVLQGHIALSRAKFPQGTTGAQLDMLARQPLFQDGLNYLHGTGHG
                     IGAFLNVHEGPHGFSSSSGGASVPVALQPGMILSNEPGYYKTGAFGIRIESAMLVRPA
                     SPASDSHEWLEFATLTRVPISTKLVDGSLLRPDEAAWLRAYNEQCRDDILPLVKGDYR
                     AEKWLQRQTLWPIP"
     gene            <373522..>374667
                     /locus_tag="MRET_4263"
                     /note="MRES_17245"
                     /db_xref="GeneID:38741029"
     mRNA            <373522..>374667
                     /locus_tag="MRET_4263"
                     /product="TPR repeat protein"
                     /transcript_id="XM_027630890.1"
                     /db_xref="GeneID:38741029"
     CDS             373522..374667
                     /locus_tag="MRET_4263"
                     /codon_start=1
                     /product="TPR repeat protein"
                     /protein_id="XP_027486624.1"
                     /db_xref="GeneID:38741029"
                     /translation="MSAETVATAEPPRHASLEDKMKELDSVPLFMRDLPTEENTALEA
                     LQTLAYDGPPDEVAENFKNQGNEYFRAKRYKEALGFYQQGIQAESEDAKLKETLYLNS
                     AACHLELHNFGSALHAARDAIVMNPRSVKALYRAARAFLALNRTKDARGCCELALGID
                     PDNTELIRLQGRVDEHAARLERLEAERTERKRRATRTEEALQVAFVARGLWLTKSSDP
                     PDNPTPAHFDPESLPSYASPDIPLVGAKQAWKAPDPIRTPVIFPVMLLYPQHNTSDLI
                     SEYHEDTPIGMHLEVMFPLEARGSLPWDPQGEYVANRLSVIAKTRKGRLLRVGHKLSL
                     RELLDQGATPSNDDRDGIVLRDGIIDLYVLPKGSDAERQWITANKAS"
     gene            <374722..>376143
                     /locus_tag="MRET_4264"
                     /note="MRES_17250"
                     /db_xref="GeneID:38741030"
     mRNA            <374722..>376143
                     /locus_tag="MRET_4264"
                     /product="cell division control protein 7"
                     /transcript_id="XM_027630891.1"
                     /db_xref="GeneID:38741030"
     CDS             374722..376143
                     /locus_tag="MRET_4264"
                     /codon_start=1
                     /product="cell division control protein 7"
                     /protein_id="XP_027486682.1"
                     /db_xref="GeneID:38741030"
                     /translation="MASLAAASPWTAGDSEVAPSAAEATNNSMQMYFEASTDHSESGD
                     PYAGRDEESIERLEEEISQLNDSVHGLDAYHIVDKLGEGTFSSVYKAIDVHHAMFANA
                     EWFKTNTPHIAPRPARHPTVYVALKRIYVTSSTARILNELEIMESLRGAPFISYLVTA
                     FRSADQVIAVMPYTRHAEFREYYRVMPLSDLPCYFYCLFSALEAMHKQGIVHRDIKPA
                     NFLYDPRTGYGTLCDFGLAERLDASDWHGKCHHTLPTPEHPHGEQCINHATQSAHLQP
                     GGALARSDDKSYVARSAAGASMGPPDRVGYLRHDPRPSVRANRAGTRGFRAPEVLLKC
                     PDQTPAIDIWSAGIVLLSFLLKRFPLFNASDDTEALLELATIFGRRRMEQCAMLHNRT
                     FSCNLPTVDHAGRRIPELIQHIRPELFEPPDHCADPAEYRQQVQYVVHLVGVCLYLDC
                     TRRWTASRLLRHAFFQDVVPDTL"
     gene            <376177..>377511
                     /locus_tag="MRET_4265"
                     /note="MRES_17255"
                     /db_xref="GeneID:38741031"
     mRNA            <376177..>377511
                     /locus_tag="MRET_4265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630892.1"
                     /db_xref="GeneID:38741031"
     CDS             376177..377511
                     /locus_tag="MRET_4265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486621.1"
