GenomeNet

Database: RefSeq
Entry: NC_040201
LinkDB: NC_040201
Original site: NC_040201 
LOCUS       NC_040201             162966 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome IX, complete sequence.
ACCESSION   NC_040201
VERSION     NC_040201.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 162966)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 162966)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 162966)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030259.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..162966
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="IX"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            complement(<201..>857)
                     /locus_tag="MRET_4283"
                     /db_xref="GeneID:38741049"
     mRNA            complement(<201..>857)
                     /locus_tag="MRET_4283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630910.1"
                     /db_xref="GeneID:38741049"
     CDS             complement(201..857)
                     /locus_tag="MRET_4283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486803.1"
                     /db_xref="GeneID:38741049"
                     /translation="MKTTIIGIALAATALTTANALKCQKNATGVLATREKRFEHKFDY
                     DGHPVAEWTQYYKMKDGKLVTSKDPGEEYDFYSCEAEGNLVSGDRAEMTGVLKTKDGK
                     KCLTNSFVWARKPAKWPAWEQVPKDVEKKVTLEDCAENGMGLRKQWFELSNAHRPGCS
                     QELLHHGYYEDQSLHLEYGEKGVAFDRIKELDNEEEKEEEDYRFSISYLMTGKLDDTC
                     "
     gene            complement(<1984..>3828)
                     /locus_tag="MRET_4284"
                     /note="MRES_17350"
                     /db_xref="GeneID:38741050"
     mRNA            complement(<1984..>3828)
                     /locus_tag="MRET_4284"
                     /product="glucose oxidase"
                     /transcript_id="XM_027630911.1"
                     /db_xref="GeneID:38741050"
     CDS             complement(1984..3828)
                     /locus_tag="MRET_4284"
                     /codon_start=1
                     /product="glucose oxidase"
                     /protein_id="XP_027486802.1"
                     /db_xref="GeneID:38741050"
                     /translation="MNKLSLVALAATLIASVAQAAQFHTQVQDLDGKKFDYLVVGGGL
                     GGLVVSKRLSQDPSKKILVIEAGRDDRKDPRIYDVDKYGEFVDTDMNWNFETVPQAII
                     GNQTKSLRAGKTLGGSTSINGGAWNRAHKVQYDMLKNITGDPTFDFEHLQEYMNRAES
                     FVPPTKEQRKAGADYVREAHGYDGPLSIGFSPIRNKQKRMFTGEGQQAFLETIQRVLG
                     VAHLKDQNSGNNTGAGWTPTSISQDSKRESACRYLEQTGDNVDVLLGWTAVRLSWKGD
                     KDIEGVVVQKDRHSQPHTLYTQGEVILSAGTINTPGILERSGIGAKDVLDKLGIEKKI
                     ILPGVGKNLQEQTMNTMGGKAKHLDTSGGGPSNMIANTGVWQIFNNASLVEKRVHLDM
                     YVEAAKLEDGGYVASSNALQDHYKLVTEAMFKKGVPACEHFFDTGFPPNSYGIDTWCL
                     LPYSRGKVHIKSKDAFEKPLLDPNYFAVHFDMKMQVAAMRANRRILQTSPLLDELEAS
                     ETQPGFEHIPDTPEHGSYAKWQAWILGTDGKGGFGSVAHQIGTCSMMPKKDGGVVDSH
                     FKVYGTKNLRIVDGSVLPIQLSAHLSSTLYGLAEKASEDIGKTAHQRH"
     gene            <4261..>5415
                     /locus_tag="MRET_4285"
                     /note="MRES_17355"
                     /db_xref="GeneID:38741051"
     mRNA            <4261..>5415
                     /locus_tag="MRET_4285"
                     /product="DnaJ-related protein SCJ1"
                     /transcript_id="XM_027630912.1"
                     /db_xref="GeneID:38741051"
     CDS             4261..5415
                     /locus_tag="MRET_4285"
                     /codon_start=1
                     /product="DnaJ-related protein SCJ1"
                     /protein_id="XP_027486801.1"
                     /db_xref="GeneID:38741051"
                     /translation="MLSWSATHAIALGLVCLVYVVPLVSAAKDFYDILGVKPRASERD
                     IKSAYRKKARDMHPDKHPDKAEAFMDVSEAYQILSDPELRRIYDARGADAALQHQARK
                     ENGHADPFDAFRQFFGGGGGSGHMHDETPKGPNKMYDAEVSLKDLYLGRSFTVAHKRH
                     VVCPACFGSGAHSTSDIHTCKACNGQGMQLHRQQIMPGFVTTMQVTCPHCNGEGRVIK
                     RLCSRCKGHTIVPDVTDIEVEVEPGAREGAEYVFEGLADQSPDADPGDVVVKVYTTTS
                     PGDFRRMGHNLYYTHTISLHDALLGFEHTLPHYDGHAIRLARTTATQPGHVSVIHGEG
                     LPIPDEERRHSEDHGDLFVEFQVIVPEIQDKKTRKALSSLLQPKEQHQDL"
     gene            complement(<5442..>7136)
                     /locus_tag="MRET_4286"
                     /note="MRES_17360"
                     /db_xref="GeneID:38741052"
     mRNA            complement(<5442..>7136)
                     /locus_tag="MRET_4286"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027630913.1"
                     /db_xref="GeneID:38741052"
     CDS             complement(5442..7136)
                     /locus_tag="MRET_4286"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027486800.1"
                     /db_xref="GeneID:38741052"
                     /translation="MFAEMAAKSRPRLVTTTLMALRSVALSCFVALVIGASVDAAPSS
                     TRQTDAPHATAPAQGLKVPMYYDRRALHPRNQNMNQDQLDEWLRMQSKNMHWRYTHPD
                     DRNSSDALEKRQQLGMGDYGPDSFYFAPIGIGTPEMTLNVVLDTGSADFWLADSQCSP
                     MKHCPESMLKYDASKSRTHKDLHVPFGVQYGSGAVRGELATEKVSLAGYTVSSVSFGQ
                     ADQLARGTINPPASGIMGMGYESLSTTGTMPFWQILLERQKLHDYLFTFQMVNKIKKA
                     SSGRVDMVEAGGVFTLGVLDDQQYSGDIAWAPMARGYGSKGVGYWALNLEDLSVNGEH
                     IDLGTHSVAAIDTGTTLIGGPKLAMDRIHAKIPGAQRYNRVPEYYVFPCDTDAKVDLT
                     FGNHTWTLKTEDLISQRLSRRVCLSSLFAMSTRSGSRMPAWIVGDTFLKTVFSVFDAG
                     KNRIGFASLPKGGAQTKSITSATMDNRVASSYQQTASSEGSPFGGGGGGGGDGGGGGI
                     IITRTRNVDESWKTASIDVPHNVQPLHAPKWNEAASLGVSQLVVPMLLIASAALFL"
     gene            complement(<7201..>8880)
                     /locus_tag="MRET_4287"
                     /db_xref="GeneID:38741053"
     mRNA            complement(<7201..>8880)
                     /locus_tag="MRET_4287"
                     /product="cathepsin D"
                     /transcript_id="XM_027630914.1"
                     /db_xref="GeneID:38741053"
     CDS             complement(7201..8880)
                     /locus_tag="MRET_4287"
                     /codon_start=1
                     /product="cathepsin D"
                     /protein_id="XP_027486799.1"
                     /db_xref="GeneID:38741053"
                     /translation="MTPRTRIPIEAHTMASIVQLVLWCALVVFSFVGAQRSSSRTARP
                     TADAHALRAPITVHRKARPRHMERDHLVTWCHAQSEKRRRKYGLAANVSKRQIVGLGD
                     YLDDSYFVPMGIGTPAQTLNVLPDTGSTNLWVIDSTCTDEKNCPSSSPKFTASMSKTH
                     QDSRTPFHELYGDHAAASGTISQDTVSLAGYSISPLAFGRVRHVTKRTMGPTVSGILG
                     LSFHDPKLDDLEPFWQVLYERQEMQDYVFSFQLPKALVYAKPDQEEDALTSGGVFTLG
                     VLDPQQYAGSISWSPLSRGYGMHAKKSWTIDVNEMRLNGHSVDLGPHRHALIDTGSSN
                     IVGPRQAMDILHALIPGAQRFPPNPEYYMLPCNSSIQLDITFSDRTWTLPPDHLIMQK
                     INQTMCLSALTTVEDTSDIPLGWIMGHPFLTHVFSVFDAKEERIGFASLPQGGVQNAT
                     LTQADIDRHNASRAFHTSNTQISERYATPISRMEHGPSSRMHPSSPPAEPTMTLNRFT
                     DSQWRSATIHAPHHINLTQRTSHTSSASSSERSWSHTCMLLCALALVWMCR"
     gene            complement(<9059..>9410)
                     /locus_tag="MRET_4288"
                     /note="MRES_17365"
                     /db_xref="GeneID:38741054"
     mRNA            complement(join(<9059..9158,9186..9301,9333..>9410))
                     /locus_tag="MRET_4288"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM10"
                     /transcript_id="XM_027630915.1"
                     /db_xref="GeneID:38741054"
     CDS             complement(join(9059..9158,9186..9301,9333..9410))
                     /locus_tag="MRET_4288"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM10"
                     /protein_id="XP_027486741.1"
                     /db_xref="GeneID:38741054"
                     /translation="MGLFGGSSSGSASAASSPQLEAATAELDMITDVFNRLVESCHAK
                     CISPRYAEADLNKGESVCVDRCVSKFFAVNAKVGEQMQALGQAASAAGGRMMG"
     gene            complement(<9688..>10116)
                     /locus_tag="MRET_4289"
                     /note="MRES_17370"
                     /db_xref="GeneID:38741055"
     mRNA            complement(<9688..>10116)
                     /locus_tag="MRET_4289"
                     /product="small subunit ribosomal protein S10e"
                     /transcript_id="XM_027630916.1"
                     /db_xref="GeneID:38741055"
     CDS             complement(9688..10116)
                     /locus_tag="MRET_4289"
                     /codon_start=1
                     /product="small subunit ribosomal protein S10e"
                     /protein_id="XP_027486787.1"
                     /db_xref="GeneID:38741055"
                     /translation="MIISKQNRRTIYMALFQEGVLVAPKNFEIKHPNLDVPNLEVIKA
                     LQSLDSKGYVHTQFSWQWFYYVLTDEGLEYLREYLHLPSEIVPNTHKQPARPQRALMG
                     DRDGFRGRGGGDREYRRRGDFDKKDGAPSGDFRPRFGRRE"
     gene            complement(<10661..>11191)
                     /locus_tag="MRET_4290"
                     /note="MRES_17380"
                     /db_xref="GeneID:38741056"
     mRNA            complement(<10661..>11191)
                     /locus_tag="MRET_4290"
                     /product="protein of unknown function (DUF2034)"
                     /transcript_id="XM_027630917.1"
                     /db_xref="GeneID:38741056"
     CDS             complement(10661..11191)
                     /locus_tag="MRET_4290"
                     /codon_start=1
                     /product="protein of unknown function (DUF2034)"
                     /protein_id="XP_027486774.1"
                     /db_xref="GeneID:38741056"
                     /translation="MSTVARGTAYEHACLALLRSWLKMDIYRTGGAHDQGRDLCGWWS
                     PHAIGEPRAHERIRVIAQCKAESRALGPSVVREMEGTLLRATWEATTTATVGVLASHS
                     GFSKQAKVYMRSSRLPLLFLHLAPQDQEPLVCQGFLWNDALANGPLHGRFEPVWVTTP
                     QHTQQLTLYRDGIRAI"
     gene            <11258..>11596
                     /locus_tag="MRET_4291"
                     /note="MRES_17385"
                     /db_xref="GeneID:38741057"
     mRNA            <11258..>11596
                     /locus_tag="MRET_4291"
                     /product="DASH complex subunit DAD2"
                     /transcript_id="XM_027630918.1"
                     /db_xref="GeneID:38741057"
     CDS             11258..11596
                     /locus_tag="MRET_4291"
                     /codon_start=1
                     /product="DASH complex subunit DAD2"
                     /protein_id="XP_027486812.1"
                     /db_xref="GeneID:38741057"
                     /translation="MSQRMSLARSRASMAPGSVPSSVSARLAAKQAELQALQQLRAES
                     AQLTQELARLSERVDTLVCGGQSVASVMASWQGVFRAIHIAQAAMHPDDDTSRTVPEA
                     LVRIPMHHAT"
     gene            complement(<11589..>12407)
                     /locus_tag="MRET_4292"
                     /note="MRES_17390"
                     /db_xref="GeneID:38741058"
     mRNA            complement(<11589..>12407)
                     /locus_tag="MRET_4292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630919.1"
                     /db_xref="GeneID:38741058"
     CDS             complement(11589..12407)
                     /locus_tag="MRET_4292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486782.1"
                     /db_xref="GeneID:38741058"
                     /translation="MDAATQPVWAGVTWLREVATQVIESVVPPAASPPPPPPPPALRL
                     APGVVRAIAAVGWTAVALWTGVHFVRHWRRASRRSVAPLKRTQCVLVLGGDTPLGQSV
                     VEYLLAHNLIVLASVSSAASARALEARIDPEMQGYVRTIQLHDATSFVHAVHASLCLR
                     YPWTATGDPYARPGQAVEWLGTVNTLGMTDTLPDVLQRLASLRPHRMIHILPGSSRAS
                     STAIGAPSVTLHASPRSESRVLARMLRLLLPSRTWRACLSSWLSSLGTRLRSLM"
     gene            <12436..>13323
                     /locus_tag="MRET_4293"
                     /note="MRES_17395"
                     /db_xref="GeneID:38741059"
     mRNA            <12436..>13323
                     /locus_tag="MRET_4293"
                     /product="SAGA-associated factor 73"
                     /transcript_id="XM_027630920.1"
                     /db_xref="GeneID:38741059"
     CDS             12436..13323
                     /locus_tag="MRET_4293"
                     /codon_start=1
                     /product="SAGA-associated factor 73"
                     /protein_id="XP_027486775.1"
                     /db_xref="GeneID:38741059"
                     /translation="MDWGVILEETQSQPPSPVPRKRAWEADASDVTEFGPFALDDSVD
                     VVVCPTCAKPVLRQAYAYHEQNCALAQSIAEGRVSPSILKSETKAEPEQRKAWTTGGK
                     KHRGPINLDRQCGVINNKGLPCSRSLTCKSHSMGAKRHVPGRSQPYDTLLFEWQKATN
                     PAFVARLEEKERQIAALKASSQAHKERKRRTTDKRDAERTTADTPTDALDLYQRHATF
                     QDVDRDLSRTLDTIHAAVTRDRTPIMPMATRSLAGQFTTRTRRCRVLRQFLAQGLAGT
                     AHVRARLSEANDDNSAARA"
     gene            complement(<13283..>15187)
                     /locus_tag="MRET_4294"
                     /note="MRES_17400"
                     /db_xref="GeneID:38741060"
     mRNA            complement(<13283..>15187)
                     /locus_tag="MRET_4294"
                     /product="ATP-dependent RNA helicase DDX35"
                     /transcript_id="XM_027630921.1"
                     /db_xref="GeneID:38741060"
     CDS             complement(13283..15187)
                     /locus_tag="MRET_4294"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX35"
                     /protein_id="XP_027486813.1"
                     /db_xref="GeneID:38741060"
                     /translation="MAFWKPGAERPASALDRDASAPVWLPSAAPLPVQAARSRILYAL
                     EQYAVVVLVGETGSGKTTQVPQYLLDAGWAQERQIVCAQPRRMAATSVAAHVAQERQV
                     RLGEEVGYAIRFDEQVHPTRTRLRYTTPGMLFRECMRDPLLHRYSVVMVDEAHERGAY
                     TDLLLAVLKKIRRRRPALRMIVASATLEAESVLRYLDPGGAASTVVAIQGRAYPVEVA
                     HTTAPHDVVAACVHTVVTLHETAPPGDVLVFMSGQDKIERVVQALADRGVYAVPLYAA
                     LPPEEQRVALRPGPPGKRKVVVSTNVAETSVTIDGVRYVVDTGYTKMRYRHTLAEVRL
                     SAASAAQRAGRAGRTAPGQCLRLYDDGALRASDPPELVQCDLTMYVLQLKALGVDQIA
                     RFDFMPPAPPAAHVADALAHLESLRALDEEGRLTLLGERMAEAPLSPMMARAILHDAS
                     CADEMLTIAAMTSVGSPFDGSESVAAQIERRKFVAEEGDHLTLLNVYEAFQRAGASSR
                     WAAQHGLSYATLKRARSIRAQLVAFVTRQWSWPWRRAGDEQAVRRCLAAGFFRQAVRY
                     DGSWKTPAGETLYVHPSSVLFTRAPPIGTWAVYGDLLHTTQPQMRDLCVVDAAWLLTL
                     APHYYHRSLH"
     gene            <15186..>16430
                     /locus_tag="MRET_4295"
                     /note="MRES_17405"
                     /db_xref="GeneID:38741061"
     mRNA            <15186..>16430
                     /locus_tag="MRET_4295"
                     /product="charged multivesicular body protein 7"
                     /transcript_id="XM_027630922.1"
                     /db_xref="GeneID:38741061"
     CDS             15186..16430
                     /locus_tag="MRET_4295"
                     /codon_start=1
                     /product="charged multivesicular body protein 7"
                     /protein_id="XP_027486814.1"
                     /db_xref="GeneID:38741061"
                     /translation="MANLLHVAHGSFMTLSAYAAPRCGSREALASMYADLGGQKHSDP
                     GTFRSRLAWWTGTIAAACWDRVLPHALCWPVDADTPTQWADADIGRPLCLSVVIREQE
                     RHGRYVRLSAYLDRTWTAWWARQWRWRSARDDDDDEALWSHVHGEWVVCENVERAARL
                     ATARDWSALERIMSRADAKAYLASLHDGSRPLALSDKDTDILLTHLVHDARAIQHDGD
                     VYKWGTARVTEQDRGILAVKGLHAQLERQVDAWQARMERAQATVRRALQAKEREAVTL
                     SYLRTQKQLESMVDKRVLALEKVHTLLLSMDQAVGDAQLMQAYTASEKTLRSLLDDPS
                     LQPDHIDRTMDAIAEAVHDQNAVTDALSSAPDDELADELAQLELDTLPSPPATQPEAT
                     SPETTSLSMKTTHDTQKQAVPA"
     gene            complement(<16384..>16988)
                     /locus_tag="MRET_4296"
                     /note="MRES_17410"
                     /db_xref="GeneID:38741062"
     mRNA            complement(join(<16384..16422,16446..>16988))
                     /locus_tag="MRET_4296"
                     /product="v-SNARE component of the vacuolar SNARE complex"
                     /transcript_id="XM_027630923.1"
                     /db_xref="GeneID:38741062"
     CDS             complement(join(16384..16422,16446..16988))
                     /locus_tag="MRET_4296"
                     /codon_start=1
                     /product="v-SNARE component of the vacuolar SNARE complex"
                     /protein_id="XP_027486815.1"
                     /db_xref="GeneID:38741062"
                     /translation="MLVLALVARGSDVLAEAHEPGYERFVSAAATILAKVHESGTPRV
                     SYAFEQWLFHYMCGDDQSYLAVADVEAGRRVPFAFLEALKQARVQSAAEIESLRRAWN
                     ARGRDPIQQAQSELGHVKDVLTQNVEQILSRGEQLDLLVDRTDSAAHQSLAFRRRAVH
                     LRREMWWRNTRIVVLMSVCALALLVFVYHALFS"
     gene            <17076..>19952
                     /locus_tag="MRET_4297"
                     /note="MRES_17415"
                     /db_xref="GeneID:38741063"
     mRNA            <17076..>19952
                     /locus_tag="MRET_4297"
                     /product="aspartyl-tRNA synthetase"
                     /transcript_id="XM_027630924.1"
                     /db_xref="GeneID:38741063"
     CDS             17076..19952
                     /locus_tag="MRET_4297"
                     /codon_start=1
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="XP_027486764.1"
                     /db_xref="GeneID:38741063"
                     /translation="MSLDGSDSGSVTDMLQRQQNRLINLLNIRKPRTPEPQNQRDALM
