GenomeNet

Database: RefSeq
Entry: NC_042506
LinkDB: NC_042506
Original site: NC_042506 
LOCUS       NC_042506            2852272 bp    DNA     linear   CON 16-JUN-2019
DEFINITION  Pichia kudriavzevii chromosome 1, complete sequence.
ACCESSION   NC_042506
VERSION     NC_042506.1
DBLINK      BioProject: PRJNA545694
            BioSample: SAMN08558011
            Assembly: GCF_003054445.1
KEYWORDS    RefSeq.
SOURCE      Pichia kudriavzevii (Candida krusei)
  ORGANISM  Pichia kudriavzevii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
REFERENCE   1  (bases 1 to 2852272)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Population genomics shows no distinction between pathogenic Candida
            krusei and environmental Pichia kudriavzevii: One species, four
            names
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2852272)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2852272)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 2852272)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP028773.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 01-DEC-2017
            Assembly Method        :: HGAP v. 3
            Assembly Name          :: UCD_Pkud_6
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 93.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2852272
                     /organism="Pichia kudriavzevii"
                     /mol_type="genomic DNA"
                     /strain="CBS573"
                     /isolation_source="lab strain"
                     /type_material="type material of Candida krusei"
                     /db_xref="taxon:4909"
                     /chromosome="1"
     misc_feature    complement(1..15118)
                     /note="similar rDNA-proximal regions on chromosomes 1L,
                     1R, 2R and 3R"
     gene            complement(1..3349)
                     /locus_tag="C5L36_RDN25a"
                     /db_xref="GeneID:40386423"
     rRNA            complement(1..3349)
                     /locus_tag="C5L36_RDN25a"
                     /product="25S ribosomal RNA"
                     /note="RDN25"
                     /transcript_id="XR_003834615.1"
                     /db_xref="GeneID:40386423"
     gene            complement(3518..3670)
                     /locus_tag="C5L36_RDN58a"
                     /db_xref="GeneID:40386426"
     rRNA            complement(3518..3670)
                     /locus_tag="C5L36_RDN58a"
                     /product="5.8S ribosomal RNA"
                     /note="RDN58"
                     /transcript_id="XR_003834618.1"
                     /db_xref="GeneID:40386426"
     gene            complement(3773..5538)
                     /locus_tag="C5L36_RDN18a"
                     /db_xref="GeneID:40386420"
     rRNA            complement(3773..5538)
                     /locus_tag="C5L36_RDN18a"
                     /product="18S ribosomal RNA"
                     /note="RDN18"
                     /transcript_id="XR_003834612.1"
                     /db_xref="GeneID:40386420"
     gene            <15630..>17156
                     /locus_tag="C5L36_0A00110"
                     /db_xref="GeneID:40381107"
     mRNA            <15630..>17156
                     /locus_tag="C5L36_0A00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463014.1"
                     /db_xref="GeneID:40381107"
     CDS             15630..17156
                     /locus_tag="C5L36_0A00110"
                     /inference="similar to AA sequence:RefSeq:NP_009892.1"
                     /note="PKUD0A00110; similar to Saccharomyces cerevisiae
                     YCL038C (ATG22); ancestral locus Anc_1.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318874.1"
                     /db_xref="GeneID:40381107"
                     /translation="MTTTKADILSWALISLAAEPYVVCVLGTYTPIFLEQIARENGVL
                     EKDHSSPCIAISQVVRGTHGDILEYSGELTQETQACVLPMFGGRFYIDTSSYALYTFS
                     LSVLIQTVCVLTINGIADNSNLKKTLIVLFGCLGGLATFFFFYLGNNNYYTASFLAIC
                     ANISFGCVSVLMNAYLTIMVNNSSCSDTEVQRQELLLEQDNDQVISNSEALGKIGSKI
                     SGVGTSTGYIAAMLLQVVFLLLMNYMTENGYDVFWSIKLVISIAGLWWLIWQAPIAIF
                     LKNIESLQTKSMSIKEMVIQGYKELGHVLINIRSLKDIYYYLLAMFVLTDSLTTINST
                     AILFGKTVLNMPVTSLAKIGVLVMISAIAGSIVIPIVLIGKYGCRVEKVQLLLVLWCL
                     CVPLYGIFALTSAFEMYVLAVWYGLGLGGLSTINRSIYSIIIPEGKENIFFSIYSLTD
                     RTSSIVGPFVVGLIINIFHNVRGAFWILTALLLISIPILSVKFDLDRARSESFNFGLD
                     "
     gene            complement(<17233..>18117)
                     /locus_tag="C5L36_0A00120"
                     /db_xref="GeneID:40381108"
     mRNA            complement(<17233..>18117)
                     /locus_tag="C5L36_0A00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463015.1"
                     /db_xref="GeneID:40381108"
     CDS             complement(17233..18117)
                     /locus_tag="C5L36_0A00120"
                     /inference="similar to AA sequence:RefSeq:NP_011389.3"
                     /note="PKUD0A00120; similar to Saccharomyces cerevisiae
                     YGL126W (SCS3); ancestral locus Anc_6.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318875.1"
                     /db_xref="GeneID:40381108"
                     /translation="MQAQQEITHPIGVHLLLVNNRLETLSKRTHFTKGQIIVCSICFF
                     FILLGQFMNKFSPIETIENYFTSPGNIVNTYYVKKGWFWTIAIYFCVSFRYYSKETVN
                     KKLLIRSLLRVFFFTICWFFFTQWFFGAPIMDKVFVWTGGQCVNVNQDKIPDALKRYF
                     KVSADIAPDLFQSTAVSSATCRLLKGNWDGGHDPSGHVFLLTLSVIILILESLELFSL
                     DESYVSPLDKAFSWKEFFLHPLIILGLAITLELTMFLMTIIRYHSFVEQLGGFAFAFL
                     AVWLVNKVTEITQKQLRV"
     gene            complement(18259..18329)
                     /locus_tag="C5L36_0Atrna1G"
                     /db_xref="GeneID:40382459"
     tRNA            complement(18259..18329)
                     /locus_tag="C5L36_0Atrna1G"
                     /product="tRNA-Gly"
                     /note="PKUD0Atrna1G; codon recognized: GGC"
                     /db_xref="GeneID:40382459"
     gene            18984..19055
                     /locus_tag="C5L36_0Atrna1Q"
                     /db_xref="GeneID:40382467"
     tRNA            18984..19055
                     /locus_tag="C5L36_0Atrna1Q"
                     /product="tRNA-Gln"
                     /note="PKUD0Atrna1Q; codon recognized: CAA"
                     /db_xref="GeneID:40382467"
     gene            <19212..>20708
                     /locus_tag="C5L36_0A00130"
                     /db_xref="GeneID:40381109"
     mRNA            <19212..>20708
                     /locus_tag="C5L36_0A00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463016.1"
                     /db_xref="GeneID:40381109"
     CDS             19212..20708
                     /locus_tag="C5L36_0A00130"
                     /inference="similar to AA sequence:RefSeq:NP_011014.1"
                     /note="PKUD0A00130; similar to Saccharomyces cerevisiae
                     YER090W (TRP2); ancestral locus Anc_7.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318876.1"
                     /db_xref="GeneID:40381109"
                     /translation="MSVCQPSFEQLCDYIEDDKKSNVFPVYKFLSAHYLTPHTAYLKL
                     TGAQSKPTQSFLFESASNGEQVSRYSFMGVSPYKVIKTGPTENVEVDPLNILEEELKD
                     IKQAQLPGVPKLSGGAIGYISYDCIKYFEPKTRNDDLKDVLKLPESFLMLYDLIVAYD
                     HVFQRFQIINNIHINRETDNSDTIKAKYENALKELEVISEILENGEVKLPEQPKITET
                     ENFTSNIGQEGYEAFVHKLKDHIKKGDIIQAVPSQRIKRPTKLHPFNIYSHLRTVNPS
                     PYMFYIDYLDFQVVGASPELLVKSDINDKVVTHPIAGTVRRGKTIEEDNELANELSSS
                     LKDRAEHVMLVDLARNDINRICDPTTTSVDSLLQVQRFSHVMHLVSEVSGTLRSDKTR
                     FDAFRSIFPAGTVSGAPKVRAMQLIGELEKEKRGVYAGAVGHWSYDGKTMDTCIALRT
                     MVVKDGNAYLQAGGGIVFDSDPYDEYIETMNKMKANNNTIVEAEKLYM"
     gene            <20961..>22139
                     /locus_tag="C5L36_0A00140"
                     /db_xref="GeneID:40381110"
     mRNA            <20961..>22139
                     /locus_tag="C5L36_0A00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463017.1"
                     /db_xref="GeneID:40381110"
     CDS             20961..22139
                     /locus_tag="C5L36_0A00140"
                     /inference="similar to AA sequence:RefSeq:NP_009495.1"
                     /note="PKUD0A00140; similar to Saccharomyces cerevisiae
                     YBL058W (SHP1); ancestral locus Anc_7.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318877.1"
                     /db_xref="GeneID:40381110"
                     /translation="MSDEREKAIQEFIDITGHTRSIAEQYLNKNDFIVTMAVNDYYNN
                     EHITPGTKADTTPKAVNNPNVKQRKSGGSTLKSFSDLKNDNGSDDDDGDINFFTGGEK
                     SGLAVEDPNKKKNGRSLVDELLEKAQREAGEPDWRDNADSDEASSKKQKSFRGTGHSL
                     GSVENAIESKTIEDPSNQAHGFKKPEKVTRTITFWKEGFSVDDGELYKYDDPKNQEYL
                     QQLNTGRAPLSLLNVQMFQDVDVNVDKKLEDSYYSHQKSKPRVFGFQGTGKRLGSPVP
                     GEPTTVEEALAREEAQQATLSQTNTEETAEKTAASGVAGSGDTTIQIRLGTGERLVQR
                     FNSTDAVESIYTFVANHTNDSRAWGLVTSFPTQPLDDKKQQSIADSKLKNSVVIQKWK
                     "
     gene            <22644..>24953
                     /locus_tag="C5L36_0A00150"
                     /db_xref="GeneID:40381111"
     mRNA            <22644..>24953
                     /locus_tag="C5L36_0A00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463018.1"
                     /db_xref="GeneID:40381111"
     CDS             22644..24953
                     /locus_tag="C5L36_0A00150"
                     /inference="similar to AA sequence:RefSeq:NP_011015.3"
                     /note="PKUD0A00150; similar to Saccharomyces cerevisiae
                     YER091C (MET6); ancestral locus Anc_7.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318878.1"
                     /db_xref="GeneID:40381111"
                     /translation="MVSSAVLGFPRIGAFRELKKNTEAYWAGKIDADQLLKVGKDIRE
                     KNWKLQKDAGVDVIPSNDFSFYDQVLDLSILFNVIPERYTKYELSQLDTFFAMARGLQ
                     RKATETTKAVDVPALEMVKWFDSNYHYVRPTFSKSTEFKLNGQKPVDEYLEAKALGIE
                     TRPVLLGPVSYLFLGKSDKDSLDLEPISLLEKLVPLYAEILKKLADAGAKTVQIDEPS
                     LVLDLPENVQAAFQTAYSKLAEAEGLPELVLTTYFGDVRPNLSAIKELPVSGFHFDFV
                     RTPAQFDDVVSILGDKKTLSVGIVDGRNIWKNNFAESIEFVKKAIEKVGAERVTVATS
                     SSLLHTPVDLVNEKKLDEEIKNWFSFATQKVDEVVTIAKAVSGEDVSAKLEANAAAIK
                     SRKESKITNNPEVRKRTADALADPSMAKRANDFPTRLVAQKAKYNLPLFPTTTIGSFP
                     QTKEIRINRNKFNKGEISAEEYEKFINKEMELVVKFQEEIGLDVLVHGEPERNDMVQY
                     FGEKLNGFAFTTNGWVQSYGSRYVRPPIIVGDVDRPAAMTVKESVYAQSLTKNPMKGM
                     LTGPVTILRWSFPRDDVTQKVQSYQLSLALRDEVSDLEKAGITVIQVDEPAIREGLPL
                     RAGEERSDYLNWAAESFRIATSAVEDTTQIHSHFCYSDLDPNHIKALDADVVSIEFSK
                     KDDPNYIQEFSNYPNHIGLGLFDIHSPRIPSKEEFVARIGEILKVYPADKFWVNPDCG
                     LKTRGWEETRASLTNMVEAAKVYRAKYAN"
     gene            complement(<25265..>25840)
                     /locus_tag="C5L36_0A00160"
                     /db_xref="GeneID:40381112"
     mRNA            complement(<25265..>25840)
                     /locus_tag="C5L36_0A00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463019.1"
                     /db_xref="GeneID:40381112"
     CDS             complement(25265..25840)
                     /locus_tag="C5L36_0A00160"
                     /inference="similar to AA sequence:RefSeq:NP_009496.2"
                     /note="PKUD0A00160; similar to Saccharomyces cerevisiae
                     YBL057C (PTH2); ancestral locus Anc_7.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318879.1"
                     /db_xref="GeneID:40381112"
                     /translation="MSNSASFAVIAGLFGVLSGIYIGTHLNVIPNSGLPKKLKKIANA
                     EDNAPSDDENYSDDEDGGIEVNSGSLNEIGGEVRMALVVRTDLGMLKGKVAAQCSHAA
                     VALYRKNLVNNPTMLKRWENCGQAKITLKCVSLEDIEELQAKAASLNIENYLVHDAGR
                     TQIASGSATVLGLGPAPKAIMDMVTGELKLY"
     gene            complement(<26052..>28703)
                     /locus_tag="C5L36_0A00170"
                     /db_xref="GeneID:40381113"
     mRNA            complement(<26052..>28703)
                     /locus_tag="C5L36_0A00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463020.1"
                     /db_xref="GeneID:40381113"
     CDS             complement(26052..28703)
                     /locus_tag="C5L36_0A00170"
                     /note="PKUD0A00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318880.1"
                     /db_xref="GeneID:40381113"
                     /translation="MVRIKRAYLAIPESFFRGNHFYTKHTLVTKFTFRPKKRYYSNNI
                     NPSVKVFTPLNFNHNLSERVYSDNIKRFGPQIDSNACLKNTLIHVKTLQDYKIQNTPT
                     YGSFIHFETDNPANEFGIVVSTRNFSLSKPTSFMVLLPSSEIVEVFNSKIIFTIQLME
                     HQVSLPQLAYTLNVFLAYYLKIQNFILDKDLIRTAYLKAALINYQTSIQLQDFSLDIY
                     NSTKSIRNLLNLKINPFSAHSFIFACHYMMYNDPIHFRYVSSLKPSMYTILNPLLQLT
                     TPYFLNPIVLSENIETIYNQPNEAIRRSYYNILTKSTNFQIFNILKSDENFKKLILFI
                     KYAIVYPNPKLFNKLDEILPLKATSTSLLQLLKKLEIYNHKTNPILASGMYGLHRKDP
                     TDLSMYPQVVADLQYSEQKAIKAENLPSALKRHKPLLQKKSYKPQFTEMINSVKYKIW
                     DKSKIHSKVYKLTDTIAFSVTHVSLTCYRFGIFVPIPNQSPNENITIIEPIKTGNINS
                     FPKLIPFNQYLRVNQPCIKLTFEHDLIHSDSLTSPKIKVGIDMFKKIEDIDEDWFRGK
                     KQIHVIDSRKKMECWSSMNKLSNLLVEKEKSRIRHGLLKTFGGLNEKNNDLKRFTDYQ
                     QYPQFDDNFDDLNHHRDKSWLIENLKLLIDENFSRFCNEKKIKVLNRSITKSSENSDD
                     YRVFKKLKIFKWYANSYDTFNFQLSSNPGDLTAYFGCLSFLSKCEISDKGYLPLGLKH
                     YSSFTSLEFIETHLNLWQLLRYLLVEAYKLIKNEKAESWDPEELEKVTAAHFKHALGQ
                     TEGYVQIINRLNRYESLSRIKNEGALDEMMRCVVTEIHDDKILGYWIDEDLQVEIESS
                     SNYMIGDRIICSNIVEIDPLSDKIVVK"
     gene            <29117..>30451
                     /locus_tag="C5L36_0A00180"
                     /db_xref="GeneID:40381114"
     mRNA            <29117..>30451
                     /locus_tag="C5L36_0A00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463021.1"
                     /db_xref="GeneID:40381114"
     CDS             29117..30451
                     /locus_tag="C5L36_0A00180"
                     /inference="similar to AA sequence:RefSeq:NP_009497.2"
                     /note="PKUD0A00180; similar to Saccharomyces cerevisiae
                     YBL056W (PTC3) and YER089C (PTC2); ancestral locus
                     Anc_7.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318881.1"
                     /db_xref="GeneID:40381114"
                     /translation="MGQILSHPKTEKTSEEGGDSFVAYGLSCMQGWRVSMEDSHSTVL
                     DMSKLVGKTNLNEQNAFFGVYDGHGGEKVAIFTGENLPKILAKSENYAKGDYIQALKD
                     TFLAADVELLNHEELSKDPSGCAATTTLITPNAIYCANAGDSRTIMSIDGVVKPLSFD
                     HKPTNEGEKNRIVNAGGFVDMGRVNGNLALSRGIGDFEFKDSNLKPEEQAVTPLPDVL
                     EHKLDTLKDEFIVLACDGIWDCLSSQQVIDFVRRYIKEKKSLIEISELLMNTCLAPTS
                     GGSGIGCDNMSVCIVALLKDGESLDDWYKRIGSKVSDEDLKKLPTADDLSNDLYKVDI
                     ATKISETSENDSSNKNGGLRSTLRSEEEDDDDEDGNVLKGGAPAFLQQLLAASSAQRD
                     NNVIYLDQNATSILQSLGVMEEDDDVKIEQEDEDNEDNDKEDKIKEVTDDKQ"
     gene            complement(<31012..>32151)
                     /locus_tag="C5L36_0A00190"
                     /db_xref="GeneID:40381115"
     mRNA            complement(<31012..>32151)
                     /locus_tag="C5L36_0A00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463022.1"
                     /db_xref="GeneID:40381115"
     CDS             complement(31012..32151)
                     /locus_tag="C5L36_0A00190"
                     /inference="similar to AA sequence:RefSeq:NP_009498.1"
                     /note="PKUD0A00190; similar to Saccharomyces cerevisiae
                     YBL055C; ancestral locus Anc_7.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318882.1"
                     /db_xref="GeneID:40381115"
                     /translation="MHSVRNKLKIPRYYDVGVNITDAMFSGIYHGRQHHRNDTIDVLK
                     KAYKHHVKNILLTGSSLEESRKTMEIIQSLQNLEGIPILKSTIGVHPCTVMEFEENGQ
                     DPSKHLENLKQLLEYGIELDLVRAFGEIGLDYDRLHYTPMDKQLLYFEKQLHLATNFN
                     LPLFLHMRNSIDDFIKTLYPFLSNKLLPNENLLVHSFTGNTEELEKLLNLEARTGYRI
                     FISINGAGLRDSSTLDIINKIPLDRLMIETDSPWCEVKKTHPSYKYLQKSPNMFYPDD
                     DENYELVTEKPEIKDLLTKFSQNKKNPKGSNITLFEFLPIPIVKSDKFDNFKYTHLFV
                     DSPLIKSRNEPCLIGLVAQVICQLRDESPEDIIDACYNNSMLVFT"
     gene            complement(<32878..>33639)
                     /locus_tag="C5L36_0A00200"
                     /db_xref="GeneID:40381116"
     mRNA            complement(<32878..>33639)
                     /locus_tag="C5L36_0A00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463023.1"
                     /db_xref="GeneID:40381116"
     CDS             complement(32878..33639)
                     /locus_tag="C5L36_0A00200"
                     /inference="similar to AA sequence:RefSeq:NP_009499.1"
                     /note="PKUD0A00200; similar to Saccharomyces cerevisiae
                     YBL054W (TOD6) and YER088C (DOT6); ancestral locus
                     Anc_7.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318883.1"
                     /db_xref="GeneID:40381116"
                     /translation="MHEKISPQSWDDEDDKLLIKLKEVDNLGWKQIAGHFRNRTSNAC
                     QFRWRRLKSGQLKKPTKLSKVMSGNSNHTNTSQSYKVGKPLNSAYTCTSAYSVPTFFT
                     RPYHPPQLEQLPPPTNNSWGVEEDILLRSRGTKGLSVAELSILLRNRSIRDIEDRIHY
                     LENSNRRDTGIWSSPMEPEFAISPTSSVSSITSATITPNNPHLEKIKLPRLQLNNDKQ
                     SQQSIVLPPLHSLFQFEVDELDSQRKLPLLSHILP"
     gene            complement(<34459..>35496)
                     /locus_tag="C5L36_0A00210"
                     /db_xref="GeneID:40381117"
     mRNA            complement(<34459..>35496)
                     /locus_tag="C5L36_0A00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463024.1"
                     /db_xref="GeneID:40381117"
     CDS             complement(34459..35496)
                     /locus_tag="C5L36_0A00210"
                     /note="PKUD0A00210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318884.1"
                     /db_xref="GeneID:40381117"
                     /translation="MLNFTETQLFKSKISILTIPRENFWIFKSGVLEIIYHIIDSYET
                     RSKSTQSDNDNYSSSDNETDNDNESKEEESGMEIEDDGLFFHLAFTREEVTIFCSSKL
                     IKRHFSKAIELDKESTVIGDEFFIIQVLNDGSNIGKKILELTQPLSLNNISLFFISNY
                     FSDLVLVPIKDKTKALEILENPYEPSINEEAEIKTFELFKKNNIQPKIVLDSKLLLTG
                     ARSGDYVEVLKQTAEAISRLNVMKDFPRIFAITRTPTEEIGLLLPCEEKELNNLRYRK
                     STIMGSLQDYYYAIVVDLKMLPLDLKGVVSGIATKLLRLQVNEMSYLSLGKSGLVLVP
                     DLFLDIVERGL"
     gene            <36205..>37131
                     /locus_tag="C5L36_0A00220"
                     /db_xref="GeneID:40381118"
     mRNA            <36205..>37131
                     /locus_tag="C5L36_0A00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463025.1"
                     /db_xref="GeneID:40381118"
     CDS             36205..37131
                     /locus_tag="C5L36_0A00220"
                     /note="PKUD0A00220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318885.1"
                     /db_xref="GeneID:40381118"
                     /translation="MVLPIMKFFSWLFHRDSKKDRIDTLRPNLGGKLNSRNASPAILP
                     NGERSKKYKKELRKSKSMANLKRTFSTLKRSSSTRRLSPQSRQQFDDALETYQEAQPQ
                     TATFNPFVGDTHELFIYSPANSTYNGTICRNCTESESTIFDKENACSPLYLLSESQTP
                     NYQINENSSMDPFRPQLPSPLHKRFITGLTIKTPVPINERQQFEEMQSETSSSSDGTG
                     ESDSHYLVYSDSCKHNIFTPKFKPTIRCPSIPADSPQLEPSTSLLNTYNNLRNTKSNS
                     GTDSGDKSLFSAVNKAELWDYSKITLVSYNNS"
     gene            complement(<37192..>38916)
                     /locus_tag="C5L36_0A00230"
                     /db_xref="GeneID:40381119"
     mRNA            complement(<37192..>38916)
                     /locus_tag="C5L36_0A00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463026.1"
                     /db_xref="GeneID:40381119"
     CDS             complement(37192..38916)
                     /locus_tag="C5L36_0A00230"
                     /inference="similar to AA sequence:RefSeq:NP_009501.1"
                     /note="PKUD0A00230; similar to Saccharomyces cerevisiae
                     YBL052C (SAS3); ancestral locus Anc_7.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318886.1"
                     /db_xref="GeneID:40381119"
                     /translation="MLLPMKKRTSRSRSRSQSVNYNETVVRQTDRHTGRGSSNVHNKV
                     ASESGNDQQQPSRPPPKKQKVNYEYPTVDSALLELPYRGLFELSDANTYECMPDENFT
                     ELFQSFVNKSKKPQMRDRLKYIYFDNYEIETWYKSPYPKQYNSNSLMYMCPHCLSYFA
                     SRFTLNRHLLKCSYKSQPAGREIYRDDNEKISMFEVDGRKNVIFCQNICLLAKLFLNS
                     KTLYYDVEPFMFYVLYDYSRGGFKFVGYFSKEKLNSTGYNLSCIMTLPIYQRRGFGSF
                     LIDFSYLLSRREFKLGTPEKPLSHMGLLSYRSYWKLAIIREIYKLLYESNIKFEDIEG
                     KDPHLKKFQLSIDDLSNLTGMCHDDVIVGLEQLNSLLTYNNGGKYSIIFHASLVKSLY
                     QSWKRKTSIKLKKELLYWKPVILGPSGGINTNTTMVLSDNTNEGQLMKNVSVIVNFLK
                     DDLEDDRPLEELTLEKVQTQQISGKFVDDTLAQSLVCFPGIKFKKSEAKQFKENGVCD
                     STINENSSDMIDTANVVDLDELIGESGDDTDVDDDKVDDDYISDAEEDDYEDDDEDEE
                     DEDDIVID"
     gene            <39106..>40167
                     /locus_tag="C5L36_0A00240"
                     /db_xref="GeneID:40381120"
     mRNA            <39106..>40167
                     /locus_tag="C5L36_0A00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463027.1"
                     /db_xref="GeneID:40381120"
     CDS             39106..40167
                     /locus_tag="C5L36_0A00240"
                     /note="PKUD0A00240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318887.1"
                     /db_xref="GeneID:40381120"
                     /translation="MKKQAAVVAKQLRNHVGEFKPKVIFAYSQKGKELIFNQSLLHPY
                     KLNPLLEIGDRTPLDYPSLRVGCQKFTPKVFSDRESRISNMLKTILEYERNNPVKEEL
                     EIYCHNGLFSDIILRTKDKYDVILYKNKFIFAGTETRRGQNKLINYIGLKFEAMLTGQ
                     ESPKDTSHCKLLLEGNVGKFPYKSVVEVDSYKMSGSEKKYAEMKLVFCPKTTEEELSV
                     TRTNFELLSYLRKKVFNFDQKMKKWLFQCHFGLQEKLIIGIRNEDFELMGMREFDLQH
                     DIVPYVREDMRGTYEQYLESIDTLEERLAYIYRQITFTQSEETQVYRFSCTNFRVKPH
                     GRQFNRVLIPQYTKSHPAK"
     gene            <40360..>41457
                     /locus_tag="C5L36_0A00250"
                     /db_xref="GeneID:40381121"
     mRNA            <40360..>41457
                     /locus_tag="C5L36_0A00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463028.1"
                     /db_xref="GeneID:40381121"
     CDS             40360..41457
                     /locus_tag="C5L36_0A00250"
                     /note="PKUD0A00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318888.1"
                     /db_xref="GeneID:40381121"
                     /translation="MEKPEEQLAIFSSRPEIIHRYSLKGEKITFDESELKPYRLISDL
                     ELGKRVDPKYPSVKKGWRKYRRKIFKMNESRIRYLLLTLLDYERKVAMDNTLEVYCHN
                     GLFSDLLNAKEGYYVVQYKNKLIFASTSTRANQNQLLSYIGVKFEALMKCQPSPRDCS
                     HCKLLLNGEYGRWPFKSVVEVDAFKKTPRGKVYCEMKLCYSSNAKEYAISKLTSNREF
                     LEFLRINVKSFRKKIEKWLFQAYFGRQDILVVGLRDDDFKLICNTELKVIEEIIPFVR
                     QTYPSLYEKFINAPQTVSSSLDTIHRQIKQLQRTETDVFLLDTSFPLNVERCARKFET
                     IIIPEFLEQHPLDPLSSLTESLDKLSVGRFA"
     gene            <41875..>45612
                     /locus_tag="C5L36_0A00260"
                     /db_xref="GeneID:40381122"
     mRNA            <41875..>45612
                     /locus_tag="C5L36_0A00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463029.1"
                     /db_xref="GeneID:40381122"
     CDS             41875..45612
                     /locus_tag="C5L36_0A00260"
                     /inference="similar to AA sequence:RefSeq:NP_015188.1"
                     /note="PKUD0A00260; similar to Saccharomyces cerevisiae
                     YPL137C (GIP3) and YOR227W (HER1); ancestral locus
                     Anc_8.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318889.1"
                     /db_xref="GeneID:40381122"
                     /translation="MNNNTGANSSATSQNGSVPTELGSNELRSSFLDPGVSNGDVDWL
                     FRGREIKKLTKRTNTINTEVQSQLLQAQHKALLESKGKESGANSPVANGSLLNESLSS
                     ATNLKSLNDQSFEHQASSPSVSIPQKVPDAPLKSSLKPSSVSSSSTLKLDTSSVVGSP
                     VSSSLGSHKSLSLAMENNNVANVGTPAHSASQSPVSTPANRSRSSSLFGKARSPSVAN
                     ESKPKKSFISTLSSKIKSSTSSSASIASPVATSNKTVPIARREYAKPTVPNTSNTEAQ
                     QASIHEQKETNLLDKELGPVSFKRVCFALNELIEDPQQQIPSRRPKRGNVLIPEDMMA
                     PPPKLSIGITNSFNEQTKDQKPNVDPQIYEEAVARHRYFLAESKKHSEEAHIAALRMA
                     KEVAAFKKRKGSFLKGIDSDEDEEDEENITDSRFLSNGDDVLDIDTPLHQHVNYFGNV
                     EEAADSQIEDPNTDISLETLYTRCCHLREILPIPATLKQLKDKTKPLHVLKMLNPRPT
                     LIDILSFSDFLAVAPIITVIFDNVTIDTEMLKIVLVSLKNSKMLEKLSMRNVPIDQEG
                     WKYLCKFLKENKVIEKLDISQQRVKKSSDSNKSVLRSDLNWDLFTETLAERGGLEELV
                     IHGCSLNPSQFTNLVNKALTLKTKRLGLASSQLDIVKMNVLSKWISSPKSTCIGIDFA
                     FNDLSLGQLKCLNSDLKANGSQIQLQFFSLNSTNVQLDECSELIKNLSTLPSLRFLDL
                     SNNPHLFPDILPVLRENLPNYPDLRRLHFDFDDLNEFSIIQLCLIFQKCPKLVHVSLL
                     GNKTVTAKTLLALYSAVKSSNIYNIDMDYEDLDEELVSRIAFYLMRNMENFLNNNKDE
                     LDKSSTSSNKTSLKDEDLIFDGSLLTKAAGHLLENQSNIKGEEKIIIYKSLVEKTLKL
                     RTEIHNSMNRLFKARENRELSIEGKENLLRLCLLDDSLENIIDIFSDEVNINKDFSKL
                     DINDNSKSNRPEMIRRLSSQLTKHHSTQDIMDTGPIINDEYYHNDERPTLINDAEQAP
                     HTVVADADSVPVDSTTGKRVFMRSFSQTSIHAKKLEEEEGELHRWGFFVQQQNDIMPD
                     DSQNSDEERERLRLEAEKEKAKQEEELRLRKENEKKTLMIHRIPSGNELRDTIMKAKG
                     IQSISDLIKKVNKDFTTVENIYKHVDAKKHHKEAEQINSFPHQRSPTIEDNTVHDEDA
                     VSDAESIDSYQGQELDHIDADEVYERILDNVIKVRSNKELQ"
     gene            complement(<46593..>47585)
                     /locus_tag="C5L36_0A00270"
                     /db_xref="GeneID:40381123"
     mRNA            complement(<46593..>47585)
                     /locus_tag="C5L36_0A00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463030.1"
                     /db_xref="GeneID:40381123"
     CDS             complement(46593..47585)
                     /locus_tag="C5L36_0A00270"
                     /inference="similar to AA sequence:RefSeq:NP_011841.1"
                     /note="PKUD0A00270; similar to Saccharomyces cerevisiae
                     YHL022C (SPO11); ancestral locus Anc_7.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318890.1"
                     /db_xref="GeneID:40381123"
                     /translation="MEDFIVSCPMRIITLAPAYPPLDSISKCVQMIEHGIKSGTPIQL
                     HLYSSPNKHKTIVNFPTVSYAGNRSFLIYFKILKLIHCQLLANELISKRQLYYLDVAL
                     FEKQGKVDKCVDIIASSLNAALVDLNIIPSQKGLVYGNLDVNGYTITKDNGSVLIPSI
                     RHFKISFETMPDRIVILEKDAILSGLISKDRESQCLGNIILITGRGFPDRLTKSFIYQ
                     LTAHFPQIPVHGYFDADIHGFMIFQEYSSKPIEKNSIGPTAAVVAAPNLKLKGAKLLG
                     DTDFLMINERDIILTISQLKIASVSNLTGNLREIQRSLFLNVKRELQLSDVLFG"
     gene            complement(<47675..>48559)
                     /locus_tag="C5L36_0A00280"
                     /db_xref="GeneID:40381124"
     mRNA            complement(<47675..>48559)
                     /locus_tag="C5L36_0A00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463031.1"
                     /db_xref="GeneID:40381124"
     CDS             complement(47675..48559)
                     /locus_tag="C5L36_0A00280"
                     /inference="similar to AA sequence:RefSeq:NP_015194.1"
                     /note="PKUD0A00280; similar to Saccharomyces cerevisiae
                     YPL131W (RPL5); ancestral locus Anc_8.639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318891.1"
                     /db_xref="GeneID:40381124"
                     /translation="MGFKFTRNSAYLSRYQTPFRRRAEGKTDYYARKRLITQAKNKYA
                     SPKYRLVVRFTNKDIICQIVSSTLTGDVVLTAAYSHELPNYGIKHGLTNWSAAYATGL
                     LVARRALKKLGLDETYQGVEEVEGEFELTEAVEDAPRPFKVFLDVGLQRTTTGAKVFG
                     ALKGASDGGLYVPHSPSRFPGWDIESEELDSELLRKYIFGGHVAEYMEELMDDDEERY
                     SLLFKSYIEDDIDADAIEDIYMEAHEKIREDPTPKKAEDKKAQYAAESKKYRQKKLSR
                     DERKARVEAKILTFKASA"
     gene            complement(<49069..>52377)
                     /locus_tag="C5L36_0A00290"
                     /db_xref="GeneID:40381125"
     mRNA            complement(<49069..>52377)
                     /locus_tag="C5L36_0A00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463032.1"
                     /db_xref="GeneID:40381125"
     CDS             complement(49069..52377)
                     /locus_tag="C5L36_0A00290"
                     /inference="similar to AA sequence:RefSeq:NP_014608.1"
                     /note="PKUD0A00290; similar to Saccharomyces cerevisiae
                     YOL034W (SMC5); ancestral locus Anc_7.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318892.1"
                     /db_xref="GeneID:40381125"
                     /translation="MTQITHFDLGSTLPVAKRLKSSYKPNLSKFHPGAIIRCRLKNFM
                     SYSLTEFHFHSNMNLIVGPNGSGKSTFVCAVCIGLGGKLANLGKESMTTDGFIKDNEN
                     DGYIELELKGKEESTSVVVRTILHRKSKTEWMIDGVLVNESSMKKLMRSFNIQLDNLC
                     QFLPQDRVSKFADLKPEELLREIEKCYKDGELLDEHLNIIQLQGNVNEQEKRVEEDKK
                     RLEELRVKNKSLKENVEKHRHYMQLEKELKKTELIRPYIEYQDLKKQRDELKGKYDVL
                     KNDYQLFMQKVAPIKESLQHVDDEMSSSDEAIKKLERKIKVYDDKIADIRKSINKINS
                     EIDQNFQSIKNFEQQCEFAKTSYLDSKAQLKEWEKRLSTLENDGQDVDIGPLKTMKQN
                     IQNEIYEIEDLVGELRTKLNTQKRLKTDICDKITLERGKLSSKDRLVSLDRRKFGKTI
                     DAVYKLRQYKDRLNARYYEPAILTLNVSDKHVAPIVEALIQFTHLNAIVVPSGEDYHA
                     ISRFLYDEQKIMVSIRTLGKDNQDIVNDRISDDIIKELGFDGWLTDYLRAPREVIQML
                     CENANIHKIPISIAGLKTEQKQKIEDSIRNGLDLVKYVSYDEIYTMNKSKYGRQQITT
                     TIKSFRLSPQIFGIGLSEEQKGAINERIRELESRLQSINDEMVRLSESMKSDNTKAND
                     KRRELQDVEGQIHRYNVQLKERDKIRRGVERAREQMEVKRVKYKELRKSKLEQTRGEV
                     YDRIDGLVNERLRIMREDYRESMEKKMEADKEYIIMKVKSVEESNRVLSIKRLVDSSN
                     EEMQRLGKLAGDAKEEVNAIRGKCKKAKLEVEEATSRLSLEEKQEVATMVQKWIDEDK
                     LSVVQLNMRLEQLHSEMALSGGGRSSGRGVLYQLQENEEEITEIEERIPHIEALIEKV
                     KQELDEKRTRWESQLEGLISQVQEDFSRNMAFIASAGDVQLERDDNDFKKWGVVIKVS
                     FRDNEGLSAFNGAQHSGGEKSTTTAVFVNSLQGLTQTPFRVVDEINQGMDAINERRAH
                     ELIVQRASQIGASQYFLITPKLLTGLYYSSEMGVHCIFAGRWIPEAGNNDSNPGNAVR
                     ESDFCQLGISQMYM"
     gene            <52550..>55465
                     /locus_tag="C5L36_0A00300"
                     /db_xref="GeneID:40381126"
     mRNA            <52550..>55465
                     /locus_tag="C5L36_0A00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463033.1"
                     /db_xref="GeneID:40381126"
     CDS             52550..55465
                     /locus_tag="C5L36_0A00300"
                     /inference="similar to AA sequence:RefSeq:NP_009391.2"
                     /note="PKUD0A00300; similar to Saccharomyces cerevisiae
                     YAL011W (SWC3); ancestral locus Anc_7.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318893.1"
                     /db_xref="GeneID:40381126"
                     /translation="MSKEVIPATTIPTNTTRSTNVVLIQQLEGINKELVYQQRLDRPF
                     KVIQNLPISKNGEPDYTVLKHPLSVKDSGVLYNSLIVSRFNWINHIFKTFWTKREQII
                     IGSDKGKRDKMIRLTDLEMIGGPHQFKIKLFFLKEDEKEKAYIEERKRKKEERLRRRE
                     ERLAEIKRRKEIKEREEKEKEEQKLQLKLQHEAKLREEEIKKEQEKEKEQEKEKEQEK
                     EKEQEKEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQ
                     EKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQEKEQQQEHKKAKLLHLQNNDTR
                     VITSHIGQKQLSIKGEENGYKDRIDAAQLGDSADMKDITEVKNTTAVKSTTNVKEKST
                     ISGRKSDMELSFKIEQPKQQAENSTNQSTPVIPQGKPSSTKSKPATKDIMSNPENAIV
                     IQNLNFMARQDSYLNELMKEVASGGASNAKILEFQTYISKAQQMGDATGYLAKLKQKQ
                     ALIERKLKLDRERKEKQKKEKVQPIKLPQMSQEELMKRAMDIKKEQELQRQEKIRLRE
                     EREQEKIRLRKEKEEKKLREREERERLKRQAREEKERERELRRQEKLAEKERIRLERE
                     ERAKEKQREKERLKLKAELKKKSNAADSSDDENTNSSDDEDDDRMGKLREDDYDEDLW
                     NDKLSPLQERYSVGATLVFEFFENNSARFMIPRDTIFEIVNKEAEDDAGESRSNSLAS
                     VPTEQSNFIKDEPSHDQPHPKSPYVTILASFLLVHNQSEIDGWDRRQEEARRAAEEAE
                     RKRKEAEKAELEESKNCTIAENARKRRRKKSNWSTATSKRSTRLSKQAKELENLRREE
                     ENYHEEDEEDDSLEKPRPLPVYSCVTLTLSKVPFRFANFIANSGNPVSVAHESMKEIM
                     KIGTRVPLDKLWYQVDGIKDELLAETLRYNLNRLDYLTAGGKKSKSAFIKKFGRGGR"
     gene            complement(<55523..>58690)
                     /locus_tag="C5L36_0A00310"
                     /db_xref="GeneID:40381127"
     mRNA            complement(<55523..>58690)
                     /locus_tag="C5L36_0A00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463034.1"
                     /db_xref="GeneID:40381127"
     CDS             complement(55523..58690)
                     /locus_tag="C5L36_0A00310"
                     /inference="similar to AA sequence:RefSeq:NP_012529.3"
                     /note="PKUD0A00310; similar to Saccharomyces cerevisiae
                     YJL005W (CYR1); ancestral locus Anc_5.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318894.1"
                     /db_xref="GeneID:40381127"
                     /translation="MAKSTCDGEVYIHNLATFIKSHEIQLANALLAYKKLNSNLKEVA
                     EHPKHSQSKIDNTIGSTNSNCDSKTNFIINTSSSPNSAATSDVNKVANHDVISDKNTS
                     FSASSPTDYNTKPDVEEELSKELSKPVRLSLSLHHLYFILGKFKDLGIHIGPMNLRLD
                     SMDADNTSNYVSFLSEFQRNKKIDSDAQSIHSISSVKSVMSSVSALWNNFGSSKVDNT
                     ISDLKYLYSAFSKLPCLRLANEKNLKLIEGHEEYPFETATPIIVFKNIIVLEIAELEP
                     KEVYGWHILAQKLRYLVVKKTTITDPIEVLINLVEADSVVKGEDDDLIDSDDPMNIID
                     NPDDNKIFKFQTTNSEGNEHHHYSNNHSHSHHYHNDKLTFRSSLSSTNIPSSHATSSL
                     GSSFTSSKTYVSPSLPHAQTFHVSQPHGYHTLSHHHSNNSNSSNSINGNTSNNINVHY
                     QSYHHYNHHNHYSLATDTLASLSTSPNNTYHNSRLYPDDPFSSTSQSKLSSSVHSSRR
                     SYYYKPQKKSRFVRGSHSAHHHISTLPSLHDSKSKGHLSKRSDESTDMGKVEKKKSIE
                     VEEAENNYWKLLKHLSFTENKIYKISSNSFDRLSNLSLLDLSYNRLTVIPTEALSKLT
                     NLKSLNLSFNRLKSVEKFPKTLKKLTALNLRGNNISKLDSIENLSNLQKVDLRQNSIE
                     KVTDLKPLLLLNENKVLLLSLHLLENPISRSRGYRVELFNLFNGVDYKNLIKIDGSRP
                     GIFESRMLLDEKTSKMKFKNYIDESIISKMTASVSSMNLNSILTQQPTTKQFNKSYKI
                     GAEIKDSTKKTEPQELNHPVLDRMSTCITTKEPRIFSGHTKIVSASPTVTSSLNELVV
                     NNNSMSNNPQDQNKASSQLPKMVGKEKGNDSIDTFINTNPVNPMPISSSPSIKSIRNP
                     VTVSFQSLNNDVPLNNSNNNTVILNDFAMPANRSMPPSQRTSNDFSTTSSILTNNTNA
                     ANSTENPMSRFSLASPALPVITQATTTTTTTTTIASSKTPDNILDHTTRRDYFVGEKG
                     IDKENTRHDTKTLADDLTSEVKIVL"
     gene            complement(<59092..>60396)
                     /locus_tag="C5L36_0A00315"
                     /db_xref="GeneID:40381128"
     mRNA            complement(<59092..>60396)
                     /locus_tag="C5L36_0A00315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463035.1"
                     /db_xref="GeneID:40381128"
     CDS             complement(59092..60396)
                     /locus_tag="C5L36_0A00315"
                     /note="PKUD0A00315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318895.1"
                     /db_xref="GeneID:40381128"
                     /translation="MDNPYTQGKQKSKTGQRAKKLSWMKRFMSNSTTGSQSPQPSQPQ
                     QLGKSLHSSNKGRKTQTVLPHRDGSVSTRETTPKHELYNRRLRISDITSIENDELESF
                     ISSNGSTTLIRQEAYQRQFYTRTPNINTNLNTNGNGNGNGNTDTMTVSSIKSIYSSKH
                     HSVYSSANASIASSQKNHTMGSQNLTSIPASPTPTFHSASLYSNHLYPNILYQLNGDG
                     DQDSQSINTYNASMINNVDLRSTSGSMLDDNISTKPILSLSSDDDDDDEEGDEDEEYT
                     DADANFEVDLDPHPGVRGTDTKVGDRSVDADIDNDDFSFIRSTGSAANEPTYLSTPSA
                     CDTGVSHIHSSQDILYSNPDRLDDFDGYSMDAKSRYAVSSKSMALTTLSGSVLSPMLQ
                     TINSATTMATSVTNHTSHTTQTNYNTAASVLTLASSSRLAHA"
     gene            <60632..>61090
                     /locus_tag="C5L36_0A00317"
                     /db_xref="GeneID:40381129"
     mRNA            <60632..>61090
                     /locus_tag="C5L36_0A00317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463036.1"
                     /db_xref="GeneID:40381129"
     CDS             60632..61090
                     /locus_tag="C5L36_0A00317"
                     /note="PKUD0A00317; Pfam Domains: UPF0057(3.6e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318896.1"
                     /db_xref="GeneID:40381129"
                     /translation="MSSLSTVPIVHNRQASKFVLVLSAVVFPPLAVFLVDGFSKETLL
                     CALMTVFGLHVAGTAYAIYFLWPYLADNVPLADIGASSNAETVNGYTRLETNTTTTNH
                     DEEALSQYKDLPPPYPANITDNTEGNTGEETLHTHPETPSFSGDHKIQLP"
     gene            <61443..>62834
                     /locus_tag="C5L36_0A00320"
                     /db_xref="GeneID:40381130"
     mRNA            <61443..>62834
                     /locus_tag="C5L36_0A00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463037.1"
                     /db_xref="GeneID:40381130"
     CDS             61443..62834
                     /locus_tag="C5L36_0A00320"
                     /inference="similar to AA sequence:RefSeq:NP_013090.1"
                     /note="PKUD0A00320; similar to Saccharomyces cerevisiae
                     YLL011W (SOF1); ancestral locus Anc_5.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318897.1"
                     /db_xref="GeneID:40381130"
                     /translation="MKIKTISRSADAYVPVSNTRESALPRNLNPELHPFERAREYTRA
                     LNATKLERVFAQPFIGTLGDGHRDGVYALAKNFSSVNKVATASGDGVIKYWDVTSREQ
                     TYSYKAHYGMCSGLVVTPDQKSMLSCGVDKTIKLWEISNDSDYNQNYNYDALTNSNAT
                     STTGLKKTFLADFSLMGLDHHFSDPLFVTAGANVNLWDMNRNKPISNLSWGADNITAV
                     KFNKTETSIFASTGSDNSLILYDTRTNSPTQKIKTSMRNNAIAWNPMEAYIFATANED
                     QNSYLWDMRYMEKSINVFKGHVNAVMDVDFSPTGKEIVTGSYDKTLRIFATDKGHSRD
                     VYHTKRMQRLFITKFSTDSKYIFSGSDDGNVRIWRTKANERSGPKSARKRSKEEYDEK
                     LKQRYADMPEIRRIARHRHLPQGIKKDSEIKAEEIKSIKRREENRRNHSRPGAVPYVS
                     ERAKPVVGRVHKQ"
     gene            <63762..>67217
                     /locus_tag="C5L36_0A00330"
                     /db_xref="GeneID:40381131"
     mRNA            <63762..>67217
                     /locus_tag="C5L36_0A00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463038.1"
                     /db_xref="GeneID:40381131"
     CDS             63762..67217
                     /locus_tag="C5L36_0A00330"
                     /inference="similar to AA sequence:RefSeq:NP_012707.1"
                     /note="PKUD0A00330; similar to Saccharomyces cerevisiae
                     YKL215C (OXP1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318898.1"
                     /db_xref="GeneID:40381131"
                     /translation="MLGLIYNQGFRSIAVCLMHSYTYPEHEEIVGRIAQEIGFTNVSL
                     SSKLSPMIKYVNRANSCVADAYLTPEIKKYLQSFQSGLKYGLKKLNDDESKGVSCQFM
                     QSDGGLVDSSRFSGLRAILSGPAGGVVGYSRTCFNTENPIPLVGFDMGGTSTDVSRFG
                     DNKFDHVFETTTAGITIQSPQLDINTIAAGGGSILSFKNGLMQVGPESASSHPGPACY
                     RKGGPLTVTDANLLLGRLIPEYFPRIFGKNEDETLDTEITKLKFTELTNDINRAHENL
                     DDKSIHEIAYGFLEVACESMARPIRQLTEAKGHIISSHRLVSFGGAGGQCAVQVASIL
                     GIKEVLVHRYSSVLSAYGMALADVVEETQQPFSTEFTDANQAILSERLNVLRQESVSK
                     LEKQGFIKENIELEEYLNMRYQGTESGIMVPKEEEGFLETFKEMHLREFGFLFESKPV
                     LVDDVRVRASGKVRQRQDEPVDRQLLELHNNGGLCEPDPNRLKFIKEIFWKVDGKLKA
                     LPTEIYRLEDTKVGTFIHGPAIIADGTQTNVVPPGAVVTVLKTHLFIQILDEKSKPRE
                     DNPDGAMEAANSSIQIEPVLLSIFANRFMDIAEQMGTSLQKTSVSVNVKERLDFSCAL
                     FDSDGNLVANAPHLPVHLGSMSACISTQAKLWNGKLKPGDILVTNHPSAGGTHLPDIT
                     VITPAFEGDEIIFYVASRAHHADIGGLLPGSMPPTSTELWQEGAAIFSEFLVRDGKFQ
                     EETIIEKLLHEPSKHPGCSGTRRLSDNLSDLKAQIAANQKGIQLIALLVKEFGLATID
                     AYMKAIQDNAAETVTKMIDSLLEKNREKSLKCTDYMDDGSQISLSVYRDQESGKVIFD
                     FEGTSAQSYNNFNAPSAITYSAIIYCLRCLVDDEIPLNQGCLRPIEVKIPKSSLLSPD
                     DGSAVVGGNVCTSQRITDTILKTFDVMADSQGCCNNFTFGSGGNGPNGKYVQGFGYYE
                     TIAGGHGASANWDGVSGVHTNMTNTRITDAEIFERRYPILLREFSIRKDSGGKGVRKG
                     GDGVVRDVEFRVPVTASILSERRVVAPHGIHGGEDGARGVNLWVRNYKNKKGEIEERI
                     YNLSGRASVDVSAGDRIVIMTPGGGGWGRIDSIEKSSSNSNKRTWSKIASGSLHNRKR
                     QQLEN"
     gene            complement(<67348..>69486)
                     /locus_tag="C5L36_0A00340"
                     /db_xref="GeneID:40381132"
     mRNA            complement(<67348..>69486)
                     /locus_tag="C5L36_0A00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463039.1"
                     /db_xref="GeneID:40381132"
     CDS             complement(67348..69486)
                     /locus_tag="C5L36_0A00340"
                     /inference="similar to AA sequence:RefSeq:NP_014431.1"
                     /note="PKUD0A00340; similar to Saccharomyces cerevisiae
                     YNR033W (ABZ1); ancestral locus Anc_6.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318899.1"
                     /db_xref="GeneID:40381132"
                     /translation="MSILLVDSYDSFTYNLRDLVRRATNAQVITIHNDSYDIEKESDS
                     VQLDTLVESVDAIVIGPGPGSPTKPSDIGVIPHLYKQYIHKPILGICLGFQTLCLANN
                     CKVDYLEEPIHGQIHSIDVVDHSSIFRNLPDKIDSVRYHSIYVDEIDSSKTIKPLAFF
                     TGENNVKILMAAQHREYPHFGVQYHPESICSEYGFEVVENFWNLVKSRASDRSIAHDN
                     HLVSATPLIESFESNGLFKFQYSDISSTLDTEFDILEICDTIQSDGQDTLLLNSASAP
                     GQWSIVGMPINKQSLVITHSTESPNEILVNKWNANEFETIEVDDIFKFLAKFVSQRYF
                     NPTINHQELKTCPFVGGLIGYMSYEEGFFVDRQNLKKRTKSNIDDTKLCFIERFIAIS
                     PEKKAYAVTIKEGDDQFLSNLRNLLKSRNTSRPVLVESLSREAKITTPDKEVYFRAFH
                     DCQKYLKLGDSYELCLTYNTIVHLPEKYEPWEIYKALVKKNPSPYSAYLNFKSSMLLS
                     TSPERFISWNDKFCQMRPIKGTLKKNPEIDYQKACKLLKIPKELGENLMIVDLIRDNL
                     LYLLDKINVTELMSVEEYETIYQLVSVIEGEFTNKFTGIDVLKNSLPPGSMTGAPKKR
                     SVEILQQLEDNQRRGLYSGICGYWSLNDNADWSVIIRSLFRYADDLDNMDGYDTYRCG
                     AGGALTVLSTDQGEWDEMLIKLHSVLQLFE"
     gene            <70358..>70753
                     /locus_tag="C5L36_0A00350"
                     /db_xref="GeneID:40381133"
     mRNA            <70358..>70753
                     /locus_tag="C5L36_0A00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463040.1"
                     /db_xref="GeneID:40381133"
     CDS             70358..70753
                     /locus_tag="C5L36_0A00350"
                     /inference="similar to AA sequence:RefSeq:NP_015181.1"
                     /note="PKUD0A00350; similar to Saccharomyces cerevisiae
                     YPL144W (POC4); ancestral locus Anc_8.656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318900.1"
                     /db_xref="GeneID:40381133"
                     /translation="MAEAVRKIHTVTTKVTPPFGDEFQIAATLPLEKPIFNASNRIPI
                     TIHLSKTGTNTELGCYVYTILDKRSGRTHQTLLNNSNETLVDMTKKIGALLSKKYHVP
                     TYVSVSGNWSLEDLLATIKSVVAFINESY"
     gene            complement(<70877..>72223)
                     /locus_tag="C5L36_0A00360"
                     /db_xref="GeneID:40381134"
     mRNA            complement(<70877..>72223)
                     /locus_tag="C5L36_0A00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463041.1"
                     /db_xref="GeneID:40381134"
     CDS             complement(70877..72223)
                     /locus_tag="C5L36_0A00360"
                     /inference="similar to AA sequence:RefSeq:NP_015179.1"
                     /note="PKUD0A00360; similar to Saccharomyces cerevisiae
                     YPL146C (NOP53); ancestral locus Anc_8.659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318901.1"
                     /db_xref="GeneID:40381134"
                     /translation="MSDIGRPQTVAQKTRKGKRAWRKNVDISDLEARLQEQREEIIHH
                     GKALTDLASEDLFLIDEEADEEVERKMKRANVKKLKSSEILENKSKVPALLSKVGKSQ
                     KKKKDNKIQGVEKKEMIHLLKLAGKVKGYDKTEERMAKEGIIRSEAYDVWGTKLEEEL
                     RYEKLPSPLKENSTVSYTHPLSVPKTLKEAPIKIRKQELIPHAGKSYNPSFDNWRNLI
                     EQEFFKEKTKEDQRLTLEEYRDRIQYLIANYEDNEVIQEDDSGNDESVLDGSDGDPEV
                     TSGENESQDVTAKASETEFKLSINPATKLKIKTKAQRNKEQRYKEKQKLQAELKEIKL
                     RIKELEKLPEILNDVDEKSKRTSEKAAGESKDERRLRLGKKKLGSKFEPIEGPLEVKL
                     SNELSDSLRKLKPEGNLLYDQMKNLQSKGMIETRRINKGKKGKKKVTEKWSYKDFK"
     gene            <72764..>73909
                     /locus_tag="C5L36_0A00370"
                     /db_xref="GeneID:40381135"
     mRNA            <72764..>73909
                     /locus_tag="C5L36_0A00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463042.1"
                     /db_xref="GeneID:40381135"
     CDS             72764..73909
                     /locus_tag="C5L36_0A00370"
                     /inference="similar to AA sequence:RefSeq:NP_014881.2"
                     /note="PKUD0A00370; similar to Saccharomyces cerevisiae
                     YOR238W; ancestral locus Anc_8.660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318902.1"
                     /db_xref="GeneID:40381135"
                     /translation="MVGVFFRKQLRQVRSYRSKHQVLSLLCLTLLVVGIYRIYNNMLS
                     KQEIHIDLKPVQDTMKSTEDYKEGWITDYPQIENMIILPCHSVFAPELNEAKDYPKDD
                     RFAIGMDPNNWLMASFQKKSNDQYSFMKHMEHALLELHANIGNTALVVSGGFTKPEIE
                     KSEASSYLDMAKAVGFLKNPYFRIGTNILLEEHARDSYENVLYSLSTFYKKFQKFPKK
                     ITIVGFGFKRERFLSSHLTTLGYYKPTKEIKGMKDEEKWPDSVHVKYASQGPFLEKSE
                     NQSDEEFKVYESEFWDSLGKSERENALALFNVNPFGSRGSKLYDKKIARDPWNKSQEI
                     TTTYKTNNEILNTLIEINDLELKDAMELYKQKVVPSFPLYIDHRNGN"
     gene            complement(<73910..>76591)
                     /locus_tag="C5L36_0A00380"
                     /db_xref="GeneID:40381136"
     mRNA            complement(<73910..>76591)
                     /locus_tag="C5L36_0A00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463043.1"
                     /db_xref="GeneID:40381136"
     CDS             complement(73910..76591)
                     /locus_tag="C5L36_0A00380"
                     /inference="similar to AA sequence:RefSeq:NP_015178.1"
                     /note="PKUD0A00380; similar to Saccharomyces cerevisiae
                     YPL147W (PXA1); ancestral locus Anc_8.661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318903.1"
                     /db_xref="GeneID:40381136"
                     /translation="MYATHTFIKNMLQALQFVLINSKRIRELILHEVKHEKRLWKRYI
                     QVLKFLNINPNAKPVWLFFLTIIFTFGSFTSYQLVCLFHLLRSKLKQNRPLSQRQPSP
                     SKSFLNFRSSLLPFANSNLQANKRIINVPYKNRTIEVKLSLPNSDKYERDKLIFKKFM
                     KDHEVSKQSSVIKVQFFEKLSIIWNLILVPKVFDKNSYLLVFQVSFLIARTWLTLLVT
                     KLDGQITKDLMSFNVKYFLRDLVYWFLFAVPASYINAAIKYLSKRIALNFRTNLVRYC
                     HDLYMDSKLVYYKLQFNTNEPLSEYKLDPESFSQYVTQDIKRFTESLMNVFTDVGKPA
                     VDLIFFAVYLRDNIGSLGITGILLNYFITGLILRNYSPNFSKIWKIRSFLEGIYYNYN
                     LNLMNNCEEISFYKGVAFERLKVEEIFNKLMSHLSFETKIRFKYQLLEDYILKSVWPA
                     FGYFFASLPILFDNTDATSLASSNIKSFTVNKRLILAMADAGSRLMYSIKDISKLNGL
                     TDRIFTMLVNLHQVHDSNFMYGYFDSTRYRPNGGFGSTYNISSFASKSKLRGYLNQAA
                     GSIIESGTIQKNFPGLRFEHIDIVPPSIKGPLGTPILRNLNFKILQGENLIIHGKNGC
                     GKTSIIRIISELWPLFSNGLLSKPANSDIFYVSQKQYFVNGSLRDQVIYPLSWKVCIK
                     RGDDDSKIKGILKDVGLDYIVDRFGLDYNPHGEGSKIEEIIINDEKVDIFDSYVGGCV
                     DGKVNWDNLLSGGERQKLIFARVLFHNKKLVVLDEPTSAISFDFEDILFDMLKKRGFT
                     LVTISNREGLIKYHDYILRLEKNDSENADPNVSDGIFSKIDEEYLRKFETIDNEIEYL
                     QQEIQKIDEMKSRKFKLIELLDGAEDGESPVMIEQHA"
     gene            <77222..>77890
                     /locus_tag="C5L36_0A00390"
                     /db_xref="GeneID:40381137"
     mRNA            <77222..>77890
                     /locus_tag="C5L36_0A00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463044.1"
                     /db_xref="GeneID:40381137"
     CDS             77222..77890
                     /locus_tag="C5L36_0A00390"
                     /inference="similar to AA sequence:RefSeq:NP_013073.1"
                     /note="PKUD0A00390; similar to Saccharomyces cerevisiae
                     YLL027W (ISA1); ancestral locus Anc_4.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318904.1"
                     /db_xref="GeneID:40381137"
                     /translation="MFTRISLQRQVPRLAFNNYRLLNTSSASKLPLLNVNLAPKTHNP
                     NSISFTSSDSSQLHPQPQLQSSSKKWSRHVIKSSQELNDELDQQAKEEDTKKLAHPTT
                     GKKTRKRRTLKPLKAPITLTENAKVHLRALNDGPEPKLIRISVKNRGCSGLTYHLEYI
                     DKPDKFDEIVEQDGIKVVIDSKALFSIIGSEMDWVDNKLSSKFVFKNPNSKGTCGCGE
                     SFMV"
     gene            complement(<78153..>80402)
                     /locus_tag="C5L36_0A00400"
                     /db_xref="GeneID:40381138"
     mRNA            complement(<78153..>80402)
                     /locus_tag="C5L36_0A00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463045.1"
                     /db_xref="GeneID:40381138"
     CDS             complement(78153..80402)
                     /locus_tag="C5L36_0A00400"
                     /inference="similar to AA sequence:RefSeq:NP_013071.1"
                     /note="PKUD0A00400; similar to Saccharomyces cerevisiae
                     YLL029W (FRA1); ancestral locus Anc_4.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318905.1"