                     /db_xref="GeneID:38741031"
                     /translation="MTHEARHQGFEGVTATSAPPIAATADVLRCYEEAVQEPMVECMN
                     LDGLYTNAQAPHSDRIDALVLREDFSSTAIIAKTWLTLRPQNRSQAVDIDLEALRDTQ
                     NILGGRRARLLQSPSFANAPHTVELMPASMEPKDARGETTWDVHEGQATTRLDRRLAK
                     RSPAHEAPEPRITLLHSDVLELPMSPPVGEPPLEAPDMVASLNYAMAYFHDRATLKRY
                     LTGVLHSLRPKTGVFITDMFGGPPTGEVYEDQEALWTRFWDEPGFRRTHGTQYVLPTV
                     RDDDDDDDLVVRPAPTDEERGTRAEWPRGKLKLVRTGQAHGGFEYWREDGPIDYATNR
                     FRMSLSFRFRDRSWLRDVFSYDFRIWSLKELTEAMEEVGFASVRLLVLPRNDVDKHDH
                     SDTDSDISDEVAAMFLRTEREEAQRRMFHTVEPGEKVFSTRSFSTYIVARRS"
     gene            complement(<377508..>378287)
                     /locus_tag="MRET_4266"
                     /note="MRES_17260"
                     /db_xref="GeneID:38741032"
     mRNA            complement(<377508..>378287)
                     /locus_tag="MRET_4266"
                     /product="TP53 regulating kinase and related kinases"
                     /transcript_id="XM_027630893.1"
                     /db_xref="GeneID:38741032"
     CDS             complement(377508..378287)
                     /locus_tag="MRET_4266"
                     /codon_start=1
                     /product="TP53 regulating kinase and related kinases"
                     /protein_id="XP_027486623.1"
                     /db_xref="GeneID:38741032"
                     /translation="MDDGAWLALVQGPHAHLIKQGAEAKVYCVDLWTRAPQLALPNRA
                     TSACAPHTERVLIKHRFFKRYRHPALSNSVTASRTVSEARALVRCARHGVHVPRLVCV
                     DETRGILGMEWIEGPSIRQWLGGLPEDGEEASHAAAPSEDKQNSAMEKIGEQLAQMHC
                     ADVIHGDLTTSNMMLRGADIVLIDFGLACVSSFWEDKAVDLYVLERAFASTHPSSEHL
                     FHRVLEAYAARTHRTSPTAWPAIHARLQEVRMRGRKRSMVG"
     gene            <378320..>379240
                     /locus_tag="MRET_4267"
                     /note="MRES_17265"
                     /db_xref="GeneID:38741033"
     mRNA            <378320..>379240
                     /locus_tag="MRET_4267"
                     /product="chromatin modification-related protein"
                     /transcript_id="XM_027630894.1"
                     /db_xref="GeneID:38741033"
     CDS             378320..379240
                     /locus_tag="MRET_4267"
                     /codon_start=1
                     /product="chromatin modification-related protein"
                     /protein_id="XP_027486622.1"
                     /db_xref="GeneID:38741033"
                     /translation="MPRRKSGAGRVTPSRRHKKDDDAPIHVSDREREVFQAEIGGRAE
                     RWAEEYADIVEQLPLELQRTFHLLRELDQRSETAKTDMDSVWKAYSCARAESSDEAQR
                     YAHLMRLRDTSQQSISLAEEKLALALSAYDTVDRQIRRLDNDLLKNERSLYAGLRHEL
                     EGHDDTLQTPVPKETDRFSPAGQLLTFWSGLVSLDPLVCLAYLQEHMQKQAPEPSTPP
                     THALVPLDTIEADPSEPRYCYCDRFSYGDMVACDNDDCPREWFHIGCVGLDQPPKGTW
                     YCQFCAPPHWKGPGQQIPPHAPHRPPPRAS"
     gene            <379304..>382042
                     /locus_tag="MRET_4268"
                     /note="MRES_17270"
                     /db_xref="GeneID:38741034"
     mRNA            <379304..>382042
                     /locus_tag="MRET_4268"
                     /product="DNA mismatch repair protein MSH2"