                     QAKRMSPSPASLHSEDRVRKLEELRAFERLVNMRRRMSAANAADIETPEQRSRYGEWD
                     VYHVESEPWAQISDIATVSRAASYDEQKIAKFFGTEWRFRARIHAMRHMSSHLAFVVL
                     REHGVTLQAVLSENGTGITPHMMHWVMRLPTESLVLVRGTLEKPRDMITGCDIAHLEL
                     HLTHVHLVSSITDRLPFTPYAAERAVSSHLEEHRDMDETVPQSSASVHSDSQKSLTQS
                     SHMPVITQRTRLSNRLIDLRTPTMQAVILIPSIICHEFRQYLSKHEFIEIHTPKLQGG
                     ASESGASVFDVAYFGRSAFLAQSPQLYKQMCIAADMRRVFEIGPVFRAENSNTARHLT
                     EYTGLDLEMEINHYYDAMSLIDGMLKHIFTVLRDKYGHVLQVIRRHFPSTDLQWLERT
                     LVLPFWEGVRLLKEDGYREEDGSEPSPFEDLHTRAEIRLGEIVKRIYGTDYYILDKFP
                     RNARPFYTLPDPVNTRYTNSFDIFVRGQEICTGGQRIHSADMLEDNIRRLHMDASSLE
                     EYLQGFRLGAPPHAGCGIGLERLVMLYLNLDDIRLASLFYRDPKSFPAKLKQELRHPD
                     AGTNPPPWVQYDRPHMLQPLESLIANYGDSTNTSWLDDRVQVWRDTETGAAVGYAPGK
                     HYVMIIGNPLCDTSQYQRIIDRFLSFCHTQLQAKPVWLMVCKAVETILGDRYGWCTLT
                     CTDDQRIPDVRKNPAKQDHEIERKMRHASKVGVTIQSLAYHERVPIELQQECDKSIQA
                     WMAQRRGVQVHLTSVRPWVDQEHRQYFFARDANNDLCCLVVLAQLSPEHGVQVKWAIS
                     FPNAPNGAIEMTILHALDTVGSGSATFGTAASPKVEAVHGLSGLAFKILSRVYNGVAE
                     RAHLQNKGDFREKLGTMRDPTYICYPKGGMSMSAVRELMHFFRE"
     gene            <19982..>20974
                     /locus_tag="MRET_4298"
                     /note="MRES_17420"
                     /db_xref="GeneID:38741064"
     mRNA            <19982..>20974
                     /locus_tag="MRET_4298"
                     /product="2-dehydropantoate 2-reductase"
                     /transcript_id="XM_027630925.1"
                     /db_xref="GeneID:38741064"
     CDS             19982..20974
                     /locus_tag="MRET_4298"
                     /codon_start=1
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="XP_027486745.1"
                     /db_xref="GeneID:38741064"
                     /translation="MTLRVLVVGAGAVGCFYASRLDAGAYVGLVCRSNYEAVRASGVT
                     MDTHTFGSYAFVPHAVYPTVEAAAATPWDLVIVATKALSMDPASVAYLAPVVRDTTTL
                     VLIQNGVDIEAPYRHQFPHTPIVSAVTIVSAAKTEAARIVQYRWTRISLGPYTDLHGS
                     DDASSALMQRATESLQTLAALLKRGGIPDVEVHDARTLQWVRWHKLCINASMNTTGVL
                     AGGRSNPDMVRDPLLRAHIEACMNEVMDAAPPIFGCPLPFASPERILQSTERNTSSSK
                     SSMVQDWEAGRALELDAILGNAIRIAEAHGAHMPRLQSMYALLQSAVAMRDAAT"
     gene            complement(<20977..>21156)
                     /locus_tag="MRET_4299"
                     /db_xref="GeneID:38741065"
     mRNA            complement(join(<20977..21057,21082..>21156))
                     /locus_tag="MRET_4299"
                     /product="translation machinery associated TMA7"
                     /transcript_id="XM_027630926.1"
                     /db_xref="GeneID:38741065"
     CDS             complement(join(20977..21057,21082..21156))
                     /locus_tag="MRET_4299"
                     /codon_start=1
                     /product="translation machinery associated TMA7"
                     /protein_id="XP_027486747.1"
                     /db_xref="GeneID:38741065"
                     /translation="MASRQGGKLKPLKQPKKQQKELDDDDLAFKQKQKEEAAAKKAAI
                     DKLKGKK"
     gene            <21339..>22316
                     /locus_tag="MRET_4300"
                     /note="MRES_17425"
                     /db_xref="GeneID:38741066"
     mRNA            <21339..>22316
                     /locus_tag="MRET_4300"
                     /product="transcription factor"
                     /transcript_id="XM_027630927.1"
                     /db_xref="GeneID:38741066"
     CDS             21339..22316
                     /locus_tag="MRET_4300"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027486770.1"
                     /db_xref="GeneID:38741066"
                     /translation="MSATCTYTRPRRAAAMRVDAERDMTGEGVDLEEEPRAPKRTRTS
                     RALHRKTDHSVIERRRREKINDRLICLQSTVPACREKARECIEKKSPSGTCGTDDIDA
                     RIGSDIVLEKLCIISHTVDYVMELRAKLKAYETQCHCDPKLPIMAERDDGAHCLTTHP
                     EKMQCERSSEASSESPDPKCATPVPDEKHALPDLSERAELPDDDVVPAAPPHYQHHHH
                     DHDMWCRPWRPWIPWHARAYLPPLCYDAPPVAGTASAVAPMPVMPPPPYAIAPTRACH
                     HHHHHHPVRTRDPWCRAPHRAYQAWGPFAAPPSPLSRKHKAARDDALSM"
     gene            <22334..>23911
                     /locus_tag="MRET_4301"
                     /note="MRES_17430"
                     /db_xref="GeneID:38741067"
     mRNA            <22334..>23911
                     /locus_tag="MRET_4301"
                     /product="methionyl-tRNA synthetase"
                     /transcript_id="XM_027630928.1"
                     /db_xref="GeneID:38741067"
     CDS             22334..23911
                     /locus_tag="MRET_4301"
                     /codon_start=1
                     /product="methionyl-tRNA synthetase"
                     /protein_id="XP_027486771.1"
                     /db_xref="GeneID:38741067"
                     /translation="MWASLTRWAKPYYVTTPIYYVNAEPHIGHLHSSVMADVLRRYAE
                     LRRRGWSTYAPAPAHATQALMTTGTDEHGLKIQRVAESMHLDPRTLCDRVSVRFEALL
                     KAADIAPTRFLRTTEAVHQAAVQHFWTRLQDAGYIYLGAHEGWYAVSDEAFYPASQVQ
                     EQGGVYTSIETGQRVEWTTETNYKFRLSACREPLLAWLEANPDVIQPRSMYDHILAEV
                     RAGLSDLSVSRLASRLSWGIPVPHDPTHTMYVWIDALVNYLTALGYPSAMQGWPVDAH
                     IVGKDIVRFHAIYWPAFLMAAGLPLPRTIVAHSHWTVEKTKMSKSRGNAINPFDAIET
                     YGVDTMRYYLMRIGGHIGTDADYAPALVEEHKRKFLQGQLGNLLSRVLAPKIQQRLAG
                     EWLPRPAHATDPLEQACTELPRVYEHSMESYEPSKAVQAVFDVIAHTNELVQHTAPWS
                     ADTPLSDVHRCVYLSSEALRVCGTLLSPIMPRAMTALLDALQVPAAQRTWDALAFQAQ
                     IPLRRSSSKIAPLFPRT"
     gene            complement(<23908..>24708)
                     /locus_tag="MRET_4302"
                     /note="MRES_17435"
                     /db_xref="GeneID:38741068"
     mRNA            complement(<23908..>24708)
                     /locus_tag="MRET_4302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630929.1"
                     /db_xref="GeneID:38741068"
     CDS             complement(23908..24708)
                     /locus_tag="MRET_4302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486768.1"
                     /db_xref="GeneID:38741068"
                     /translation="MSTDAHRRQGRLSEMVADDVPPELLEAESRELVQQDTDTPVRHL
                     RIDWPSSSIKGVYAIGSSVPHANPPLYDAPDAKDVEGNATSAVFTSRRSPINVTVLVL
                     HGQGQRTPHTPSSETPPDVGDPMQLLEVERKNTVFVSARTQLNSACVHVPSYAGRKPL
                     HIKVQTHSGNATVILPHSFNGLLTWKVEAGLFHMSPGAASHAMRLGDKEHRHHGMFRM
                     VADPDLPSWMTAQGRRGDVCEIKVHTGRIYVCMSGEKKSSAAKGCVIC"
     gene            <24754..>25923
                     /locus_tag="MRET_4303"
                     /note="MRES_17440"
                     /db_xref="GeneID:38741069"
     mRNA            <24754..>25923
                     /locus_tag="MRET_4303"
                     /product="sorting and assembly machinery component 37"
                     /transcript_id="XM_027630930.1"
                     /db_xref="GeneID:38741069"
     CDS             24754..25923
                     /locus_tag="MRET_4303"
                     /codon_start=1
                     /product="sorting and assembly machinery component 37"
                     /protein_id="XP_027486769.1"
                     /db_xref="GeneID:38741069"
                     /translation="MAVAVTVWGVPRDGLPTIEPTSLYVLALLQLAQKQAVVLTPPTL
                     IHTEAVPALYTFEGHVGEVLATTPTDIRSHLHTGLDASAYAVHAALDDMLSDLVLHTL
                     FSLPLNFQKVTCQALTQRTTIPSSLPRRMRAAVRARLESPHIRLWGMGGSWDREERQE
                     AQRWQASAGLTEARDPLTCMPRQGFYSSLTSDMREEWERSRLATRARRVLAAVAKQAS
                     THTATPVDARLYSLLAPLLYVEWPVDTLPSLIRREFPGLVEHTHRMHRLLWHDAPWAW
                     ERRPFHVMPASTPWWRTPKAPRSDAPLPPTLRYGRLLWSALAILVPIPWLLLTGMIAI
                     ETEEEEDEPEEVDDDGEDLDGEDLDAGEDLDAGEDLDAGEDLDAGEDLDVEEDHS"
     gene            complement(<25924..>26544)
                     /locus_tag="MRET_4304"
                     /note="MRES_17445"
                     /db_xref="GeneID:38741070"
     mRNA            complement(<25924..>26544)
                     /locus_tag="MRET_4304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630931.1"
                     /db_xref="GeneID:38741070"
     CDS             complement(25924..26544)
                     /locus_tag="MRET_4304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486784.1"
                     /db_xref="GeneID:38741070"
                     /translation="MSFEAPPGYVRADTAQASDAWERADEVWVMRVPDGVDVRKLDGV
                     TIPFDALERADHAPLASVRVSETDTYDVLVAHGAAGEADSQLIDMAGPSTTPVFLQRD
                     FLRSADGVASELQSVCALLPRAKDATLRMKPVARRMYMARRTASAKGRDHGYDVSLPP
                     KHTQPWDRLQGVFRPAGSQAKSPALPDKKRKKASSDEASKKKKKKK"
     gene            <26626..>27654
                     /locus_tag="MRET_4305"
                     /note="MRES_17450"
                     /db_xref="GeneID:38741071"
     mRNA            join(<26626..27584,27609..>27654)
                     /locus_tag="MRET_4305"
                     /product="short-chain dehydrogenase"
                     /transcript_id="XM_027630932.1"
                     /db_xref="GeneID:38741071"
     CDS             join(26626..27584,27609..27654)
                     /locus_tag="MRET_4305"
                     /codon_start=1
                     /product="short-chain dehydrogenase"
                     /protein_id="XP_027486767.1"
                     /db_xref="GeneID:38741071"
                     /translation="MPRLAWTLVACVVLHVVWTYARRKKRTQYVDAGAERVLILGAST
                     PDGLGAELLRQYVERGAKHIMIVGRRQHALDDVRKRFPRVQVHVHAADLTCTQSVLAL
                     RDAVVRCMGGLDTLHMVFGATSILPILGVAGVDPCGVNAETEERGLTHATQDGLDRIG
                     ETVQRSCDANVKGPAIVLGALIPLMQTTSSRPAVVTIGSVAGLIPAPTRAVYCASKSA
                     QHLLVRSVDLECEAQAAMPAPGQPRRARVHFLLVAPGPIKNSFVATYSVDASTGPRDR
                     RDHALGVEDVVRATLRRVDAEQWGVLVMPSYLRVAWILTCLDATRAWLGRAAHRLYRY
                     "
     gene            complement(<27687..>28502)
                     /locus_tag="MRET_4306"
                     /note="MRES_17455"
                     /db_xref="GeneID:38741072"
     mRNA            complement(join(<27687..27728,27754..27885,27912..>28502))
                     /locus_tag="MRET_4306"
                     /product="NADH dehydrogenase (ubiquinone) flavoprotein 2"
                     /transcript_id="XM_027630933.1"
                     /db_xref="GeneID:38741072"
     CDS             complement(join(27687..27728,27754..27885,27912..28502))
                     /locus_tag="MRET_4306"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) flavoprotein 2"
                     /protein_id="XP_027486765.1"
                     /db_xref="GeneID:38741072"
                     /translation="MVAMALRQTARTLVARGGMRMASHMRAISTSSVVRSDALFVHRD
                     TPYNNAAIPFSFTGEFVPEAQAIIKQYPPQYKKAAVIPLLHLAQKQNDNWLSISAMNH
                     VAEVLEMPPMRVYEVATFYTMFNRTPVGKYFVQVCTTTPCMLGGCGSTAVLEAIEKHL
                     GIKAGHTTPDKLFTVIEVECLGACANAPMVQINDEYYEDLTPASVVAVLEGLARGEPV
                     KPGPQNGRLNSAPDTEQRTLKEKPYGPGQYCVPEFA"
     gene            <28660..>30006
                     /locus_tag="MRET_4307"
                     /note="MRES_17460"
                     /db_xref="GeneID:38741073"
     mRNA            <28660..>30006
                     /locus_tag="MRET_4307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630934.1"
                     /db_xref="GeneID:38741073"
     CDS             28660..30006
                     /locus_tag="MRET_4307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486766.1"
                     /db_xref="GeneID:38741073"
                     /translation="METPACPLCEQVGTVQWLDEAYAYVCGECATIVADAPLDVVEQP
                     EGVVPPPPRLPRWWVYDRASARHAHEQRRARHATEMVQGAATRLGFAYAAHDSLALLD
                     RALRQERAPPWGALASACLYATLRRDHRLVDVAAVATAMEQTHAAVAHACRWLRRKTA
                     LPLLVNDPALYLEAQLAYLEAHPDVLPRAVDMAHVRTMTTRLLQHICTYAWATSLEAP
                     SLAYATIMHAIEGVCRRAWPVRAMASHAPQVSAHTLDGSVLVSPCHASVSTVLVRYAE
                     IEKMLHALVEALPWVAQRPISKRERDRMRHAHGQRSLSRAEVAMYMSDAIEWAAQHPP
                     PETRVWSQAFAARRSIPRSPDHASMAQRLGLHGPRIDALSDADVDARLFAPDELASYM
                     RTPAEQARWAQLKGWDTAPAAPAPVPSPPPMKRPRLHGPTQQPMKQVTDGASDWDD"
     gene            complement(<30003..>31412)
                     /locus_tag="MRET_4308"
                     /note="MRES_17465"
                     /db_xref="GeneID:38741074"
     mRNA            complement(<30003..>31412)
                     /locus_tag="MRET_4308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630935.1"
                     /db_xref="GeneID:38741074"
     CDS             complement(30003..31412)
                     /locus_tag="MRET_4308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486749.1"
                     /db_xref="GeneID:38741074"
                     /translation="MAATVRVGTLDDLRASTRHTLVLRHGETERKLLLFSMPGVQGKP
                     TFSCMESECPHLGKSLDTAPLQWHGADIEDLVVVCPWHQYDFRLSTGDSSTGLRACVY
                     TVRVDDDTVYVEPPTQDTTAEGESVWTCAAIVPVPTQFATMPPPPPESTSLKQLGYAG
                     VFDPDGVPPPAYEPDTLVAWAVLILQTASPLHKVAYTRYAKRALDQGIPIGGGAWRES
                     EWYVPPAEEPPDRPPRLQDEQCVAPGQQSKRGRGGSERSRIALLHALANIEQWAIDLA
                     WDIVARGPRLSVRHMQSSDTDRPDMPLPRAYFADFCQMALDEAKHFTLLQQRLVDMGS
                     FFGALPVHHGLWDSAVETREDLCARLSIIHLVHEARGLDVNPLTIEKFRAAGDARSVD
                     SLTTIHLDEITHVSTGHRWLTYLCAVHPEQPSPVDVFRANVRRHFVGQLKGPFNAPDR
                     HQAGLSPAWYENLAGEKKT"
     gene            <31501..>31803
                     /locus_tag="MRET_4309"
                     /note="MRES_17470"
                     /db_xref="GeneID:38741075"
     mRNA            <31501..>31803
                     /locus_tag="MRET_4309"
                     /product="fungal protein of unknown function (DUF1748)"
                     /transcript_id="XM_027630936.1"
                     /db_xref="GeneID:38741075"
     CDS             31501..31803
                     /locus_tag="MRET_4309"
                     /codon_start=1
                     /product="fungal protein of unknown function (DUF1748)"
                     /protein_id="XP_027486772.1"
                     /db_xref="GeneID:38741075"
                     /translation="MMGRLVHYAADALMVSTIIAGVKRSSGVTIDTTRVSEPNVRNAL
                     QYYLAAGEFVFDKTLSIAQSSQYFRPAEPVNPLSLFNQEALTSLRQYSHPEAQPRW"
     gene            <31965..>32621
                     /locus_tag="MRET_4310"
                     /note="MRES_17475"
                     /db_xref="GeneID:38741076"
     mRNA            <31965..>32621
                     /locus_tag="MRET_4310"
                     /product="ribonuclease H2 subunit B"
                     /transcript_id="XM_027630937.1"
                     /db_xref="GeneID:38741076"
     CDS             31965..32621
                     /locus_tag="MRET_4310"
                     /codon_start=1
                     /product="ribonuclease H2 subunit B"
                     /protein_id="XP_027486790.1"
                     /db_xref="GeneID:38741076"
                     /translation="MTRPPIALAYPPDVAHATTRLWVLPHPRTGVPTYFATSQDGTTA
                     YELLVTRPPTRSWLLRGHDDDGYVIADGAMRILSRIDPAFLLLGIFCVLDTSQQYWPL
                     DDWLEAATDVHVQRRSMSAWPDMAAFVALPSMQAHLDRICATQEADGGRVYRLDETRI
                     RAMLHAKAQRVCARAPEQVAAQAWRTLDASASDADVDSAQQEVARQWIEAYVPLSVRW
                     "
     gene            complement(<32642..>33274)
                     /locus_tag="MRET_4311"
                     /note="MRES_17480"
                     /db_xref="GeneID:38741077"
     mRNA            complement(<32642..>33274)
                     /locus_tag="MRET_4311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630938.1"
                     /db_xref="GeneID:38741077"
     CDS             complement(32642..33274)
                     /locus_tag="MRET_4311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486726.1"
                     /db_xref="GeneID:38741077"
                     /translation="MPTDEPAVRMPAYMSPVDQLRTSPSPLQSFDHDEHEARVMQQLY
                     EARKRLESANHDADAEHVWLAPSSAILSRPPSASPRPLSPTTSGATPQRTQMRRPHSL
                     TLDLKDVPFTALVDAERRRLSETVPTGSSDPDAPPATRPVPPDNSGSHYGMAPYMHLE
                     RDEWVWQYDVRQAPMQVRPSHDTPATPSKVTHVQEEWAWAVAGPAPVTMS"
     gene            <33535..>34314
                     /locus_tag="MRET_4312"
                     /note="MRES_17485"
                     /db_xref="GeneID:38741078"
     mRNA            <33535..>34314
                     /locus_tag="MRET_4312"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8"
                     /transcript_id="XM_027630939.1"
                     /db_xref="GeneID:38741078"
     CDS             33535..34314
                     /locus_tag="MRET_4312"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8"
                     /protein_id="XP_027486728.1"
                     /db_xref="GeneID:38741078"
                     /translation="MSSTMWMSRAVPRMMGPVMATAVPVSSPSAWSVRMLSTSRVWQQ
                     AQPTQPDGGHTGPLHVSPVHDTLNVGLDHAQPIRHRRKHAVRPPKVEPDYNEGLSALE
                     KAGRLFFFTEMARGLWMTFENFFRPPYTIQYPFEKGPVSPRFRGEHALRRYPSGEERC
                     IACKLCEAICPALAITIESEPRLDGSRRTTRYDIDMTKCIYCGMCQEACPVDAIVETQ
                     SMEFATETREELFYNKEKLLANGDRAEAELASNIYADHLTR"
     gene            complement(<34325..>36433)
                     /locus_tag="MRET_4313"
                     /note="MRES_17490"
                     /db_xref="GeneID:38741079"