                     /db_xref="GeneID:40381138"
                     /translation="MSNRQNNPVNMAKPSMFSLLSRNGIAGATTIREASQGLRFPNSN
                     GRCNDCTCSPGLLSRNRRSSMYLRRMMSSSSVSPSHRHGHGHGSPGSSAPSSPGRYRS
                     PVIDEVTSEDNLCKVVQDMNTSLRLEKIRNLMKESNLGVYIVPSEDAHQSEYTSPVDQ
                     RRAFISGFSGSAGVAVITRELTSMNETPEGLALLATDGRYFTQAANELDFNWTLLKMN
                     TPGVPSWEQSAIDHAASLSLDSGSVVNIGIDPRLITYSSVQHIQRLIEEKQKENEKYQ
                     IKLIPVRGNLVDKIWNDFEAVPAREFKPIFKLDDKYTGETTTSKINRLFDDYMTKNGS
                     STLIVSALDEIAWLLNLRGNDIEYNPLFYSYLIINGKDNLTLYTDKHERFDGLQDYLK
                     EINCNLKLYDEVWYDIRKIATELHNLKKKLLLTEEATWKMVNCIIARNFTMIESPIKS
                     MKEIKNDVELKGQTEAQISDGYALIKYFAWLEKELVDKSSFITEHEAAMELLKIREEL
                     SNFRGLSFETISSTGSNAAIIHYSPPAVGSSLINPNKIYLCDSGSQFLNGTTDTTRTL
                     HFGEPSCEEIENYTLVLKGHIALARLVIPNDRVTGYQIDCIARQFLWSKGLDYMHGTG
                     HGVDSYGPVHSAGVGIGFRPYCNKNTIKAGHLVSNEPGYYKPGEYGIRIENMVYLREV
                     KEKEGWLEFVTTTKVPYCKKLIDVKLLSDDEKKWINDYHRDIWELFSPKLEKKSYEWN
                     WLKRETSPL"
     gene            <80849..>83872
                     /locus_tag="C5L36_0A00410"
                     /db_xref="GeneID:40381139"
     mRNA            <80849..>83872
                     /locus_tag="C5L36_0A00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463046.1"
                     /db_xref="GeneID:40381139"
     CDS             80849..83872
                     /locus_tag="C5L36_0A00410"
                     /inference="similar to AA sequence:RefSeq:NP_011499.1"
                     /note="PKUD0A00410; similar to Saccharomyces cerevisiae
                     YGL016W (KAP122); ancestral locus Anc_4.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318906.1"
                     /db_xref="GeneID:40381139"
                     /translation="MSSVDEIASLVQTLYSPNQDKDLILSVQQQLQSIQKRPDAPELA
                     HELLKYNVQTIQFFGALTYTVYLFNHPIDTQIGDVMIGELVEACSRNLDSVVIQKLLF
                     NIAKIYTNILYFPINDLFQKLSSKGLDMITISKYGLLACKTIGEELNRCEKITAEKNQ
                     MIMDSMLEDNTKNLLNNTTHLVLEDSSLKKVWLDCLQAWMIYVSKSSFEFHVKSDLNE
                     YYRITLMLLQKLDIDALDLISEIFDVCPSQLNNDNKSFFRSLVFSEWTTNFITNNDID
                     DNSKLSKLIASSLDSEILTFASKLIDSEYQQRIEFLLFLTNQPGDPITDEPFSVDMLE
                     FWTLFAEAFINDTEAIHTLIGNEEAKIQTLHKISKTYFIKLSAIYWEKCKLIDGFDEY
                     EDEFLNFRRDIGELFESLFTIARSEVFNNLSNSVSSSLLNERCSNDQIKNADTSLYLL
                     TVISSIVGETENDTNLFYDLNCLFESKFLVRIASLPLSSDLDNKLYQYLVKDSIKFIS
                     EINWFYQTPSGLSHVNDVLMFLFKYLEDSNFQDSASRAILSITDTCRSDLTSLLNDFE
                     LAATSIIKNIDVDTNVRTRIIRSYSSILQTVANLRLQAEKISKFLDLIYTESISAYGS
                     IETTAGNADILEKIDAFLVSMVSSLVGLARGLEIPEDWEKYYEDDPDKMKLSYEYWKF
                     QDQHKFQVHDKCLKLVLLFTFPSYHFSNLSTKRNLNPEIVEQVYNLLRSGLSEPIPGP
                     FVIDYFEIIKLIIKVFQYCQTNETSNVDPPIIKFIQLYGILVKSNYTSSTITKITGLQ
                     VGIDDLHMSEVIDVLLFQNFDSITEDTDVLQYIFTLLGDIITCYPTELIQNPGFVRIM
                     EIFIDQIYRNCQQRFVVISLSKFASNLIYLRKGKLEDVEFMNHLLVDKNIGEILVLNL
                     MRGFINTSRSLIEFYVDIIRALTSKYGKYLRVWIENAFLRINEENMTKNAKIVDQKVV
                     EGFIKQLLVTRGQRVANRIIKEFWYTVTGMVDYGM"
     gene            complement(<83970..>85874)
                     /locus_tag="C5L36_0A00420"
                     /db_xref="GeneID:40381140"
     mRNA            complement(<83970..>85874)
                     /locus_tag="C5L36_0A00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463047.1"
                     /db_xref="GeneID:40381140"
     CDS             complement(83970..85874)
                     /locus_tag="C5L36_0A00420"
                     /inference="similar to AA sequence:RefSeq:NP_009404.1"
                     /note="PKUD0A00420; similar to Saccharomyces cerevisiae
                     YAR007C (RFA1); ancestral locus Anc_4.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318907.1"
                     /db_xref="GeneID:40381140"
                     /translation="MDKMVPGSIAKIFTENDTSTPLVLQTHQSKAMNDDVNRIRLLLN
                     DGKFSINSIFKPNDLQEKIENFQKCCYLSISNYSISVVSKKIFLLINQCEVVAQGEKP
                     TTSFESIDKYLKENPDLNKFPIDLTKQENTTPEPSSLNINTNANPSSTTAKTLALNPN
                     NQNNTKAARTPTPTLTSTLASSHSSHKSQVPPEFQGLTTIDQISPYLSRWSIKARVSY
                     KSDEKRWNKNGNEGKLFSVHFMDETGEIKATAFNQAADKFYDLLQENSVYYITKVQIR
                     SAKKQFSTLPNENELFLDKDSIITPAPDADDVPKVQYNFVKLDQIEGLENNTVIDVLG
                     IVKNVEEKREIVAKASGKPYDRRDITIVDESQTAINVGLWNKMARDFSLDPGTPIAIR
                     GCKINDFNGKQLSLTPSATIQANPDIPEAFKLKGWYDNQGSSENFKTLKSTTTNSTSL
                     TSKESILERITVAQVHETKLGYNEKPDYFTIKASVSYIRPDNFSYPACSTQGCQKKVI
                     QQGDGTWRCEKCSINHPEPLHRYILASSVVDETGQLWLNLFNEQAEQLIGKDAKSLLE
                     LKESSDETAFKNYLTDNVLFKEFIFRVRAKVDTYQGVDRPRFQVLSISEINPSTESDA
                     LIDIFNKLNL"
     gene            <87419..>91192
                     /locus_tag="C5L36_0A00430"
                     /db_xref="GeneID:40381141"
     mRNA            <87419..>91192
                     /locus_tag="C5L36_0A00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463048.1"
                     /db_xref="GeneID:40381141"
     CDS             87419..91192
                     /locus_tag="C5L36_0A00430"
                     /inference="similar to AA sequence:RefSeq:NP_011509.1"
                     /note="PKUD0A00430; similar to Saccharomyces cerevisiae
                     YGL006W (PMC1); ancestral locus Anc_4.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318908.1"
                     /db_xref="GeneID:40381141"
                     /translation="MTFTHHSRSSDLESHGSHYQIPIEKLQSLFDPKSIRNLLKIGGL
                     KALTLDLNTDLHSGLSQDYNENDIKQRINIYGKNKLPNKSQKSLLSLCWEALHDQVLI
                     ILSISAIISFVLGLYLAYFEPPEYDEDGNPLPNLEWVDGCAIILAVIIVVLVGAINDF
                     NKEKQFMKLNNKKDDRKIIVYRSNVKTYISIYDLLVGDLLYVETGDIIPADAILISGE
                     CSCDESSLTGESRTIDKKPIDQALSYFNDEIKSIKSQSFASTISTSSSSRFDVGDSDV
                     LDPFLVSGSKLLSGNGKALVICIGEHSVNGKMMMSLFHGNEDEEDAEETPLQVRLDHL
                     ANNISKYGFLAAIGLFLGLFLKFLYQLSTVLAHLSLLQKFSKFINIVITAITVVVVAI
                     PEGLPLAVTLALAFATTRMMEDGNLVRVLKSCETMGGATCICSDKTGTLTINKMTIVE
                     GLIGDDYFIDNGKKSTIDNSNHSHSSIEILQHCNDKLIDVLLKNIFLNSTAFENIEPQ
                     RRTTTNSELNKPKSSVLDSLKTLFKSERYNHILPLSSDSSNSNSNATITEKPDEFVGS
                     KTECALLEFVKYKVSQVDPRIPTVSKYRDDFESNIVKTVPFESSLKWSGVVYHDTSKN
                     NYTFLIKGAAEIVLDYCDYITGMDGHIQKFSKNEKENIGEKRQDMAKNALRAVSLAHY
                     TFKESEISKIDWSKISADDLVQYPLVLDLIVGIQDPLRPGVREAIEQCHRAGVDVRMV
                     TGDNVLTARAISKGCGILDDDTFDDPSYFMEGPKFRSLSDSERLRIIPNLHVLARSSP
                     EDKRILVQTLKKLGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIVLMSD
                     DFPSIVNAIKWGRTVAASIRKFVQFQLTVNFTAVTLTIVSAVASDDDTSVLTAVQLLW
                     VNLIMDTLAALALATDKPDDDILDSKPEGRSKLMISPNMWKMILGMSIFQLGITTTLN
                     FKGSQIFYGLPYDEVNTHDKFSLKAMTFNTFVWMQVFTLFVSRILNEPLCLNPSSTLR
                     ERLCYQNIGFFRNITRNYWFISIVSTISVSQVIIMFYGGRVFSIAPQTFGMWATALGS
                     GFSMIFFGGLLRLVPDYWLTDYLPIDGLCRVIYGLEWFIFGCGYFQSPEHREDYESFF
                     DSSDNIIQDGDNLVASQHSSDISRGTSSPTFVSSGSPSPMLEPSHSGETHKMNKLKSL
                     LIRSNNTSASSLTKEPNERSSSFTRTRSPSQTNLFDSVSVQPNYTDIDVSASK"
     gene            complement(<91446..>92366)
                     /locus_tag="C5L36_0A00440"
                     /db_xref="GeneID:40381142"
     mRNA            complement(<91446..>92366)
                     /locus_tag="C5L36_0A00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463049.1"
                     /db_xref="GeneID:40381142"
     CDS             complement(91446..92366)
                     /locus_tag="C5L36_0A00440"
                     /inference="similar to AA sequence:RefSeq:NP_011510.1"
                     /note="PKUD0A00440; similar to Saccharomyces cerevisiae
                     YGL005C (COG7); ancestral locus Anc_4.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318909.1"
                     /db_xref="GeneID:40381142"
                     /translation="MSHSNTVSSIDLGLPLEAKVLSQFFEEDFVPVDYVNALVATSLN
                     ANTNSSTNSATISGTSNSLNSSLSLKVLNQRLNSLSFRYNEYTNELSNQFDRTYSKLL
                     KSSIEVVSYSNTGNINSNDFVDNDDPHSVTRLQYQLSTLKTSMYSLLEDLQVTKESIN
                     SINPEIDNLPVSKLKELTEIQERIKNVDAAFELLKSLVASSDAVNSQDLNNVKDKLNN
                     KITIAEFGNSLNIIKQSIQEQIEKEMQSIKISSKVTKNDKLVKIIDSMIDMQPLFKSF
                     VHFQVPYSSFVDFLKLQKSNYMNVFEASRE"
     gene            <92572..>93780
                     /locus_tag="C5L36_0A00450"
                     /db_xref="GeneID:40381143"
     mRNA            <92572..>93780
                     /locus_tag="C5L36_0A00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463050.1"
                     /db_xref="GeneID:40381143"
     CDS             92572..93780
                     /locus_tag="C5L36_0A00450"
                     /inference="similar to AA sequence:RefSeq:NP_011511.3"
                     /note="PKUD0A00450; similar to Saccharomyces cerevisiae
                     YGL004C (RPN14); ancestral locus Anc_4.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318910.1"
                     /db_xref="GeneID:40381143"
                     /translation="MYTIPQVEIQSDALQVLIDEREHPNDESIWLRYNDELFDLKATG
                     KSFVNTKSNILITQSSNKSTSFQMMRFNDKFSLVFPNNYHGLKITENYNFTSIATCND
                     NILIGTDDGSVIKLPIPISIHPLFPIISQNIHFADIIKILRFPSNKVFLTVGLDLQIK
                     LWSNENKDSVLKTPVRILKNEHCRRITDVGMIGRGRNIVSCGLDGKIIIWEMSSALSV
                     WKASRIKDLNDGCTSLDIIQSENYVQSNKSNCFFDCEGKFIIVGHQSGFVTIWDCSAR
                     LFMFEHKVSNFAISDIKCVDQGRIIIGLNNGHVLLYQIDLKVRTLELIWDTHVEVSDN
                     LIVDIIHTEVYKGSVIVLSDNKLVRLNLKDGKLSDVYVGIDEKIFHFTILNGTLIVVG
                     KRNLIVSINL"
     gene            complement(<93944..>95911)
                     /locus_tag="C5L36_0A00460"
                     /db_xref="GeneID:40381144"
     mRNA            complement(<93944..>95911)
                     /locus_tag="C5L36_0A00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463051.1"
                     /db_xref="GeneID:40381144"
     CDS             complement(93944..95911)
                     /locus_tag="C5L36_0A00460"
                     /inference="similar to AA sequence:RefSeq:NP_015390.1"
                     /note="PKUD0A00460; similar to Saccharomyces cerevisiae
                     YPR065W (ROX1); ancestral locus Anc_3.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318911.1"
                     /db_xref="GeneID:40381144"
                     /translation="MTGPDYKTSLPPLAKIISPKQSPSNLNMNQDTLSNLDLHSKIQS
                     PIQQVPQNHQTQQVQPSLFYPAASNPAMSESNVLKSMNDFSNQLSQSNSSQHLPGLYQ
                     NLNLMRPNSNDSSHQSFLNQENLDLSNNDLLRQRQQSPLINNFYHNLQPNGFRQSPNP
                     LLQQVPLAYHHQQQQQQHQQQQQQQQNLQQNNQQQMFQLHQQYQFPQQVQPIQFNDHL
                     HVQQDFSQQTQTLEPPQNIPTKCTCKQNQAKRIPRPRNAFILFRQKHHQALIEEGNQL
                     KSNPEVSKELGEKWRALSDEEKQYWNNLAEEEKRLHAEKYPGYKYTPKRKSKKKCDFC
                     LYKQKLKLQMAEKAAARRIEKEQKRLEKQYKQKLSQQAKQMKVMSTSPLTMQQQQHQL
                     QQQQQPMQLNEFANTTLQNHIFNDMNLSNYQKYAQQIQQMRTPTPNSTSSTPLHASNP
                     YYNSAFTSYSQQQQQQQQQQQHPQQQQQQQQQQQQSSIKADDLKPFLFNNIGTFQRPQ
                     MGDGRQSPLALQTPNSTSPSSYNNSLASSNNLRVMQQHQHLPYQASEPDHPSQSHHDN
                     QNPSQNQQNNNPTSSSTTASSLFTEQNHPSRNATPLVNESETKNADSQDHSFSRVDEQ
                     GTSNASSVNQSTSLPSINALSLPPLNIQQNN"
     gene            <97348..>98445
                     /locus_tag="C5L36_0A00470"
                     /db_xref="GeneID:40381145"
     mRNA            <97348..>98445
                     /locus_tag="C5L36_0A00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463052.1"
                     /db_xref="GeneID:40381145"
     CDS             97348..98445
                     /locus_tag="C5L36_0A00470"
                     /note="PKUD0A00470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318912.1"
                     /db_xref="GeneID:40381145"
                     /translation="MLLKNLLLSTLLSTLVIADDQTTTSQVTVTITETLLTPQQSAQH
                     KALEQSSASAASLYSVESVESAASAASVASAASIVSIESIESIESASSLSAASVASVE
                     SVESASSVSAASIASHDAYLSSVSAVSASSVLNAIASASSLEAEHRIMIASASSVASY
                     DAYLSSVSAASHSSVSAASVSSASAASASFVSARSKSVHDQMVRSSMSLASHLAYESS
                     LSKASQISQASQASRLSVYSASVSAHNAQLSREHESQVLASKSLASKMAQASKIHASE
                     ESVRSAQQASISSESEYMKTHITTTHSSLSKAGGLLAIASETTTMKTVSTSSHAPVSS
                     ISKTSHGAGNSLTPVAGSLFGLIGFLFALSI"
     gene            complement(<98764..>100431)
                     /locus_tag="C5L36_0A00480"
                     /db_xref="GeneID:40381146"
     mRNA            complement(<98764..>100431)
                     /locus_tag="C5L36_0A00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463053.1"
                     /db_xref="GeneID:40381146"
     CDS             complement(98764..100431)
                     /locus_tag="C5L36_0A00480"
                     /inference="similar to AA sequence:RefSeq:NP_015463.1"
                     /note="PKUD0A00480; similar to Saccharomyces cerevisiae
                     YPR137W (RRP9); ancestral locus Anc_3.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318913.1"
                     /db_xref="GeneID:40381146"
                     /translation="MVDSFFVDPSKRKRKTRANRQTSTVRTNQKRQKSQQTNKASRIA
                     TEPEHENDSEEIDSLDEEEVDSDVFADVGEEKKEVEDINESDEEEDNGNESAADKRRR
                     LAKQYLKDLKESLGQGGVDSEDDDLESSGKQTNYAFDAKDLDDEIISSRLKKDVAEQK
                     GWVYKFYSKQIKSIIKRKVTRVANNCLTSVSVHYPYLFTTSKDLEISKWDIRDSTKNP
                     TLIKTVKGGIQHLELSKEHSENGHCDEIYASAVSPDGKYLVTGGKDGRIIVWSVNSLS
                     CIRVLETKNRNGQVLSLTFRRNSDQLYVACADLKIRTYSINQLAQLETLYGHQDLVTD
                     ISALAMERCVTVGSRDRTAMLWKIPDETRLTFRGGDSIEKFKKSDTQEKIFFEGSIDC
                     VSMIDDSHFVTGSDNGNISLWSLNKKKPLFTKRVSHGIQPKPKASNASAENDQKIREE
                     QISEPQPFWITSIYAIPFSDVFVSGSWDGRLKIWKLDEQQRSFELLMEIPIGGIVTRI
                     SHHEDAENGQLRIYTTVSKEHKFSRCVKPLPGSRNALLTCIIDMKET"
     gene            <100804..>103659
                     /locus_tag="C5L36_0A00490"
                     /db_xref="GeneID:40381147"
     mRNA            <100804..>103659
                     /locus_tag="C5L36_0A00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463054.1"
                     /db_xref="GeneID:40381147"
     CDS             100804..103659
                     /locus_tag="C5L36_0A00490"
                     /inference="similar to AA sequence:RefSeq:NP_015461.1"
                     /note="PKUD0A00490; similar to Saccharomyces cerevisiae
                     YPR135W (CTF4); ancestral locus Anc_3.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318914.1"
                     /db_xref="GeneID:40381147"
                     /translation="MNLEDRVTHAYMNDAAVSVASTPTTLFTAADGSIKVFDLINTTS
                     EPEIVNTLEKVKDFDIRVLNDKAYGLVCGGSDCSYHNLSNFLGINNKHRHNDSIISEM
                     KKIWRSEAKITQAIFTHGGQRACIGDLAANMVIIDISNPTDSTTFGKVTEKIKVNGEI
                     VGLSYSYAVDLMAVTVADGGIYIYSMSSNNTERRASLGTLVVDKRVALTHEMGLVDDD
                     DSDLSDLSDTNFDDEDSMFTETTMGVGGKNSRNKTNNLIKFASSKTAWNPVGDVLAVP
                     NKNYKIDFYNVVNWAVPAFTLYAGGNHHKNYISGLAYSPDGKYLASISLDKSLIIWDI
                     KDKKIKGKVGLPFIGCDITWCDNSSVAIGSNKGDVLTIDKSTFIDIITPKLVPEKEIN
                     DTTGTVDIANGKGVNNNVTGDSDDSGDDVNISDDEEEAEEERLDRRNSQDLDDFIIDD
                     ETNTDSRRRYRDNDSQSTELTDFNKRARRETGNDENHLYKLNVRSGWGRSLTKPYSVG
                     STPWEGSDRRYLTITPIGCVYTVKIQSVYKVTVLFFDEEKHRKYFFDDLNGFDICSIN
                     DQGSVFATSGYKKQKGFIARIEYKDHSNGKTGETQWIRDIALRPYEFITCVSVYGNNI
                     FVCTNKGFVRRYNLYGRLQNIMMMDCVVGIMNNNNYVFTVIKRTIGSGYLFNIQDLDG
                     EYIQQEVGLPLITENDFGEDQCDIPVKSMFFSSEGEPCLVRNDGILMVLTRWRDSNSK
                     PVWKPLLDIQEGVSRAGRGTELKAWPLGLFGDNFMFVPFRGTKFPIFPLLTPMNVDVR
                     IPLNYYDPNKRKPIREIDEEDRELFGDEENEIEEPQINKAEEAEEQFLRTLVLAEILN
                     DAISNNEVESSEGLEKLQLLSLDYDKALLIQIDDACSSGDSDDAYELCKMLRDSRALN
                     AAQRLAEMKSMAGLARRIMNLREARMAEEEHDVLEEE"
     gene            complement(<103750..>104481)
                     /locus_tag="C5L36_0A00500"
                     /db_xref="GeneID:40381148"
     mRNA            complement(<103750..>104481)
                     /locus_tag="C5L36_0A00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463055.1"
                     /db_xref="GeneID:40381148"
     CDS             complement(103750..104481)
                     /locus_tag="C5L36_0A00500"
                     /inference="similar to AA sequence:RefSeq:NP_012245.1"
                     /note="PKUD0A00500; similar to Saccharomyces cerevisiae
                     YIL019W (FAF1); ancestral locus Anc_7.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318915.1"
                     /db_xref="GeneID:40381148"
                     /translation="MAPVIVKFEDKYTNPTAQKPTSTEKKLRKSGKPISLAELKLKKQ
                     EAIEQQLKSANTGPSSAKDMKDDIELQRLLSESHLLKNLADSRRISKGESGAELTLKT
                     LNEPLIGKARVRTLDSRIDQLARINGDERKLEKLEKMPMNMRKGMIEAQKRRIEKYEK
                     EARENGIVLAKNRKGAFRQLENDRSFIAKDKIIGKGNIQKNRMRDRGLKIQSVGRSTR
                     NGLVLSSSDISKIQGRQGNDRRKRR"
     gene            <104789..>105577
                     /locus_tag="C5L36_0A00510"
                     /db_xref="GeneID:40381149"
     mRNA            <104789..>105577
                     /locus_tag="C5L36_0A00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463056.1"
                     /db_xref="GeneID:40381149"
     CDS             104789..105577
                     /locus_tag="C5L36_0A00510"
                     /inference="similar to AA sequence:RefSeq:NP_012244.3"
                     /note="PKUD0A00510; similar to Saccharomyces cerevisiae
                     YIL020C (HIS6); ancestral locus Anc_7.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318916.1"
                     /db_xref="GeneID:40381149"
                     /translation="MTKYVGCIDLHDGQVKQIVGSTLTTDNNDLSTNFVSSHSPAYYA
                     KLYKEHNIFGTHVIKLGSNRPNDEAAIEALSAWPGSLQIGGGINIDNCKEWIARGADK
                     VIITSWLFPNGGLSWDRLKEISSAVGKEHLVVDVSCKRQTIDGADSWVVAMNKWQTLT
                     NTTLSKELFHAMSEYTGEFLVHAADVEGLCQGIDEELVVKLGEWCSGLDVKIVYAGGA
                     RSLDDLQIVDKLSQGTVDLTYGSSLDIFGGDVKFQELVEWNKSH"
     gene            complement(<105609..>105983)
                     /locus_tag="C5L36_0A00520"
                     /db_xref="GeneID:40381150"
     mRNA            complement(<105609..>105983)
                     /locus_tag="C5L36_0A00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463057.1"
                     /db_xref="GeneID:40381150"
     CDS             complement(105609..105983)
                     /locus_tag="C5L36_0A00520"
                     /note="PKUD0A00520; similar to Saccharomyces cerevisiae
                     Scer_YGOB_ADL119W (ADL119W); ancestral locus Anc_7.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318917.1"
                     /db_xref="GeneID:40381150"
                     /translation="MTKPVIPDLRFEESLRARLVRNTILKQGLPCEDGEKPAKVAIPW
                     SVLAQSLVVDQIIMPFLQSFLLTSALIYVRPLLRYFSNRGYQFGSSLIKSIKTFSKTI
                     FFLNINTNMTTSSTGTAAATTV"
     gene            <106593..>107594
                     /locus_tag="C5L36_0A00530"
                     /db_xref="GeneID:40381151"
     mRNA            <106593..>107594
                     /locus_tag="C5L36_0A00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463058.1"
                     /db_xref="GeneID:40381151"
     CDS             106593..107594
                     /locus_tag="C5L36_0A00530"
                     /inference="similar to AA sequence:RefSeq:NP_012243.3"
                     /note="PKUD0A00530; similar to Saccharomyces cerevisiae
                     YIL021W (RPB3); ancestral locus Anc_7.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318918.1"
                     /db_xref="GeneID:40381151"
                     /translation="MSKEPQITIRKAGRDEVDFILSDVELSLANSLRRVMIAEIPTLA
                     IDLVEIQVNTSVLADEFISHRLGLIPLDSTDIDQLKYTRDCTCEDHCDKCSVTLELRA
                     NCETDETMNVYSSQFMITSNTGNTTLGQPVVRDPMKKGILICKLKKHQQLHVKCIAKK
                     GISKEHAKWSPCSAIGFEYDPYNKLKHTDYWYEESVEKEWPKSSNADWEEPPIPGEKF
                     DYNAKPDKFYINLETTGVLKPNEVFNKGCLELQQKIANIVFELGKLDQQQQQQQQQQS
                     ANPDDLTNIGYSNMGNEPSMNGRPNATQYGGHTQYGGTSYGGNTHYGGGDYTEGGRW"
     gene            <107964..>108761
                     /locus_tag="C5L36_0A00540"
                     /db_xref="GeneID:40381152"
     mRNA            <107964..>108761
                     /locus_tag="C5L36_0A00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463059.1"
                     /db_xref="GeneID:40381152"
     CDS             107964..108761
                     /locus_tag="C5L36_0A00540"
                     /inference="similar to AA sequence:RefSeq:NP_015454.1"
                     /note="PKUD0A00540; similar to Saccharomyces cerevisiae
                     YPR129W (SCD6); ancestral locus Anc_3.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318919.1"
                     /db_xref="GeneID:40381152"
                     /translation="MDSIIGKTIAIISYAEIRYVGTIDNFDGDKKIITVSNVRIFGTE
                     DRVVDSSKWVLPSADIYPKIELSGDAVKTLNILEGKPEDVKPVLLPEMVAFIQMQSSM
                     VPNMNTMLMDALKQEPKGEDVGETHAAVMQEPKEPVEAEIVEESKETPKEAPRPPPTN
                     ETVTRDDTDFDFTGNNAKFEKESFEKPVVKPIYDKKSSFFDDLGDDRSRNVNFRSNNN
                     SSNNNNNRGNRGNRGNRGNRGRGRGGRGGRGRGRGGFNKEPQPEWAF"
     gene            <108937..>109884
                     /locus_tag="C5L36_0A00550"
                     /db_xref="GeneID:40381153"
     mRNA            <108937..>109884
                     /locus_tag="C5L36_0A00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463060.1"
                     /db_xref="GeneID:40381153"
     CDS             108937..109884
                     /locus_tag="C5L36_0A00550"
                     /note="PKUD0A00550; Pfam Domains: Y_phosphatase(6.3e-54)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318920.1"
                     /db_xref="GeneID:40381153"
                     /translation="MYLQRRRGTLSAFFSSLPLQLEVGFMYTLFCPNVPPSYSFSAYP
                     MKPAGRLVEEYKALQREDSLNWKRFPKVSGGRGKDRYSNVLPYAHSIVNLQNGEYINA
                     NWIRPGGDSCHGGSSSDEVEDGVKYIATQGPLATTIGTFWSMVEEQCCRYSKVCVVML
                     TEVAENGQEKCFDYVDGIDESVRRIGGGFDKVFEERGKVERRFYKGERMGENGCRELR
                     HYWIREWPDFGVPNGEQDMVLKVVKEIEGVECVIVHCSAGVGRSGTFIGVDHCYRVRN
                     GACGVPDTFDVVYNMRRCRVMMVQRMEQYEYLNKVIENI"
     gene            complement(<109982..>111049)
                     /locus_tag="C5L36_0A00560"
                     /db_xref="GeneID:40381154"
     mRNA            complement(<109982..>111049)
                     /locus_tag="C5L36_0A00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463061.1"
                     /db_xref="GeneID:40381154"
     CDS             complement(109982..111049)
                     /locus_tag="C5L36_0A00560"
                     /inference="similar to AA sequence:RefSeq:NP_011419.1"
                     /note="PKUD0A00560; similar to Saccharomyces cerevisiae
                     YGL096W (TOS8) and YPL177C (CUP9); ancestral locus
                     Anc_6.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318921.1"
                     /db_xref="GeneID:40381154"
                     /translation="MHAFQYPTTSSTVSPAPVPALAAPSSSSRTSLAHMGIGATPSSM
                     SSMSSSPASSKSFSAIQSGPSNDLLKYSHSKRNSNSNLGMHSQPHLGIHQQPHLHSYA
                     SYPYSSYQSHTQLPPLQRLPSITSILSESPNRSGSVSSIESFLKSGATNTTINTNINT
                     PVNINTAANAGTCINSNTNGLLGSSLDTLSNLATNSISSLTSSSSSSCISRPSPTGES
                     SSLGLLHRNSLSNSHYLAMRPYQTDSRQRNISSPSLINYSSSSSSSSPSSLPSSVTPL
                     STLSSSGPKMKKKRSNLPKQATAVLLTWLVDNINHPYPNSKEKVELMRKTGLTPQQLS
                     NWFINARRRKIQMLKEKSSSI"
     gene            complement(<111956..>115219)
                     /locus_tag="C5L36_0A00570"
                     /db_xref="GeneID:40381155"
     mRNA            complement(<111956..>115219)
                     /locus_tag="C5L36_0A00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463062.1"
                     /db_xref="GeneID:40381155"
     CDS             complement(111956..115219)
                     /locus_tag="C5L36_0A00570"
                     /inference="similar to AA sequence:RefSeq:NP_009794.3"
                     /note="PKUD0A00570; similar to Saccharomyces cerevisiae
                     YBR235W; ancestral locus Anc_6.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318922.1"
                     /db_xref="GeneID:40381155"
                     /translation="MSSPLLINKKYDYGSVHDDEDSMKGKLGTIDGVTLPTILNVLSI
                     LMFLRFGFIIGQLGVLGTIIVLVISYTINTLTTMSVSAIATNGTVKGGGAYYMISRSL
                     GVEFGGSIGVIFYIGQILNSSMNVAGVIEPLIYNFNVDDGELGKILPVSYWWNFTYCT
                     IFLSICVVVALIGSNAVSKAGKYLCIVLLFSTLMIPISTLAVSPFETEYGLRYSGPSL
                     DTLRGNLFPKLTKGAAGSEVKGQETFNDLFGIFFPATAGILAGASMSGELKNPSKSIP
                     KGTIQGLVVTFLSYLIVILSMGVSIPRKLLYRDTQILEIVNLSPFIILAGEMSTSIFS
                     IIVGIVGAAQLLQAIAKDEILPGLQIFAENEKLSILVTWIICQLFLFADLNQIAIFIT
                     MAFLLTFIITNMACALLKMGSAPNFRPSFKYFSTKSAILGTMLSFITMLIVDSISAII
                     VFIILILLIIFIHFISPPKSWGDVSQSLIYHQVRKYLLKLRQDNVKYWRPQILLLIDN
                     PRTSWKLITFCNHLKKGGLYILGHVFIIKDFQENIQEFTSMRDNWIKIRDLSKVKAFV
                     QISIAESFNWGVRNIFIGSGLGGMKPNITIIGFYDLSKYRDVIPEWMHIENEGEEFDN
                     QVRVEINSLPTDQRAERSPKVGICEWIETLEDLSLLNSNIGVGKGFSKMVFPSEATST
                     KELPYIDLYPIQMAQRIQGDEAISTINFDTCTLILQLGAILHTVPTWRRHHRLRVVVF
                     VEDEGDMDEEYKRVRRLLEILRMSEATIKVVSLNGGSLRKYEYISRGDSSGLGEEEVK
                     RINELLEDDPWWQRVIELRKERANNSGCNNDKSNNKSNNSKDSLRYNKTMNNRKSRNF
                     EDIRRIVGPTIRRGRRMTVSDATEMGFSLGRMNFQAGGIQDMESDVESVNVSGNVNAV
                     LKSDASSIISSGKFTAARLPMSRIRRDAEGNDASIMWDDHYGPNEGLDIEGDVSSVAD
                     YSYGDVNGDNCGYNYSYSYNYNCGYSNGYNGNNIKVEFASMTRRAQFLVLNELMGQIS
                     PSGVTALILTTLPCPAPGTHNSHGECLRYCVDLALWTMDFPPSLLVAAKTVTVTSNL"
     gene            <115478..>118165
                     /locus_tag="C5L36_0A00580"
                     /db_xref="GeneID:40381156"
     mRNA            <115478..>118165
                     /locus_tag="C5L36_0A00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463063.1"
                     /db_xref="GeneID:40381156"
     CDS             115478..118165
                     /locus_tag="C5L36_0A00580"
                     /inference="similar to AA sequence:RefSeq:NP_009796.1"
                     /note="PKUD0A00580; similar to Saccharomyces cerevisiae
                     YBR237W (PRP5); ancestral locus Anc_6.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318923.1"
                     /db_xref="GeneID:40381156"
                     /translation="MSGYMSRSDSRRGRGRPSRGGHARNYNYQYGDYNQKYNYYDNRG
                     YNNYDYNYNYAHGYNNHGYDNHGYDNHGYNTNRQSQYPQHQQPQRVNVTTAEAIKNPK
                     TENLSGLNEANVPNRHRIENDETKTEHFEPKNAILNGLFERKSKIEEFQNKVQKPKKS
                     LMKFKKKKTNKVNNQEVKNALSFDDDDDDANIEYDHATASGGDDNTAAGSNDSYNNKS
                     ARMNDNKSMGDISVHDDIDLLLDKMSSDVGQKKISIQESDDERVAVNDDISLPVKPKR
                     DIPYHEPSNIPFVKKFYNECEEIKNIPESEINAFRISNGIYVKNSNIRPIFQWSQLGI
                     PSIIYDTLMLLGYDKPSPIQSESLPKIMSGSDFIGIAKTGSGKTISFLLPLFRLLFGN
                     KNDKISGFSEPRAIIITPTRELTVQIGKTCRPFTDSMALKVVKCYGGQSISVQIGELK
                     KGCDVVIGTPGRIIDLLCSNNGKILNLSKIQYFVMDEADRMFDLGFEPQIEKIVEQCR
                     PERQNVLFSATFPNKMQWLARRMTNNPIEVTIGSKNVVNEDIEQSFEVIQENGDKFNK
                     LLEILGQHYHDGNKILIFVERQSTCDSIVKKMIKRGYPVMSLHGGKEQHERDGIIKDF
                     RSGVIDIIIATSVAARGLDVQDLNLVVNFDSPSHLEDYVHRVGRTGRAGKKGLAITLL
                     ERDDRVLPDLVKMLKKSGKDVPLEVMELYNEVENQNTINNNSTTNHATTNQHRKKFSG
                     YSGHGLEQLQQRREVQNNAERKAFAVNEDDDDGGAGDGEANSFGEDLKINVHTGSGES
                     NMFRIERPTPEEAQVSLVGLSPDTRRLVTSPETVSQLSEMGVTVAVRGSASKGDLHLY
                     MEGSAVGVDRGVVFIRREVSRSLEEANGVTRKGGKYSVV"
     gene            <118360..>119013
                     /locus_tag="C5L36_0A00590"
                     /db_xref="GeneID:40381157"
     mRNA            <118360..>119013
                     /locus_tag="C5L36_0A00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463064.1"
                     /db_xref="GeneID:40381157"
     CDS             118360..119013
                     /locus_tag="C5L36_0A00590"
                     /inference="similar to AA sequence:RefSeq:NP_015258.1"
                     /note="PKUD0A00590; similar to Saccharomyces cerevisiae
                     YPL067C; ancestral locus Anc_8.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318924.1"
                     /db_xref="GeneID:40381157"
                     /translation="MSGALEKPLQWNEVKEIVSEYRLEELGRSPEGLKEYHNFKASMQ
                     AKGISLTTNIFINTLHWLPVDTDPHLSTEEAVKRIHYTDPRLFANPNDTCITLNDFPY
                     WIKEPTIHLLVWVRSPMPPDPNSEIGDIDNQTKKLIEEYVQETFVKGSGIDRDDIIWW
                     KNYTKIQSIKSIPHVHVLIKTEDKRVEEKARALVGTPGATLKYDDIGQNYTSNQVKL"
     gene            <122013..>123806
                     /locus_tag="C5L36_0A00600"
                     /db_xref="GeneID:40381158"
     mRNA            <122013..>123806
                     /locus_tag="C5L36_0A00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463065.1"
                     /db_xref="GeneID:40381158"
     CDS             122013..123806
                     /locus_tag="C5L36_0A00600"
                     /note="PKUD0A00600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318925.1"
                     /db_xref="GeneID:40381158"
                     /translation="MGFLVPGVRFIHDKKRKGRQNKPCSNLVYTNENKIFNRRYPNEL
                     FLQHTDKLARIYRGFIRMSKSTRNVNGIVKFKNLEYFRRRLEEYIILVQELENFSHEK
                     FRLPIPKSDAIDLLRKIITMQGMDLLERVNENMKNHKVPPLEARLSRNLELIEGGCIL
                     FNKFLSHGLTVEIKKKESITPVLSDQVQKSKKIQELNKRQFTNKRQDPKVNLFDELLY
                     SQRKITELPDEILVKIISYSNNVNNISMVSKFFHNFIMSHLEFISFEVIANKYTHRYK
                     LTKDTDGGDPYSNDEHHLLNSHNIKVHEAEYSEMETRALISSDFKRDVNGNFILTRYK
                     DKNNLIVLSSGVFDTPFLTYQIYKSLKVDHVIPVSAWQDLQERYNTELSKLAKPTDRI
                     SKMAFQQFWNETAINMPYMNQFNPGSLEMIKNGTYVDKLRIILDLMVSKTRFTNDLED
                     ILFFITSLIVQVESDQVDDAMDSCIVPFDILKQYSIYHLRQNRSETEGEDQRQEANEV
                     GNDNNANRRSDDEYWNELTLKNPYFYAYLKNTANEELEYEFCRVFYRSGIENNVQFWT
                     GLKNMGEMDLIEELIERNIAPSPFILTLLAG"
     gene            complement(<123942..>124928)
                     /locus_tag="C5L36_0A00610"
                     /db_xref="GeneID:40381159"
     mRNA            complement(<123942..>124928)
                     /locus_tag="C5L36_0A00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463066.1"
                     /db_xref="GeneID:40381159"
     CDS             complement(123942..124928)
                     /locus_tag="C5L36_0A00610"
                     /inference="similar to AA sequence:RefSeq:NP_015294.1"
                     /note="PKUD0A00610; similar to Saccharomyces cerevisiae
                     YPL031C (PHO85); ancestral locus Anc_8.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318926.1"
                     /db_xref="GeneID:40381159"
                     /translation="MSRTSSQFQQLEKLGEGTYATVYKGKNRESGTYVALKEISLDSE
                     EGTPSTAIREISLMKELKHENIVTLYDVIHTENKLTLVFEYMDYDLKRYMELNGYNSS
                     GALEPRIVKSFMYQLLRGILFCHDNRVLHRDLKPQNLLINSKGVLKLGDFGLARAFGI
                     PVNTFSNEVVTLWYRAPDVLLGSRNYSTSIDMWSAGCILAEMFTGKSLFPGSSNDDQL
                     LKIFRVMGTPNERTWPGVSQYPNYQSNFALFIPQNFRALIPNIDNLSLDLLQGLLQMR
                     PDTRLSARQALNHVWFDEYNNPQPTYITQHSNSPTTDLNVNQHSVPQHGYNY"
     gene            <125193..>127352
                     /locus_tag="C5L36_0A00620"
                     /db_xref="GeneID:40381160"
     mRNA            <125193..>127352
                     /locus_tag="C5L36_0A00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463067.1"
                     /db_xref="GeneID:40381160"
     CDS             125193..127352
                     /locus_tag="C5L36_0A00620"
                     /inference="similar to AA sequence:RefSeq:NP_014546.1"
                     /note="PKUD0A00620; similar to Saccharomyces cerevisiae
                     YOL095C (HMI1); ancestral locus Anc_3.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318927.1"
                     /db_xref="GeneID:40381160"
                     /translation="MELEKNDDFSVVELDIRCTEAQKLAITEPSLPNSLINIVAGPGT
                     GKTKTLCDRVAYLLGSGLKPNEIVIFSLTNQSVNDLKNILKETIGEELASLICITTFH
                     SFAYSIAMSDSPFWQMLTESKLLGTDVISHVLNSISINSRGKHKVSVRNDEFKLVDKL
                     SPRAISALKVTDSKLYVRYLSSPSATGALLKNENFLYDKLIHEMTQLLSLHNRGLIEI
                     ETNGLLKVNEIKEIIVDEFQDVSYVVMDFILELAKDKQLTIAGDIDQSLYGYSGATPD
                     ANINRTVPMYKQEGFHLKEIVLDRTFRFTDSIHKLGLNILNTGHSLIQETVSEENINV
                     VREEFSNTYEEFEFIYKEIKFLIENSEGNIRPKHIAVLSGTNDSLDELKMYLDNKNGP
                     FKCRRLTGTSLWTNSKISTIITLLKLLENPYNDASFLVCLSLLPKFGPKTIIDIKDGT
                     KNGKHVYDVLKDTPRLLKILPSDFFVNFDKVVENTDKSDPSSIIYNLTELCKLFNFPK
                     KLEDNWLVILSNFLEDLFARLKVISNTSGENTNILQQYISNYQNEVYNCERNTSATTC
                     EAISLSTIHSAKGLQWDIVFILTTNCYNKQGIQAVDSRTQYVGITRAKHLLYYNKSKF
                     DNFKYIDTKVDKVVEQSFVKVKYGKTIADYIPELKAYCKTNHLNIMPVFTKSFNKSEN
                     SKVLMELIGNMKKRAAFHVSYPQIPKMITRLGKLVSK"
     gene            complement(<129175..>129891)
                     /locus_tag="C5L36_0A00630"
                     /db_xref="GeneID:40381161"
     mRNA            complement(<129175..>129891)
                     /locus_tag="C5L36_0A00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463068.1"
                     /db_xref="GeneID:40381161"
     CDS             complement(129175..129891)
                     /locus_tag="C5L36_0A00630"
                     /inference="similar to AA sequence:RefSeq:NP_014117.1"
                     /note="PKUD0A00630; similar to Saccharomyces cerevisiae
                     YNL282W (POP3); ancestral locus Anc_3.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318928.1"
                     /db_xref="GeneID:40381161"
                     /translation="MSSLKGQEVQKKAIFKPLLSNPYTCRNKWPTVDHQLQKDLLTAL
                     ESNVLESIKTWNSLTREEKRKHPELKTNDANDILTGFNSIMKCLETQIQSIIKKQTIE
                     NRIKVLFVCKLDISCKLLYLHLPTVCALANVKLVSMPKGSSKRLSNALGLKNEVQLLA
                     IRENLYNKNKFLSLSVDSQVEDLSVGFIENIKNPKLDMDVKYVLTEMPIVKKNNHNNN
                     NKNKIKKSNNNSHNNNSKDT"
     gene            complement(<130978..>131676)
                     /locus_tag="C5L36_0A00640"
                     /db_xref="GeneID:40381162"
     mRNA            complement(<130978..>131676)
                     /locus_tag="C5L36_0A00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463069.1"
                     /db_xref="GeneID:40381162"
     CDS             complement(130978..131676)
                     /locus_tag="C5L36_0A00640"
                     /inference="similar to AA sequence:RefSeq:NP_010286.3"
                     /note="PKUD0A00640; similar to Saccharomyces cerevisiae
                     YDR003W (RCR2) and YBR005W (RCR1); ancestral locus
                     Anc_3.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318929.1"
                     /db_xref="GeneID:40381162"
                     /translation="MPAIRPHKPSTYSQLRKLARGISHELKRRDSFYYGDDGSDAARY
                     AFFAFAVVALILFIFFTCVVNKRRLRTGRSPIISSYLAPPNYQQSQSQYNANTTGGAN
                     LPTYTPNANPSQDVGYYDKNGNFIPAIKDSQGNVLNPNPDLVNNSTINNTGVELSTDI
                     PTAHTQPPNIYEPQSTNDMTYTRPNGPPPTQTYNTSPIQMGTSSSNMNELDDDPELPP
                     YEAPPLPEKSHYRA"
     gene            <132617..>134302
                     /locus_tag="C5L36_0A00650"
                     /db_xref="GeneID:40381163"
     mRNA            <132617..>134302
                     /locus_tag="C5L36_0A00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463070.1"
                     /db_xref="GeneID:40381163"
     CDS             132617..134302
                     /locus_tag="C5L36_0A00650"
                     /inference="similar to AA sequence:RefSeq:NP_014505.1"
                     /note="PKUD0A00650; similar to Saccharomyces cerevisiae
                     YOL136C (PFK27); ancestral locus Anc_3.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318930.1"
                     /db_xref="GeneID:40381163"
                     /translation="MPIHRIHLPSQSTVSMNNLDEYFNPPVLSHTNSMPVHTIHSNNH
                     THTKSPSHSNDSLNLLKASTKNSLKFSNSSNSSSGVTLANAQSSSSLHSMLSNQTATT
                     EYSPNLIDDECGDLLKIIDLDIDSDRSVPSQYTTDDEHQKIPYNGTLHEDLTSLNSSN
                     LDVDDTDVHTLRDNIRAQFHLEDDESDDNDDGYFDSDIDHHHASMLSPLTKTTTSTDT
                     CGCSHTIDDTITTVIPDYKDESKWNYKEKWAFVLIGLPACGKSTMIHDFMDYVNQNTD
                     GKVRVDSYNAGEIRRAYELEGHHRFDFNDLKSSQKLRDFYAFEALKNLTDFLVNDKTD
                     IGILDATNTTKVRREAIFDYIKKVSKETGVRINPLLLEVKCSNRALRRYNIEQKSKNK
                     DYKAMPHDNAINDFLGRIYRYENSYEKVTIDEIQHLNVKYFGIDNVGDSIYYDCGLDH
                     HDDTRHQNLTFNQIALDLLYRFLISYRTKYAGEYLTKVDEFYTGGHYKPITTHFSKPV
                     SVDDVKNVQKEPSGTINSVVKHENDESNNCDDKVSHTKVQFPKVLSSSRIDLY"
     gene            complement(<134566..>136014)
                     /locus_tag="C5L36_0A00660"
                     /db_xref="GeneID:40381164"
     mRNA            complement(<134566..>136014)
                     /locus_tag="C5L36_0A00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463071.1"
                     /db_xref="GeneID:40381164"
     CDS             complement(134566..136014)
                     /locus_tag="C5L36_0A00660"
                     /inference="similar to AA sequence:RefSeq:NP_014082.1"
                     /note="PKUD0A00660; similar to Saccharomyces cerevisiae
                     YNL317W (PFS2); ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318931.1"
                     /db_xref="GeneID:40381164"
                     /translation="MSVPTRRVHDLDITNDQKQKQSRKTVDYFTPLGKYMITKNVYNR
                     RRRSAFAIGSVRPDPSFITDLPPSMVSNPSIVDLNCKFTHVSTNKTRHAIHAVKWTPD
                     ARRILVSSYSGEFTLWNGLTFSFESIMQAHDLPIFSLEYSHNGKWLISGDQSGCIKYW
                     QPNFNNVNILNKGHENTVGELKFSPNDSKFVSCSDDQTLKIWDFTTAREERVLKGHHW
                     DVKSCDWHSSLGLVVSGSKDNLVKLWDPRDATCITTLHDFKHTVSKTIFQKGGNERLL
                     AACSRDQSTRIFDLRMLRPISNIKSDREADLTSLAFHPIHSTMLSIGGYDGSLAHYDL
                     SKTAEIEIFKDNNAKLGNIEEEDKKIAGKMKELRNSNDVNLKSEISDYVFNNLNNRGT
                     PVINDAWHSIPHAHEKAIYSIEYHPLGHMLCTAGADKSMKLWCRARPGDKNAFKDLAH
                     TGEENVKDDEFKDNNALALGGIPGLNSIPGFS"
     gene            <136168..>139269
                     /locus_tag="C5L36_0A00670"
                     /db_xref="GeneID:40381165"
     mRNA            <136168..>139269
                     /locus_tag="C5L36_0A00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463072.1"
                     /db_xref="GeneID:40381165"
     CDS             136168..139269
                     /locus_tag="C5L36_0A00670"
                     /inference="similar to AA sequence:RefSeq:NP_015142.1"
                     /note="PKUD0A00670; similar to Saccharomyces cerevisiae
                     YPL183C (RTT10); ancestral locus Anc_6.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318932.1"
                     /db_xref="GeneID:40381165"
                     /translation="MVVEKKKNHSQEISSTPQMVEVKMIPVQHMGPICSLKILSDGLL
                     LAGNGPTLEIYNYVTGEKLFKRIVFKRNKIHGIEFIKNGEAFQLVVWGGRSLSIFTLD
                     QFKDENFELPLLGVGDWIFHCVFQSSTDLYILNSHNVVHHVTLVSDRPKLLETIDCNW
                     KSILYSGTLHLNRDNNKITVLAGTVMNGILVWELETAKVKHNLTLHEGSIFSVNASPD
                     GRYLISCSDDRSIKVWDMESGNLLSNGWGHGSRIWGLTIYNMTADGFNMLSCSEDCTA
                     RIWTFKDGADEIKQERIILGHTGRHVWSLAVDDEKMIGFTGGADGKILVTDLNEQGRK
                     GYWGHRWELKDIFRECNYDLEKGELIKEYVDFGYGLYAVTSEGKAMVLKDHKSWSPLF
                     TDSRFEKFCVLKGFESSPICVLGSKLGRVIIMKFNENCEVIQQNEIDLSSHFNRLNNI
                     LIHEYDGKYFALFESPNPKHPLVYQEFDPVTLQVLYEVLLEKPDEKVCVSSVEYNKAK
                     EYLLVGCRYATLIVYQIKSAENKPTKVYSHLFKGDTISSLKSLDHEECIFHLTNKDGT
                     YHLMKIHDNLQYEFLQSSRIQKGFLEGGFKIPNGDLIFYGFKSDSFFIWNETKQYEIL
                     REICGGPHRRWFFKHWVNESDNRLKYRLIYTRASEVQLVEKGEAEAVETLATGLHGRE
                     VRDICIVDAEDENEKVVITGAEDTTLKIGTLKENGDFQLHWTYREHVAGLQSIHAINR
                     NYIITSSAREELFIWKITECDGKKCMSMNASLKPSEKNPDLRIMNFDSIEVFSENTAR
                     GCLIVAVYSNSAIKVVYFDFEEKKFSTLIDDAYMQCCIFHVRFVCIGGKLHIMIGSTN
                     GHLTIYDISETTDKYFVAEYEENSVKLRKKPVDVGMQIMKLGKLLINQQIHQSSIRAL
                     ATTQTSQNEVSIVTGGDDNAIALLRLYKCPGSQTKLDLKSFEASAASSTITTITHVNK
                     NQVLIGAVDQSIKLWNINNGLKLVANKYSTVADIGCSEITHFANGKKYALIGGAGLSI
                     WNL"
     gene            complement(<139490..>139744)
                     /locus_tag="C5L36_0A00680"
                     /db_xref="GeneID:40381166"
     mRNA            complement(<139490..>139744)
                     /locus_tag="C5L36_0A00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463073.1"
                     /db_xref="GeneID:40381166"
     CDS             complement(139490..139744)
                     /locus_tag="C5L36_0A00680"
                     /inference="similar to AA sequence:RefSeq:NP_015141.1"
                     /note="PKUD0A00680; similar to Saccharomyces cerevisiae
                     YPL183W-A (RTC6); ancestral locus Anc_6.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318933.1"
                     /db_xref="GeneID:40381166"
                     /translation="MLFNNFKLGLQRIGAAAAVNKHACAHNHSHLNMKIQPNFMTNLA
                     RTYKIRTAVKKFCSECYIARRKGRVYVLCKANPKHKQKQA"
     gene            <140374..>143493
                     /locus_tag="C5L36_0A00690"
                     /db_xref="GeneID:40381167"
     mRNA            <140374..>143493
                     /locus_tag="C5L36_0A00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463074.1"
                     /db_xref="GeneID:40381167"
     CDS             140374..143493
                     /locus_tag="C5L36_0A00690"
                     /inference="similar to AA sequence:RefSeq:NP_011421.1"
                     /note="PKUD0A00690; similar to Saccharomyces cerevisiae
                     YGL094C (PAN2); ancestral locus Anc_6.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318934.1"
                     /db_xref="GeneID:40381167"
                     /translation="MYTSVKAHNEPILKIINHKKGVLSLSFGSIRLGTSEGVTLFNIH
                     SEELKGLNTMSYTSNTQTELLVAGDKDATGSRIFKVDTVNHCISGSFHYPHTVVMMET
                     NLKYIILGRSDGFIDIMDPKTHNILKTFKGHSSGISDISVKDNNLLTSGFSVKKEQFI
                     PDTFVNSFDLKSLTTLPPIPFPAGAAKVFHHPTMPNVILISSSAGHMNFLDVKNPTRL
                     NIYQAEISTYITAFDMATSGSFLAFVDGSHKLSLWSSKSNEPNSGFALFNSPLTYPTP
                     VSEVIPAENHIVSPESPLSLVKVPPFHTPLLSAFPSDLVFKVGALPRQIDPEIQRSSE
                     VVNGVVVARYNREKFGPRNLANKYTSISSLTKNGTVIPRFLSEKDDDSEIDDYENAQN
                     KIKEEAIANEIFSLKSTNNDVPNAYKQLSILYSKFGVDDFDFDIYNKTKYSGLEINSG
                     NSFLNPILQLYRFIAPIFNHALLSLSEDVTMEPNLLVELGYLYDMMNKSNGKHCAASN
                     FQIIFSQLEKAKQLGLTKDTSMSRDDFKQRRLIQTFNRFLLDRLALDECKLYGTEQPN
                     RLNDICGVLTETNIFSNFCSLTHKRVAMYHSIDINTLPSLLTIPTTVTILNYMEASIN
                     KHAQQSITCENCAQIHPVNASLTINKLSHVVVLNIDLTNHQMNEIRYLTGWLVPNFYY
                     ALSPLGTPVLRTNTIGGTATDMKRYELIGYTAQITNRDNESHLVTYSKIRKNANDSGT
                     WYLFNDFLSMEVTEEEVLQVAHWWKKPVVVVYKEVGIYDEFNPNIYMENLNKDILYRD
                     QFVSGDRENKLIDYTLLSKDEEIKPGTLVALDAEFVELSPAEYEFNSDGSKTLVRPAK
                     LSLARISVVRGEGKREGECFIDDYIATDEPVHDYKTAYSGITHGDLDPKVSNKSLVHL
                     QVAYRRIWLLLNMGCVFIGHWLSSDFRMINIYIPPTQVRDTGKLFYLKKERRKLGLKF
                     LAHHVLKKDVQMSNHNSIEDAVSSLLLYKEYLKLKESGQFDSVLSKIYLEGQFSNFKI
                     PTEITLRKG"
     gene            complement(<143622..>146108)
                     /locus_tag="C5L36_0A00700"
                     /db_xref="GeneID:40381168"
     mRNA            complement(<143622..>146108)
                     /locus_tag="C5L36_0A00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463075.1"
                     /db_xref="GeneID:40381168"
     CDS             complement(143622..146108)
                     /locus_tag="C5L36_0A00700"
                     /inference="similar to AA sequence:RefSeq:NP_015145.1"
                     /note="PKUD0A00700; similar to Saccharomyces cerevisiae
                     YPL180W (TCO89); ancestral locus Anc_6.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318935.1"
                     /db_xref="GeneID:40381168"
                     /translation="MTQKVEDSLSFSNDSPSPLPRRKKNKQFTVVNSKKSVPRLPQSN
                     IKPHTKLLRNRSVDLLSEFMRDDKKKPSLTRTRSLEPAAIHLRHSPIPPHIENSITPM
                     KETHGSNVGTLLGSTMKTEEGTKPTDDLALQTPAETALEGKRVSEAKEDMTHKCFSDK
                     KESETEHSNSINSSLIEGDDTSAPTRIISGGGKEDFEQVNQRNFTSEDNDKKKSDRIG
                     SVKDDVNDESVIAREDPINGTDCSNLEKAISSEEKGKLGNQQNDAESIHNVGSCTQNM
                     ETENNIVKTDDETSSKIRDDELIRNHEKSSPNSSRRHTEELHNEVSSIYLRDLKTKNN
                     SLVSLKNFKLNTLLSQSTGQEHQIQASSSTTQVVVNTDPNNTGTGELLNCNGTSKQNH
                     DVAENFKDTPFPDSTLRQHGSTSKTDTIGTSFSNKSDSSNITNPDSLIFRQSGLTLYN
                     MNNEKMQTTNDTRQFNPSSMVRNVSQPSLHRQESYLSFRVPSKNTNSTDKNKRVESNH
                     QRVGRLEQPTPQKNHAQLKQAILNTNSKTSLLSEQAMRDEKIDEDSSRDKNNDAKIVE
                     IDLSSYLSSQEPEVETRTQQKLWLQRENVASLNVSEEGADQITSKIVNQTTRFQYEKI
                     SREFLHIRRHTNPTLDALKRINENQSPKKRLSIDAKSNDLLSKSVAKSMTTGYITKNA
                     SLSKSLGLSLKDSNTADDGYTGDLDSFNVLLKTMWKANCADFSEEIPSSNGKAANPSF
                     ESENNVLSSRYGYQPSNTSSSALFSRGNTTPFGTNAHISFGTSSKNRHVTNNHVNNNN
                     HGVHTQTQPTTRFQQHQEQHRQNKQHLRLR"
     gene            <146348..>148126
                     /locus_tag="C5L36_0A00710"
                     /db_xref="GeneID:40381169"
     mRNA            <146348..>148126
                     /locus_tag="C5L36_0A00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463076.1"
                     /db_xref="GeneID:40381169"
     CDS             146348..148126
                     /locus_tag="C5L36_0A00710"
                     /inference="similar to AA sequence:RefSeq:NP_011420.3"
                     /note="PKUD0A00710; similar to Saccharomyces cerevisiae
                     YGL095C (VPS45); ancestral locus Anc_6.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318936.1"
                     /db_xref="GeneID:40381169"
                     /translation="MAVTKKVNLYKVANDYIEKILASDRGENSTSIRVLLLDKDTAPI
                     ISLVSTQSNLLKKEVYLVERLESETRDKLRNLKCICFLKPSDLTITKLAQEINNPKYS
                     SYDIYFNNVISKSRLERLAEADDLEIVHKVVEVFQDYYVLNKSFFTATNAPNPLLASP
                     AIGWDPAAFQSSIDSLLSFILSLNIKPTIRYENNSKMAFKLANAMKYEIESSNSQLFD
                     NIMPRSITEPMVLILDRKNDPITPLLFPWTYQSMIHEMLTINNTNNTVDLSHLSSVGE
                     ELKTVIMNEIQDPFYEKCMYSNFGDLSSRLKEYVDDYKQKTKTNSNISSIKDMKFFLE
                     NYPEFKKISLNLSKHMLLTSEIDKQIHQKRIWETSEFEQDMCSTPDLSHHDSDLQELE
                     RFLHDKASRDGTINKPIPEDEKLRLLSLYAIKYENHASCKTKDLLETLNNPKFSSFIP
                     LLLKYCGSQARMAGEEGQIFNKLGNNGGSTNQVAALFNNFSRNSNSDNAYMQHQPRLV
                     NVLQRLLKTKTGLSDNLFPSVNTNNTTAKVPRDVVVFVIGGVCYEEVRFVYELNQNNE
                     DFNILIGGTNTLNSNTFINNLIDSST"
     gene            complement(<148256..>149701)
                     /locus_tag="C5L36_0A00720"
                     /db_xref="GeneID:40381170"
     mRNA            complement(<148256..>149701)
                     /locus_tag="C5L36_0A00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463077.1"
                     /db_xref="GeneID:40381170"
     CDS             complement(148256..149701)
                     /locus_tag="C5L36_0A00720"
                     /inference="similar to AA sequence:RefSeq:NP_015144.1"
                     /note="PKUD0A00720; similar to Saccharomyces cerevisiae
                     YPL181W (CTI6); ancestral locus Anc_6.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318937.1"
                     /db_xref="GeneID:40381170"
                     /translation="MSSRRSRRNHSTQPVYATEDFDLGENDMDTYNPPASVSSNKRSN
                     RSRNGDITAGETNRQMEEKEGAEEGEEFVDEVEEITRCICGEDDLSVPKNHQGEFNNV
                     DPGFFIQCETCSVWQHGYCVGIKDEENSPEKYWCEQCKPHFHTLFTDKFGYRRSQYDA
                     SSASSFHAKRGSKRKQGKGQAIKSGDEQTADLDSEIKNEDNDETSDDGKRKHRKRSSI
                     YNYEEMLKKALEESAKESGVNPEDVNITPSQINEGRELRNSNQRKSKTKLSETWNHQA
                     DDVDPKLEQGTEGGHKNDNSKNYINTQNHNHKDNDVNVTNAEEKPKKDIKKTNRRKTQ
                     VGSDMNESENFNETNTETDNNFPDRKLVGGSNTVTPSKRSSRREKKEQKQNVAPEDKP
                     FRANIPSARTNMNEMNRRIFSIVDFVSTIHINLSNEEEFKKTLYAMDDSTQVNPEITE
                     LKNKLITCYNDSVMHLDTLTSMLNKWQERYT"
     gene            <149971..>151272
                     /locus_tag="C5L36_0A00730"
                     /db_xref="GeneID:40381171"
     mRNA            <149971..>151272
                     /locus_tag="C5L36_0A00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463078.1"
                     /db_xref="GeneID:40381171"
     CDS             149971..151272
                     /locus_tag="C5L36_0A00730"
                     /inference="similar to AA sequence:RefSeq:NP_009795.3"
                     /note="PKUD0A00730; similar to Saccharomyces cerevisiae
                     YBR236C (ABD1); ancestral locus Anc_6.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318938.1"
                     /db_xref="GeneID:40381171"