                     /transcript_id="XM_027630895.1"
                     /db_xref="GeneID:38741034"
     CDS             379304..382042
                     /locus_tag="MRET_4268"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH2"
                     /protein_id="XP_027486693.1"
                     /db_xref="GeneID:38741034"
                     /translation="MSGCMYPTEDARPDAKRDEGFVSYFRRLPPAVPGTVRLFDRQDF
                     YAVYGDDAVRVADIVFKTQSVVRQLGSKASPLASCTLNMASAKAFLRDALTARQLRIE
                     IWAPTGDRQTWAVARQASPGNLQEVEDLLFLQSDVVSSPIVMALRVKMEDGISVIGAA
                     FADATNRHIGVAEYTENDLFSNSESLIIQLGVKECLVPADDADYHLSKLRALMERCGC
                     VITQVKRGTFTSKSIEEDMQRLLPASQRAALAPECSKKVAMSSAAALLSYLGLLSDES
                     NFGRYTLKTHDLSEYLRLDHAALRALNLFPDESGSVANKNASLFGLLNRCKTAQGVRM
                     LSQWIKQPLVHVHAIQNRQALLQTFLDEADARQRLQEHFLKWMPDMLRISKRFQRGVA
                     TLEDVVRCYQAVGKVPGLRAELAAISMPSEADRVLFHSTFVAPLDELQHHLSKLVEMV
                     EMTLDLNELAYHNYVIKPDFDDTLRTIRAKLDTIRDQLDEQHTKAGHDLRLDTEKKLH
                     LENHSSYGYCFRVTRTEAGVIKNRTGYLDLGTVKGGLYFTTPTLRELNSDFRSLSDEY
                     ARTQSRLVRDVIDIAASYAPPLEQLNIVIAHLDVVVSLAFVSSHAPVPYTRPNVTEGG
                     ALILCESRHPCLEAQDEMHFIPNDVRMEPGISDLVVITGPNMGGKSTYLRQIGLITLM
                     AQMGCYVPAAEGAQVPVSDCILARVGASDSQLRGISTFMAEMLETATILKSATPQSLV
                     LIDELGRGTSTYDGFGLAWAISEYIVTQIRCKCVFATHFHELTTLAQQQRGVQNLHVV
                     AHVDDQDITLLYKVEPGTSDQSYGIQIAELADFPPSVIRLAKRKADELEGHAQPVGGA
                     DEGAALVDEFVSAYRDRVRDPKRPCTEQEALQSCMNEFDERLRSNTWVRHLLEHLS"
     gene            complement(<382039..>382484)
                     /locus_tag="MRET_4269"
                     /note="MRES_17275"
                     /db_xref="GeneID:38741035"
     mRNA            complement(join(<382039..382343,382370..>382484))
                     /locus_tag="MRET_4269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630896.1"
                     /db_xref="GeneID:38741035"
     CDS             complement(join(382039..382343,382370..382484))
                     /locus_tag="MRET_4269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486692.1"
                     /db_xref="GeneID:38741035"
                     /translation="MGQQGSKPARTLGARVSTGPLKAPSTAAPAASRFQKDESILSDA
                     RDPQFMRNLSALGPVAPQQPVDAPTREGPMMGILHARVRNEREEEEGTAPGLTAGELV
                     RLLTEYREDPAKLDTLATEYDVDRDKLRRLVQFVSVP"
     gene            <382537..>383529
                     /locus_tag="MRET_4270"
                     /note="MRES_17280"
                     /db_xref="GeneID:38741036"
     mRNA            <382537..>383529
                     /locus_tag="MRET_4270"
                     /product="protein transport protein SEC9"
                     /transcript_id="XM_027630897.1"
                     /db_xref="GeneID:38741036"
     CDS             382537..383529
                     /locus_tag="MRET_4270"
                     /codon_start=1
                     /product="protein transport protein SEC9"
                     /protein_id="XP_027486549.1"
                     /db_xref="GeneID:38741036"
                     /translation="MKPLFRRKPKIPPVEQPPAAPSHSSELDPYVSAKGAAGRPRDPY
                     GSASAETPQPSDAELLAEYGSGSAPPVSRLPPPTSVYRDPYTTQGAGSEFDPDEEAIQ