     mRNA            complement(<34325..>36433)
                     /locus_tag="MRET_4313"
                     /product="anaphase-promoting complex subunit 3"
                     /transcript_id="XM_027630940.1"
                     /db_xref="GeneID:38741079"
     CDS             complement(34325..36433)
                     /locus_tag="MRET_4313"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 3"
                     /protein_id="XP_027486727.1"
                     /db_xref="GeneID:38741079"
                     /translation="MRAAAAARRPAAPRAAGVPSVDDMDRRRVPQLIALAEMYLHVAD
                     DAESGTSTAVSLAPDWASATLYACMALALDPDHVEARRIVALCYLNGGAELLFPFSPS
                     SYGQTRTPDGYQARSPTRACALAAIHLLQRGSRATFLDLGSARVYASASMVLGRYKEA
                     HDALAYTMQQGGAKRKAAPGTSASASLVSPHDMYTSQAYTQLARMAMKQAKYTDAAKY
                     CEAARDLDPYNWSAWTMLCDMALAPPASEAWRLPKREAASRPMRQVTPRAAALRSGMT
                     REAPRTLATRTNTDDARRRTVSKPAAPRSASAPATSPPLLDMTRDVAEAYRCVRRYEG
                     QRALELLCGPVPSVRRRAYRIAGVHCLVGRALHDMTEYTDAEMHFRRARAMEPYLCMH
                     MDIYSLVLFQLHREVALSALAQDLLAMDPRSAMAHIAAGNTWSLQHQHDAAYQCFRQA
                     TLVAPECAYAYTLAGYEALELEQPARAVRLFLCARRCDRRHWNALAGLGQVYLRQGYE
                     LRASEAYAQAFLINRHNAVLLDLLGWTLEQAGDADGALAVYQRAIDMQPKAAMTRLKK
                     AQLLLATVRAADDLRLSPRECTQRRQAAHAELLRVCALVPSEPRVHLMLARSYMRMGG
                     GHFAPSEDSTPPPSPLRLPHAYHAEITHHLATAVDLDPRCVRDVHAMGDMPKLVYQAT
                     GAMIAEDEEQDDVDGYIWEG"
     gene            <36535..>37410
                     /locus_tag="MRET_4314"
                     /note="MRES_17495"
                     /db_xref="GeneID:38741080"
     mRNA            <36535..>37410
                     /locus_tag="MRET_4314"
                     /product="cytosolic Fe-S cluster assembly factor CFD1"
                     /transcript_id="XM_027630941.1"
                     /db_xref="GeneID:38741080"
     CDS             36535..37410
                     /locus_tag="MRET_4314"
                     /codon_start=1
                     /product="cytosolic Fe-S cluster assembly factor CFD1"
                     /protein_id="XP_027486740.1"
                     /db_xref="GeneID:38741080"
                     /translation="MSADAALERRLQRVRRIIVVLSGKGGVGKSSVAAQLALTLSYEA
                     ASSEPDASRLRVGLLDLDLTGPSIPRMLGLDGQAVHQSSDGWVPVYTDDSQCLGVMSV
                     GFLLRSKNDSVVWRGPKKQGMIRQFLSDVRWGDLDYLIIDTPPGTSDEHISLMEAIHP
                     YAPQAVLVTTPQAVALSDNLRSLDFTRKVGLPVIGLIENMSGYVCPHCAECTNVWGRG
                     GGASLAEQQGLAFLGRVPIDPTLVRLLDDARHEAAEHADDEHALTYATVRRYRASATY
                     PLFQRITDAVRQYTH"
     gene            complement(<37407..>38174)
                     /locus_tag="MRET_4315"
                     /note="MRES_17500"
                     /db_xref="GeneID:38741081"
     mRNA            complement(<37407..>38174)
                     /locus_tag="MRET_4315"
                     /product="adenylate kinase"
                     /transcript_id="XM_027630942.1"
                     /db_xref="GeneID:38741081"
     CDS             complement(37407..38174)
                     /locus_tag="MRET_4315"
                     /codon_start=1
                     /product="adenylate kinase"
                     /protein_id="XP_027486737.1"
                     /db_xref="GeneID:38741081"
                     /translation="MSAATTELSYLKSLVHELNEKIAVLEGKAPAARNDGVRMVLVGP
                     PGAGKGTQAPKILERFQNMVCHLATGDLLRQQVALGTDLGKEAKKIMDQGGLVKDEIM
                     IGMIKDQLETNRSCQKGFILDGFPRTTPQAEKLDQMLRERQQKLDHVVELQIPDELLI
                     SRITGRLIHPASGRSYHKLFNPPKKPMTDDVTGEPLVQRSDDNEEALRKRLATYHKQT
                     TAVTDYYKKFGIWSPVDATQSPSAVWHSISAIFNKGA"
     gene            <38263..>40677
                     /locus_tag="MRET_4316"
                     /note="MRES_17505"
                     /db_xref="GeneID:38741082"
     mRNA            <38263..>40677
                     /locus_tag="MRET_4316"
                     /product="DNA repair protein REV1"
                     /transcript_id="XM_027630943.1"
                     /db_xref="GeneID:38741082"
     CDS             38263..40677
                     /locus_tag="MRET_4316"
                     /codon_start=1
                     /product="DNA repair protein REV1"
                     /protein_id="XP_027486789.1"
                     /db_xref="GeneID:38741082"
                     /translation="MATPPSSFPCSQEDVLLEALEDYEKKQEAVYDPVSFGDIGTYLQ
                     NKRAKLQRQAEAVQAESDTLRGCAIYVNGRTDPPYAELRRLILLHGGRFVPYLDAKRD
                     VTHIVTTDLTPQKRREFQARRVVRPAWVVDSCRLRAKQPCAAYALDTHDMITAFYAHS
                     RLHHLSLWKQELQAWVAEQEHDTAPCDDAPRTIVHVDFDSFFVSVSLRDKPAWKEEPV
                     VVCHGTSATSTSDVASCNYVARRFGVRNGMSLQRAQALCPGVRTLPYAFEAYRATSRQ
                     FYEALVHVADAIQVVSVDEALLDMSHALPALLRGDGHPLADRFDAHKHLGDAALGEAV
                     RDLIRSATQCEASVGIGANILQARLATRLAKPSGTHVLDVACLRSMDVQDLWGVGAGL
                     RERCEAWLGTTCIGEILERTTEAQMQQHLGPKLGAALWRKCHGLDTDVLQHARVPSSV
                     GAHVTWGVRLGTPADVAQFVRGVCEEVMRRAAARGMRAAQHVHIQVMERIAGAGEPPK
                     YLGHGPCHHRHRSVRQLVSDAATLTAAVEALLAPLAIPPVDVRGLSVTLSEPVTSPSP
                     AASPRKPRRPIPRSGRALPAYVMSEAPAPAPAPPDVFHVPSSSQVDPAVVADLPPAMQ
                     EHIAHVLSERRAGPRQTRLSAYVSPPKSRPRARSASRAAARRHAAEAAYLHEARIQAA
                     AGQAAPPAPLGAPAGLEPRASLLTCPSRPASVLHAGLPLDTLRARLSQWIEACAEPQQ
                     GDVERVFAVLCACVDARALVKVSGALQWLDALVRGASDAWHAAHLTIRTSVHAYVAQT
                     CQGTLL"
     gene            complement(<40679..>42532)
                     /locus_tag="MRET_4317"
                     /note="MRES_17510"
                     /db_xref="GeneID:38741083"
     mRNA            complement(<40679..>42532)
                     /locus_tag="MRET_4317"
                     /product="mitofilin"
                     /transcript_id="XM_027630944.1"
                     /db_xref="GeneID:38741083"
     CDS             complement(40679..42532)
                     /locus_tag="MRET_4317"
                     /codon_start=1
                     /product="mitofilin"
                     /protein_id="XP_027486788.1"
                     /db_xref="GeneID:38741083"
                     /translation="MLTKRVAAQARASYSTATGASVPRRRAVLPRLVAYAAVGAAVFY
                     GGSVEASRHSEAYRDFFTQNVYGGKELVSYFSQHALSDIPDDLKRIDVDEQVSWAAQQ
                     VRDGFQHLRRYVQSNEHVQHTREEVEKRTAELQQKLQEQLEELRTKAEKESAHLYEQA
                     QSVAGRSLSDAREHLEHLTHGRTEEAEQREPTGAKEPSPADEPTSAPLYAERKLVADG
                     RPTGRLRDDPEAPRLPQLAASLKKQSSSEPVIAQLAGTIDELAAFLRDAPHAGALARG
                     VLTTAQSDLEKLCQRLDDIKASDAQKLDAQLEKQAQGFEAELKKAAEKAASELGQRDA
                     DWSKKVQALQDEQARQFKTHLAKELQVQSEIIDERLRDEVIARGIELQRKWSNEIKAK
                     VEQERAGRLARLDELAKELQGIEGMLFANADTLDDSFQLNSLHAALRTLRSAIDGAGA
                     ADASPYVRRTFANELATLRSKAKNNDVIEAALRAVDETGAASEGVESVPTLHEWFRAR
                     VAPRLTQVALLPEQGAGVLSYVASVVLSPLLLTRQGLVPGSDVSSIVARAEWLLDHRD
                     LDAAARELNQLRGWAKLIASDWLHAARQRLEVDQALHLVEQEASFASLLHT"
     gene            <42693..>43322
                     /locus_tag="MRET_4318"
                     /note="MRES_17515"
                     /db_xref="GeneID:38741084"
     mRNA            <42693..>43322
                     /locus_tag="MRET_4318"
                     /product="3,4-dihydroxy 2-butanone 4-phosphate synthase"
                     /transcript_id="XM_027630945.1"
                     /db_xref="GeneID:38741084"
     CDS             42693..43322
                     /locus_tag="MRET_4318"
                     /codon_start=1
                     /product="3,4-dihydroxy 2-butanone 4-phosphate synthase"
                     /protein_id="XP_027486743.1"
                     /db_xref="GeneID:38741084"
                     /translation="MFDDVADVVRAYRAGEFVIVLDDEDRENEGDLLIAASKVTTEQM
                     AFLVRHTSGFVCIALTPERLNELELPLMVPQNQEKYKTAYTVTVDYRHHTTTGISAHD
                     RALTSRMLADPALGAQRDDFTRPGHMNPLRYTPGGIQVRRGHTETAVDLCIAAGLPPA
                     GLLCELVDPHDPHGGIASRDACIAFAREHGIRVTTIEALRAWQQEPKRV"
     gene            complement(<43338..>45194)
                     /locus_tag="MRET_4319"
                     /note="MRES_17520"
                     /db_xref="GeneID:38741085"
     mRNA            complement(<43338..>45194)
                     /locus_tag="MRET_4319"
                     /product="V-type H+-transporting ATPase subunit A"
                     /transcript_id="XM_027630946.1"
                     /db_xref="GeneID:38741085"
     CDS             complement(43338..45194)
                     /locus_tag="MRET_4319"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit A"
                     /protein_id="XP_027486742.1"
                     /db_xref="GeneID:38741085"
                     /translation="MAGAMSNAKRDVRHIRDDHRESQYGSVFGVSGPVVIAENMIGSS
                     MYELVRVGHDELVGEIIRIENDKATIQVYEETSGVCVGDPVLRSGKPLSVELGPGLME
                     NIYDGIQRPLQGIQQKSQSIYIPRGIDAPALDREKLWEFTPGKLAVGDHISGGDIYGS
                     VHENALVTEHRLMFPPRARGTITYIAEKGTYTVDDVVLETEFQGEKQEHKMMHSWPVR
                     APRPVAEKLVADTPLLTGQRILDSLFPCIQGGTTAIPGAFGCGKTVISQALSKYSNSD
                     IIMYVGCGERGNEMAEVLEEFPELTLVRDGKEQPIMRRTTLVANTSNMPVAAREASIY
                     TGITLSEYFRDQGYNVAMMADSTSRWAEALREISGRLAEMPADSGYPAYLGGRLASFY
                     ERAGKTRALGSPERIGSVSIVGAVSPPGGDFSDPVTTATLGIVGAFWGLDKKLAQRKH
                     FPSVNWNVSYSKYSQMLEPYYETHSPGFAALRTSARELLQKDADLAEIVQLVGKSSMG
                     ENDKVTLEVARIIKDDYLQQNGISEYDCYCPFYKTTGMLRNMILYHEKAQAAINNNPE
                     MTWARIREHTSDVMYRLSQQKFEDPKDGEEAIAAKYEQLASDMTEAFRSLAD"
     gene            <45321..>46730
                     /locus_tag="MRET_4320"
                     /note="MRES_17525"
                     /db_xref="GeneID:38741086"
     mRNA            <45321..>46730
                     /locus_tag="MRET_4320"
                     /product="26S proteasome regulatory subunit T1"
                     /transcript_id="XM_027630947.1"
                     /db_xref="GeneID:38741086"
     CDS             45321..46730
                     /locus_tag="MRET_4320"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit T1"
                     /protein_id="XP_027486818.1"
                     /db_xref="GeneID:38741086"
                     /translation="MAPKKDWEKYEKKGDDADKKEAIVPLDEGDIQLLRTYGQGPYAS
                     ALKRIDQEIKDAEKRVNEKMGVKESHTGLAPPDLWDIAADKQRMSEEQPLQVARCTKI
                     IPAQNSDADTSNNDGGNSAVDNMLGALGGLGQAFNMGNADSKDKYVINVKQIAKFVVG
                     LGERIAPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMQVEDKPDVTYSDIGGVKE
                     QIEKLREVVETPLLEPERFVRLGIDPPKGVLLFGPPGTGKTLCARAVANRTDAAFIRV
                     IGSELVQKYVGEGARMVRELFELARTKKTCIIFFDEVDAIGGMRFDDGAGGDNEVQRT
                     MLELINQLDGFDSRGNIKVLMATNRPDTLDPALLRPGRLDRRVEFGLPDNEGRAHILR
                     IHARSMSVERNIRYDLIARLCPNTTGAELRSVATEAGMFAIRAHRKVATEKDFLQAVE
                     KVVRQGSKFSSTSLYAQYN"
     gene            complement(<46731..>47528)
                     /locus_tag="MRET_4321"
                     /db_xref="GeneID:38741087"
     mRNA            complement(<46731..>47528)
                     /locus_tag="MRET_4321"
                     /product="coiled-coil domain protein 75"
                     /transcript_id="XM_027630948.1"
                     /db_xref="GeneID:38741087"
     CDS             complement(46731..47528)
                     /locus_tag="MRET_4321"
                     /codon_start=1
                     /product="coiled-coil domain protein 75"
                     /protein_id="XP_027486763.1"
                     /db_xref="GeneID:38741087"
                     /translation="MDDDDDDDDDYLSDAILARLEDPRTLTYTERQTKRQVQHVARQA
                     QEMRDAEARRRVKARLAHEGEADARSQGLLTNVLEAPAVGSGTLAAQRMMQAMGYDGS
                     GASPLSPDLRWLDSRRGLGPTDRTPPEAPPSVDAFRQAMMSDATHRHQEHLLRLARNA
                     CRMLDEEHRGETYSPYWLDPTSLPTTHPLYQTRCVTPTDDACDMLTEALESAERHDDA
                     YAFCALPTDERLRRTIRYLRETHQYCVYCAQATLETCPGETESDHDG"
     gene            complement(<47541..>48710)
                     /locus_tag="MRET_4322"
                     /note="MRES_17530"
                     /db_xref="GeneID:38741088"
     mRNA            complement(<47541..>48710)
                     /locus_tag="MRET_4322"
                     /product="acetyl-CoA C-acetyltransferase"
                     /transcript_id="XM_027630949.1"
                     /db_xref="GeneID:38741088"
     CDS             complement(47541..48710)
                     /locus_tag="MRET_4322"
                     /codon_start=1
                     /product="acetyl-CoA C-acetyltransferase"
                     /protein_id="XP_027486711.1"
                     /db_xref="GeneID:38741088"
                     /translation="MADHRDVYIVSAVRTPIGCFQGALKSQTAVDLGVAAAKAAIERA
                     NIQPTDIQEALIGCVLQAQLGQSPARQVALRAGCPPSTDATTVNKVCASGMKCVALGA
                     QSIRLGENEVILAGGMESMSRAPYYLQRGLMFGDASLSDAVLHDGLTDALSQQHMGQC
                     ADQSAEKHGVTRADQDAYAIQSYERAAEAWKTGKFADEIVPITVTEKRAQTVVAEDEE
                     YHKFRPEKMSALRPAFGQNGTVTAANASALSDGASALILASGEAVKRHGLTPLARVVS
                     WADAACEPVDFPTAPALAMPKALARAGLTHDQIALWEINEAFAVAALANAQLLHLDLA
                     RVNTRGGGVSLGHPIGSSGARIVVTLTHALQPGEFGVAGICNGGGGASAVVIQKL"
     gene            <48813..>49258
                     /locus_tag="MRET_4323"
                     /note="MRES_17535"
                     /db_xref="GeneID:38741089"
     mRNA            join(<48813..48921,48948..>49258)
                     /locus_tag="MRET_4323"
                     /product="ubiquitin-conjugating enzyme E2 variant"
                     /transcript_id="XM_027630950.1"
                     /db_xref="GeneID:38741089"
     CDS             join(48813..48921,48948..49258)
                     /locus_tag="MRET_4323"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 variant"
                     /protein_id="XP_027486781.1"
                     /db_xref="GeneID:38741089"
                     /translation="MAQVPRNFRLLEELEKGEKGLGNGSCSYGLANSDDILMTTWNAT
                     ILGPANSVHENRIYCLRLVCGDSYPLVPPEIWFLTRINLPCVDAHTGRVMPDQFSPLL
                     HWRDEYTMESLLAELRRVMAQPANKKLPQPEEGSTYA"
     gene            complement(<49255..>50250)
                     /locus_tag="MRET_4324"
                     /note="MRES_17540"
                     /db_xref="GeneID:38741090"
     mRNA            complement(<49255..>50250)
                     /locus_tag="MRET_4324"
                     /product="exosome complex component RRP4"
                     /transcript_id="XM_027630951.1"
                     /db_xref="GeneID:38741090"
     CDS             complement(49255..50250)
                     /locus_tag="MRET_4324"
                     /codon_start=1
                     /product="exosome complex component RRP4"
                     /protein_id="XP_027486816.1"
                     /db_xref="GeneID:38741090"
                     /translation="MTASPFRIVSAGECSAPVASYTYASGSARVPQSKRVTDDELEDA
                     HENRSAVYVVTGQAISSTTQYIRGHGTYLDTENSDIVSVVCGTAERVSKLLMVRPIRT
                     RYRPEVGDLVVGRITEVQSRRWKVDIGSQTDASLPLSAINLPGGVQRKKLETDELQMR
                     TFFQEGDLVSAEVQTVAVDGSVTIHTRSLRYGKLRNGALVVMPPPLIRRHASHFVSIM
                     PLPDHGIDLILSLNGLVWVSKHVEYDDAMMHGMSGRIAPDKVYSVYSDVNDRLSKATR
                     GSIALVCMVLASMAHYSIPVIQTDLEHACVWARQHLDMSDPVAFAQGIAKLLMDR"
     gene            <50316..>52127
                     /locus_tag="MRET_4325"
                     /note="MRES_17545"
                     /db_xref="GeneID:38741091"
     mRNA            <50316..>52127
                     /locus_tag="MRET_4325"
                     /product="pre-mRNA-splicing factor CWC22"
                     /transcript_id="XM_027630952.1"
                     /db_xref="GeneID:38741091"
     CDS             50316..52127
                     /locus_tag="MRET_4325"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC22"
                     /protein_id="XP_027486762.1"
                     /db_xref="GeneID:38741091"
                     /translation="MADDERTAKRKRSVSPSEPARNAMEKLAETRAGGTYVPPARLRA
                     LMDDAARADPSSATFQRMNWEALRKSITGLVNKVAADNIKHIVLDLFAGANLIRGRGL
                     FCRSIMHAQELSLHFTPVFAALAAIINTKLPFVGELLVHRLVSQFRRSFRRNDKPKCH
                     ATLQFLAHLVNQRVVHELLALEILVLLLEHPTDDSVELAVAFTREVGAFLTEEAPKAS
                     HTVFDRFRAVLYEGSISVRVQYMIEVLAQTRKDQFRDHPRIPEQLDLVEEEDQITHQV
                     GLDDELQLHEGLNVFKVDPDFVANEDMYRRMKAEILGENEEDEEEEEEEEEDDDDEDD
                     PVAIQDRTETNLVNLRRTIYLVIMSSLDYEECVHKLLKLRVPEDQEMELCQMVIECCS
                     QERTYAKFYGHIGERLCKVHRRWSALYEQSFHTYYDTIHRYETNRLRNIARFFGALLA
                     TDSISWACFEVVHMTEDDTTSSSRIFIKILMNEMQSLLGLRALAARFKEPSMQVYFQS
                     MFPMDHPSDTRFSINFFTSIGLGLVTEPMRDYLTVATQRMLERREAEWAAGDRSPSPS
                     GSSYTGSSYTGSSYTGSSYSRSPSPPGPPPVPPPQRS"
     gene            <52128..>53683
                     /locus_tag="MRET_4326"
                     /db_xref="GeneID:38741092"
     mRNA            join(<52128..52399,52424..52574,52601..>53683)
                     /locus_tag="MRET_4326"
                     /product="DNA repair protein RAD7"
                     /transcript_id="XM_027630953.1"
                     /db_xref="GeneID:38741092"
     CDS             join(52128..52399,52424..52574,52601..53683)
                     /locus_tag="MRET_4326"
                     /codon_start=1
                     /product="DNA repair protein RAD7"