                     /translation="MSFYNDDASRYKRRRVVKNRVGSSRRRTTDIEQTPNEANEDGYQ
                     NGNNNELLSNEKTNMTVSTPDVLKEKPVWMSDAEWAIQQASVKRAIEPLVQGDNDDKE
                     VDKMAYEDINVKMKYLKDIKDSGKDEIVKEYYNTQTFHSRQSKRTESPIYRLRSFNNC
                     IKYILINKYGIPEGSTLDLGCGKGGDLAKWGMNNTRQYVGIDLSDESIREAIKRYKNG
                     RYSFQAVFATGDAFKVELPEILKDFSMEQVSFLQFDNISMQFCMHYAFSSEASVESML
                     NNVSKSLRVGGMFVGTIPSSDFIKWKINKMKEGEKGWGNSLYSVTFPDLEGCWDREKK
                     NFKKPFGNVYNYFLKDAVEDVPEYVVPFEKFRSMCEDHGLELRYKKNFFDMFNKEIAT
                     FFPMLPGPLVQSLRQEDGTYGVSGEEREACSFYLSFAFERV"
     gene            <151800..>153209
                     /locus_tag="C5L36_0A00740"
                     /db_xref="GeneID:40381172"
     mRNA            <151800..>153209
                     /locus_tag="C5L36_0A00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463079.1"
                     /db_xref="GeneID:40381172"
     CDS             151800..153209
                     /locus_tag="C5L36_0A00740"
                     /note="PKUD0A00740; Pfam Domains:
                     SH3_2(1.8e-08)|PX(1.2e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318939.1"
                     /db_xref="GeneID:40381172"
                     /translation="MVSISAPFNVQHNPKVKDVAVLMWNNKSNKNEQESRSLRNTYSQ
                     NSSTQSVSTAHNSGSGFRKNAIVVCTIEFTAEYHNELSCSPGEVFKLIDPKVVNGWVL
                     VQSLSNGAKGWAPNSSMKLLDLFKNKNENTSKPSLGSQPSSVETSPCATSPKKDTRLL
                     SLRSSAASSSTSSSNSFIDYYASPRDSLPYSSVYVHSMYLREGNRYMFWYRVDLQSKN
                     IPNQIIHLARYYNEFASLHKALNKHIKSLNLDVILPKLPPSVDLLDSSEELDSLSRNL
                     SNLNRYLNVVFAIVNQQPTNSPLLQTLVTFLSPIDKDFQHYVSLTDDEIMKILTPQSS
                     NNPEEIPLDISLPNTTDNNGELFAKPSSIGVHRSASVSSTSSHSSKISNILDINKSND
                     FIKIKIIYRDEFSIIKLDMKTINFLTLSKAVARKVNRLNGLTLAYKNSNSVFILLRDD
                     EGLERALKDNNSKLIIKVI"
     gene            <153518..>154234
                     /locus_tag="C5L36_0A00745"
                     /db_xref="GeneID:40381173"
     mRNA            <153518..>154234
                     /locus_tag="C5L36_0A00745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463080.1"
                     /db_xref="GeneID:40381173"
     CDS             153518..154234
                     /locus_tag="C5L36_0A00745"
                     /note="PKUD0A00745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318940.1"
                     /db_xref="GeneID:40381173"
                     /translation="MQFGLLIWVLYSLLDYCLAHTGEYVFAINQINSSFPIPLASIHI
                     TDNETTIDPSNLVSEPLEDVCLSFFHARQETPQFKCFNYFENSNVASKNGELIGELRL
                     FMDHSWIDSVSFISTDSPLKITFSNINELHDPQPRLQIPTTELSSKDKSFSNAKDVMT
                     KETSENFEVEGKQEDDKSLKKPKLIDGDVDVDGVEFEEVVKPSNFYKDNQTFIERNWK
                     FILGPIVVIIIIGNLFGPRN"
     gene            <156629..>157159
                     /locus_tag="C5L36_0A00747"
                     /db_xref="GeneID:40381174"
     mRNA            <156629..>157159
                     /locus_tag="C5L36_0A00747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463081.1"
                     /db_xref="GeneID:40381174"
     CDS             156629..157159
                     /locus_tag="C5L36_0A00747"
                     /note="PKUD0A00747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318941.1"
                     /db_xref="GeneID:40381174"
                     /translation="MALIYSIAMSQAQIYRAQALLGKITGLNAEDKRASIAWIVSNFE
                     ALLEFKSKLKSSSNFKNKLQIQVFITNKLTVGTLQKCDEDNNQVKPLSDLNVVFEDGD
                     VTGFLSSLPNMKKIRNTVWNDTNNLDWQKRIGTQNHNVNTLDSIRIEGLDGIPIKEYI
                     DTLNKNTADSNIEKKR"
     gene            <157557..>158255
                     /locus_tag="C5L36_0A00750"
                     /db_xref="GeneID:40381175"
     mRNA            <157557..>158255
                     /locus_tag="C5L36_0A00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463082.1"
                     /db_xref="GeneID:40381175"
     CDS             157557..158255
                     /locus_tag="C5L36_0A00750"
                     /inference="similar to AA sequence:RefSeq:NP_012994.1"
                     /note="PKUD0A00750; similar to Saccharomyces cerevisiae
                     YKR068C (BET3); ancestral locus Anc_5.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318942.1"
                     /db_xref="GeneID:40381175"
                     /translation="MSKGTSKQNSRVKQIGEDIWKTQTTKINSELFTLTYGSIVAQLC
                     REQGYNYTKVNEILYEMGDNIGVRLIDELLSKANLERCTSFKETAEIITKIGFKMFLN
                     IVPNITYWSADGRTFQMVLPENPLADFVELPDDGDDIENDCNQELSINEQLSNLNIEN
                     ESGGEIKRRKGLARKDLWYSNILCGVLHGALEMVQLDCQVTFVSDVLRGDPSTEIRVK
                     LLQILKDEIPDGDE"
     gene            <158688..>160340
                     /locus_tag="C5L36_0A00760"
                     /db_xref="GeneID:40381176"
     mRNA            <158688..>160340
                     /locus_tag="C5L36_0A00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463083.1"
                     /db_xref="GeneID:40381176"
     CDS             158688..160340
                     /locus_tag="C5L36_0A00760"
                     /inference="similar to AA sequence:RefSeq:NP_011712.1"
                     /note="PKUD0A00760; similar to Saccharomyces cerevisiae
                     YGR196C (FYV8); ancestral locus Anc_5.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318943.1"
                     /db_xref="GeneID:40381176"
                     /translation="MTDEIAPLNENRNHLNYDERTNTSKKETGANAKTEKGFPVEETQ
                     PNDHDQEGENESTMVFDEHGNEVNHSEEAGEEMYDVDFNDYAEDEEPEESGNNEESDG
                     SEDDDDDDADDEFDDSELILPDIGISRENTLASRLNGESGIFDNPRQPSMAYQRPSLQ
                     SLSQEILDGEEAKNDAEFTSSSSAEFVNGAPSHSAESTRTSTMNSDLTIDNHDEFVSK
                     AKDEESIISYETDDAFSFMANDDKEYEIGYQPRGEDSGYSTEQNKFQRAEDDDLTDTE
                     SVRTENGGGKEEDYQPPIIPPVPHAPAVRDSVVIATRLESDVNAMRSAFVKENGDNDY
                     DNDESSDGESDKGGNGGKKGQTKGLLTREVEGKDAPSKDFDTNKSLDSDCDKNIDTAT
                     DRTSTSTSTLSNSSDLRNKKSIQVNVTTFSSIPNTDLMSILSKISTSDEKISKLKEIR
                     KELTNIETGLTDWISYNMGDSVKISKEDERLGPHVKEAIKLLDDGTLSGSSRNFAISD
                     TVETVAYGLKVSKLKEAVKDVKVSKIGQRGKTLLRKFKKAPS"
     gene            complement(<160447..>161196)
                     /locus_tag="C5L36_0A00770"
                     /db_xref="GeneID:40381177"
     mRNA            complement(<160447..>161196)
                     /locus_tag="C5L36_0A00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463084.1"
                     /db_xref="GeneID:40381177"
     CDS             complement(160447..161196)
                     /locus_tag="C5L36_0A00770"
                     /inference="similar to AA sequence:RefSeq:NP_011711.3"
                     /note="PKUD0A00770; similar to Saccharomyces cerevisiae
                     YGR195W (SKI6); ancestral locus Anc_5.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318944.1"
                     /db_xref="GeneID:40381177"
                     /translation="MSRSELLSPEGMRVDGRRYNELRAFECKINTHQHSADGSAYISQ
                     GNTKVLCLVRGPSDTLVPSSSNSVTPNNPTEPTISVSIIQPPYAKMERKSTSKNDRRL
                     TELAIFIKRALQQTIVKKNYSRTLIDVSITVLQLDGGLLAACMNAATLAFIDAGIAMY
                     DYISACSVALYDNCPLLDSNSLEETDLSNLTIGVVGNSEKINLLLMEDKIPLDKLQIL
                     INLGINGCHTIRQLMDSTVREIGLDILSKKE"
     gene            complement(<161624..>162028)
                     /locus_tag="C5L36_0A00775"
                     /db_xref="GeneID:40381178"
     mRNA            complement(<161624..>162028)
                     /locus_tag="C5L36_0A00775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463085.1"
                     /db_xref="GeneID:40381178"
     CDS             complement(161624..162028)
                     /locus_tag="C5L36_0A00775"
                     /note="PKUD0A00775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318945.1"
                     /db_xref="GeneID:40381178"
                     /translation="MHWKNEASLTRDQLANERSILASFRCTCTSLLSGASIMMAMLNV
                     LVGSATNSARYRTFLHQYVSFLKPTVVYLMSVGLFVSINGFLRGVRNIFSIPKSSIHP
                     SVLGMGLLFVGVFVVDVILLKECIVLGIKSVL"
     gene            <163166..>164488
                     /locus_tag="C5L36_0A00780"
                     /db_xref="GeneID:40381179"
     mRNA            <163166..>164488
                     /locus_tag="C5L36_0A00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463086.1"
                     /db_xref="GeneID:40381179"
     CDS             163166..164488
                     /locus_tag="C5L36_0A00780"
                     /inference="similar to AA sequence:RefSeq:NP_010559.3"
                     /note="PKUD0A00780; similar to Saccharomyces cerevisiae
                     YDR273W (DON1) and YOR042W (CUE5); ancestral locus
                     Anc_5.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318946.1"
                     /db_xref="GeneID:40381179"
                     /translation="MLPELNNVSAEPLGEGEMTNIIQPQESIKSNNSTKTKPEYDSNS
                     HNEVQSQGQGSSASGSASTETPAQFSTNPRGNLHPTVSAGSNASRDSKIQETHTNDSD
                     TPPMPPRPSTLSPRSATISHLKDIFPNIDLKYIKMALIASEGRLESASNALLFLSDPQ
                     SGIEVPITLNSSPQQPPSLQSDEKLARRLARSYQFHKPQTHSNKKLPPIPPAKPKSMR
                     EGDRKFLDLGDYSQDDVLDTLERNINDAKQTIGSWFSSVAKKLQNNDDDIDVGGGSGN
                     YGNDGLYSNNHNPNLRRQSSQSPYQQHNPQQRSSTETYPLRNKIKLNSAIESADDNDD
                     ATAAAASAVVDNDDDAPRLPPRLKKNLYSAVRITDSSLEPPDVKAGASVPSSTQSSKP
                     LAAQSSNNNKKWNPAKETVTEPANDAFLVEDSEDDEDDNINSGSTRKE"
     gene            complement(<164595..>166337)
                     /locus_tag="C5L36_0A00790"
                     /db_xref="GeneID:40381180"
     mRNA            complement(<164595..>166337)
                     /locus_tag="C5L36_0A00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463087.1"
                     /db_xref="GeneID:40381180"
     CDS             complement(164595..166337)
                     /locus_tag="C5L36_0A00790"
                     /inference="similar to AA sequence:RefSeq:NP_013361.1"
                     /note="PKUD0A00790; similar to Saccharomyces cerevisiae
                     YLR260W (LCB5) and YOR171C (LCB4); ancestral locus
                     Anc_6.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318947.1"
                     /db_xref="GeneID:40381180"
                     /translation="MRGHIDFKRNGIKLSGQPLIPAHTANSNTNPLGCCLPSSTSTSN
                     FSNSAITFLPFLCILWAQETSTGRENELEITYAYPIECAYSDNLETSDNMQFQLPYED
                     AKRKVRVASEIMFIDIESTKSELPSEDRDMKTCDLILKYSYPFSQFNPFTEEFHQQSI
                     FVIINPHSGKGTALEIFNDKVRPILEGAHCNITVQLTDYQGHATDLARELNIDEYDTI
                     LCASGDGIPYEVINGFYQRPDRAQAFSKINIVQSPGGSGNAMSLSCLGATSASLSALR
                     ILKGKPSQCDLMAISKSSSDEVILSFLSQTYGAIAQADIGTEWMRFIGGIRFDLGVAY
                     EVLSGKKYPCELAFKIKCKNNDEVMEHYQNEVGKYKNNSSTYSNLKNNNRDIQGARGI
                     YRDDSVEFDLTEQSQDKNVSCGLQLRKLTEDDFQLKYHEEFREDTSMRRLPEDWEIYD
                     KDKTENMRIFYSGKMPYIAATTNFFPAALPADGAIDLVVFDSRSKFASTANALLSLEK
                     GTHVWDDCVEHMKVEAFRLEPKSTTPCYISVDGERFPYETFQVEVLKGVLRTILWEGN
                     YTVTGFLENGYSSK"
     gene            complement(166476..166557)
                     /locus_tag="C5L36_0Atrna1S"
                     /db_xref="GeneID:40382469"
     tRNA            complement(166476..166557)
                     /locus_tag="C5L36_0Atrna1S"
                     /product="tRNA-Ser"
                     /note="PKUD0Atrna1S; codon recognized: UCA"
                     /db_xref="GeneID:40382469"
     gene            complement(<168178..>169143)
                     /locus_tag="C5L36_0A00800"
                     /db_xref="GeneID:40381181"
     mRNA            complement(<168178..>169143)
                     /locus_tag="C5L36_0A00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463088.1"
                     /db_xref="GeneID:40381181"
     CDS             complement(168178..169143)
                     /locus_tag="C5L36_0A00800"
                     /inference="similar to AA sequence:RefSeq:NP_014271.3"
                     /note="PKUD0A00800; similar to Saccharomyces cerevisiae
                     YNL128W (TEP1); ancestral locus Anc_2.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318948.1"
                     /db_xref="GeneID:40381181"
                     /translation="MEVVKPAKSFRDQKRLDLYHIQPNLLIGSYPSVDYTRKSSLLSE
                     NYEAILSSKFAKTLIVDLVSERKPYIARSSNILVKHVNWVDYHSVAFQELNLLVNVVS
                     NFLAKPNQGVFVHCKHGKGRTGTLVCAILIFMFRFTISEANSLFIQHRSIYHHGVQVH
                     SQKKLLQYFHQYLSFLKPMYIDLILKTIAWKVEGVEIVGDLKNSNSRKLEISLANIEK
                     NSKFSVYKFDRIGKTRVNERLVCAKLVSEDICFEIRHATIVMLSFCTFSINCAIEYLN
                     STKSAHESQCVIKVPFEEMDGVLGFGLKGKKCFSFIKIIISRVSL"
     gene            <170207..>170860
                     /locus_tag="C5L36_0A00810"
                     /db_xref="GeneID:40381182"
     mRNA            <170207..>170860
                     /locus_tag="C5L36_0A00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463089.1"
                     /db_xref="GeneID:40381182"
     CDS             170207..170860
                     /locus_tag="C5L36_0A00810"
                     /inference="similar to AA sequence:RefSeq:NP_011426.1"
                     /note="PKUD0A00810; similar to Saccharomyces cerevisiae
                     YGL089C (MF(ALPHA)2) and YPL187W (MF(ALPHA)1); ancestral
                     locus Anc_6.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318949.1"
                     /db_xref="GeneID:40381182"
                     /translation="MKFTTVGLLSILIASTTFAAPVSQADATADAVADAEAWRWHKWF
                     RNQAIYKREADASAVAEAEADANAEAWRWHKWFRNQAIYKRDADADSDADAWRWHKWF
                     RNQAIYRREDEPEQAEGDLEEEEYDGKEPIGFAYAFADDDKNSEPVAFFPMFASDFEE
                     QPTNGTNVAKRDADADAEAWRWHKWFRNQAIYKRDAEADANPDAWRWHKWFRNQAIY"
     gene            complement(<171120..>176441)
                     /locus_tag="C5L36_0A00820"
                     /db_xref="GeneID:40381183"
     mRNA            complement(<171120..>176441)
                     /locus_tag="C5L36_0A00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463090.1"
                     /db_xref="GeneID:40381183"
     CDS             complement(171120..176441)
                     /locus_tag="C5L36_0A00820"
                     /inference="similar to AA sequence:RefSeq:NP_012426.1"
                     /note="PKUD0A00820; similar to Saccharomyces cerevisiae
                     YJL109C (UTP10); ancestral locus Anc_1.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318950.1"
                     /db_xref="GeneID:40381183"
                     /translation="MTSLSQQLAGIAQRTKAVALDRKRRTKIHGVSFLNDPTIAATQD
                     YETIYYDALDALERLESIDRRFGKFKNSIFSLTSIQIDRHVQSQEENENLTKTINAFL
                     SLLAPYWHLAVAIRAAEWPLRRFQMNIYNAEHLLLTTLPYFDQPVFPRILYVVNDLPK
                     LFTWAVNFKKSNSNPSMNSMIKVFTDVDFFNLYSKFLQDELHHKSNFTKQLVFYVSMT
                     ISSIAALSSSTSDKLNSLIPYALETVSSLLSSKNDDCKTAAYTILIVISAAVPLTRSI
                     VLASIETVLLSSTQETKKNALSCVIKLLQSIQEQGLDPLPGKILQLLPSNMLEDMETL
                     KKIPNNEKFVCVYLRSLITNNGNIGVSETKNLKKLDITFSKHQLSVVTADLLNSIMNN
                     SASTNNYYIDLLKYLITENQELFLENLEKFNIKVSDLEMMVQSTLVDSLQTVPSDDEV
                     VDIKDSENDVDENLLEIYEANKSSIRSFLADDENSQITDKYNLLENLFVKSILNNSTA
                     SFLDTCFPDKESAVSFLLRLATSRCPIKSRLLSIVKLVQIVESLDSDVFAGTIIPVSI
                     TLLIDPIQQIRQSAVILIKALESSCSRSSAKKILLADVLYGSESQDFAVVSPKDSKPL
                     LESLDESSPNFIVDDTALFSCLETLLQNKKLGKIYLALFTTHALSVKIPAIKLNLINI
                     TIKSAENLKFAASPSTLFEDVLQLYVQSRDKWIKRCEQTQCDSIIFERTLLKLVIPKE
                     KNEFAIKFLESALASPYEQLSNLAKDQLIEILPTLKFDFQIKIINDILEEYLTDNIVN
                     YDPVEILESVEIKNVVFIELLKSCTLNTNEPSSQPANLPKRRRRSSQSTRQAMKDDEV
                     SNIASTHLKKVTMLLEILDVSSKKPYFDPSFELLNLIFTILDDLETLGKDGKLPILYT
                     QETIASCLKNIIERLKDMNVVVKNPSAIRADVIVSAIRASDSPQVQNKLLLVIAALAS
                     LSPELVLHSVMPIFTFMGAHTIRQDDEFSGHVVEQTIICVVPALANAAQYGKIDEIEF
                     LLASFVSAFLHVPRHRRVRLFTTLARTLGGDLSIHLILFLCGQQYVNAYMKHRMGDCS
                     ALVDFATVFLQAFSANEELDAAIKFLDLWKHIPEVPVEKDSQEFKELSSRVIFGPSIV
                     TMTKSELYNWRKGLVSFIRHALTDAKSGSDIPKLRLKVASLILEDKNTDILLNSFSSL
                     ITYLLDVIETSTKRHEDAEILKKFHKLLGDVLGLLPIQYYSKSVNDILNAPSTSVETM
                     KSLISLTAAKFNLEHTENAYAHEGIALLMPTLQEKISSSADIELSQASLDTMAALVHR
                     FGNSIASANLVKFLGVISGECGLANKNSPELTISSINCITSIIVIVGVKMIGLFPKIV
                     PPIFKIFEGCVNSKQESARLIQISITVFFSTLVKKIPNFLTPNIKDILKTLLRANLVS
                     DSIRSNVLEIVVEYIDSKLVMSSLCSLWAFAAGLNATSLGLFIGTMENTIEKMNKAAA
                     VSESTLFFRFLTNALEYRAISAFDSNTVGRVESMIHNCAIVYVMKLNDKSFRPFLAMI
                     VRWAFDGEGVVTEIGEVERLESFYKFFNKLQENLRAIITSYYSYILDSTVSLLNRFAS
                     GELSSSSLRRLILISLTSSFKYDQTEYWLVNSRFDSISEALTSQLHNIEDSIGKHLVK
                     ALCSLAQDTSSSDDHNKKLNELIISHMRVIGDKEPNAREKYWSVKALTTIYKRVGESW
                     LSLLPQLVPIIAELLEDDDDDIQTEVREGLAKIMEELMGESLDHLLA"
     gene            complement(<176739..>177455)
                     /locus_tag="C5L36_0A00825"
                     /db_xref="GeneID:40381184"
     mRNA            complement(<176739..>177455)
                     /locus_tag="C5L36_0A00825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463091.1"
                     /db_xref="GeneID:40381184"
     CDS             complement(176739..177455)
                     /locus_tag="C5L36_0A00825"
                     /note="PKUD0A00825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318951.1"
                     /db_xref="GeneID:40381184"
                     /translation="MGDQAYQNFQQHQQQYQNEHNTQLGSIVDLNPVFQEINNIDQGY
                     INIQPPPTVNAPIIPTQKTFKYANDCSISIGCTPSGFTTILLHIRDTPYFGVGTIYSL
                     SALELKDATIYYNSKHDFLLEEDIDPNSISPLDLDKDRRLHKICIYKLNETGEYRIDF
                     VKLAKTGIEELDRQDPWKDFNDMRNQGAGDRQVEMMRKFINILSTSRNEPDIIVTSSI
                     PEKSPDLKPCVGIMEFKRVQ"
     gene            complement(<177611..>178663)
                     /locus_tag="C5L36_0A00830"
                     /db_xref="GeneID:40381185"
     mRNA            complement(<177611..>178663)
                     /locus_tag="C5L36_0A00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463092.1"
                     /db_xref="GeneID:40381185"
     CDS             complement(177611..178663)
                     /locus_tag="C5L36_0A00830"
                     /note="PKUD0A00830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318952.1"
                     /db_xref="GeneID:40381185"
                     /translation="MTVSHAEHRRGQALDQQTERGRLHQVPNRFKLQKNIARIDTSED
                     PKILIRDLGLKRSSILRPTSNLLPFERLRVPSGSSTNLTQYKRYFMSNSTTHPEPSSE
                     CSLCSSLSTSPPLAGGEPRYMDRYFDYGNDRRAKNVPASESKFTYARSVSTQESRQIQ
                     FDLKLGKSDVDLRMPNPFVMETISPASSNDTNLLISSSTEICASNNIDSTHIDNSTAI
                     INEINCSSQFKKHYYNIHRENGSLNVTLNDASDNEEEIGSAWMNPSNYNDNIKSNNDF
                     SKETSKRTSKPFKSQHFSLKQRVQHEKASSNLRSLALFGHHPMMESMQRVKCKRQPQT
                     AVPEVDIVATLQSMWG"
     gene            complement(<179011..>180600)
                     /locus_tag="C5L36_0A00840"
                     /db_xref="GeneID:40381186"
     mRNA            complement(<179011..>180600)
                     /locus_tag="C5L36_0A00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463093.1"
                     /db_xref="GeneID:40381186"
     CDS             complement(179011..180600)
                     /locus_tag="C5L36_0A00840"
                     /note="PKUD0A00840; Pfam Domains: MFS_1(9.7e-31)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318953.1"
                     /db_xref="GeneID:40381186"
                     /translation="MSEVKEIDSTVDSEQGIIHSKDDKDIVHVVSYISERFEELDEDE
                     KEGIAGLDHLIKANHLSAEEVEALDKKVRWKIDCYIMPIICITYTLQFLDKLSLNYAS
                     AYELIPDLGLEGQRYSWVAAIFNFGYLAGSIPANYLIQKFPVAKFTAIMIFIWAIILL
                     GHIGAKNYGGILVLRFLLGVLESCISPSCMALSSAFYKKSEQPLRMCCFLSFNGIATM
                     LGALLSWALGHAHDKHLKIWQLIFLLIGLLNLVWSAVFLLLCPSSPVDAWFLDEKEKL
                     VGVERVANNMMGIKNAKYKKHQVIEALTDYKTLIYTLIGLACGVINGGASNFQSALIK
                     NFGFSSNMSTILQMPTGAIEFAVIFTAGVIAVLIKNTRCYIFILLCIPSLCGLIGIAT
                     IPLDKKWSLVGCTWLQYLIGGPVILSWIFLTANVAGSSKKTISNGFWFTFYAAGNIIG
                     ANIFYARQKPRYISGIIGLACCYGGMIVLGAVYRLGLMWENRKRDILYGVPTEEVKAE
                     AIIKGFQDYTDKENTGFRYEL"
     gene            complement(<181381..>186291)
                     /locus_tag="C5L36_0A00850"
                     /db_xref="GeneID:40381187"
     mRNA            complement(<181381..>186291)
                     /locus_tag="C5L36_0A00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463094.1"
                     /db_xref="GeneID:40381187"
     CDS             complement(181381..186291)
                     /locus_tag="C5L36_0A00850"
                     /inference="similar to AA sequence:RefSeq:NP_012956.3"
                     /note="PKUD0A00850; similar to Saccharomyces cerevisiae
                     YKR031C (SPO14); ancestral locus Anc_1.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318954.1"
                     /db_xref="GeneID:40381187"
                     /translation="MGDLLDNVDTQTRLKDYAIAQRIKDAEIVGNKSNLNPLQAPFAY
                     IDGTLSSTEGLRLLTTSLKSLFTKEHKIIEDSQYVETVDKEQMKNISQIINNYNHVKN
                     ENDELHSIFSHRTSHEQEVDYYIFQRLLNDPQPIILPRRDKTWKHSNCEKLFESQQIL
                     DNRDIQLVLDEKFQNSKKNESKRGNKENFMNELLFPKSIGEFKTNKMSPENLSSSINV
                     CLSDITYQFVDARESKKADENSINKSPATRGMNKESILKTSVMARNRLYRLHLEFNLG
                     DYVLRWDIDKDVKSLRSLHRRLNRIYEFSNKSGKPNVLPFPSLPRSDRVNKALNLLKV
                     DNFKSHKDRERDKDKDRSDVPLSSHTSISDVAISAFHSTPRRFSVKSIPFMKKDIADS
                     EDSQLIRRQEANEKFLSDLEKYLDALLSNLKSDDLSLKVYQFLELSPMSFFLVNELRE
                     KHKEGYLYITTSSAKQGWRVSHFRVQDWTSTIKRHTSKWVILGDSYIMYTKNFHSTII
                     EDVFLVDSATSIEYQGQTTTEYIELDDDGTENENTNDHQDETDLFFTPARKLLNKTNK
                     YPKIKMRNSERQFKLVAKLPKISNIWAHEIRRMVSETEWSQNQRFNSFAPIRNDCFAQ
                     WFVDARNYWYAASTAINMAKDVIYIHDWWLSPELYLRRPANGNQDWRIDRLLQKKANQ
                     GVKIYIIIYRNVGTTVVTDSMYTKHSLLDLHENIFVLRSPNQIMQNVFFWAHHEKLLI
                     IDQTVCFLGGIDLCYGRYDTPDHVLVDDSLTKFGNDEEKDDNTAVSEDSIGPPNVDEN
                     EDMEKLRYDFQREFQIFPGKDYSNPRKKDFFDLPDPHKDMYNRQFIPRMPWHDVHMVS
                     SGQIARDLSRHFIQRWNYLIRQKRPSRPTPLMVPPRSFTNDELEELGLKGTCEIQLLR
                     SSCEWSLGIKDHEQSIQNAYVKCIEESEHFIYIENQFFVTSTTIDNTLVKNEIGSALV
                     DRIICAHTRGEAWKAVIVIPLMPGFEADVDTKEGGSVRLIMQCQYMSISMGENSIFAR
                     LRRLGIKPEDYINFYSLRKWGLISDYKLLTTEQLYIHAKTMIVDDRIAIIGSANINER
                     SMRGTRDSEVCAIVRDKDLIESKMDGKKYYVGKFAHSLRVRLMREHLGVDVDLIDLVE
                     RRFAEIEKFCKSGNGIKASILSKKDGNMQLSAMVELGTRYLLGLDQGTPYFNEIKEDE
                     SLKDQLTKEMKSNFTKIEVNAERSQNLDDLVYPVSFNHRVGNVNPGLRSDKNLSNDVR
                     VANENHRKEVEGEIDGFRSSNFIVAKRKLKEFLKLRVQRTSSESSDPESLPYFEDIVE
                     VLSQKKSEILSKKENNSMNIDRWTMIKRLFYMRRLYCKIKLQNEKEEVFLGNNSESYN
                     ALKNRKTFNNFNSVEDNNSSNSPPPVEHLLNGGINSNFGNNNNVVIPDNPLVSLTDEE
                     LREIDKILLPQVDYDFIDPYNFEDPLDISFFEGTWMAQAVRNTMLFRMVFHVQPDDFV
                     QTWKDYKDYEEMRNAFDIYQHILKGHLQINESAESPPKEGNNLQDETEYENEDVEEHH
                     RRLQRNAKLIELERFQMSVTNENAGTSITPYGKGTVYDHETGLKLMKMVRGHVVCFPT
                     RWLKKEVESSNWFYKADKLPPIQIYD"
     gene            complement(<186749..>187261)
                     /locus_tag="C5L36_0A00860"
                     /db_xref="GeneID:40381188"
     mRNA            complement(<186749..>187261)
                     /locus_tag="C5L36_0A00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463095.1"
                     /db_xref="GeneID:40381188"
     CDS             complement(186749..187261)
                     /locus_tag="C5L36_0A00860"
                     /inference="similar to AA sequence:RefSeq:NP_009996.2"
                     /note="PKUD0A00860; similar to Saccharomyces cerevisiae
                     YCR071C (IMG2); ancestral locus Anc_6.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318955.1"
                     /db_xref="GeneID:40381188"
                     /translation="MRGGACSTIRFSKMIFFHFPLVHRQVYTDKYMQSGLQGEEHLIY
                     LPYLSVHLTLYRMSTISSSVVARLSKVLPSLDSISVAQLTAKPPLASYSLPRTSKGNL
                     PIYRTIRSQAVYTEIKRVQGNVVSFRNDLQTLLPHIPKEKYSCRTINGCLRIKGDFKD
                     EILELLQKKF"
     gene            <187784..>188536
                     /locus_tag="C5L36_0A00870"
                     /db_xref="GeneID:40381189"
     mRNA            <187784..>188536
                     /locus_tag="C5L36_0A00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463096.1"
                     /db_xref="GeneID:40381189"
     CDS             187784..188536
                     /locus_tag="C5L36_0A00870"
                     /inference="similar to AA sequence:RefSeq:NP_010335.1"
                     /note="PKUD0A00870; similar to Saccharomyces cerevisiae
                     YDR050C (TPI1); ancestral locus Anc_3.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318956.1"
                     /db_xref="GeneID:40381189"
                     /translation="MARTFFVGGNFKMNGSKASIKTIVENINNSSIPSNVEVVLCPPA
                     PYLSYTADLNKQANVQVGAQNCYPKASGAFTGEVSPLAVKDSGAEWVITGHSERRQYF
                     NESDEFVAEKTKFAIDQGLKVILCIGESIDEKKAGKTLDVCKRELSAVIKAVAPEDWS
                     SIVIAYEPIWAIGTGLAATAQDAQDIHAEIRKYLASQLGESTAQAVRILYGGSANGKN
                     APEFKDKADVDGFLVGGASLKPEFVDIINSRA"
     gene            complement(<188681..>189109)
                     /locus_tag="C5L36_0A00880"
                     /db_xref="GeneID:40381190"
     mRNA            complement(<188681..>189109)
                     /locus_tag="C5L36_0A00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463097.1"
                     /db_xref="GeneID:40381190"
     CDS             complement(188681..189109)
                     /locus_tag="C5L36_0A00880"
                     /inference="similar to AA sequence:RefSeq:NP_009369.1"
                     /note="PKUD0A00880; similar to Saccharomyces cerevisiae
                     YAL033W (POP5); ancestral locus Anc_7.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318957.1"
                     /db_xref="GeneID:40381190"
                     /translation="MVRLKTRYILFQIHSESQTAPTPKTIISTLRLSLSKNYGDKGLA
                     DSITSFIIKYFSPKTGMGILRCHFDAVENVLGAMFFVQTLDGKNVVLEAIGVSGSISK
                     AERRAIRRNKDMIRRLKNEGRENEVEGLILDMKDENEGEL"
     gene            <189427..>192342
                     /locus_tag="C5L36_0A00890"
                     /db_xref="GeneID:40381191"
     mRNA            <189427..>192342
                     /locus_tag="C5L36_0A00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463098.1"
                     /db_xref="GeneID:40381191"
     CDS             189427..192342
                     /locus_tag="C5L36_0A00890"
                     /inference="similar to AA sequence:RefSeq:NP_014980.3"
                     /note="PKUD0A00890; similar to Saccharomyces cerevisiae
                     YOR335C (ALA1); ancestral locus Anc_7.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318958.1"
                     /db_xref="GeneID:40381191"
                     /translation="MSSIWKRTIRNMSIYTNPATNPKIKEWPAAKVRDTFLNYFKSKG
                     HTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTVDPSSSFANLKRAVNSQKCIRAGG
                     KHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKEGAIKYSWELLTEVYGIPKDRLYVTYF
                     GGDEKTGLEPDLEAKGLWQQVGVADDHILPGNVKDNFWEMGDQGPCGPCSEIHYDRIG
                     GRNAASLVNEDDPDVLEIWNNVFMQYNREPDGSLVPLPAKHIDTGLGFERLVSLLQDV
                     RSNYDTDVFYPIFQKIQEITGVRPYTGKFGKDDSDGIDTAYRVLADHVRTLTFALADG
                     GVPNNEGRGYVLRRILRRGARYVRKYMNYPIGNFFSQLAPTLIEQVKHIFPELEKDPS
                     TIFEILDEEEASFARTLDRGEKLFEQYALIASKTPEQTLSGKDVWRLYDTYGFPVDLT
                     RLMAEEAGLKIDEEGFEKARLESKEASKGTGTKTGKTLLKLDVHALASLNDQSVPKTD
                     DSFKYDTKDIHAKVLSIYSNGQFVDSISQSEQQVGIVLDKTPFYAEQGGQEFDTGKIV
                     IDGKSEFSVENVQVYGGYVFHTGFVQEGELKVGDDIIAGYDELRRWPLRNNHTGTHIL
                     NFALRKVLGDSVDQKGSLVAPEKLRFDFSHKKAVELKELEQVENITNKLIKDNLKVYA
                     KPVELEIAKGINGLRAVFGETYPDPVRVVSVGVPVDDLLADPSNEKWNNYSIEFCGGT
                     HVAKTDDIKEFVIIEESGIAKGIRRIVAVSGMEAKEVQRKASEFNGILNEVEKLPYGE
                     VKERRIKELGTELGKLSISVIEKAALKDKFSKIEKAVKDETKSRVKKDTAKVMDAVKS
                     YFETPEHSAVCTLKVTAGANAKIVAEAINYMKKEQKESCLYLVLGEDQGKVAQGVYLS
                     PAVQDKIAAVEVATKAAEYIGGRAGGKGNSCQGMGDKAENADKAVEEIKTLLEKLSV"
     gene            <192583..>194205
                     /locus_tag="C5L36_0A00900"
                     /db_xref="GeneID:40381192"
     mRNA            <192583..>194205
                     /locus_tag="C5L36_0A00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463099.1"
                     /db_xref="GeneID:40381192"
     CDS             192583..194205
                     /locus_tag="C5L36_0A00900"
                     /inference="similar to AA sequence:RefSeq:NP_014108.1"
                     /note="PKUD0A00900; similar to Saccharomyces cerevisiae
                     YNL291C (MID1); ancestral locus Anc_3.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318959.1"
                     /db_xref="GeneID:40381192"
                     /translation="MMAHMLNHWTLIFLLFNSFFTLAVELGNLSGSSLNTLFSATIDH
                     NIDDEYKSTDIVNSYILAESVPVKDNIPYGSMLGYRFKPNMSAEFTHSYQIIIYLSAS
                     LCQLPVNWNTSISNNGLTLYYTFNETIANNTDFKNMEKVDFQGGYASAIAETEIISTD
                     SDYMLYLMIQPQQCNNCTAEDIWVYEFAASQRKVMFLYDTEPRISVLDVDYEAAIFQT
                     GDIPFGQNSSYSLYLFKDEYPIPIGLNQSWCAISENQQYDKKISVNESLVSSLKNAFV
                     VSDLDIAKTYTGVLVITNDIIPYGGGIFEPFVFTMSKTRSCKLAYGLEFCDEVAYAVP
                     ISESYLYGKESWSEFVSSYDNYSESLYQPFEYALQQVACDTELDARYSPIRTCNDCKY
                     SYKQWLCAVTIPRCVSSLNSGVFNLNYTAEQGRNEYIAEHIKPPLPYSEILPCLNVCQ
                     AIVRDCPADFGFGCPKTPELVQLSYGDQELLKGNSDADDTDDDESNAIAELVRETLSD
                     GSIQTYRLCNYLGVSNIYTSSSSAEATSSAST"
     gene            complement(<194272..>195462)
                     /locus_tag="C5L36_0A00910"
                     /db_xref="GeneID:40381193"
     mRNA            complement(<194272..>195462)
                     /locus_tag="C5L36_0A00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463100.1"
                     /db_xref="GeneID:40381193"
     CDS             complement(194272..195462)
                     /locus_tag="C5L36_0A00910"
                     /inference="similar to AA sequence:RefSeq:NP_014107.1"
                     /note="PKUD0A00910; similar to Saccharomyces cerevisiae
                     YNL292W (PUS4); ancestral locus Anc_3.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318960.1"
                     /db_xref="GeneID:40381193"
                     /translation="MLRVFSMDGVFAINKKSGVTSRQVVDQINRILSNSTSGNKSLDQ
                     LKNARNESNGKQRLRKWKTSKLKMGHGGTLDPLASGVLVIGVGSGTKKLGEYTNGSVK
                     RYECIGLLGGSTTTGDSEGELLLKTEVDHVTMELLEKTRDRMIGTLDQTPPIFSALKM
                     DGKRLYDYAREGLPLPREIKSREVKIIDLNYKQDTLTNNHEYKFIKSQVDETGRSLSE
                     QLAKNPTLNDHKIPFAKEWTEKHSDDKGLPLEMKPVKDSSAYESDDYRAPLLHFESTV
                     SSGTYIRSLLSDIGRCVGSSAYMVDLVRLKQAQWDMSKNVFEMEDFTNYREEIWAPVL
                     QKVLTSDNGEVNVREEMKKAIKEHPEAVKSDKEIEELETEREEEDKRRKERQNDHSNK
                     RQKK"
     gene            <195730..>200640
                     /locus_tag="C5L36_0A00920"
                     /db_xref="GeneID:40381194"
     mRNA            <195730..>200640
                     /locus_tag="C5L36_0A00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463101.1"
                     /db_xref="GeneID:40381194"
     CDS             195730..200640
                     /locus_tag="C5L36_0A00920"
                     /inference="similar to AA sequence:RefSeq:NP_014102.1"
                     /note="PKUD0A00920; similar to Saccharomyces cerevisiae
                     YNL297C (MON2); ancestral locus Anc_3.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318961.1"
                     /db_xref="GeneID:40381194"
                     /translation="MSQRVPGSGIPDQFISDLVNIAVDAKRKNPEIRHACDHSIDILQ
                     PFSSSNNKVNENPKLKGNFEEAIKSRPEFISPLLMACHSKNPKLIINAIKILGRVVQL
                     RLIPDNKNLVEQIVDALSDASTLGDEVQVKLLQLLPTFAQINARYITGETLSKLLFIC
                     SNLQTANKSLLIINTAQATFSQIMDIAFQKVGSEEMPSTTFHEINIDDHIQMEVDDFS
                     FDAYRILDDICSLVEHHRPSFLKPAYISEDYGFEILESLIKNNSELFRKHAELASLLR
                     TKLAPILLRFISSSKDFNLMVKVCRIILVLVTEVFEVMKIESGVILSLLTHILTKESG
                     SPYWKKVMVLEIYVAIFKNITLLEQLFKEFDINADQPSKSLVKECLQACLTIVIENKS
                     LLNTGDLVQPPFNLQIKSEQQQSLPSGLNSSDFKDSVRFIDSIDKHEAPHVVPTYSLF
                     MITQMFTALSSCIQHSTLKLMKIADPVQYLSPEALDQHKSEENDEAKKAYNCIYELIR
                     HTWEIQLQTADIFIHSSLDDDSFTNVLTILENLCYCAGSLTFVEVQHVVFSYLAVCTL
                     KLDGSCGYKSKVLSFGESLVGTISSTLGHAVSNIGNSSHDDKYEPHIKFYPRSINSRH
                     ILCFHTLVRLAVSLSKRLNKDWEIILIVLQWMSYYVDGPSGFKKKEFPAVSEYLSNRD
                     LQIVEHSLTELNKSICNLNTETFTILLKSIISLSCKVLDEPHEELFGQLPVDKDGNIQ
                     PCVFNKLFYVSKITDVSSISPTKFMILSSDNMDSIRAFFSNIVGNRDYSDETRHLGSR
                     NFNAIIRASAESGFEDSDPKIHERTECEVLDQMSRFMMDLFELPMSNELLVANCEGEI
                     YLQTLETLRNIVDRFGSLIASSWDIVTEMLNFPFSLIKKAENNAPKENALREIIITLL
                     KSTFETMKVILDEYLQCIPKSQIKIIIDSLHNFVNQAFDLNISFNAISYFWIISDFIK
                     EKVDVSPKSPKKTSLISTEAALSSYIVSTPANDFEFYKYLWVYLVLQLTKTMLDRRAQ
                     VRNGSIITVFNIIDSFPSEDSLCEILFNLVLSPVILKTRAPSLISMKPQEQNEWMESF
                     VNIINGLSKFLLTYVPISKRNEFADTMKVTISFFIHLVNLDYGWVELNNSIYKSYHDL
                     LNKISEADVPPQNDLLESLYDFWAKIKINYNFGNPSMYQKALLTLVGCFPLSMKLFIP
                     IMNPEKFEKMLMVLNHCIRYPILADSRNDDERCTFLQESILKNLENLIFDKTDESYYA
                     YQSIIIQQLNMILVLPFHTRDLIVKKLGDKGVKIPTFVAASGYSMRILKSQIKDMSDL
                     TFLNDQSIVKVVKSLIEPSKLKRDILIVNDNNEKTYLWMVSYELLTSVIVKFLGMIMD
                     RQDKLSPTTISRLNEFLPNCLQAYECCFIAHDASSKTNDFAYSQYKLLSATLLKFINL
                     YYGTQENYQVSRELAEKFVSITWEFSFFYKHDSLMESFFGSDVSTYTSITELIDILTF
                     EPNWNIYGSTEPIVIHSHIRLLSSCFKDLYKMSNAREYSEISKIAFPFFLVRCAYGLR
                     KYLMQSKQIKRMPLSKILVIEMEYVSEALNGLIQLESNNERNAMFEKILPMVFQLNSH
                     GATEATQKNLAEMSVQFITSTKNGSV"
     gene            complement(<200745..>204326)
                     /locus_tag="C5L36_0A00930"
                     /db_xref="GeneID:40381195"
     mRNA            complement(<200745..>204326)
                     /locus_tag="C5L36_0A00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463102.1"
                     /db_xref="GeneID:40381195"
     CDS             complement(200745..204326)
                     /locus_tag="C5L36_0A00930"
                     /inference="similar to AA sequence:RefSeq:NP_009579.1"
                     /note="PKUD0A00930; similar to Saccharomyces cerevisiae
                     YBR023C (CHS3); ancestral locus Anc_3.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318962.1"
                     /db_xref="GeneID:40381195"
                     /translation="MVFKRKRSLIRRDRTRPLSGQSKNTLSNSNSTRLSGYQDNTATS
                     NDHYTDLNDYGEFENDASEIPMQNLSNKRDSNISYNRKFAPLDERDDIESALTNPFIP
                     EEDRRNREGLGSPLYNQPKEIFHLNDETQEDSGLIDSNHQVSTEDSTLKKDDAVTATN
                     NFYTAIPPKRLELEEDKGGFPYWKLYCYAVTFWAPGALLNCVGLKTKDRQYAWREKMG
                     LISIILVIGAIIAFLTFGFTRATCTHLTVKLKPQDVSTAYIVVNGRAYNLLHSSHPGV
                     PGIQEGTNVLYPPLDAGAKDASLLFQNVNGNCKGLIKPTANSNIPHDGDDMAWYMPCK
                     LMNLNGTTKPDFSFKYYDGYACHTSEYARSSFYDLKVQGDIYYDWETISNSSRDLIVY
                     NGQVIDMGFIDWLYKDELTYPKLFDDLKNDKTLKGYDISLLLTEPHQKQIADCLIEIA
                     KVGVVDSSTIGCIASTIVLYVSLVFVLSIVFVQFFVACYFKWFVAPYQGASYSSVKEM
                     NEKNNQVENWVDDPGNSAQLPDVPLKRRADYHSARRASKSLRLSWGGDLNDYVENFKS
                     QEVGEYNPKYITMTTEAYMMANADTKKRQNRNVSTASMLTSSNLNPFKTKDPFADESE
                     IETLDPALISTDAIPQPPVNWEPFGYPLIHTMCLVTCYSEDEAGIRTTIDSIATTDYP
                     NSHKLIVVICDGIITGAGNDRSTPDICLDMMTDLVIPKEEVQPFSYVSVAHGSKRHNM
                     AKVYAGFYKYDDSTIPKEKQQKCPVLLIVKCGTPAEMTSAKPGNRGKRDSQIILMSFL
                     QTVTFNERMTPLQYEMLKSIWQVTGLMSAMYETVLMVDADTLVYPDSLTHMAAEFVKD
                     PEIMGLCGETKISNKAQSWVTAIQVFEYYISHHQSKAFESVFGSVTCLPGCFCMYRIK
                     SPKSANVWVPILANSDIVEKYSDNVLNSLHKKNLLLLGEDRYLTSLMLRAFPRRKQVF
                     VPKAACKTVVPDEFKVLLSQRRRWINSTVHNLMELALVKDLCGAFCLSMQFIIIVQLI
                     GTLVLPASITFTLYIIIIAMVSKPTPTMSLILMAIIFGLPALLIVVTVSNLAYVLWMC
                     IYILSLPVWNFVLPTYAYWKFDDFSWGDTRKTEGGDKGGHGDSEGAFDGSQIKQMTWR
                     EYERARRENTYLTVPSASHSNLASVYNPGSFDERMEYIDLSHEYSLD"
     gene            <204952..>207696
                     /locus_tag="C5L36_0A00940"
                     /db_xref="GeneID:40381196"
     mRNA            <204952..>207696
                     /locus_tag="C5L36_0A00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463103.1"
                     /db_xref="GeneID:40381196"
     CDS             204952..207696
                     /locus_tag="C5L36_0A00940"
                     /inference="similar to AA sequence:RefSeq:NP_009530.1"
                     /note="PKUD0A00940; similar to Saccharomyces cerevisiae
                     YBL023C (MCM2); ancestral locus Anc_8.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318963.1"
                     /db_xref="GeneID:40381196"
                     /translation="MSDRRSPRKRLHRHDDRSDDSSDEEITENYQTRNTAPQRHLGSS
                     PPASDLPDIASSPNMEPFPEDLEGDGFNVRDEVDDDLRELDDNDEDEDEIANEQLETD
                     EELEEATGRDLIGDDMLDDYKERPEEDRYDDLNIDDDAVDEMDLGQRRQVDQLLNLRD
                     DFSRNNLDLDDDESMDGQQSEDEFGLPTQRTRRRFEEDLNDEELGANEITYAQLIDIK
                     APSVLEWICQPQVTRTIAREFKSFLLEFVDKNGRSVYGPKIREMGESNSESLEVSFFH
                     LLTSKAILVDFLRQCPEEMLKIFDVVAMEATEIHYPDYTRIHSEIHVRIIDFPDLLNL
                     RDLRQSHLNNLVKIRGVVTRRTGIFPQLKYIKFDCPRCKTVLGPFFQDSNQEIKIRFC
                     SNCEYRGKMPINSEQTVYRNYQRITVQESPGSMPAGRLPRHKEAILLWDLVDIAKPGE
                     EIELVGIYKNSYDGVLNAKNGFPVFATVIEANNIKRREGGSISSDDDSSPYQISLEDE
                     KMFKSMSNQPDIIDKIISSMAPSIYGHKYIKTAIACALFGGVPKDVNGKHSIRGDINV
                     LLLGDPGTAKSQILKYVEKTAYRAVFSTGQGASAVGLTASVRKDPVTKEWTLEGGALV
                     LADKGVCMIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSVIAAANPIGG
                     RYNSTVDLQRNVNLTEPILSRFDIICVVRDLCNPENDERLATFVVDSHMRSYPEENVD
                     LENDDDEPNNEEDIADNLNDEIVKSKRRDKLEKIKKAKESEISPIPQDILTKYIYYAR
                     TRIQPKLNQMDMDKVSRVYSDLRKESNTTGSFPITVRHLESILRAAEAFAKMRLSPYV
                     SSSDLDRAIKVIVDSFIGAQKVSIRRQLQRSFMKYTLPHRSHRSARSTSFAAGTTAGA
                     "
     gene            <208032..>208694
                     /locus_tag="C5L36_0A00950"
                     /db_xref="GeneID:40381197"
     mRNA            <208032..>208694
                     /locus_tag="C5L36_0A00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463104.1"
                     /db_xref="GeneID:40381197"
     CDS             208032..208694
                     /locus_tag="C5L36_0A00950"
                     /inference="similar to AA sequence:RefSeq:NP_015438.1"
                     /note="PKUD0A00950; similar to Saccharomyces cerevisiae
                     YPR113W (PIS1); ancestral locus Anc_3.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318964.1"
                     /db_xref="GeneID:40381197"
                     /translation="MAPVTQLSDPVKPGDIFTFIPNLIGYGRVITLVLSFFTMKNHPF
                     ITMGLLYNISCLLDAFDGYYARKYNQSTSFGAVLDMVTDRCSTCSLIVFLSVLYPQYY
                     IAWQALISLDLASHYVHMYAQITSGSSSHKKMREGANWLLKLYYENRTFLFLVCAFNE
                     LFYIAIYLYSFDAAWAYWIIVVSTPVWFFKQICNVIQLVNACQILAELDAKKINSERK
                     ST"
     gene            complement(208936..209007)
                     /locus_tag="C5L36_0Atrna1P"
                     /db_xref="GeneID:40382466"
     tRNA            complement(208936..209007)
                     /locus_tag="C5L36_0Atrna1P"
                     /product="tRNA-Pro"
                     /note="PKUD0Atrna1P; codon recognized: CCA"
                     /db_xref="GeneID:40382466"
     gene            <210535..>212781
                     /locus_tag="C5L36_0A00960"
                     /db_xref="GeneID:40381198"
     mRNA            <210535..>212781
                     /locus_tag="C5L36_0A00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463105.1"
                     /db_xref="GeneID:40381198"
     CDS             210535..212781
                     /locus_tag="C5L36_0A00960"
                     /inference="similar to AA sequence:RefSeq:NP_012668.3"
                     /note="PKUD0A00960; similar to Saccharomyces cerevisiae
                     YJR134C (SGM1); ancestral locus Anc_4.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318965.1"
                     /db_xref="GeneID:40381198"
                     /translation="MSEEKEESSQCAKETGVTETVPTKKLSLQERLAIAAQKKASDSN
                     KKKNKKKQEDTMKEGHGIGEKAQAEECAYLDKVVQLIDDSTKRDDILEAVKRYVSAKN
                     ERLESKIVILESELKKVKTKTTLANKTSDDGLLKKLKEKEDQIHDLLDEGAKLSKKEL
                     ALSQTIKRLKSRETELESDLSRLESTIEELNAKIDGMEKSLDMCDVNERQLAEERLRV
                     ESLQAKYEAILKANDGLTDELKEIKFSNLDGKLKNIQKELDEERQENEQLNEDYKKLN
                     LLHQELKKENEETISNLQKELKSQRAINIEREAEIKRLEEKVEELRYHTETTISNKSS
                     DSSIELLQTQYDQAQENWKLIESTYLRNISKLETRIDELQIDNVTYSKKIKVLTNDLK
                     QKNSEIKELQETNLSLLDELKNSKKQNDKLKSEIEDLTQRLNQAIVDCKNEKESLVKK
                     IEKLQEESANLESTLKLRMNEFNSSTSNIPQNSFYLQDLSSASSLNFKNASSHSPSIG
                     TPLGRQFSNKRLSLQFGEGALAPRLPSSSSAFTLNKLNNIGSLSAQDKILRHQNSIIS
                     MDSNDAPLGINTSARSISEGLPEFTVEEEDPDEIGMDATSDRYTVGEGVDTPILNNSN
                     EGVGVNVQLIKKLGDHARMLELEVSTLKDETLALEKEKECASAEIGRLIEENSKVNEL
                     KHEIELRDSEVRKIDDNYQRVLVLLGEKEERLGELNEDIEDLKVILREQVQQMVEMQE
                     KINELSKQ"
     gene            complement(<212930..>213820)
                     /locus_tag="C5L36_0A00970"
                     /db_xref="GeneID:40381199"
     mRNA            complement(<212930..>213820)
                     /locus_tag="C5L36_0A00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463106.1"
                     /db_xref="GeneID:40381199"
     CDS             complement(212930..213820)
                     /locus_tag="C5L36_0A00970"
                     /inference="similar to AA sequence:RefSeq:NP_012667.1"
                     /note="PKUD0A00970; similar to Saccharomyces cerevisiae
                     YJR133W (XPT1); ancestral locus Anc_4.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318966.1"
                     /db_xref="GeneID:40381199"
                     /translation="MYLRDNSQYCPIVFILYFFFPLQKLHSLSSFFSSSIIVSAACPR
                     KKNGGSFFFIWTTFPSNFSKLHLCEDIFLLTLLVEDPSHRCHPSRSMSEEKIYISYNN
                     VHKLCQKAASQILETVGKPDVIVAIGGGGFIPSRIIRTFLRQTGEKNIPIQAIGLSLY
                     EDLGLGADTIGKEVIRTQWLDFGSLAQQFDSLIGKNILIVDEVDDTRTTLHYALTELY
                     NDVKENADKLGKTMEGTKFSIFVVNNKLKEKRADLNESLMNGGIYLAGEDVPDKWIAY
                     PWESDDIDTHTANAIAQGNN"
     gene            complement(<214054..>215991)
                     /locus_tag="C5L36_0A00980"
                     /db_xref="GeneID:40381200"
     mRNA            complement(<214054..>215991)
                     /locus_tag="C5L36_0A00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463107.1"
                     /db_xref="GeneID:40381200"
     CDS             complement(214054..215991)
                     /locus_tag="C5L36_0A00980"
                     /inference="similar to AA sequence:RefSeq:NP_012066.1"
                     /note="PKUD0A00980; similar to Saccharomyces cerevisiae
                     YHR196W (UTP9); ancestral locus Anc_4.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318967.1"
                     /db_xref="GeneID:40381200"
                     /translation="MKSPIVVSPSLGSTFVAASIARPDKTSIDVLPLDYLLAHKEGEE
                     EEKGEGEGGLSPQPGKFEIDFLNGEQVAAFKWLRVPKGSDERGSTAATAAPNVSKRRR
                     DSFPLEKTTPDFIDYLVILLTTGEILVYSTFLKEFTNKISSDSNFSAMEVMSNTGDHN
                     IVVFDSSVSSVKFFQSNSPQIVSTIPFKEDANISCILSLENDDLQLNLILASSSAIYI
                     INLKGEIIDKIDISLPESGTVNSKQRLPAFDNSTPILKMAKHKNEDILYLTRKNNAII
                     QVVDLKSKTSRFLTASTTITDISILRTNNSYIIAATLLGGSVELFSPRSEETSSYARL
                     EIEGGKDIGKFVGLLDSNNIIDGVYKGVWYDHFNIQITDIEFDDISALDGTIRITVTN
                     SGDDELLELSDGESSGNDEYYEADETFTKPKNVDNLQCTDLKEFSQLIRQKLILPDLD
                     NERDDVNKNEYFTELLAQNTTFAKPIIHTLSVDETKILFNRVAYLVSQFPSSINQDFT
                     IVSNVKQWLKWILILRGSAIINDDESIGWLKLLRSEFNQEAKVLNNMVKLTGKLTLLK
                     DQLEIRKEMMKAAGSNGEADGENEADDVNNDSGSDSEDDAINVMDGEGGFGEEEADDD
                     DSDNEDDDEDDDEADDNAATE"
     gene            complement(<216224..>216634)
                     /locus_tag="C5L36_0A00990"
                     /db_xref="GeneID:40381201"
     mRNA            complement(<216224..>216634)
                     /locus_tag="C5L36_0A00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463108.1"
                     /db_xref="GeneID:40381201"
     CDS             complement(216224..216634)
                     /locus_tag="C5L36_0A00990"
                     /inference="similar to AA sequence:RefSeq:NP_014574.1"
                     /note="PKUD0A00990; similar to Saccharomyces cerevisiae
                     YOL067C (RTG1); ancestral locus Anc_3.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318968.1"
                     /db_xref="GeneID:40381201"
                     /translation="MSKQDNTLAGVTTSNNSSNRRKDNINEKIAELLQLIPERFFADL
                     GEKNTGTKDGRPNKGQILSRAVDYISWLQGEIDSRNRREVQLTLALEAQQLQLQQQQQ
                     HDSVQHESESQHNRHTVAEEMLAQIGVGPLAEQN"
     gene            <216974..>218446
                     /locus_tag="C5L36_0A01000"
                     /db_xref="GeneID:40381202"
     mRNA            <216974..>218446
                     /locus_tag="C5L36_0A01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463109.1"
                     /db_xref="GeneID:40381202"
     CDS             216974..218446
                     /locus_tag="C5L36_0A01000"
                     /inference="similar to AA sequence:RefSeq:NP_010452.1"
                     /note="PKUD0A01000; similar to Saccharomyces cerevisiae
                     YDR168W (CDC37); ancestral locus Anc_8.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318969.1"
                     /db_xref="GeneID:40381202"
                     /translation="MVDYSKWDKLEISDDSDIEVHPNVDKTSFIRWKQRDIHEKRMER
                     EHQIKGLKVQKEMYTQLNKRVDFLLAALGDNDLSVEGTRNSMLNSKFDKDERCTLESN
                     NEDSPPYNQMVEDLFTQIIEDLKKEEGEIEGSKIRSKVLEHRAKINGVLEQIDPKIEE
                     FEKEKHAHITSEDIHDGWNSSFINKKKKEEEAEREKSESSPSTNSSKTTIIETLNTLA
                     SKPTKKPSKPISQLGELELLKETETFLTLPSLKAQGQFILEHPFIACTHQKDAVLLKA
                     FDLELNDKRKEAIELIKKGILLQFCADLLENPPYPMPEDTRITYVKQLLSQMENDESP
                     GKVAYDEECKRMIDHVKTRCKIIRKEQEAEQEGGENSEELVEQIQLRSVDPNSKLIVT
                     IPEEGTKEYEIYKQLPEKMRDALATGSLDEVNRVFASIPVDDAEAMLEKFNESGVIGV
                     QALLDNESQFQELVENEKKFEEMKKAAESIDLNDQVHQDE"
     gene            complement(<218554..>219054)
                     /locus_tag="C5L36_0A01010"
                     /db_xref="GeneID:40381203"
     mRNA            complement(<218554..>219054)
                     /locus_tag="C5L36_0A01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463110.1"
                     /db_xref="GeneID:40381203"
     CDS             complement(218554..219054)
                     /locus_tag="C5L36_0A01010"
                     /inference="similar to AA sequence:RefSeq:NP_014570.1"
                     /note="PKUD0A01010; similar to Saccharomyces cerevisiae
                     YOL071W (EMI5); ancestral locus Anc_3.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318970.1"
                     /db_xref="GeneID:40381203"
                     /translation="MFRSTARRALHISRPLFIAKPKADSVPIDKTAAPQGYLQGKPVK
                     NYYVDEETNEIVIKVQPLKREGESLETMRKRLTYQSRKRGILETDLLMSRFAKKYLSS
                     FDRGMLEEYDKLLDELDWDIYYWATENYKITPLPDKWKDSKVLKLIQQESRNEKKEIL
                     RMPSLN"
     gene            <219408..>220124
                     /locus_tag="C5L36_0A01020"
                     /db_xref="GeneID:40381204"
     mRNA            <219408..>220124
                     /locus_tag="C5L36_0A01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463111.1"
                     /db_xref="GeneID:40381204"
     CDS             219408..220124
                     /locus_tag="C5L36_0A01020"
                     /inference="similar to AA sequence:RefSeq:NP_014845.1"
                     /note="PKUD0A01020; similar to Saccharomyces cerevisiae
                     YOR202W (HIS3); ancestral locus Anc_8.612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318971.1"
                     /db_xref="GeneID:40381204"
                     /translation="MSPQKKHKLDDDRAAISSHLEHTAYIKRITNETKIQVAISLRGG
                     DISLPSSILNKTYDRTPDAKSQTICIHTGIGFLDHMLHALAKHSGWSLIVECIGDLHI
                     DDHHTCEDVGIALGEAFHEALTAHGPIRGVKRFGYAYAPLDEALSRAVVDLSNRPFAV
                     VELGLKREKIGDLSCEMIPHVLESFATSARLTMHVDCLRGFNDHHRSESAFKALALAI
                     KDSLSSTGKDDVPSTKGVLM"
     gene            complement(<220233..>221414)
                     /locus_tag="C5L36_0A01030"