                     DIKYQLRSTKQESLSSSRNAVRLAREAEETATNTMVRLGEQSDTIGDTERSLDVAKAH
                     ASRAEDNARLIAQLNQSIFRPKFTRNKKAKRDAEEYRAVQRHIDERQERELTRAEMLS
                     SQRRVEESVSNTGMFSKMRSKFGGGPAGELVDPQEQRRRYQFEATASDDEMEDEIDGN
                     LDEIAALSARMNVLGRAMGQEVDEQNRRLHRVSDKTTALDTRIYAGTKRLENLK"
     gene            complement(<383532..>384230)
                     /locus_tag="MRET_4271"
                     /note="MRES_17285"
                     /db_xref="GeneID:38741037"
     mRNA            complement(<383532..>384230)
                     /locus_tag="MRET_4271"
                     /product="mitochondrial inner membrane protease ATP23"
                     /transcript_id="XM_027630898.1"
                     /db_xref="GeneID:38741037"
     CDS             complement(383532..384230)
                     /locus_tag="MRET_4271"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease ATP23"
                     /protein_id="XP_027486698.1"
                     /db_xref="GeneID:38741037"
                     /translation="MAAQDAWVARWTAWCERIVAPSLIEKSGPIPSESKEDIKARERV
                     EQWKDDLLRTSPMVRFMVKHLALIQCDPLTPRGEHASKDAPPKLLIASCPPDIAGGFS
                     PSPPGRPPSEAGILLCANRLFSKAHLEDTLSHEMIHWWDHCRFHVDWNNLRHHACSEI
                     RAASLSGDCRWTREINRRHYGFAKQHQACARRRAILSVRSNPVCKDDATAERVVDDVW
                     DSCFHDTRPFDEIY"
     gene            <384476..>385105
                     /locus_tag="MRET_4272"
                     /note="MRES_17290"
                     /db_xref="GeneID:38741038"
     mRNA            <384476..>385105
                     /locus_tag="MRET_4272"
                     /product="large subunit ribosomal protein L13e"
                     /transcript_id="XM_027630899.1"
                     /db_xref="GeneID:38741038"
     CDS             384476..385105
                     /locus_tag="MRET_4272"
                     /codon_start=1
                     /product="large subunit ribosomal protein L13e"
                     /protein_id="XP_027486508.1"
                     /db_xref="GeneID:38741038"
                     /translation="MGFRHNNLLHNNHFHKDWQRRVRVWFDQAGRKKSRRNARAAKAA
                     ALGMRPLQPLRPAVRGQTLKYNTKLRQGRGFTIEELKAAGIRKVEALSIGIPVDHRRK
                     NRSEEGLKLNADRLKAYKERLIVVPRPTKQNKQKMPDLSSVATTRTTIEAFPIPAGTT
                     PEAPRAITAEEKESNAFRTLRMARAIHRHEGARQARQAKREEEAANAKK"
     gene            complement(<385235..>387478)
                     /locus_tag="MRET_4273"
                     /note="MRES_17295"
                     /db_xref="GeneID:38741039"
     mRNA            complement(<385235..>387478)
                     /locus_tag="MRET_4273"
                     /product="Ras GTPase-activating-like protein IQGAP2/3"
                     /transcript_id="XM_027630900.1"
                     /db_xref="GeneID:38741039"
     CDS             complement(385235..387478)
                     /locus_tag="MRET_4273"
                     /codon_start=1
                     /product="Ras GTPase-activating-like protein IQGAP2/3"
                     /protein_id="XP_027486662.1"
                     /db_xref="GeneID:38741039"
                     /translation="MPLIHSETAMPPYFEPSIEWSRGIDPRHESMLKGVQEELEDLKL
                     EITSQSKRNFVLEKDVRYLDSRIALLIANRMTPRDIESPDEEHLGIRRVILEQKQLQL
                     YSNLFYLLMTEPRHIATLCSLVSAEELDMFLQTVMFTMYANQYEDFEEHLLLTVFQSV