                     /protein_id="XP_027486773.1"
                     /db_xref="GeneID:38741092"
                     /translation="MPPRSQVRGPTSALTEFLASQGIRASEINARKRQSEAPAPPPDH
                     VTPSRARIPAGASMQFDEDDDLGDDLGSGDTATCVSCGTRFFITRYTPVTGAGRLCTA
                     CRDPAPRRAPKRVRRSAAIGSVVDVAADEVPTLQSLCINIVAQWIDRIEALGVLSERS
                     RHQLSRVISKNRRLTDRTLPLFLGSGVRDVRLYDCSGLSSTALQMIPRLAPALERLQL
                     DYCGQLDSVAFRALGRLPHLSHLALYGAYLVRKEDWLAFFAEHGAQLTAFCLRETARF
                     DGACVEALVRHAPHIHTLHLAQIGCLDDACVQRLAALPRLVHLDVSQPGVSQLGVPPA
                     SLTDAGVIPLLQRHTHLTSLHVGKNAALSSAAVDAMGPHLTHLVADGLVNVSADAWIR
                     LWQRCPHLAHLSLRGAGITDACVAALAQLPHLTTLTLHSNALTKAGLSALARVPLHTL
                     DVGFVRSVDDELLDTLAASIPTLTKLYVFGCPRVTHFAHPRITVIGRERRA"
     gene            complement(<53680..>54669)
                     /locus_tag="MRET_4327"
                     /note="MRES_17550"
                     /db_xref="GeneID:38741093"
     mRNA            complement(<53680..>54669)
                     /locus_tag="MRET_4327"
                     /product="actin-related protein 10"
                     /transcript_id="XM_027630954.1"
                     /db_xref="GeneID:38741093"
     CDS             complement(53680..54669)
                     /locus_tag="MRET_4327"
                     /codon_start=1
                     /product="actin-related protein 10"
                     /protein_id="XP_027486817.1"
                     /db_xref="GeneID:38741093"
                     /translation="MSVGRRRGSLLGTDERIVMDLGSHTCRAGFSGDVEPRVVMNAAA
                     ACGTESLWRLDWDADREHPDLVRTLTRLVRRVYQEHLLVDAKTYRVLLSRHPLGLDAV
                     QRALCDVLLRTMHVPRVSFIDTHVLATIAAGRTHALVVHVGHLETCVMPVYDARPMPH
                     LLTTTPRGGRRLTHALQNLLAQHNAPALCTPDVVEAIQTQALVTAAADGDHADDWTYT
                     TPAGPVHVPGSLRERVCELFWERGDPDEDSVPDCVRRCAARLPIDLRRPLLDSVLLTG
                     GVCCIPGFVQRCATELERPVLNDTATHWPPNMLIWMGLSLAGHVGADGTDVYT"
     gene            complement(<54694..>55434)
                     /locus_tag="MRET_4328"
                     /db_xref="GeneID:38741094"
     mRNA            complement(join(<54694..54700,54735..54750,54779..54815,
                     54841..>55434))
                     /locus_tag="MRET_4328"
                     /product="pre-mRNA-splicing factor SYF2"
                     /transcript_id="XM_027630955.1"
                     /db_xref="GeneID:38741094"
     CDS             complement(join(54694..54700,54735..54750,54779..54815,
                     54841..55434))
                     /locus_tag="MRET_4328"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SYF2"
                     /protein_id="XP_027486759.1"
                     /db_xref="GeneID:38741094"
                     /translation="MSSSDRRAKFQQLQRRWQDTSKANRRDVLGEQAKQREASQRASR
                     AHAFRLAKAERTLEERDLLERGEDVARHRAKTYTIEENEAWERKLEEKERSRDKGMMD
                     FQDLAERSYQRQLKRLTPDVARYQRDKAASADDAQRDPAAYGTHAPDDDAVDRLVQHL
                     NYEHDQIQRRSRRRDDDLDVEGTYINQRNKRFNRKIQRYFGEHTKEFRENLERGTAL"
     gene            <55491..>56162
                     /locus_tag="MRET_4329"
                     /note="MRES_17555"
                     /db_xref="GeneID:38741095"
     mRNA            <55491..>56162
                     /locus_tag="MRET_4329"
                     /product="regulator of nonsense transcripts 3"
                     /transcript_id="XM_027630956.1"
                     /db_xref="GeneID:38741095"
     CDS             55491..56162
                     /locus_tag="MRET_4329"
                     /codon_start=1
                     /product="regulator of nonsense transcripts 3"
                     /protein_id="XP_027486760.1"
                     /db_xref="GeneID:38741095"
                     /translation="MTDSARKAVVRDLPPTLPAEVFWKAVEPWVRTEPETARTAKHTS
                     YVQGKRAEQPGVWDTPSVAYIEFLTPALLLAFATHFHGHIFRDSKGHDFVAFVDVALI
                     QSCARWAPTTYERYKGAVEHAPEYKAFVASLEAPPAKAMPDKPADKADAPVTTPLVEY
                     MRQKQQPSEAPAKNRQEPPKTPKPTKAPKPKKDKAAKAPPKSAPAPRITILTKPPPPP
                     PSSHA"
     gene            <56227..>57438
                     /locus_tag="MRET_4330"
                     /note="MRES_17560"
                     /db_xref="GeneID:38741096"
     mRNA            <56227..>57438
                     /locus_tag="MRET_4330"
                     /product="ubiquitin-protein ligase involved in
                     ER-associated protein degradation"
                     /transcript_id="XM_027630957.1"
                     /db_xref="GeneID:38741096"
     CDS             56227..57438
                     /locus_tag="MRET_4330"
                     /codon_start=1
                     /product="ubiquitin-protein ligase involved in
                     ER-associated protein degradation"
                     /protein_id="XP_027486716.1"
                     /db_xref="GeneID:38741096"
                     /translation="MPETEADCIDAQQVEAWLFSDAKACRDTRSCRICFDTELPDGDR
                     WLCPCQCKGTMKYVHASCLDEWRRRSRRPQSIMACDQCGATYRVRATRASRLLTSWWL
                     RLLVSFLLLGVMAQVLGVAVHLSLHRFAPGMFAGPHPLHLQSVAYRPEAQASAWSRAW
                     VSRARSVWQLWGSSEDEDVSGDGFARLGVFHPAMVLQIVQGMIQRMLESLGRPFSLAS
                     LLRHRRGVPSLVQRVVTYRQGLGAAPPTPVVPLTWTEWLWWQTTLGLATMGLSVHFHS
                     FSILSSNGVFRFGSPFWAVAVYPHAPHGSEGTVVWESRSSAGVVLLALILWGIRSTWL
                     MVWNTLTRLSEWYLTHTGPCIVNYDEGEALRPAPRHTTHWLIDRVVRGHEAMRHVEDA
                     RWVWMLAQAGD"
     gene            complement(<57453..>58616)
                     /locus_tag="MRET_4331"
                     /note="MRES_17565"
                     /db_xref="GeneID:38741097"
     mRNA            complement(<57453..>58616)
                     /locus_tag="MRET_4331"
                     /product="proline-rich receptor-like protein kinase"
                     /transcript_id="XM_027630958.1"
                     /db_xref="GeneID:38741097"
     CDS             complement(57453..58616)
                     /locus_tag="MRET_4331"
                     /codon_start=1
                     /product="proline-rich receptor-like protein kinase"
                     /protein_id="XP_027486715.1"
                     /db_xref="GeneID:38741097"
                     /translation="MRTRQESQRLSGVDASAMQLDEILSHFEQYRRKHAAQNRDIVQA
                     NALAHARIRELEARVLQLESECAEHKLAAGRQSAHVRCLEYTLECVRVGWETMAHALR
                     DCGVPTPQRTRERAASALPTPPTVRTRQIVLQDDRPTTRLPAAYATPLASEWIQEEAS
                     SSPTPVDSPRVASPLCGDACPPSVSRRRPSRRAPSREPEIEPPSALEPASPHLESPRP
                     ASPPPAPEQERAQAKTASPPAPPNDMPACTPTTPVRPRSPVADVDVPDRTRRTRKSIN
                     YALPKLNTKMRKPDPDDEAAADTKRPRTSRKSVATPSPPRRPRRSRDTSRRATPQVSK
                     HRDTPAASPFQPRTNTTPFVPSRPSSTMPSWASSLLHLPSPEPPRHAKENALP"
     gene            <58725..>59765
                     /locus_tag="MRET_4332"
                     /note="MRES_17570"
                     /db_xref="GeneID:38741098"
     mRNA            <58725..>59765
                     /locus_tag="MRET_4332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630959.1"
                     /db_xref="GeneID:38741098"
     CDS             58725..59765
                     /locus_tag="MRET_4332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486713.1"
                     /db_xref="GeneID:38741098"
                     /translation="MTGRVVGRNHYDDADLAHIRSLIQLEAKPLNVSRIARALANEYP
                     KHTYWSYLSFLQKNLRDRPDLFEAPPPDVLDDSEEEELDEEALSAFDAQYGAAPESTP
                     SVPSLRPEHVCMLVDALVELLHSSHFEASDDAVHALESSDVPLSVWQELASKVPTRPE
                     HMWQAYYERFRGMLWERALEQYVPQAPADVTPSPSPSSVHTPESTTHTPQSVRVGQRS
                     GHHDAKVLARGGVHPEEPSPTVERHPASPPSRAERHRARALYEARVWELCADYGFASP
                     RQLVPFMLRASGDVDACREYVRQYIEGLSHKYTLDVPTLIEMLEAQRGDAKLLTRILD
                     IQLRARRAAAHE"
     gene            complement(<59733..>62012)
                     /locus_tag="MRET_4333"
                     /note="MRES_17575"
                     /db_xref="GeneID:38741099"
     mRNA            complement(<59733..>62012)
                     /locus_tag="MRET_4333"
                     /product="lipase esterase family protein"
                     /transcript_id="XM_027630960.1"
                     /db_xref="GeneID:38741099"
     CDS             complement(59733..62012)
                     /locus_tag="MRET_4333"
                     /codon_start=1
                     /product="lipase esterase family protein"
                     /protein_id="XP_027486753.1"
                     /db_xref="GeneID:38741099"
                     /translation="MTISTLGILVHVTPTLVGNACRHYVRFLLGCGWCAPRESANEFL
                     YDQLFHLISKLTIYLTHHTAEDVQKLTDQLVPVPPWCYDQQVMIPLECCHKSAALLQT
                     YFGPEMMQSFIGGPRWWQMRSQAGIPADWIAHYSDYHSAMAKRGRKGGYHTSMLHRLT
                     RHTARVNPRHEHPTEPDPHLVREAGRFADTTEESERLSRIVLYIHGGAYYFGSVNTHK
                     YMIHRLTTKFGGFALAVNYRKAPQFPFPCAIQDCLAAYLYLIDPPSGAPHPPIDPSRI
                     VVAGDSAGGGLALALLQLIRDLDLPRPAGGLLLSPWSDLTHSFPSILQNTKTDYIPPY
                     SFLHRPSVLWPLPRDAGAFVRTTGLLRRFRGKKAGLSVEASGPWHARPLYMTQADGTA
                     APIKSQIQLYATNAQLRHPLCSPALAGSLGGLPPLFVLAGDDEVLRDEIVYLAHKAAN
                     PAAYPTNPALLREFPQTRRAAERYTTPTDVHLQVFDGQCHVFPMFMYTLSARYAFRAM
                     ASFIKRVTGAPCQASSPVTQSWGSAPPGKNKYAAHVPLERPHFRDHMIRERIARDGDV
                     RPMESVEQIPCLNLPLSSIGLIYPATYARFRKGHTIWDNKYHRDIKRIKKKRARMERR
                     ITRILSKAQTEGLLENHGDIDTHGTRWTDLGTYGPADLRDETPPPSAIVARRDTPDAL
                     ALLKLGLHLRAKRRHAQSPHDRPPGGGGQQRRSLADEAPRRAYSMGEHVHTDDERPVP
                     LDQFGWWRSLLVRGRPSRS"
     gene            <62131..>63087
                     /locus_tag="MRET_4334"
                     /note="MRES_17580"
                     /db_xref="GeneID:38741100"
     mRNA            <62131..>63087
                     /locus_tag="MRET_4334"
                     /product="cytochrome-b5 reductase"
                     /transcript_id="XM_027630961.1"
                     /db_xref="GeneID:38741100"
     CDS             62131..63087
                     /locus_tag="MRET_4334"
                     /codon_start=1
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_027486729.1"
                     /db_xref="GeneID:38741100"
                     /translation="MLLSLVTAVATFLLCAWIARILTRPIAHMHWLLQDMHDAFAFTD
                     PHVIVAFVVGLACSAALLYRFGAFQTPPALHQNEWRAFKLMERTRVSHSSSVYRFAIP
                     HQLGLPIGQHVSIRASIDGKPMVRSYTPISDHTETGHVDFLVKTYEKGNVSRAFDRLQ
                     LGESLDMRGPKGRFTYARNMAQQIGMIAGGTGITPCLQILRAALRDPKDKTQFSLLYA
                     NVSEDEILLRDELTSLQDTYPHRFSVHYFLNTPPPTGWTGGVGFITREAIAQHLPPAS
                     ADSRILMCGPPPMMEAMKKHLSALQFPVSAGVYKDTDQVFVF"
     gene            complement(<63089..>64252)
                     /locus_tag="MRET_4335"
                     /note="MRES_17585"
                     /db_xref="GeneID:38741101"
     mRNA            complement(<63089..>64252)
                     /locus_tag="MRET_4335"
                     /product="saccharopine dehydrogenase (NAD+, L-lysine
                     forming)"
                     /transcript_id="XM_027630962.1"
                     /db_xref="GeneID:38741101"
     CDS             complement(63089..64252)
                     /locus_tag="MRET_4335"
                     /codon_start=1
                     /product="saccharopine dehydrogenase (NAD+, L-lysine
                     forming)"
                     /protein_id="XP_027486754.1"
                     /db_xref="GeneID:38741101"
                     /translation="MAPVQSLWLRCETKPAEHRSALTPTTAKKLIDAGFDITVERDPQ
                     RIFDDNEFEAVGCHMVNYHSWVLAPRTMPILGLKELDAPGPDLKHTHIQFAHCYKHQE
                     GWVDVLGRFKRGGGKLYDLEFLEDENGRRVAAFGWHAGFAGAALGLLSLAEQLQGRRL
                     GPQAAYPNEDELLKRTRAAVEVIREHRQDKRVTALVIGALGRCGRGAIDCLVKSGVQL
                     DDVARWDLQETSAKSGPYQEIVDSDLFINCIYLSKKIPPFVDAALLQQAGSNRRLGTI
                     VDVSCDTTNPHNPIPIYSVNTTFERPTVGVPGVDGLEVISIDHLPTLLPRESSEAFSH
                     DLLPSLLQLPYIQNDEHALDALQKEHAEGQGAVWARAEKLFQHHMADAVAHGA"
     gene            complement(<64319..>64837)
                     /locus_tag="MRET_4336"
                     /note="MRES_17590"
                     /db_xref="GeneID:38741102"
     mRNA            complement(<64319..>64837)
                     /locus_tag="MRET_4336"
                     /product="Ran-interacting Mog1 protein"
                     /transcript_id="XM_027630963.1"
                     /db_xref="GeneID:38741102"
     CDS             complement(64319..64837)
                     /locus_tag="MRET_4336"
                     /codon_start=1
                     /product="Ran-interacting Mog1 protein"
                     /protein_id="XP_027486776.1"
                     /db_xref="GeneID:38741102"
                     /translation="MPLYPLFGGAITVSLDGDYLDASDMRQVPDNQEVLLSRTTNLSV
                     IVEVLQCVAAHTSADGMRQGVHDHFDSLAHDNSAQQTKVERVDAVECASRAAGATPTP
                     SLLHGTQVIPKFGKVQDLDTVHVYVALWRLPSKNVDLVLSVNDPEPSCTGWDAVHRAA
                     QSLRIVDWGLFP"
     gene            <64861..>65559
                     /locus_tag="MRET_4337"
                     /note="MRES_17595"
                     /db_xref="GeneID:38741103"
     mRNA            <64861..>65559
                     /locus_tag="MRET_4337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630964.1"
                     /db_xref="GeneID:38741103"
     CDS             64861..65559
                     /locus_tag="MRET_4337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486717.1"
                     /db_xref="GeneID:38741103"
                     /translation="MATATQERLWRYATLAQSASAATVGSVLIVHLAAPVVAALVPGP
                     SGVDLANQTMLLGREYYQQALLEPIVVWGAMGVHLGASAVRRWLRPPKRTSWHALAGL
                     ALMPVVAWHVCLNRLVPMTSRAPIAHLSPSELDMAHVGAGLQTFPIVTWCFYTWLCVA
                     GAVHMVGGLPKLRRRCARTRSAMQAGLALAGVLLLGTWAIGRYATHGVARGTLDRIVY
                     CYRQVWPYAWLHRA"
     gene            complement(<65545..>66963)
                     /locus_tag="MRET_4338"
                     /note="MRES_17600"
                     /db_xref="GeneID:38741104"
     mRNA            complement(<65545..>66963)
                     /locus_tag="MRET_4338"
                     /product="pre-rRNA-processing protein IPI3"
                     /transcript_id="XM_027630965.1"
                     /db_xref="GeneID:38741104"
     CDS             complement(65545..66963)
                     /locus_tag="MRET_4338"
                     /codon_start=1
                     /product="pre-rRNA-processing protein IPI3"
                     /protein_id="XP_027486785.1"
                     /db_xref="GeneID:38741104"
                     /translation="MRHVRQLYPPEVVVMASAASAAQRGGVFAIDPSSATAAHAPLLH
                     WKGVAQPARHGVSCTASSTHAAHDGGTGGTVCAIEADKAVLVLYSWQRDQPIARIVLP
                     QKMTCASLSPQGTWVATGTADGRLFVWDVASGALLTSFEAHYRAMTTIAWTSDSAAIV
                     TASQDTRVCVWSWPSLMQHTDLTGSSSPVAPYATWSDHTLDLTAVHVTPGAFPHHVRV
                     WTASRDHTVKVWDAGTHMLVSTYAFDAPITSIAVDPLERYALVADERRVMRLDLYVDG
                     TFRGGRASAGVSVRVQDAPHVEVGAGVTTMAISVHGTHAAIGTWHGTVPLVDVTTLQT
                     IRTLAPHASSRDPAPTPVTYLRILPRPTDLATHTQLRAKKSATDSVYLDALPMPCVAP
                     QFERTIQVPSHAWMRLGHVALDEAPSDAGEMLPAEPVSLTAPSVPASDERLHTLEAQV
                     QRAKALNDEMWQRLVEMHSRTV"
     gene            <67077..>68964
                     /locus_tag="MRET_4339"
                     /note="MRES_17605"
                     /db_xref="GeneID:38741105"
     mRNA            join(<67077..68875,68913..>68964)
                     /locus_tag="MRET_4339"
                     /product="asparagine synthase (glutamine-hydrolysing)"
                     /transcript_id="XM_027630966.1"
                     /db_xref="GeneID:38741105"
     CDS             join(67077..68875,68913..68964)
                     /locus_tag="MRET_4339"
                     /codon_start=1
                     /product="asparagine synthase (glutamine-hydrolysing)"
                     /protein_id="XP_027486783.1"
                     /db_xref="GeneID:38741105"
                     /translation="MCGILGCIHHPDAQAYRSKMLTMSRLIRHRGPDWSGCVVINEGD
                     EQKPARGSVLCHERLAIVGVDSGSQPLVSDDGKLFLAVNGEIYNHRQLRASLSEKIEF
                     KTDSDCEVILYLYREHGLDFVNMLDGMFAFILLDTRVHPHRVIAARDPIGITTLYYGR
                     TFEYPGALYFTSELKAIAKECERLYTFPPGHYYDSQREKGDELVRYFQPSWFGTDETE
                     PPSAPADLALIRTTLEQAVRKRLMSEVAYGVLLSGGLDSSLIAAIAARETAKQAKAQQ
                     SALDAAHHATRPAEAEPQHKMRKLDDDSRPLVAWPRLHSFSIGLPGSPDLLAARQAAE
                     FLGTFHHEYTFTVQEGLDALADVVYHLETYDVTTVRASTPMYLLSRKIKATGVKMVLS
                     GEGSDEVFGGYLYFHAAPSKEAFHQESVKRVKNLHTADCLRANKSTMAWGLEARVPFL
                     DKAFLDVCMNLDPAQKQFSKGSLQQRDADGRPYMEKYILRKAFDVHPDDIEAGHAVKD
                     SLPYLPESILWRQKEQFSDGVGYSWIDGMKEHAERVVSDDKFAERESRYPVDTPDTKE
                     AYMIRELFESSFPSDAAARTAVRWVPRGDWGCASDPSGRSVAIHDAAYDA"
     gene            complement(<68952..>69461)
                     /locus_tag="MRET_4340"
                     /note="MRES_17610"
                     /db_xref="GeneID:38741106"
     mRNA            complement(join(<68952..69310,69337..69427,69459..>69461))
                     /locus_tag="MRET_4340"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /transcript_id="XM_027630967.1"
                     /db_xref="GeneID:38741106"
     CDS             complement(join(68952..69310,69337..69427,69459..69461))