                     /db_xref="GeneID:40381205"
     mRNA            complement(<220233..>221414)
                     /locus_tag="C5L36_0A01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463112.1"
                     /db_xref="GeneID:40381205"
     CDS             complement(220233..221414)
                     /locus_tag="C5L36_0A01030"
                     /inference="similar to AA sequence:RefSeq:NP_015213.1"
                     /note="PKUD0A01030; similar to Saccharomyces cerevisiae
                     YPL112C (PEX25) and YOR193W (PEX27); ancestral locus
                     Anc_8.601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318972.1"
                     /db_xref="GeneID:40381205"
                     /translation="MALQYTPPMPLNAHPSGARVVKPLQTYREPSAFEIFNACVNDLT
                     GKDKLAKLTQYGIRLIGAVHDIHGFGNSRVKEKYRNLELVDNAVKNGDSPISNGSQLR
                     LILSQTATVFKGHRLKRLLYLFLAYLTRKLAGLLNGLNIYRHLLRAGTVPFRVWKFAN
                     HIKHSIKILLDESKSDGQAVKLEKVLQYWTTRDMVSQMCNFWYALSDEILLIFRFGLL
                     LRGKQGGFGFADALFSWAEDHELYSWMALIILGLQKDWNKWLHLKNEESRIILNQKVK
                     ARTRRIVGDMQRQRGNKLGSPDVDFEDYERVEEEFEYDHGYFSRLAKINHDKTTILIN
                     SVRLTCDLLFDAKYIMHWNMYRPLHVALGLASGTLGFVNCWRGQRERLVAEALAKMRE
                     Q"
     gene            <221688..>222614
                     /locus_tag="C5L36_0A01040"
                     /db_xref="GeneID:40381206"
     mRNA            <221688..>222614
                     /locus_tag="C5L36_0A01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463113.1"
                     /db_xref="GeneID:40381206"
     CDS             221688..222614
                     /locus_tag="C5L36_0A01040"
                     /note="PKUD0A01040; Pfam Domains: Glyoxalase(7.3e-35)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318973.1"
                     /db_xref="GeneID:40381206"
                     /translation="MVDSSFLTNTTCLHVSNLDASLEWYIKSFGVSVIKRTQQENYKS
                     AFIALDSDGHPSRGLSVSARSGVIELRELLGEIGKKATVYDGNQDPYKGFGHLCFSVS
                     NIEAAQKKLLEQGVQFKKRLEDGSMNFVAFVQDPDGYWVELIENQIHKEAGVYNLQSN
                     RMNHTMVRVKDAHKSLEFYKGVLGMKHFSTLDFPDMKFSLYFVGYEHSEGYTENKEDF
                     TQQASRQSIIELTHNYGTENDDSFPGYYVFGKDDSAVGFDHFSVSCKDPKGVAKELKA
                     RGAAIVAETAEAFTIADPDGWRVQIHSLDYLN"
     gene            <222963..>223984
                     /locus_tag="C5L36_0A01050"
                     /db_xref="GeneID:40381207"
     mRNA            join(<222963..223882,223966..>223984)
                     /locus_tag="C5L36_0A01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463114.1"
                     /db_xref="GeneID:40381207"
     CDS             join(222963..223882,223966..223984)
                     /locus_tag="C5L36_0A01050"
                     /inference="similar to AA sequence:RefSeq:NP_013710.1"
                     /note="PKUD0A01050; similar to Saccharomyces cerevisiae
                     YML004C (GLO1); ancestral locus Anc_6.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318974.1"
                     /db_xref="GeneID:40381207"
                     /translation="MADTSLLTNTTCLNVSNLEKSVNWYTDIFGVSVIKKVRNEDYES
                     AFLALDSELHPNKGLPLSCRDGVIELRQPMNAGEVTIENGNNEPYKGFGHICFSVSDI
                     EATQKELLEKHVEFKKKLEEGRQHNIAFVYDPDHYWIELVENEINRRDGVYDLPSNRM
                     NHTMIRVKDPKKSLEFYCVKLGMRLFSTSDHPNAKFTNYFIGYDHDPDYLENREEKLT
                     QFARQSVIELCHNYGTEDDSSFHYYVFNEANDNVKGFDHISISTKNLDSFVRHLQSKD
                     VEVTTNKSDNATIHDPDGWKIEIHSYDYLSHTFYKL"
     gene            complement(<223996..>224466)
                     /locus_tag="C5L36_0A01060"
                     /db_xref="GeneID:40381208"
     mRNA            complement(<223996..>224466)
                     /locus_tag="C5L36_0A01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463115.1"
                     /db_xref="GeneID:40381208"
     CDS             complement(223996..224466)
                     /locus_tag="C5L36_0A01060"
                     /inference="similar to AA sequence:RefSeq:NP_009897.1"
                     /note="PKUD0A01060; similar to Saccharomyces cerevisiae
                     YCL033C (MXR2); ancestral locus Anc_1.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318975.1"
                     /db_xref="GeneID:40381208"
                     /translation="MNKVRFLRPSVSAVIRRYKHTMTGASKAIPQTESEWRAVLTPVQ
                     FAVLREKATERPHTGEYNHFDKEGIYKCAGCGNPIYKSSTKFDSGCGWPAFYEGLPGA
                     IRRETDTSHGMERTEIMCAKCGGHLGHVFKGEGFKTPTDERHCVNSISLKFNEE"
     gene            <225362..>226411
                     /locus_tag="C5L36_0A01070"
                     /db_xref="GeneID:40381209"
     mRNA            <225362..>226411
                     /locus_tag="C5L36_0A01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463116.1"
                     /db_xref="GeneID:40381209"
     CDS             225362..226411
                     /locus_tag="C5L36_0A01070"
                     /inference="similar to AA sequence:RefSeq:NP_011628.4"
                     /note="PKUD0A01070; similar to Saccharomyces cerevisiae
                     YGR113W (DAM1); ancestral locus Anc_3.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318976.1"
                     /db_xref="GeneID:40381209"
                     /translation="MRELTPQTPQTPQRHRKRSSGCAFPISSPYTGKSPLPMPVLLPG
                     QYRLGSSVSSEYTNGEAEYDSEENKRRMVVFERPEEGSGNIVPEVGSLLEDMPFFNEE
                     RAELFLETASKLSLRTKQLKRTNDTVVELNESLGAYLFGLYQNAWCVNMNESISLETM
                     NKLDKMKKLQKEVEELRQQLAKKNEKSKKDTRPTLSSARLRGNIARTPSSSLVDRLTQ
                     IKRKSRGIASNAQQEQQPAQKKRTFLRAGSRTPLFKSRKSSRPVLSGGDRNGMGLQLS
                     DALKYQVSRGEVSDDSLSSVGDTSEVQTLSSIRLNRFNNGLRVSNGNPVLDHYWRSRL
                     PQNKDWQVKHRKPFR"
     gene            complement(<226574..>227407)
                     /locus_tag="C5L36_0A01080"
                     /db_xref="GeneID:40381210"
     mRNA            complement(<226574..>227407)
                     /locus_tag="C5L36_0A01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463117.1"
                     /db_xref="GeneID:40381210"
     CDS             complement(226574..227407)
                     /locus_tag="C5L36_0A01080"
                     /inference="similar to AA sequence:RefSeq:NP_010943.3"
                     /note="PKUD0A01080; similar to Saccharomyces cerevisiae
                     YER026C (CHO1); ancestral locus Anc_3.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318977.1"
                     /db_xref="GeneID:40381210"
                     /translation="MSLRSSLKKPVSNKTSIPDASALSDSESDPISVSNVKTQLKRRS
                     SSMSSIFSLHEDPLPPPEEHEIRAFADDERHLSFVRNLHMADCITMLNGFSGFYAIIS
                     CLRFTLTSQTHYLQRAIFFTFLGLFFDFFDGKVARLRNKSSLIGQELDSLADLISFGV
                     APAAIAFCSGMQTTADCLNLVFMVLCGLGRLARFNVTVARIPTDKSGKSKYFEGLPIP
                     TSLWLVSLLSVLIKYDMVGENLPLGILWKDTPYEWHPLASLYAIQGCLMISKSIHIKK
                     P"
     gene            complement(<227885..>229144)
                     /locus_tag="C5L36_0A01090"
                     /db_xref="GeneID:40381211"
     mRNA            complement(<227885..>229144)
                     /locus_tag="C5L36_0A01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463118.1"
                     /db_xref="GeneID:40381211"
     CDS             complement(227885..229144)
                     /locus_tag="C5L36_0A01090"
                     /inference="similar to AA sequence:RefSeq:NP_013127.2"
                     /note="PKUD0A01090; similar to Saccharomyces cerevisiae
                     YLR027C (AAT2); ancestral locus Anc_2.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318978.1"
                     /db_xref="GeneID:40381211"
                     /translation="MSRGFFTENITQLPPDPLFGLKARFSNDSRENKVDLGIGAYRDD
                     NGKPWILPSVRLAENLIQNSPDYNHEYLPIGGLADFTSAAARVVFGGDSKAISQNRLV
                     SIQSLSGTGALHVAGLFIKRQYKSLDGTSEDPLIYLSEPTWANHVQIFEVIGLKPVFY
                     PYWHAASKTLDLKGYLKAINDAPEGSVFVLHATAHNPTGLDPTQEQWMEILAAISAKK
                     HLPLFDCAYQGFTSGSLDRDAWAVREAVNNDKYEFPGIIVCQSFAKNVGMYGERIGAV
                     HIVLPESDASLNSAIFSQLQKTIRSEISNPPGYGAKIVSKVLNTPELYKQWEQDLITM
                     SSRITAMRKELVNELERLGTPGTWRHITEQQGMFSFTGLNPEQVAKLEKEHGVYLVRS
                     GRASIAGLNMGNVKYVAKAIDSVVRDL"
     gene            <229560..>231113
                     /locus_tag="C5L36_0A01100"
                     /db_xref="GeneID:40381212"
     mRNA            <229560..>231113
                     /locus_tag="C5L36_0A01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463119.1"
                     /db_xref="GeneID:40381212"
     CDS             229560..231113
                     /locus_tag="C5L36_0A01100"
                     /inference="similar to AA sequence:RefSeq:NP_010816.4"
                     /note="PKUD0A01100; similar to Saccharomyces cerevisiae
                     YDR527W (RBA50); ancestral locus Anc_1.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318979.1"
                     /db_xref="GeneID:40381212"
                     /translation="MDILGDIVEHETSVPKPPSVPSSSSKGFPQATAKRPSRWRQRLQ
                     EKGLSSMSGEVSGGDQDDGKFYTVDNDTNLKKFKDDGERRLDYSGLSEEERVHQENIE
                     ILARMSNKDREEAKQELLDNLDPKVLEMLMKRSMRKYGKPGEKGLCEEYQQTKEASMF
                     DPVEGAAGTWVGGEHELDKTIPTATVENTASSHCSPAGSCSDNLKSSLMKSKTMASSS
                     PVGNSASSEKKIRFSKEAKVIYLDQSKQVTLETPEDDEWEDVSDVKSPSLTPLVDDDA
                     APPLEDAIQLAEQSVHDVVRTKSGIHFPKPRQPYEELDINDPNFNDKLYEKYFPDLPK
                     NPKQLEWMENSNTRIPDEIAYDSLESVRFDFKGEIITSDNIDRYLGENQGLYNHSKNP
                     ELPGYTLTELAHYLRSTYPGQVCIACRTLGRIMYKLGTLEYQVNEVGPTAEDNGNGIA
                     KESGKEGQFEIECWKLIDTLQIIPLLQSYSSDKQKNLSIKNYAIDALWLWKKGGGDGK
                     MKKFITQSQ"
     gene            complement(<231097..>235041)
                     /locus_tag="C5L36_0A01110"
                     /db_xref="GeneID:40381213"
     mRNA            complement(<231097..>235041)
                     /locus_tag="C5L36_0A01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463120.1"
                     /db_xref="GeneID:40381213"
     CDS             complement(231097..235041)
                     /locus_tag="C5L36_0A01110"
                     /inference="similar to AA sequence:RefSeq:NP_014149.1"
                     /note="PKUD0A01110; similar to Saccharomyces cerevisiae
                     YNL250W (RAD50); ancestral locus Anc_1.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318980.1"
                     /db_xref="GeneID:40381213"
                     /translation="MSSIYKLSICGIRSFSDESQETIQFSKPLTLIVGTNGSGKTTII
                     ECLRYATTNELPPNTKTGASFINDPNLHSSNETKAQIKLAFQNTKRVNLILSKSLMAI
                     KNPRTKTISFKTKENQLMAIHHGEKQTISSKVADIENLIPQHLGVSKAILNYVVFCHQ
                     DESLWPISESAVLKKKFDEIFDSSKFIKILENVKTMTKDINATIKLINNNVEHLKNDK
                     VRAASKRKSIGILQSRIRENQAVMDEKQSQIDELTLKLQKVYTSNQDYERTISKIESL
                     EQDKKNMLKNIESLKLTTDLLNRPKEILLDELANFENVLSNQAKQCETLQHYIDDNNS
                     KIVKLRNELNQTLVQSGNLKSLHEKYLENLQKRDDMMGEFTHQLAIDDISQFDSKLSS
                     ELSRLSTLYNQKKSDYEQLTKEISDKLLSLQFAKSNESKHLQYLSTDKENLYRRMQEF
                     ESRYENITGHQTKLKSLKAKLDSEIEKLKKLKTSNEIHTLNMKIDEKNNELISMEIKL
                     ENLQRKLKESRISIDIHTKLKILKDLNNSSSRDLNSSLANVTKEFPDLSKDTLGDSFE
                     SNMKTLDTEINRKRSELETQKFRRSKSKIDYDVSLASLGEKQEQIKSYETQFLHLNDQ
                     YKSIYGDNLTLEKYENIMDDIELDYNDEFQQSKEIQFLSGYYTKAKKSADEDHNCLLC
                     RRKFNDSDPKDQERLSAFSGLLTVRLNRLSSREGFEENVKRKELFLNSLRDFKSNALK
                     LLHIKKEEIPKLSHKIEEQKRSLLQYDETINKIELDLEEKRGQLKKMKILEHDVSVFK
                     HHSEAIKERELEIERLQQTIEESGMFEDTEELERQNSLLYKALKDTRNGIESLKLNRD
                     AKQRRNTEIEKGIDQMKLSINELELKSLDKLNIEKAIEEIKSQIKDIEKSFTLSQDKI
                     VELDSSIAEYESQLKNQNIIKQDDLSKIQNQVEELEKIKKHFSQIDEEIKGYIDNNIE
                     AKLSEADEKIDRINSQITQLSFENEKKSAELKRLEAAVSDSSHQERNIRANLNLIQFE
                     EDIVSLDDQIDQLDIKKAYAHRSEYLSTTAQLQEQQKQYQRELATKLGETTQLERQVT
                     DIADEIERDYKDIDKRYMIEYAKLQTKLAMATDLTTVYKSVDNGVMEYHQTQMAKINN
                     ILDELWKKTYTGNDVETIMIKSDPIQGKKKSDTMATNNRSYNYRVVMIKNGTELDMRG
                     RCSAGQRVLASIIIRIALAECFCLNFGMIALDEPTTNLDDENIESLARALHSIIRERA
                     VQRNFQLIIITHDEKFLRCMNAVDFTDHYYKVIRDERLNSTINKVSIATVTE"
     gene            <235365..>237758
                     /locus_tag="C5L36_0A01120"
                     /db_xref="GeneID:40381214"
     mRNA            <235365..>237758
                     /locus_tag="C5L36_0A01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463121.1"
                     /db_xref="GeneID:40381214"
     CDS             235365..237758
                     /locus_tag="C5L36_0A01120"
                     /inference="similar to AA sequence:RefSeq:NP_014152.1"
                     /note="PKUD0A01120; similar to Saccharomyces cerevisiae
                     YNL247W; ancestral locus Anc_1.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318981.1"
                     /db_xref="GeneID:40381214"
                     /translation="MAPLLGRHLQRINFILSIRRAMSSEANTTKWYPPVTKDANSRPV
                     LKLYNTLTHSKVEFVPEEAGKIKWYSCGPTVYNPSHMGHARNYVSIDINRRILQDYFN
                     YDILFIQNVTDIDDKIIIKARQEYLFEKFVNKFDCKVTTELKERTEQSVSEYVKKNLP
                     EFEKTGDILNSFNKWASTLNLKEIGLEKPKFPMHVKAVNLAISAINNDKIDFDKFVNS
                     VKDVVVLSLDKEFGHEVTDPNIFRKCSSYWERQFDLDMEKLNVLKPSIVTRVSEYIPE
                     IIEFVDKIVKRGYAYVTSDGSVYFNTSRFDKDEKHQYAKCQPWSKGDMELLEDGEGSL
                     TNEKSIENKLNSSDFALWKSSKSGEPFWDSPWGQGRPGWHIECSVMGSDFVGEKMDIH
                     SGGIDLAFPHHDNEMAQSEAHYDCQQWVNYFLHTGHLHIEGQKMSKSLKNFITIDEAL
                     EKYSARELRLIFSLVQWNNPLDFKESLLNEAKSIESTFDKFFSKMRALARDNEEKLAK
                     GEIVSKKFGALEKKLLKDFEASKDKFHASLCDNLATPMAIRNLGEVINNCNIYISESG
                     SALKVDLLVEIVKYITKMLEMFGFEVRGDRMGWTEVARAGTQSTVGSGGHSGGDSFNR
                     EDVCMPFVKVLSGFRDVVRETCIKNEEGGAKKLLEKCDSVRDGDLLRLGVALDDRGDG
                     QGALVKFLNDSERDELLKQQAEREAVLAEKAAKKAAAAKAAFEKEKLRLERGKVPPKE
                     MFQTDEMRQMYSAWDEEGLPLRTVDGEDVSKSARKKLAKQQLAQTKLYKEYLDSLNK"
     gene            <238443..>240191
                     /locus_tag="C5L36_0A01130"
                     /db_xref="GeneID:40381215"
     mRNA            <238443..>240191
                     /locus_tag="C5L36_0A01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463122.1"
                     /db_xref="GeneID:40381215"
     CDS             238443..240191
                     /locus_tag="C5L36_0A01130"
                     /inference="similar to AA sequence:RefSeq:NP_011353.1"
                     /note="PKUD0A01130; similar to Saccharomyces cerevisiae
                     YGL162W (SUT1) and YPR009W (SUT2); ancestral locus
                     Anc_8.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318982.1"
                     /db_xref="GeneID:40381215"
                     /translation="MTFNFSNDLACYSLARSVNVPASVLDSHHCSYRGSQTLNDTFNG
                     THSTAISAARPPSPSPTPPTSTSTSARPTHTPTAISTSTSTPSQVELGMELGKKNTLI
                     ETPASTSACFTKLDLLIHTATSVSLSRDNGAFHSTHPSKYHSLGATPTTSLDSTIPSK
                     RKMPTSLPPSAIAAFPIGTPSCSGTSTLDFLCNHAEKVLAQQMDHANQGQEANTKIDI
                     LVETQGNVSNIDTIDVNTAPQTNTNVQTPLSRTFSAVKRRRKSNKTLLSNNNTPALPS
                     SASASNHLAIKLASPSNHSKRQRSGPSCDCCRSRKIKCDSEIFILSTLDSISGDAETR
                     TDQLPNSDIAHCEFISLNPNTGYQYYKIIKDEEHDLNNRLTSFNYLQFKPCSACTTKN
                     LKCSFSKGFTRNDIIKFNKSEKSMNSIVTPANSTLSTSASTPIPSNLPSSSNSGSGSD
                     RSSPTTPLLKQESTNPRKLKHSLRTPSPTPASTPTPNSSLDLPSDYNNSKSTTTASSA
                     SASLSLQASSTSLASSSLSAAVAATSSFTAPTAGKSSKKTSCNTCRFKKIKCVKVENA
                     DNCGYCQKKNIKCRFD"
     gene            complement(<240403..>242319)
                     /locus_tag="C5L36_0A01140"
                     /db_xref="GeneID:40381216"
     mRNA            complement(<240403..>242319)
                     /locus_tag="C5L36_0A01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463123.1"
                     /db_xref="GeneID:40381216"
     CDS             complement(240403..242319)
                     /locus_tag="C5L36_0A01140"
                     /inference="similar to AA sequence:RefSeq:NP_013217.1"
                     /note="PKUD0A01140; similar to Saccharomyces cerevisiae
                     YLR116W (MSL5); ancestral locus Anc_8.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318983.1"
                     /db_xref="GeneID:40381216"
                     /translation="MAMEETKLDLDVDFGDRGRTRERLFSSHHWTGKPSKGVAIRQHN
                     KPTPTIISNTLTSEQIEAYATLVRIDEIGHMIATGVPVPVPTDGRSRSPSPEPIYDSN
                     GLRKNTREQRMRQKLDRERNFLVERMFQLVEDYKAPDWYKPKPTKIVEKLYIKADEYP
                     EINFVGLLLGPRGNTLNKLQKDSGAVIGIRGKGSVKQVNRGPSNIDMSHLQEKLHCLI
                     TADSQEKVDLAKKLCQEVMDKAIFSPVGQNDLKRDQLRELAKLNGTYRETSERMCPVC
                     GNSGHGRNTCPQKPSFSSTLRCGKCGNIGHLEKDCISEGKEGDEMDQEFEEFMNDLNG
                     NNEDPGVHQTSGNADSVGNESRMAEELRKGGSLKRSYSPSNHGTPPLKRQYNSNYTTN
                     YASNNNNYNNNNYNNNNYNNNNYNNNNYNNNNYNNNNYNNNNYNNNNYNNNNYNNNNY
                     NDSYNNNYSGQYQHNYNRQHNSQRNNQLNNHYQGTEYKQDGYYQQYDSHPNLGYNKSY
                     YEGNHDYSERHRGNNSYQPVQQLHGSQQLLPQPYTKPPVYPPSLKTTNRVPLPSTKAV
                     DTTTRSHGVSVPTPPPPPPPQAPQAPQSVPPQALPPPPPPPPPAKKAPGKKTTHPAQH
                     LPPPPPPPPFRGKS"
     gene            <242623..>242946
                     /locus_tag="C5L36_0A01145"
                     /db_xref="GeneID:40381217"
     mRNA            <242623..>242946
                     /locus_tag="C5L36_0A01145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463124.1"
                     /db_xref="GeneID:40381217"
     CDS             242623..242946
                     /locus_tag="C5L36_0A01145"
                     /note="PKUD0A01145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318984.1"
                     /db_xref="GeneID:40381217"
                     /translation="MAIQQVSRVGGPNRCFGTFQKAIECMTNANTKNNEECKPFLDDY
                     VECRRHRLETYKMVIVKQHLEKDRTDLDVEKIGAPYVKKRDYLTPKTLGLVGGDDHAI
                     QTAKF"
     gene            complement(<243146..>244360)
                     /locus_tag="C5L36_0A01147"
                     /db_xref="GeneID:40381218"
     mRNA            complement(<243146..>244360)
                     /locus_tag="C5L36_0A01147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463125.1"
                     /db_xref="GeneID:40381218"
     CDS             complement(243146..244360)
                     /locus_tag="C5L36_0A01147"
                     /note="PKUD0A01147; Pfam Domains: IF4E(5.2e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318985.1"
                     /db_xref="GeneID:40381218"
                     /translation="MSKIFDNITTASKHEETHTLSYEWNFWHHLRKPKTSSANPDSGN
                     INTNSGTNSIPKLDDENCHRPLERYLQGMSLMEFPQIYGQGAEKTSKIDTIEQYWEAL
                     VNLKDISKLEIDTELYLFKKDIKPLWEDEKNLNGGRWVACFGLKNFADNSAWLSSLWE
                     LLSLKLISGQFISTEISLPLSEKLIDNPAFDNCKSSKVMSNEELNKMVIEDIAGLAVS
                     VRNKKILISIWNTNLAYEEYKKLNGIIETVKSEEYMSYFKEPVYTGNRSNYEKCGLTR
                     ILFRKLIYQTIVDTMDEVTKRLAAKEGKNKVKPLAPMLFKYCTHQQDLFNENYRKPTN
                     RTGKNKSLGDDKQPKKTCKTVEYGEYDLVIEEITCNAQKSRRNRRRQASNKAFEGAES
                     EDVNIIDRDAKV"
     gene            <244992..>247823
                     /locus_tag="C5L36_0A01150"
                     /db_xref="GeneID:40381219"
     mRNA            <244992..>247823
                     /locus_tag="C5L36_0A01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463126.1"
                     /db_xref="GeneID:40381219"
     CDS             244992..247823
                     /locus_tag="C5L36_0A01150"
                     /note="PKUD0A01150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318986.1"
                     /db_xref="GeneID:40381219"
                     /translation="MEGLHILADGEEVVFPVAVEKENIGQDVNYKSYLDYLKVNYPNL
                     HKFNIKLESDDPVEFDKLLQRDSIIHNAIDIQMYEHLNSADDIWDSITHRITNMGFMG
                     RYARIATSIEHGRNYIFTFGEFSHVYPFLKSCVGDARERRRDLQLPQLDESLIDSYKL
                     HYVNHYKGLFDSTSADFEIEKRTPYNRSFVYKTPRQTPLGTEWSVLSVDEVHVKLTKN
                     FRDLYTRARYEQCVEEVSKSQRSHNFMVGRDYNIGETLSTHEDLYPSVIRDGLNIKRY
                     VYEKFLHCSVSSCPGSVRIILDCIHNVVIISTTNPHFDCMEAHKRRVYDVVRKMFVIN
                     NADLSKLDEKYLAILRRYGLTYVESWIGSEDLESFHKTELTPSIHRYNYKREFGQSWS
                     SQKNRSWVVDSFYNKDEETLRKKRKTASEKQIVDSELTALKVHDKTTNGISSWNTDLL
                     RKSRIGGLIYRDEWEFHVDQRVNLKLREVFRVWRKFYFEIHDTIRNVISYRKLRSRQL
                     EIYFSYGKFKGKIHRLYNQTMRVLNEAYEILEEWSPVYITDELLIKSYLGLKTNPVIH
                     RDYSAYFHPYPLIKQFNFDARVYSSHDTQELLICDSKDQLVNCDDIYIYERNYRYFSS
                     PQKQAEKIQKLYCHPSEKYMSYNPNLEELILMLHIDEPEFIKNRFFRATMFRNPKKFT
                     ADTSADLIQHHLKVQEHFTQIEKYEFDDIFQPYIYQMKFKVDDETRNAFLLCESKFDM
                     LRFRKWVAEYRIKETPMNAMLFRQPASKEHIVDDETVLSRTLILQPKLHEKYPIPLIH
                     YFIGCMIHQDYNDAVAISIIRRYLPLYRNKESDEHTLVINDRVVSKVTGKSRFIISQL
                     EQELREFSNRPEYWNISVENDSFDDDEIYKLKLQLKRLLTVDEKNKKLILDGIELYTA
                     AYQQDEYKDVFLATHRDHISLIEALAKKI"
     gene            complement(<248404..>249975)
                     /locus_tag="C5L36_0A01160"
                     /db_xref="GeneID:40381220"
     mRNA            complement(<248404..>249975)
                     /locus_tag="C5L36_0A01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463127.1"
                     /db_xref="GeneID:40381220"
     CDS             complement(248404..249975)
                     /locus_tag="C5L36_0A01160"
                     /inference="similar to AA sequence:RefSeq:NP_015063.1"
                     /note="PKUD0A01160; similar to Saccharomyces cerevisiae
                     YPL260W; ancestral locus Anc_7.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318987.1"
                     /db_xref="GeneID:40381220"
                     /translation="MTSRSDTIPENEVEIFNKLTEIRQRLSIIKRDHTKFMNSKDITE
                     IYKSVLTYTEELKKIRNITNQDIKSSKSSLPLVTNKVDVLIDEIFQLLSLCFLTCGLA
                     NTAPATYASLSTVQRLLEHLNESSIYTPHDLKPIKDRLDEISNIIKNNEFSDNDDISN
                     NNTEFALLTNKLNICYNEYNYMMEKTSNLSADVKNLMDDLLDIKYNLFQMITEDDHNN
                     EKVNLLSKHLHECQVKAELIFSSNPNEKGAGIIKCLFDNCSNYLNDLQLGIDRVDPHL
                     TSIYEKLLNLKSILENLLLTKRWTLRTTDIFNYQKQLVEIDNSRVDGYFLNKDYKGQS
                     VLLYLLRSCFAIIYKLLESSEPVSESLQPIHNQLLTVKRCLLDLKRMGGISSIRELYP
                     YQLKLDSIDNMKVDGKFIIKGQIPEGQATVTALLAECFDIIHELKIELDDKDDDDAAE
                     KPKYSVIGTKASQDSNYDYNHHDDEAISRSNSRFSAGETDHHSSVKDLGSLDYDEAED
                     NLASYANSICESADE"
     gene            <251594..>252766
                     /locus_tag="C5L36_0A01170"
                     /db_xref="GeneID:40381221"
     mRNA            <251594..>252766
                     /locus_tag="C5L36_0A01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463128.1"
                     /db_xref="GeneID:40381221"
     CDS             251594..252766
                     /locus_tag="C5L36_0A01170"
                     /inference="similar to AA sequence:RefSeq:NP_014650.1"
                     /note="PKUD0A01170; similar to Saccharomyces cerevisiae
                     YOR008C (SLG1); ancestral locus Anc_7.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318988.1"
                     /db_xref="GeneID:40381221"
                     /translation="MPLLSNPKMIPSLLLIASLVSTTIADGQVLGCFDSLPSSFTSQG
                     EYSYQSSQHCADACSNYDFFALSSGNMCYCGSSFDSNLSESTSCTVPCVGYPKENCGG
                     KGAYNILAQNGVDISTLTSSNSDAASSSSSSSSSSSSSSSTASSTSTTDTTATNSQNI
                     GSSSDDSTSTAETSPQQSNSIVLLQTTTSSSSSESTSSATSTDSSTDSTTSTATSETS
                     NTVSSTLDTSTTSSAETDQITSQKPLTSLRTTVIENSSATVTSLVYITQTPSSQPSGT
                     SNKSSSPSSNKGAIIGGVVGGVLGFLVLLVAILFLLRRRIFSKFYDDHEGVAMVADDV
                     AYEEALKSNSDNPFSSEDDKEADKVLLGRRRLSDGSLADAADYGMKILRVANPDDD"
     gene            complement(<253253..>254833)
                     /locus_tag="C5L36_0A01180"
                     /db_xref="GeneID:40381222"
     mRNA            complement(<253253..>254833)
                     /locus_tag="C5L36_0A01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463129.1"
                     /db_xref="GeneID:40381222"
     CDS             complement(253253..254833)
                     /locus_tag="C5L36_0A01180"
                     /inference="similar to AA sequence:RefSeq:NP_010103.1"
                     /note="PKUD0A01180; similar to Saccharomyces cerevisiae
                     YDL178W (DLD2); ancestral locus Anc_7.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318989.1"
                     /db_xref="GeneID:40381222"
                     /translation="MFALASISRLGRASASARARASAALSIRGFALTAEKYPSVKRGD
                     YAKLTDEDLGKFHSILNPNQIITDAADLAAFNQDWMKKYAGQSQLVLKPKTTQQVSQI
                     LKYCNERKLAVVPQGGNTGLVGGSVPVFDEIVISMAGMNQIRSFDENSGTLKVDAGVI
                     LENADNYLAERGYIFPLDLGAKGSCFVGGNVATNAGGLRLLRFGSLHGSVLGLEVVLA
                     DGTIVDSMHSLRKDNTGFDLKQLFIGSEGTLGIITGVSILCPARPKAVNIAFLGLESY
                     EHVIQCFKEARSDLGEILSAFEFMDRDSQLVASKFLKTTHPLCQEDEVAEASVPEYPF
                     YVLLETSGSNKDHDDEKLEKFLEKVMENEVVVDGTVSQDEAQLKTLWTWREGIAEASQ
                     QFGGVYKYDVSLPLDSLYKLVEETQERLKSFSLASTEDESKPVYEAIGYGHIGDGNLH
                     LNVAVREYNKEVEKALEPFVYEFIEKHNGSISAEHGLGFQKKNYIGYSKSEVEIKMMK
                     ELKNHYDPNGILNPYKYI"
     gene            <255580..>258042
                     /locus_tag="C5L36_0A01190"
                     /db_xref="GeneID:40381223"
     mRNA            <255580..>258042
                     /locus_tag="C5L36_0A01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463130.1"
                     /db_xref="GeneID:40381223"
     CDS             255580..258042
                     /locus_tag="C5L36_0A01190"
                     /inference="similar to AA sequence:RefSeq:NP_012159.1"
                     /note="PKUD0A01190; similar to Saccharomyces cerevisiae
                     YIL107C (PFK26); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318990.1"
                     /db_xref="GeneID:40381223"
                     /translation="MRVHNPRHRPSLSLAPNMEPADSTASIIQESQNPTDDALKLVIV
                     CVGLPARGKSYITKKLQRYLNWMQYNTKIFNVGNMRRQLKVTPSKYPIQGPTVDHSTP
                     IPNLTPSPCISKNHSFTTPEREHRPSVDENDKHDGNDDVGTLHDSSIFDHSNKENFQM
                     REQWAKETLDQLLDYLLSDDGNVGIFDATNTTKARRKWIVETINKRTKGSVKILFLES
                     ICTDTELIEKNIRLKLSGPDYKKMDPEKALLDFRKRLYNYEKVYETIDESEELENEKF
                     DIQYVKIINAGKKVISYNISGYLASQCVFFLLNFNLTDRQIWLTANGESIDNVQNKLG
                     GDSDLTKSGIAFAKALPKFISQKRQEFKLRQYNKEFINDTSTFKTNPNLTNKSFNIYT
                     STLKRTIETAHYFPKDEYFFKSFKILNDLGCGIFESITEDDFRYLHPDEYMASLENKL
                     SYRYPGLGGESYLDVISRVRPIIVEIERLRDHVLIISHRVIIRVLLCYYMNLNKEMLT
                     ELDVQHNYVYCVEPKPYGLDLKIWQYEELTNMFIEVDVAEIMKRKRKRKSLVVNDVER
                     LRRLLIRHSATINYDSDDILTTERSDNGDSSDEETESETESEENSTDSVSRINSRNSP
                     LQRRTLSEKSESQPYEFAKASSTDLKALAQVNNLKTKSLSNASLQSLGSGNQQSCTSL
                     SSLTNLRKHLRGSSSDLRSLPAQANKGIQFHSPTSPILTPSLTPAITLSRKNSYKHIK
                     KPSIDWDLFDHNVETDENLLVNSHRNSGTSMHSKLQLSESASSGTSSTTPASTVLDAE
                     VDLIMSNPQLLDRILQRLNSAS"
     gene            <258295..>259491
                     /locus_tag="C5L36_0A01200"
                     /db_xref="GeneID:40381224"
     mRNA            <258295..>259491
                     /locus_tag="C5L36_0A01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463131.1"
                     /db_xref="GeneID:40381224"
     CDS             258295..259491
                     /locus_tag="C5L36_0A01200"
                     /inference="similar to AA sequence:RefSeq:NP_010065.2"
                     /note="PKUD0A01200; similar to Saccharomyces cerevisiae
                     YDL216C (RRI1); ancestral locus Anc_2.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318991.1"
                     /db_xref="GeneID:40381224"
                     /translation="MEAYCRLIDQLQEIVRENLQKIQDVSARGPNDLNTAPDVSKRIM
                     MFESDARKIYDNLYKRSDEEDNGCKPWKKYPYYFQTVNVSILAMNKMLTHAISGGSIE
                     IMGMLLGYHHESQLYVLDCYPLPVQGTESRVNPQNDSYEFMLGYLTKLQENGLKKEHV
                     IGWYHSHPGFGCWLSGIDVQTQKLHQGFEDPYVAIVIDPIKSLKDGYINIGAFRTFYD
                     GNKPDTTESSELGWHSKEYYPLDVKLFVNENDQILLDSLDGGQRSYASLTVPHDDRND
                     KLTRNDDRFELDSNYVSLKVWKKMNSLLDSKSFENEKNSVEDVTEQTSTYSGDVKMGF
                     NELMTDPASSAPSGHLNAANINETVDTPDLEKLNIAKTAVEMDLITIQELKKLLVKDV
                     QKRIFR"
     gene            complement(<259614..>260948)
                     /locus_tag="C5L36_0A01210"
                     /db_xref="GeneID:40381225"
     mRNA            complement(<259614..>260948)
                     /locus_tag="C5L36_0A01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463132.1"
                     /db_xref="GeneID:40381225"
     CDS             complement(259614..260948)
                     /locus_tag="C5L36_0A01210"
                     /note="PKUD0A01210; Pfam Domains:
                     Pkinase(1.2e-88)|Pkinase_Tyr(1.2e-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318992.1"
                     /db_xref="GeneID:40381225"
                     /translation="MGIPDLLNVFSKKKDYDFLETLGAGSFGTVRKAIQKSTGREVAV
                     KIILKSRLHGHLEVVEREVNLLSSVRHPHIVELIDSFQTKHNFYIVTQLATGGELFDR
                     LIEKTSFTEYDACDIIYQLLDAIAYLHERGIAHRDIKPENVLYLTIDEKSPIVLADFG
                     VSKQTNSHEKLTGVAGSFGYIAPEIYASEGYGELYGLGQGGYTLSCDIWSLGVVAYTL
                     IGGYSPIRAQNPQDFLDEVRTNNFVVFHEKYWSCISDEAKDFIIKSLDIDNRRRPSAK
                     DLLNHPWIKNHFKGKEGTEGQNIISNIQEGFNAHARLRRAVRLVIMKNKLEKLRQLRA
                     ASATTSQDTELEEDDASDFEFCGNTKDNRLIEHFKELKDAGHSGMPSNLSSPPTTTSQ
                     VSGSESLQRLKSKELTTTFQNLVRIAQESKDQIRQYQEEEERKESENSRSQQ"
     gene            <261210..>262103
                     /locus_tag="C5L36_0A01220"
                     /db_xref="GeneID:40381226"
     mRNA            <261210..>262103
                     /locus_tag="C5L36_0A01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463133.1"
                     /db_xref="GeneID:40381226"
     CDS             261210..262103
                     /locus_tag="C5L36_0A01220"
                     /inference="similar to AA sequence:RefSeq:NP_013372.1"
                     /note="PKUD0A01220; similar to Saccharomyces cerevisiae
                     YLR270W (DCS1) and YOR173W (DCS2); ancestral locus
                     Anc_6.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318993.1"
                     /db_xref="GeneID:40381226"
                     /translation="MTAENIVRQFQYTRVLEEDPLLKRVVLLGKIGDADAILTLEKTY
                     FTNITKPGDYLVEVSEIANNDVYHWGSTLTKPDSFENPSCKYNLIYPATETHIRKYEK
                     ATLHMVRETPEAYERIVKPYVESMKGDRLQWVRNILYNGAEAERILFKNDDYIILPDM
                     KWDGKDIGSLYCCCIVYEANISSVRDLNESHIDYLKKIRESILTEIPKVYKSHGLLRD
                     SLRLYVHYQPSYYHFHIHVVNSNFFGLANSMLVGKAILLDDIIDNLYFLGDKGYGQKT
                     LCYQMKETHALWNLGMKEYSQ"
     gene            <262292..>264013
                     /locus_tag="C5L36_0A01230"
                     /db_xref="GeneID:40381227"
     mRNA            <262292..>264013
                     /locus_tag="C5L36_0A01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463134.1"
                     /db_xref="GeneID:40381227"
     CDS             262292..264013
                     /locus_tag="C5L36_0A01230"
                     /inference="similar to AA sequence:RefSeq:NP_014713.1"
                     /note="PKUD0A01230; similar to Saccharomyces cerevisiae
                     YOR070C (GYP1); ancestral locus Anc_5.672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318994.1"
                     /db_xref="GeneID:40381227"
                     /translation="MWKRGYHQPVGSDGRGSSDFLFDADYIDYQNDVCNLSANNLNGT
                     TSNDSNTSKGKDRSSSASSSSGKGFFRSLMSHGDSSPKKASAAQRARLDRFEQSQSVY
                     PKSFLDSAIENSKLRSMSPDRASINSQRSNSSLSIQRTPSNTLSKLGLTKLTPKRASD
                     SPFVDSDEDWNDTLDDINDTIDGNGKTSGQFPGRNDVTASLKMENMSLDGLSLMERDA
                     KVDKNYPFLRADYQEIMADPFSILTSQQAPKKDMIKYNKIVKEFLKPTFEVSELKKQT
                     WGGIPASLRALVWPILVGYLSTNKNTRESALTRKRKEYGNSISRLFRGDKDQSIWHQI
                     KIDVLRTNPSIPLYSFEATHRSLEKILYLWAIRHPASGYVQGINDLVTPFFHVFLQHY
                     LAGNVDVDTFDPQCMPKELLNIIEADTYWCFTKVLDTIQDNYIHEQPGIIRQITELKN
                     LIKRDEPSLNAHFEKEHLDFIQFSFRWMNCMLMREFKLNLIIRMWDTYLSDFPTGFSQ
                     FHVYVCCAFLRRFSNYLMDMEFQDIIMFLQDTSKNEDWTEDDIEMMLSEAYVWQSLYE
                     NASAHLK"
     gene            complement(<264087..>264977)
                     /locus_tag="C5L36_0A01240"
                     /db_xref="GeneID:40381228"
     mRNA            complement(<264087..>264977)
                     /locus_tag="C5L36_0A01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463135.1"
                     /db_xref="GeneID:40381228"
     CDS             complement(264087..264977)
                     /locus_tag="C5L36_0A01240"
                     /note="PKUD0A01240; Pfam Domains:
                     THF_DHG_CYH_C(2.6e-83)|THF_DHG_CYH(2.8e-52)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318995.1"
                     /db_xref="GeneID:40381228"
                     /translation="MVADKIDGKAISAELRAKIQEEITTLKIAHPRFQPKIVIIQVGD
                     RPDSSTYVRMKLKSCADAGIEGELVKYDAGISQKEMLEKLEGLNNDVSVHGILVQLPL
                     PDQLDEEAITNAVKVEKDVDGFSELNIAAVFKKNSKLKLVPCTPKGIMYMLEHENVQL
                     EGKNAVVCGRSDIVGGPMGKLLEKRGATVTTLHSKSTPEQFKFFLKNADIIVSAVGKA
                     GFIHGDDVKPGCVIIDVGTNYIRDESKKSGQRMVGDVDYETCSQVASKITPVPGGVGP
                     MTVVMVLSNLLQTAKQQSGL"
     gene            <266087..>267751
                     /locus_tag="C5L36_0A01250"
                     /db_xref="GeneID:40381229"
     mRNA            <266087..>267751
                     /locus_tag="C5L36_0A01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463136.1"
                     /db_xref="GeneID:40381229"
     CDS             266087..267751
                     /locus_tag="C5L36_0A01250"
                     /inference="similar to AA sequence:RefSeq:NP_014334.3"
                     /note="PKUD0A01250; similar to Saccharomyces cerevisiae
                     YNL065W (AQR1) and YIL120W (QDR1); ancestral locus
                     Anc_2.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318996.1"
                     /db_xref="GeneID:40381229"
                     /translation="MKVWTSLPFVRDPMQGITSAENGKCGLGRECELEQDGDCNYDYD
                     YDDEDTKETKQADNNGDLVRESLKNQPGDNWELEKYRSIDEDDHTILTHRERVVMALT
                     LSLIGLCSAMSMPIYWTALTELEREFHTTESKINYTVTAYLCFQAVAPVFVSSFSDIW
                     GRRPVILVCITAGLCTNVGLAVSRTYWLIVFLRCVLASSLAPLVSITAASVGDFTTRR
                     NRGSLTGLTTGFTLIGQGIAPFLGAVMDTAWGWPAIFWFSAAFNGTILLLSFVLVPET
                     HRGYVGNLGIKPKSFIHYSPYLLYLGSRLEPYDENKVAKRNHKYQPWKPLMLSYKPDI
                     LSILLPCSILFALWTISQTTLSVHFSKVYHMRVIIIGVCFFAPGMASIFGTVISGRVL
                     DYLYRKRKAVYDATYKDLAPQDRSPFNIVKVRLLTIPFAGLFAAMASIVFGWCMDKHT
                     NIAPILIMSFLITFFVMFPLNTAVTVLIDMYPQIAGGATALNNLFRCGMSAIFVSCLN
                     MMEDKMTVGGTYTFMAAISLLFLTVVLRLIIGNEDTITKPKNLSED"
     gene            <268302..>269924
                     /locus_tag="C5L36_0A01260"
                     /db_xref="GeneID:40381230"
     mRNA            <268302..>269924
                     /locus_tag="C5L36_0A01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463137.1"
                     /db_xref="GeneID:40381230"
     CDS             268302..269924
                     /locus_tag="C5L36_0A01260"
                     /note="PKUD0A01260; Pfam Domains: MFS_1(2e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318997.1"
                     /db_xref="GeneID:40381230"
                     /translation="MSISSFDQSTLTTLSSDDNHNVAPPQQFNTLRAPKTHPIYDEDV
                     TDDNSLVEKYESDEDLDDLQKYISIKEDERTILTHRERTVMALTLSVIGLCSAMSMPI
                     YWTALTELEREFHTTESKINYTVTAYLCFQAVAPVFVSSFSDIWGRRPVMMGCLIGGI
                     CTNVGIAVSRTYWLIVFLRCVLASFLAPLVSITTASVGDFTTRRNRGSLTSLTAGFTL
                     IGQGFAPFIGAVMDTAWGWPAIFWFSAAFNGLILLILFFLAPETHRGYVGDLSVRPKH
                     FIHRSPYLIYLGDRIKPYDKSKVEKRIHKYQPWKPLMLTYKFNILSILVPCSILFALW
                     TISQTTLSVHLSKDYHKSVIIIGLCFFAPGFACILGTLTEGKILDYLYKTKKAVHDET
                     YKDVHPKKKPPFNILKVRLLTIPFAGLFIAIASIVFGWCMDKHTSIAPILVMSFLITF
                     FAMFPLNIAATVLVDMYPQFSGGATALNNLFRCGMSAIFVSCLNMMEDKMTVGGTYTF
                     MAAISLLFIFLILNLIHRSEKISANAALSSKV"
     gene            <270190..>271701
                     /locus_tag="C5L36_0A01270"
                     /db_xref="GeneID:40381231"
     mRNA            <270190..>271701
                     /locus_tag="C5L36_0A01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463138.1"
                     /db_xref="GeneID:40381231"
     CDS             270190..271701
                     /locus_tag="C5L36_0A01270"
                     /inference="similar to AA sequence:RefSeq:NP_010935.1"
                     /note="PKUD0A01270; similar to Saccharomyces cerevisiae
                     YER019W (ISC1); ancestral locus Anc_1.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318998.1"
                     /db_xref="GeneID:40381231"
                     /translation="MSLLRFLSIFVGLFAVLLSTFKFGSFMDTSTTINESTRLQNYYV
                     EKQLSYLHDNMNNINMNTQDTLDLDGKGLERSDEVFRLLTFNTWGLKYVSKFRRERLT
                     AIAERLAGLKNNEFPSYNSDGDNDDYDIVALQEIWTKEDWDYIDRICASKFPFRRWFS
                     SGILSGPGLAILSKYPIKKTSLYRFPVNGRPSAFFRGDWYVGKSVAVTILKLNNGSTI
                     ALLNSHMHAPYAKSGDAAYETHRACQAWEIANIVNDLKSAGHAVILVGDLNSRPGSIP
                     YEILQKEAGLADSWEVINGETDLELVKAMQPWEQIVRAATTCDSILNTWRADRNPDEA
                     CRLDYALIDKNLLHPVEASVKFTEKIPNVGSYSDHFAYSVNLRLNKEPLSKITATECP
                     NNGLLGLYLKFRNLVNNYIQTTLEWQRQWRLWHFVLSMFIAIAFIPVIIVVSYRAPWS
                     SVLFYFFGCIIFSTGLVNGMISFLFGRYELRNLREVIFEIDDRTNFLKHVIQC"
     gene            <272047..>276258
                     /locus_tag="C5L36_0A01280"
                     /db_xref="GeneID:40381232"
     mRNA            <272047..>276258
                     /locus_tag="C5L36_0A01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463139.1"
                     /db_xref="GeneID:40381232"
     CDS             272047..276258
                     /locus_tag="C5L36_0A01280"
                     /inference="similar to AA sequence:RefSeq:NP_013290.1"
                     /note="PKUD0A01280; similar to Saccharomyces cerevisiae
                     YLR189C (ATG26); ancestral locus Anc_1.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029318999.1"
                     /db_xref="GeneID:40381232"
                     /translation="MEETNIRASGKMLNKDETKLADRLAKTDSQLYKIKSPIQLPIKY
                     ALPARKLFVNAIDLTRDISAGFEGKTRNSSGDIPHSEKKTSKAKDGEYNGSETNVLGS
                     DDEYIADDDYILKDSYKSWSPLRKYKSPLADLGLGDDVKKVGASSQWLLRKSVHPIKT
                     AGKVVVKPLPKPKGKLIDGNKSIDGISKSFAGYLATASMYAGFQDIENESREMETNTT
                     EPDGSSIGNSEASPSVQGGNSEDGCSQHQLLDHVASKINEVVTLKDNDSNIDQLESIV
                     SDDGSSVCYSKSDSTIPIPTFKDETIREKEPVKPRRNLSVFELSVVKRVTYGAGTDGD
                     ADFLVKRAEAITEKLKNVFGINDNEEFLGDYPCWLMGDVLLQGHLYTTTYNILFFAFL
                     PKKRKDAEIKSGALSIASFHSLRLHRKWVIIRENTFSIYSSPTELYFPELVIDLRTAL
                     RAEVYGNSKTGDPLTPVWIRIVTENRTHWFQAENHDVARSWVTTLKKQIFSSRNKGDQ
                     VAIKIPLQNLVDIELTSIVGVAKNLRIKVIENNESFAIDDYYLMFFSDGERAIRDIKQ
                     AVENAGVQVCTDIDQETLDYSDLIKSKMELLKHSASAVESTNFKPKKRNGILKGIKSA
                     LLSSDEESEVDTDTDYVDDDDANDDDDDNNNNNNEASILEPDSSDNITKVEGLGKLSR
                     RFIPSRFQSRAKSNDTKSTIHPLQDERMNNDSKLAEWGDDDEVTERKWSLKSMVQNVT
                     SFGHGLIFAGPPTHYLESELALEGGDTYFLNNKKSRDQAQKRFIKRFSLSGTEKLVST
                     YHLYLMKGLPSYGKLYIGTQNVCFRSTVVGSNTVMILPFTDIENIHKESGFRFGYCGL
                     VIVIRGHEELFFEFSANEYRDDCELQLLKQLDIFKNYSSGTGSPDCSFESENSCISSA
                     KLKMFENKLNEGMGVSVPIIIEDHPIDKLQLKSMKVYRFTLLTIGSRGDVQPYIALGK
                     SLLEEGHKVKIVTHEEFKDWILNHGIEFGAIAGDPSELMALMVSNPSINYSFIKEARS
                     KFRAWIDDLLLSSWNACQDADVLIESPSSISGIHIAEKLQIPYFRAFTMPWTRTRAYP
                     HAFLVPDQKLGGSYNYMTHVAFENGYWRGTSYQVNKWRVKTLGLPKTNLNAMHQNSVP
                     FLYNISPVVFPPSVDFPEWVKVTGYWFLDEKTDYTPPEALIAFIKKARDDNKKLVYIG
                     FGSIVVEDPTELTRAVVEAVLASDVRCILNKGWSERLGSKNSKEIEMELPREIYNSGN
                     IPHDWLFTQIDAAVHHGGSGTTGASLRFGLPTIVKPFFGDQKFYAGRVEDLGCGVSLK
                     SLDSKALSKAIREVTTNSRIIDRAKAVGELIRSENGVKTAIDNIYVLMEYAKRLSIAK
                     HKHGDDVDDEREDENVEMDGSWLLV"
     gene            complement(<276469..>277974)
                     /locus_tag="C5L36_0A01290"
                     /db_xref="GeneID:40381233"
     mRNA            complement(<276469..>277974)
                     /locus_tag="C5L36_0A01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463140.1"
                     /db_xref="GeneID:40381233"
     CDS             complement(276469..277974)
                     /locus_tag="C5L36_0A01290"
                     /inference="similar to AA sequence:RefSeq:NP_014122.1"
                     /note="PKUD0A01290; similar to Saccharomyces cerevisiae
                     YNL277W (MET2); ancestral locus Anc_1.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319000.1"
                     /db_xref="GeneID:40381233"
                     /translation="MGYKVVDSQPENPFSKIVQGQTIVEIPEFELECGDILYKVPVAY
                     KSWGKLNDQGNNCMIICHALTGSADAADWWGPLFGRGKAFDPTRFFIICLNSLGSPYG
                     SASPMTTDYEYGEERYGPEFPLCTVRDDVRIHKMVLDSLGVKECAICIGGSMGGMLAL
                     EWTFVDGGKFVKNLVALATSAKHSAWCISWGEAQRQCIYNDPKYDDGYYPLGDPPNTG
                     LGAARMSALLTYRSRNSFESRFGREAPSEKQRLKSTTNLPNVANLSLKDKEQTSAVED
                     ENEQHEREVNWKIHNEGASRKKSFESYRSSRSSSFLSSTSIEETNGSTLSSKIASDSA
                     SMSTKPRSRSRRLPQHYFSAQSYLRYQANKFVSRFDANCYIAITRKLDTHDVGRDRPE
                     YNNDTAISLQSRKQPALIVGISSDALFTLSEQIFIAKNMPNARLVKIDSPEGHDAFLL
                     EFNEINELLLTFERENLKEIMCREGNFEDWNDTIDEVKESVFGEAEDVAQW"
     gene            <278295..>279362
                     /locus_tag="C5L36_0A01300"
                     /db_xref="GeneID:40381234"
     mRNA            <278295..>279362
                     /locus_tag="C5L36_0A01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463141.1"
                     /db_xref="GeneID:40381234"
     CDS             278295..279362
                     /locus_tag="C5L36_0A01300"
                     /note="PKUD0A01300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319001.1"
                     /db_xref="GeneID:40381234"
                     /translation="MKDVQLGRTTVKGGLFTQDVEKKLEQMYDSHNFVNRIDVVVKKA
                     ELESAGADYMKSITCESIEFMANLFQLLKYILAFEPIERQYFKLISTDTDIMDENSIC
                     IHRGKLTLKLKKESYLKSGFQFKLSTASRGNRNVVSQMYIHTFDLVNFEENIKKNIQN
                     YVRLLWFAENIDSKNYVYNLTCESDGFDYQNSILTLENMNIEAQLKKATITTKIMIDC
                     VFPNLDIVQNEEQLQDIAEWITLSSIGGTVQQYRDVDPYISSYFARLDAKDSVDLAVM
                     TMEETLITSALHAKIMQHLINNFSWFAFGSYGVKNVTKAYENSGEHIIADDGSNDILL
                     FFSEGSYAVWDTTDGGDPHIL"
     gene            complement(<279459..>281726)
                     /locus_tag="C5L36_0A01310"
                     /db_xref="GeneID:40381235"
     mRNA            complement(<279459..>281726)
                     /locus_tag="C5L36_0A01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463142.1"
                     /db_xref="GeneID:40381235"
     CDS             complement(279459..281726)
                     /locus_tag="C5L36_0A01310"
                     /inference="similar to AA sequence:RefSeq:NP_013289.1"
                     /note="PKUD0A01310; similar to Saccharomyces cerevisiae
                     YLR188W (MDL1); ancestral locus Anc_1.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319002.1"
                     /db_xref="GeneID:40381235"
                     /translation="MSLLGLQARAGVNVKMLKGSLPLTRNRTITRSLQGRLVALSSNM
                     SFSTGFNRPYIIDNFKKTALKRSVGFNQVAIRYESTSEKSQQSRLEKTSDKPQKITKK
                     GSVKEVLELLKLLRNEWKILAFATSCLIISSSVSMLFPSIMGKIIDTAKIEETDTLGA
                     IGSPLSDSIQILSYQVPTNVFYGSLICIFAVGSLANFGRIVLLRKVGERIMARLRVDI
                     ERNIFLQSSKFWDKYKTGDLISRLVNDSTIVTRSVTQNVSDGLRSTISGIVGFTMMLA
                     ISAKLTGYMLLIFPVLAFIALVFGRRVKKVSKEIQTQLGALTKISEEQFNFVKTIQSF
                     NNEGYEVSKFKKEVTKLYKLSVHEGRLNGYFYSANGFIGNTFLIYLLSVGVWMVRQGD
                     LTLGELSSYLMYTIYSASSVYSLSNFYSELMKGVGASERVFELLKLQPDIDPHAGKKA
                     SADGDIVFKDIDFHYPTRKNHQVFNKLNLTLKKGDHVCLVGPSGCGKSTVTQLLLRYY
                     EPNSGKIIVNGNDITELSLANFREQVGIVQQEPMLFSGTLRENITYGKRDASESDIAK
                     VCQLANCSSFIDNFPDKLNTIIGPKGAQLSGGQKQRIALARTLLLGSKVSECVIDHLK
                     DLELVGDDGEILLGPNILVLDEATSALDAHSEEAIKKTLELRHQAGLTTISIAHRLST
                     IQTSNRVIVFSQHGVIVADGDFSDMIKDKQSELNKLLNKSPKGDNTEAELNEEEADTV
                     EGKTVTGELDSVGRS"
     gene            complement(<282092..>282772)
                     /locus_tag="C5L36_0A01320"
                     /db_xref="GeneID:40381236"
     mRNA            complement(<282092..>282772)
                     /locus_tag="C5L36_0A01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463143.1"
                     /db_xref="GeneID:40381236"
     CDS             complement(282092..282772)
                     /locus_tag="C5L36_0A01320"
                     /inference="similar to AA sequence:RefSeq:NP_011097.3"
                     /note="PKUD0A01320; similar to Saccharomyces cerevisiae
                     YER170W (ADK2); ancestral locus Anc_8.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319003.1"
                     /db_xref="GeneID:40381236"
                     /translation="MSSTSKSLRMVIMGAPGSGKGTLTSRLLSKFPQIHSLSTGDVLR
                     REIAANSKIGEIAKDSIAKGQLLPDSFMASLVQNELNKNNWLDGKTSFLFDGFPRTVG
                     QAQALEPVLRPHNAEINFVVELNVPPEIILDRIANRWVHSSGRVYNLQYNPPKVPFKD
                     DITGEPLYKRPDDNPETFKVRLDKYFSELEPIREYYEQKGVYHVVSGNSSDIIFPQLL
                     SLVHKQLS"
     gene            complement(283091..283172)
                     /locus_tag="C5L36_0Atrna2S"
                     /db_xref="GeneID:40382488"
     tRNA            complement(283091..283172)
                     /locus_tag="C5L36_0Atrna2S"
                     /product="tRNA-Ser"
                     /note="PKUD0Atrna2S; codon recognized: AGC"
                     /db_xref="GeneID:40382488"
     gene            284097..284180
                     /locus_tag="C5L36_0Atrna1L"
                     /db_xref="GeneID:40382463"
     tRNA            284097..284180
                     /locus_tag="C5L36_0Atrna1L"
                     /product="tRNA-Leu"
                     /note="PKUD0Atrna1L; codon recognized: UUG"
                     /db_xref="GeneID:40382463"
     gene            284193..284264
                     /locus_tag="C5L36_0Atrna1F"
                     /db_xref="GeneID:40382458"
     tRNA            284193..284264
                     /locus_tag="C5L36_0Atrna1F"
                     /product="tRNA-Phe"
                     /note="PKUD0Atrna1F; codon recognized: UUC"
                     /db_xref="GeneID:40382458"
     gene            complement(<284563..>285933)
                     /locus_tag="C5L36_0A01330"
                     /db_xref="GeneID:40381237"
     mRNA            complement(<284563..>285933)
                     /locus_tag="C5L36_0A01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463144.1"
                     /db_xref="GeneID:40381237"
     CDS             complement(284563..285933)
                     /locus_tag="C5L36_0A01330"
                     /inference="similar to AA sequence:RefSeq:NP_015325.1"
                     /note="PKUD0A01330; similar to Saccharomyces cerevisiae
                     YPR001W (CIT3); ancestral locus Anc_8.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319004.1"
                     /db_xref="GeneID:40381237"
                     /translation="MSLRNFARSATRAYSTAEPTLKERFAELLPGWQAEVKELKSKHG
                     KTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPVEGIRFRGKTIPDIQKELPKAEGSSEP
                     LPEALFWLLLTGEVPTLAQTKAFSAELASRSALPKHVEDLLDTCPTTLHPMAQFSIAI
                     NALESESKFAKAYADGVNKKEYWKYTYEDSIDLLAKLPNVAAKIYRNVFKDGKVAPVN
                     ASLDYSHNFANMLGFGDNKEFVELMRLYLSIHSDHEGGNVSAHTTHLVGSALSSPYLS
                     LAAGMNGLAGPLHGRANQEVLEWLVGMKKELGDDIFNKEKIEEYLWKTLNAGRVVPGY
                     GHAVLRKTDPRYTAQREFALKHMPDYDMFKLVSNIYEVAPKVLAEQGKTKNPWPNVDS
                     HSGILLQYYGLTQESYYTVLFGVARAFGVLPQLIIDRGLGMAIERPKSFSTQKYKELV
                     ENLNKA"
     gene            complement(<286255..>286776)
                     /locus_tag="C5L36_0A01340"
                     /db_xref="GeneID:40381238"
     mRNA            complement(<286255..>286776)
                     /locus_tag="C5L36_0A01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463145.1"
                     /db_xref="GeneID:40381238"
     CDS             complement(286255..286776)
                     /locus_tag="C5L36_0A01340"
                     /note="PKUD0A01340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319005.1"
                     /db_xref="GeneID:40381238"
                     /translation="MQLYNHIRFIPIRNAQRNINCNNSIPCCGCPFFLSHNCQKGGNP
                     PSYALHRRVDIDIDIDIFFPPPPQKPTLLHRRVASSSRFPKTVLKYKPYAAFLFFLFF
                     FQKHHGKKNTSNDFWPTLDDLSVSRLLGSDNCFPFPFSFFPPPPTQSLTVEIPKEAIL