                     LSTQCKAATEFSSLLRANTPISRMMSMYTRRGPGQTYLKRVLTKHMDTVTSMSAENLE
                     IDPFLVHDELVRAKEASADDDPQQHRQVQNCIQTRMHKLLKLAEVIMDDILRSIHLIP
                     YGIRWICKQIRNLTRRKDPNVSEDALSSLIGSFFFLRYVNVAIVSPQMYLLSNESLSK
                     NNRRTLVLLAKVFQHLVNNPAHEKGSFVHDLKPFMAVYRPRLVAFLQSLCHVGDFYDT
                     LELYRYVDLSKQDKTLHVSVNELYFMHTLVKKHAHILAPDRHVHLGQVILELGEAPAQ
                     VERPDNYTMELTLFSRWEKPIQDLTSTLMMENNMTPSDILYIETKSLFVQILQLLPNT
                     GPVSSLSNVAAEATKSGIKRLEHLGRRASYMLRELEELRVVDESALKTLMLDEVIAEL
                     VSLGNVHMQDKLKEDKESLLSVLEALKQHHTYLQGQFDTYQAYLQNVRLSSSVVQSSD
                     MNGVIGVLSSPDRELKGDKPPHTLHRFTYDQWERDKIIRASMIPSNRLSDITFHVHSP
                     SPGSFMISLFCQGRPEAFLEIDLKLDDLLEKLQDHQATVKVEYLELDTLRLYLLLDRL
                     YGLSQRH"
     gene            complement(<387680..>389830)
                     /locus_tag="MRET_4274"
                     /db_xref="GeneID:38741040"
     mRNA            complement(<387680..>389830)
                     /locus_tag="MRET_4274"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027630901.1"
                     /db_xref="GeneID:38741040"
     CDS             complement(387680..389830)
                     /locus_tag="MRET_4274"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027486661.1"
                     /db_xref="GeneID:38741040"
                     /translation="MPLEHFGRGSWPSYQKRPLSDINTGAAMSRASPDEPDGAMARMQ
                     LRDGDQDHDEGVLSKLTGVSRSVSWGRGTSNRMAAQNRPHHERSHRAAASLSMSSSDA
                     LAESPADSSSPLSSAALSLRSLSNDTYRPYEMSAMSTSPQPAQKDWQSQAPSVPVVRV
                     ESNAAPSTSYPQQDSPPVLEAPSPRHALGLGPPDRDDQPVRRHMGSFYLRKQSSNPDL
                     SHSLQSLSSAGEEDINDPQSGYVQFFSRFYPDHRPFGSRSGDTSPLLSPPPMRMRYEL
                     GDTRRSFNAGRPNYAMQPFRISAHKALPRPPRSPMMSAVSVSHNDDDVSEIHGLTTRA
                     STPISYPSAPHGPEPPPDTHAPTQRLATLSTPEVHTIDAYDIGDCMGSGAYGFVRRAR
                     CRENGDEVVIKYIIKSSIFADSWRRHRVYGTIPGEIFVLLQLQHTAYTPPATPPPYLT
                     NKEHWQHVRDEILAMQRQGRVTGHPGICKLLDFFEDEEFYYMIMPRFGNGQDLFNYVE
                     SSPYGLEPQQVRNFLGQVADVIAFMHANGVVHRDIKDENVILDSYGMVQLIDFGGAAR
                     VRPDAMFDTFSGTMDYAAVEILRGEKYTGPPQDVWAFGVLGYVLVCGECPFADVDEAS
                     TGLSPGSRALLVLQHFCHEQSHDASSDDDIPSSDGGGDLSQLCDLICQCLQPDPFARP
                     PAHEILRHAFLFGAHGWSGLRGWQAESRPRFDSS"
     gene            complement(<389945..>390580)
                     /locus_tag="MRET_4275"
                     /note="MRES_17300"
                     /db_xref="GeneID:38741041"
     mRNA            complement(<389945..>390580)
                     /locus_tag="MRET_4275"
                     /product="AT rich DNA binding protein"
                     /transcript_id="XM_027630902.1"
                     /db_xref="GeneID:38741041"
     CDS             complement(389945..390580)
                     /locus_tag="MRET_4275"
                     /codon_start=1
                     /product="AT rich DNA binding protein"
                     /protein_id="XP_027486548.1"
                     /db_xref="GeneID:38741041"
                     /translation="MPRHWLLKAEPESRLVKGVDVAFSVDLFEKVHTSPWEGVRNYQA
                     RNFLRDDMKVGDAVLFYHSNCALPGIVALAHVCKEGYPDSTAWDAHHPYYDAKSHPDA