                     /locus_tag="MRET_4340"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /protein_id="XP_027486719.1"
                     /db_xref="GeneID:38741106"
                     /translation="MSFPRLLAQIAFTGSRILGRAFMEAGRQAVRNVRAGQVEGAAAA
                     ASARGGASAPSNSLTVTHRMALDEARMILNMQGDVTLPPRGQGIPDEVKRELVERYER
                     LFVINAPPAPKGKQGGGQGSFYIQSKIVRARERIEAEWALQAPPPQAS"
     gene            <69567..>70229
                     /locus_tag="MRET_4341"
                     /db_xref="GeneID:38741107"
     mRNA            <69567..>70229
                     /locus_tag="MRET_4341"
                     /product="OmpA-like domain protein"
                     /transcript_id="XM_027630968.1"
                     /db_xref="GeneID:38741107"
     CDS             69567..70229
                     /locus_tag="MRET_4341"
                     /codon_start=1
                     /product="OmpA-like domain protein"
                     /protein_id="XP_027486791.1"
                     /db_xref="GeneID:38741107"
                     /translation="MHDFDSGSELSSPGASPKGAPAEPAADAPPVAPQAPAPESAPTQ
                     ESAPPPPPKKPRTRPPPEARFAHDMSGWDQLFGPMTQPTPTRAKDATPEQRAAAVEAE
                     SARVRESRAHEAEKAREEKAREATERAKEQERHVAAAIRKPRVRPDVPPTERRPQSVT
                     LDVLAEKRRQLRDDMHVATSMDMLSHIRSMHSFEDAMAQDRRALRASKFGAGLQHLRM
                     GS"
     gene            complement(<70212..>71825)
                     /locus_tag="MRET_4342"
                     /note="MRES_17620"
                     /db_xref="GeneID:38741108"
     mRNA            complement(<70212..>71825)
                     /locus_tag="MRET_4342"
                     /product="spinocerebellar ataxia type 10 protein domain
                     protein"
                     /transcript_id="XM_027630969.1"
                     /db_xref="GeneID:38741108"
     CDS             complement(70212..71825)
                     /locus_tag="MRET_4342"
                     /codon_start=1
                     /product="spinocerebellar ataxia type 10 protein domain
                     protein"
                     /protein_id="XP_027486761.1"
                     /db_xref="GeneID:38741108"
                     /translation="MLSHRTSHARAVVDRTTCEKTACDVSTQWRTDWPSPPGSFVMDD
                     VYRAWATWEKERTQEAQQVLLERAAVACAQFRACPTEHDAPAVWAWAMRVVRAWLDYE
                     GRIDPRKEDVREARAQHADVVRATLGILRNASLSDDYACQALAHTDTLAQLCAMCVAY
                     ERMSEPALLVMIRVLTQLLVNLVTRHEAVRDTLWTLLAVPPNEAGVAGETILRLLSSA
                     DDRTSLAAHVFLLNSAAPHTCHSLVHTAHGRRVLQVVLASYDAALVHEASDTLHVILA
                     LSSRLCAHGHWGPLLQALGPTEDMNASQLALVRTLIDNMHMNEEGVLASMIACLEPLA
                     RMVTDLSRATTQCLATIQADPAQVPRLVRAHVGLLALLEAVHVMALHAQETPSNESTR
                     ILADMRSSDMIHACIELLREARAFVPPRPPFQPAAPAVQADAHERPSQLHTPQPDDDR
                     PGLPYLKRTALQVLGTLAFHAKGTSWDDVHAFQDRVREAGGLIEVLSLTQLDELNPYI
                     REHAIFALRNLLDRNPTSQDHVAQLRPHT"
     gene            <71865..>73367
                     /locus_tag="MRET_4343"
                     /note="MRES_17625"
                     /db_xref="GeneID:38741109"
     mRNA            <71865..>73367
                     /locus_tag="MRET_4343"
                     /product="protein SIP5"
                     /transcript_id="XM_027630970.1"
                     /db_xref="GeneID:38741109"
     CDS             71865..73367
                     /locus_tag="MRET_4343"
                     /codon_start=1
                     /product="protein SIP5"
                     /protein_id="XP_027486723.1"
                     /db_xref="GeneID:38741109"
                     /translation="MGAGLVQSRPRSRSLQSSHTHTSGSSAATSASTRENAGGSERRI
                     SSKTRVDGGFVVRQGLYKDKTDYADMQVRQWIVERRLSPFFAGADDEEELEGAQVRSE
                     CPICFLFYPMHLNQTRCCTQPICTECFVQIQRVDPSTRVPPSSQPAACPFCVEPNFGV
                     VYARDAPSVDAQAAIEHAAKAIGTGGNTTDTKRASFPADHEAVVLVDHVHPHWHDKLD
                     RAVRNAARQANRRVILREEGGSLVPVGVSSSRTGDALATFVAQHRHIGRPGPGGSIIL
                     HSHVMHTELQRYAHSSLARRDPNRPQVGDQMARTLAALSPEELEELMLRETLRISQLE
                     HQGTAPPEPSQEEPRPERASRRRSLLPTKLAQASPFRFKRRNSASSSSQPRASFDRAP
                     GDPAATAAAAPSTPRGSPERPIRSSPLRLSHTCRASLDTPRSSPWAERAIQQGVSRAS
                     MSSVPDSRRHSLQLSPALRDLEGLALVPDGPAAPRSSTNPFRTVPPSLRR"
     gene            <73511..>74146
                     /locus_tag="MRET_4344"
                     /db_xref="GeneID:38741110"
     mRNA            join(<73511..73558,73594..74100,74126..>74146)
                     /locus_tag="MRET_4344"
                     /product="cell division control protein 42"
                     /transcript_id="XM_027630971.1"
                     /db_xref="GeneID:38741110"
     CDS             join(73511..73558,73594..74100,74126..74146)
                     /locus_tag="MRET_4344"
                     /codon_start=1
                     /product="cell division control protein 42"
                     /protein_id="XP_027486722.1"
                     /db_xref="GeneID:38741110"
                     /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV
                     MIGEDPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPSSYENVREKWLPEVR
                     HHCPGVPCLIVGTQVDLRDDPAVVERLARQKQRPISTEMGERLTRELGAIKYVECSAL
                     TQKGLKNVFDEAIVAALEPPVVRKKAKCAIL"
     gene            <74294..>75173
                     /locus_tag="MRET_4345"
                     /db_xref="GeneID:38741111"
     mRNA            join(<74294..74382,74414..>75173)
                     /locus_tag="MRET_4345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630972.1"
                     /db_xref="GeneID:38741111"
     CDS             join(74294..74382,74414..75173)
                     /locus_tag="MRET_4345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486724.1"
                     /db_xref="GeneID:38741111"
                     /translation="MTGLTARQQSRLVMYLDDALLRMARAFQKRHEPDAPLHTLRAFL
                     DAWSPHVRVVTSTPQDTAATAALRDTYLMRIMSDMSEGVVGYACSADDALDTDTQLMY
                     VLYWMDVLDHLWAARLSERHVALDEVQKCAASVFPTPEDAPRVHPVVQEVVMDDRVLG
                     TPVDMPRYSPTDCVRLRDEMTRAREQLFGWMRDQLRLPRPPTIEEEPASLSSSDDDDD
                     EAPAREAEEAPASESEHYARLFDKRLDPDAEPPAKRTRVEDHAFWDTHYASLFARSLR
                     TLRPTP"
     gene            <75436..>78507
                     /locus_tag="MRET_4346"
                     /note="MRES_17635"
                     /db_xref="GeneID:38741112"
     mRNA            <75436..>78507
                     /locus_tag="MRET_4346"
                     /product="centromeric DNA binding protein"
                     /transcript_id="XM_027630973.1"
                     /db_xref="GeneID:38741112"
     CDS             75436..78507
                     /locus_tag="MRET_4346"
                     /codon_start=1
                     /product="centromeric DNA binding protein"
                     /protein_id="XP_027486804.1"
                     /db_xref="GeneID:38741112"
                     /translation="MCFAGHDDDAARRCLFARDVVPLGLAGDSRALPDRQGMQAAVAA
                     EDAAVGRHKVAWLTDDVLIEEAGKGVRATASFADEAQAHALVLVAGRQLEGARDAAYV
                     GFAELAEGEEAACEARRWDGRQEERLVLRGVDGALHDGEGRRALVARAYPSIVARGEP
                     GRLDGVEQRAKLDRAIARHVRIRRRAVRPLLERRLKHVDPVVAREIDHVDVHAEVPCD
                     GLDVVPLFLPRTSHDAATAALHTSHLVGRRPVAHVHASHVVVALCEQGRYDGRVDAAR
                     HGHGDAVAAPWRRPGPQRWPPKQHVAKRQRGAVVSRDNNTARRASCRRGAWDVDDDMQ
                     AAPARRFHEAGLGSRTGLRIGSVRLDEQGQEDLDAFFAESKRVLEWMEGSEDDTEAPS
                     EAGSDAWHRAAPQMAAESLEARPSLAPRADESLWNSTVDISRAERTFRLASSSPVPMD
                     PALPSTSTPVVVPRGSLSQVSMSRGSESRASPMDVSLPATDASWARPAASRLPETDVS
                     FLRPEASRLPETDVSFLRPEASRLPETDVSFLRPEASRLSVSEASFGRTEASRLSLSE
                     ASFLRPEASRLSLSEASFVRPEASRLSTSEASFVRPDASRLPETDVSFLRPEASRLST
                     SEASFLRPEASRLSGSEASELAPPTWDDAPASDPPSEPMEALDAIDEDEPAPVPIKRG
                     RGRPRKDASMPPLRGRPGRPPGRQKPAQRIVERILDPPAWQLENPEGLRRGKRHRIAP
                     LDWWRGERALYGKPDEPTGDALTGVVAPVLKQVIRVPRAPGEGTFSGMRRFRAKPAGY
                     AQPGRPPGSRNYVPRLSPVEEDEDDEAEAAAAWEADTDPYGRVMDADTNTEVTMRIAC
                     TAAGIRPRPAFNQAFSYEKIFGISDFMAAGVLVIPEGGEKPAKPSKDNNYTFVVLRGV
                     VQVMVHRTRFVIAAGGMFLVPKGNTYHIRNVAQREVRLFFAQARLLTDAPHMTHVVRE
                     GRTAFAHGPERVRVEEEGDDDEEDDDDEAASEAASEAASEADASGDYIDPT"
     gene            complement(<78557..>85588)
                     /locus_tag="MRET_4347"
                     /note="MRES_17640"
                     /db_xref="GeneID:38741113"
     mRNA            complement(<78557..>85588)
                     /locus_tag="MRET_4347"
                     /product="hypothetical protein"
                     /transcript_id="XM_027630974.1"
                     /db_xref="GeneID:38741113"
     CDS             complement(78557..85588)
                     /locus_tag="MRET_4347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027486721.1"
                     /db_xref="GeneID:38741113"
                     /translation="MQAETTRGQGGGWLLLVLALPLCVVVLERVVLPLVVRWVCRGRA
                     TVRSASLVRGVQDLVWGDVIRVPSAYVRCQARMPCLVLHVRGLRVAYQPRDATATAPA
                     VRRVSRRALVALSFLANLVAIDAQDTHVALPGATAFTSHRIYVHASVLLRYLAPQPTH
                     AAACDGFDDAPAVPPRRALRLHVPEARARLCVDVDDARLLQQDDTLLTLPHRTTLSVQ
                     ARLRHTIQPASLSIRVHIADAHLTAWPTIARSERAAAPRAPPAVLTYLASASLSVSRA
                     TATLPVRGADPVCTTLTHFHASLDPSRPTHGVHQAWFGACGVQRRRDAIVLHEARRVF
                     ALHLRVASWHAQIGPMHAHIAHVSCWARTSCTPYGVLTSEPRWSDPNEAALVLRASVG
                     HVRVQPHWAYLARLVPLLRTSSSSPPPSPPPPRVAALVQLGALDVHAPDGLRIHIART
                     HLSVRGAYVERRGACPMQYTLEASAGCGVVDAYVLSAQVRHDLLHIAAPTATYTLCVP
                     VGLHRETFAPQPHWPERDADVALAVHRIDVHMWSEPVVRTTEALIGAIASHKPPREPN
                     EAPHAGPRHVHVHVGGTAVYVGGADAHFEPHVRRGVGLVLGATVVDYARAAPAPLDAR
                     VQDARQALGLPRPIEHVAHAAGGAAVRVLVSDVRLCPIVHIAAAHDAPVEPDAHDQQG
                     VYAADVWDFAAPTVPMPRQTPRLHQLERGTEVAYAPHVQIDAQRRGGAPYDAHVHVTR
                     TSQARIRLLHTYCLLVAAATARRLVRERRAPRSRTAERVHWTLAAPLVHVHIDLPHER
                     RVLVRVTQLAVRPTERVSLDALRACVPGNDGGGAWDEAVIARRLLLTHRGRAAWWLTG
                     DCVHVRVPYGYHTHKLIEASIVAFKATKQLFFQFWRGCTHSVIYPHDEAPKRLPAVTV
                     RLGMLVLEAADHSLDAALNLLFRTGMDEQLMRLQRTSAAQDAAHWIRRWRRARDVRAQ
                     REHDLRSYIHKRAFRDADDVRAWPLEPPLIRVSLTMLRLQVSQPTSFALDDVHAWLHE
                     QAGNPVDLPYTTLIPMHVRLRVSEGMVRLRDYPLPLLHVPPRDDLDVCFDAEGDVVIA
                     EQLGDAFSVRHVRTTIVPAVDSRHGAEHGLLVPKSAMTPKVYGPLVVRVSSQRPTVLT
                     WGHALQPALQDVLRVFDAITSPPHDPSPKPGPWDKLPFQLQASVRLHFEHDVHLHLRG
                     TRQPYAVTGAGAGFVLVWRGGVELRLGRDLTDHEFLQVRSREHLLAIPDVRPLLDPAG
                     VGLASAARSPHAVLRRPDAPPPLALDKVAWHLAGGVRWGMGFVSEHTCTDATCERTPP
                     CRGAPFDRACRVFGRIPHWRVRLRTFEGFARLPPAERTDSYRGWRSDFAHLSLSLQAT
                     GAERPPGAPRNGLYLSWRAWDHFRDWLHLFHDRLHLPIRHGPVFPKPPGVKAPKFGRF
                     VATIKYRFHVTDLHVAHTYAHRAAFDLRRQLRTFVGVKAHVGTCALDLHQRMQASPAS
                     PARRKPLYEAEADVRDAELFALCARFREAGAPRDVHLDADDALRDVWADADDDAAHMY
                     DPLDYRDAATPAAADDAPRRHIRRVLTLARFHVHRLLRPTRGAYSKFGHEPTHTCLIG
                     HAAPPRLGAEGDAYPHQVRIDRPTGVLTHATRAILLAYYESTLLHRSLAQRLSVSAQR
                     QLRALLERARQHDARSSASTSGAADVSLDDVLADTLRLASQSLPAAFVHDFGAEHSAT
                     HAPSDAISDAFHLRTKMLCVCAQPALVVRTHAHSAIIVHADELRVRTHVVSDPLFDER
                     SIHCHVLHRHFVSLASLQLFHTARDAPLDRAGRLPPEALSGGAGYARLVDRTHAYVLY
                     DKHNRLRLPDRTRSVVAHARRDDPAVQYLHHRTDLVQCMSPPLTLTATGAQFAALSHV
                     YHLLTPSDAQHQQRERRRDALLYSRAWDDAPYVVRLFATYQRHIHDTLHRLAAYEAER
                     LTDAGRAEYVRLALALLDLHADMGALEEAVYLSHASARDRSQHLALLVRARADAIEWH
                     LVDAQDRLHVRLTLRGTSFARLALVSGTSMHCLAIHDLHARNVHPSAYFPDMLTPHTP
                     PAGHPMIGQRFLLAHWLLLPPSGGIAIMDRCELHLHPVRVQLELRVGRLLTEYLLGAR
                     RSPPRDEARRPWLRHLVAMSRKARSSHDSESDGLSESASDDSDNDSDNDDDAAATPLR
                     LAPSADDAAHIDALRAAMLHRARTYMSFVHVVFAAVDICLSYKGDGEYALTNLYDLPL
                     QLPRLAYHHVLGTHHDLLDLVRRDLIRIAWHHRHTLLKGVMSTNARKHAALKSRQADR
                     LSAAGADDTDEAGAERARPAPSSHDEPVRPRRWFSRS"
     gene            complement(<85646..>87601)
                     /locus_tag="MRET_4348"
                     /note="MRES_17655"
                     /db_xref="GeneID:38741114"
     mRNA            complement(<85646..>87601)
                     /locus_tag="MRET_4348"
                     /product="integrin alpha FG-GAP repeat containing protein
                     1"
                     /transcript_id="XM_027630975.1"
                     /db_xref="GeneID:38741114"
     CDS             complement(85646..87601)
                     /locus_tag="MRET_4348"
                     /codon_start=1
                     /product="integrin alpha FG-GAP repeat containing protein
                     1"
                     /protein_id="XP_027486712.1"
                     /db_xref="GeneID:38741114"
                     /translation="MRVELPPLLLLLLLLVVAPSAHAWRLWPAKRFAEEGLVRAGALG
                     LDDVRGQVAAWSYFSSTRFLDAWIVDAQRQSVSVHAWDHTHFRFNATPVTRVSVPDGL
                     HIVDAMVADYTHDGHADLLVMAEGPASTTLSLYLWAAVVAHDGTTTLAPPITLPASTR
                     AHPLTIDATGALAADLLGHVASDPTTLTLWHAAQGTLVTEPLAMHGDGTPPCQLAHPH
                     SSAHVDMNGDCLADLFLVCDAGRGRLSYQVWTARRDAPRTYDLARVGDLPPGTGALSF
                     ADMNRDGTIDVVFPACERDRCYIHIAYNEQMPLCAPERRGVWGARNASAERCRDAAQL
                     CAPDDAFVLRDGADLVRIPIDALTSDRRLLLVDDIGASQPVPVRVGDYNLDGYPDLAV
                     LTVPRGAAPGETRLHLLESRPCGGASGAAAGCAPSGPEHRTFARVRRSVLDREAYVRS
                     VAFIDLDEDGTLDLMLQSLPPATTRASAARVVSFVRNNDFHDAFFLKALSQRRADGSA
                     LLGASYKFAVLDPNGVRRAQQVAQQAQTVYGALPTPYAFFGLGRTNNYVESLFVGSTL
                     RRAPAPLVLEGVVPNSEVRVYPNGADTWRRELFLHPADWIPYVTLALGTLLALLAAII
                     YMLDRHEKHEDERERRRAVHAINFDAL"
     gene            <87733..>90267
                     /locus_tag="MRET_4349"
                     /note="MRES_17660"
                     /db_xref="GeneID:38741115"
     mRNA            <87733..>90267
                     /locus_tag="MRET_4349"
                     /product="V-type H+-transporting ATPase subunit a"
                     /transcript_id="XM_027630976.1"
                     /db_xref="GeneID:38741115"
     CDS             87733..90267
                     /locus_tag="MRET_4349"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit a"
                     /protein_id="XP_027486714.1"
                     /db_xref="GeneID:38741115"
                     /translation="MSDESLFRSAAMSLVQVYIPTESVHETVHELGELGHVQFRDLNP
                     DVTPFQRTFVAEIRRLDEMERRLQFLQTQLEREAMPARPLERAIPFLAADEGQSGPMR
                     LEELARRLQEHESRVAQMNGSHDALQRRLLELEEAKHVIHETEAFFQQAETQPAEASS
                     AVRVSMDEDVHDEAPLLTQQGAGVRGMDAPGPVDVEFVAGTVERSQMATLERVLWRAL
                     RGNLYMNYAEIQQALEDPSREEPVYKNVFVIFAHGAAVLSKIRKICESMGGTLYPVAS
                     DPLQCREHLRQVLERIEDHENILYSTNAARRAELVRVAESIRAWDDLVRREKLIFGTM
                     NLFRTDVSRKTMVAEGWVPSAALPSVQLALRRATETTGAHVSSVMQTMRTKETPPTYQ
                     RTNKVTEGFQAIIDAYGYARYQEVNPGLFTVITFPFMFAVMFGDVGHGLLMSLMAGAM
                     VLYERRLLRTRLDEITSMFFYGRYMILGMGLFSMFTGLVYNDVFSRSMHLFRSGWTWP
                     RGTGTLTAEPTGHTYALGLDPSWHGADNALVFTNSFKMKLSIVLGVVHMTFALLLNVP
                     NHIHFQRRLFIWAELVPQLLFLEALFGYLVITIVYKWSVDWYALDAHGAPLHNAPPGL
                     LNMLIYMFLQPGQVAPEQQLYRGQATVQTLLLLVALVCVPWMLVAKPYFLYREHKERE
                     GAGYHAVGSARGEERVRDVDAAEQELADEFLEEEEEEADGESFELGEVVIHQVIHTIE
                     FCLGCVSNTASYLRLWALSLAHAQLSQVLWDMTIRPVFGMTGVAGVAATVVAFALWFV
                     LTIGILCVMEGLSAFLHALRLHWVEGGSKHYMADGVPFEPLSLAAP"
     gene            <90327..>91043
                     /locus_tag="MRET_4350"
                     /note="MRES_17665"
                     /db_xref="GeneID:38741116"
     mRNA            <90327..>91043
                     /locus_tag="MRET_4350"
                     /product="adenylate kinase"
                     /transcript_id="XM_027630977.1"
                     /db_xref="GeneID:38741116"
     CDS             90327..91043
                     /locus_tag="MRET_4350"
                     /codon_start=1
                     /product="adenylate kinase"
                     /protein_id="XP_027486752.1"
                     /db_xref="GeneID:38741116"
                     /translation="MTSRRAPLRMLMVGCPGSGKGTLSARIERHFGVPIITAGDLLRS
                     HIRQGTPLGHAASASIRAGRLMPDATMMELVGAKLHTMQHDDWILDGFPRTLGQAQLL
                     SAELARTQCPLSLVVQLHVPESVILQRILERWTHVPSGRVYNLSFNPPRTPGLDDVTG
                     EPLEQREDDNPTTFQRRLAGHHAQTEPMVEFFRTQTSPLGAPLVVDLEGRTSDEIWPQ
                     LQRVLIERGASLSTRTRCGP"
     gene            complement(<91018..>92187)
                     /locus_tag="MRET_4351"
                     /db_xref="GeneID:38741117"
     mRNA            complement(<91018..>92187)
                     /locus_tag="MRET_4351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630978.1"
                     /db_xref="GeneID:38741117"
     CDS             complement(91018..92187)
                     /locus_tag="MRET_4351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486751.1"
                     /db_xref="GeneID:38741117"
                     /translation="MNTEHELVFALSYPVQVSVAGMTTAFMVLLALHQCFTAAYHFPL
                     DPLNFVLQLVSSIVYVVYHGATLGVQLRELDEFSHRWPHMFPYMAYRLPRYGHWTTVQ
                     MVFFILAEALASLLAHAAHIQFLMLLFPSKLERRLIFWLLGPFVLIETGLFFVDLVPP