                     TRERVALPIVFFP"
     gene            <286816..>287229
                     /locus_tag="C5L36_0A01350"
                     /db_xref="GeneID:40381239"
     mRNA            <286816..>287229
                     /locus_tag="C5L36_0A01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463146.1"
                     /db_xref="GeneID:40381239"
     CDS             286816..287229
                     /locus_tag="C5L36_0A01350"
                     /inference="similar to AA sequence:RefSeq:NP_014984.3"
                     /note="PKUD0A01350; similar to Saccharomyces cerevisiae
                     YOR339C (UBC11); ancestral locus Anc_7.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319006.1"
                     /db_xref="GeneID:40381239"
                     /translation="MSIPRNFKLLEELEKGEKGLGADACSYGLADPNDITMTTWNATI
                     LGPPNSVHENRIYSLQVVCGESYPDAPPKVQFLSKINLPCVDQRNGEVIQSKFPTLNR
                     WQRSYSIEILLLDLRKTMAEPANKKLPQPKEGETF"
     gene            complement(<287471..>287842)
                     /locus_tag="C5L36_0A01360"
                     /db_xref="GeneID:40381240"
     mRNA            complement(<287471..>287842)
                     /locus_tag="C5L36_0A01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463147.1"
                     /db_xref="GeneID:40381240"
     CDS             complement(287471..287842)
                     /locus_tag="C5L36_0A01360"
                     /inference="similar to AA sequence:RefSeq:NP_058154.3"
                     /note="PKUD0A01360; similar to Saccharomyces cerevisiae
                     YEL059C-A (SOM1); ancestral locus Anc_6.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319007.1"
                     /db_xref="GeneID:40381240"
                     /translation="MAPALPVYTRGEIEKLFPVMRSEEIPPNCSLYQLIQNQCTYDGN
                     RVICLPFKRVFLRCLETRNGEVVGYRLQPKHGLKEGVYRDIEVTSRSDNTYTINDEIQ
                     DFLRADSVLQEKMQAYYERHV"
     gene            <288141..>289742
                     /locus_tag="C5L36_0A01370"
                     /db_xref="GeneID:40381241"
     mRNA            <288141..>289742
                     /locus_tag="C5L36_0A01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463148.1"
                     /db_xref="GeneID:40381241"
     CDS             288141..289742
                     /locus_tag="C5L36_0A01370"
                     /inference="similar to AA sequence:RefSeq:NP_010856.1"
                     /note="PKUD0A01370; similar to Saccharomyces cerevisiae
                     YEL058W (PCM1); ancestral locus Anc_6.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319008.1"
                     /db_xref="GeneID:40381241"
                     /translation="MSAPFSEIQPIYSKYPPPASPKFQYGTAGFRMLASKLDSVMVAV
                     ATLSVIRSFSLQGKTVGVMITASHNPPQDNGVKVVDPFGDMLPQDWEPLATSLANCTN
                     FDEFESILNPLWKKYNPNGKNKANIVIARDTRESGSHLLDICTQLFESIPEFVNCTNF
                     GVLTTPQLHYITRAFNDPSFGEPTEEGYYKKLNESLLRLLEINELNASDLTNVVVDCA
                     NGVGALKLEQFLEKSAVASKFKVVNDNTEDPQQLNVKCGADYVKTNQRLPANISEAVA
                     SAPNTLCASFDGDADRLVCYYQGDGFVLFDGDKIAILLSSMISKLLSQLSVDLKVGII
                     QTAYANGASTSYIVEELGLPSICAKTGVKHLHHEALKFDIGIYFEANGHGTVLFSDNF
                     RDKISKINHPAAESLLLLNDLINQTVGDALSDLLAVVASLCILKQSNNDWSRTYKDLP
                     NKLAKVVVKDRNAFVTTDAERRLIEPNAIQPKIDQLVSTVKLGRSFVRPSGTEDAVRV
                     YAEASTIEECEYLTNAVVKLVAEYS"
     gene            <290247..>294821
                     /locus_tag="C5L36_0A01380"
                     /db_xref="GeneID:40381242"
     mRNA            <290247..>294821
                     /locus_tag="C5L36_0A01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463149.1"
                     /db_xref="GeneID:40381242"
     CDS             290247..294821
                     /locus_tag="C5L36_0A01380"
                     /inference="similar to AA sequence:RefSeq:NP_013413.1"
                     /note="PKUD0A01380; similar to Saccharomyces cerevisiae
                     Scer_YGOB_SDC25 (SDC25) and YLR310C (CDC25); ancestral
                     locus Anc_4.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319009.1"
                     /db_xref="GeneID:40381242"
                     /translation="MDVPTLVEKEHRVSKVDFSYLVSQLSPSPGAWSPPRKSSQPDLE
                     EFIDMDNESTHSEKFEYKGETVHGILEHARTRSADSKHSSISLNNSILSIKNESHNTS
                     SSFLNSSVPTNDILNNSSFNEPFVEQNQVEDHTPIVHQQQHFDDSTPVPARRQTIDND
                     DLKLSSEVITNIFAEDSMTMLEPESKNQSRIQSTTSSIYSALPNRIQSTTSSMYSEIP
                     GHKSVDITDGLKKFRISSMKPQLHKHTSQPLENLEEVNEEVEFQDNVTSKYDSLVDDQ
                     PLDFTSPTPSVGQPTFPPNTAPRVSVLDQSIYKNKGEPAQSKTLSSVQSQQNIEKMMD
                     KTGSSKTELFDNYEMTEESRRDETEDEDEDTSALFVTAIYAFNADSLESENDSSICLS
                     FDQDEIAFTYNLDDSGWGEVTLLSSLKRGWVPMNYFKSTVTSGIQDIELKSLSPRDLA
                     ETRAPLKLLLKHAGTFLLNPQSKPVYINGELRGYTFDVECFNGMTDGVRKLLIDTNCI
                     SRSNSVVQSKPVVRKMRKKLLRGWADLIGKGKDYMGTIASSKIEYLQLLTFHLLQKAI
                     TFLDIWRLEQERLDEETQQLPQRVDKNRTTLAWDSFESVNLNILYLEKPPILSYRINE
                     IYNQLITYFCLIAGRIDLVEHNPKSFQVVATVTGHINLLINEYFFIIKLLKSTMNEQD
                     SEKRLSMNLTKYGKLTSNMNLKTQMKKLDLQTEKLRQMVEELNTYIKILHDSAKKEMF
                     NRGTNFNATEVNNNLYFYSREGGAVVVCACKMIELCSSIYYIMKNSISFDDSMLLPQS
                     RRYPNYLKMSVTPEEFIKKCSSALANDSNIQKQVSKYKRESIALNSKPEKLRENVNRV
                     SQQYSIFKMGNSTDVQLSSAGLDFLSHINSDEQSNFLADDLETDLQATELSDLEFNVE
                     SELIRSQTDGKIIGASFRALVYLLTDESNPPDYFFINAFFLTFRIFADSTQLLEALIR
                     RFDVNDDYKNRLNDGTGKFTEIKVMNKRKLVAKSFRFWLESYWNSKNDYSLLAPLMNF
                     FNEGMKNFLPIESYQLLVTASKLIGNPPIENNDDRLNFYNNFSNNEQLLPRKISSKLH
                     QKTLKNMSLGANPNGLLTEIEAYNAFLDDVETYDLEKIDEAPIENNSRLSLSLNLNIE
                     LKNSGSNSVLLTPQQISMIRMIIMSYRRMLGTHWYKKHIENQFEPLDTKTLIDSWWSA
                     SQESWKILNDDLTLLNFNGLEIAKQLTLIESKLFCSIQVGELLNQNFTTKKLHLNLSP
                     NIQKSILFTNLLSDYVIESILKPDLKMRQRIHAFKCWLKISISCLYLRNFNSLASIMT
                     SLQSFLITRISAIWEGLTEKYKELFHYLASIIHPNKNYSAYRDRLRDFLSTNEQDNID
                     IPIVPYLSLFLQDLTFIVDGNPNYRTNSKSFLDEKLINIDKYLKITRIVSDIQALQIS
                     YKDVGELGQLYNDKNTDIIRSETIKNLKEQLGGTDNMISFADMFDIYGVPILQELILL
                     EIWKVKQTNARDDDRSWKLSCAIQPRDLNG"
     gene            complement(<294991..>297333)
                     /locus_tag="C5L36_0A01390"
                     /db_xref="GeneID:40381243"
     mRNA            complement(<294991..>297333)
                     /locus_tag="C5L36_0A01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463150.1"
                     /db_xref="GeneID:40381243"
     CDS             complement(294991..297333)
                     /locus_tag="C5L36_0A01390"
                     /inference="similar to AA sequence:RefSeq:NP_013407.1"
                     /note="PKUD0A01390; similar to Saccharomyces cerevisiae
                     YLR304C (ACO1); ancestral locus Anc_4.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319010.1"
                     /db_xref="GeneID:40381243"
                     /translation="MLAHARRSVRKFATASSIPVAPAGFESRTPPYAKLLRNLEQVQK
                     VLNGQPLTLAEKILYSHLVNPEEIASNVRDIRGLQYLKLNPDRVAMQDASAQMALLQF
                     ITCGMKSTAVPASIHCDHLIVGKEGADTDLKASISTNKEVFDFLQSCGEKFGIQFWGP
                     GSGIIHQIVLENFSVPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELKA
                     PKILGVKLTGELNGWTSPKDVITHLAGQLTVRGGTGYIVEYFGDGVKTLSCTGMATIC
                     NMGAEIGATTSTFPMQEAHHKYLTATGRGPIADLARDVNNQYGFLRADEGAEYDQIIE
                     IDLNTLEPSVNGPFTPDLSTKISELKAVTKENQWPNEVSAGLIGSCTNSSYQDMTRAV
                     SIIKQAEKVGLKPKIPFFVTPGSEQIRATMERDGLIDTFEKNDAIVLANACGPCIGQW
                     DRGSDAPSGENVIFTSFNRNFKARNDGNRKTMNFLTSPDIVTAVIYSGEMGFNPLKDS
                     IKLPNGEDFKFQPPNGEDLPSQGFIKGREEFYPELEPQPKPEVEISVSSDSDRLELLE
                     PFDKWNGEEVETTVILKVEGKCTTDHISAAGAWLKYKGHLSNIANNTLIGAVNKETGE
                     VNTAYDLDGSKFSIPDLMFKWKEENRPWIVVAEHNYGEGSAREHAALQPRFLGGKIIL
                     TKSFARIHETNLKKQGMLPLTFADEADYDKLSSGDILKTLNLKDMVAKNGDNGGVIQM
                     KVTKKSGEQFVIDCKHTMSADQVAFFKAGSAINYIGESKK"
     gene            complement(<297785..>299593)
                     /locus_tag="C5L36_0A01400"
                     /db_xref="GeneID:40381244"
     mRNA            complement(<297785..>299593)
                     /locus_tag="C5L36_0A01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463151.1"
                     /db_xref="GeneID:40381244"
     CDS             complement(297785..299593)
                     /locus_tag="C5L36_0A01400"
                     /inference="similar to AA sequence:RefSeq:NP_014787.3"
                     /note="PKUD0A01400; similar to Saccharomyces cerevisiae
                     YOR144C (ELG1); ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319011.1"
                     /db_xref="GeneID:40381244"
                     /translation="MKKLTAAQLLLGYKDKDPMKFESEIITPSTSRNVNKVNALSLLT
                     GNFSKHQNRKQTKKPRTSTRPSFFVTLRYSKRERVHAKNTSHPFFLEVKDKLKRQKLA
                     PKLTIEKQLELPWLTRDQFINKNIDPIEEELLRRPLIVEIPNQKKNQPSLPVIEPSEF
                     SLFVVSSLSKETRNDRPTCNITKTSILPSDEIFQKYQHLQFDNRFTKFFQNDYRSNTS
                     NNTVSQWCDLYRPTCHSENLQKEYISSDIFNWISNAFLTLKSVDSNKRMLKLKRGANS
                     TKDDFIVYSSDDDGDSKEDVPCLILEGPVGCGKTTLVYSIIEQLNGHVFEFSSNESRS
                     KKNLEFRLNQIGTTTNLEQSNSIILFDDVDLINEDDKDFWSCVTNLLACSYRPVVLTT
                     TSLKAIPDRIINESTIYTLESISELDLSHYIDFIALSRGLRLDNAIIDRFSKLSLRSA
                     IMQLQFFSYTIPTQNSNVGLIDVTKNETNTKRKKIKLLSRLKKLSYESDIAYFTNTIK
                     VKPLRDDFNEDKNSCLEFYSSKYFTHGKRSKSCRYSSGENYNKRHPTNVFTYLPKSTL
                     AAEVLPFISEMANKEQERIENNQPRLFDIFPMDVFQ"
     gene            <300096..>301343
                     /locus_tag="C5L36_0A01410"
                     /db_xref="GeneID:40381245"
     mRNA            <300096..>301343
                     /locus_tag="C5L36_0A01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463152.1"
                     /db_xref="GeneID:40381245"
     CDS             300096..301343
                     /locus_tag="C5L36_0A01410"
                     /inference="similar to AA sequence:RefSeq:NP_015079.1"
                     /note="PKUD0A01410; similar to Saccharomyces cerevisiae
                     YPL245W; ancestral locus Anc_6.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319012.1"
                     /db_xref="GeneID:40381245"
                     /translation="MKRGNEDDIYKEHQGEYIDRLCEVSLSEEQEKVRDVIIDFCKQT
                     LVGYQDGDKAKVFIVEGGAGTGKSVVMNTVFNEMQRLTRQVKVDGLKDEDHYLLVNHP
                     EMIRLYLRISKRYPYLRKGDVDRPTSFVNRADKKGKAGVVIVDEAHLLATCKNSWKGW
                     RYENHLIEILKRAKAVVLVYDHRQCLRTDQWWDKDTMTQLLTSEGIEYSKAELKVQWR
                     MQSEAVCEWARKFCYEKVQGWPVKEAKEAGFDFRYFDNAQKMYEKIVEMDKRCGSSRI
                     ISTYDSPYRISGGKTYYVDGRGGFHQPWDKYVGGPDVPPWSVRDTIHEVGSCYTVQGI
                     DLEYAGVIVGKSVVVVENPDKSMHIEVDVSQYCDNAGVAKRNGQYPSPRAVEDIIRNS
                     LYVLLTRGRKGLYVYVERFARRK"
     gene            <302033..>303931
                     /locus_tag="C5L36_0A01420"
                     /db_xref="GeneID:40381246"
     mRNA            <302033..>303931
                     /locus_tag="C5L36_0A01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463153.1"
                     /db_xref="GeneID:40381246"
     CDS             302033..303931
                     /locus_tag="C5L36_0A01420"
                     /inference="similar to AA sequence:RefSeq:NP_013774.1"
                     /note="PKUD0A01420; similar to Saccharomyces cerevisiae
                     YMR058W (FET3); ancestral locus Anc_2.622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319013.1"
                     /db_xref="GeneID:40381246"
                     /translation="MKFLSSLAIAGLASTVFAKEHYYHWNVTYVSGNPDGLLEVDDIV
                     GCNGEYPWPEIRVEKGDRVVVEVYNGLDNANTSVHFHGLFQHGTNQYDGVPGLTQCQI
                     VPGQTLIYNFTVPDQVGTYWYHSHSNGQYMDGMRGAFIIEDPDDPYKANYTQEKTIAL
                     AEWYHDNIFTLTESFLDLYNPTGAEPIPQNLLMNHFMNATIEVEPDTDYLFRIINMGG
                     FVSQYFWIEDHDMTVIAVDGVYVKPNTTDMIYITAAQRYDVLVHTKNQTTKNFAIMQK
                     FDDTMLDVIPDELLLNVTNNLQYNKDADWPEESIVEELDFLDDFWLTPLEDYENYDSY
                     DHQITIDVVMDNLLNGVNYAFFNNITYVAPKVNTLGTVLSANTSELALNSEIYGSNTH
                     AIVLQKDEIVEVVLNNNDTGKHPFHLHGHVFEVYQRGPDYGDEDEPVPYNESAPYTPR
                     EKSLFRDTLYVNPQSHFVIRFKADNPGVWFFHCHIDWHLLQGLALTFVEDPVGIREKE
                     ADLGETWKETCEACGGYTGNAANNTDFLDLHGENVQPKDLPAGFTARGIVALVFSCVA
                     GVLGCVTIFIYGMADIPNIEERVVKDLNIDERQLLAEFDEDEDEAVSSTGSTDPKFPD
                     TVTHTLEK"
     gene            complement(<304102..>305484)
                     /locus_tag="C5L36_0A01430"
                     /db_xref="GeneID:40381247"
     mRNA            complement(<304102..>305484)
                     /locus_tag="C5L36_0A01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463154.1"
                     /db_xref="GeneID:40381247"
     CDS             complement(304102..305484)
                     /locus_tag="C5L36_0A01430"
                     /inference="similar to AA sequence:RefSeq:NP_011945.1"
                     /note="PKUD0A01430; similar to Saccharomyces cerevisiae
                     YHR078W; ancestral locus Anc_5.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319014.1"
                     /db_xref="GeneID:40381247"
                     /translation="MAFLYKVASTIFLVFSHILSYQLSEKFIRPIILPLIYTTNNARL
                     ASLTNRNLQILHIDHHVVNNQIDSIKVYGESRFVIIAIDVIMSLSVQLIGLFLFDILR
                     FCDFSIRHLDCYITLVLLTIGLVYVIPVYILYKWIQPTPNNTNLVDYSKVILAWILVL
                     VVVYLATSKEMSGTYLQLSLYLVSLFGICCLSILNGIGCVMSLREMYEWFHGIHELLL
                     SGKEEELIRELKSENVDLIKAESLSRELVNIKNGDKGIGALVTYTTWIYSIYKIGYGI
                     IRVIQFMMNIVQKKKGEIDGNGDLLASTIAHILGYNGEQITMIINFLISVSFFLMSIQ
                     NVLITFKNLRLVKKKLVGLEIVNKLQVYNESVAILDELYQELIPLVLCEMTGIYVIST
                     ALMLNTKLPIHLTKLWINEQEWSGLKMTLDSLDVDFMNDWFDKWFVIGSTASILIFTL
                     FEKIIETSIV"
     gene            complement(<305609..>306397)
                     /locus_tag="C5L36_0A01440"
                     /db_xref="GeneID:40381248"
     mRNA            complement(<305609..>306397)
                     /locus_tag="C5L36_0A01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463155.1"
                     /db_xref="GeneID:40381248"
     CDS             complement(305609..306397)
                     /locus_tag="C5L36_0A01440"
                     /inference="similar to AA sequence:RefSeq:NP_012768.1"
                     /note="PKUD0A01440; similar to Saccharomyces cerevisiae
                     YKL154W (SRP102); ancestral locus Anc_5.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319015.1"
                     /db_xref="GeneID:40381248"
                     /translation="MNQALHKETSILVPLIITIFLLALGGYLMKRHSLITSNKKKFLI
                     CGQQGSGKTNLFHLLKEGTLPLLTVSSLEPQEGELKVDEKFAGEKTFQDIYVIDFPAN
                     KKLKSLYLTPFFEEHLADIKGIIYLIDSSTFDAKACHDVAEDLLEILNVSESRPNGID
                     MLVFCNKNDLFTSKKSTKIKEMLETEIGKIHDIKQRGLSKVDKSLSKGTISSEDMEDN
                     LDLAIQNGRFQFQLLESNVDFSQGNIFKDKWSTINDWLYEKIVN"
     gene            complement(<306754..>308397)
                     /locus_tag="C5L36_0A01450"
                     /db_xref="GeneID:40381249"
     mRNA            complement(<306754..>308397)
                     /locus_tag="C5L36_0A01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463156.1"
                     /db_xref="GeneID:40381249"
     CDS             complement(306754..308397)
                     /locus_tag="C5L36_0A01450"
                     /note="PKUD0A01450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319016.1"
                     /db_xref="GeneID:40381249"
                     /translation="MSGLLKKINPLGSSTLESGNANVNKDEQVLAELGYKQEFNRTYD
                     FLSSFSFALSISGLMGTISITYLYPLWAGGPACAVWCWFAGCLGCLCIAWSVAEITSC
                     FPTSGGMYYVITHVTPKKYVPLLCWIDAWLYFTGAITGCCSTDFGAATLLMNVIQMAS
                     DYTYNPSRGHITAVAILVILSHGAINSLPGSVLASVTKYYCFVNIGATIGLIVTLLAK
                     CPEFNTRQYTFGQVINSTGWDADGWAFLFGFLQVSWVMTCYDATSRMSEEAYNAAYLT
                     PLAIASALTTTAVLGWVLVIVITLTMGTDLDRILNTGSGQPIVEIYHIAMGKTGAIAY
                     LSLAFVVIWFCGAVAMCYTARGLWSFARDGGLPYSNFWYNLDPRTKAPLRCVWLICLI
                     NSLLVLINLGSNIAMNAIFSACAICTDWSYIIVLFLFALNREKMGVPRGPFHMGKLSK
                     FVMLYGVTWTVFLSIVFIFPNYMPVNKENMNYTVVILGAVFIGAGGWYAIDAKKWFKG
                     PLGNVDVDESADTQSGSSGDKIDSVSEENIETTGKTIDS"
     gene            complement(<309084..>310769)
                     /locus_tag="C5L36_0A01460"
                     /db_xref="GeneID:40381250"
     mRNA            complement(<309084..>310769)
                     /locus_tag="C5L36_0A01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463157.1"
                     /db_xref="GeneID:40381250"
     CDS             complement(309084..310769)
                     /locus_tag="C5L36_0A01460"
                     /note="PKUD0A01460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319017.1"
                     /db_xref="GeneID:40381250"
                     /translation="MTEELKGQKTLQTIKSVLSNDAPSIQDKEDANGLANLGYKQEFD
                     RNYGFLSTFSFALSISGLMGTISITYLYPLWAGGPACAVWCWFVGAMGCLCIAWSVAE
                     ITSCFPTSGGMYYVITHVVPKKYVPLVCWIDAWLYFTGAITGCCSTDFGAATLLINIV
                     QMASDYTYTPSRGHITAVAILVILTHGAINSLPGSVLSSVTKYYCIVNIGATIGLIVT
                     LLAKCPEFNTREYTFGQVINSTGWDADGWAFLFGFLQVSWVMTSYDATSRMSEEVHNA
                     AYMTPLAIASALTTTAVLGWVLVIVITLTMGTDLDRILNTGSGQPIVEIYHIAMGKTG
                     AIAYLSLSFVVLWFCGAVAMCYTARGLWSFARDGGLPYSNFWYNLDPRTKAPLRCVWL
                     ICLINSLLVLINLGSTIAMNAIFSACAICTDWSYIIAIFFFSLNREKMGVPRGPFHMG
                     KLSKPVMMYSCIWTLFVSIVFVFPNYMPVNKENMNYTVVILGAVFIGAGGWYAIDAKK
                     WFIGPKANIDADDDSSYGIEVRSEDYEMGSAGSDPVKSNRIKVAIMESPDKGN"
     gene            <311573..>313438
                     /locus_tag="C5L36_0A01470"
                     /db_xref="GeneID:40381251"
     mRNA            <311573..>313438
                     /locus_tag="C5L36_0A01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463158.1"
                     /db_xref="GeneID:40381251"
     CDS             311573..313438
                     /locus_tag="C5L36_0A01470"
                     /inference="similar to AA sequence:RefSeq:NP_010610.3"
                     /note="PKUD0A01470; similar to Saccharomyces cerevisiae
                     YDR323C (PEP7); ancestral locus Anc_5.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319018.1"
                     /db_xref="GeneID:40381251"
                     /translation="MIKPVQPNPEVSPPTNNSILSPKVEVDSKLSLNDPDNNLNTSSS
                     SRKSTSSSECTSRKCPKQPLTPSSALYEGDDDVKSLVYSDKDSTNIHNTPPRENTTTD
                     SLSKDNSGTIIDNVSSTPNSEKVINSRRFSFNKRPVSFSSKLQRKSSQISFINNYPPQ
                     RCDSIKRDIDHSKFYSKFKGIMKDKDELPDSAINDLSFEYNYDEKIRAPRMSVVSFIS
                     KASSINSQQQNHFNATRQTSAPVLLKTRTSSSNHTLESLSEEASYQPASFDLTKQLRH
                     LSIGEDAEKVRDEINTPFSDAYTYNITKTKSRISNSSSNVSPTKEKASFLSHEEKPPK
                     QIEAPTRLAKDYIPPVLRPIPTTSLVQIDLAEQNDSTKAKSIDHVETTPIMLNSNVEL
                     NTPPSSSSTLDSGTKCGPKKGKVHYQLFTQLSNRELPKTPVLKTTLGENPSISEALLT
                     ASVTNSSFYLPKKTPSNLEPSHSHWKPNCAVSACESCGSSFNLFHRKHHCRHCGGIFC
                     SNCLGQFANLNLLGNFEKPELLVRSALLSPIQSTETCATFGSNKTFSQRESSQRYSAF
                     CKVCPECSKLWIQFLASDEDYEGKILLEHGGSTASANLRKESLNAVPSDWNWSSF"
     gene            complement(<314679..>317030)
                     /locus_tag="C5L36_0A01480"
                     /db_xref="GeneID:40381252"
     mRNA            complement(<314679..>317030)
                     /locus_tag="C5L36_0A01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463159.1"
                     /db_xref="GeneID:40381252"
     CDS             complement(314679..317030)
                     /locus_tag="C5L36_0A01480"
                     /inference="similar to AA sequence:RefSeq:NP_011900.1"
                     /note="PKUD0A01480; similar to Saccharomyces cerevisiae
                     YHR035W; ancestral locus Anc_5.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319019.1"
                     /db_xref="GeneID:40381252"
                     /translation="MADIYEIEDIDGVRFNWNTFPVTRLESENMASPVGCLYTPLLPR
                     EDLPIANYDPQLCRKCRSALNVFSQIDMNNRTWTCPICFNRNQLPPQYQNISADNVPI
                     ELMPQASTMEYILNRSQPPPPPAFIYVIDLCQDPEDLKSLKDTLIASLDLHPPGCFFG
                     LVTFDSVVNVHELSFTSCSKKYVFSGKRELKSYDVQEQLGIKGNASRPWSQQFQSGSI
                     NNTINKFLLPLADETAKAQIVKSIEALEVSKWTIKPGHRALRVTGSALNIASCLAEGS
                     YVQCAAKISLFAAGACTFGPGQIVGTELKEPLRSHSDIEKGSAKHYKEAVKFYKKLAT
                     KAIGINRDSNDKFFDNSSTTTFSVDIFAGCYDQVGIYEMRHLSNKTGGVLVVTDSFQT
                     SIFKNSFLATFNKDEEGYPLTYFDGKLEVFTSPKLKVAGVIGHCQSLKKDGENVSDIQ
                     VGDGKTNQWKMCSISPKHTYAVFFDIQTVGAAEQRSQFVPEVYIQFQTTYRHTDGTYR
                     TRVTTMNRLTSNKGELSSSFDQEAAAVLYARLVVYKLENGGEYSDLLRWIDKSLVKLC
                     SAFGDYAKNDASSFRLSHKFSLLPQFIYHLRRSQFLQVFNCSPDETAFYHHTLLRADV
                     RDSLVMIQPTLVRFKADGSEPEPVLLDSASLTPDSVLLLDAFFYTVIYFGNIAAEWRD
                     ANYPRDEYPGVYEMIDGAKEEAAALIADRFPLPRYVTCDEGKSQARFLYSKLNPSEND
                     GKISGGGQMGNFGGDSGTVVHTEDVSLRTFFTHLAKLVVNHSA"
     gene            complement(<317566..>319152)
                     /locus_tag="C5L36_0A01490"
                     /db_xref="GeneID:40381253"
     mRNA            complement(<317566..>319152)
                     /locus_tag="C5L36_0A01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463160.1"
                     /db_xref="GeneID:40381253"
     CDS             complement(317566..319152)
                     /locus_tag="C5L36_0A01490"
                     /inference="similar to AA sequence:RefSeq:NP_013707.1"
                     /note="PKUD0A01490; similar to Saccharomyces cerevisiae
                     YML007W (YAP1) and YDR423C (CAD1); ancestral locus
                     Anc_5.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319020.1"
                     /db_xref="GeneID:40381253"
                     /translation="MLLSVVCFLYKRVTTIRNQRKMPSTKTQENAAVEKPHSKPGRKA
                     LTSEPKNKRTAQNRAAQRAFRERKEKRMKELEEKVQALEKEKMLLANESELLRHQVLT
                     LMKQVKGSQGIDGNHGIDINTNTSVSPEVKLDTSSEAWDTSNDGKSSFYESSSSSVHS
                     NTPVSFGNDYMAKMTTPKESSVGNLELTNKLNNADFKDNYDEQIFCTELSTACGSKSC
                     PIPRGKMEKHGQSISSEYSDSHGPTREKDAKHVPTTYSGSSCQSMTSSSSVTSPEFPS
                     PPSQVKGNVLNHDTSHFSTPFLNDGKVNEGIDSLDNIESPNWNFDFGHFDNKQPSVIP
                     TNRENEMDFLLSTNDFNNNFISKNPAAFQLDPTSAVFVDPVSNDFEVDFDDNAFDELL
                     KIPQGEEEVEVPLALQAGNTSKENIHSGSSKVVDKKEDEETVPDTNGNLIKCSQIWER
                     ITTNPRFTDLDIDNLCDELKQKAKCSENGVVVDSADVGKLLQSAIREKQENTQREREV
                     ALKRLAIANSSGGSILQGLW"
     gene            complement(<319401..>320750)
                     /locus_tag="C5L36_0A01500"
                     /db_xref="GeneID:40381254"
     mRNA            complement(<319401..>320750)
                     /locus_tag="C5L36_0A01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463161.1"
                     /db_xref="GeneID:40381254"
     CDS             complement(319401..320750)
                     /locus_tag="C5L36_0A01500"
                     /note="PKUD0A01500; Pfam Domains: ACBP(8.7e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319021.1"
                     /db_xref="GeneID:40381254"
                     /translation="MEVNTDKAFVEAVLVIKSLTDLSKKSNLPRPTIDDRLNLYGLYS
                     QATKGDINSNEPDGNRISEVRKYNAWKAFKGLTRKEARRQYCKYLLDVLKNNYSQEKY
                     PIVSPLRDRLQEMWDMLENHNLSLSIGESVHLGSPILPDSLTQTLTATTTSATTLPPP
                     QPTNGVSFNTPSYNIPPRAQSPAVSLFRMASSGINPSMIRPPSRNHSVSISRKNSVGA
                     TNYNNSNSNPLAKASTNIPTDSHHADLTTGNSIQHFNNVVDTDNCAVSSYNVEKHINS
                     LDFLKWQGEINNTLLKISTELANLKYRQISTDTSSKTKLNLENVEQRNFTGSTTLSCG
                     GFISDYKRRNANPNGRENNSNYVSRLAKFVYSKLSALFQRLQNKCILRLQNVNIANAS
                     RHILASIIALSILSAFEKLVGRLLRKRYGTFKVGFFDRCRRVFSTYAGAFSTGRLSP"
     gene            complement(<321464..>322058)
                     /locus_tag="C5L36_0A01510"
                     /db_xref="GeneID:40381255"
     mRNA            complement(join(<321464..321477,321575..>322058))
                     /locus_tag="C5L36_0A01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463162.1"
                     /db_xref="GeneID:40381255"
     CDS             complement(join(321464..321477,321575..322058))
                     /locus_tag="C5L36_0A01510"
                     /inference="similar to AA sequence:RefSeq:NP_010706.3"
                     /note="PKUD0A01510; similar to Saccharomyces cerevisiae
                     YDR418W (RPL12B) and YEL054C (RPL12A); ancestral locus
                     Anc_5.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319022.1"
                     /db_xref="GeneID:40381255"
                     /translation="MPPKFDPSEVKYLYLRAVGGEVGASSALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEAPRDRKKDKNVKHSG
                     NIPLDEIFEIARTMREKSFGKTLASVTKEILGTAQSVGCRVDNKPPHDIIEAIDAGAI
                     DVPEN"
     gene            complement(<322572..>324827)
                     /locus_tag="C5L36_0A01520"
                     /db_xref="GeneID:40381256"
     mRNA            complement(<322572..>324827)
                     /locus_tag="C5L36_0A01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463163.1"
                     /db_xref="GeneID:40381256"
     CDS             complement(322572..324827)
                     /locus_tag="C5L36_0A01520"
                     /inference="similar to AA sequence:RefSeq:NP_010861.3"
                     /note="PKUD0A01520; similar to Saccharomyces cerevisiae
                     YEL053C (MAK10); ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319023.1"
                     /db_xref="GeneID:40381256"
                     /translation="MSELVPPLEDLDINRKRQDFVDITDKFFELTNEIQYSHIVKSKE
                     FPLLHGTHALEILNPRLDTFLLEEVIYDISDSANELTLEETTAIIGNLLKSLTSWMGQ
                     NVSIPNSILSCEYISQILEIYTKDISLERVLTKFKSGSLNEIIIKFSILLISTVRFIL
                     ALAMKSQIYEEEDLNTSTMNLNWLYELSPNEIIKHSLVSPKTWKSIQENVEENDDIKT
                     KHISLLKNAFTILQSINSLESIYQWDINLFHLKSSHDLTSKLGNKLTQLENVVEKLNE
                     FESIDIDGIHVPRNCFNANSQIKFDNQAPPKVLPVVSSSWSDCTLNLIQLFNDCSDVL
                     KTVQASNSLEFMEWLKYLENKRNNNDANEINGLHIFSRVLFFSFINSNNQQQEQDFVF
                     RDKNLRFKDLFYSYMKELLLDGSKIDLEFQKRIKNVDAMQQIEYYLETVSLLFKESLF
                     LPTLNPSRQRQFKCKELRYWNMRQVETGQLEDYFRQIHFYTPSERYYPLTSVIIFFKL
                     KCILEVILKSIELNLFKDIREYVSVYYQVIVLVYHLNHHLDNMLGIANKSKKSKLSLY
                     LLYLKNEYNMIYQLSILKAKGYELMTYLGFYYLPKNLIHQLSNREDLLYNLQWRQFNN
                     ITDPEMLSYQDFKSRLQVNEKVYQNDFANYIESLNGEAKLLVGEFNKSFKFLNILLDK
                     LDWFHELKSIKRLEFENLHGEIHKTKTDIENLIRFAKSSESIAGHTIKISKLGRHCYF
                     PGFEIIEKTNN"
     gene            complement(<325409..>326026)
                     /locus_tag="C5L36_0A01530"
                     /db_xref="GeneID:40381257"
     mRNA            complement(<325409..>326026)
                     /locus_tag="C5L36_0A01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463164.1"
                     /db_xref="GeneID:40381257"
     CDS             complement(325409..326026)
                     /locus_tag="C5L36_0A01530"
                     /inference="similar to AA sequence:RefSeq:NP_010584.1"
                     /note="PKUD0A01530; similar to Saccharomyces cerevisiae
                     YDR298C (ATP5); ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319024.1"
                     /db_xref="GeneID:40381257"
                     /translation="MASRQFVRSLATAASSVKPPVQLFGLDGTYATALYTAAAKDSSI
                     DQVYQSVEKLNKAIEGDAKLANILANPALSAGSRAEVISTVSSTLRLDKSVTNLLTIL
                     SENNRLGLFQAIAKQFSVLNAAHNGVVEATVVSAKPLDNKTIQRLQKAIAGSKFVGAG
                     KSLKIYNEVKPEILGGLIVEVGDNSVDLSVSAKVSKLNKVLTESI"
     gene            <326534..>327649
                     /locus_tag="C5L36_0A01540"
                     /db_xref="GeneID:40381258"
     mRNA            <326534..>327649
                     /locus_tag="C5L36_0A01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463165.1"
                     /db_xref="GeneID:40381258"
     CDS             326534..327649
                     /locus_tag="C5L36_0A01540"
                     /inference="similar to AA sequence:RefSeq:NP_010864.3"
                     /note="PKUD0A01540; similar to Saccharomyces cerevisiae
                     YEL050C (RML2); ancestral locus Anc_5.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319025.1"
                     /db_xref="GeneID:40381258"
                     /translation="MFKGTISRALFTNTYPGSLNRLVVSRFASTVPPSSSSTTSATSL
                     HNELTALEKQDELNRKQVELAKEKVQMKKVKPTSPGLRWWRKPIYPYLWKGKPYKPLT
                     VTRVAKSGRNNTGRIVVRHQGGGVQRRIRIVDYERKTPGPQTVVRIEYDPNRTSHIAL
                     LKHNETGEHSYIIACEGLRPGDQVESFLAGIPKRFIEEMGGKIDPALLSVKISGKGNC
                     LPISMITIGTIVHNIGEHQKGPAKYCRAAGAYGRIVSKLPEENRAIVQLQSGEQRYVH
                     LEACATLGVASNSAHHNESLGKAGRNRHKGIRPTVRGVAMNTCDHPLGGGRGKSKSNK
                     PSMSPWGVLAKGGFKTRKGKHENKNKFKDRPRGAANK"
     gene            <328221..>331160
                     /locus_tag="C5L36_0A01550"
                     /db_xref="GeneID:40381259"
     mRNA            <328221..>331160
                     /locus_tag="C5L36_0A01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463166.1"
                     /db_xref="GeneID:40381259"
     CDS             328221..331160
                     /locus_tag="C5L36_0A01550"
                     /inference="similar to AA sequence:RefSeq:NP_009640.1"
                     /note="PKUD0A01550; similar to Saccharomyces cerevisiae
                     YBR084W (MIS1); ancestral locus Anc_3.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319026.1"
                     /db_xref="GeneID:40381259"
                     /translation="MLRQVTRRSSLRLATKVNGFSRTYRNFSTSSTLLDATIISGKQL
                     AQKIRAQTFEQIGLQKQKYPEFQPKLTIIQVGDRSDSSTYVRMKAKASKEADIDCEVI
                     KLPEDVDEFTILHTISKLNDDSKVNGILVQLPLPKHLDEDKIVNSVSSIKDVDGFDTF
                     NVGELSKKNGNPHYIPCTPNGCIRLIKETGVDLKGKNAVVIGRSDIVGSPVSALLRRE
                     DCTVTTCHSKTENVKDLISRADIVIAALGHPSFVKGDWIKEGAIVIDVGINYVEDSTK
                     KNGYKVVGDVDFESVKEKARFLTPVPGGVGPMTIAMLIENVFNAASKQLAKNQEPLKI
                     NPLKLKTLNPVPSDIDISRAQIPKLINQVAKELGIKNKDFENYGHYKGKVSLDVYEDL
                     KDKRDNGNYVLVAGITPTPLGEGKSTTTMGIVQALGAHLNIPAIANVRQPSMGPTFGV
                     KGGAAGGGYAQVIPMDEFNLHLTGDIHSISIANNLLAAAIDTRMFHESTQKDEPFYKR
                     LVPRKNGVRKFTPSMLKRLRKLGIDKTDPDSLTSEEISRFAKLNIDPKSITIKRVVDV
                     NDRFLRGITIGQAPTEKGFTRETGFDITVASEIMAILALSKDLKDLRERVGKMVIGLN
                     VDGEPITCEDICCAGAITALLKDTIKPNLMQTLEGTPVFVHAGPFANISIGASSVIAD
                     RLALKLVGKPRKSSDDFKKGFVVTEAGFDFTMGGERFYNIKCRSSGLKPNVVVLVATT
                     RALKLHGGASDVKPGQVLPTEYVTENIEFVRNGASSNLRKQIENAKSYGAPVVVAINK
                     FATDTEKEIETIREEAIKAGAFDAVESDHWSQGGKGAIKLAEAIVRATEERPLKESQP
                     PNYLYSLDGSLEDRLRTIATKMYGAKDIELSELAKKQIEEYESQGFGKLPVCIAKTQY
                     SLSHDPTLKGVPKDFIFPIREVRISAGAGYLYALAAKIMTIPGLSTYAGFMNVEVNED
                     GEIDGLF"
     gene            complement(<331444..>333171)
                     /locus_tag="C5L36_0A01560"
                     /db_xref="GeneID:40381260"
     mRNA            complement(<331444..>333171)
                     /locus_tag="C5L36_0A01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463167.1"
                     /db_xref="GeneID:40381260"
     CDS             complement(331444..333171)
                     /locus_tag="C5L36_0A01560"
                     /inference="similar to AA sequence:RefSeq:NP_011601.3"
                     /note="PKUD0A01560; similar to Saccharomyces cerevisiae
                     YGR087C (PDC6)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319027.1"
                     /db_xref="GeneID:40381260"
                     /translation="MTDKISLGTYLFEKLKEAGSYSIFGVPGDFNLALLDHVKEVEGI
                     RWVGNANELNAGYEADGYARINGFASLITTFGVGELSAVNAIAGSYAEHVPLIHIVGM
                     PSLSAMKNNLLLHHTLGDTRFDNFTEMSKKISAKVEIVYDLESAPKLINNLIETAYHT
                     KRPVYLGLPSNFADELVPAALVKENKLHLEEPLNNPVAEEEFIHNVVEMVKKAEKPII
                     LVDACAARHNISKEVRELAKLTKFPVFTTPMGKSTVDEDDEEFFGLYLGSLSAPDVKD
                     IVGPTDCILSLGGLPSDFNTGSFSYGYTTKNVVEFHSNYCKFKSATYENLMMKGAVQR
                     LISELKNIKYSNVSTLSPPKSKFAYESAKVAPEGIITQDYLWKRLSYFLKPRDIIVTE
                     TGTSSFGVLATHLPRDSKSISQVLWGSIGFSLPAAVGAAFAAEDAHKQTGEQERRTVL
                     FIGDGSLQLTVQSISDAARWNIKPYIFILNNRGYTIEKLIHGRHEDYNQIQPWDHQLL
                     LKLFADKTQYENHVVKSAKDLDALMKDEAFNKEDKIRVIELFLDEFDAPEILVAQAKL
                     SDEINSKAA"
     gene            <333867..>336017
                     /locus_tag="C5L36_0A01570"
                     /db_xref="GeneID:40381261"
     mRNA            <333867..>336017
                     /locus_tag="C5L36_0A01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463168.1"
                     /db_xref="GeneID:40381261"
     CDS             333867..336017
                     /locus_tag="C5L36_0A01570"
                     /note="PKUD0A01570; Pfam Domains: MAN1_C(3.4e-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319028.1"
                     /db_xref="GeneID:40381261"
                     /translation="MDSSQYLSPEFNPWTLRVKDLRPLLASHGIRASPRDRKADLVRL
                     FNTDLRPKLTESLNTNNPKNNNNNTDTIDTTNNPLKRRRLSNVDEPSIPYTRSTPATA
                     EPPVSLQLQPPLKRRKGRKRDAKSRATELTATEDGKNGHLDNGSKVRENANSKGNETT
                     IIRGLFKRDTPVKFEDTEFNDKVIFGDVVPRHISSLTNNRPSEVGDEIAAHSTFIEQD
                     HGLTAKVKQEPVSAPSSPGRLESTPFPPLHQGSLSSNRQDLSSHTPTDLEENSFDSIK
                     NTINAPIVTNDDTSRLALSGPTVDIRDGSFAPQTPRNSSPLTHSESGNPVSCSSLSFD
                     TPTRQTESLLESVSEGVDESALLGDLQHDFELENSKIAQEANVTLQKINAREKFALYR
                     YSFIKLTISWLLFLLLTYVFVLYRHERIKVGFCNVDGSSTPAENIFSLQCVPCPPHAT
                     CFSESRLSCHQDYILYAPLFWSLGGILPTFNKCILDSTKIKKINKITKEILNLLSRRN
                     AEFNCGDANDEIASLSWNQIVEIVDQRLLLDRNDANHDYFWNRVKLLVPSMVNIRETK
                     HGLRSTSLHHLTFRCRLKRFFMTILLRYKIYWLCLSLLLTFLSFVFHRVNQLIRRNEH
                     HHRLVADILKKLQRQAKDNGNGNGNGIQAQKYIPKIHLRDFYLPQLNDLTRDSRKTVW
                     NSVVKEVEQNSNVKVDDIEVNGDIMRVWTWNSGF"
     gene            <336442..>337566
                     /locus_tag="C5L36_0A01580"
                     /db_xref="GeneID:40381262"
     mRNA            <336442..>337566
                     /locus_tag="C5L36_0A01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463169.1"
                     /db_xref="GeneID:40381262"
     CDS             336442..337566
                     /locus_tag="C5L36_0A01580"
                     /inference="similar to AA sequence:RefSeq:NP_011367.1"
                     /note="PKUD0A01580; similar to Saccharomyces cerevisiae
                     YGL148W (ARO2); ancestral locus Anc_2.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319029.1"
                     /db_xref="GeneID:40381262"
                     /translation="MSTFGTIFRVTTYGESHCKSVGCIVDGVPPNMSLTEADIQPQLT
                     RRRPGQSKLTTPRNEKDQVEIQSGTEFGKTLGTPIAMVVKNQDQRPHDYSDMDNYPRP
                     SHADYTYQMKYGIKASSGGGRSSARETIGRVAAGAIAEKFLKQINDVEIVAFVSSVGD
                     CSIDRSCLNPEFMELLQNITRDQVDAAGPIRCPIPEKAKEMTKIVETVRDEQDSIGGV
                     VTCVIRNCPIGLGEPAFDKLEALLAHAMLSIPASKGFEIGSGFEGTKIKGSLHNDPFV
                     QKGDRLGTITNKSGGIQGGISNGENIYFSVPFKSPATICQGQNTATYDGQEGVLNSKG
                     RHDPNVVPRAIPIIEAMAALVIADAYLIQKSRESSFNAVY"
     gene            complement(<337576..>340035)
                     /locus_tag="C5L36_0A01590"
                     /db_xref="GeneID:40381263"
     mRNA            complement(<337576..>340035)
                     /locus_tag="C5L36_0A01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463170.1"
                     /db_xref="GeneID:40381263"
     CDS             complement(337576..340035)
                     /locus_tag="C5L36_0A01590"
                     /note="PKUD0A01590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319030.1"
                     /db_xref="GeneID:40381263"
                     /translation="MKPVVFALLFSLLQTVFTLTHQDVIYDYNGRQVYIHLHNHDRKE
                     LDTKGMSSNKIFRIPFNSKFDTGDTIANSTITSPTNELCKIVIANSTLLSFCPSSDET
                     TLDVNKYSSDKDAWEPISLASQMSYLNDSNYLYTNTDPSGVYIFSGLLGRSVSTIMTR
                     LDINSWNFTDATSRIQPAPFYKSTTLQINTNTQVLFGGISANNDLVSMMQIPVWQYNS
                     WAERPCKIGTVEGLESRVNPLVLPVFSRDNPYFQNGNLTNFEVSSVLMIGGKTMDDRN
                     AQPRIASLNVSSSLLSWEWKSLSTANGSNDTTSLYRSLDDIVAASTIYDTLIAIKVNE
                     TRKRDSSNDAHKYYIELFNATTLEPLDGVDYSHLQDIELVGSHTSKSTIIAISVIIPV
                     LVIILVVILITWLYKRYKEKKEQELHDREVKEIVDFYQNQHKRNSQLTLTTSDSDYKS
                     SDGSAFEYNIRVSNYQDDDNLSLSSWRKKRKQYLEERLMYKLNKPLRKTNNPLSRSLS
                     VASNFMGTLSRKNSTQSSIATFVTAPSSVTEQQNKDSRITNSAGDDSLTSDNPFQSEL
                     YTIKSNTSDTNASLAEPPPAVPKHSTFFTLNRTNSNLHHIPEDSSINTFHSENLGFIT
                     LNQAYGSSPQHQYMKTIEKRMSYPVYASSLSSSSSYYESSFSSSASPSRSPSRSLIKS
                     PPRSPGRSINTRTRPLSMVSIMPSINSVDSGADESFVNDTTIMETIGEAETGSIIERD
                     NDNMEVQVLVGHKRRSKLRVVNPDDALEEEEVKSRCSSSGSSKVHSNFEVRQRVASRE
                     ESIHEEIEDEKRGRGVNIEKH"
     gene            <340749..>341969
                     /locus_tag="C5L36_0A01600"
                     /db_xref="GeneID:40381264"
     mRNA            <340749..>341969
                     /locus_tag="C5L36_0A01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463171.1"
                     /db_xref="GeneID:40381264"
     CDS             340749..341969
                     /locus_tag="C5L36_0A01600"
                     /note="PKUD0A01600; Pfam Domains:
                     Glyco_transf_15(9.4e-136)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319031.1"
                     /db_xref="GeneID:40381264"
                     /translation="MGKVLSYRYLTCQVALLFVFLVFFLIYLLSVDWDFTFIWKSTPK
                     VELFNDNDIEIRIKEGVDSANRVQDATLFTLCQNTDLGGMLHSIKSVEERFNNRYHYP
                     WVFANDVPFSDDFKDRISEAVSGNAIFTTIPKQYWEVPANIDMKYVEMQLKKMKAEGV
                     LYGGNLSYRQMCRFNSGFFYKLEALKEYEWYWRVEPNIKFKCDIPYDPFQVMKKEEKV
                     YGFALAMIEDPRTIRRLWKTTRDYFETQEDWASKIPESSHYNKFDDDSRSLEFIEQNV
                     DAKEMVRGDFNLCHYWTNFEIANLDFFRSPNYENYFQILDNTGNFFYERWGDAPVHTL
                     AVSYLLPVSKIKYFDNTGYFHETIGNCPREKSLHRELNCMCSRYTEFSWNVYSAVPRW
                     FEAFGLPLPREKHY"
     gene            <342244..>343641
                     /locus_tag="C5L36_0A01610"
                     /db_xref="GeneID:40381265"
     mRNA            <342244..>343641
                     /locus_tag="C5L36_0A01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463172.1"
                     /db_xref="GeneID:40381265"
     CDS             342244..343641
                     /locus_tag="C5L36_0A01610"
                     /inference="similar to AA sequence:RefSeq:NP_011334.1"
                     /note="PKUD0A01610; similar to Saccharomyces cerevisiae
                     YGL181W (GTS1); ancestral locus Anc_8.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319032.1"
                     /db_xref="GeneID:40381265"
                     /translation="MGKSKQNHQERVLLDLLNSPVNRNKCGECKAHDPTWASWNLGVF
                     LCGRCASGHRSLGRHISRVKSLSMENWSKHELDVLGRIGNKRNNQFWNEKSIPFTFEA
                     DDKDELVMWLRRKYTGKFRYGPVTDKDYNLDDDWGDRTDDYGFDKIKTSKRGYFTSLS
                     SDNIGPTRSMRRAQERSMSYDGEDYGYDDDYPSRNRRGSARSSASPVHTSSSSSVGRS
                     MRLTYRRPTDTEYRKYGDMSRKMKYDLGYEDEDSNIEALSMTHGNIPKAVEILKQNGS
                     KPSNANNSRSSVSSYSNRVEPNKTPSLPARKQETGAIFDSSKAGGFNWLDDTVSTSVT
                     TMDTGNAADNNIYQYVDPTTGNVYYIDAQGQQYIDPSQQQQMQQFDNTMIPQQQIQQP
                     MAPQQTVNPFQQPIMGGVLPLQGQPDLTLNQLQQQQLQQQQQQQIQMQIQMQQTHQLQ
                     QQQQQQQQQPFFNGY"
     gene            <343921..>346743
                     /locus_tag="C5L36_0A01620"
                     /db_xref="GeneID:40381266"
     mRNA            <343921..>346743
                     /locus_tag="C5L36_0A01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463173.1"
                     /db_xref="GeneID:40381266"
     CDS             343921..346743
                     /locus_tag="C5L36_0A01620"
                     /inference="similar to AA sequence:RefSeq:NP_012478.3"
                     /note="PKUD0A01620; similar to Saccharomyces cerevisiae
                     YJL057C (IKS1); ancestral locus Anc_1.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319033.1"
                     /db_xref="GeneID:40381266"
                     /translation="MSSSNNPVLAASTSEAGKVISHFKFGMEIGRGSFANVYKGTDLQ
                     SRKTVAIKSVFRSRLKNQKLISNLEIEIKILRNLKNPHIVSLLDCVKTDNHIHLIMDY
                     CSLGDLSYFIRKKDQLADCHPIIKAVLEKYPSPPNLNGLNQVLVINFIKQLASALQFL
                     RSQNLIHRDIKPQNLLLCTPAHSKEQFIEGGYSGFWELPILKVADFGFARYLPSTSMA
                     ETLCGSPLYMAPEILRYEKYNAKADLWSVGAVIYEMAVGKPPFRASNHIELLKRIEKA
                     NDQIKFPKELEFQQDLIHLISNLLKANPIDRMGFDEFFNDPIIVSTKNLVESMNESLS
                     YSFENEEMYVSEFLNAQNIKQLGEISADKKTKNNTTKMLKHINEKTKNSTDKVVTAIS
                     NVKELGKTKTLYAQSNTDSTTVNSTPLNKLVIAEEDENQSESVEQGEGDGIGNNNTTY
                     CDDQNQIQTSETSNAISINSGVNMKSNIRSNMSFFKSPASNDVTKETVRTSSDISNAN
                     ANSNSNSNLKSVEALLQNSKATLESAALQTPDLHSLNAHMQNTSGCTSSNATKILKKD
                     LIVEKDYVVVEKRNVEINTFADEVKKASFTIEGRKLNSGSRRYSLSVSPSTALKDVID
                     YTSGKLFGLNNANTNLSNVKTAKPITGFPKRMGGEHIKHENDTKRLINITNKQVTGTS
                     NTKITDEDEEMISKIERLAMMAHSISIFGLVKFNQVIPLPPSTIDDTNNIIDPYNYKN
                     ETYKIDNEKDNLDSESCRQYNLVYKRLCQEGLVLYLKVLSMLSEAIKISSEWWSRNKL
                     KSNITPKIGELIQWIRNKFNESLEKAEYLKLRINRFEEENANSSSKEEEFVCEKIIFD
                     RSIEISKNTAIRELKSSNRKDGDISELKACEVAYSLAVWMLESLIYKSNEDEGLTGND
                     AKIVENFINSIGTRLLILRGKIDRSL"
     gene            <347220..>348278
                     /locus_tag="C5L36_0A01630"
                     /db_xref="GeneID:40381267"
     mRNA            <347220..>348278
                     /locus_tag="C5L36_0A01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463174.1"
                     /db_xref="GeneID:40381267"
     CDS             347220..348278
                     /locus_tag="C5L36_0A01630"
                     /inference="similar to AA sequence:RefSeq:NP_014641.2"
                     /note="PKUD0A01630; similar to Saccharomyces cerevisiae
                     YOL002C (IZH2); ancestral locus Anc_6.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319034.1"
                     /db_xref="GeneID:40381267"
                     /translation="MMMNNKKTSGIDVTETTVKNIANSTKKSMRDGDIRLAESSTDEL
                     QAVKPHRLLVSYHDLPHWQKDNDYILHGYVRETNSYWLSIDCLFFLHNESINIYSHLV
                     PGFIFPLFLVVFVPWLSIHENFISCIPTWLIYLPKFTNTDETDNLVFLLFFIGFMFCL
                     TCSATFHTLKSHSHRVSIIGNCLDYAGILVLIGTSLISVIHYALIDHQHMKNMFVTII
                     VIIGFISLCFTWHPKFKTPAWRPIRTSMFIMFSFSGLLPICYALAIMDFTTIVNRAGL
                     KYVALEGLSYLSGAALYACRFPERLAPGIFDLFGHGHQLFHLLVVSGAYWHLRALGHA
                     YIVAKSSTLSGEIVSKAL"
     gene            complement(<348310..>350349)
                     /locus_tag="C5L36_0A01640"
                     /db_xref="GeneID:40381268"
     mRNA            complement(<348310..>350349)
                     /locus_tag="C5L36_0A01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463175.1"
                     /db_xref="GeneID:40381268"
     CDS             complement(348310..350349)
                     /locus_tag="C5L36_0A01640"
                     /inference="similar to AA sequence:RefSeq:NP_011391.2"
                     /note="PKUD0A01640; similar to Saccharomyces cerevisiae
                     YGL124C (MON1); ancestral locus Anc_6.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319035.1"
                     /db_xref="GeneID:40381268"
                     /translation="MNGEIGTSPLEFRDDYFAAALSSDDSEESTSLGSNFHGLENACI
                     TDGKLRKQKSIISLNDTNRKGILFNNIRTEPTSGLNLENASVRAPKNDEPEDTSLNLL
                     DDSFSILLENNMNDVHSDRDDTLVGRVPSKTGFPYESIKDLEKSDENDDPNEFFKRRQ
                     QFFILSTAGKPIYSMHGSYELLVVYSGVIQTIVSFYKYPTKEENQESIKCITLKDAKT
                     TKPLKFVFLDRSPLILLTIIKESDATQFELEQQLDFLYSFIISALSKPYIDKIFNKYP
                     NFDLRNLLGQTDLLTLDSICEDLSNNTNVSQILGGLQTLRMHSSARLKLERKLIGHRT
                     SNLLYGLIIGPDQKLISIVRPKRHTLHTSDLMILFEMIYNTNTFKSKNDEDEKLRIVT
                     NETFWIPLCLPKFNSSGHLYTLIQFHQLYDERFFKLHDIKMTDSAQIDEDSTKIGIIL
                     MSPFKESFSELKSISNAISKDILFDRSIYCDIWKGVTAKGRLVVEKILLDQTKKSMNS
                     GISAKLTVSSIMNTLSFQNDERPEDQIMQSSDASGEMIHFSAKNKQLVQCIFPESFSF
                     DIKENHIRRNILEIYKYLRRRLQFVSSDLYVLEEDNKSVSDLEGLGSFKNNIVYEKWI
                     NEGHGEIIVGFGYKAGPYEIMIIAKGDKFDESTMIKYSIKILKWCRKQQRTIFIS"
     gene            <350601..>352991
                     /locus_tag="C5L36_0A01650"
                     /db_xref="GeneID:40381269"
     mRNA            <350601..>352991
                     /locus_tag="C5L36_0A01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463176.1"
                     /db_xref="GeneID:40381269"
     CDS             350601..352991
                     /locus_tag="C5L36_0A01650"
                     /inference="similar to AA sequence:RefSeq:NP_009829.2"
                     /note="PKUD0A01650; similar to Saccharomyces cerevisiae
                     YBR270C (BIT2) and YJL058C (BIT61); ancestral locus
                     Anc_1.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319036.1"
                     /db_xref="GeneID:40381269"
                     /translation="MSLRHKKSTASLTRQNTSSTADVLSLSRSDTHTDKHSLDARIDK
                     KIMKLSHFFHRAKTDDSMGLENMKHSLGDSGSESEYSEDIPPPMQLRSNSLYSLKNDS
                     SGTLTNRNLSNDSYLGANNVEFNNVRNNSFTGSSGSGMVSSNASIYEKTKDSKLGRFL
                     HKTGHKVKKLSDINNETLNGLGLSLHTEGHQHHHAAKELKSPIGRNFGGKMNSEQKTS
                     FGDKLKLLNSTKYKNYHYHNILRKQKDSIKNGMKIGTKTNDIIINGKNYTNNISGSSY
                     ALSDINVGEVEMMITSQVLNFEQCEQYSLFLFGRIQHLLLPLFKGENLKCPIEDVTKL
                     VSLYVRIRKLQEETIKASDGRSSFSKTIKTVPSLTQISTSAYKFEDASDNGTITDDDD
                     NGQYKTPFMKPTASFIGSPMTNESRLSSGLYSPIIQTGPKFDAMSKVLDEIRNMLRSN
                     MNVMINQLFYDEPKDSIKFIRGTNDSLRKRVNTINSLASRNGTRRHSSSVENEDFGDS
                     FMDNSFFVDQTYSNSVMDLPIVAPSQSSIFTDTNDSVGETRKTSASFMDNTRTSIYTN
                     HSVPTNDILAASESDDAGTTSRLLGLGMLPPGRFEKCTSILWDIFQRDILFELSSILL
                     PIELEFANGHREKSNIHRQADSILYNGGEKIHTFTNTLIHPEISGSAPKLPRKDTMGS
                     LGEWSDLNIHDTLLLVFRDHVIIPLYEMNRKFEERDDPDVSFQRSVRGRAGKNGTKYG
                     SLVDMEEYRDAASLVQCFQRVCGVATNDTNQKLVENLLQQLKMLVSDLEHRIHAGT"
     gene            <353249..>354964
                     /locus_tag="C5L36_0A01660"
                     /db_xref="GeneID:40381270"
     mRNA            <353249..>354964
                     /locus_tag="C5L36_0A01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463177.1"
                     /db_xref="GeneID:40381270"
     CDS             353249..354964
                     /locus_tag="C5L36_0A01660"
                     /inference="similar to AA sequence:RefSeq:NP_013360.1"
                     /note="PKUD0A01660; similar to Saccharomyces cerevisiae
                     YLR259C (HSP60); ancestral locus Anc_6.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319037.1"
                     /db_xref="GeneID:40381270"
                     /translation="MLRFASSSSLRQSLKQTTQIRTIAHKELKFGVEGRAALLKGVET
                     LADAVSVTLGPKGRNVLIEQPFGAPKITKDGVTVAKSIVLKDKFENLGAKLLQDVASK
                     TNESAGDGTTSATVLGKSIFSESVKNVAAGCNPMDLRRGSQAAVESVIDFLSQHKREV
                     TTSAEIAQVATISANGDSHIGNMLASAMEKVGKEGVITIKEGKTLEDELEVTEGMRFD
                     RGYISPYFITDAKSGKVEFENPLLLLSEKKISSIQDILPSLEISNKMRRPLLILAEDI
                     DGEALAACILNKLRGQVQVACVKAPGFGDNRKNILGDIAILSGGTVFTEELDIKPENA
                     TPELLGSAGAITITKEDTVILNGAGSKDVIQQRCEQIRGAIEDASTSDYEKEKLHERL
                     AKLSGGVAVIRVGGSSEVEVGEKKDRYDDALCATRAAVEEGILPGGGTALIKATQVLD
                     SVKTENFDQKLGVDIIKAAITKPAKRIVENAGGEGSVVVGKLLDQYADEFNVGFDSSK
                     GEYVDMIEAGIIDPFKVVKNGLVDAAGVASLLATTECAIVDVPEPKGPAAAAAPGMGG
                     MPGMF"
     gene            <355310..>356554
                     /locus_tag="C5L36_0A01670"
                     /db_xref="GeneID:40381271"
     mRNA            <355310..>356554
                     /locus_tag="C5L36_0A01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463178.1"
                     /db_xref="GeneID:40381271"
     CDS             355310..356554
                     /locus_tag="C5L36_0A01670"
                     /inference="similar to AA sequence:RefSeq:NP_012476.1"
                     /note="PKUD0A01670; similar to Saccharomyces cerevisiae
                     YJL059W (YHC3); ancestral locus Anc_1.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319038.1"
                     /db_xref="GeneID:40381271"
                     /translation="MLHISPTFLSFFIFGLVNNVLYVIILTAAHDLVSPTTPKSLILL
                     ADILPAFLLKLALPWLVKQTTHRETQIGLGINYRLRLAIIVALSATGMFLTSLALPLY
                     IVLLGVVLASLSSGLGETTFLQLSHFHNQDSSNTAIHGWSSGTGAAGLIGAGLILVLT
                     TIFKLPIDVVLRFCSLFPFIHLYVYYCYLPTPVLYAYSTRMEDNGINYDDPSEITNGI
                     NLYESTFVSETTVEKTMLTKMRNYFWVYMLPLSVVYFAEYTINQGVAPTMLFPLEDTP