                     PRWYMVDVAFERRLTHPVPLALLQHMTRALTESQRQDVSYLTQEHLEALSHMALLHRS
                     RLSVQPVDPMAYEAILLLGDRGGFEHWPGKWAPTAPPPPKRRRRALTAGAP"
     gene            complement(<391217..>393121)
                     /locus_tag="MRET_4276"
                     /note="MRES_17310"
                     /db_xref="GeneID:38741042"
     mRNA            complement(<391217..>393121)
                     /locus_tag="MRET_4276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630903.1"
                     /db_xref="GeneID:38741042"
     CDS             complement(391217..393121)
                     /locus_tag="MRET_4276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486660.1"
                     /db_xref="GeneID:38741042"
                     /translation="MEALHRFFTIGLATRLEPLPALSYDVVPVQEGDGPIDESSHLGH
                     GQWLKPRMTPFAPLTFERAKQCAMEPWFRTCVEAWTRVFRLLDAVDHDPHFSRLRHFF
                     DTRRPAEVDNAADGSEEASRPLERKVSTHSGSHAPIRWHWARRANEASTDAQTAPAAS
                     SYDQCDLFMEGHEYGQVRFPVRVDLDRIHLAHARSSSRSEVSDSPEDDPSARSDASQR
                     SFVQRVLDRQWRRGSQASSNAAARPDSIGEPCAMDDSDDEEGLESPRHNGDELLPLLR
                     VAVHYSAGSAWRYGDQDPLPVILMQAWADAVGWEGIMHLCYGQHSASQTEHVYSALGR
                     AADISLHQREKHDAVLSWLDKMQHGDQEPKPQAPWDTTSKAPVASVGQRSAPGHTRTW
                     DDWQRLFSSLSSWVSEYETARVRACLAHEYGKEPAYSTRPNDVHANIPPSVAQDMLQG
                     AHGFWRLDGIPDALRQPDTQQEHMDYRWARSRLESGQIGTPLVLATAAVQFCLKQLSS
                     ASWVYRSAWELDYLDGCILQSSIMRERFPPPGESPAPSLDPANATRDRHVPCPYPSTS
                     GAWDPVEWRSWLGTLQDGQVIVPAVSWQGWWTLLAVLNGADRSGREFDLQVRAPGDPV
                     HPEEFGSIYL"
     gene            complement(<393331..>395520)
                     /locus_tag="MRET_4277"
                     /note="MRES_17315"
                     /db_xref="GeneID:38741043"
     mRNA            complement(<393331..>395520)
                     /locus_tag="MRET_4277"
                     /product="sphingomyelin phosphodiesterase"
                     /transcript_id="XM_027630904.1"
                     /db_xref="GeneID:38741043"
     CDS             complement(393331..395520)
                     /locus_tag="MRET_4277"
                     /codon_start=1
                     /product="sphingomyelin phosphodiesterase"
                     /protein_id="XP_027486501.1"
                     /db_xref="GeneID:38741043"
                     /translation="MHLLVGCGAALVASVAATAASTSTFSWSLHGQGSPVYTAPKAFP
                     TSEFRSMYFTPKAQEAIPRPVVTDVDGQAFPDSLNDPDRMPTTTPSASGVLPAASSSS
                     SASKDEVRSQVASTIRDQSQSKCDRCKQALRLGQSLARAHPEVVPGVLIDLCKEFQYK
                     QFGRNPDVNKTCELSYTAGGQGGVFTQLLSFADLSDSSSDADMICAQLFYRYCPLPPF
                     QTLSDSFLDAWFHGQRDEPAHVTCRSKRVGKPQDKDLRVLWTSDIHLDARYAVGSEAR
                     CTYKYCCHSNSFNTTTYNVTGYQTHVPAQNVSLPAPYWGYEGCDAPWSLVASAFQAIE
                     KLGPYDLALYTGDLVAHGQTWEESPDMVHYSESALFDIMHRHLQNTTVVAAIGNHDSY
                     PTENAAPRKLPNGRSSQFSWDWDYVSKLWHQEGWVDECQAQQVRTHYGGYSITPRRGL
                     RVITFNTDFWYRSNVFNYIHSSHPDYSGVLRWVTDELQAAEDAHERVWIVGHVLPGWD
                     GYSSMDLPTNLFYQIVTRFRSTIAHMFFAHSHEDTFSVYYHNTNGNASSVSQHTQDAV
                     GIALHSPAITPLTNMNPGIRVLHVDPVTYDIMDYDQYYTPLQNVQNATETHTGLAWHH
                     LYSARDAYGDFRASQAQGTYAAPVQLDHGLWPQHAPLNASFWAAITDEILARPSLAGQ