                     DHVKVLDLSDAMMNICDSSLALLYMSGLLVWGGLVNWRRAWRADGSTAAFGVAALLVA
                     LCKTVVSFVHIGYDRVYWLRLMTATFKNWQNWLGFWWWVSAGMGIGEYEDRLRATEKR
                     RRTKQRRASLADSGGEDVEMRSMHSATQPPEHASHSNSAPWTVRLLERLVSRAPRLIR
                     RRFEYLRRSHNRAVSDQAMKQAALYARVVVPRSLSFLTRSNVMHRMLLKDRTVYE"
     gene            complement(<92223..>94067)
                     /locus_tag="MRET_4352"
                     /note="MRES_17670"
                     /db_xref="GeneID:38741118"
     mRNA            complement(<92223..>94067)
                     /locus_tag="MRET_4352"
                     /product="splicing factor 3A subunit 1"
                     /transcript_id="XM_027630979.1"
                     /db_xref="GeneID:38741118"
     CDS             complement(92223..94067)
                     /locus_tag="MRET_4352"
                     /codon_start=1
                     /product="splicing factor 3A subunit 1"
                     /protein_id="XP_027486735.1"
                     /db_xref="GeneID:38741118"
                     /translation="MASERPPPPPTQQGAGDDRLHVVRTSQVHDEIFPTGGVVYPPPD
                     LRPVIDKTAEFVARNGVAFEAKIREQERLNPKFAFLQADDAYNSYFRMQIRAAAERSH
                     GDTRAAASSERAASAVQAALLADRSERPVDEEPPRPAPHAFSLEFPSTPAVELDVLKL
                     TALWAARQGPSFTARLMAREQHTYQFGFLHPAHPLCSYFHLMTEQYRRVMQPSQACID
                     TVRRCASRRCGPGVGGARLAVLDEVRKRAAWTRWDDARRHEVREEESRQRALFDEIDW
                     QDFCVVGVVEVTGSDVRADLPPPTSLAALQHQLAAQEQVQAMERSQPAPEPAPAPAPA
                     PPPPTRPAEAPAPEGPSVTITASGAKIRHDYVRHARAPRAAPQTTVCPVCGDRVDVNE
                     MSEHVRIELLNPQYREQRASLERRRQEQASLAAGADPSHYLRQLAGARTDLFGAREDE
                     DARARRDAAERERAREKEKHVWDGHMNSRRTAQQAQSAPSDAGLGKRASSEALPPPKR
                     AALAAPTYAESEWLAMYPHPITLHVHVPKAPQIAPVCDGHTEVLSGLPLSTTIGHVRD
                     RILHDTLHQAVGASKLKMWVHGRPATLRQSLAYWNLADGAHVEMSVGK"
     gene            <94140..>95642
                     /locus_tag="MRET_4353"
                     /note="MRES_17675"
                     /db_xref="GeneID:38741119"
     mRNA            <94140..>95642
                     /locus_tag="MRET_4353"
                     /product="anthranilate synthase component I"
                     /transcript_id="XM_027630980.1"
                     /db_xref="GeneID:38741119"
     CDS             94140..95642
                     /locus_tag="MRET_4353"
                     /codon_start=1
                     /product="anthranilate synthase component I"
                     /protein_id="XP_027486734.1"
                     /db_xref="GeneID:38741119"
                     /translation="MLIAPALADVRAALTAPEGARRGRIMPIYTKVPADLLTPVMAYL
                     RLSNGAERGHESFLLESVNTGERVGRHSFLGVKPRDILRTGPGLPCEGDPLRHLEERM
                     QPYDYVPVPELATVFTGGAVGYMAFDCIQHFEPRTKRALRDPLGIPECVMLLCDDVVI
                     FDHVFQTVYCVSHVYVASEHDDIDALYAACVARVEALVRTISQDATPLPAQPPIDATP
                     REPQSNVGQEGYERFVTQLRQHILHGEIFQAVPSQRLSYPTQLHPFNCYRHLRRINPS
                     PYMFYVDCGDAQLVGASPETLCQIVQGKVAVHAIAGTVRRGATPQEDAALGEALLQSP
                     KDRAEHIMLVDLARNDVNRVCDPTTTRVESLMNVEKFSHVIHLTSRITGQLRPDRTKL
                     DALRSIFPAGTVSGAPKIRAIELVSQLEQERRGVYAGAVGRIDYAKHDLDVCIAIRTM
                     TFKDNTAYLQAGGGIVHDSVEEDEYIETMNKLAGNLRCLMQAEASYASPT"
     gene            complement(<95697..>96282)
                     /locus_tag="MRET_4354"
                     /note="MRES_17680"
                     /db_xref="GeneID:38741120"
     mRNA            complement(join(<95697..96045,96071..>96282))
                     /locus_tag="MRET_4354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630981.1"
                     /db_xref="GeneID:38741120"
     CDS             complement(join(95697..96045,96071..96282))
                     /locus_tag="MRET_4354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486738.1"
                     /db_xref="GeneID:38741120"
                     /translation="MSGLASLTPFPANTYMGRYGMGLMHFPPFGERQPSAPPAPHLAD
                     MRLAIERFYKGDFVSLLVQERPVYVSDPGLHRRWELTEHELIILLVVCITCTALAYMV
                     GERLLLRAGLLAHAPVFSKDEFAHTYDATVAQYDAWLSSAPHSHGWLTPLRSQVAAYV
                     HATYLHLRARIAHALRRRTPTHSQRV"
     gene            complement(<107724..>108147)
                     /locus_tag="MRET_4355"
                     /note="MRES_17690"
                     /db_xref="GeneID:38741121"
     mRNA            complement(join(<107724..107800,107826..>108147))
                     /locus_tag="MRET_4355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630982.1"
                     /db_xref="GeneID:38741121"
     CDS             complement(join(107724..107800,107826..108147))
                     /locus_tag="MRET_4355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486736.1"
                     /db_xref="GeneID:38741121"
                     /translation="MWTRLATRTIVSAARAVPPMHAARVQVRALSVSGRALATEDSRP
                     DFDRALPPGFEKVAESPSALGAIKELADVLEKNGLDMSGGVKPSMTQMVKLAANADVR
                     EKTAKVVDEMRKAGVDMSPENLQNLMKGFK"
     gene            <108275..>109441
                     /locus_tag="MRET_4356"
                     /note="MRES_17695"
                     /db_xref="GeneID:38741122"
     mRNA            <108275..>109441
                     /locus_tag="MRET_4356"
                     /product="lipase"
                     /transcript_id="XM_027630983.1"
                     /db_xref="GeneID:38741122"
     CDS             108275..109441
                     /locus_tag="MRET_4356"
                     /codon_start=1
                     /product="lipase"
                     /protein_id="XP_027486757.1"
                     /db_xref="GeneID:38741122"
                     /translation="MPARPVWTWACLIAALYLYVHVWLRKEDERPGVRSVVRPIRRLK
                     DVRGFLQERQHNAWASMIPADAWQDTEAVWPDVTDRHTLKMLARMSCWAYYEHVPTTI
                     TDAPGWQWSSKFGWDVDGLRGHIFATANNASILVALKGTSASVLPGGKTAQQDKDNDN
                     LLFSCCCARVSSSWKPVCGCYRDHQTCDAVCIGRTLMERSLYYPAATDLYNNISYMYP
                     RSQIWLTGHSLGGVMASLLGATFGVPAVAFESPGDRLAAQRLHVPLPPSEQNNTDALV
                     PVTHVYHTADALATGQCVGPHSLCARTGFALETKCHIGQSIVYDTVRYLGWSVGVLSH
                     RMTQVLSELLSEDWDKRVLRGRSVPSSVAATLGAVPEAQHETDCVDCAGWTLSA"
     gene            complement(<109452..>109977)
                     /locus_tag="MRET_4357"
                     /note="MRES_17700"
                     /db_xref="GeneID:38741123"
     mRNA            complement(join(<109452..109540,109566..>109977))
                     /locus_tag="MRET_4357"
                     /product="glycine cleavage system H protein"
                     /transcript_id="XM_027630984.1"
                     /db_xref="GeneID:38741123"
     CDS             complement(join(109452..109540,109566..109977))
                     /locus_tag="MRET_4357"
                     /codon_start=1
                     /product="glycine cleavage system H protein"
                     /protein_id="XP_027486756.1"
                     /db_xref="GeneID:38741123"
                     /translation="MLAAPLRTACFSSLRAAARATPRSVPRVSAARSFQTSSVSNAIK
                     TLYTAEHEWLKYNDETNEGVLGITDHAQNSLGDVVYLELPAVKLEVSKGDQIGSVESV
                     KAASDIYSPVSGIVSEVNEKLNDEMTLVNKSPENEGWFAKLRLTNPAEIDELLSEEAY
                     KAILEH"
     gene            complement(<110058..>110797)
                     /locus_tag="MRET_4358"
                     /note="MRES_17705"
                     /db_xref="GeneID:38741124"
     mRNA            complement(join(<110058..110502,110526..110543,
                     110568..>110797))
                     /locus_tag="MRET_4358"
                     /product="DNA-dependent metalloprotease WSS1"
                     /transcript_id="XM_027630985.1"
                     /db_xref="GeneID:38741124"
     CDS             complement(join(110058..110502,110526..110543,
                     110568..110797))
                     /locus_tag="MRET_4358"
                     /codon_start=1
                     /product="DNA-dependent metalloprotease WSS1"
                     /protein_id="XP_027486755.1"
                     /db_xref="GeneID:38741124"
                     /translation="MRKPHHEKALALLKEVGHAVQTLMRMHGWTVHVLAEMYPRNAQL
                     LGLNYNRGEKICLRLRESSDESAFLTRDAILTTMLHELAHNVRGPHDDVFYHTLQALT
                     DEYTTAQRLGYWPGAGFLTPGTRLGGRSVPSNAWERRQLAATAAVRRQGQTGGGTRLG
                     GAASSRPLNQLAAEAALRRQRDARTCASQQDMQEILNSTREADVVALDDSDEDTPSGV
                     ARGTYDDPILIE"
     gene            <110982..>114014
                     /locus_tag="MRET_4359"
                     /note="MRES_17710"
                     /db_xref="GeneID:38741125"
     mRNA            <110982..>114014
                     /locus_tag="MRET_4359"
                     /product="cohesin complex subunit SA-1/2"
                     /transcript_id="XM_027630986.1"
                     /db_xref="GeneID:38741125"
     CDS             110982..114014
                     /locus_tag="MRET_4359"
                     /codon_start=1
                     /product="cohesin complex subunit SA-1/2"
                     /protein_id="XP_027486725.1"
                     /db_xref="GeneID:38741125"
                     /translation="MPPRQRKRAAPTHTSKRRRTDDVSDVDSDSSLSSVPDSDDEGPS
                     SRAPRAVASDADLLEQGDNELFQAVLDGSIEEASENWIVLYQGEPAEALTQLVTFVIR
                     LCGCTATLSSDEVRDLEHRDALQERIQSHDVRAPYPIVSRTKPWSGVRKSAARLIAKL
                     WADASEAEVLADDDLLDTWQSWLVGLSVSSIRAFRHTASVVALWTIGALSAQLEQVRE
                     SYDVAVKQRDAEARRTSSSSISNRTRLAHTAHKMEQLDTQRDTFDAHLDDLVTQVFGP
                     RSRDFDAAIRLDCMEQLGQWLIVYPTQYMQTFYYKHLGAALSDPDASVRACALRGVHG
                     VLRAAHAAQLAPFVEEHKARMMDMALYDTDMHVRGTAFAVLASANEHDMLEHDDRSAL
                     AVHIYDREPRIRHAAAAFLLRLLEPPDDVERIRALVARLSEYDAQLPAEPDTTASLAV
                     LEPGLGRISIALEALWDQDESLHAFKPYVQVLMRDDMSLSSEEESAAVEMLAAATRLV
                     SGDEEGHAWDDASLCLVEALPLLLAKYSADAPRLADLLAVVPHMRLEVYHETRNMEAF
                     ESLWDDVCAHFMRHVHPVLLQRAARAIQLLATAPMAAHTTTSRLATLKESVLSLLQDT
                     LYQRQVDTTVFSEDDVHNLQASLARLYTLLKAMDASALLDDDEPLWQHMLALAMRGRL
                     QYDQEKTFVHYALSSLALYLLWRTKRAIDDDTELVSRRDEVLQMIHMFLERGSHVQAT
                     VLHVALILHTLFFTVRDDLRILCPEEIQTRCATQFSTELQTLVPLYRAQGKSIALLDT
                     DMHISMLASAYVAALRVGALGVQHAAAILTYYGHFHSDFDRMCHEAVEVMRDDAMHSD
                     RAWAVCETILEALKGSMQLYFQYKDTEPRLVSLARQLANATMIRGPGFSVVRAIDANA
                     MVTLHVATVQQFVQYVRDGGHEGHEAKLFKALVHLVGTLHPSDALKIHATMQQRLAAA
                     HVEPEQGNKAWDPYFAYEKRLLNVAAKDAHLLHTAQPS"
     gene            complement(<114027..>116945)
                     /locus_tag="MRET_4360"
                     /note="MRES_17715"
                     /db_xref="GeneID:38741126"
     mRNA            complement(<114027..>116945)
                     /locus_tag="MRET_4360"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027630987.1"
                     /db_xref="GeneID:38741126"
     CDS             complement(114027..116945)
                     /locus_tag="MRET_4360"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027486730.1"
                     /db_xref="GeneID:38741126"
                     /translation="MLFSLYRGLAALLLAPDGQQIPVTTIQNVLHLQRASATPGSKQF
                     LTVGEELAVVQRLQQHLNHVRAGYDTIYGQGGTDGFGALDACQSTWDLKTFQANLRRG
                     VEQIVKTVLRSSLNYINLPQMGEPLQLDHTSRTPSMYMVQSDTINRMTQVLEDAYFTI
                     VNELSKSETLPPGASKAMHAPPARFPTGPPANMDRPGPRGVPAFSDVYPLRTDSDASH
                     FLSSPNESGASQNDAVQRTMMLTEALKPNKVLTRVDSKSGLRWTKTISRRKSKKTLKR
                     SISNPYLVTTTQNLDNAIDLGNLPSNHVPYENTVPNRLRSLSSSTQAAPDRSESLSAS
                     QLNDPAYLRIPGYLRSPSHEHNRYDEGLYLGRNAAAGGSSPLLPGHTSQNSRYNALTA
                     PETAARTPDEAIGARSQLPGPSIPASSSAIPAYTALAPPICATDYLGHTTKSSAPVPA
                     VSTAKTSTSSPASPLAPSTETSTSPSLSLAPMASPRIHTASPPRVTAPIVTSFPDIDS
                     RTKPLPDIKSKPQNVSPLSMPETSPKTPPMFASRGTSDVKARPASKISVLATPTGSLA
                     PNMIHTPSSHTRDSVHSAMFTAEGPEDDSVASEFGHMSLSSKVVPAQTAAPPSSTSRM
                     STVSTYLRNPGNSDVITFPSAAEDSTEMDFSMPGQFFDAAPPPVPPVPEEHALPRTTP
                     SKSHTESVYDMYATDVHDNDDTGDESRQKANSDNFKNEVYMGQRPVTGYGFPDAKSRI
                     RSTRIGSTSNPIWQVVAGLNDRSSLLSEVDTSVNNKRTSDVSVVSRLPESSFMLSQSK
                     AAPRFSTNLDKRALFMQARSAKLEDHPLETLLGPSTSEKLASRLNEDEVTLSSVGDHE
                     NHPHDEDDHLVTPLPEPVQEPEPPVNGEAEPVIELNDQGLPVQIVYYDDDELPDIMDR
                     IASGNNAARIEFRRRSAHPGQPKESTDTKLKDDDESNLTRVEQSILTLLRPTFSIHNL
                     "
     gene            <117542..>119248
                     /locus_tag="MRET_4361"
                     /db_xref="GeneID:38741127"
     mRNA            <117542..>119248
                     /locus_tag="MRET_4361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630988.1"
                     /db_xref="GeneID:38741127"
     CDS             117542..119248
                     /locus_tag="MRET_4361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486731.1"
                     /db_xref="GeneID:38741127"
                     /translation="MTAHADEFLVVLKLIQRLLHDTHRDGWVLHSTDLHRPRIDTLVL
                     FIKRLCRHCWMISGGPRSTDSLTGRCIHLAVGQILLPEFSHDTKDTESLFYDFVCQIP
                     AYYSLLVLPGIAFRFVAEKSARLDLLCRSSFYPDVLNFLVQSQAYCEAESVLTQWVAY
                     AFQSEGPWDMEQYRIPVHRLDPSVQQWMQGQMVKFLDNHPRGVFCWLHPDVQGLFSDD
                     VNSPRDLSTDIVKGTRHIMCGVLRPLEDISTDTIQQVPVPYLYDTLSRELATRVGACW
                     HQSKSHTSFAERQKLDTYILEMTQCVSDFALHGHEQLVVVAIELAILAIIRIGTYHGT
                     ISTMQLLQDPECRYCKQMSGHNKHKELLELIRQLYNAQQDVALQSIIDSPDSSPLKAL
                     SNEGLDLGHTFMLIAKEMQWHNMALPEAQALAVCSQWMTASDMPCSDEFFRRLSMYQA
                     DAENRALLTSSQAGAYIYDDIVDAWVSPESSRPTMHRSIREKENIAPLKRRRRHTDIL
                     PRCADFAQEEDDEIDFLGHADEINSSRVRRKVQRLDVAREASRSQMLGHRSRRASLLP
                     YL"
     gene            <119312..>120005
                     /locus_tag="MRET_4362"
                     /db_xref="GeneID:38741128"
     mRNA            join(<119312..119338,119369..119408,119438..119456,
                     119490..119526,119584..119616,119643..119796,
                     119825..119890,119923..>120005)
                     /locus_tag="MRET_4362"
                     /product="ubiquitin-conjugating enzyme E2 L3"
                     /transcript_id="XM_027630989.1"
                     /db_xref="GeneID:38741128"
     CDS             join(119312..119338,119369..119408,119438..119456,
                     119490..119526,119584..119616,119643..119796,
                     119825..119890,119923..120005)
                     /locus_tag="MRET_4362"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 L3"
                     /protein_id="XP_027486797.1"
                     /db_xref="GeneID:38741128"
                     /translation="MSGSRRLTKELKELKDTPLPGLLLLEAHEGHLYTWDAVLLGAGT
                     PYEGGHFPVRFEFPVDYPFKGPNVHFQCRMYHPNVDEMGAMCISLIKSDAWKPSTKVS
                     AILQTILQLLEEPNPEDALSAGIADQYQRDPVAFRQTAAEYTRKYAPRTP"
     gene            <120171..>121040
                     /locus_tag="MRET_4363"
                     /note="MRES_17720"
                     /db_xref="GeneID:38741129"
     mRNA            <120171..>121040
                     /locus_tag="MRET_4363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027630990.1"
                     /db_xref="GeneID:38741129"
     CDS             120171..121040
                     /locus_tag="MRET_4363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486777.1"
                     /db_xref="GeneID:38741129"
                     /translation="MSASYAIYTSPNHPLVAYHLPTLIVTPFGQPQHILYSYVHTNYN
                     NESYLLTPSMMGELCVAKAIPPPGSRRLGGPPAPPTTERNVYCEASRNLRWTIINTGI
                     NAPVYKLTLPNPDMPGHDQPLFQISKPNPNDTWWTMFYFTYGGHQLPPKRIEFGRIQK
                     NATASSGGGSGTRVTITGRTPEQQAVWHTLGEGNEDMVEWIVIFAALNLIDEEIVRAA
                     ARATLSDKPLQASTPASQHTPRPATAQPRAAVAQTQGATFMASGTRTHPVPGSAAAKG
                     RKGGRGLFGLKKA"
     gene            complement(<121085..>121980)
                     /locus_tag="MRET_4364"
                     /note="MRES_17725"
                     /db_xref="GeneID:38741130"
     mRNA            complement(join(<121085..121694,121718..121852,
                     121877..>121980))
                     /locus_tag="MRET_4364"
                     /product="tRNA(His) guanylyltransferase"
                     /transcript_id="XM_027630991.1"
                     /db_xref="GeneID:38741130"
     CDS             complement(join(121085..121694,121718..121852,
                     121877..121980))
                     /locus_tag="MRET_4364"
                     /codon_start=1
                     /product="tRNA(His) guanylyltransferase"
                     /protein_id="XP_027486732.1"
                     /db_xref="GeneID:38741130"
                     /translation="MAGSRFAYVRDFELSDVVVPHTYMLVRIDGTGFHRFSQRHAFSK
                     PNDAQALELMNEAARQVMHAFKGHITLAFGESDEYSFLIDKYSTLYNRRQSKLVTHIV
                     SLFTSAYVFHWSQYMSAPLGEPPSFDGRLVVYPGTQEIRDYFAWRQADTHINNLYNTI
                     FWALVLQGQKTEREAHDLLKGTVSSEKHEMLFQQFGINYDKLPAFFRKGTTLVWAPVP
                     DPRRTKPRTKLCTLHVDIIGDAFWHAPPDTASPGIEGVTSTCFYEHPERLCGVGLGHA
                     VLTTKP"
     gene            <122041..>123294
                     /locus_tag="MRET_4365"
                     /note="MRES_17730"
                     /db_xref="GeneID:38741131"
     mRNA            <122041..>123294
                     /locus_tag="MRET_4365"
                     /product="peroxin-12"