                     FDTFRDSYVAYGTLYQVGVFISRSSGSFIKLHNLYLMGILQFVNLAFCILQSMYMLIP
                     NIWVVFLLILYEGLLGGAAYVNTFMKVSDEVGNEDREFALGCVGVSDSFGIVLAAIIS
                     LWLEPKLCGYQVGIGRNWCTKK"
     gene            complement(<356777..>359497)
                     /locus_tag="C5L36_0A01680"
                     /db_xref="GeneID:40381272"
     mRNA            complement(<356777..>359497)
                     /locus_tag="C5L36_0A01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463179.1"
                     /db_xref="GeneID:40381272"
     CDS             complement(356777..359497)
                     /locus_tag="C5L36_0A01680"
                     /inference="similar to AA sequence:RefSeq:NP_013230.1"
                     /note="PKUD0A01680; similar to Saccharomyces cerevisiae
                     YLR129W (DIP2); ancestral locus Anc_8.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319039.1"
                     /db_xref="GeneID:40381272"
                     /translation="MVKSYPRYIQDTVFGVISSKSNIIYNRKANSVYASALDSIIEWN
                     YKTQTQISTITDRVTPGALNSSSLLPPAEITRLAYSSFANLLAIGLSNGDIKVWDLST
                     DSLIIKFQGHKSAISCLEFDTNGTQLISGSNDTTIIIWDLISEAGLIKFKGHKNMITS
                     IHYYNDNYLISTSKDGLLKIWDLKVNQCIETHLAHNGESWSMCKFTYNDKEFLLTTGL
                     NGECKIWSLNMDLDDGNKLKEFGVFEKQSKNRVADVKFDEHNQLLILANADKMVEVFR
                     LRSVQEIKKATAKRTKRLSEKGMSEEEIQQSLENSKIQMLICPFTIIFTESKINNICL
                     LNSNSKEVNLVVNNSNNTLNYWTIHLPENVKKHNNINDKISVLKYSVDRPGHRSDIRS
                     VDINDDDTLLYTGSNNQIKIWNLKTLNCIRSIERIGNVLCGKFLPGGSLLVVGLKNGD
                     LKLIDLSTSEVIHHIESAHDDSIWAIEITSDGKTILTGSSDKTVKYWEIKVNTLENQL
                     NLSHVKSLEVNESILALKISADSKYLAVSLMDNTVKVFFFDTLKFYLSLYGHKLPVLS
                     IDISFDSKVLITCSADKNVRIWGLDFGDCHKSIFAHDDSIMNIKFFPQSHNFLTCSKD
                     KFIKYWDGDKFDQVQKFAAHLGEVWGLAINSDGEFFVSISHDSSIRIWKQDNDEVFIQ
                     EEREKEMDELYENELLTSLEGDDITPRKTGEDEDEEMNDAEAVRSKTMENLKSSEKLI
                     EALDMMDDEENALLKAMNTTPSQNLFDTLSKIKPNQLEDSLLVLPFSYSVKLLSAINE
                     WTKDNGLLQKNSARLNVISRTLFFIVRSNHLELISQKDEVFKNKMITLKTQLRSTIKE
                     TTNDIGFNVQGLRFLQNKWSQDHSHIYADDDEAAEATSDKVRKRVYTTLA"
     gene            complement(<359677..>360441)
                     /locus_tag="C5L36_0A01690"
                     /db_xref="GeneID:40381273"
     mRNA            complement(<359677..>360441)
                     /locus_tag="C5L36_0A01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463180.1"
                     /db_xref="GeneID:40381273"
     CDS             complement(359677..360441)
                     /locus_tag="C5L36_0A01690"
                     /inference="similar to AA sequence:RefSeq:NP_013229.1"
                     /note="PKUD0A01690; similar to Saccharomyces cerevisiae
                     YLR128W (DCN1); ancestral locus Anc_8.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319040.1"
                     /db_xref="GeneID:40381273"
                     /translation="MFSAKITNFIQVTGCADETIADYFLKKNKLHLNNAIDDFYANGH
                     VVVQESANAKVISQIFDKYTDNDSKDQIGIDGALSYFSDMGIDVENDVEALIAAYILK
                     SPSTCIFNKTEFVSGWCNVSPEITSVADMARYLHHAKNNCDLMKKVHNFAFMYALDEG
                     ERKLEIDAAVALWKIIYKADFAHFEETGKHTTVTKFVIDFIVSGKSGKSQISRDEWEM
                     SYDFFVIPLVELENYSESEAWPVLMDDFVDFLFGRV"
     gene            <360832..>362637
                     /locus_tag="C5L36_0A01700"
                     /db_xref="GeneID:40381274"
     mRNA            <360832..>362637
                     /locus_tag="C5L36_0A01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463181.1"
                     /db_xref="GeneID:40381274"
     CDS             360832..362637
                     /locus_tag="C5L36_0A01700"
                     /inference="similar to AA sequence:RefSeq:NP_013228.1"
                     /note="PKUD0A01700; similar to Saccharomyces cerevisiae
                     YLR127C (APC2); ancestral locus Anc_8.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319041.1"
                     /db_xref="GeneID:40381274"
                     /translation="MRETTSPHRYIGEPPIDETEILLKWLNSQIFTSSDYQDVQIPTV
                     VQNLIRDCPDSHFFLPVFQRILYAKSKQLNKVYDGNAINFLKWIESSSTHLGLLYLIF
                     KLGQTDITLLKRTEFAIYQGFIRSIWNDIISLLMEPSYELELVLISKVLGRINLTNDL
                     DNLIYQVVKKRIVEKIETLYCDEPVYSKLVIWLDMEIYPGFHSFVSLRNRNEFYQCIN
                     MIAKSILISRRILDSYELVDSYPKSTETLKEFNVCLAKEDQKEILVRQFINDLNTKLL
                     IPSTNTVDIIIYYIKTIHSFLIIDHRGVLLDKVTRPIRQHLRSREDTVEKVVNGLLDK
                     NKRTNRLIELNVQLQKITEDNFGTNSLCSLQKRTLNWEPDPVDALPDFQVGKIDDIID
                     SLTTIFEDSSVFINQFVNIFSRELLYTTGYDIQSTLQKLALLKAKFSNDDFSKVDIMI
                     NDIKRSKELDKDLHSNTEIGAVHGVFLSHLYWPNLPEEIPSFVLPDYLLVVLKSYEDV
                     YTQQKRKKELRLHPQVSLATLDILIRGETKTFTVSFDKLAVINYICESKIPVVKLGIL
                     LMNLKMPLQILKSSLEFWVNEEVLVEQDGGWKVNE"
     gene            complement(<362805..>367019)
                     /locus_tag="C5L36_0A01710"
                     /db_xref="GeneID:40381275"
     mRNA            complement(<362805..>367019)
                     /locus_tag="C5L36_0A01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463182.1"
                     /db_xref="GeneID:40381275"
     CDS             complement(362805..367019)
                     /locus_tag="C5L36_0A01710"
                     /inference="similar to AA sequence:RefSeq:NP_013523.3"
                     /note="PKUD0A01710; similar to Saccharomyces cerevisiae
                     YLR419W; ancestral locus Anc_4.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319042.1"
                     /db_xref="GeneID:40381275"
                     /translation="MAKKSKKNLPEEDIQRGKKAGKNGKTFKNSKDDVVDNGKPAKTG
                     RAMVAQTSSWTGKLPGSLLHEHCQKQKWGKVEYDMKKLPEGFIAVPQISWENPKTKEN
                     IQIKFYPPKHIVKPQETPIEARHYAATYALHRIAFNKNIHMVLPSNHKALWSELEAER
                     KSITNKYPSRAKLDYSNDPFSALLEKRREDEARKKESEVREAAVAKVKKPAIIIGSQT
                     NNNVKTNNELKVDNGTIRSDKGQNLGRGKFDNLQQVSFPKKVWDNSVLFDINPELRVS
                     IEDSIRNHIEWSDEESSVHEYVSNTSSYTELLVQLGFRKVHVLEAVKYTYTLNDSLEW
                     LIFHLPEDDLPFSFVRDETDSSVRLKITKDLNKERLITQLMRGGYSRNESIFGLEHCD
                     YDITKAAVLLTNNLFEKSLSLDYPDGLSSLEDWLEEKNSLRVIYDSKIVEDDPPKDDS
                     FSILLDVSGLASKLLSLKVYRSQNYPYDICGLLLVVNDKSYTLPSYIKKSIISQLIEY
                     LAKNGAFGMPYIYTCIDWLEHNILKVIENPGPLYISSNELKKSKGLLTVPKIQGQKKT
                     TQRRISEEKVEISYKARIGSSKYQESINKRAKLPAWKQRELIVRTINENNVCLITGET
                     GSGKSTQIVQFILDDLNKRNDFLTTIICTQPRRISAIGLADRVSEERVDKCGSETGYI
                     IRGENRTSDTTRISFVTTGVMLRMIQSIFGKNSSHDSFFENLGYIFIDEVHERSIDSD
                     FLLIILKKMTKNFPKLKIILMSATIEKSIFNGYFDPRKSQIAHVHIDGRTFPIDDYYL
                     DDIIDMTDFKISNYRSNPYDDALDKDETFKPRADSKYFQSGNINYDLIAALVYKVDDD
                     LNAKQDDGSILIFLPGVMEIKKCLNKIEDAGFWKLQLHSALSSQEQRRIFDKPPTGKR
                     KVIASTNIAETSITIPDAVVVIDSGKVKSVQYDSKSNNTKLVEIWASQAETKQRRGRA
                     GRIRNGICYKLFTRGTEQKMISQPIPEIKRTKLESVYLVVKAIGVKNVYEFLQAGLDP
                     PDEDNVNNARRVLCDVGALNLDSDNLTCLGKYLSMLPTDIKSGKLLIFGCIFGCMESC
                     SILAAIGVTGSPFTCKQEDRDRMKTVQQKFGQDSGDMVAILNAFNEFQSLKSMKEKRR
                     FCSENFVSILRLNDIESTKFQYMSCLKELGFIPLDYGSVRASNSEAFDYLNRNGKNTS
                     MIQALVTASSYPQIARVQLPETKYAQINGGAVALDPEFRKIRYWIRNEKHRRLLENEG
                     GKGPHESGETVYPSSRVFMHPSSSLFINEEKSSTNPPFVVYNDSQETSKLYVYGITPT
                     SVTSILLFGGRISYDLTGIPNNIRCRGIIMDSWLPIRTWCKNAVLIGKLRLLLDKTIN
                     ARLENPGSHEGNDVLEVIEKLVKCNV"
     gene            <367629..>370742
                     /locus_tag="C5L36_0A01720"
                     /db_xref="GeneID:40381276"
     mRNA            <367629..>370742
                     /locus_tag="C5L36_0A01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463183.1"
                     /db_xref="GeneID:40381276"
     CDS             367629..370742
                     /locus_tag="C5L36_0A01720"
                     /inference="similar to AA sequence:RefSeq:NP_013239.1"
                     /note="PKUD0A01720; similar to Saccharomyces cerevisiae
                     YLR138W (NHA1); ancestral locus Anc_8.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319043.1"
                     /db_xref="GeneID:40381276"
                     /translation="MVWDQLDTSKTHVAYAIVAVFSTIFALCSLFVKEKLYLGEASVA
                     TLYGLIVGPHALNWFNPFTWGNYFNITLEISRILLCVEIVAVSVELPKKYVLHHWFPL
                     FLLLIPCMTAGWLIIGAFVYAIIPGLTFGYGLLISACVTATDPILAQAVVGKGKFAKR
                     VPAHLRNLLSAESACNDGVSVPFVYLALNIILHEGDASKIAKNWICVTVLYECLFGAI
                     MGAIFGYSCRKALRFAEGHDLIDRESFLAFYIMLATLCAGFGSILGVDDLLASFAAGT
                     AFSWDGWFTDRTEESNVSTVIDVLLNMAYFVYFGTIVPWSDFNNAELGLNCWRLICLA
                     IVVLLLRRLPAVLLTKFINPDLKNWKEAFFVGHFGPIGVGAVFAAIIAIADLEADILH
                     ISHGPTTNYPTESEYYQLIRIIWPTVCFLIITSIIVHGSSVAVLVLGRQLQSMTFTMT
                     WTKAESGDIRSGNWFNRLPKIERSGTSFSIKRIDTMAPSEEGEFYSGSSDEKFADEKQ
                     NARLNANIGMERFNEISANPTIETSGVPVKPSGGANRKKKKRLLKHKRSKKRKAPPVS
                     ETLDLKNGRKNHPDEDREANKDDVDEKQDTIYYPVGNEPSISSKNNSISEIDEATNVP
                     LDKQKKLVLPLQKIISNATQHSDTSKEVIANDMEGTIHVNPEAMKKISENFEIDEDDI
                     KPVYDEDGQLRIPTQAINYKDKLVIEDQHGEVLHTVPSRNSTLSSASRSNSLRSRSGT
                     VRKLATSLGFFPSSEAEEKKEQNDSADNIDEPPSIANVLEKEPSKRSTTYKSKGKSRS
                     NTTASKSALEKVIDFGDVLLQKNVAPRRTKKLHGFRVDDDIIIENEDGEILGRYKVNV
                     KKQKALEAKEGLSEDQYNRNLVGKALKYFGLKKRREILDEEMNQMTNGDLIPGDGEVV
                     DLGIEDKIKHFINADSSQAVVTLPPHLRKSHLSSSERNAGLRSNRNKQDSRNCYEETT
                     SEEYNSHQNDDSFEDSSSNNSTYSSDSRDVSLEPSDPLYSESKFEKARRSAALDKSRR
                     KSDDEEE"
     gene            complement(<370957..>372303)
                     /locus_tag="C5L36_0A01730"
                     /db_xref="GeneID:40381277"
     mRNA            complement(<370957..>372303)
                     /locus_tag="C5L36_0A01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463184.1"
                     /db_xref="GeneID:40381277"
     CDS             complement(370957..372303)
                     /locus_tag="C5L36_0A01730"
                     /inference="similar to AA sequence:RefSeq:NP_013231.1"
                     /note="PKUD0A01730; similar to Saccharomyces cerevisiae
                     YLR130C (ZRT2); ancestral locus Anc_8.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319044.1"
                     /db_xref="GeneID:40381277"
                     /translation="MSGLNYLKSPGHFAELFIRGEDNCESGNEYNGEYMGARISAVFV
                     VLVASAFGAFFPVLSSKYSMIRMPPICFFVAKFFGSGVIVATAFIHLLSPASDNLSND
                     CLGYPFDIYPFAFGICLIVLMLMFFLELIAYRWVEAKIAKQSLDANAPHSHSHFGDPN
                     MYVINIDNAKQNHNHQHDHSHSHENESSDNEEAHLHVHPHGHAENEIEVVHFSKDHAH
                     IHQTHNHLAHTHSDTSSGDGLRRETLEITYSDMSASKTEKMGSILTDDDSTADIDVEK
                     QASESLADYSAQILNVFILEFGIIFHSIFVGLTLSCSGDEFVSLYIVVVFHQMFEGLG
                     LGTRVATVDWPKSKRWTPWLLCLGYSLSTPIAIAIGIGVRNSYPPNSRRALITNGVFD
                     SVSAGILIYTGLIELMAHEFLFSDEFKGEGGFKRMIWAYLVMCVGAGLMALLGRWA"
     gene            <372777..>373937
                     /locus_tag="C5L36_0A01740"
                     /db_xref="GeneID:40381278"
     mRNA            <372777..>373937
                     /locus_tag="C5L36_0A01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463185.1"
                     /db_xref="GeneID:40381278"
     CDS             372777..373937
                     /locus_tag="C5L36_0A01740"
                     /inference="similar to AA sequence:RefSeq:NP_015187.1"
                     /note="PKUD0A01740; similar to Saccharomyces cerevisiae
                     YPL138C (SPP1); ancestral locus Anc_8.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319045.1"
                     /db_xref="GeneID:40381278"
                     /translation="MTEHNAVNRKYLQVLEKEYEAYQKSPKFSLNSEELFCVCRKPDH
                     GELMVACDGCDEWYHFKCVGIEKKYKDLVNNYYCQFCDLLLHRGKSVWKRKCKLDSCY
                     KPIAGQSQFCSAEHGKIYWNIILHKFEETNHSSEVDIAEVVNRQQVENLLQHVQSRNQ
                     LNEIGNELPLFDKEQLKVTGSQFSELNANKEKLRMLEENINILRSKYQYLMKLQNVIT
                     QVSDILTTSLDPNSIQYNAENPDGNTAIKQHRKSKSRKFKVDICGFDENLLLNDSQWP
                     EFCGTEHYNLISNFTVCSELDRELIVQYYKSPEPFDDESSGTFMSLLRKLCLSDKGKK
                     CHLHGGWFTIYKYGIDLKLKEKEQEKNEIIELNEKLIKMIQIKNWRLYCDDL"
     gene            complement(<374057..>375337)
                     /locus_tag="C5L36_0A01750"
                     /db_xref="GeneID:40381279"
     mRNA            complement(<374057..>375337)
                     /locus_tag="C5L36_0A01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463186.1"
                     /db_xref="GeneID:40381279"
     CDS             complement(374057..375337)
                     /locus_tag="C5L36_0A01750"
                     /inference="similar to AA sequence:RefSeq:NP_014872.1"
                     /note="PKUD0A01750; similar to Saccharomyces cerevisiae
                     YOR229W (WTM2) and YPL139C (UME1); ancestral locus
                     Anc_8.651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319046.1"
                     /db_xref="GeneID:40381279"
                     /translation="MSEKLINEEYKIWKKTSPLLYDLLYTYSCDLPPLSVKWLKTYET
                     LLSENKEPYIKANLLMGTHSQDKQNHISMVSVCVPPTLAPDYKPTDLTIPQNLLKSRQ
                     LNVVRDWNHPGEVNKLQINEYNNLFVTHTNSGDILLFDLKDDKLKTHKSTLKFHTKEG
                     FGLEWNPVERKKNLLLSCAEDCKIALWDINEKVSNEIKPITTVSSHESIVNDISWNKS
                     IDSIFASVSDDSSYQIHDIRLNTGPIIHITDAHHNPDSENTVNYPINSVEFNDSVSTL
                     FATGGSDNSIQIWDLRNPTIPLRRLIGHKGPVIGLKFHENYLMSSSVDHRTLIWDLNK
                     LDEGEPDKRKSEYMDPCLSFMHGGHTGKVCDIDWHPVLDNLIVTAAEDGLLEVWKPAH
                     LGYEYEEEVDEKLKEGGVGEEEKKEIALENNVNN"
     gene            377033..377104
                     /locus_tag="C5L36_0Atrna1H"
                     /db_xref="GeneID:40382460"
     tRNA            377033..377104
                     /locus_tag="C5L36_0Atrna1H"
                     /product="tRNA-His"
                     /note="PKUD0Atrna1H; codon recognized: CAC"
                     /db_xref="GeneID:40382460"
     gene            complement(<377492..>378805)
                     /locus_tag="C5L36_0A01770"
                     /db_xref="GeneID:40381280"
     mRNA            complement(<377492..>378805)
                     /locus_tag="C5L36_0A01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463187.1"
                     /db_xref="GeneID:40381280"
     CDS             complement(377492..378805)
                     /locus_tag="C5L36_0A01770"
                     /inference="similar to AA sequence:RefSeq:NP_009368.2"
                     /note="PKUD0A01770; similar to Saccharomyces cerevisiae
                     YAL034C (FUN19) and YOR338W (YOR338W); ancestral locus
                     Anc_7.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319047.1"
                     /db_xref="GeneID:40381280"
                     /translation="MSTFIRETMTPINNTSNNTSNNTLHTTPKENPHDYNPIVTSIAN
                     SIANSNSSSTLNMPSPPLSPYTRNSCEEIDIPNLLFPRPSKPIVSDLRYLDGGSLANK
                     PLDGLQLQSNPSIDKCTLTSLNNTPILDAQLHNPPPDRFSAEQLGDPIEKETNNKSEK
                     VDETNEVADEKENGNIDDASPLLINPYREINRPGFKKFQFDFLSEYQFKNLNSYSSYT
                     TSSNLKYSSLPSTTRSTPRHHYDSLKSQSNYNSLSDSDVEKPRTRRFVRQNRFELESV
                     DTNADTISRPSTPIRKKSQFSNSSPATPKRQRTSTPISYNYDYKKIEDFCPPLDTLPP
                     NNTKCLRTDWKGQSMDLSSDPLVSELHPAEVVLASILRLPCAVYLDSKRRIFQEKVKR
                     MKLNLPFRRTDAQKSCKIDVNKASRLYASFEKVGWFDEKHFQKFM"
     gene            complement(<379386..>379847)
                     /locus_tag="C5L36_0A01780"
                     /db_xref="GeneID:40381281"
     mRNA            complement(<379386..>379847)
                     /locus_tag="C5L36_0A01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463188.1"
                     /db_xref="GeneID:40381281"
     CDS             complement(379386..379847)
                     /locus_tag="C5L36_0A01780"
                     /note="PKUD0A01780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319048.1"
                     /db_xref="GeneID:40381281"
                     /translation="MHNISMHVPPISLQKQVATVKQFLKTHTYRYAPTEAQTWTEPPV
                     SALAIGVNNFFLIISRFVFQGHRFFFSFPHQFTVIPVANSDARDLTCPTLYPLIASIV
                     CSLVQEKACVYVFPFLYVEHEERICRAKQRFERVGSFFPALCIMNCAMRTV"
     gene            <380359..>382173
                     /locus_tag="C5L36_0A01790"
                     /db_xref="GeneID:40381282"
     mRNA            <380359..>382173
                     /locus_tag="C5L36_0A01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463189.1"
                     /db_xref="GeneID:40381282"
     CDS             380359..382173
                     /locus_tag="C5L36_0A01790"
                     /note="PKUD0A01790; Pfam Domains: DUF2009(2.3e-258)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319049.1"
                     /db_xref="GeneID:40381282"
                     /translation="MEHKTLADLLDSNNNEEEIIEINGEEDVKDGELSLGEVCVDCER
                     MPKELYCKQCEENFCRVCFQFAHRGGKRKVHGYDELLPLDEAESGEKGRSEEEQEESE
                     GGSEEEGNHLEDGARNKGLRETEKGSITETHLVILKKIKKFTKFIPLRLTYEERQLLK
                     LLEAALSVSEYTDKVDIITYTSKTKRIITQLKEICSILAGLVVSSNMKVGQKLIENKN
                     FVDNAEWYKSIFEIGRRYKVMNPERMRDTYGKLCYIIMDSRLKQVKEHMEFDLYKPIL
                     TIERFLDEHSNDHSNSLFEDILLLDATADIRPENKPRATINRLIKQKEKAIEILADRY
                     HHKEGLNKEQIRMIIYSIGDFNSYTNKNRIPVINMTKKLDSFFLDSENDPKYSLGIRY
                     GHKGSRLTHNHEKQYLYVKQALGLWNHVMRDLIELWYIADEDLFDGNNYRMADTGQGF
                     QRIKSCPKLYKKMYALLHECQSKFDYWVGIPVIHLGDDAVPNALFFLDKYIQIPSILI
                     PIDKCIESIPNLATDKYIHNMINEQFGGVENLQKDILCDYFKHGFDGSGADNYYFAGS
                     CVDASSTSSCEFCNNISKKPYYKIFLLSGFTNFNGEGY"
     gene            <382467..>384038
                     /locus_tag="C5L36_0A01800"
                     /db_xref="GeneID:40381283"
     mRNA            <382467..>384038
                     /locus_tag="C5L36_0A01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463190.1"
                     /db_xref="GeneID:40381283"
     CDS             382467..384038
                     /locus_tag="C5L36_0A01800"
                     /inference="similar to AA sequence:RefSeq:NP_010410.3"
                     /note="PKUD0A01800; similar to Saccharomyces cerevisiae
                     YDR125C (ECM18) and YLR099C (ICT1); ancestral locus
                     Anc_8.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319050.1"
                     /db_xref="GeneID:40381283"
                     /translation="MLKLQNRLILSGLTGTRWNSSATGNKKLLCNISLKESFDIWSHE
                     LSNYDDGDTIAQDKFLKYVIPYYQPKELVSDKYRNIRAFNLKTSVDFQNDNINIENRG
                     EWYLNEIRVEKGDKDDERKHLVLIHGYGASSGWFYKNFRGIIENSVNSPNITLHGLDM
                     IGFGLSGRPSVEFKYDNKTKAALNIETEGIVWGKYSTCKKCGGHLDGRKSKDLHWCSC
                     SHEEEEMRKGSLIDSTRRANVVIEKNEILEYMKNQVELINEVEDVYVESLETWRKKNQ
                     IDKFDLLAHSLGGYLSFAYSLKYPQHVNKIIMVSPGGVERSPFAISNPQYKSIVKDSE
                     KEGQLRIPISNHVDQYGFLGRYGLIGKSFRDLWNMRVSIFSALRWLGPFGPKVLIDRN
                     ASKFTRSGSITDMRELGLFLEYIYSCCIRSSFSETSIYRIFDATIVGKYPILDKIRDK
                     GNVLVDKEILWVYGEHDFMYSECGKKAIEEFEKHNYELTERNQQILTVSNAGHNMYLD
                     NSADFNSGVLKFLKY"
     gene            <384605..>385693
                     /locus_tag="C5L36_0A01810"
                     /db_xref="GeneID:40381284"
     mRNA            <384605..>385693
                     /locus_tag="C5L36_0A01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463191.1"
                     /db_xref="GeneID:40381284"
     CDS             384605..385693
                     /locus_tag="C5L36_0A01810"
                     /inference="similar to AA sequence:RefSeq:NP_010228.1"
                     /note="PKUD0A01810; similar to Saccharomyces cerevisiae
                     YDL055C (PSA1); ancestral locus Anc_4.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319051.1"
                     /db_xref="GeneID:40381284"
                     /translation="MKGLILVGGYGTRLRPLTLSYPKPLVEFANKPMILHQIEALAAA
                     GCTDIVLAVNYKPEVMVGALKKYEEIYNVSITFSVEEEPLGTAGPLKLAEKILQKDDT
                     PIFVLNSDVICEYPLKELLDFHQAHDGEATIVATKVDEPSKYGVIVHDRDVPNRIDRF
                     VEKPVEFVGNRINAGIYVINPSVIDLIEMRPTSIEQETFPILVDQKKLYSFDLQGYWM
                     DVGQPKDFLTGMCLYLAAQTKKNNPDLSKEDYIVNGNVLIDPSAKIGKGCAIGPNVVI
                     GPNVVIGDGVRIVRSTILKNSQIKDHAMIKSTIVGWNSTVGKWARLEGVTVLGEDVTV
                     KDEVYVNGGKVLPHKSIKDNVETPQIIM"
     gene            <386084..>391735
                     /locus_tag="C5L36_0A01820"
                     /db_xref="GeneID:40381285"
     mRNA            join(<386084..386119,386213..>391735)
                     /locus_tag="C5L36_0A01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463192.1"
                     /db_xref="GeneID:40381285"
     CDS             join(386084..386119,386213..391735)
                     /locus_tag="C5L36_0A01820"
                     /inference="similar to AA sequence:RefSeq:NP_012151.1"
                     /note="PKUD0A01820; similar to Saccharomyces cerevisiae
                     YIL115C (NUP159); ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319052.1"
                     /db_xref="GeneID:40381285"
                     /translation="MSYKELETLDTDNIGFQGKKPIGLFTDIDKGKLSELLNQFTINY
                     LDISYFHGIIFAYLNHELKLLSIEKLSQYLENGDSNLSIDDLVTFKFVISSDVTQIKL
                     NANESCLYVISQVDNEMVVSNIDTSILLNGTFNEHEVYRVPAGVKILRFMPSPKNHEQ
                     SVCLLDSKDLILINKNSTSKLFGNVSSANWFDEKLMFSYDDDMCLNFYDLKSSKIVNS
                     FTLNSDCSDDKGEEDQRIVYLQKVNDHSIIAVAGDSISSTENPDFTTYIIDLSPNDFS
                     PNKILTTQMLFTSYGSIDRIASFYTLCLKNWSQEYSDVLISTGSKSIDINISLPDKLV
                     ELLNDSDRATMPMDDESGDDDTPLGMVLDLNSTINVKEPCKGVDESKPLPRVITLTNR
                     GQLICWNFWIKDSILNNQANLANVEKINRSNTLHDETIIPSSSAKPNSLSSLGSLSVG
                     TCAKDKDSKASIFGSSTNQSENPFGSTAGNPFASSIFPKANISTSSMTTSNNNQNPFG
                     STSKDAFGNFNLEKSTSVSETHPFGEASAPSPFGGSSFGTKSGTNGFKMGEMVDNSKP
                     SNFKFGSSSFGGAFSSSSGGVGGFKMNMTNTGTPKASTSLFSSGGFSKFSTCDNAFTD
                     AGAASSTSSPFGTLGTSNASPFSGLGSTAKPPIFGDSNGKNFEGKVTDSVPFSSLNNK
                     RTDLFAQKPVGTTVSTTSNVQEMQSNSLFGTPKKATSGLFGSASFRKGQDDRKVNAAG
                     LFDKPNLNPSIALNSSTKTETVAEVSESGLYNHNPDLRNTEVVSSDELSDVSKESVSE
                     SELSEEEEEEEEEEHGEEEKARESDVELNKVKQLLNKTEKPTRESNEPAEEAIMPRVQ
                     KPKGKLQNTNFEQSEEKVPKAEKKIKVIADEPVSFDLQMDDYKFDLERNISLDRAIKK
                     LIESKRIELYGGDLDYRRFLDDQARIYDSKVPNVKKLVSDWEANRNLEVENAKRDLEL
                     NEQQTHRNKLDELLKVKEDKDKLFTDAEQNRTRILELLRHETERRRSVLARLSREVEL
                     EEEITAKVREEEISNMKAFTAMEEYFKEMKKLEDEQNELIAEEIELESKRKQSAEDKQ
                     NSENELKSSEDEEKFNFTKGEAWTEQGKDALGESTANLKEPFCHKINETVVDESADKG
                     KMLDSKYEVSANFYPKEGGMDQQTKNSLATIENKVEHESNQMKNENKEILQDGTVEAA
                     KGVGSRVVPAKKVTLNNANADIQDKGNNFINDKSEEPVEGSLDKVTGKTDNILSDSPF
                     VPPVKKASEPVLDMVPESTKAAEETVPIEEACKIAADEDKARPHSGGHDIRYEESTGV
                     DELDASNEKDISEGNTVDTKKVEREEIVAATVTEEPYEVLNLNGSNSAGITKQQYSSK
                     HFDDEPYIHSMKTEGYSKGTDEPIKKVHKLVSMYDSDSDTKEKITFKCVNDFPVDTSE
                     VISKPVEHETLYESADSEYLKAATNSNKPNQITHDVSTTPEYVQASVESTEENRILRS
                     ISASPGYIKSEIDTSSLLRQEELNCLPNYESLNETKEPSYAFVSTLTDRMIACNLSTT
                     DDENYFSSYYIPKTVPLLHAKGKVNYPIDFDQLPPMGKEMKKLIYDRLIEFDILHKNL
                     RAMGEYIADQSNTSLIFHTLDKSSASPSHWRLFEIDTLLLGAEKYSRFFCDLLQLYDK
                     LASDSTYLKSSLFGEFRKLSSYEISLDRLTKKDREFKECYLNSSRPLPFENVKTRRTL
                     REKIETLQQTDRTLQSGVLILKSQIYPEKVIQNQRSMNSVLASLQKELYTHAETLNTL
                     SQGLNSVEEGKAECIKSAGSSGISCAGLSDLHKIPASRISDLILKKNAKRSLANILKD
                     KINNSRYVSL"
     gene            <391938..>396485
                     /locus_tag="C5L36_0A01830"
                     /db_xref="GeneID:40381286"
     mRNA            <391938..>396485
                     /locus_tag="C5L36_0A01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463193.1"
                     /db_xref="GeneID:40381286"
     CDS             391938..396485
                     /locus_tag="C5L36_0A01830"
                     /inference="similar to AA sequence:RefSeq:NP_012672.1"
                     /note="PKUD0A01830; similar to Saccharomyces cerevisiae
                     YJR138W (IML1); ancestral locus Anc_4.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319053.1"
                     /db_xref="GeneID:40381286"
                     /translation="MNKNKRINIDFNSTRNRISHRTNEATLVVGRKSNDPNRSDTLVN
                     SSSIDNSQLGKAPSQENYISRQFGEQFSGSSCEKVLPDITEPQEENSTSQGIYNPVTL
                     TVKFHETRTSAETVLVDPNIVPGAKPGDIGEIQCLFGSRKKFFFKFLIKDSLGPIQNN
                     NAFDKILNKNDDGIDNYAGISGKKPSTTAADENENLVTENGNSNEVSGIISILSGPIV
                     NKLELKPRSQVLVRVRNKDSVQADTVEIYVKDIHLSRGDMWNISSLMVDKCVYKNQKP
                     AFINNSIRLSVNKIYKNGHKFFSSYVGKDTKLVFRSDSARLIVFIQISSEMWHFEESG
                     QQLFHKLMNSFFPKAFQKWKDLDTHHLITIILFSSVDLEGDDIRYSEGETPPNKADYY
                     RVVVDQVHILLWNEIMATLRVEFANFKRDIYLHRNKRRDAEHPQEYIIEGDILPSAKG
                     SILEAINLGMSLVSDDFKDSYLRQTTNHFIMISPGTGLFDVSYDMLIRTSNLMSTIDS
                     TVDIICLSQAPLHIVPLVRYLDNQNKLKHCIPNWLDISFWTDSSQAVHQWLPKCKIYE
                     LQMMGVMENELSNVNISGLEFPYHRSASEAMDSYDQSAFKSTVNLRQDKEPKRPKRIT
                     LSLNSPTQVKHKLSAPSIRDVNGLKPSELIVGNNKSSPATVEAFGVSTTSKPNVSAFS
                     SLLSLSKSSDLKTSTSTALKFVRKIISTPILNPSSPDLLSRDSLSDLQSVTSLSLNEN
                     KLDYRLESIPLSGNKSFENVTDKDSLIPSLNRRSNTQNFTVESNNRKLQEKKINHLSR
                     TKSIAKRNRVQEGKDFTTSCYWTDIDNPSNSLSHQTLSLVSYGRWRFVFPPNVKRRAV
                     KWISLSSPASLPIMTMVFPTLNDFNQNYTFRIYDVIPNQNASNEKKTSETLMRQMISL
                     RLSLGYQICIGERVEKVESHRKPNGDSNMLVQYLSSTSFLGSRIYLSLGNEIHRISCD
                     YNGLINVQVYKRVSSTDEQFTLKSNKEYIENIRTRYSETYSPVKISSNTGNLRNNYNW
                     NQLDQVLAGYEDSIDKQKYHRMKFVILPASIPENTFTLKNEKLSAEEIRLEGIRTLIM
                     NIYRIKYRTKEEKHSKKRLEIAPQIHFYTGNLFDYLKQKSLEVNKGSPTSKPQYNKNI
                     DVHKLIEILQGPDGIQIMDRYWHLKFYKYCFLGMDLVNFLVENFEDIETREDAVEYGN
                     KLMQEKIILHVISAHKFLDGHYFYYFDKKFLEGVSHESFDATNRKSIQSDKSVVSSQD
                     QRKSKSDVVMLSEEVVCDLDSNGYSWQPELVKVHYDIVHNPEHCFHLRIEWLSTTSKL
                     IEDMINGWSKYCERYGLSLVEIPWEELFTLPKRNPLHSTIEISLCLDPWKDEEFSKYG
                     SIFKQEKYYFHLYLLTKSSFMLDNRTATYFKDNSMDVVYSWGKPMFKYAQFIHSTGGY
                     IAELRNNGDFFLAPNNAHISRLNLNIGKLHNLGKSKAVYFDSQSVMLEFRSTCSDETK
                     LREMFREAVIEFNNFENLLKL"
     gene            complement(<396530..>397606)
                     /locus_tag="C5L36_0A01840"
                     /db_xref="GeneID:40381287"
     mRNA            complement(<396530..>397606)
                     /locus_tag="C5L36_0A01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463194.1"
                     /db_xref="GeneID:40381287"
     CDS             complement(396530..397606)
                     /locus_tag="C5L36_0A01840"
                     /inference="similar to AA sequence:RefSeq:NP_012673.3"
                     /note="PKUD0A01840; similar to Saccharomyces cerevisiae
                     YJR139C (HOM6); ancestral locus Anc_4.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319054.1"
                     /db_xref="GeneID:40381287"
                     /translation="MPSVNVAVIGAGVVGKSFLAQLAALKSKSITYNLIFLSTSRKAL
                     ISSDYKPLDIANALDLLKTSSQPSLSIADLIAYLKESPLPVILVDNTSNEDLAKSYPQ
                     FVENGISIATPNKKAFSGSFKLWNEIFNNSGSGLVYHEASVGAGLPLISPLKEMVETG
                     DKVVQIEGIFSGTLSYIFNEFSTIQPNTAKFSQIVSVAKELGYTEPDPRDDLNGLDVA
                     RKVTILARISGLPIENSTSFPIHSLIPKELESVESAAEYMEKLPNFDAEMDALKSEAA
                     KENKVLRFIGKIDVPNNKVSVEIAKFDFSHPFASLKGSDNVISIKTDRYPNPLIIQGA
                     GAGADVTAMGVLGDVIKIAQRIAK"
     gene            complement(<398012..>399295)
                     /locus_tag="C5L36_0A01850"
                     /db_xref="GeneID:40381288"
     mRNA            complement(<398012..>399295)
                     /locus_tag="C5L36_0A01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463195.1"
                     /db_xref="GeneID:40381288"
     CDS             complement(398012..399295)
                     /locus_tag="C5L36_0A01850"
                     /inference="similar to AA sequence:RefSeq:NP_009758.3"
                     /note="PKUD0A01850; similar to Saccharomyces cerevisiae
                     YBR199W (KTR4); ancestral locus Anc_8.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319055.1"
                     /db_xref="GeneID:40381288"
                     /translation="METGGDMFNRRISKWLFTLLLLGGLFTVSKEFQKRELPKATVVI
                     EETVKVETKIPDFYFNPLSEYEGLSRDQVVKKNYDKLVKIMETPIDEPKGVLTRSNGD
                     RANATMMVLAKNSDLKGVLYTLDQIESTFNKKFHYPYVFLNDNAFSEHFKSAIRKHTD
                     SECYFETIDPSIWNQPDWIDPVKQQKLMSVLKSQNIQYANKISYHNMCRFYSMSFYNH
                     PRMQQFRYYWRFEPNTDYFTNIDYDVFKFMEDNDKIYGFTIALYDAHETVKTLWTETK
                     AFIGSHPEYVHPNSAASFISENLQNPEKTEYTQGYSTCHFWSNFEIGDMEFYRSEAYT
                     EWMKHLDEAGGFYYERWGDAPVHSLGVSLFADKKKVHWFRDIGYRHHPYTNCPTSRKC
                     KGCTPGEFCWEGIRDQNCLTNWWNYEMDEQDRSVY"
     gene            <399698..>400714
                     /locus_tag="C5L36_0A01860"
                     /db_xref="GeneID:40381289"
     mRNA            <399698..>400714
                     /locus_tag="C5L36_0A01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463196.1"
                     /db_xref="GeneID:40381289"
     CDS             399698..400714
                     /locus_tag="C5L36_0A01860"
                     /inference="similar to AA sequence:RefSeq:NP_012071.1"
                     /note="PKUD0A01860; similar to Saccharomyces cerevisiae
                     YHR201C (PPX1); ancestral locus Anc_4.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319056.1"
                     /db_xref="GeneID:40381289"
                     /translation="MGVEKFVEYIRHVRLVFPASPLDIVIGNSGGDYDSFISTLMFSY
                     FQHLRNGRVFYPIISFPADNLKLRRDIVHGMSIIGLGEKDLIYVDELKGHGVNEVQLV
                     DHNVIDSPLVNGKVVGIIDHHNDGNQYKSADPRIIEVCGSCSSLVLREFAPEVVKAGL
                     DDKEKKFMSAAILLDTDGLERRVESVDIQSWKGISYNQEVGTLSREFIDAKANIEGLS
                     VYDLLRKDYKEWTTGKIKLGISSTIVPLEEIEKDKEAIGNWIRNRELDILLVMGAFEK
                     DGKFTRELSIHSPSVHVGKIAMLLKEELHLEGNGPIYEQKRVEWSRKKVAPFAIDVFS
                     TLTK"
     gene            complement(<400797..>401786)
                     /locus_tag="C5L36_0A01870"
                     /db_xref="GeneID:40381290"
     mRNA            complement(<400797..>401786)
                     /locus_tag="C5L36_0A01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463197.1"
                     /db_xref="GeneID:40381290"
     CDS             complement(400797..401786)
                     /locus_tag="C5L36_0A01870"
                     /inference="similar to AA sequence:RefSeq:NP_012675.1"
                     /note="PKUD0A01870; similar to Saccharomyces cerevisiae
                     YJR141W; ancestral locus Anc_4.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319057.1"
                     /db_xref="GeneID:40381290"
                     /translation="MHSIYVFDTMKFTVEYLPRLQTTTVYADIPINNLNVELNGTKLA
                     LNGEDIDVIQGITKPVISKVPVSSSLTCVKIQPEKIEVLRNADDLSVDRYQWNIGDFK
                     GNYSLYCKSCNNCVMSSKNVSKIMPMPSSLWYEMVDYWHCHKPHEDGPVKYMKRFNQL
                     VPRERGVIVGSYFFIINPGDWNLLAVDEELFCQCGEVLGDKDFTFGNYKLLKWKLSLS
                     NHKYDDYNMVYCRFFEEIKYTAGRIFTLTIRERKVCIWCFGFDIDVNINGTIMRKALK
                     ILFKDTAEVQGEELDLEYELPYVAFLKHIEMVNASLLEHLQTYKEWKVSYIPQ"
     gene            <401932..>402657
                     /locus_tag="C5L36_0A01880"
                     /db_xref="GeneID:40381291"
     mRNA            <401932..>402657
                     /locus_tag="C5L36_0A01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463198.1"
                     /db_xref="GeneID:40381291"
     CDS             401932..402657
                     /locus_tag="C5L36_0A01880"
                     /inference="similar to AA sequence:RefSeq:NP_013302.1"
                     /note="PKUD0A01880; similar to Saccharomyces cerevisiae
                     YLR201C (COQ9); ancestral locus Anc_7.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319058.1"
                     /db_xref="GeneID:40381291"
                     /translation="MFVTTFSKRSLGIRLYHSIYHVNPAIVDLSKPENLLLEKAYTQY
                     VPKHGFSNKSIELASSDMGLNSNTPNALFNFTTDSRNINMELILFHLKKSRQELQHVS
                     LEGSEFDKLRILLHKRLQLNTPIARHLPAMLGTMILPSNVLQSLKELHNLSDDISYYA
                     GDRSIDFAWYSKRMSISQLFVLSELFMVNDTSAGYQDTYKFVDNKLKEILTAGYIYNS
                     VEEWTFFNAVSLVNIIKSQLARG"
     gene            complement(<402718..>403026)
                     /locus_tag="C5L36_0A01890"
                     /db_xref="GeneID:40381292"
     mRNA            complement(<402718..>403026)
                     /locus_tag="C5L36_0A01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463199.1"
                     /db_xref="GeneID:40381292"
     CDS             complement(402718..403026)
                     /locus_tag="C5L36_0A01890"
                     /inference="similar to AA sequence:RefSeq:NP_013301.1"
                     /note="PKUD0A01890; similar to Saccharomyces cerevisiae
                     YLR200W (YKE2); ancestral locus Anc_7.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319059.1"
                     /db_xref="GeneID:40381292"
                     /translation="MSALEELQGLQKKLQDLVQSRTTLETQYQENKIVKEELDTLDSS
                     SNVYKLMGPVLLKQDKEEAEDNVSKRIDFITAEIEKIEKSIKTTQAKMQSLRSSLQHQ
                     "
     gene            <403199..>404293
                     /locus_tag="C5L36_0A01900"
                     /db_xref="GeneID:40381293"
     mRNA            <403199..>404293
                     /locus_tag="C5L36_0A01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463200.1"
                     /db_xref="GeneID:40381293"
     CDS             403199..404293
                     /locus_tag="C5L36_0A01900"
                     /note="PKUD0A01900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319060.1"
                     /db_xref="GeneID:40381293"
                     /translation="MFRIRGGIRYLSTTTTLNPTSIRFHRPDNHHKSLILLTTPSQLN
                     QIVTKLSESTQPKVESLLVASVDSITGSRNAFTELWLETPFKIKELELVEDMEKRLSK
                     KYNPLSADPIKMQGRNWKDTTEETILGLSIPQWNITFHTRLANTIFTNSQQSTCFIAN
                     GGELDYLNLSQVRIDIDTDQEYGSDNITYHNRLTEIPMVCGIEDTYKITDFKGNLIKS
                     INHKSASGYLTENPKVMDSKKDLFFKLYSEGDNVDSWMEEYYRLVVGGLGWGEKQAFI
                     ALDTVVGEPGLRNVRLFYHDEQKPKFQLQSPDNKDSMVFECTELEEGYQDFTKDNDEK
                     VLPRVFGVGSNHGFNLNGVWHRSNGETVVL"
     gene            <404886..>405497
                     /locus_tag="C5L36_0A01905"
                     /db_xref="GeneID:40381294"
     mRNA            <404886..>405497
                     /locus_tag="C5L36_0A01905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463201.1"
                     /db_xref="GeneID:40381294"
     CDS             404886..405497
                     /locus_tag="C5L36_0A01905"
                     /note="PKUD0A01905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319061.1"
                     /db_xref="GeneID:40381294"
                     /translation="MEIPQLTLDIDADYKDCEVHIVPNKLKRRLLAEKRFRNRERVGS
                     FRVSLDENSINDGNGELYDDIEQIYVRDRSACKYYSLYGESDLQDINIYRLRAGGTPQ
                     LVIEVPEFRNYLMYNLLASQILSNLIPSAVHLVIESESSSVGNVPLSAIMDQLSTGTF
                     QGVNGERHLGGITASMFNASVSEITTAVSFYVLDTHSKGTLYL"
     gene            <405988..>407472
                     /locus_tag="C5L36_0A01910"
                     /db_xref="GeneID:40381295"
     mRNA            <405988..>407472
                     /locus_tag="C5L36_0A01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463202.1"
                     /db_xref="GeneID:40381295"
     CDS             405988..407472
                     /locus_tag="C5L36_0A01910"
                     /inference="similar to AA sequence:RefSeq:NP_013298.1"
                     /note="PKUD0A01910; similar to Saccharomyces cerevisiae
                     YLR197W (NOP56); ancestral locus Anc_7.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319062.1"
                     /db_xref="GeneID:40381295"
                     /translation="MAGLDFVLFEEPTGYAIFKVKLQQDNIGSRLKDVQAAANDLATF
                     SKLVELVSFAPFKGAAQALENANDISEGLVSDYLKSVIELNIPKSEQQINLGISDKQL
                     GPSIKEVFPYIDCHSNEVVQDLLRGIRLHSTKLLKNLQEGDIEKAQLGLGHAYSRTKV
                     KFSVQKNDNHIIQAIALLDQLDKDINTYSMRVKEWYGWHFPELTRLVNDNHIYAKLVL
                     KIQDKSNLSDDNLHDIAALVNDDAGLAQKIIDTAKISMGQDISETDMENILTFAQRTD
                     SISTYRANLYKYLTDKMHVVAPNLSELIGEVVGARLISHAGSLTNLSKQAASTVQILG
                     AEKALFRALKTKGNTPKYGLIYHSSFIGKAAPKNKGRISRYLANKCSIASRIDNFSDD
                     ANNIFGKVLKQQVEDRLEFYTTGKAPKKNSDAIKEALELSGASDLAEAPKEEQKEKKD
                     KKEKKEKKEKKDKKEKKDKKEKKRKAEDDSEDKKDKKKKKKSKD"
     gene            <408024..>408710
                     /locus_tag="C5L36_0A01920"
                     /db_xref="GeneID:40381296"
     mRNA            <408024..>408710
                     /locus_tag="C5L36_0A01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463203.1"
                     /db_xref="GeneID:40381296"
     CDS             408024..408710
                     /locus_tag="C5L36_0A01920"
                     /inference="similar to AA sequence:RefSeq:NP_010112.1"
                     /note="PKUD0A01920; similar to Saccharomyces cerevisiae
                     YDL169C (UGX2); ancestral locus Anc_7.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319063.1"
                     /db_xref="GeneID:40381296"
                     /translation="MSNNSAVWKKHYKARDGPASTSPVPIKVKKRRMSSFGCLSSPYT
                     RRSSFLSKAMLENESLQCYKLHSHSSFYSAGDSKHENLPAFSISLSESQGFIWNQDLF
                     ASSYQQSEAGVDKLLSMSDGSFLDDEDTINPIVDVIDVILSPNDYHSDEEANVDMLKT
                     DNTNKGERIQEVGTDQYGGCKSLNLHSFNASNNTLKNEREVEIGIKINSINNLNAAEY
                     KDSNIYVSNL"
     gene            410640..410711
                     /locus_tag="C5L36_0Atrna1W"
                     /db_xref="GeneID:40382472"
     tRNA            410640..410711
                     /locus_tag="C5L36_0Atrna1W"
                     /product="tRNA-Trp"
                     /note="PKUD0Atrna1W; codon recognized: UGG"
                     /db_xref="GeneID:40382472"
     gene            <411078..>411398
                     /locus_tag="C5L36_0A01925"
                     /db_xref="GeneID:40381297"
     mRNA            <411078..>411398
                     /locus_tag="C5L36_0A01925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463204.1"
                     /db_xref="GeneID:40381297"
     CDS             411078..411398
                     /locus_tag="C5L36_0A01925"
                     /note="PKUD0A01925; Pfam Domains: DUF1713(6.9e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319064.1"
                     /db_xref="GeneID:40381297"
                     /translation="MFRSVARMFPLAMGGRLASTMVSKPAMNSVIFNQPLKPEAHFIQ
                     SGLFANNKIAQGIFEINDPISESSVTEMIMTSVLRKRRLKMKKHKLRKRRKAQRALRI
                     KIGK"
     gene            complement(<411496..>412047)
                     /locus_tag="C5L36_0A01930"
                     /db_xref="GeneID:40381298"
     mRNA            complement(<411496..>412047)
                     /locus_tag="C5L36_0A01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463205.1"
                     /db_xref="GeneID:40381298"
     CDS             complement(411496..412047)
                     /locus_tag="C5L36_0A01930"
                     /inference="similar to AA sequence:RefSeq:NP_010115.1"
                     /note="PKUD0A01930; similar to Saccharomyces cerevisiae
                     YDL166C (FAP7); ancestral locus Anc_7.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319065.1"
                     /db_xref="GeneID:40381298"
                     /translation="MTLRKLPNIIITGTPGCGKTSHAEEFVSQNPEFTHINVSEFAKA
                     NGCIEGYDEERDSSIVNEDRMLDLLETMSEKGGLVIDWHCCEIFPERWIDLVVVIRCK
                     NTVLYERLEKRGYKQSKITENVECEIMQVLLTEAMESYNPNIVVELRSEDVDSLDENV
                     FRISQWYQLWKKNNPDGVSNELE"
     gene            <412315..>413079
                     /locus_tag="C5L36_0A01940"
                     /db_xref="GeneID:40381299"
     mRNA            <412315..>413079
                     /locus_tag="C5L36_0A01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463206.1"
                     /db_xref="GeneID:40381299"
     CDS             412315..413079
                     /locus_tag="C5L36_0A01940"
                     /inference="similar to AA sequence:RefSeq:NP_010116.1"
                     /note="PKUD0A01940; similar to Saccharomyces cerevisiae
                     YDL165W (CDC36); ancestral locus Anc_7.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319066.1"
                     /db_xref="GeneID:40381299"
                     /translation="MSDLGLSDRTSSTKSKTSKTTELTPEQIQQQNILRLNGFRTSTI
                     LRNVSNDDSYGEEGNSGTDGMDGKIDDILNTQDEDSMDPMHRFGLIALDSLLKQEDND
                     QNNIAKGIDLNMLGLDLSLDKHSHILSKTFASPWLETSRSEVEPLFTRPESFNINANE
                     IVPVTERMPSFNDLTLFFLFYTKPRDILQELAARELNKRNWRYHKELQVWLTKDTNSE
                     PKSIGSGAEQGTYIFFDPVTWEFVTKTMVLYYNSIM"
     gene            <413546..>416329
                     /locus_tag="C5L36_0A01950"
                     /db_xref="GeneID:40381300"
     mRNA            <413546..>416329
                     /locus_tag="C5L36_0A01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463207.1"
                     /db_xref="GeneID:40381300"
     CDS             413546..416329
                     /locus_tag="C5L36_0A01950"
                     /inference="similar to AA sequence:RefSeq:NP_010111.1"
                     /note="PKUD0A01950; similar to Saccharomyces cerevisiae
                     YDL170W (UGA3); ancestral locus Anc_7.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319067.1"
                     /db_xref="GeneID:40381300"
                     /translation="MDPFNNVLTAKVFEGSSTDCNKATSNKEQKGQRNVKKKSIHTKS
                     SKRTSNGCLTCKLRKKRCDEVKPVCGDCLRLGRRCEYISDDMTEEEIHKLREEMSLIE
                     ADSKTRKRKKKVKEEGPNPLSATKYENTSNGTDDIGLCSSTKKHIKAKRKPRVKKARN
                     GKVVFNPFAMNLASITHSPVFNGLQSSALLPKHITSSPSFTNITELPDTVTKLNFNES
                     NILLSSKTVSTSKVEKSFEGLNTLTNGNAASDIPNSTNSTGNSNNPYTHNDQPKNLNG
                     LSPNFLANIAAVTPIPEIPTLEQNSPAPLLSLNDDFELGLSEMFPANFSKLIHEHFKK
                     EINGKLSNQLDTDTSSKELDSPTPLSTIQDVLSFSPRFQQIDVLDEDFNTDNGKHPHI
                     KSSSKEILVDQSIGYYHVGHHRSTTEPPQLYTNPSIVTNTTLANLSTMGQTLYQYYRD
                     KLSFIVCSAPKTENMYLNTFLPMAHVDKSVLYGLLAWSAFHLGGRTMERQGNYYIKLA
                     IDEFYRRPIIGREVAGNLKLVYDEVDETDETIIKECITDIDAESYQDLQLSQLSRDDL
                     INTRLAAFLILCGVEICKGDVSNWSKFLIYGAELIKMKGGLEKFNESKDEHFLATNYA
                     YHDITAIQVVDDRTIRFDIQEYEKMWLKSNELGFTDPQHGISSPVFKILAEVNKLVLD
                     VQKSNKRLKKQDIQRIGKDDKTKYKSVSESPDELRHGLDEEDCWVSETGSSISSNIEE
                     YFLSEQLSTVDTEDSMGERYDQILYMEELNTIMKECSNIEQKINEAKPKLSPYLTNKE
                     LELQLTMFECFQVTSKIHLKQSVQRMNSSSIEIQYLNSQLIKLLDVLLGSEVEACLCL
                     PMFIAGMNVVTQSDRIGMIRRFDSFINRYKWKNVTRCKIVIRYIWKLNNNGDRFIDWY
                     SVVKRLGWDLSFA"
     gene            complement(<416611..>417168)
                     /locus_tag="C5L36_0A01960"
                     /db_xref="GeneID:40381301"
     mRNA            complement(<416611..>417168)
                     /locus_tag="C5L36_0A01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463208.1"
                     /db_xref="GeneID:40381301"
     CDS             complement(416611..417168)
                     /locus_tag="C5L36_0A01960"
                     /inference="similar to AA sequence:RefSeq:NP_013294.1"
                     /note="PKUD0A01960; similar to Saccharomyces cerevisiae
                     YLR193C (UPS1); ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319068.1"
                     /db_xref="GeneID:40381301"
                     /translation="MVLYYKSSHIFNHNFEIVTLAYFNRYPNPFSTHVKSTDTIDVYI
                     DDDGKLHQIKLIRKTGKLPQFIKPFLGKITTSWIIENTVVDPKTQEMHTYNCNLDHRK
                     IIRVEEYNFYKFDSSENITKSNTTVKFSSGFSQKFGLGLNIKDRIENWSKNKFSSNII
                     RSREGLQIVMESVKERLKANRQLTS"
     gene            complement(<417703..>418773)
                     /locus_tag="C5L36_0A01970"
                     /db_xref="GeneID:40381302"
     mRNA            complement(<417703..>418773)
                     /locus_tag="C5L36_0A01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463209.1"
                     /db_xref="GeneID:40381302"
     CDS             complement(417703..418773)
                     /locus_tag="C5L36_0A01970"
                     /note="PKUD0A01970; Pfam Domains: ELO(8.9e-71)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319069.1"
                     /db_xref="GeneID:40381302"
                     /translation="MSDSLAGKLVSFKWFPDLNTFNVPDFNKPIPAWPFSFQNEFLKE
                     TIYPLSLNGYTPIIIATVYFCSVHLINGKIQQRQIDHFKKTNPKEPLPKNLKKLKAVP
                     FAISKTRLFKVFVLLHNIFLCLYSVWTFIGMTSTIHHLSNQIIPLFFSEIKPSPLSKF
                     ESFWQSICNSNDEKYNLWMNISDPKLKGLTFWAYLFYLSKYYEILDTVIILLKGKPSS
                     LLQSYHHSGAILCMWSGTRYMSPPIWIFVVFNSFIHSLMYFYFSLSCINIRLPKWFKQ
                     TLTSLQITQFVVGGSLALVHLFVRYYNNVTGTFQSCISNPEEAMAVYVNVVYLTPLTL
                     LFGAFYVDSYRKKSTSSAKKNN"
     gene            <421820..>422977
                     /locus_tag="C5L36_0A01980"
                     /db_xref="GeneID:40381303"
     mRNA            <421820..>422977
                     /locus_tag="C5L36_0A01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463210.1"
                     /db_xref="GeneID:40381303"
     CDS             421820..422977
                     /locus_tag="C5L36_0A01980"
                     /note="PKUD0A01980; Pfam Domains: zf-C2H2(6.8e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319070.1"
                     /db_xref="GeneID:40381303"
                     /translation="MQVATSTRSSNSKDDRPYKCTMCDKSFHRLEHQTRHIRTHTGEK
                     PHKCTFEGCPKRFSRSDELTRHLRIHTNPTVRKKRKPRKTKLQMQEERMRLQREKELK
                     ELENQRQRLQVEQQERDLQQQHYPQIMLNNEKVSPMSLPPILSTNHQLNASKPLLVRN
                     LSANSLPSYYPQPSLQVPSNTQMPPVPPSLISPYSASQSLNKSFSSSRTNSTNSLASL
                     DSSFGASSSTTTLSSFNNKSFMPLSRYGSFSRLSNTPYNSTFSLSTMLNSTPSSLSIS
                     DERPTKRSRPNSPKNSSLRPMFHVSSPSSTPISTPHHSPKLNPQNTTTNNKTVLPSIK
                     SIINNDDFGNYMNHTLSSRNLMIPNVATSNDETVKNILNRGMSHDMLSLRR"
     gene            complement(<423173..>425794)
                     /locus_tag="C5L36_0A01990"
                     /db_xref="GeneID:40381304"
     mRNA            complement(<423173..>425794)
                     /locus_tag="C5L36_0A01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463211.1"
                     /db_xref="GeneID:40381304"
     CDS             complement(423173..425794)
                     /locus_tag="C5L36_0A01990"
                     /note="PKUD0A01990; Pfam Domains:
                     Fungal_trans(4.8e-14)|Zn_clus(3.1e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319071.1"
                     /db_xref="GeneID:40381304"
                     /translation="METLLNNFTPDSLRPCSNCKKKKVKCVGTAPSCTRCKKYGLSCD
                     LSDNVLYSYSSIETIITQIKELEAILESKRVGSNSNLTTLGLPNNTEVTDESKTPESV
                     HKEPETLDELSDEVGTLTTSGNDDLQGKYIGAATGSNFAKAFLKQMHLQKLDDLSNMS
                     SSDFSGYDHVTSLGSTSCSPLPPYNVGKMSLNFYMDTVHPCYPVFVLKDFLEVFETCY
                     KSPQSLTYHDKYVVFMVIAIGFERGEKDCEIAKHYNQYKPIEFYNTAFRYLEKTITNR
                     SIDSLQELLLLMIWKLNTDVFKDDYGDFWYMGRYLIALAIELELHLTKNLENLSENKI
                     ELRKRLFWSSFLLERGNTVKYGRGLTIRMHNIEIGRPSMIKDDTFEFYATIDDRSDFV
                     GTRNSFFKNYNVIHLTPCLLSIELYEIYGVLLETVYISRTKGSTPRLDMNTIIGYKTE
                     IERSISSLLIRIESELPHTCLFYHELKIKSYIGSIILHRPSPSFPNPNDESLKICRDH
                     CLQAVESFKFLTAKGSTWKTKPASLHDLVNIGLTMIFCCWKIEKDSTTLKSFSSITLN
                     VMNDMIDFYPSFIKFKNLYIVISAIIIKSLDEKERLSQTPTDPNNIFNDVPSPLQNLK
                     QNLIFQQQWQPLNPQLNERQYLNNQFLQHQQQQEQQQQQTGQQNQYQQTLFASQSQYE
                     QLQRDQHLQQEKEPQQRHKKQRVQHPQELTSFSDHSNVYTEQNTSDTMPNVETRHQPR
                     AFPYLNMKKTSTFTPKNSTLFDSSMDAQSPHGTPAYLTSKLPMKPSYLAQERNNGNGN
                     NNVQVQQQQHLQQQQPFMNVDPYISNTTMPDGMGTVDPMTQELFQDIFNKYYFQGNDS
                     IKEDIDQLFEFQKFNWL"
     gene            <426635..>427699
                     /locus_tag="C5L36_0A02000"
                     /db_xref="GeneID:40381305"
     mRNA            <426635..>427699
                     /locus_tag="C5L36_0A02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463212.1"
                     /db_xref="GeneID:40381305"
     CDS             426635..427699
                     /locus_tag="C5L36_0A02000"
                     /note="PKUD0A02000; Pfam Domains: Pro_racemase(6.4e-45)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319072.1"
                     /db_xref="GeneID:40381305"
                     /translation="MDTIAITTIETHMCGEPFRILTSGLPKRIPGKSLLEKRNYLQNN
                     YDFIRNTLMREPRGHYDMFGGYLLDPVDEKIDADASVIFVNPDGYTDQCGHGIIALVT
                     TLIQQGWVDKSKYTLKPNLMKIVLETTVGAIETHACWNGSKVEYVEFKNTPVYILYKE