                     FQTFQGRNSPLSPPCYNVACARAKACFMRAGSFALGKSCGSAYSTVQ"
     gene            complement(<395621..>397000)
                     /locus_tag="MRET_4278"
                     /note="MRES_17320"
                     /db_xref="GeneID:38741044"
     mRNA            complement(<395621..>397000)
                     /locus_tag="MRET_4278"
                     /product="2-phosphoxylose phosphatase"
                     /transcript_id="XM_027630905.1"
                     /db_xref="GeneID:38741044"
     CDS             complement(395621..397000)
                     /locus_tag="MRET_4278"
                     /codon_start=1
                     /product="2-phosphoxylose phosphatase"
                     /protein_id="XP_027486634.1"
                     /db_xref="GeneID:38741044"
                     /translation="MIRLLWCLGLALSCVWADAVDTLYPDLKDPAVVHKPGYNATMMG
                     HRRETRNTTSDGTYSYCSMPHPDVSFYQEPGPVQNKSVHANLTKLLYIQRHQKRTAYH
                     LFPNGEKDVYTCSDLRTYSYAGPAGGPDVEPMQVYPRTYVDFLNPLNQQFTNSTCQFP
                     QLTLGGYLDGVQHGQDLRKLYMDKYNVIPGEPDHKRVWFRTSTAPLTQHSAAGVLRGL
                     WIGYRESLPVFEQSSSVDTHEPSCDKVDELKSAAQKTDVWQKHLQETSALRKDLEAIL
                     RTNASDWQKDWDHYNDNFQARLCNGYELPCSLDDPSKCVTPEQARQVFVAGDWEYNYN
                     WVSRENVTEAIKLTSGLYIRDLIEQLKELSSGKSELQYVHHFMHDGDIGPLAGSLGIE
                     SLRWPGMASNIAIELWTTDDKKTFVRVLYSGHTIRSRHGNLDWMPLDAFLHMWSQYVP
                     TDFEAQCRT"
     gene            complement(<397088..>398098)
                     /locus_tag="MRET_4279"
                     /note="MRES_17325"
                     /db_xref="GeneID:38741045"
     mRNA            complement(<397088..>398098)
                     /locus_tag="MRET_4279"
                     /product="aryl-alcohol dehydrogenase"
                     /transcript_id="XM_027630906.1"
                     /db_xref="GeneID:38741045"
     CDS             complement(397088..398098)
                     /locus_tag="MRET_4279"
                     /codon_start=1
                     /product="aryl-alcohol dehydrogenase"
                     /protein_id="XP_027486635.1"
                     /db_xref="GeneID:38741045"
                     /translation="MEYVRLGQSGLKVSRIILGCMSFGSREWMNWLTEEEEALELIHH
                     AYQNGINTWDTADVYSNGQSEEIVGKALKKYNIPRERVVIMSKVFFAVGDDNAPTFSA
                     TNDGEFVNRLGLSRKHIIDAVEASVKRLGTYIDVLQIHRLDHETPKEEIMRALNDVVE
                     RGWVRYIGASSMAAWQFQQLQHVAEKHGWHQFISMQNLYNLLYREEEREMIPYCHDTG
                     VGLVPWYPLASGLLTRPLGEMNTERAQTDRFRAAFQGASEADKTIINRLEEVAKNKGV
                     SMAQVALAWLLSKKDVSPIVGLSKKHRIDEAVAAVKIQLTGDEIKYLEEPYVPRPVRG
                     YS"
     gene            complement(<398853..>400448)
                     /locus_tag="MRET_4280"
                     /note="MRES_17335"
                     /db_xref="GeneID:38741046"
     mRNA            complement(join(<398853..399324,399351..400085,
                     400118..400165,400192..>400448))
                     /locus_tag="MRET_4280"
                     /product="ion channel regulatory protein UNC-93"
                     /transcript_id="XM_027630907.1"
                     /db_xref="GeneID:38741046"
     CDS             complement(join(398853..399324,399351..400085,
                     400118..400165,400192..400448))