                     /transcript_id="XM_027630992.1"
                     /db_xref="GeneID:38741131"
     CDS             122041..123294
                     /locus_tag="MRET_4365"
                     /codon_start=1
                     /product="peroxin-12"
                     /protein_id="XP_027486733.1"
                     /db_xref="GeneID:38741131"
                     /translation="MDVLANIDPTSSNSTTADPFRPSFFELIAQEQLSDLLKPAIRYV
                     LTVLAQRHPRYLLRIVHRFDELYMVLMLAVERHYLRTWNASFTEHFYGLRRRRRPAVS
                     TQRLDASVPPNKLQAARQLRDRDVNWSVFFLVGLPYLEAKVTDYWERMGGGAVVDGDD
                     LWGDDDDDDEPHPARRETLEERRRRQWISLVRRGYPYAQVAFQLWMLAYHIRYLFGRT
                     PYWRPWLAAMRVDVRRAMGNEAPLRVGASAQRLPPFTRYPCLFAYLVACKGTARVLDA
                     LKYALPAAIFVFKFLEWWYSPQNRRRRGDSDGDAIKRIGAPAILPPSPQGVVYAPLPT
                     YRAPPVLFRHEGAEVAQDASAPVLLHYSCPLCGAAPMHNASVLASGYACCYACATDYV
                     DKWHRCPVTHMPLPGGVEQIRRVLV"
     gene            complement(<123291..>125486)
                     /locus_tag="MRET_4366"
                     /note="MRES_17735"
                     /db_xref="GeneID:38741132"
     mRNA            complement(<123291..>125486)
                     /locus_tag="MRET_4366"
                     /product="ubiquitin carboxyl-terminal hydrolase 5/13"
                     /transcript_id="XM_027630993.1"
                     /db_xref="GeneID:38741132"
     CDS             complement(123291..125486)
                     /locus_tag="MRET_4366"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 5/13"
                     /protein_id="XP_027486778.1"
                     /db_xref="GeneID:38741132"
                     /translation="MKRRASDDVCGHVASASLQPPSASQDVCKDECMWCFDSQDTPTG
                     VAVCMHCFLAGCLAQAHAGRHCEQTGHALALWLRRTPKPAAPITRLAVVDVPDDERYD
                     YERRIVCMACDTKHGRELRDVPAPIQAVATAIVHATSHAHKAEVHAWEEDIVPCAHTQ
                     ALEQDAVAAPSLGGDASCARCELTSNLWMCLQCGHLGCGRAQFGGVAGHSHALAHYEQ
                     TGHPCSVKQGTITPEGSGDVYCYACNDARIDPALDVHLRALGVPVATLSKTEKSSTEL
                     QLEQNIQFDFRMVDDEGHAMRPAYGPGHTGIQNLGNSCYLASIIQAVWSIPAFRERYG
                     HDAGACASPWDLECQLRKLTDGLGSGRYAEGDAPRGIRPAMLKACLGRGHPEFASMRQ
                     QDAEEFLQHLVTVLRRESHPEGDPTRVFGYVLEHRLQCTACRRVRYTEEAVDVGVGLP
                     VPVRGTDGHYEDVSLRESFDALVAPDTIQYTCPSCARSVTATKQTRFATLPDVLVVQA
                     QRFQLVNWVPQKMPVRFQVPLTESLDMSTYLGHGQRDDEEALPDEGHVAVDPEAMATL
                     SSLGFADAQVQQAWHATGGDLEASAHWLLEHGASVDEGATPLQALQDMGFSHAQSRKA
                     LRLHGDVEAAVAWLFDNPDDPGDDDTAEPTPTQRLGTRSPTTYQLMSFVTHRGPSVHS
                     GHYVAHVRDDTGWVFYNDDKVVHAPMHGTSSSVSALSDMAYLYFFRRTP"
     gene            complement(<125521..>127023)
                     /locus_tag="MRET_4367"
                     /note="MRES_17740"
                     /db_xref="GeneID:38741133"
     mRNA            complement(<125521..>127023)
                     /locus_tag="MRET_4367"
                     /product="adenylyl cyclase-associated protein"
                     /transcript_id="XM_027630994.1"
                     /db_xref="GeneID:38741133"
     CDS             complement(125521..127023)
                     /locus_tag="MRET_4367"
                     /codon_start=1
                     /product="adenylyl cyclase-associated protein"
                     /protein_id="XP_027486798.1"
                     /db_xref="GeneID:38741133"
                     /translation="MSSGIGNLTTLIQRLEAAASRLEDIVIAQTGEPEKSEKSEAEPV
                     APAASSPALEAWAADVGPAVRAYEDASAAIGPLVREHAELVRRAMDEVQHVIEAATVC
                     RKPEQDALPAFFEPLQAAVKSVVDFRDAHRGDTALFSHFSTVSEGVPALAWVAVEPTP
                     GPYIGDMKDSAQFYANRIIKEYKGSDEAHVAWARSFIAVLDAMRTYVMAHHRTGLAWQ
                     AHGQDLSVYRKASASSASAPPAPPPAPPAPPAPPAPPAPPAPPAPPAPAAPAPVPPSV
                     GGMDAVFQDINQGEGITRSLRKVDRSEMTHKNPALRAPQAAPAAPAASASTAAPVASK
                     RHAPHKALDGNKWAVEHFAHDAHIVVDGTDIGHTVHIFDCDHCVIHIRGKVNAVSMLS
                     CTKTSVVIDSLVSSLEVTHCHSFAAQVMGYTPTVLIDSCDSGQVYLSEQGLQTDVITA
                     KSSALNVSVPAASGEPGVLEEIALPEQLKHTLTRSGPRTVAHSEVVHHAG"
     gene            complement(<127055..>128905)
                     /locus_tag="MRET_4368"
                     /note="MRES_17745"
                     /db_xref="GeneID:38741134"
     mRNA            complement(<127055..>128905)
                     /locus_tag="MRET_4368"
                     /product="kinetochore protein NDC80"
                     /transcript_id="XM_027630995.1"
                     /db_xref="GeneID:38741134"
     CDS             complement(127055..128905)
                     /locus_tag="MRET_4368"
                     /codon_start=1
                     /product="kinetochore protein NDC80"
                     /protein_id="XP_027486779.1"
                     /db_xref="GeneID:38741134"
                     /translation="MSQRRMTLASIDTNKGAVPPRTSKGSMPPPPAGSVRGSRPSLAL
                     RRSSVALGGGDVRSRMSLAPGQRRSVGMGRVSLAPGAVPPLSMPVLKDSRLRSKNARS
                     AMEANLTQFLEETGFTMAGWSSKFVHEPTQSAFVHMFKHIYQVCVDPDYQMGADGKKF
                     EEEVMLLMKEIRYPFVDDLTKTKLTAAGSQQNWPACLALLDWIVHLGVAVGPSRSGPM
                     GRDDENELHALFFPYLWKCYEKFWENYDTYPDELADLARSFEHKNEALAASVQALEAE
                     KDEMEAELRALTDKPSPLEREEHENQVLQGDLAKFVKYHHEVLVPKLDKSRRTIQRLH
                     AAWDEYSSELRDKQQERERRQKLVDTQDVSSEEFERLVSEREWLARQLEELRVQNREA
                     MEQCWSLEMALSKRQADVEKRLQVFHTGQQRIHLLPLSLPNGVELSELELVPAHPTTM
                     LAPGVTMEAVRAKIETMRAAEVDSFRRLSDERVALQEAVDELLERLERTRRSTRSLEM
                     RHESLREQIDEMGRISSAEEDESGAEYMRQEHLVNSMEHASSMALQQADTRVKALQLQ
                     LQEALESTADERAAMHEEICRALHTLLDLKVRVGKGLDAVTSAVHGVMRA"
     gene            complement(<129013..>130155)
                     /locus_tag="MRET_4369"
                     /note="MRES_17750"
                     /db_xref="GeneID:38741135"
     mRNA            complement(<129013..>130155)
                     /locus_tag="MRET_4369"
                     /product="ribonucleoside-diphosphate reductase subunit M2"
                     /transcript_id="XM_027630996.1"
                     /db_xref="GeneID:38741135"
     CDS             complement(129013..130155)
                     /locus_tag="MRET_4369"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase subunit M2"
                     /protein_id="XP_027486780.1"
                     /db_xref="GeneID:38741135"
                     /translation="MAAGLAKIDMSSPTKAKQAPKHLVKEEDEAQTESPSDDLYGKFV
                     GEVDLPEEEEPLLKEDPGRFVLFPIRYHEIWQMYKKAEASFWTAEEIDLSNDLNDWDN
                     RMTDGERHFVSHVLAFFAASDGIVNENLVERFSTEVQATEARCFYGFQIMIENIHSET
                     YSLLIDTYIREPEQRAFLFNAIETIPVVKKKAEWALRWISDKRASFSERLVAFAAVEG
                     IFFSGSFASIFWLKKRGLMPGLSFSNELISRDEGLHTDFACLLFSHLKKRSHPDTVNR
                     IITEAVAIEQDFLSDALPVSLIGMNARLMCQYIEFVADRLLVALGCPKHYHSTNPFDF
                     MENISLQGKSNFFERRVGDYAKAGVAHDDDCANAQSNHTFSLSEDF"
     gene            complement(<130499..>132121)
                     /locus_tag="MRET_4370"
                     /note="MRES_17755"
                     /db_xref="GeneID:38741136"
     mRNA            complement(<130499..>132121)
                     /locus_tag="MRET_4370"
                     /product="YL1 nuclear protein"
                     /transcript_id="XM_027630997.1"
                     /db_xref="GeneID:38741136"
     CDS             complement(130499..132121)
                     /locus_tag="MRET_4370"
                     /codon_start=1
                     /product="YL1 nuclear protein"
                     /protein_id="XP_027486748.1"
                     /db_xref="GeneID:38741136"
                     /translation="MLVQERARRSNAGNRMQELLARGEFEADDMFLEAENDVEFEARE
                     EEPDIVDSDFDGNSTEEESDEDVEAEESIAREEKRQRKAAKPVVRTLAQPKGPSAPAP
                     ARPRAPRTMPSVVPPGGVRSSSRRSTVENKMATQTKLQEAEARRASVRARPAKRVKHL
                     TQDALIREALEMEEENTQSLLHYLEQEEERKARQRQAGKKHMSGPFVRWISVGLDQNI
                     FNSIEVRDAKAKKEPPSEERENAFPQRTEAQAAREIPERTTPLPTEEAGPEPDSGAAE
                     PRTEAPNESREAPNEVAEPHSEAPNEATERHSEAPIESREAPNEATERHSEALSESRE
                     APIEVAEPRSETLSESRETPNEAAEPHTEAPIESCEAVQPPSLACSEPNESAQETHPP
                     LAPSHAPMEPAASTDPDTPSSTEKTARTILSLHGLEPGATWVDEFRYLLGDHCAWDRL
                     PFVPSRNRPYRPRQSTCVITGLPARYRDPRTGIPYATTEAYATIERVLRGEYVWTGSV
                     HRSVALSAGMLAAAHDDGGAGGVFLRSPGVER"
     gene            complement(<132163..>133713)
                     /locus_tag="MRET_4371"
                     /note="MRES_17760"
                     /db_xref="GeneID:38741137"
     mRNA            complement(<132163..>133713)
                     /locus_tag="MRET_4371"
                     /product="diacylglycerol acyltransferase family"
                     /transcript_id="XM_027630998.1"
                     /db_xref="GeneID:38741137"
     CDS             complement(132163..133713)
                     /locus_tag="MRET_4371"
                     /codon_start=1
                     /product="diacylglycerol acyltransferase family"
                     /protein_id="XP_027486744.1"
                     /db_xref="GeneID:38741137"
                     /translation="MSWARRYLFVSNADNGQTAPLMPIMLELAQRGCQCILVSAAKVL
                     SRVQAIQRLGSFPVQTEAGSATGAVLKTHPLLLHSLGESPVLTYLNFVEEYPERFHEH
                     CCRKPGDVMGWTKLYTELVPDSTDEYLRIVHLVRDAVDALDPDMIIVDNFSPFAVDGV
                     RLTKRPFIETAPGSAMGLANRVNPFKQPLAMSGGRSEAGGLSVVHRNTSYVFRWLYFA
                     LYDPWSIRRRQFRKDVLRLTAPSLMDDAIMPPSPGVLPQQIATITFNVAGLDIYAPSA
                     YDRSVFFVGPCFPPQAQPDAQQPADDEVIAWMDKMHAEGRRVVCINMGTIYYYQPQDY
                     AHMVQALHMIHEQNPNVAFLWKIAQRPKHVQNIPSEDEAALPPYVRRLSWIPSMTAVM
                     EHPALAVMMHHGGGNSLNECLAYGIPQFCISQWVDTHDIGLCIRHSGVGLWSEYSPDF
                     VPEDICSQLLQLVEDKDHTFRHTALSWKLKTQQAGGTKFAADLIQSYVTDYTYAGGSS
                     KAPMPHAM"
     gene            <134160..>135884
                     /locus_tag="MRET_4372"
                     /note="MRES_17765"
                     /db_xref="GeneID:38741138"
     mRNA            <134160..>135884
                     /locus_tag="MRET_4372"
                     /product="BRCT domain protein"
                     /transcript_id="XM_027630999.1"
                     /db_xref="GeneID:38741138"
     CDS             134160..135884
                     /locus_tag="MRET_4372"
                     /codon_start=1
                     /product="BRCT domain protein"
                     /protein_id="XP_027486811.1"
                     /db_xref="GeneID:38741138"
                     /translation="MQSTNRWHKSHRSIKIPHVKLRPAPPSKRTHDPDAEDDAHFRKT
                     RVTTTARAHTHADFVAHAPLQHVVLSFTGIPDKHDLIQVAERLGARVCGDLTVDVTHL
                     IALSAGSDKYRAAVQFHMCVVRPEWLYLVREAWLAGDDTVDVAQLAEQCRLLPFEGLV
                     LGLTGFDAHERDRLAARIDALGGHVAPRIVWDGSITHLVCAPPSEDRHRKGLDRVLMY
                     RALLSECPDAPHVQHAARIHLVHHVWVDDCERARVLLPESAYDATRDVDSADARAQRV
                     ASLQPRVLDRTHSDAAPPPAPPTPPAPAAPRRRTSLLSWSRSASFDAPSRDQGLWATH
                     TFHIDMHDAARTRRVIHVVRSAGGHVVPSTDEADYAIGPYVPPAPGRARCYATHHWIE
                     RCLYDEALVDVHAHPAYRPPTRPLPIPEAKDWCITLTGMDRHAPTYHHTCAVIEAIGA
                     RVSASLARHTTTHLLCAPGAHTSLKAQKATEWQIPLVDLAFLEALVHPAAASPSRRRA
                     RPTHRAVLGHDARPSITEEAPVASEPDRIEAPAQPMVLYDDPVARREQSKLMALVHGE
                     PSHRTRKS"
     gene            complement(<135881..>136672)
                     /locus_tag="MRET_4373"
                     /note="MRES_17770"
                     /db_xref="GeneID:38741139"
     mRNA            complement(<135881..>136672)
                     /locus_tag="MRET_4373"
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /transcript_id="XM_027631000.1"
                     /db_xref="GeneID:38741139"
     CDS             complement(135881..136672)
                     /locus_tag="MRET_4373"
                     /codon_start=1
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /protein_id="XP_027486810.1"
                     /db_xref="GeneID:38741139"
                     /translation="MDYFEDALFTVFAHHQPARGDPGTRSVFADEALAPSRHGERRIV
                     YRIPELSSENTRLFAHHQWDAGVHLAKMITAREMDVRAKRVVELGAGTGLPSLVAAVM
                     GARHCVVTDYPDPDILAALQRNVHDTCDAYAALSLEVRGLAWGDVTQEAQAGGPFDMV
                     MAADVLWVSSQHAHLLHSICALLAHTSEARAVIVAGFHTGRPATARFFEAAREAGLVP
                     DATAKFGGMYERSVLGDERAYTASDDMGDIEERSKWVVVACLRWR"
     gene            complement(<136726..>138345)
                     /locus_tag="MRET_4374"
                     /note="MRES_17775"
                     /db_xref="GeneID:38741140"
     mRNA            complement(<136726..>138345)
                     /locus_tag="MRET_4374"
                     /product="periodic tryptophan protein 1"
                     /transcript_id="XM_027631001.1"
                     /db_xref="GeneID:38741140"
     CDS             complement(136726..138345)
                     /locus_tag="MRET_4374"
                     /codon_start=1
                     /product="periodic tryptophan protein 1"
                     /protein_id="XP_027486758.1"
                     /db_xref="GeneID:38741140"
                     /translation="MISSGVWIARGVAARHPTKQKLDEAEMERISALTGTELGEAERQ
                     LAQAQAEAGGDGWEDVDEDEEAMEEDETDAHDLTRYRLDTYDEEPSQTMAMGALSGIR
                     GAQFFRDDNDDPYMTLKDDPADEQEEREQLEILPTDNMILTAKTEDDVSMIEAYVYSS
                     EDQNLYVHHDLLLPSFPLHLEWLDYAPAPYEGDTRGRVAGTMGNFVAVGTMDPEIEIW
                     DMDTIEGIFPDAVLGRKDLTSQLDAPSGTGKKKRRVPKARVPNETHHVDAVLSLSWNR
                     HARNLLASASADTTVKLWDLSRPMSGTSSSALRSFSAHTDKVQSVAWQVGAPGGSSGT
                     ENPAVLLSGSYDKTIRVFDARMAEQAVVARIGADVEAVRWNGWKEHSFLVALESGIVQ
                     GFDVRALTPSGTDAALYTLVAHDGACTSLDISPHIPGCLLTAGTDRQVKVWNVDSDGD
                     KPRSISLVSARDLGIGKLFTTSFSPNDPLTIAAAGSGGKLHIWDTLTNPGVRRTFGDR
                     LRQHHLSWDERTERPADIQVDDDAESDEDAA"
     gene            <138431..>139543
                     /locus_tag="MRET_4375"
                     /note="MRES_17780"
                     /db_xref="GeneID:38741141"
     mRNA            <138431..>139543
                     /locus_tag="MRET_4375"
                     /product="ribosome production factor 2"
                     /transcript_id="XM_027631002.1"
                     /db_xref="GeneID:38741141"
     CDS             138431..139543
                     /locus_tag="MRET_4375"
                     /codon_start=1
                     /product="ribosome production factor 2"
                     /protein_id="XP_027486809.1"
                     /db_xref="GeneID:38741141"
                     /translation="MLRVAKPKNARSKRALEKRESKEKENAKTAIFVRGTRTSEKVNV
                     AMTELAALKKPDAVAFNKRNDVLPFEDATSLEFWGQKNDASLLVVGSSQKKRPDNLCW
                     VRLFDGQVLDMLEMGVLEATSMNAFKTNKPGIGMRPLFHFSGPEFESDPETDRLGAAG
                     ADPEAKGAFLHLKSLLLDFYRGEELDPNHIALGGLEHVISVSVAPSRKAAPSETDLSS
                     LYRAAGVSSQASGVSSVHRCEPCRIHFRVYTIRMIASGTRTPRIELDLCGPSFDFELR
                     RRLPASIDRMTQALKRPKTAEQKSSQGKGKRKNIDTDEMGDMVGRVHLGRQDLSQLQV
                     KKMKGLRGKPQFDEEDEMHPAFDNDEEEEEEEEDDE"
     gene            139665..139761
                     /locus_tag="MRET_t0071"
                     /db_xref="GeneID:38741265"
     tRNA            139665..139761
                     /locus_tag="MRET_t0071"
                     /product="tRNA-Val"
                     /db_xref="GeneID:38741265"
     gene            <140238..>140781
                     /locus_tag="MRET_4376"
                     /note="MRES_17785"
                     /db_xref="GeneID:38741142"
     mRNA            join(<140238..140447,140494..>140781)
                     /locus_tag="MRET_4376"
                     /product="membrane-associating domain protein"
                     /transcript_id="XM_027631003.1"
                     /db_xref="GeneID:38741142"
     CDS             join(140238..140447,140494..140781)
                     /locus_tag="MRET_4376"
                     /codon_start=1
                     /product="membrane-associating domain protein"
                     /protein_id="XP_027486746.1"
                     /db_xref="GeneID:38741142"
                     /translation="MDMSSTIRRGHPAAFAVFIVLSLIVAIIASAVVADLNKHDDTGY
                     DSNLVRDTTRFMVFTGWWSFLVGVLFLVLFLTGTGGVVSSIAVHGLVLFVTWVFWLCG
                     SAALSNGVGNMSCNSEAPRDCDAVKAILAFGWIGWIELTFLLCVICYLAFKAFRGGRG
                     VQQGF"
     gene            <141480..>144120
                     /locus_tag="MRET_4377"
                     /note="MRES_17790"
                     /db_xref="GeneID:38741143"
     mRNA            join(<141480..141501,141530..>144120)
                     /locus_tag="MRET_4377"
                     /product="ribonucleoside-diphosphate reductase subunit M1"
                     /transcript_id="XM_027631004.1"
                     /db_xref="GeneID:38741143"
     CDS             join(141480..141501,141530..144120)
                     /locus_tag="MRET_4377"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase subunit M1"
                     /protein_id="XP_027486739.1"
                     /db_xref="GeneID:38741143"
                     /translation="MIYVYKRDGRKEEVRFDKVTARVAKLCYGLDMNYIDPIEITRKV
                     IDGIYEGVTTVELDNLAAETAAYKTTTHPDYAVLAARIAISNLHKETKKGFSQVIQDL
                     HDYVNPKTGKHSSMISEETFHTVMKHRDVLDSAIIYDRDFHYNFFGFKTLERSYLLRI
                     NGKVAERPQHMLMRVAVGIHGEDIESAIETYNYMSEKAFTHASPTLFNAGTPNPQMSS