                     VQVQTSIGLLTGDIVFNGAFNFFTEVAENILRIESQNAMKLMSLGAEVKKKIQSMKSL
                     DIRSKDFPQIKGLHGVDFINVYNKENISDNVSPNQKSCLVLGVKQIDRSPCGSGTAGR
                     TGLLYLKNRFNGKSWFINESIIGSSLKSRVVETGIKANGGDYDACVVAIQGTANLLGS
                     SNWNIDLNDKIGTYGFIIPH"
     gene            <430444..>432573
                     /locus_tag="C5L36_0A02010"
                     /db_xref="GeneID:40381306"
     mRNA            <430444..>432573
                     /locus_tag="C5L36_0A02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463213.1"
                     /db_xref="GeneID:40381306"
     CDS             430444..432573
                     /locus_tag="C5L36_0A02010"
                     /note="PKUD0A02010; Pfam Domains: Zn_clus(1.1e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319073.1"
                     /db_xref="GeneID:40381306"
                     /translation="MDKKHAKQNIRKSIRWGKSCSNCRRRKVKCNFEIPCDRCITRNQ
                     AQTCTRDPMIFDGMLVKNEERELKFSRENETLKNKIKELQDTIQKLVNNKESLKSLQP
                     NEGNDTRRSKFVLVEHFQFVEKESLVIDPMFSKDWGSYSTTISKLKRSFDRGFISETQ
                     SDMDIQAGYDTEDWLALKHSDYSSYKGEDLKSKCWQFELDKIQNLTKKDCDILINSGL
                     NIIYLYPIIDRQKFMCKYNSYWKRTGIEEQHLSEKYCKSSDTYLFLSLMYSLLCLGIY
                     QTNENEKSLLSFTSEDWEIYPKAMFGSSLEALYRGRFMTHPRIESIQTINIHRILLGL
                     LSGKTLSNNLLCVSFYLSYKLGLHYSCDSIARNNMWTLLTFDWYDDHDRYPLSNMSTY
                     TSFTPPSKWLDEGKSIIDWSTYFLNFQIRVSSLKRSFYYEQSKSTLKALKRANLELES
                     FLEEVSEEIKRNCIMKHPNMPNESLQQIRFHTMLITYHEILIVNCRMSTFLTYNEWTK
                     NNRHVCLNSATYILRLFVSQNMHLHHKAYFSICDISTFAAIFLIIDSMYFISQTDFVE
                     KYQPLIKKTISVLYSFSSPVRGATRGIYVIKKMMLLCQQEFSSGQKKVCHLLSNSTPK
                     ILSDYNMKSGIHFEKKLPQPCNKVIENDSSSNTLTDISNIDRTHNQRIAKSTELPNPI
                     MEILEDRGWTNFINSIDDLALSFDVNN"
     gene            complement(<432595..>435204)
                     /locus_tag="C5L36_0A02020"
                     /db_xref="GeneID:40381307"
     mRNA            complement(<432595..>435204)
                     /locus_tag="C5L36_0A02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463214.1"
                     /db_xref="GeneID:40381307"
     CDS             complement(432595..435204)
                     /locus_tag="C5L36_0A02020"
                     /inference="similar to AA sequence:RefSeq:NP_014175.1"
                     /note="PKUD0A02020; similar to Saccharomyces cerevisiae
                     YNL224C (SQS1); ancestral locus Anc_2.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319074.1"
                     /db_xref="GeneID:40381307"
                     /translation="MPKKTSRSSDSSGRRSGRGGRRGGRRGGRGGRGGRRGGRGRQFD
                     DRLEEDISSFVNKSEIPNYNMLLRGKKVDSSIKLNKKLKLSKLNQINDMVDLNGGNFN
                     SVEEMSLNSMIYQSPNTRRKYGKGNSLFDEVRYTSMHRDDILKKSYKKANIEFIQAKE
                     VYDPSKLLFRKLAGKKNVVVTKLHQAEDQLQDEIITQFERHMEINHYGSNDDASDTEV
                     LEIGKTLRFGDEEKFVEQQKSSIADAEETVHMAGDKSTEESEMEQEHLERTEGGISIR
                     KVAEKDNNLPIFSGRYTENPKIEYTILPKKKNKKSEITIVDDNLDTQYNLSYEEDDSD
                     SEDKYKETDFMTPHSDNYISDNLNVNSSEEDGSDTEEVQVGKLLFTMKTTKNGENFIE
                     LPPLGRSRNKFKTENETEKVLYSIKTEDDDMTVNEVIDHVNRKLTGTKHTQVEPKGAE
                     DEEPEFGFLEEDYVSFDTTQIKIENIRYGANVADHQYYIQALHLLGDDDYQWLSCNDL
                     RETLVSNGLPDHRFEAFLRSATTHLHLSDQNVFSDYEEKEESDEELDDGDDTDDTNDF
                     IDVNFNLKSSKSAKAAKIQNAITSSDNEESDEELDEESLEGLDDLLAMHKISKDSFFD
                     PIEVATKTVKATGKHKKLRMEFNTEISSELEAYILDKYKLHKEKRKNNRIDREYRNAS
                     YMLIKYPYLLEMSDIIAEFKAFWANPERECMRFPPLDVQVNVVLKTLAGQFGFKATRR
                     GKAPKSFLEINKTSKKHKQPEWGNIKKMAERNQICFRTDIKLSREERHELKLIRKGEK
                     VRMKNNRKGNFSYKEGEIVGANAKEIDSSSIGRRLLERMGWQDGEALGPENNKGIIEP
                     IKVIVKTSKRGIM"
     gene            <435504..>437264
                     /locus_tag="C5L36_0A02030"
                     /db_xref="GeneID:40381308"
     mRNA            <435504..>437264
                     /locus_tag="C5L36_0A02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463215.1"
                     /db_xref="GeneID:40381308"
     CDS             435504..437264
                     /locus_tag="C5L36_0A02030"
                     /inference="similar to AA sequence:RefSeq:NP_014176.2"
                     /note="PKUD0A02030; similar to Saccharomyces cerevisiae
                     YNL223W (ATG4); ancestral locus Anc_2.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319075.1"
                     /db_xref="GeneID:40381308"
                     /translation="MGSQDIADGNDVYFSGLQNMWDRIWEFPGGLDKCSSESDLVILG
                     MHYKVNDENQEDEKSEEQSGISKCAGRATYEKIENSENSEDQLINVNYDKILDDKNTG
                     DEPEKFDNNAIDNIKMFMKKISDTTYQKFHSELNYTYPQNALDDLQTRLWFTYRYGFP
                     LIKYDENGSPPIHLGAILRGNMDIQNFGKGFTSDSGWGCMIRTSQTLLANALVSLKLG
                     RNWRLQGSAPEDMKVHWEIVEQFADSPDARFSIHNMVLYAAKYCGRRPGEWFGPSNAA
                     RSIEMLCNESQVDTNLKVYISSDSGDIYEEDLLNSCYEKNIDKFTPVLILCGVRLGVH
                     NINKIYWEFLKLTLDLPYSVGIAGGRPSSSHYFLGCQADYLLYLDPHIPQQAILLNDL
                     KKAGSSDYKSKMLGTLHTTKIKLLSLGKVDPSMLIGFLVKTREEYNDLRQKINLFPSN
                     RRFLNFSNSKPVIRRTSSVEDDIDGFVDLTMESGDEFLEHGEIIDDIDNKIKDMAEDK
                     HQELAEYEKLEHAEIKDEPIVEIEKIDTPVKLQSERSGKYNNEIFASDGIIEVEDINN
                     ESIVFVSECGKILTDTSSVR"
     gene            <437542..>441702
                     /locus_tag="C5L36_0A02040"
                     /db_xref="GeneID:40381309"
     mRNA            <437542..>441702
                     /locus_tag="C5L36_0A02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463216.1"
                     /db_xref="GeneID:40381309"
     CDS             437542..441702
                     /locus_tag="C5L36_0A02040"
                     /inference="similar to AA sequence:RefSeq:NP_014126.1"
                     /note="PKUD0A02040; similar to Saccharomyces cerevisiae
                     YNL273W (TOF1); ancestral locus Anc_1.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319076.1"
                     /db_xref="GeneID:40381309"
                     /translation="MSTIEDDVFYEQDELDFEELIEKNMDSNFEDDENIDKDLLSDLE
                     EYEDEEVDGSKEKIKREERLQQKMNMTKNPLTSVSLTATKDEDHIKRRVAMLCSALGG
                     FDLNPPQDYILGIEAAGCLRDIKRLLKVVDEEKNVHVVASACHDSGLLINDLVPIVVQ
                     FGTTDVANADPDIIKLLLSCLELITKLMTPITLGNDDVDDTGLLKLKRAQIEYKHRLL
                     HYKKGKIFKYLVALIIPVLQLERSEVTHRDNIILNLCLTLFTNILRIKPSDANTAKKN
                     KSHVINVFQELPPGILEEDISLEVVLEVYRKYKILPIVQTIASNLSNEFESRILGTAC
                     LDFYYYSFVSVDPKSLVDDIGKAGNALDSLPKSAAIADARDETNDRNVSNINDRLRQL
                     KMKEKENIRSFKSKSSTRHAKFGSLISVQDRKNGTRVLSGQDKLRDTNIVGLLDKNVS
                     KIESGKIFNRINKKENEGHEKIVRLNIRSRELLSKFVQDFIENGFPIVFREMYSMILE
                     GLVHPEEKKIYKLDYDFFFVVNWILRFEMCYQSVHKRGLRTVSKYKYFYCCFTGKTIK
                     DLINVFIPTYTKVNYDCLRVTTCVLKNILSSALTIHSYENFEDSKMLSDDKMVLKALV
                     QTGEAVLRLVFEIESEVKSLLRLPQDAHRRSYLFGLEMIEFTHVVLKVLSYISKLSIP
                     IMLFRKYSDDFNEDDIYDGQDRSNLTKNALNRYKELDRGRCEDFKDLLFHDNIVSTHI
                     WLFKQYQEVEEEKLNLVLFYFRKLLLKWERNILKLFRLDFMHALYEFKNADVSPKLKL
                     DFGNLTNFFMHHFTKICQHSPYAFIDLAVFDETFDSDIKTYLMSGDPMALGSLTFKER
                     RKTERRGNKDVKFRDDLMPDKRKTILLVSLLFFKDMTAVLDTLSKYLQQWYDELTQTF
                     DGKDPIGPLNVYRFAGTLQGEYRSNPYFRLLCNVGGIVNGAFISKSAQKLLDFKTNVE
                     QAMETPVDPDMLEDILDDPNIEIQQLHQYNKRRKRQNVDDVDDDPDLNDGYDSYLEDD
                     SYGDEVVNDGDDLAGSGDEQQDELELMETRLQSLENRIKGKAMKRTVDGQLVEMGKKL
                     RRKKSKKSKDKKKTHKRRRIVEDDNEIVSDGEIKRRANLSKHMIYDSDEEANEDPNFF
                     EREIKLHQLLQKRHGLITKEQYNSLMDGSLDVDDVSDLDDNLVVDTEKDLEITAAASK
                     PDRELLIDLLRGGKSLSNDEENVIMSGESSHESDTSDEDEISEEHQVSVELGRIRDML
                     RNSSGEPEVFNNVENKRPTKLRIVDDEEEEEEEEEEEEEKRKLAKVKDQKNENLRLAG
                     KPGGDNTNSDVAANIHPEEQMQETEIDSQMTSTSSVDSTTQTTENTEIDILNSLRQIH
                     DVINLQNI"
     gene            complement(<441784..>443202)
                     /locus_tag="C5L36_0A02050"
                     /db_xref="GeneID:40381310"
     mRNA            complement(<441784..>443202)
                     /locus_tag="C5L36_0A02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463217.1"
                     /db_xref="GeneID:40381310"
     CDS             complement(441784..443202)
                     /locus_tag="C5L36_0A02050"
                     /inference="similar to AA sequence:RefSeq:NP_010850.1"
                     /note="PKUD0A02050; similar to Saccharomyces cerevisiae
                     YEL064C (AVT2); ancestral locus Anc_1.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319077.1"
                     /db_xref="GeneID:40381310"
                     /translation="MSREYSDLVGDGGPQYNDQIQDEISIFDPLSETSNESSNDNDNI
                     PLSMDVVTPSSGSDLKAAFFNMTNSIVGAGIVGIPMAFLNSGLFLGVLLMTVLTIVND
                     WTLRLIIINTKLSGTKTYTGFVTYTYGKLGKVVVLLSQGLFAFGGSIGFIIIIGDSIP
                     HVIRPLFANEINNSAILSYILSRNSIMAFCVCAVCFPLSIIKDISLLAKASGLALVSM
                     SIIISIVVFKAPFVSSDFKGTIPTLSYFVNVGFFQAVSVISFALVCHHNTTFIYDSIN
                     TPTLDRFNRVVHISCAISGFVCCLMGVCGFLNFGNKTKGNILNNFPSDDLLVNVARLC
                     FGMNMITTLPLEVYVLREVIKDLYIIYKANLNPSYKFQGFSKLQHLATTAILILIPLI
                     IALNTCNLGAVLEIVGATSGSLIAYILPPLCYNKLTKRNHTLKQQIPYYACATFGFLV
                     MVLSTAQTIHATFSSPSNSHCI"
     gene            <443861..>449482
                     /locus_tag="C5L36_0A02060"
                     /db_xref="GeneID:40381311"
     mRNA            <443861..>449482
                     /locus_tag="C5L36_0A02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463218.1"
                     /db_xref="GeneID:40381311"
     CDS             443861..449482
                     /locus_tag="C5L36_0A02060"
                     /inference="similar to AA sequence:RefSeq:NP_014128.2"
                     /note="PKUD0A02060; similar to Saccharomyces cerevisiae
                     YNL271C (BNI1); ancestral locus Anc_1.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319078.1"
                     /db_xref="GeneID:40381311"
                     /translation="MKASKKSESSGSENINGGIMNSLIGSMRKSRTNNSSNVSSHSME
                     RPKDLSAQSVNSINPRSASNNGFFSKGKVSNSFGDNSSFDSISRVNTNASIGTSSTHT
                     FHSLSQNHAKKIIGGSGFRKTHRHTISDDFVLEPPSDPNEIERMFTEVMQTRDFESLP
                     ENAKAEMLNYSIERKWMLIRQQKLTEFKRQRLKELPEFRPSAGPNDAIQMQMKAQAEP
                     ISFITLLLNNTITTEQLKELEVYLTSEDLNWMIDFLNQDGAVCLCNVLNNLYKTKPLL
                     QLPVQHKTKMFTNVSESYQTIIEKEARLFRCIKVIALSTAGTEKINSMMSLFIPVIFG
                     GMLSPRAWVKKLAIDIITHYSFTYNNPRPLYSTLKKNINENCHLIYIKEFYENSTTNV
                     RLDKRSQVILSNINGVTRYEAWIWCSLRTFLGHGKLGSKVGSFPEFKFSGPMDISYIA
                     GYAESTLLLLRLIIENAGALKERLQMRRILQASGLHELMDRCELLEIPEVNILLEDLN
                     TLNNNDDLELRKTNEFKQQDINFEDPTSLLTALWRNSKGTKIGDYLLSLIQSIFLNAN
                     SDETNEDLIRNLKLTNDFVSNITMATSVDDNNMNISINKLLAAYRSDDTAKQALQEQK
                     RTKLEIEKLEAERDNLKKQLDDGSQGMVHTLQNELIHRDETIRKFREIIDRKDAELYV
                     INNELKKTKLEAEEYARKTIIAADSNKPKQHLVELRPTPGRSAISSNIRHSAKSRSRV
                     ASGHKPLSGTIVSLESLEKEARTLENTDFEEYLDQIPDAKDVKLTKDRTARDRDADMQ
                     TLNSLRKRLKFLEKDANNVIKYQSKLANQESLEQRKLEALERLNKLQSTLQDLRIQES
                     KYEDEEERNAKKTLDPYGTMDRIDTSKSKKLRSELSEIEQLCDNLKFQLSLKGDENYD
                     EDSDELVRKTQEMYTTGKKVQPKAEFNAGPVVNPITVKKMDMNSMRPFLGELEQKVGR
                     KQPITEVTNTDDFHVKDLNTPLHEDSKSADFIGLSYNADDKNKKKMITLNIGSNEETN
                     DDLDHKKHIIRTGIVKQPGSMSTAEYQTEGKIFEAIDINSINTTEHASGNIQRKYVQH
                     SQGNGNEICEEEASEEIEIEAGYKSKDKMKVRVPRDNTMKHFDNETIEDDDNDLPISR
                     KSITSDEVYDKHNTAPIHQSNESLERIEQANVSLPLSAEITEPTLANETSAIIRNSDL
                     LAADKFTSDSKSLDASSQGSQSSSSTVIRANVEASPTLPSPSSSSSLSSPQAPAPAPA
                     PAPPPPPPPPPPPPIHINTSGSPIPSPPPSPPPPPPLMFSGKSVSSMSPIITSSPFDH
                     LPRTKKKLKQLHWEKIDDIENSLWSDMNIEQFAEVFREKGIFDNIEDLFAAFEAKMNP
                     KTIKADVEKKSFLSAQHRQEFNICLQPLNKDSDMEIVTKILHCSQEILQRQKIMELLA
                     KPELCEISNTLGKNLEPYSTEWNSKGIISKPDKDPNELARPDRIYVETFYNLNHYWRS
                     RMRVLNVITSFKEDYQLLNKQLDLVEEATRSIESSESLKMLFEIILLLGNYMNTDNKK
                     AFGFRLSTLQRLSFLKNHNNSMSFLQFLEKIVRKDFPEVQKFVNDLKAVKGASNISIE
                     HLEKDCVSLISSVNNIDTSLTTGNLSNPGLFHPEDRFLKIVYREMPAMRREVNNLDNK
                     KLIVLERFNTIMKYFKEDPDADEFARNSFFKKFSDFLESYSKISVENIQSEALQKKVE
                     EAERIRETTKRKRDEKITGANIDLEKSIDKLKNSGLPERRNRLKELIVTSIHSASASR
                     NEGAEDNEVKGIVHVNHESESLNQNLDDLSSPAGSLLEGYRIEADGSLVSLNGDDGTL
                     ELDENAVLSERLKKRLQQGRRASSGTQISES"
     gene            <450071..>452041
                     /locus_tag="C5L36_0A02070"
                     /db_xref="GeneID:40381312"
     mRNA            <450071..>452041
                     /locus_tag="C5L36_0A02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463219.1"
                     /db_xref="GeneID:40381312"
     CDS             450071..452041
                     /locus_tag="C5L36_0A02070"
                     /note="PKUD0A02070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319079.1"
                     /db_xref="GeneID:40381312"
                     /translation="MVTNNRGRMEDVSDTRKDTSDLSSSDNPDGDSRRFTHDNPNLSG
                     DTHVKTDVSRDFEANSTSKVAKRNMKSTKKKGPKRKPGRPPGSLNRSTIARMKAEEEA
                     IALFMSSDPDAPPFRSTGVSLGDPKHGISKHEVHDPVSTTSTTNVIHGPLRRDLQSNH
                     LYSQPQHPSPQQPPHHQFHYFSQPYHQPPQVQMPQNNTSTSELHRAPIVPLPRVTNQF
                     QYTENVDPSSEAASFYQTLPPQGMVFDPSASAIVPVYYQQPIAPLNHPQSVHQSFQDQ
                     KQPEYTLPFIRNGPTEHQVQEQNTNESFPSKQMPRNSTFGSNHSSSLYAPDRQLYGVP
                     LNRIAPAVYSSSQLPYYHHQSQPQPQAQLQPQPSQMAISPILQQRRKTLLQQDDASNE
                     LSGIKNSGNDKIEKAEYENQRNEDAARDTKLKSYTQRLEFENNSKNTDNSEGERKLSV
                     NSTLGQPTTASYQPLTYQTSLPSVQPLVKLHNPTRPTRTATSSSFSSGSTNSINTYQQ
                     TGYSQPSPPHSNIAQYKPRSGSGLEAGFLKYQHQNPPSQLGTTTPSQPYFASQLAATH
                     QNQQPFTAFAHCTRISGSFPSPYVVFPGPQSRENTAINPENGSSILPGESPTTNDHLE
                     PKNSANEANINESKHDIENGSNYERVDRTWND"
     gene            complement(<452108..>453181)
                     /locus_tag="C5L36_0A02080"
                     /db_xref="GeneID:40381313"
     mRNA            complement(<452108..>453181)
                     /locus_tag="C5L36_0A02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463220.1"
                     /db_xref="GeneID:40381313"
     CDS             complement(452108..453181)
                     /locus_tag="C5L36_0A02080"
                     /inference="similar to AA sequence:RefSeq:NP_013282.1"
                     /note="PKUD0A02080; similar to Saccharomyces cerevisiae
                     YLR181C (VTA1); ancestral locus Anc_1.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319080.1"
                     /db_xref="GeneID:40381313"
                     /translation="MGDIPTLENVPAEAEKTIGPFIKRGREVATAQPLISYYCYLYAA
                     QLILESKLHTQYTSVAEYIEVLLDTIETNRKSLEEGAPKLAEILLDKEKSFKLVLGFT
                     LSIFNKCASEIDQHMCSKKTVQGFMAFLNFIEILKLWPEIYETKKDELQKQIKYAKYH
                     SNRVLKSLKNGEDPNDYVTENDKEMLDQLLQEQFEGTQDGVQESPTDEIAPTLPEPPS
                     NAPNNDIVLPTAPVLIKNHKNSLGLPAVPNESLSIQPASPDSTRVSHIPQLPPKPPKA
                     SSDDESPDISKISIKRTPGKSQLAKDGKVMSREEVEELWTKEDIISSAQKKAKYAISA
                     LNYEDIETAIKELQEALKLLKGE"
     gene            <453384..>455795
                     /locus_tag="C5L36_0A02090"
                     /db_xref="GeneID:40381314"
     mRNA            <453384..>455795
                     /locus_tag="C5L36_0A02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463221.1"
                     /db_xref="GeneID:40381314"
     CDS             453384..455795
                     /locus_tag="C5L36_0A02090"
                     /inference="similar to AA sequence:RefSeq:NP_013283.1"
                     /note="PKUD0A02090; similar to Saccharomyces cerevisiae
                     YLR182W (SWI6); ancestral locus Anc_1.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319081.1"
                     /db_xref="GeneID:40381314"
                     /translation="MDSSVAPTEHSMNEETTIENSTTIMDHSNANQPMINDVPSQFTQ
                     KTEHEDLMKSPDIPPKKLTQETTITESPIISTQKITSDEESDAGDNQKTGGNSLGNTT
                     KDDKLNITTGDHNNVFESPKKKGTPFKLPIFTHDLATGNETSPHTLQPLIIEDNNESK
                     SEKLIIDENSKVIISSLFLPYQKEVTLEDVIVNQESFLSRDENIRNQGGEPITLIEKS
                     QLNVDVPIDDNGQTALHLAATLGKVKLVRELLENGANRFRGDNDGQTALNRVVYATNC
                     YELACFDELLDLLYPTIKLIDNRGRTILHHIALTSGLKGRYDSSKYYLETLLEWVVKK
                     GSQFSNDPSLTLKYFLDEIVNKSDKYGNTCLNYATLAGHKYIVSQLLDIGADPYKPNK
                     VGVKPDDLGIDINKSRISSGRDITRTIADSQIESGKMSNIAISINGKSITDSNNDNEE
                     GKHKTKFEKVTTSKKTGSEFKELSNSLQLLDTIQTFITNLGKDFKQEIEQKSQQIEKL
                     NPVLRDKTLVLSQKRKQYDELQKTVHKISKITNKIDNLEKAIDEEEAKFAEQIKDLNV
                     DINQNDIVGAFDPDQPFTIPEMYEDVEAIVEQLLKEKLSRIKKDGMDISKVSVDGDGD
                     GDGDGEANEACLSSFDILEELNSIKVDDILPLFKEKITTEKMEKLKERIPPSVVLDAR
                     IRAYEKNNKNLLDKMNNRRLNNSELENQFKRIIALCINTDPENIDDKLLSSLLMSVEN
                     DPDPEIGQIRKVLKIVGDLDGEPKQDQQISNPASVSASSHTPLASASVATGSSSASKS
                     ASIAK"
     gene            <456011..>456232
                     /locus_tag="C5L36_0A02100"
                     /db_xref="GeneID:40381315"
     mRNA            <456011..>456232
                     /locus_tag="C5L36_0A02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463222.1"
                     /db_xref="GeneID:40381315"
     CDS             456011..456232
                     /locus_tag="C5L36_0A02100"
                     /inference="similar to AA sequence:RefSeq:NP_014383.1"
                     /note="PKUD0A02100; similar to Saccharomyces cerevisiae
                     YNL015W (PBI2); ancestral locus Anc_2.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319082.1"
                     /db_xref="GeneID:40381315"
                     /translation="MTNPDFKTYIVTLKENAAVENFKKAINAIGGEIGHEYSLIKGFS
                     IKIPSISASELHKTEGINTIEEDKEVNIQ"
     gene            complement(<456409..>459483)
                     /locus_tag="C5L36_0A02110"
                     /db_xref="GeneID:40381316"
     mRNA            complement(<456409..>459483)
                     /locus_tag="C5L36_0A02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463223.1"
                     /db_xref="GeneID:40381316"
     CDS             complement(456409..459483)
                     /locus_tag="C5L36_0A02110"
                     /inference="similar to AA sequence:RefSeq:NP_013288.1"
                     /note="PKUD0A02110; similar to Saccharomyces cerevisiae
                     YLR187W (SKG3) and YNL278W (CAF120); ancestral locus
                     Anc_1.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319083.1"
                     /db_xref="GeneID:40381316"
                     /translation="MPFRVFSKNKDKDSRSKSSTESNSPTSAYFPQPNLASQKSRKLS
                     MSSNSPTLLTPESTGKLAPELTPIVSLLSAQSHRKYIEGVFMLLKDLDSDGNPAERKW
                     LEVYGIMIGNELAYWDSQQLDSKDSNAMGDSKPSYLNFSDGTLKPCLTLPSSNNTIEN
                     VIVLSTTLKNRFLLQFSSRDKFLNWCTAFRLSSFEYTSLQEAYTASLLSARGSLLSDI
                     RVILSETKFNHEDWTSVRFGSGMPWKRYFAVIEPGKFTRKGPKNGAIYFYDNEKKSKK
                     SLMAKITNITSVYALYPRNYTVIDHSTLIKLDGSIQFDQKDSSKSCSIFLMPEQHTSV
                     PGYDTLIRFIIPLMDSFHLYGRPKKLNADKRDTSSLLFGLPVLPNVHYLELEDLDPII
                     KDITSIDWDQNSWNIKIKQILKGKMDKGYNGCGSQNGIQGVTDLLAASNELADGKTKF
                     LVNKPEVHKYLESSSSLKNFNSSGESIDLLSKKISHSNNSKRSNELNSSPLRNVTKTP
                     IENTTTTMPKNSPSPHPVNIYTKYSQIPDNRDVNQQFNRLDIDSNDRSIDGNRKTTEG
                     ENSGLDDLYPSNVYDDYEDDDDDDDDDDDDDGSEESELHFNKPSNHTSPLDQRVFSPF
                     TDFNNSFRDALKLDNQQSHRIKPLEYQNDAAGSHLMVKKQRSPDGNRSLAQNERANQR
                     APSDRIPPQKVSYNYQDTLDLPPVNPYKPLPSSSPSTPLDQQYPPSNPVLNFKNPSRP
                     MREPIFKVDSPLETNLKKMPFSQPQTIQNQGGSYQYTNSPELKPPHSYSGKKNNENIV
                     PQVIKQSSSNPLNSPSLSIGKYGPMKLPSPQLNSHPQFQQHSEFMPDTQFQSQPAQPH
                     IQPQQIHQHQYQHKLQPQQPNHHHPNPLPPSQQQQPYMNQQMARNQNQGGYQPQGHPG
                     YIHPVQYKQQHQQPPMGYPANQGPPPMGYPANQGPPPMGYPANQGPPLMGYPANQGPP
                     PMGYRADQGLPPMSANAHKNHRPKRLPPPTMQQPAGGKSFKHDPYALTKQSK"
     gene            <460773..>462323
                     /locus_tag="C5L36_0A02120"
                     /db_xref="GeneID:40381317"
     mRNA            <460773..>462323
                     /locus_tag="C5L36_0A02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463224.1"
                     /db_xref="GeneID:40381317"
     CDS             460773..462323
                     /locus_tag="C5L36_0A02120"
                     /note="PKUD0A02120; Pfam Domains: zf-C3HC4(1e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319084.1"
                     /db_xref="GeneID:40381317"
                     /translation="MRCSRRYNSLRFVSGYFERPNSVSKVPLSCSFLLFFFFFFFFFF
                     FSTLQRHSMPFCTVVTRPRVPVKKKLLTFLKKVFVKQKIPLGNLPNSASLISLPFRPN
                     TPPLPFHSLDESNDFFHCNPLSINGATSSGNENSLLETDQTTNLLASKEPFLTNEFKA
                     FDIIHSLPYLLVSDITAISIALYYLISGNVRDILGKPYWNYAICSPAWKGFYFSSFQL
                     FQHDNALALMSEDQCSLSNLLVEITCKFYLHKIFHNQLSSNRVMHFLETFRMNPTSTQ
                     CVPVLIVGITCLHDPDSKYNNTHSQTQIIFQNSTDNIFEFFNCLVKQIETESYYQLKM
                     NPLTEKLEPYKGPRFQLSPITFTDTSPYRWEMIQLAHVFPNDDPILTNLTQISHTLES
                     YLSNDLNDLTDVYLNLKNLVLESFDYYNPPKLEKYLKPFPWGDIMIVGMDWKTRDLIL
                     DPQYILDTDDGEICAICRSDYQEGEISLKLKCNHYFHSDCIGEWIKGSPLQKCPICRK
                     RIAGLPLD"
     gene            complement(<463571..>464209)
                     /locus_tag="C5L36_0A02125"
                     /db_xref="GeneID:40381318"
     mRNA            complement(<463571..>464209)
                     /locus_tag="C5L36_0A02125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463225.1"
                     /db_xref="GeneID:40381318"
     CDS             complement(463571..464209)
                     /locus_tag="C5L36_0A02125"
                     /note="PKUD0A02125; Pfam Domains: CBFD_NFYB_HMF(6.5e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319085.1"
                     /db_xref="GeneID:40381318"
                     /translation="MSNKSSDSERYDTYEIREQDRWLPIANVDRVMRNCLPKNTKISK
                     ETRECMQECVSEFILFVTSQAAEKCLIEKRKTLNGEDILYALYSLGFENYAEVLRIYL
                     AKYRIFELDEVEKRRKKYLARKERLQKEKKENKYSSMDGGDDDDDDDDDDDVYEEAGK
                     INHAKFNRPSLSNILNDDPQIFPLEPTDEMFWSINNSSSDYGDDQDIMMNSS"
     gene            <467371..>468756
                     /locus_tag="C5L36_0A02130"
                     /db_xref="GeneID:40381319"
     mRNA            <467371..>468756
                     /locus_tag="C5L36_0A02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463226.1"
                     /db_xref="GeneID:40381319"
     CDS             467371..468756
                     /locus_tag="C5L36_0A02130"
                     /note="PKUD0A02130; Pfam Domains: Cyclin_N(8.5e-44)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319086.1"
                     /db_xref="GeneID:40381319"
                     /translation="MQTFHTRKSYGPPRRPVSKSYSSRLESVENYQNRIIVNEYMGTI
                     TQHLRVLEKESSVNPSMIDLQPEVKWYMRPYLVNFIIQMHSSLKLKPQTLFLCWNIID
                     RYCAKRIAFKQHYQLIGCTALWIASKYEDKKSRVPTVKELNTMCSNVYDDSMFREMEI
                     HILSTLNWSIGHTTLEDILQLAVKSSDPDGKEQLNQPIQLYKGNTPTVSAILAVSRFL
                     CELSLYDRNYLKFSTSAIGITCFLMSCSILNMDVGTNYISQLIESFEKKSSNLFTYKE
                     DDLTEDEDESFFYEAAVKENQNNFSNGPFINGFDGHESLNEIRMISLNLFKSMLDPSN
                     VLIEKYTSLGVMTVVKRFIQENNLHQVDQSLIDQDIEEPVNNDMTNMAYSFSHTSFEL
                     TNLLLSFNENCSFLLPKVHRNISITSSGDSIFGTSCESPSNFSSFSSISSATSYYSDS
                     ALNSDLKSNLI"
     gene            complement(<469168..>471618)
                     /locus_tag="C5L36_0A02140"
                     /db_xref="GeneID:40381320"
     mRNA            complement(<469168..>471618)
                     /locus_tag="C5L36_0A02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463227.1"
                     /db_xref="GeneID:40381320"
     CDS             complement(469168..471618)
                     /locus_tag="C5L36_0A02140"
                     /inference="similar to AA sequence:RefSeq:NP_014797.1"
                     /note="PKUD0A02140; similar to Saccharomyces cerevisiae
                     YOR154W (SLP1); ancestral locus Anc_1.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319087.1"
                     /db_xref="GeneID:40381320"
                     /translation="MEAEKAMMFQLQTDVILRRLDFFVLVLLAFLGCTQAETKNESCT
                     SNSTLTTGIVAKLNEPTLNITESALGGSFFDGMQETTEGNRELNAVGLNFRSFEEWKK
                     DKLDHDQKESSRLNYDQLTNISSKNNGTTDINSDLTIEGIQSQRYKKRESSLHHDGLS
                     TTNDEIGEDMMIQLEMFTGKNEEQGKLYKGRYNYASIDCAATIVKTNNEAKGANSILV
                     DNKDSYLLNECRSKNKHVVIELCEDILVDEVSIGNFEFYSSVFKDIKISVSDRFPAPQ
                     WMILGEFQAENIKKLQTFKIENPIIWAKFLKVEFLTHYGDQFYCPVSTVQVHGKTMIE
                     QFKEENPDEEIATLESSMIEEELHSLSTADPLLEKNTSTFLEMKDQSEISSMFNFLPF
                     PDTMNSLCFDANLTTTDVDCSTLKYLKLDQFLIEHENKRSDEQCLAEPEVGTLNRTND
                     QENITYQASQQYSITPKSQPQDSIYKNIVKRLSLLESNATLSLLYIEEQSKLLSSAFM
                     DLEKQQSHKFQQILSQFNTTIRSQMEIYEKLSIDVYKSFSGLFEYQQQKFESTNLEII
                     EKIQEIEKSVTLYKHLTITCVVLIIVLIFYILLSKDLYLDEAYIADASFVPSPNLSPT
                     TSPTVSRSTSVYNMKRKIPHFSEKGSANEQLGTHNQDSNTNIVPKLALKLREGNSQEY
                     TSALNPIPTPSSSLVAVPTSTSVTPTSSSTSIVLRYRSSLLDTFSKSWSPSKKKHIQS
                     QSRYSNRTLISTNDIQTPETSRSTSPIPVMERIGAKNTTVNNKVADQDRGIHSAFEDE
                     DVNRTSEPGDFELVVDDQ"
     gene            <471903..>472601
                     /locus_tag="C5L36_0A02150"
                     /db_xref="GeneID:40381321"
     mRNA            <471903..>472601
                     /locus_tag="C5L36_0A02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463228.1"
                     /db_xref="GeneID:40381321"
     CDS             471903..472601
                     /locus_tag="C5L36_0A02150"
                     /inference="similar to AA sequence:RefSeq:NP_014177.1"
                     /note="PKUD0A02150; similar to Saccharomyces cerevisiae
                     YNL222W (SSU72); ancestral locus Anc_2.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319088.1"
                     /db_xref="GeneID:40381321"
                     /translation="MENPLNLRFCTVCASNNNRSMEAHKVLKNAGYTVRSYGTGSAVR
                     LPGPSINKPNVFQFGTPYTEIMKVLESQGIKVHKNNGVLDMTVRNMQIKKAPERWPYY
                     NQPPQKLPEEEHEGFKGELDFEIVITCEERCFDNVVEDFLTRNYFNPDETSRKVHVFN
                     VEIRDDHENAQIGGRAILELANSLNDLYRKSVANSDLDDSHPECWEDDIPDLIANWQA
                     KYGNLPLLYSLCFH"
     gene            complement(<472647..>474116)
                     /locus_tag="C5L36_0A02160"
                     /db_xref="GeneID:40381322"
     mRNA            complement(<472647..>474116)
                     /locus_tag="C5L36_0A02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463229.1"
                     /db_xref="GeneID:40381322"
     CDS             complement(472647..474116)
                     /locus_tag="C5L36_0A02160"
                     /inference="similar to AA sequence:RefSeq:NP_010043.1"
                     /note="PKUD0A02160; similar to Saccharomyces cerevisiae
                     YDL238C (GUD1); ancestral locus Anc_2.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319089.1"
                     /db_xref="GeneID:40381322"
                     /translation="MPTKIQEPYFQGSIDTLCYRKIKYTGYYGTFVHTPQLGKLEVLN
                     RTLVGVDTNGTIDFIIPINSEDADIKELILKHSSIKGLNENDVEIVDIFNEETRFFFP
                     GFIDTHIHAPQFPNNGIFGNSTLLDWLETYTFPLESSCKDLNIAREIYTQCVRRTLGY
                     GTTTASYYATIHAKATSLLSDIALIHGQRAFIGKVCMNRFAPHDYIETEDECKASTLQ
                     VIDYIERRNPKGDLIKPVLTPRFAPSCTEEMMRWLGSVRDKGDYHCQTHLSENNNEIQ
                     WVQELFPKYDNYTDVYYKNGLLSTKTTLAHCIHLSDDELLILQKTGSGVSHCPTSNSS
                     ITSGEARVRWLLDNQINVSLGTDCSGGFTPSILEVAKHALLVSRHLVMKTKNDAEKLT
                     PAEVLYLATMGGAEVLKINDKVGCFKKGLKFDAQLINLNAKNSNIDIFHFQKPKWGQF
                     ETAESMNKFINLIDKWLFNGDDRNIETVYVNGRTVINNV"
     gene            <474586..>474894
                     /locus_tag="C5L36_0A02170"
                     /db_xref="GeneID:40381323"
     mRNA            join(<474586..474591,474670..>474894)
                     /locus_tag="C5L36_0A02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463230.1"
                     /db_xref="GeneID:40381323"
     CDS             join(474586..474591,474670..474894)
                     /locus_tag="C5L36_0A02170"
                     /inference="similar to AA sequence:RefSeq:NP_011864.1"
                     /note="PKUD0A02170; similar to Saccharomyces cerevisiae
                     YHR001W-A (QCR10); ancestral locus Anc_2.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319090.1"
                     /db_xref="GeneID:40381323"
                     /translation="MAYVSGPVLKHAATLGGFHIKNIVSYIPVLAFWGVAAGAGVATF
                     TENWPLFQKTFYTKIPVIGNHWIHEVDPEDQP"
     gene            complement(<475108..>477663)
                     /locus_tag="C5L36_0A02180"
                     /db_xref="GeneID:40381324"
     mRNA            complement(<475108..>477663)
                     /locus_tag="C5L36_0A02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463231.1"
                     /db_xref="GeneID:40381324"
     CDS             complement(475108..477663)
                     /locus_tag="C5L36_0A02180"
                     /inference="similar to AA sequence:RefSeq:NP_012379.2"
                     /note="PKUD0A02180; similar to Saccharomyces cerevisiae
                     YJL156C (SSY5); ancestral locus Anc_1.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319091.1"
                     /db_xref="GeneID:40381324"
                     /translation="MRKLFSKRNPTPNEVPDSRGETGCASINSSHSSHSSHSIPRSLS
                     RQQEFPLDLNIDSNTVSPSFQYSYNSDTTSLFSSKRTVSTGLSSNAGSNTSYNQKGNE
                     QSKIVSRGRPLRVLLEEDQEENYELQNLASPAMMGIATNSEASMQPYNQNSSLSTSAG
                     LRAKARKKSSNADDASILTETSSSSATTSNFEGVLSDNEIVTQLNEYIKAQLKILASS
                     IDNVIIQIYQSVLNLTKATVMISESMEMIILKISNAKNIGMLPRKQFDTINTIGLRKL
                     IKNILLLVDSLLTGNVYNKSKSLILKNLHDLFVLIRVLPKGTPDLSNFVTKMSPKNFA
                     IGATAKDPPNISKVGFIMDRILSRDTRQFFSDQNGSFIAPVLRGFILPELSIITFIFG
                     FPMISKEHQDVIKYFSTISADIHFLLQKNKIIQASGMRLKSPFRQLDEDNDYVPISMS
                     ISTDISTTTSGTLGGYIYPKVDDDVLNPRLLKYKGQVFGLTCAHVVLNQESISGGAEK
                     LHPRVFTPSPVLINLYRRALVSEMMNHSNTTPEYKVYYDAVQKIDEKYPIETIVVNSR
                     SKKRNLPPSSLGNVVWGERLIDDNKLSDIAIIKINDGSKKKFVNYLGEDIQLSQYDPS
                     LILSNLNIKRTVSLQPRKHGILNTANLNVFKIGSTTNYTRGTLNGMKLIYWSNGSLRS
                     SEFIISNEDNKEGFANGGDSGAWILSKLVDVNDTINSFDDEPQESGTESERQDDYKNS
                     LAAFIESFIPKVSNKTEQINNNAKKNKQENRQTETGLGVLGMLHSYDGEYKQFGLFSP
                     IDDILDRLYTITGVKWGIVGCFDDDNTELFSSKSIVSGEMSLVSTSDENDVID"
     gene            <477873..>478775
                     /locus_tag="C5L36_0A02190"
                     /db_xref="GeneID:40381325"
     mRNA            <477873..>478775
                     /locus_tag="C5L36_0A02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463232.1"
                     /db_xref="GeneID:40381325"
     CDS             477873..478775
                     /locus_tag="C5L36_0A02190"
                     /inference="similar to AA sequence:RefSeq:NP_013497.1"
                     /note="PKUD0A02190; similar to Saccharomyces cerevisiae
                     YLR393W (ATP10); ancestral locus Anc_4.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319092.1"
                     /db_xref="GeneID:40381325"
                     /translation="MKSLGPRIFRRNAGFFGNLGQSMSKIVPKPHKYFKIAKPFGFAK
                     PPVRLQDQETKPFFTLENLNIPKKIWNFYFDGITRRTRVEAIQKDLAYGGMYDFHVYT
                     RTKGRLFEAPISFFRKDRALYFPNFRVKSLEGKRMDLLDALDKAKLTILRVYSTDAGF
                     EMTNDYFKIKDSEDTYMSSTGIKVFSQEYPEAQIVELVLSENASKHFIHTFVTPGKLL
                     QQRPKEQHDKYLIARRDSVLTRDDREKLLMTNAYSGYIYLIDQSYKIRWAGSGWPTEA
                     EVDGLWKAVKGILKENTLRLNKNK"
     gene            complement(<480960..>482339)
                     /locus_tag="C5L36_0A02200"
                     /db_xref="GeneID:40381326"
     mRNA            complement(<480960..>482339)
                     /locus_tag="C5L36_0A02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463233.1"
                     /db_xref="GeneID:40381326"
     CDS             complement(480960..482339)
                     /locus_tag="C5L36_0A02200"
                     /inference="similar to AA sequence:RefSeq:NP_012380.1"
                     /note="PKUD0A02200; similar to Saccharomyces cerevisiae
                     YJL155C (FBP26); ancestral locus Anc_1.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319093.1"
                     /db_xref="GeneID:40381326"
                     /translation="MPLVTIADSNPIKICVVIVGLPARGKSFISQKIVRYLSWLSIPT
                     QSFNSSANLQEILKSSDLTSCNLFDPKNEATLDHGILKETRNMTLKQILSWFADAGDC
                     AVAIYDGINSTKKERDLINETLEKEGIQTVFLESFCDDYELIKANITDIESTSPEYSN
                     SKSLQDTIDSVSNKIRFFEKNYETLTIEKDSDLSFIKLINFSSQIVLNQIDSYLKSRI
                     VYYIMNLHVKNRYIWLSRHGESQYNLEGKIGGDASLSERGEKYAFKLVELVNKYIPDP
                     EKLEVWTSTLKRTQQTAQFLPYPQKQWKALDELDAGSCDGLTYEEIAEKFPDDFKARD
                     DNKFEYRYPGGESYRDVITRLEPIIMALENQENVLVITHQAVLRCIYAYFMNVHQEES
                     PWMSIPLHTLIRLEIKAYGTQVTRIKADIPAVSTYKEKGTSKLGESANPSNIMIGSVI
                     SGITDKVID"
     gene            <482645..>486469
                     /locus_tag="C5L36_0A02210"
                     /db_xref="GeneID:40381327"
     mRNA            <482645..>486469
                     /locus_tag="C5L36_0A02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463234.1"
                     /db_xref="GeneID:40381327"
     CDS             482645..486469
                     /locus_tag="C5L36_0A02210"
                     /inference="similar to AA sequence:RefSeq:NP_013502.3"
                     /note="PKUD0A02210; similar to Saccharomyces cerevisiae
                     YLR398C (SKI2); ancestral locus Anc_4.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319094.1"
                     /db_xref="GeneID:40381327"
                     /translation="MGGIDILYSKLLEVETSDGVALKHDTCLEKEQISDTTDEKGDIN
                     SQELVDQYLTPTDKLSWSLLNELDSCPDITPGKEDELDSSMIKLPGLLNRTTIRFKRS
                     GIDGKIISFSEELSPDALEDTQGASSLAFSRKFNTDSKLNVRGSSSNLPFMPGGLNQE
                     GETLQSKATRFLHRDQNGLFDIPQGFKRGLSDTTSAKSEKIDIALGDTENMEELEILP
                     EQSSDTCEEIGTDGLDKSVKVDNEVVEVVDHEIDDEIGDLIPKDTLFKPSMATDSLMN
                     QRKRKTKWAHVVDLNHKIENFDELVPNPARTWPFELDIFQQEAVYHLEQGDSVFVAAH
                     TSAGKTVVAEYAIAMAHKNMTKSIYTSPIKALSNQKFRDFRQTFDDIDVGVITGDVQI
                     NPEANCLIMTTEILRSMLYRGSDIIRDVEFVIFDEVHYVNDVDRGVVWEEVIIMLPEH
                     VKIILLSATVPNTLEFASWVGRTKQKDIYVISTPKRPVPLEIFIFAKDTPFKVIDSNR
                     KFLESGFKQHEDKFLKIKPKDNDKQGGTQNSGRGGRAGARGGRGGRGGARGGARGGSH
                     SGNNGPRFIKRDAPTSKSWTTLVEYLRRNELLPVVIFVFSKKRCEEYAETLSGFNFSN
                     AKESSAIHMFVDKAVSRLKKEDRELPQILRMREMLKRGIAVHHGGLLPIIKEVVEILF
                     SRGLVKVLFATETFAMGLNLPTRTVVFSSTRKHDGTGFRDLLPGEFTQMSGRAGRRGL
                     DKIGTVMIMAYQQPADKNSLKQVALGVPTKLTSQFRLTYTMILNLLRIEALKVEDMIK
                     RSFGENSSQSMLPDQQMEILKLEKELQLAELPALDTENVNKLESIFSICSDISYLREN
                     FIKSIIKGNKSKTLFKLGRLITFRNDKGEMHVGAILNVNSGKNIADCLVVTSNSNREQ
                     ASKFASSNLFFDPIFNEAFNRQWTESWNIKLSKTTSVPTSRIEFVSDEFMPVSKELFS
                     RDQATTRKTMHKLEMLFKRINSWKEFDYHPCMNETTVESISLYYKKLNQLAGMLSDED
                     VVTMMFKNDNYLKVANKMTIAERIETIKQTLSDENLELLPEYNKRMEVLKTLNYIDPE
                     QLTVSLKGRVACEINSGFELIITELVFENFLGGFSSEEIVALLSCFVYEGKRGNNDDT
                     EVMLATPRLEKGKERICAIVEKVMELSTELKIQLTAEEDAFLENDRFGLVNTVYEWAR
                     GRTFKEIMEYANDADESEGTIVRVITFLDEICNQVKNAAMITGDSALHSKMTDAQEKI
                     KRDIVFCASLYL"
     gene            complement(<486572..>487009)
                     /locus_tag="C5L36_0A02220"
                     /db_xref="GeneID:40381328"
     mRNA            complement(<486572..>487009)
                     /locus_tag="C5L36_0A02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463235.1"
                     /db_xref="GeneID:40381328"
     CDS             complement(486572..487009)
                     /locus_tag="C5L36_0A02220"
                     /inference="similar to AA sequence:RefSeq:NP_010946.3"
                     /note="PKUD0A02220; similar to Saccharomyces cerevisiae
                     YER029C (SMB1); ancestral locus Anc_3.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319095.1"
                     /db_xref="GeneID:40381328"
                     /translation="MVLGRVPKNTRLETLIGFKVKVTTNNTSTFIGSLKSYDKFMNLV
                     LTECEEFRLTKKSKKYLGQTKNEEVDEGKIREQKRFLGLVLVRGENVVSVVAEAAPNS
                     KSLKPQLRIKKGKVSINPLKRKIACEEGDNKTNSGVKKPTTRK"
     gene            489639..489722
                     /locus_tag="C5L36_0Atrna2L"
                     /db_xref="GeneID:40382482"
     tRNA            489639..489722
                     /locus_tag="C5L36_0Atrna2L"
                     /product="tRNA-Leu"
                     /note="PKUD0Atrna2L; codon recognized: UUG"
                     /db_xref="GeneID:40382482"
     gene            489735..489806
                     /locus_tag="C5L36_0Atrna2F"
                     /db_xref="GeneID:40382477"
     tRNA            489735..489806
                     /locus_tag="C5L36_0Atrna2F"
                     /product="tRNA-Phe"
                     /note="PKUD0Atrna2F; codon recognized: UUC"
                     /db_xref="GeneID:40382477"
     gene            <490192..>491967
                     /locus_tag="C5L36_0A02230"
                     /db_xref="GeneID:40381329"
     mRNA            <490192..>491967
                     /locus_tag="C5L36_0A02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463236.1"
                     /db_xref="GeneID:40381329"
     CDS             490192..491967
                     /locus_tag="C5L36_0A02230"
                     /inference="similar to AA sequence:RefSeq:NP_014278.3"
                     /note="PKUD0A02230; similar to Saccharomyces cerevisiae
                     YNL121C (TOM70) and YHR117W (TOM71); ancestral locus
                     Anc_2.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319096.1"
                     /db_xref="GeneID:40381329"
                     /translation="MSFIQQNKVAVAVSAVVGIGTLAGIVYYLNKSSSTSPDAKGTKK
                     SKKRSPKKKKNSKASHSGTVVEEDPETCIYPINESTKLPEIDDGTVEKLPAAEKEKWA
                     LSLKEKGNEYFKAEQYEKAITYYTDALKCKKDHIFYGNRSACYYALKEYEKAIEDATA
                     ALEIKPDYSKCLLRRAHLYEDVGRFEDAVFDLTALSIYGGLADKSSESLLEKVLAKQA
                     DKMNREIYADLPKELPSSSSISSFLGAFVKEDIDLDLSKYAEASGSYFLAKALNELAK
                     DTDEGYDEADNLFNQSVEQFEKDGYSGDDKKLAAIAYEYKGIFAFLKTLDNAAELVEK
                     ALSINARPRMYVVLALIAADKGDYLTADKNFNNAIAMDPNDPNIYYHYGQVFYLMGDL
                     IKAEKNFEKAKELNPKNVFAYIQLACITYRHNDFSKCLELFNEAKAKFPTAPEIPNYL
                     GEILFDKGDIDGATKQFDVAIKLQEVVPGNNVGVLPLINKSVIYQKSSQFQECISLLE
                     KAVKVDPRSEIAWTNLGQLYLMLQRVEPAQECFEKACVLCRSSEDRKQIISLLESAKI
                     QLKVQKDESLSKKVKEIMSLYSAQA"
     gene            complement(<492312..>492830)
                     /locus_tag="C5L36_0A02240"
                     /db_xref="GeneID:40381330"
     mRNA            complement(<492312..>492830)
                     /locus_tag="C5L36_0A02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463237.1"
                     /db_xref="GeneID:40381330"
     CDS             complement(492312..492830)
                     /locus_tag="C5L36_0A02240"
                     /note="PKUD0A02240; Pfam Domains: ETC_C1_NDUFA4(1.2e-30)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319097.1"
                     /db_xref="GeneID:40381330"
                     /translation="MFTRSLRNSNTLRLAQAIRLNSTGPNPTPVVASVEVPETVKKIT
                     DLTQNGKQLISGAPEELSISGNRLVKIYKESKYATQNGTRNSKFWRLEWDILGKGNRW
                     ENDLTGYQSTADYMQASRLSFSEKEQAVKFAESNGWDYYVVEPKTKKFVKKEYSSNFV
                     HSKGPLKYIFTK"
     gene            complement(<493092..>494129)
                     /locus_tag="C5L36_0A02250"
                     /db_xref="GeneID:40381331"
     mRNA            complement(<493092..>494129)
                     /locus_tag="C5L36_0A02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463238.1"
                     /db_xref="GeneID:40381331"
     CDS             complement(493092..494129)
                     /locus_tag="C5L36_0A02250"
                     /inference="similar to AA sequence:RefSeq:NP_013126.1"
                     /note="PKUD0A02250; similar to Saccharomyces cerevisiae
                     YLR026C (SED5); ancestral locus Anc_2.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319098.1"
                     /db_xref="GeneID:40381331"
                     /translation="MEVVPNIQDRTFEFQQAVNTFAKQQHVESRSAPAPKPSTQKSEF
                     NRQAGYIAKDIVRVTGALHKLAQLSKRKQLFGDKPTDIVELTYIIKQDIFKIEKELKG
                     LKSLQVNGLRGDGDTQIKSYHKNIVQLLNTKTKNISENFKDVLEARQRAEFAQRNRQE
                     QLLSEVRNSGGDTGKDGIKTSVENNVPFAIRSNNLPNGIASDNPFLAGIQLQELSEQK
                     KAQATQDAIHSYGENGNLLSLPDQNQQLLLLEEQNNQYLQERSNAVDAIESTINEVGG
                     LFQQLATMVQEQGEVIQRIDDNVEDVSLNIQGAQRELMKYYKSVSSNRWLMMKIFGII
                     IAFFLLWVLVS"
     gene            complement(<494481..>497210)
                     /locus_tag="C5L36_0A02260"
                     /db_xref="GeneID:40381332"
     mRNA            complement(<494481..>497210)
                     /locus_tag="C5L36_0A02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463239.1"
                     /db_xref="GeneID:40381332"
     CDS             complement(494481..497210)
                     /locus_tag="C5L36_0A02260"
                     /inference="similar to AA sequence:RefSeq:NP_012801.1"
                     /note="PKUD0A02260; similar to Saccharomyces cerevisiae
                     YKL121W (DGR2) and YMR102C (YMR102C); ancestral locus
                     Anc_2.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319099.1"
                     /db_xref="GeneID:40381332"
                     /translation="MKSFNEKASYISSYPKLVSGPLVSDIASAMKPVSDVALSPIVDS
                     FCSRNNNSDSVSLMQPQLHSNSIDNSVDLELERIKKIELSYLTLFRKNSKFKNQGFSH
                     FFLCQELNVNDNPANPIKIQSNAIGSNNSTLLIDDGSSFSNSSLKKDFANTTIGNNNT
                     GSILSTESPAIYNLVFSHDGKYMASAGADGFIKIWEVISSEMDRHDPGFVEPNNHQVP
                     SNYLTVPSRPHRKSFIDNFLDDTFSDAASSMTTFDVPGVRKSTSKSKSKSKSKSRTRN
                     RARSDTTYSFGSNDSEGTHYVDDYSTYSNQTQIQSDIYAPVFKHQPYKTFFHDKTINS
                     LDWSNNNFLLSSSDDGTVKLWHVDRADCLQTYNFDSVVTCAKFHKLDDRFFVASLWNG
                     KIYLLSILEKEIIYQINLQKQVTCLEFSPKSNMLLVGCDKGYVILLKIDGGFKIEEEY
                     QINKKKNKTGPRITAISIIDCSLKNTNKNSIYRNSKNDESNKPESESMRILISSNDSK
                     VRLYELSGLKMKFSGLSNRFSSIAASANEDLTYIISGSEDGWTYLWETGIDSTNSGGT
                     NDAKKKTNKLFSKQHFDIFSFFRDESDSIENKNYGSFRTNSSRCNVSVFAPRASLKLL
                     ELSNDPIFDLKHKYSFILNEMHIKDLEVDDLSTAVIITADNTGKIKVFRRDFSRYIRK
                     ALNFKSASQIVERRQTMMNRTGSEHILNKNTLVIPNYQANSAGIKHIMSSVYENPELD
                     RGRSDTKGVIKPANKFAVESSVVDHSKEKLNLTGINIENVGGNVVVENNGVSNPDDIS
                     NEILHDKENAVLDSSDLSPIHISNSIKDIDDELKKIIGDSEQGKLAKVSQHQHSSSTA
                     SVYNVPDHENITSGTLTCSKCGSTDFNSAPMDAGNTNHIRFFCKDCGQEVNLK"
     gene            <498646..>499884
                     /locus_tag="C5L36_0A02270"
                     /db_xref="GeneID:40381333"
     mRNA            <498646..>499884
                     /locus_tag="C5L36_0A02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463240.1"
                     /db_xref="GeneID:40381333"
     CDS             498646..499884
                     /locus_tag="C5L36_0A02270"
                     /inference="similar to AA sequence:RefSeq:NP_010720.3"
                     /note="PKUD0A02270; similar to Saccharomyces cerevisiae
                     YDR432W (NPL3); ancestral locus Anc_5.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319100.1"
                     /db_xref="GeneID:40381333"
                     /translation="MDSPSAHADESSSNYMEDQHSHHSEQQEEEQQQQQQQQGEAAGF
                     EQNQPAHPTGPAQTHDIYSKVQLFVRPIGAHAKHEEVQDFFAEHGALRELRLMPGYAF
                     VEYESAEIAEKAHRELSEKTFQGEPLQVEFAKNKPEYAKKGENRVKVSSLPPYTSWQD
                     FKDFLREEIHVVPTFVRIPHEEPTICHLEFGTRDELEKAISLINETKFKETQIIAEED
                     TSPYIASASRQIVSRRGRGGFMPRGRGGYRGGFRPMHRGGYGGPGGYRNGPPPPMGGA
                     PYDPYHGGPGGYRDYPPRGGYMGGRGGYPPRGGRGGYMPRGRGGYGGPRGGFPPRGDY
                     PPRDYPPRGDYPPRDYPPRGDYNSGPPPPRGDYGMPPAPGPDFRDGPPPPRNEFRSSR
                     EDGDYQGDRDFNRDRSPGRF"
     gene            <500784..>502574
                     /locus_tag="C5L36_0A02280"
                     /db_xref="GeneID:40381334"
     mRNA            <500784..>502574
                     /locus_tag="C5L36_0A02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463241.1"
                     /db_xref="GeneID:40381334"
     CDS             500784..502574
                     /locus_tag="C5L36_0A02280"
                     /inference="similar to AA sequence:RefSeq:NP_013699.1"
                     /note="PKUD0A02280; similar to Saccharomyces cerevisiae
                     YML013W (UBX2); ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319101.1"
                     /db_xref="GeneID:40381334"
                     /translation="MDKLTDEQQIVLDQFSEITNFDKEKEDKKVLRLLTVCNWNLETA
                     IARYFDNDFPQLLDDHHFSSIYSDTQSFNGNTDSVFTNQSVAPPSNRSSSPPNVSPFF
                     NPPDISFQASLVNASDELLVPKFQRALPINNKWKFQAGLLKPSSEMTKLNPLLTSLVF
                     ILMLIPKFFLLLGYGLNRVFGDYAPHLFKFLGLRKDEDDFPSHPTHNSPDDVAQHDIR
                     KYVAEISGKEGEQLPPIYNGEFNSAFEECRKNLKWFCLILFNSESSSAERIIKEIITN
                     ERFVEFIKRNDVVLYLGDVSYPEAYEVGTSYRAYGLPYLSLIANVSLNGLSYPEFSIV
                     CKCQRLLDGFNPTTNNNSISRLLKRLNRIIEKYEPQLVTQRFDKQEAEMSRIIREQQD
                     NAYKESLLKDKQRQEEKVKKQLEQDLQISKQLEKESLLKQNKIKAKEYTIRYINNYYI
                     RDDASWVKGEFTTIQFRTNDGKRFVRRFSKNETVFDIFMFVLSKQMINSYINRGVYDN
                     DSDDDGNDEESEEVYEFVEEDDVLEYFKDYPFKYDEVENIHLDFEFDLVSPMPRLRLV
                     SNHDPISEVKGIWPNGSLLIEPNDIYEEDD"
     gene            complement(<502701..>503351)
                     /locus_tag="C5L36_0A02290"
                     /db_xref="GeneID:40381335"
     mRNA            complement(<502701..>503351)
                     /locus_tag="C5L36_0A02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463242.1"
                     /db_xref="GeneID:40381335"
     CDS             complement(502701..503351)
                     /locus_tag="C5L36_0A02290"
                     /inference="similar to AA sequence:RefSeq:NP_009980.1"
                     /note="PKUD0A02290; similar to Saccharomyces cerevisiae
                     YCR051W; ancestral locus Anc_6.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319102.1"
                     /db_xref="GeneID:40381335"
                     /translation="MSENIWVAAADNKVDVVKKFFESGFNANSADPNGFTPIHAAASY
                     GHVELLKYLLANGGNVNVQDSDGDTPLHHAESLDVVKLLINEYNADYRIKNNDGLNVK
                     EYFIEEGEFPEIIHYFEILEKTGDHQSDELKGALNLPNGQEIKAFLHAENNDDENSPE
                     MMERRRQVEAIFTNTELSESGRDDKLREYVMGVVSANMGKLKNGQDIEKENHKRRK"
     gene            <503554..>504177
                     /locus_tag="C5L36_0A02300"
                     /db_xref="GeneID:40381336"
     mRNA            <503554..>504177
                     /locus_tag="C5L36_0A02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463243.1"
                     /db_xref="GeneID:40381336"
     CDS             503554..504177
                     /locus_tag="C5L36_0A02300"
                     /inference="similar to AA sequence:RefSeq:NP_014417.3"
                     /note="PKUD0A02300; similar to Saccharomyces cerevisiae
                     YNR020C (ATP23); ancestral locus Anc_6.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319103.1"
                     /db_xref="GeneID:40381336"
                     /translation="MSSPEKQLSTTPPQQQQLEQPVLSEEKKAELCRQCDEYKSWMMK
                     YSPTVLFMFDQIKNAGGYVSPNKITCEICPDPKLGGFHAEMGIQLCANYIPDKWVLND
                     TLSHELVHWYDNTRFKVDWMDLRHHACSEIRAASLSGECAIMTEFKKNAGMMKISKGH
                     QRCVKRRAALSVVGHPKCKDMDHANQIVDEVFRSCFNDTRPFEMIYS"
     gene            complement(<504338..>506044)
                     /locus_tag="C5L36_0A02310"
                     /db_xref="GeneID:40381337"
     mRNA            complement(<504338..>506044)
                     /locus_tag="C5L36_0A02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463244.1"
                     /db_xref="GeneID:40381337"
     CDS             complement(504338..506044)
                     /locus_tag="C5L36_0A02310"
                     /inference="similar to AA sequence:RefSeq:NP_009978.1"
                     /note="PKUD0A02310; similar to Saccharomyces cerevisiae
                     YCR048W (ARE1) and YNR019W (ARE2); ancestral locus
                     Anc_6.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319104.1"
                     /db_xref="GeneID:40381337"
                     /translation="MVKMKDTLGSPALKTKLSENTLNKATSGFKRFNILQNNNDDGSA