                     /locus_tag="MRET_4280"
                     /codon_start=1
                     /product="ion channel regulatory protein UNC-93"
                     /protein_id="XP_027486617.1"
                     /db_xref="GeneID:38741046"
                     /translation="MRIVSNLKTFYRSVLFQIIVLGFVSFTQPGVWGAANSLGAGGQS
                     TPFLVNTSNAIIFGIMAIGCSPAGGLCNLITSKWTLVIGVMFFTPYSSSLYTLNRYGT
                     EWWLYLASVFCGVGAALFWSSEGAIAVGYPSESQRGRLLAVWLAMRHVGPLITGIITL
                     VLNTSGAETGKVAYKTYYALIVIQCLGVPASLLISKPDKVIRPDGTRIPYLKKDRTSA
                     KKELRHIWDTLRTPQLIPIFITGVWGQTYQSNFVTAVLSVRSRALVGLLTSIVSILAD
                     ISFGVVADAKWLGSQARRARCLWPAFALGITGLWVWQTVTQVHFTRTKNSVDWAGATP
                     EFNNAIAVVLLWKFAYEALLAFYYWILSTYPHTDGSMERAVGMLRTFESLGNCLAYVV
                     GSTSWPNVHHCILAFALWGTCLVPTTLAVGRVPPDKVEISEEENSHTKDVLHGDSSSE
                     DSYRIWNEMDKEALFPMPDLDRKLTARDSVSGLPIRAPIAVHATSLWLEQAEA"
     gene            complement(<401359..>402504)
                     /locus_tag="MRET_4281"
                     /note="MRES_17340"
                     /db_xref="GeneID:38741047"
     mRNA            complement(<401359..>402504)
                     /locus_tag="MRET_4281"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027630908.1"
                     /db_xref="GeneID:38741047"
     CDS             complement(401359..402504)
                     /locus_tag="MRET_4281"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027486551.1"
                     /db_xref="GeneID:38741047"
                     /translation="MLVFPTLALLLASLSSAARIDLVRDEASHDASIEADMQYVLHKY
                     AAIARHHYNRTGEHLNIVNLEYVDQLRANAQKRASSQTRLRKSKNWSGQIEVGFPPQK
                     SLVVFDTGSADLFVDKSSYHPKLSLTSKNVHKPFDFSYETLHVYGDVYIDDVSIGGVK
                     AKQVPLGHGSKDFDGEVTGGTLGLSFATAENRVHGFEQDPFMWAAKKQHLIQSSTYQF
                     TLRPNGKATLNVGKIDLFELGGLITWSDKNTDKTFWRTTVEFNGHKMENALLDTGTNV
                     ITGPNDQIKDILDQIDGMDVQVLEDGSYQGTYDCRHPPNLEFKVLGQTFKLPEEALNF
                     GYAGDKCFSSIIGSPGMNEWLLGSPFFQVGSIIFNFDVRRMGIAKSS"
     gene            complement(<403564..>404697)
                     /locus_tag="MRET_4282"
                     /note="MRES_17345"
                     /db_xref="GeneID:38741048"
     mRNA            complement(<403564..>404697)
                     /locus_tag="MRET_4282"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027630909.1"
                     /db_xref="GeneID:38741048"
     CDS             complement(403564..404697)
                     /locus_tag="MRET_4282"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027486703.1"
                     /db_xref="GeneID:38741048"
                     /translation="MLLLLLPFFALFFASLSSAARIDLFRHQKSNSTDLKPGLLSLVN
                     KYAAISRRHFNRTGEHLNIVNFDYLNLQKRANAHSNLHSDRSWSGQIEVGFPPQKTLT
                     LFDTGSSDLVLDKAAYNPKWSLSSKNLHKRFDFSYGSQHVAGDLYTDKVAIGGVKASN
                     VPIGHGNGDFNSGNGGTFGLSFSNSENSAFDVQQLPFTWAAKKQHLIQSSTYQFTLRP
                     TGKATLNVGRVDLFELAGPITWSDKNTDHTFWRITTELNGNKIENAIADTGTNFIGGP
                     PDQVKALLDNLDGVSVELAEDGSYGGFYSCQNPPHLSFKVLGQTFDFPEPAMNFGFNG
                     DKCRLAIFSTPGMQEWILGSPFFETASVILNYDVRRMGFAKYR"
CONTIG      join(CP030258.1:1..405301)
//
DBGET integrated database retrieval system