                     CFLVSMKDDSIEGIYDTLKTCAMISKTAGGIGLNIHNIRATGSYIAGTNGVSNGIVPM
                     LRVFNNTARYVDQGGNKRPGAFAIYLEPWHSDVFEFVDLRKNHGKDEVRARDLFLALW
                     VPDLFMKRVEKNEDWSLMCPAEAPGLSDCYGEEFEQLYEKYEREGRAKRTVKAQKLWY
                     SILEAQIETGNPFMLYKDSANRKSNQKNLGTIKSSNLCTEIMEYSSPEETAVCNLASI
                     ALPTFIEGTGPDKVYNFQRLHDVSKVVCKNLNRIIDINYYPVPSARRSNMRNRPIGIG
                     VQGLADAFMIMGYPFDSQEARRLNVQIFETIYHAALERSCELAEQYGTYETYEGSPAS
                     QGILQYDMWNRTPSDLWDWTALKAKIAKHGLRNSLLLAPMPTASTSQILGFNECFEPY
                     TSNIYMRRVLAGEFQVVNPWLLRELVELGLWNESMKQKIIAHGGSIQNVPGIPDNIKA
                     LYKTVWEISQKVILDMAADRGAFVCQSQSLNVHLSAPSFGQLTSMHFYGWKKGLKTGS
                     YYLRTRPAASAIQFTVSNEEIAAAKATKKAVSAQKAAAHTAASSAPQPPAQTSAPATD
                     DRKYESVVQGVGRLGVDGTVTQDGPGSDRPENPADDEGFKAAQERQRRRQEEADARLA
                     CSLENKDACLMCSG"
     gene            <144202..>146046
                     /locus_tag="MRET_4378"
                     /note="MRES_17795"
                     /db_xref="GeneID:38741144"
     mRNA            <144202..>146046
                     /locus_tag="MRET_4378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027631005.1"
                     /db_xref="GeneID:38741144"
     CDS             144202..146046
                     /locus_tag="MRET_4378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486805.1"
                     /db_xref="GeneID:38741144"
                     /translation="MAPPRLELRPLANQTFVQGYPGIPASDSRPDAHLTGTIAVHVPS
                     SRGVEAAWLRVEMCKVETLPRGQSWRELIGEGPMDVWKAETAWQTLTSQSFPFRVSVP
                     EKLPPSLRLNKTSGIKYQLIASLKVRLKKGFMRKDTYETVVQDTQDFVLEKHELHSTW
                     PIYNVPEEYETQEGPFTAKLMRNKWAYSVGDQMDLRIIVASKAMKTTKLKSISVGIRQ
                     NVSFFPETGMQAQPIQQKSIMLDYKTKRINKKVQHGEYFMQDLNLIVPRKNAIMSIHT
                     AKHMEISHSLRVDIKIGKAVMTFDRLNVLLSGFLSTASSSMIARIGDVPSLGITQDSN
                     PHAAREQPSVFVADNDPYLSSTTTSPMAPGRASLGARPDSVFAGDLPPVETGDFAALG
                     TATPTRPAETASPMPPSAAWQSPHLSMRPGDILGQHGSSYVANASPSAEPKQRPVSVM
                     MTPPRPQAPSVRHSTHAFSTAEQEKVRLFERARAEAEQYQSDMGESVSFPREQAPEPA
                     PPAPLRVDPGAAPTNPSETPSSSPFLTQSEARAVDEKARLQSHYAQLDAQPTESAQPP
                     ITSTPSQPAPPALNVDEPTPAPSYFAPPRAENESLATAPPRPPKVPLT"
     gene            <146088..>146879
                     /locus_tag="MRET_4379"
                     /note="MRES_17800"
                     /db_xref="GeneID:38741145"
     mRNA            <146088..>146879
                     /locus_tag="MRET_4379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027631006.1"
                     /db_xref="GeneID:38741145"
     CDS             146088..146879
                     /locus_tag="MRET_4379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486720.1"
                     /db_xref="GeneID:38741145"
                     /translation="MRWWIGVCLAAWASAAHVPHVETDAIVHVAQHEPWRIQAPSHDV
                     DGHVELCTDQQPHTQRHRGWIDPAEHGGSMLDVVGNGFREPINVIISGASDRRVLSDQ
                     GLLDYARSLGFSFECLHIHLGGLQYANLGDGQGHVPQLFEYRSIASPRSPGAWIGACW
                     ESLAGGNHFRVWRQNGTLADTGAWFLAVSKEEDVARHHTISPNGYDIGRNLLVEKAAQ
                     GSSFRGTSWTAHVEWKEGLLHPGRQGINHNISIDGRVAILTVHQL"
     gene            complement(<146880..>147776)
                     /locus_tag="MRET_4380"
                     /note="MRES_17805"
                     /db_xref="GeneID:38741146"
     mRNA            complement(<146880..>147776)
                     /locus_tag="MRET_4380"
                     /product="DUF833 domain protein"
                     /transcript_id="XM_027631007.1"
                     /db_xref="GeneID:38741146"
     CDS             complement(146880..147776)
                     /locus_tag="MRET_4380"
                     /codon_start=1
                     /product="DUF833 domain protein"
                     /protein_id="XP_027486808.1"
                     /db_xref="GeneID:38741146"
                     /translation="MCVVFWTTHVPDYSLILLANRDEFLQRPAEPAAWRTHGHRILCG
                     IDEVAGGTWVGMSSSGAISALTNVYEFPQVRTTADGRPLQSRGELVKQWLQGHESPNT
                     LDHMYASRHAYGAFNLLLGRIKDGHVYMSYLTNRPSDAPIRSWHEPKVRGLSNSSPND
                     PWPKVRWGEALVEDVLARERHDEAELIERLFEVLQSTSASSATQEDLPRLIHVPPMRM
                     PSSADGTRLASAQEVREATTGWYGTRTSTMILVSRAAPYRAVFVERDCYTLHNDEPRR
                     ICYTDPAERAKHERYYEWELAE"
     gene            complement(147816..147922)
                     /locus_tag="MRET_t0072"
                     /db_xref="GeneID:38741266"
     tRNA            complement(147816..147922)
                     /locus_tag="MRET_t0072"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:38741266"
     gene            complement(148003..148109)
                     /locus_tag="MRET_t0073"
                     /db_xref="GeneID:38741267"
     tRNA            complement(148003..148109)
                     /locus_tag="MRET_t0073"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:38741267"
     gene            <148320..>148605
                     /locus_tag="MRET_4381"
                     /db_xref="GeneID:38741147"
     mRNA            join(<148320..148419,148447..148518,148547..>148605)
                     /locus_tag="MRET_4381"
                     /product="DNA-directed RNA polymerase III subunit RPC11"
                     /transcript_id="XM_027631008.1"
                     /db_xref="GeneID:38741147"
     CDS             join(148320..148419,148447..148518,148547..148605)
                     /locus_tag="MRET_4381"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC11"
                     /protein_id="XP_027486750.1"
                     /db_xref="GeneID:38741147"
                     /translation="MQLPVSSRMYLQRKQVDDVMGGEDSWKNVDSTEVTCPKCDNDRA
                     YFMQLQIRSADEPMTTFYKCTRTECGHQWREN"
     gene            <148750..>150765
                     /locus_tag="MRET_4382"
                     /note="MRES_17810"
                     /db_xref="GeneID:38741148"
     mRNA            join(<148750..148872,148900..>150765)
                     /locus_tag="MRET_4382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027631009.1"
                     /db_xref="GeneID:38741148"
     CDS             join(148750..148872,148900..150765)
                     /locus_tag="MRET_4382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027486795.1"
                     /db_xref="GeneID:38741148"
                     /translation="MSSAEDAAHMPSASVTKALQTITESPLQFFFSRYAFVLMMMVVV
                     MNRIQHICAPTGRPAHLTLIKRLILRLPAIFMLLRPLVQLYVAMCRDTRTPSAQVWLS
                     YARMIVPSSWLDLETDYASLFWSTFIGACFTQCSSIAARSLEHIPSMDDPSTFNLVSF
                     GFLLYIHSTSRAFLPDAHVYLIVISRVIELLGLQCLRIWRRPPVSRLVFSSALGLLMT
                     LHYVYTTLYTEEYPIIHSTSRFMEALTGGIIVLTVFLHAFTMLMTDGRISFQRLIFTG
                     VNMPRSTDDYTIAVLKLGTACLHATRFSGLALELKSLDMPLHTYVEMDADGRVVLQHG
                     MADLERIESEGINGLATEVRDVRVVLRERPPEIGSPVRGGDKLQHAWAFMTALYNVVL
                     HMIQAVLSRLKPYVPPLPLVLVQLPRYVRLFWHGTNGEARREERIQARRRQEAEQIAM
                     RERLMSLRERYTLRRPADLHAPSVWSAADDLDPVELISMAQVEGDRSMFQDMLLKHMM
                     RPDHAPPLTRSEYRRLMQAQAPDKTRAMALSTCSQSTRHNAWASAAALLSTSDMANMQ
                     RASDAHTQRAILHILQERRTHQTPSEQAQLCVVCCCEPRTIIHWPCRCLALCDACRDI
                     LANQQRTVVVRGSDGVLPVQLCPTCRTPVMAFSRIYVP"
     gene            <150824..>152548
                     /locus_tag="MRET_4383"
                     /note="MRES_17815"
                     /db_xref="GeneID:38741149"
     mRNA            <150824..>152548
                     /locus_tag="MRET_4383"
                     /product="structure-specific recognition protein 1"
                     /transcript_id="XM_027631010.1"
                     /db_xref="GeneID:38741149"
     CDS             150824..152548
                     /locus_tag="MRET_4383"
                     /codon_start=1
                     /product="structure-specific recognition protein 1"
                     /protein_id="XP_027486796.1"
                     /db_xref="GeneID:38741149"
                     /translation="MATTQFDNVYHGSGKLLGMIRFSDAGLGWKPLDEGATVTIPAEQ
                     MTAFAWLRVARQFQLKIRLKGTSDQEEGEHVATFENFQRDDHAKLEQVLRECYDKPLE
                     TIEVSTRGWNWGAADVDEHDIRFFVKNKLAFSLPLANIANSNIAGRTEVSMEFINPKD
                     QQPEQNTGAASSADALPFQGSKKNRPDQLVEMRLYIPGQVERDEAEDEEDEKDVKEED
                     QELEEEEEGEEEDGEEESAALAFHNTIKAKADIGQVAGDGILVLKEVLVLTPRGRYDI
                     DMFPSFLRLRGKTYDYKILYSSITQLFLLPKPDEVHVLFIVALDPPIRQGQTRYPFLV
                     LQFPREEEMDAELNLDEETIQTKYEGKLKKRYEEPTFRIVTNLFRVFSQQKVHVPTGF
                     TNSTGQECVRCNVKANDGVLYPLNRGLIWVSKQPVLISYNDVHQFVFSRVGGAVASAK
                     TFDMRVELSHGVDHTFQSISREELDNLNHFFAERKLRVKNELTEEAMGIKASVDELLG
                     DDDDEDESGKRRRDDDDDDDEEEDEDFEAESDDDDGGSPSEGSSDDEDDDAVPDEDDP
                     PKSKKPRT"
     gene            <152579..>153423
                     /locus_tag="MRET_4384"
                     /note="MRES_17820"
                     /db_xref="GeneID:38741150"
     mRNA            join(<152579..152607,152634..152823,152848..>153423)
                     /locus_tag="MRET_4384"
                     /product="nicotinamide/nicotinate riboside kinase"
                     /transcript_id="XM_027631011.1"
                     /db_xref="GeneID:38741150"
     CDS             join(152579..152607,152634..152823,152848..153423)
                     /locus_tag="MRET_4384"
                     /codon_start=1
                     /product="nicotinamide/nicotinate riboside kinase"
                     /protein_id="XP_027486786.1"
                     /db_xref="GeneID:38741150"
                     /translation="MTEVVVIGIGGPTCSGKSTLASDLQAILTPRAGEASSIVSVDVL
                     HQDDFCPPSEQIPWNQAWQVQDWDTPHGSSDYARLARVIQYFRAHQKLPDDFQSFEFR
                     RSNYTCSLSPEELAVQRRRFHTQASHDGRPAPRIAILLVEGFLLYYSAVVRTLLDIRL
                     FIRIPRNTMHKRRKERANYILDNGEVWQDPPFYFDQIVWPAYLEAHAGMFECGDPEHG
                     KAIAPQNDEAPDGGALQHLIVLEGESCTKPQLALAACNVIRPSLIR"
     gene            complement(153467..153566)
                     /locus_tag="MRET_t0074"
                     /db_xref="GeneID:38741268"
     tRNA            complement(153467..153566)
                     /locus_tag="MRET_t0074"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741268"
     gene            complement(<153763..>154041)
                     /locus_tag="MRET_4385"
                     /db_xref="GeneID:38741151"
     mRNA            complement(<153763..>154041)
                     /locus_tag="MRET_4385"
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /transcript_id="XM_027631012.1"
                     /db_xref="GeneID:38741151"
     CDS             complement(153763..154041)
                     /locus_tag="MRET_4385"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /protein_id="XP_027486794.1"
                     /db_xref="GeneID:38741151"
                     /translation="MFGSAVRSSRSAWKGPFFVPFPNLQQALKNNAPIRTNARSCTIL
                     PNFVGLKFLVHNGKFHLPVTITEEMVGHKLGEFAPTRKRFSYRLTKNK"
     gene            complement(<154093..>155134)
                     /locus_tag="MRET_4386"
                     /db_xref="GeneID:38741152"
     mRNA            complement(join(<154093..154180,154207..154407,
                     154431..154526,154551..>155134))
                     /locus_tag="MRET_4386"
                     /product="NAD+ diphosphatase"
                     /transcript_id="XM_027631013.1"
                     /db_xref="GeneID:38741152"
     CDS             complement(join(154093..154180,154207..154407,
                     154431..154526,154551..155134))
                     /locus_tag="MRET_4386"
                     /codon_start=1
                     /product="NAD+ diphosphatase"
                     /protein_id="XP_027486792.1"
                     /db_xref="GeneID:38741152"
                     /translation="MREGSPQKAWLGSTQGLISPLLSLAFLGIEMREDGPSLPAEPGL
                     HVPTGMPYFVLSLTARSQHRHAWTEACDVLDMRKALGSLAPQDTALVSMARSLIDWNE
                     RTRHCPSCGSKQYSALSGHKRVCGTALAKHAYPCSMLEIGGRAPPQECEAWSSLQNYT
                     HPRTDPVVLVGVVCDDKILLARKRGWPKGLYSCIAGFVEQGESIEEATRREAMEETGL
                     DVGHVSYQCSQPWPFPAQLMLGLLAFVKTPDAQVRLDLDNELEEAFFATKEQVKSMLC
                     SQNDQQSHGVVRHGHPVTVPGPEALAHELLSRWAQSSHHVEVHSRL"
     gene            complement(<155410..>157299)
                     /locus_tag="MRET_4387"
                     /note="MRES_17825"
                     /db_xref="GeneID:38741153"
     mRNA            complement(<155410..>157299)
                     /locus_tag="MRET_4387"
                     /product="pre-rRNA-processing protein IPI1"
                     /transcript_id="XM_027631014.1"
                     /db_xref="GeneID:38741153"
     CDS             complement(155410..157299)
                     /locus_tag="MRET_4387"
                     /codon_start=1
                     /product="pre-rRNA-processing protein IPI1"
                     /protein_id="XP_027486793.1"
                     /db_xref="GeneID:38741153"
                     /translation="MGTKRKATKPAVDFTKTKQKLGKGKQAASNATDTSFRAKAIAMP
                     QQSILLDRSHQVTTRRRQTLNDLVQHTHHPSPGVRKDAVMGMLELVKTYAGFLELHCA
                     ALINAALPLLGDDDVHVRGAVATYFGVLLDRLDDEAFAPFAPSMLLLTTSAMSHISMA
                     VRIDALRVLSLLLDKVPALATEDWESALDAHSGSDRHGQRLLQAFFAMLGVAADAHRQ
                     RLGLSTASTASVELGTSQRLRILRALGQFLSVTDQEEHGMWCFQSAFASPSDLEHFEG
                     LFQPSKACALWTVAAMPSASSYEIHEALVHGATSQEAPVSAHERLVRILHPSLLSTLL
                     DALPSVMSPDGHRSDAHAELAQHILQVYLLLWRRTITSHLAAGAAQGTTRVAVPSLPQ
                     LSQLLTHLAPYFAEKSEMLHLHVIYCELVALYTVATQKAHHLSSVPFLLDLLSEPSLS
                     PALYEALLPTFWLVVSSPMDGHTDVMAALLTHFDTLRDRTLQAAAFRFLARLAMLPTY
                     KSLQANIDALYTPLWNTWILSLPRVLWQAATWAVSSKASPAEARDAQRLVEDVLTFLR
                     WIALMPRHPFFDHAHVLNELAPRLTPLFHVEHPQRGPIPGPYHKWPVATQHLAQALTK
                     LVSSP"
     gene            complement(<157496..>159133)
                     /locus_tag="MRET_4388"
                     /note="MRES_17830"
                     /db_xref="GeneID:38741154"
     mRNA            complement(<157496..>159133)
                     /locus_tag="MRET_4388"
                     /product="MFS family protein"
                     /transcript_id="XM_027631015.1"
                     /db_xref="GeneID:38741154"
     CDS             complement(157496..159133)
                     /locus_tag="MRET_4388"
                     /codon_start=1
                     /product="MFS family protein"
                     /protein_id="XP_027486806.1"
                     /db_xref="GeneID:38741154"
                     /translation="MPSSHTSIDEDAKSTTKHSETASIDGKKEDDQNVMIGAVGATWK
                     EKLTVVLTTLFLTFGANYTLAALPVLKPVILKNTYYRGHLIDNAKYGVMTSASNLINT
                     VLPFFSGVLVDVYGPSYIALFCSTCIAVGNLVLSLGASRGEFNMINGGEILMGIGNVT
                     IHMCQLKIYAHWFRGSTVDGPGLLGLVTGFDVAIGRVFGLMGALIPAPLMEATGKWYW
                     GLWLGFIFSIFAWALCLVYVLHERTLPAPRKIAQSMLHRRCMSPWQHVTAFLGQFWDH
                     VVQVPAAFWILVLVQLLQTGAVASYESNTVDMMVVTRGEDNVASLKSAAYKYSMHYAI
                     PIVLTPIVGLGFDKLGYRSAAISVCACFYIIAMSLMGFSQVHPVVPMLFDAFGYTLNS
                     VPFLTTVPLLVRRQTLMGTAHGILKAFNASGETIMQVAGGSLQDRAVRHGKPMREKYD
                     YMLYLVLTFKGLEALYGGLYHALDRRYFGGVMRMTEKQRVKKEAELGEQSYGSLCRPH
                     AFWTVLGCVTSVLIVAAAYGVFIHFWITNPDEKPGTA"
     gene            <159795..>160256
                     /locus_tag="MRET_4389"
                     /note="MRES_17835"
                     /db_xref="GeneID:38741155"
     mRNA            <159795..>160256
                     /locus_tag="MRET_4389"
                     /product="septicolysin"
                     /transcript_id="XM_027631016.1"
                     /db_xref="GeneID:38741155"
     CDS             159795..160256
                     /locus_tag="MRET_4389"
                     /codon_start=1
                     /product="septicolysin"
                     /protein_id="XP_027486807.1"
                     /db_xref="GeneID:38741155"
                     /translation="MLLAEALAERAEAQRQYEQVMQRLLRVVRVQEGDAPVEDPEELL
                     ASANGILDRMEWLIRCINRTNMMTLMDEKHTLTDAIAFRDMALKRRKLYSDVAAKAST
                     GQDRYSRSEIKYVNVMDVREMQKKVDKLAAEYRHLDTRIQKMNWEVALIER"
     gene            complement(<160941..>162074)
                     /locus_tag="MRET_4390"
                     /note="MRES_17840"
                     /db_xref="GeneID:38741156"
     mRNA            complement(<160941..>162074)
                     /locus_tag="MRET_4390"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027631017.1"
                     /db_xref="GeneID:38741156"
     CDS             complement(160941..162074)
                     /locus_tag="MRET_4390"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027486718.1"
                     /db_xref="GeneID:38741156"
                     /translation="MLLLLPTLALLLASLSFAARIDLSRDAKNNATSFKGEMQYILNK
                     YAAISNRHHNRTGEHLNIVNMDHVNKQKRAIGKTSLRRDKAWSGTIQVGFPPQKALVV
                     FDTGSSDLVIDKSSYHPKLSLTSKKLNKKFDFSYASLHVYGDLYTDKVAIGGVKARDV
                     PIGHGKEDFDGDSTGGTFGLSFAHSQNSGFEVDQKPFIWAAKKQHLIQSSTYQFTLRP
                     NGGASLNVGKVDLFELGGLITWTDKNTDKTFWRISVELNGNKIHNAIADTGTNVIAGP
                     NEEVKELLDKLDGISVEQSDDGSYQGYYSCKNPPHLSFKVAGQTFKFPEAAMNFGRDG
                     DKCLLSIFGTPGMQDWILGSPFFEIASVILNYDVGRMGFAKYK"
CONTIG      join(CP030259.1:1..162966)
//
DBGET integrated database retrieval system