                     NRRKSIIMDNEYESSELNVSNTESESSEKEVVEPPRELEEVEDVGKDKHVVTPKGLVE
                     THDKRGRLVYKHVKTSKVRYKKDGQMRSNFGDLIFLPRYTIFDQEIYFGAKFFGFFVA
                     IWLCVFFFGLNVILSYHTSQGTFKNSEIVHLMLKDLWKVALFDLTMYLSMYFSVFVQL
                     CIKSQLIRWKPTGFTLQAIYEVLLLVCPFFYADKLQLPWIAQIFLMLHSVVMLMKVHS
                     YAFFNGYLWEIKNEYEFSTLFMKKKDILEENIVSSLEKSIKFCQDEIKSQSFPNNISF
                     KNFFIYSMFPVLVYQSEYPRNDRIRAKYLFNKILGIFGVIFLMMVISQHNLYPIVIEC
                     LRLQKTTSIWYRIKVYPLILIRIIPSFLSVYLLTFYLIWELILNALAEITRFADREFY
                     GYWWNSVNWNEYARDWNVPVHKFLLRHVYHSSISAFKVNKTVATFMTFFLSSIIHELA
                     MYVIFKKVRFYLLLLQMSQLCLIQITNTKYLRNMNVFNNAIFWFGIIFGPSLMCTMYL
                     VF"
     gene            <506426..>507250
                     /locus_tag="C5L36_0A02320"
                     /db_xref="GeneID:40381338"
     mRNA            <506426..>507250
                     /locus_tag="C5L36_0A02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463245.1"
                     /db_xref="GeneID:40381338"
     CDS             506426..507250
                     /locus_tag="C5L36_0A02320"
                     /inference="similar to AA sequence:RefSeq:NP_009976.1"
                     /note="PKUD0A02320; similar to Saccharomyces cerevisiae
                     YCR047C (BUD23); ancestral locus Anc_6.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319105.1"
                     /db_xref="GeneID:40381338"
                     /translation="MSRPEQIAPPEIFYNDIESKKYTSSSRVQHIQAKMTLRALDLLN
                     LEEGKTHYLLDVGCGSGLSGEILTEEGHMWIGMDISADMLATAIDRDVEGDLFLADMG
                     CGVPFRPGTFDAAISISAIQWLCNADTNTNEPKFRLARFFNTLYSALCKGGKFVGQFY
                     PANEDQIIQITSAAKVAGFQCGVVVDEPESKKNRKHYLVLQAGTSVRPLNVDGMDVEN
                     MNAKHAKESSKLSKKKLKANETKKEYIMRKKILMEKRGKDVRKDSKFTGRSRKPRF"
     gene            <507689..>508429
                     /locus_tag="C5L36_0A02330"
                     /db_xref="GeneID:40381339"
     mRNA            <507689..>508429
                     /locus_tag="C5L36_0A02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463246.1"
                     /db_xref="GeneID:40381339"
     CDS             507689..508429
                     /locus_tag="C5L36_0A02330"
                     /inference="similar to AA sequence:RefSeq:NP_014419.1"
                     /note="PKUD0A02330; similar to Saccharomyces cerevisiae
                     YNR022C (MRPL50); ancestral locus Anc_6.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319106.1"
                     /db_xref="GeneID:40381339"
                     /translation="MFSRTSSHVLQAAKAELNKTGVRYTAQSKKNRIEVQLLKDFPGV
                     GVRGQVVSVKPSAMTNRLYPNNGAVYLNYKGAEPVIPVVSKQAALTAAAALKSAQKQK
                     EKQNKVKLNPILKNEIEQSKKKGETLLSLDDLLAFDVNDLTKDQLELVFAKLPKKIVF
                     VKKSTDKVLQSPLEKTFIINQIESTLSRYLKEKDIVSKFFNSSATTFTIKGDSDEELA
                     SISKLGAYYVNVEHQEQSQLISVIVNEK"
     gene            <509644..>510384
                     /locus_tag="C5L36_0A02340"
                     /db_xref="GeneID:40381340"
     mRNA            <509644..>510384
                     /locus_tag="C5L36_0A02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463247.1"
                     /db_xref="GeneID:40381340"
     CDS             509644..510384
                     /locus_tag="C5L36_0A02340"
                     /note="PKUD0A02340; truncated at 5' end; possible
                     pseudogene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319107.1"
                     /db_xref="GeneID:40381340"
                     /translation="MIRFTWHCCAHYDPASGTGGSSGGPMGFAQEFNDIGNTGLITTK
                     SYLDKIQHQFPWITFADVYTFPECVAFEELGGPKIEWKPGRTDCPGPNKVPVMGRLPV
                     ASNDSDLIKEVFYHRLGFNARETVALIGGCHGLGGCHARYSGFNGTWTRKLFTWDNGY
                     FKALLEENWCLGVVPEIGIEQYYNEDKSLTMLNTDIEFLKCPEFKRWVEIYANNEAFF
                     NEQLATAFAKLLELGVIRDKDGVQRIKI"
     gene            complement(<510585..>512819)
                     /locus_tag="C5L36_0A02350"
                     /db_xref="GeneID:40381341"
     mRNA            complement(<510585..>512819)
                     /locus_tag="C5L36_0A02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463248.1"
                     /db_xref="GeneID:40381341"
     CDS             complement(510585..512819)
                     /locus_tag="C5L36_0A02350"
                     /inference="similar to AA sequence:RefSeq:NP_010499.1"
                     /note="PKUD0A02350; similar to Saccharomyces cerevisiae
                     YDR213W (UPC2) and YLR228C (ECM22); ancestral locus
                     Anc_8.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319108.1"
                     /db_xref="GeneID:40381341"
                     /translation="MPSAYIYDTKNNTNDHLRITKSDKKATGKRKFHKKSRNGCTTCK
                     RRRVKCDETKPICARCERMGIECVYLNAEVTSGHKENNTESTLKHPGAASLHKTESNK
                     TPMATQIALDSLLQQQGQAPETPRDLPPPIPLGVSESLSNLLSMSPMTQLLQQCPLSP
                     VSVPVATAQIGLQFLNSFPPEMQVKLFQQFQQLPPDKQQQLYQSLPMQMRASSENNSL
                     QDSVLLDSLPKSNISRQQHQHDTQSIKHETQQQNEAFSTNTLPPLQSPSINSIAGVPN
                     NLISEIIGDLANKKSNFPVGSNKIPTPQELAAQYQQRTMNNGSPEVGGPSISPDTITS
                     SLPPITNGQTTISQQSSSLNMLDLRLMYHYTTKVWHTITDAGISDSKIWSDDIPLLAF
                     KYPFLMHSVLAFSATHLSRNERGLDQCVTCHRAEALRLLREAVLEMSPENTDALVASA
                     LILIMDSLANASLPTSSSIKALPPSAWIFHVKGAATILTAVWPLSEKSRFYKFISVDL
                     GDLGDIGYDLISGELANTSDSNENSRSSSVTCGDSQSTKLRSNKGHSLSDLARSSNDY
                     KKPPKSKFSTIRCFDEEISDMFPVSLTSPYFPTLAYMAKLYSERDKSDFILRIFAFPA
                     LLDKRFLGLLINCDLSAMRIMRCYYRLLRNFTEQMKDKVWFLEGVSSVLPADVEQYAG
                     GGGMHMMLDFLGGPATLDDDGNGENYVAKSAAQSGLLDTNNLPSASMNDNSLRYDGEL
                     NNDS"
     gene            complement(<513192..>514856)
                     /locus_tag="C5L36_0A02360"
                     /db_xref="GeneID:40381342"
     mRNA            complement(<513192..>514856)
                     /locus_tag="C5L36_0A02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463249.1"
                     /db_xref="GeneID:40381342"
     CDS             complement(513192..514856)
                     /locus_tag="C5L36_0A02360"
                     /inference="similar to AA sequence:RefSeq:NP_010498.1"
                     /note="PKUD0A02360; similar to Saccharomyces cerevisiae
                     YDR212W (TCP1); ancestral locus Anc_8.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319109.1"
                     /db_xref="GeneID:40381342"
                     /translation="MFSNARSETLFLGGEKLSGDDIRNQNVLATQAVANVVKSSLGPV
                     GLDKMLVDDIGDVTVTNDGATILSLLDVQHPAGKILVELAHQQDREVGDGTTSVVIIA
                     SELLKRANDLVKNKLHPTTIISGYRLALKEAIRYINEVLSQPVETLGKETLINIAKTS
                     MSSKIIGSDSDFFSKMVVDTMLSVKTTNSAGEAKYPVKAVNILKAHGKSSKESVMVDG
                     YALNCTVASQAMLKSVKNAKIACLDINLQKTRMAMGVQINIDDPEQLEEIRKREYGIV
                     LERIRMIIASGANVVLTTKGIDDLCLKEFVENKVMAVRRCKKEDLKRIARATGGTLIS
                     NLSNMEGEETFESSYLGFADEVAQERYSDDECILIRRPKKHSAASIILRGPNDYTLDE
                     MERSIHDSLCVVKRTLESGTVVPGGGAVECALNIFLENFATTVGSREQLAIAEFAAAL
                     LVIPKTLAVNAAKDASDLIAKLRSYHAASQQVSDADVKRKNYKNYGLDLIKGKVVNEI
                     ASGVLEPTVSKIKSLKSALEACIAILRIDTMITVDPEPPKDDPHAH"
     gene            complement(<515479..>516066)
                     /locus_tag="C5L36_0A02370"
                     /db_xref="GeneID:40381343"
     mRNA            complement(<515479..>516066)
                     /locus_tag="C5L36_0A02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463250.1"
                     /db_xref="GeneID:40381343"
     CDS             complement(515479..516066)
                     /locus_tag="C5L36_0A02370"
                     /inference="similar to AA sequence:RefSeq:NP_013330.1"
                     /note="PKUD0A02370; similar to Saccharomyces cerevisiae
                     YLR229C (CDC42); ancestral locus Anc_8.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319110.1"
                     /db_xref="GeneID:40381343"
                     /translation="MGTFNNTIKCVVVGDGAVGKTCLLISYTSNQFPEDYVPTVFDNY
                     AVTVMIGDEPYTFGLFDTAGQEDYDRLRPLSYPQTDIFLICFSVVVPSSFDNVKEKWF
                     PEISHHAPHVPCIIVGTQIDLRSDPTALSNLARQHQKPITAQQGERLARELKAVKYDE
                     CSALTQVGLKSLFDDAIVAALEPPVIKKSKKCTIL"
     gene            complement(<516559..>523800)
                     /locus_tag="C5L36_0A02380"
                     /db_xref="GeneID:40381344"
     mRNA            complement(<516559..>523800)
                     /locus_tag="C5L36_0A02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463251.1"
                     /db_xref="GeneID:40381344"
     CDS             complement(516559..523800)
                     /locus_tag="C5L36_0A02380"
                     /note="PKUD0A02380; Pfam Domains:
                     HATPase_c(5.2e-35)|Response_reg(1e-18)|HisKA(7.5e-
                     16)|Pkinase(1.6e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319111.1"
                     /db_xref="GeneID:40381344"
                     /translation="MEDRGYTPSFKPNSPHSRKNNTSNDYFSLRRSGARKNPSLSSTS
                     GENMTSISTESFNLPKYTVNRPSSLGFFLSPILTSPLSSGLDELTPTSPSYANVPLPS
                     ASTKESYHNVLQELERFSYPISNQPVFHPHDSDFINASMADKSHLFDGSLSNNESLEN
                     ILQEYNIKVKLDVENPADVISSYIAIHRDTKNLVIIRFAHNSTLGTVSRLVNSYYITS
                     GLNNRVPRCGFPHFVEKLDWNYRPKTCPSDMEGVLPCTKINFVNDNSSIIAVHPIGEE
                     AVPLVLLDIGIKSDIIKMMLIFFNLLKILKKLNCYGVVVNSLTSSNVLVNQKTLDVYL
                     MGFDFAFSSFLEKIDSPYRGVNKTYSQTYLPFTAPENFNPVLSVDFRADMYSAGCIFY
                     SMLSGRNLKAINTSLLITTVLTTKYQPLHEINNTIDVNFSKVIAKMTEVDPNKRYSSF
                     DHILHDLSLIYFEKTSRVLYQEYKTTTFLRIPITIPSKVIGRDSIMKKLNHLIRKISV
                     ESVTLVGEQGVGKTTILQHLRQSCSINKVFYSYWKCHPRQYYNSRFQTFEFLLSQILK
                     EILGLESSWILFWRNLFTTEVKADLSLLFDTVPEMYKLLGKRYKQLRRSNSKHSFYQE
                     ELDRQYIMKKLVELFARHAGWVLVIENIDEISENEAVLFEQLWDHFQSFEPEELNFTV
                     LSSYTVKKQENIECDQEIPEFLKKKILNLKPLTFDNVEETVGLSLQLYDSQFAWKRIQ
                     SYNARFYFELADRPSVTEQRRVLAESIYRKTRGNPLMVKEILTQVHFSQMEHEEAVDP
                     VEIYYKTFARSKHEVLSGNFLFDSVNDLGLGDSKTVETLQYAACITPCSIFNLYDLLV
                     VTESSLTDTFTALFTGAIVGILEFCSNTAKLPIHLLNEKGFILNELKPDEKEKLLRNV
                     KLQFRHESIKENIMKFQEPGRQEKIHRICGLRLFANIKGRAELTELTKLECYSIAYHF
                     MCSIKIANEDEYPTYLKIIITAGWLAYTAHEYIAALSYFQTSMKLTVDNDILKILEWI
                     EIHICFLKENHEKCIELVDLALEKYCTKPLIAAEFMLSKHRSLTKLNRWEESYEICIK
                     ILNILDFELDLSTMTDSEVDRYTHDVLRPKLPSSISEIRQLLRSNAINTDQRILMIEK
                     VLVELNSFSVYLGKKCLVPFCNIMNVCLFLQYGKSIYCNFSMIVLASIEASIDQIGIK
                     RAHEYCKLGFSMSNYGSMEAIELLNLSFRWYFFLVGSIIEPCEVVEQAFDSIPVVPQV
                     LDSHFSRAILLKFKFHLWVTRGLTVSRLIERTRSLKESTINNKTADEVYDTMYSIVTG
                     ILYVVTGDITYEDYLKYSHNDETLRIYHVKLIFNTNKCFACYIFKRYEMGAEIALNEI
                     TEEWSEELASIELIWARFMSSLLIYSNQRRLINSKQPQTKDQADKVAILMKENRTYFQ
                     EVSTQNPSVFMCVYLIVDSLCMVLDSTNFSQIDILSAFETAVEACSEYQNFLLKAIVT
                     EETARWSGSVSSSNRLANKYFKIAYESYKTWGLKVKVEQLEKELGDIVNGNLDMSHIK
                     HRRRASTSLLISDLNALQQSSMSSFDTIPDHMGMKPNVSLERSVDERSSDSSILAAFR
                     LKNNGSTEGDPLSNTNNTLLSESISGKLETASNGDSVYGDDEPPSSVGIESSSLGFST
                     EDDVGFKNEATSDQEWDNSMVMDLSVRIAQSNDIEDITKTLLGFASRFLKTDYSCLVV
                     NSDSGIPFVKALGMLNDEFRFLDNEIMSLRGDLVPIQLVRECMKRNASIWRDSDKFYF
                     DSNFKNRDPYYENSNCENCFCIPIRSPNGEVIGSLYLESHMRESFTQSRKIKQIEYVC
                     LQSFISISKIDMLEKLQIAKEAAEEATADKTSFLANMSHEIRTPFNSLMSCAVLLLDT
                     KLTKSQRMYVETIKNSALVTLNIVDGILSFSKLEHGSLALDYEPFNLTQCIEDSIQLI
                     GDQISHKSLELVFIDDAYPFNIVFGDKTRVTQVIINLVGNASKFTSEGHILIRSSYTE
                     VSESRYEFKIEVSDSGIGIPKGSKARLFKVFSQLDGSSKRIYGGSGLGLAISKKLAEL
                     MGGDLDYESTEGKGTRFFFTFTTKGEKDKLLDVAKEVQEKKVVMFDTRELSIKSLKIS
                     LHRGGIRPDNILVFPKVDEHTQKKAVGADYIFIFSGLITTKEELEELRLIFKKSILIY
                     QVPFATKIPEFVDFEGDEEERDRNRQGSKSMQNDSQRLVDFILFNPYKIRRISEILNG
                     GVYETDSHKIKNSRTNLSARGRKGPEKIAEKYPLSILIAEDNMINMKVVKLQLQRLGY
                     SSDHAKDGVEVIEKCLEKVEKDGHPYDLVFMDLQMPRKDGFEATVEAKELYGDSIRIV
                     ALSANVYAEEKNRCIKIGMSGFLNKPLLPEALCSQLIDTYYAKHGESSQ"
     gene            526536..526608
                     /locus_tag="C5L36_0Atrna1R"
                     /db_xref="GeneID:40382468"
     tRNA            526536..526608
                     /locus_tag="C5L36_0Atrna1R"
                     /product="tRNA-Arg"
                     /note="PKUD0Atrna1R; codon recognized: AGA"
                     /db_xref="GeneID:40382468"
     gene            <526802..>528241
                     /locus_tag="C5L36_0A02390"
                     /db_xref="GeneID:40381345"
     mRNA            <526802..>528241
                     /locus_tag="C5L36_0A02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463252.1"
                     /db_xref="GeneID:40381345"
     CDS             526802..528241
                     /locus_tag="C5L36_0A02390"
                     /inference="similar to AA sequence:RefSeq:NP_116638.1"
                     /note="PKUD0A02390; similar to Saccharomyces cerevisiae
                     YFL016C (MDJ1); ancestral locus Anc_8.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319112.1"
                     /db_xref="GeneID:40381345"
                     /translation="MNKLMLNALKVRSFNRFNVSSLRLIRQFHATSISRLDDPYKTLG
                     VGKDSSASEIKKAYYKLAKKLHPDVNHEEGADEKFHKIQEAYDILSDTTKKQQYDQFG
                     AAAFNQGGGGGPGAGHPYGGGNPFAGFGGFGGFGQGGGQGGFDINFEDLFGGFTGHQG
                     GRRGGMQHFQGEDIEILKTIPFKDAVFGTEVKVGYSAVVECDACHGLGLKKNRKKSTC
                     RVCNGTGTQTHVLQGGFHMASTCKACNGTGVQINPGDECSSCHGEGVKTQIKQTEVRL
                     PAGIKDGARLRVAGAGDAPHMAKSSSYKLSNGDLIIRIRVQPDPVFKREGRDLICHLD
                     IPMTTAALGGTVEVPTIDGQKIKLRVSAGSQPGKTIEIPNQGVPLNDRPGSPRGSMKV
                     VLGVKTLRPQNATQVALLEAVADAFGDNTAKRMDPDWKPLEGLYKEGKESEGHACEEP
                     NNLKRIESFLSKTFRKILGEKDNGNEKKD"
     gene            <529127..>531115
                     /locus_tag="C5L36_0A02400"
                     /db_xref="GeneID:40381346"
     mRNA            <529127..>531115
                     /locus_tag="C5L36_0A02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463253.1"
                     /db_xref="GeneID:40381346"
     CDS             529127..531115
                     /locus_tag="C5L36_0A02400"
                     /note="PKUD0A02400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319113.1"
                     /db_xref="GeneID:40381346"
                     /translation="MFPSLDVIQENFEDVPLDFNTQAQQTFYNVNRPNSSRSLNNISK
                     SKLSRFNYSNSSFSNSSKELLLTPSQRLKIIKHQRLEKSQDKLSTNYPENFNTSDFLS
                     DDVIPDDMIVFDVPSLYSLQTLSTNKLKARKPSLRRRNSVSSSTASTTETIITNTHNI
                     NQRIEESTGVVNANSSMQVVQNRTSLLSNSTHSSVVSSPATRTSSIFSHTSDVSDFRS
                     SIEEASSPLSKEVKLLSLNKDIKLEESLQRMTMLKNMSKLSQIDSPTPDTEKIHYLTT
                     TRQQNLPPKTKYEILKHEKDYHDLLEAELYHEQENLRKHQLLQEKLKSQRERDEKSWK
                     KVIDNYDKLVKLPQTRELWWRYVPSKYRYKIWERQIISVKKTTIEAELIIESLEKASE
                     IINDACDFKIIKDELRKKQKEKEYQNIRENISFIEKVSYRLQFAFPELHIFQFGEHFD
                     NVLHIAVAFERLKTKNRKLEPIMIESLINLICVFYYVFQDLFTSLNCFVSLILRKLPF
                     AMLTASDADIPSTLAEDLQMENTQPPYLKDIKDQCDKYLLQLIPPLFNHFVQADINPL
                     KVIQGLTCCFFTNQLEFDIVLRVIDIYLFEGDIMLLRTSLALLKRISYKLYGSNEEVY
                     SLLNSNKLFKITPTLNVGETTDFINEIRNVLKKEKTQN"
     gene            complement(<531265..>533403)
                     /locus_tag="C5L36_0A02410"
                     /db_xref="GeneID:40381347"
     mRNA            complement(<531265..>533403)
                     /locus_tag="C5L36_0A02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463254.1"
                     /db_xref="GeneID:40381347"
     CDS             complement(531265..533403)
                     /locus_tag="C5L36_0A02410"
                     /inference="similar to AA sequence:RefSeq:NP_013439.1"
                     /note="PKUD0A02410; similar to Saccharomyces cerevisiae
                     YLR335W (NUP2); ancestral locus Anc_4.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319114.1"
                     /db_xref="GeneID:40381347"
                     /translation="MSGKRTKQQLTKDQVLARGADVDSSDGESQMDTPQVASAEVMAT
                     RKIAGANRRFMKRATRPSADANAALSIKQNKTSAIFNGDVTYDSLTISQMKSLNANFL
                     KSVNDGINKNPIADFSEICSKYLDYVKKVQEKKIDVKRLDVPKVEIKADVIKSADDKT
                     KPNPFAMFASLNKSTEPESNQVTVSKAEISHQSSQPIKVEADPDSDNSDDSEKKQVEI
                     KGPEFKIGELPKAKGGFKFGYVPPKDDSDSEDIEIKGPTFSTNVKISDAVFKFPTETN
                     VKKEEVKPAFSFGKPEDKNEETKPAFSFGKPEDKKEETKPAFSFGKPEDKKEETKPAF
                     SFGKPEDKKEETKPAFSFGKPEDKKEETKPAFSFGKPEDKKEETKPAFSFGKPEDKKE
                     ETKPAFSFGKPEDKKEETKPAFSFGKPEDKKEETKPAFSFGKPEDKKEETKPAFSFGK
                     PEDKKEETKPAFSFGKPEDKKEETKPAFTFGSNTATQPSNTTSAFQFGSSNSSSGTSA
                     PSYAFSFGKKEGSKSDTSNPFNFGSNATFNNTSSSVFNFTAPSAKQTQSANGEDRESS
                     KADVDPDANEAEKDTVQGSFAVVNLTKKVDVQNGEENEDVLILKRSKITKFNTETKAY
                     DNVGVGEFKILKNVSNSKSRILVRSDGSGNVLLNVRVLPQMKYELMGEKKNMLRIPSV
                     TSDGNLETYIARVKTSADGEELLKTIQSCQ"
     gene            <534218..>534538
                     /locus_tag="C5L36_0A02420"
                     /db_xref="GeneID:40381348"
     mRNA            <534218..>534538
                     /locus_tag="C5L36_0A02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463255.1"
                     /db_xref="GeneID:40381348"
     CDS             534218..534538
                     /locus_tag="C5L36_0A02420"
                     /inference="similar to AA sequence:RefSeq:NP_011541.1"
                     /note="PKUD0A02420; similar to Saccharomyces cerevisiae
                     YGR027C (RPS25A) and YLR333C (RPS25B); ancestral locus
                     Anc_4.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319115.1"
                     /db_xref="GeneID:40381348"
                     /translation="MPPKAQQSKAAKAAAAMAGGKKSKKKWSKGKVKDKAQHLVILDQ
                     EKYDRILKDVPTYRFVSVSVLVDRLKIGGSLARVALRQLEEDGVIKAVSKHSKQMIYT
                     RATN"
     gene            complement(<535275..>536003)
                     /locus_tag="C5L36_0A02430"
                     /db_xref="GeneID:40381349"
     mRNA            complement(<535275..>536003)
                     /locus_tag="C5L36_0A02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463256.1"
                     /db_xref="GeneID:40381349"
     CDS             complement(535275..536003)
                     /locus_tag="C5L36_0A02430"
                     /inference="similar to AA sequence:RefSeq:NP_011540.3"
                     /note="PKUD0A02430; similar to Saccharomyces cerevisiae
                     YGR026W; ancestral locus Anc_4.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319116.1"
                     /db_xref="GeneID:40381349"
                     /translation="MTASPTPETTSPVGQNRSKKLRKIVKPGKPIAKTIWLTGHAISL
                     CCGFSYSLFYFTRSRNWISWILYKFTLFGVLLAYSISIQNQYPIKSLPHWSALISSDN
                     FQYLLLGTFWIFNRNSFFKILPFLIISLLQLSQNFKIQSILKFEKKLSILALYDELFL
                     FVLLTFDTLLMRGTSGYGLVIYSLFMWLKLLQSEDTRYFIYDNIKKLDALMSKIKNEK
                     VQKAWRKVKKFLSLKQANFEQKYL"
     gene            <536678..>538126
                     /locus_tag="C5L36_0A02440"
                     /db_xref="GeneID:40381350"
     mRNA            <536678..>538126
                     /locus_tag="C5L36_0A02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463257.1"
                     /db_xref="GeneID:40381350"
     CDS             536678..538126
                     /locus_tag="C5L36_0A02440"
                     /inference="similar to AA sequence:RefSeq:NP_013463.1"
                     /note="PKUD0A02440; similar to Saccharomyces cerevisiae
                     YLR359W (ADE13); ancestral locus Anc_4.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319117.1"
                     /db_xref="GeneID:40381350"
                     /translation="MSQNDSYLTPLSSRYASKEMSHIFSIRNRFSTWRKLWYNLAIAE
                     KELGLDIITDEAIAQMKEHLVITDEEIEAAKIEESKVRHDVMAHVHVFGETCPAASGI
                     IHLGATSCFVTDNADLIFLRDAYDILIAKLVNVINRLAKFAYEYKDLPVLGWTHFQPA
                     QLTTVGKRATLWLQELLWDLRNFQRARDDLGLRGVKGTTGTQASFLSLFHGNHSKVEE
                     LDERVVELLGFKYAYPCTGQTYSRKIDIDAIYPLTSFGSSCHKMATDIRLLANLKEIE
                     EPFEKSQIGSSAMAYKRNPMRSERVCSLARHLGSLFQDTFQTASIQWFERTLDDSAIR
                     RISIPEAFLTADILLSTLINITDGLVVYPKVIERRIKSELPFMATENIIMAMVEKGGS
                     RQECHEEIRVLSHQASAVVKQQGGDNDLIERIKNTEYFRPIWNDLDSLLDPSTFIGRA
                     PQQTEKFVNVTVKEALRDYQKLINDQEVKLSV"
     gene            <539272..>542814
                     /locus_tag="C5L36_0A02450"
                     /db_xref="GeneID:40381351"
     mRNA            <539272..>542814
                     /locus_tag="C5L36_0A02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463258.1"
                     /db_xref="GeneID:40381351"
     CDS             539272..542814
                     /locus_tag="C5L36_0A02450"
                     /note="PKUD0A02450; Pfam Domains:
                     PYC_OADA(1.4e-120)|CPSase_L_D2(1e-119)|Biotin_carb_C(5.1e-
                     63)|CPSase_L_chain(7e-47)|HMGL-like(4.8e-
                     25)|Biotin_lipoyl(7.9e-25)|HlyD(1.5e-10)|RimK(9.9e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319118.1"
                     /db_xref="GeneID:40381351"
                     /translation="MSTVEDHSSLHKLRKESEILSNANKILVANRGEIPIRIFRSAHE
                     LSMHTVAIYSHEDRLSMHRLKADEAYAIGKTGQYSPVQAYLQIDEIIKIAKEHDVSMI
                     HPGYGFLSENSEFAKKVEESGMIWVGPPAEVIDSVGDKVSARNLAIKCDVPVVPGTDG
                     PIEDIEQAKQFVEQYGYPVIIKAAFGGGGRGMRVVREGDDIVDAFQRASSEAKSAFGN
                     GTCFIERFLDKPKHIEVQLLADNYGNTIHLFERDCSVQRRHQKVVEIAPAKTLPVEVR
                     NAILKDAVTLAKTANYRNAGTAEFLVDSQNRHYFIEINPRIQVEHTITEEITGVDIVA
                     AQIQIAAGASLEQLGLLQNKITTRGFAIQCRITTEDPAKNFAPDTGKIEVYRSAGGNG
                     VRLDGGNGFAGAVISPHYDSMLVKCSTSGSNYEIARRKMIRALVEFRIRGVKTNIPFL
                     LALLTHPVFISGDCWTTFIDDTPSLFEMVSSKNRAQKLLAYIGDLCVNGSSIKGQIGF
                     PKLNKEAEIPDLLDPNDEVIDVSKPSTNGLRPYLLKYGPDAFSKKVREFDGCMIMDTT
                     WRDAHQSLLATRVRTIDLLRIAPTTSHALQNAFALECWGGATFDVAMRFLYEDPWERL
                     RQLRKAVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQ
                     LKVGVDAVKKAGGVVEATVCYSGDMLIPGKKYNLDYYLETVGKIVEMGTHILGIKDMA
                     GTLKPKAAKLLIGSIRSKYPDLVIHVHTHDSAGTGISTYVACALAGADIVDCAINSMS
                     GLTSQPSMSAFIAALDGDIETGVPEHFARQLDAYWAEMRLLYSCFEADLKGPDPEVYK
                     HEIPGGQLTNLIFQAQQVGLGEQWEETKKKYEDANMLLGDIVKVTPTSKVVGDLAQFM
                     VSNKLEKEDVEKLANELDFPDSVLDFFEGLMGTPYGGFPEPLRTNVISGKRRKLKGRP
                     GLELEPFNLEEIRENLVSRFGPGITECDVASYNMYPKVYEQYRKVVEKYGDLSVLPTK
                     AFLAPPTIGEEVHVEIEQGKTLIIKLLAISDLSKSHGTREVYFELNGEMRKVTIEDKT
                     AAIETVTRAKADGHNPNEVGAPMAGVVVEVRVKHGTEVKKGDPLAVLSAMKMEMVISA
                     PVSGRVGEVFVNEGDSVDMGDLLVKIAKDEAPAA"
     gene            complement(<543012..>543371)
                     /locus_tag="C5L36_0A02455"
                     /db_xref="GeneID:40381352"
     mRNA            complement(<543012..>543371)
                     /locus_tag="C5L36_0A02455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463259.1"
                     /db_xref="GeneID:40381352"
     CDS             complement(543012..543371)
                     /locus_tag="C5L36_0A02455"
                     /note="PKUD0A02455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319119.1"
                     /db_xref="GeneID:40381352"
                     /translation="MNRQHKTAVSIFLVDLAHDNSKCSMSLIRQEIEEIKNFNATLEA
                     TLSSLTTISDNLSVFANNLDSSKKLSNIYTDIYDHDRRLQQNINNIGICFDERKLDED
                     IKDLEQQIESLKSQLSK"
     gene            <543503..>543985
                     /locus_tag="C5L36_0A02460"
                     /db_xref="GeneID:40381353"
     mRNA            <543503..>543985
                     /locus_tag="C5L36_0A02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463260.1"
                     /db_xref="GeneID:40381353"
     CDS             543503..543985
                     /locus_tag="C5L36_0A02460"
                     /inference="similar to AA sequence:RefSeq:NP_013599.1"
                     /note="PKUD0A02460; similar to Saccharomyces cerevisiae
                     YML108W; ancestral locus Anc_8.830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319120.1"
                     /db_xref="GeneID:40381353"
                     /translation="MSDEEYIVRREVEYGEEEEQSQLPNPSEDSVFDNEFRILILANT
                     TINKDQNGNNRVNVEESDMEEILIRQVRTLDDVNEFFDAFDSEIAQPNEGHLKYEVGS
                     DGLCVVLVDSVKIKDDAVTFINRFIKRYQGSDDGNNINHKEEEEEEEEEESRDSKRRK
                     "
     gene            <544417..>546105
                     /locus_tag="C5L36_0A02470"
                     /db_xref="GeneID:40381354"
     mRNA            <544417..>546105
                     /locus_tag="C5L36_0A02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463261.1"
                     /db_xref="GeneID:40381354"
     CDS             544417..546105
                     /locus_tag="C5L36_0A02470"
                     /inference="similar to AA sequence:RefSeq:NP_009779.3"
                     /note="PKUD0A02470; similar to Saccharomyces cerevisiae
                     YBR220C; ancestral locus Anc_6.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319121.1"
                     /db_xref="GeneID:40381354"
                     /translation="MSKHRRSHSPTTGSSGSTFIDFDIDESQYIQTFAENKPLTNEDA
                     ALPKQDYSRFFLLVLLYFIQGIPIGLAFGSVPFLLKSSNLSYSQVGLFSLATYPYSLK
                     IFWSPIVDSCYISTVGKRRSWIIPIQVVSGLSLIYLGNKIDIWMSDDSLILRNLSLIS
                     GCFFFLILLCATQDIAVDGWALTILSKNALSYASTAQTIGLNTGYFVSFTIFLAFNSK
                     DFMNKYFRKTPLDRGFISLGEYMVLAGLLYLAITAFIVIFIPENPPVHKSDGLEYAKD
                     EGDDSIKTVYHKMFQVFKLKNVQTFIILHLISKIAFQANEGATNLKLLDKGFSREDLA
                     ITVLIDFPFEIIFGYYAAQWSNSARPLKPWLYGYLGRIFAAALGQILVWSFPKSGKVG
                     STYFLFVIVQHLLSSFMSTIQFVSICSFHTKIADPLIGGTYMTTLNTLSNLGGQWPKI
                     IALYLIDSFSSSICVENAFAPDSKSRANIFKDKPYYQCYQSDLKTQCIDNGGSCISIK
                     DGYYTTNFICIVLGLVLYYGWIRKTAMHLETLPIGAWRVKEKGNKNGIRSHLPL"
     gene            complement(<546255..>549317)
                     /locus_tag="C5L36_0A02480"
                     /db_xref="GeneID:40381355"
     mRNA            complement(<546255..>549317)
                     /locus_tag="C5L36_0A02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463262.1"
                     /db_xref="GeneID:40381355"
     CDS             complement(546255..549317)
                     /locus_tag="C5L36_0A02480"
                     /inference="similar to AA sequence:RefSeq:NP_015210.1"
                     /note="PKUD0A02480; similar to Saccharomyces cerevisiae
                     YPL115C (BEM3); ancestral locus Anc_8.605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319122.1"
                     /db_xref="GeneID:40381355"
                     /translation="MDPLEHPVFSSSRHNDSVSTLNNSNNNTEQPMDALQQENEVLRK
                     KITYLQKIIELKDSTINELNAKLLLYKSGRGDEENVQEFGDISSQVEAASHVEKESDP
                     TNDKYSENPLVSPTLTDNSVSRTTETMWEIPQRNSNRSLRKEIKSSPALSASKQQQPE
                     AEEHQNKTHAPHLSISSITSSHYSESDDQGIQLEIDEDYQDSQVPNASTDENNDSTQN
                     MSTSDTIDKALKLDLKNGNLTLGSSPRRLSPHRKSFSFEGLQITSNESSHQNADESYS
                     AKSDDFNFNQVNSPDDPVYKKLTQESLYSTNSSPITEYFNQKNNNEVSTPYVNVPVRV
                     SSPSPMGISLSSNSPKLLNPSTSFQNRQPETGPVEIPLPQTPSNPPHLPVHPTSSTPN
                     NNRNKVDSIVPLQKRVTSADDSEKFLLNSLNHAVIRIESLVDPSNFSTQSDPRDPHSN
                     SLKRSSYKVSFMVYTDENAPTLTPIYRVRKSYIELLMMDKAIRPQVPNLPLLPDISYV
                     SCSNFRYWASSKNAIQTYIIHLLNLFKNQKPFNPNHPVWKNFSNYFEFKMDLNDLENP
                     EYSVLHLQNKISYLLYVKKNFGGRTYDFINMVFPSSSNVLTINFVLSKTKETLQKEEI
                     QLTSKDQEIVVKKRKKLATKTWVFFAESKYDADDLCKRLLTWIGNETLGPDEEEMEIN
                     SSDTNEAEELLKSSTEQSLSSPSLNGPWKLFKKTNKLQSQPSLYTSPRQSPSTFSSIG
                     SSVPGSPSRDSIPSSSHRSRSSTTAVQHSDVLNFKAMPYESNKLSVDNSNSNNSLRSP
                     IKQGNPRQGEIFFQPIDDSPKYFKSTLQHSYDLCPKYKLYGFNVPSIVYQCITYLYQQ
                     GGEGFEGIFRLNGMMSEVNRIQEIFNEEHDCDLSKLTPNPDVHSIATLLKRYLRYLQD
                     RLISDDITFELCSIINKSENKGDDGSLSSDAIEQFKSVFNRLPELNRNSLYALFRYLG
                     DVLKMGKHNKMSVSAMSVLMGPNLTQKDGGGQICAVLLENFSTIFQRN"
     gene            complement(<549709..>551052)
                     /locus_tag="C5L36_0A02490"
                     /db_xref="GeneID:40381356"
     mRNA            complement(<549709..>551052)
                     /locus_tag="C5L36_0A02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463263.1"
                     /db_xref="GeneID:40381356"
     CDS             complement(549709..551052)
                     /locus_tag="C5L36_0A02490"
                     /inference="similar to AA sequence:RefSeq:NP_014838.3"
                     /note="PKUD0A02490; similar to Saccharomyces cerevisiae
                     YOR195W (SLK19); ancestral locus Anc_8.604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319123.1"
                     /db_xref="GeneID:40381356"
                     /translation="METPPRKRQKVSLQDSSSPLVETPGRGVEFGDISDGGHERRSPS
                     KRMNSHEDVHTNTVLLEEEINVEALDENNGPNAPVIAESVDEKDDIGKSKNTNTHKDD
                     LENNQNGTDDDHVEEKSDTHHSISITALSPLKLGSATEANCSKGSNEEEDMEQEHSPE
                     PAFKHLISRFNSIVDDLSNLNETLTSVHEAENVVSSTLIEFAQLQNKYDSTINELNIK
                     LQKSLTTINGLNNEVASFKQKVDNMHLTIEQSQLDNQKLSSSNELLMTECETLKSTIE
                     KLNSEIAAEKNKRATINSKVQQLKESAEPILSSYASIQQQLVELRNENTQLKGTINEQ
                     QVKISSFDDTLKQELESLAQELYIQYAEKHESKISKLRAAYETKYSKKHALFNEKLKL
                     LQEQQNTLQKELSHVKQRLQVETNEKHQLVKLWDEYVALDKKDVDQMSNFVKRLK"
     gene            <551263..>552324
                     /locus_tag="C5L36_0A02500"
                     /db_xref="GeneID:40381357"
     mRNA            <551263..>552324
                     /locus_tag="C5L36_0A02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463264.1"
                     /db_xref="GeneID:40381357"
     CDS             551263..552324
                     /locus_tag="C5L36_0A02500"
                     /inference="similar to AA sequence:RefSeq:NP_014837.1"
                     /note="PKUD0A02500; similar to Saccharomyces cerevisiae
                     YOR194C (TOA1); ancestral locus Anc_8.603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319124.1"
                     /db_xref="GeneID:40381357"
                     /translation="MSNSACAELYANIIEEVIIESRQDFENAGIDEQTLQDLRNIWKQ
                     RLAAAKVAPLGWGDDDDDDDDDDDGKDLGVEQASEDISSAEIAPNMAVTVDNPGEQKN
                     VPLPQSQQQQILQDAHQLQNFQELQQQQQQQQQQHQQQQQDLQLQKTTELDPQISNPQ
                     LPNLTNHTSLQPTQSHNQTFDMSFIGTQNNGDGIKTEENSSVKKEGGDESVPPFGFPT
                     SLPTSNKNNLQDPTVTFSIRNNQLDGSFDFSAPKENANDSDSDDDLGSDLGADSDAIN
                     SDLDDSDDEDDDSNGEEDDEDGENGGANGDIEQNIMLCLYDRVQRVRNRWKCSLKDGL
                     MNINGKDYVFQKATGDSEW"
     gene            <552661..>553269
                     /locus_tag="C5L36_0A02510"
                     /db_xref="GeneID:40381358"
     mRNA            <552661..>553269
                     /locus_tag="C5L36_0A02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463265.1"
                     /db_xref="GeneID:40381358"
     CDS             552661..553269
                     /locus_tag="C5L36_0A02510"
                     /inference="similar to AA sequence:RefSeq:NP_015226.1"
                     /note="PKUD0A02510; similar to Saccharomyces cerevisiae
                     YPL099C (AIM43); ancestral locus Anc_8.579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319125.1"
                     /db_xref="GeneID:40381358"
                     /translation="MKFNFPESVEKELAQQAKQEQQRTNGKITFSQHTLPVQQEDKTN
                     VTQKMTPKELEHQQRKIENISSKLYTPQSPLTPEFRSKSSEIEERLQRIKTRFDSIKK
                     KEEARIAQIQREAWLRYSHTSKPTLQDFKRPLTSFFLFASAIYITLQFSWYALEREKY
                     IEEMENKQDKIVNELNEALREQKQILDQYNSMGGARKWWKLW"
     gene            complement(<553351..>554610)
                     /locus_tag="C5L36_0A02520"
                     /db_xref="GeneID:40381359"
     mRNA            complement(<553351..>554610)
                     /locus_tag="C5L36_0A02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463266.1"
                     /db_xref="GeneID:40381359"
     CDS             complement(553351..554610)
                     /locus_tag="C5L36_0A02520"
                     /inference="similar to AA sequence:RefSeq:NP_011801.1"
                     /note="PKUD0A02520; similar to Saccharomyces cerevisiae
                     YGR285C (ZUO1); ancestral locus Anc_5.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319126.1"
                     /db_xref="GeneID:40381359"
                     /translation="MTFTALASYSTAVRRPIEPVGPYFLAHATRTIKGHSWSEFEKIE
                     AEKNVVTVEAKDSDEDLFDESIDDEELLNHDPRDWKSCDLYAALGLSKLRVKATPEQI
                     VKAHRRAVLQHHPDKKSSAGGSLTQDGFFKIIQKAYETLMDPIKRRQFDSVDEFANIS
                     PPSTKPADEDFYAAWGPVFLNEARFSNKQPVPTLGDASSSKEEVEAFYKFWNNFDSWR
                     TFEWLDEDVPDDSANRDHKRYIEKKNNNSRKKKKTEDNKRLSDLVKRAQSEDPRIKAF
                     KEAEKEEKARKKWEREAGARKAAEDAKAKAEAEAKAKADAEAAAKAEKENAKKAKEAA
                     KAAKKKNKRAIRAAAKDNEYFGDADKSASIDADIDLLIESFDDVKLGDVAGKLKGVSA
                     DAAKAVLSQVAAEQTAAGKVSSLSYFN"
     gene            <554801..>555526
                     /locus_tag="C5L36_0A02530"
                     /db_xref="GeneID:40381360"
     mRNA            <554801..>555526
                     /locus_tag="C5L36_0A02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463267.1"
                     /db_xref="GeneID:40381360"
     CDS             554801..555526
                     /locus_tag="C5L36_0A02530"
                     /inference="similar to AA sequence:RefSeq:NP_014043.1"
                     /note="PKUD0A02530; similar to Saccharomyces cerevisiae
                     YMR312W (ELP6); ancestral locus Anc_5.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319127.1"
                     /db_xref="GeneID:40381360"
                     /translation="MASTSDLQQQALTFYSTKDGSLLSDFNTLSLILHDSSNCPAWLI
                     TGIIQQALSKDNECYLSPQAPKVTKATIPTFLYSFTNTEQTYSKCFQKYINSNKDFLK
                     FTSYLSDSSKDPSKFSTDVLQDVGKVEEKPFVIIENPELLLSIVPGMTIIQLLSQLNE
                     IQKHTTLYIVTSTSPNKSSLLSMLLHRSSLIITLTALTTGRADDMSGTLSVSPGPIKS
                     KQNVSDRQYSYLVSTNNVKLFYK"
     gene            complement(555654..555727)
                     /locus_tag="C5L36_0Atrna1V"
                     /db_xref="GeneID:40382471"
     tRNA            complement(555654..555727)
                     /locus_tag="C5L36_0Atrna1V"
                     /product="tRNA-Val"
                     /note="PKUD0Atrna1V; codon recognized: GUU"
                     /db_xref="GeneID:40382471"
     gene            complement(<558299..>559951)
                     /locus_tag="C5L36_0A02540"
                     /db_xref="GeneID:40381361"
     mRNA            complement(<558299..>559951)
                     /locus_tag="C5L36_0A02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463268.1"
                     /db_xref="GeneID:40381361"
     CDS             complement(558299..559951)
                     /locus_tag="C5L36_0A02540"
                     /inference="similar to AA sequence:RefSeq:NP_014044.1"
                     /note="PKUD0A02540; similar to Saccharomyces cerevisiae
                     YMR313C (TGL3); ancestral locus Anc_5.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319128.1"
                     /db_xref="GeneID:40381361"
                     /translation="MLIIHKHSSIHGSTVENFLFSVIIWILTHIPLPILKLILLLFDV
                     FVYWFGSIYDKFKNSPDRILLYKLNHSTSWSEFSKTAFDLDNYFNNDIWKNNLVSSKY
                     DYVLIQERLHDLRNARLSNNFQHMLSLLRAGMLRNLGGISNKSLYNRTYIGTKSLIEQ
                     YNKEVANCLESLDKDPFIDNQLKLDFYHDAKTTLGATALCLHGGSLFGMGHIGVVKSL
                     LDQNLLPNVLVGSGVGSVVGALVGCLEKEELVEILVNLKNVMQEEGYGLKPKNCNDPI
                     ESTQIGLKWIENIKKGVTKEMKLFIDFVLSKVGGMTFKQAHEKTGKTFNILVYPKSSK
                     LPTLLNYLSTPYITMESAIRCSLGTGVLKDKIPTLEIKFRGDITKYSNVQCEFQPPYQ
                     VRGQSIELKNSPYNRITEMFNVNHFVISISRPYLASFVSMRWRRIYNYNSLLKKLLNI
                     INIELKHRIRMLNRFGLLNTSLRWLLVDEKSVLVDTNHIAIIPTGTRWILWDFIDLFV
                     QNKSVMNYWIECGERSVWSMHSLLETRSRAEFLLDEYFQKYR"
     gene            <560170..>562053
                     /locus_tag="C5L36_0A02550"
                     /db_xref="GeneID:40381362"
     mRNA            <560170..>562053
                     /locus_tag="C5L36_0A02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463269.1"
                     /db_xref="GeneID:40381362"
     CDS             560170..562053
                     /locus_tag="C5L36_0A02550"
                     /note="PKUD0A02550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319129.1"
                     /db_xref="GeneID:40381362"
                     /translation="MIYRSLCRGKVIKRETCLRLFSASRVIYINPFLPIDPTEIATDL
                     QTEDENKQKQCVQKAKGRIKHMLSQQRTINGKKNNSGSSGSGGPGGNEGGKNPDKNRK
                     KRGWKSFWNSFSSLSKKLAEAGLITLASLGILVIGGMAYHKLYKQNVLWKIEESFNTG
                     DSSLMIMQNREGIENGDGVLDTQLWAERLHQKLIDEIIKGEKRGRYYLLLGEKGTGKT
                     STVMESIKRVNGKDCAIIDCSSDVEIMRLRIGSALNFEFFEDYIGSLFSMKGPRETTP
                     ILDIERAFMKLEKILTERKKETSKPLILIFNNSHLIDSSLVELLQQKAEYFSSSGMLT
                     TMFISDDYWLFEKLKILATRLQLINFEDAKFNSSIKIINRARLKRFNEFLSEDECKKI
                     YTLIGGRPQHLNHVVSSQSYLDACEEVIQSEATWFLNNCTLLGADMDDDVVESGKFST
                     SAMLLMRELVELDRKKKKTKNKGAEVDPDDQVHLPELPLWRARQIMTRPDYIQEYDRR
                     NIFTIDAHSNVRADSVPMMQAFHRIASSPNFDSLLQETIDRVSEIESLQRTREIVSKD
                     LGHGKKYKLSTAREPGSYYITLEDESENAPFEMKVEDHEGERKKWWKRRWEAYLAGKD
                     SKE"
     gene            <563018..>563599
                     /locus_tag="C5L36_0A02560"
                     /db_xref="GeneID:40381363"
     mRNA            <563018..>563599
                     /locus_tag="C5L36_0A02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463270.1"
                     /db_xref="GeneID:40381363"
     CDS             563018..563599
                     /locus_tag="C5L36_0A02560"
                     /inference="similar to AA sequence:RefSeq:NP_010928.1"
                     /note="PKUD0A02560; similar to Saccharomyces cerevisiae
                     YER012W (PRE1); ancestral locus Anc_7.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319130.1"
                     /db_xref="GeneID:40381363"
                     /translation="MDIILGIRLKDCTLLATSKAFTRGISVLKATDDKTCDLNTHNVI
                     GYTGESGDTTQFAEYIKGNVQLFGLREGYDMEPQEIASFIRHELATSLRSRKPYQVNL
                     IHAGTTSKGEGFLSMIDYIGTRCDLPYVAHGYAAFYTMSLLDHHYREDITFDEGLKLI
                     KLCEQELNMRMPIEFKGLNVKCVSKDGIRIVDY"
     gene            complement(<563709..>565598)
                     /locus_tag="C5L36_0A02570"
                     /db_xref="GeneID:40381364"
     mRNA            complement(<563709..>565598)
                     /locus_tag="C5L36_0A02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463271.1"
                     /db_xref="GeneID:40381364"
     CDS             complement(563709..565598)
                     /locus_tag="C5L36_0A02570"
                     /inference="similar to AA sequence:RefSeq:NP_116697.3"
                     /note="PKUD0A02570; similar to Saccharomyces cerevisiae
                     YFR039C (YFR039C) and YGL228W (SHE10); ancestral locus
                     Anc_3.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319131.1"
                     /db_xref="GeneID:40381364"
                     /translation="MNIFCVFRSLLILFTGMFVLKHIHRSCPVSEEFTGKFTTDPVCY
                     SAHQIHHFSEPVLLFVYKNYESSPIKAVVDDSLVKLSPYTIPARNTWNKVHEDLAEFR
                     QTHEGYIVEQTYETANKVITVTTDFINNVVIPHSAKVVHSIYQSSKIILRQIQLQMYI
                     NYNIIIRPSLIKLKIKFLESSLGERCLLAFHSHYIQSILYHIEAIYAKVAYALKYLVA
                     KSKDTYESAMEFKDSDTYQKIQFKKKFLVDYMQYLPDFSKSETTSQSTTINVEPTNIP
                     TSEKFNNLLKTTIESASKDFNLEIDQLNERFINKLHNEFQPALQQLSRDLTSGYDNLE
                     KMIDNVNRFKSADHESHVSREIYRSAHRIKGEEVDAQIEEIKSKVDKFVESYLDEVLR
                     VRVGILETLEEFADSTLNAYANEIIANGDDWEEWKKYKAIKKELVDFRDKLIIEKPNE
                     SFNKALNALKHEIYVLHNEAGSYLAILRAKANVEFQQREAEERENERKAKEEQRIVTP
                     EQMGKKQEDIEGKADEGTKMEKEELRKQDKTKAQAALKKRAKEKEAARKADKARKAKL
                     EYYNKKQEQEKDQHVEMAIDTSKFSKSIVRGDADKHTTSIVEIVDEARAAPSFEKDET
                     KVIIS"
     gene            complement(<565928..>566524)
                     /locus_tag="C5L36_0A02580"
                     /db_xref="GeneID:40381365"
     mRNA            complement(<565928..>566524)
                     /locus_tag="C5L36_0A02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463272.1"
                     /db_xref="GeneID:40381365"
     CDS             complement(565928..566524)
                     /locus_tag="C5L36_0A02580"
                     /note="PKUD0A02580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319132.1"
                     /db_xref="GeneID:40381365"
                     /translation="MSLFATIKCYLACAVLAWAIYHVSTECPLSSPLPLPHGEKDAMC
                     RHAHSAYVYLKPYTDPWTPYISEGYEVVHSFVEEKWTQLKDRLDNEELLNEKIVKEDD
                     KDSGVTTPAEDVVEPTHDYTGSNVIPQTPEDVQKENDIETTEENEPIPQETVIVENTE
                     QAESEEKKHDLKKDIKILAEEVIVDEAVVAAEAVVNGL"
     gene            <567031..>569595
                     /locus_tag="C5L36_0A02590"
                     /db_xref="GeneID:40381366"
     mRNA            <567031..>569595
                     /locus_tag="C5L36_0A02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463273.1"
                     /db_xref="GeneID:40381366"
     CDS             567031..569595
                     /locus_tag="C5L36_0A02590"
                     /inference="similar to AA sequence:RefSeq:NP_009877.1"
                     /note="PKUD0A02590; similar to Saccharomyces cerevisiae
                     YCL054W (SPB1); ancestral locus Anc_1.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319133.1"
                     /db_xref="GeneID:40381366"
                     /translation="MGRVQKKNAKGRLDKYYYLAKEKGYRARSSFKILQINEKYGHFL
                     ESSRVVIDLCAAPGSWCQVATQLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRS
                     RLAGYMKSWKADTVMHDGAPNVGLNWVQDAYTQSQLTLQALKLAVEHLNVGGTFVTKV
                     FRSKDYNNLMWVFNQLFEKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRFLDPKHV
                     FEEVEDDKSQNMEAKVFNPEIKRRQRQGYEEGDYTLFHPMPLMEWVKLEDEVINTLGR
                     VSRFDIDTEDPEWKILKKMKQTTKEFFECCKDLKVLGKKDFKMLLKWRKHARNELGII
                     DPNDEKKRQKEGLVEVEELDEDEKIDKELNEIKEKLRLKNKREKRRSNLQKQKEIQRM
                     QMNMLTDMQIGIDAANIGSESLFNLKTAEKTGEIDQLAKGKKTIIFNNSTGDDTNMFI
                     DDSNGKPQHGRELMDRDNADTLEDELNSMYDSYKERKKMRDAKLAAKEARGGDDDAWE
                     GIKENEDELESSDDGEEVDDSDSELDTDDDEAISNLVATIERKKKNSLSSKASSFFSD
                     SIFQDVDLNIASSGKGETKILKEKTRVRRPRAEESEMVMNTENEGGEEADSDEDEKSS
                     DSDDGFEIVPNEYHDIENADDIDTDSEDEMAERARESHKADIDIATAQAMTMAHELAL
                     GRKTKKDLVNDGFNKYSFRDKEGLPDWFIEEEDTHSKINRPITKEAALAIKEKMKQLN
                     ARPIKKVLEAQGRKKMRAIKRLEKLKKKSDGIMDDEGKSEADKAAEIQALMGKMTKKQ
                     KTKPKVTLVVATGANKRMAGRPKGVKGKYKMVDGVLKNEMRALRRIAKKNKKKGKK"
     gene            complement(<569745..>570599)
                     /locus_tag="C5L36_0A02600"
                     /db_xref="GeneID:40381367"
     mRNA            complement(<569745..>570599)
                     /locus_tag="C5L36_0A02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463274.1"
                     /db_xref="GeneID:40381367"
     CDS             complement(569745..570599)
                     /locus_tag="C5L36_0A02600"
                     /inference="similar to AA sequence:RefSeq:NP_012152.3"
                     /note="PKUD0A02600; similar to Saccharomyces cerevisiae
                     YIL114C (POR2) and YNL055C (POR1); ancestral locus
                     Anc_2.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319134.1"
                     /db_xref="GeneID:40381367"
                     /translation="MAPIAFSDIAKPSNDIVSKDFFHQAPFSVDVKTTAPNGVQFTTK
                     AKSTGDNVAASLESKYSDKSTGLALTQGWDTKNVLSTKLELADAITPGLKTELVSALV
                     PGVSKSVKFNTYFATDSINARAFVDLLKGPVFNADLTFGQDGLTTGGALTYDVKSAKL
                     SSYTAAIGYKASAYAVALVASNNLSVFTAGYYHRVCPQLEVGTKATYDSKSTASGNPV
                     AVELASKYQLDPTAFVKAKIADSGLVSLAYQQDLNKGVKLGFGTAFDALKFGEAAHKL
                     GVSLSFSA"
     gene            <571042..>572331
                     /locus_tag="C5L36_0A02610"
                     /db_xref="GeneID:40381368"
     mRNA            <571042..>572331
                     /locus_tag="C5L36_0A02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463275.1"
                     /db_xref="GeneID:40381368"
     CDS             571042..572331
                     /locus_tag="C5L36_0A02610"
                     /note="PKUD0A02610; Pfam Domains: PIG-X(6.8e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319135.1"
                     /db_xref="GeneID:40381368"
                     /translation="MTIRRSFLLVSPKTSPEEVLGSLEVSNSSVSIDGSSTSNVLNQH
                     LIRYSPQEVDTRTEKRDFTLTFSQGNGDIPWIPNGLVLFSREKYPVPVLSTSPIFVNN
                     RWYWYKPIEETSLQDINTLLNWLNFETLESLPVGIELFVNEDADLYIYQNKSTIEGIN
                     SKEKHEFALVTEMDSGEVEVDRFVQGINGQSIDSIHPTMFVFSPFATSSGNVKVTIDQ
                     HSNAALHPIMEFQIQQFDKWDMKPSDLAISDSSECRLKIDLWIVKDFIIDKYEIQRLI
                     DRGQSCISSFQVNEMDLELPNYKVDEWGSWGNFQIDPQCLASKNGSWSIPTHLRYTFP
                     QEHMYWLLPPSVQVYWECPVNSETSVSISQSFFTDANRGFNHSQRRYYYNITEDINIY
                     MPTIPKSATSSIDFMTALVVGVASLIILIRCLSFSRV"
     gene            <572495..>573817
                     /locus_tag="C5L36_0A02620"
                     /db_xref="GeneID:40381369"
     mRNA            <572495..>573817
                     /locus_tag="C5L36_0A02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463276.1"
                     /db_xref="GeneID:40381369"
     CDS             572495..573817
                     /locus_tag="C5L36_0A02620"
                     /note="PKUD0A02620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319136.1"
                     /db_xref="GeneID:40381369"
                     /translation="MKSSNASVHFQASFQQMYIPRTDSVDGVEDIQGRLERNVTRKIK
                     RSVNPVANLAKLEVQQQYYQRQQKRYKQKQSHQYQQQQYINQHQQYQQYQQYQQYQQY
                     QNYQYQQYPQYPQQYPGEYEPQYKQYNAPLLVPATSSTTLSTKAPSPAPASDQTPASG
                     PPLQAQQQQMRSYRQFQPQHQYQSKQEIQYPQHQQYIQNKQYNRSSQIYSHYPMKSSN
                     LNLPERSNKRPIYTSCSEIETVNGSVGTITSANSNTSYRRQGNGGNSTPVTTPSDATA
                     NGVSTASPEVTKVTPTITSSSTKALNPVSVSRAMPTQPSTNNARTTTTTTTTIAAVPP
                     TAAPTASARVTAAAVPNMPPPASSKSEPKKGFFRKIFGRSKSIKLTRSNSTSSLSSIS
                     SASSKISRKFSFLRREKDVSVVRPTEDMIDVRTPIIVESLEDSARNRT"
     gene            complement(<574395..>574703)
                     /locus_tag="C5L36_0A02630"
                     /db_xref="GeneID:40381370"
     mRNA            complement(<574395..>574703)
                     /locus_tag="C5L36_0A02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463277.1"
                     /db_xref="GeneID:40381370"
     CDS             complement(574395..574703)
                     /locus_tag="C5L36_0A02630"
                     /note="PKUD0A02630; Pfam Domains: Transthyretin(3.5e-37)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319137.1"
                     /db_xref="GeneID:40381370"
                     /translation="MLSCHILDTTTGRPAAGVQCELRMDSQVLESGTTDSDGRIKWRT
                     VVPQGTYSIRFFTKEYFQTTQRSTFFPWVDIVFTVEKGEKYHVPLLLSNYGYSTYRGS
                     "
     gene            <575209..>576357
                     /locus_tag="C5L36_0A02640"
                     /db_xref="GeneID:40381371"
     mRNA            <575209..>576357
                     /locus_tag="C5L36_0A02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463278.1"
                     /db_xref="GeneID:40381371"
     CDS             575209..576357
                     /locus_tag="C5L36_0A02640"
                     /inference="similar to AA sequence:RefSeq:NP_010367.1"
                     /note="PKUD0A02640; similar to Saccharomyces cerevisiae
                     YDR082W (STN1); ancestral locus Anc_8.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319138.1"
                     /db_xref="GeneID:40381371"
                     /translation="MNPLKNSREPNYSSIVDTSHGGLETKVSFYNRDGVPFYRPETFH
                     LAPTMGGNGQALPISVRDLAGSTPLGETYRNEGARLGSEGVRLLGNWPVGKVRIVGRV
                     VGEARVDDGSSGYALEVAGKIAAVDSEMLGSLVAVEGSVLNVAGGVVCVRGEKCHRVR
                     EAEQIKWWGEVVQTREMLRKPWIQHEVIVIDDDNDNDQGGSDSINNWLNEDVYNGVNS
                     LKELENEVTLKTPTLAIVEATLVGELVDKTLGSTPRTVEAAQRLLAVRFLVAGTPLVP
                     TLLEAATQELLGILLKRLQEKGVICITAEGVIDKSVLLNHVAALREWVTNVNREFREI
                     MLGEVLSLLWEKCTLETAVSLVDVVSQKSLKYNRDSRSWSKRGDQGKH"
     gene            <576372..>578108
                     /locus_tag="C5L36_0A02650"
                     /db_xref="GeneID:40381372"
     mRNA            <576372..>578108
                     /locus_tag="C5L36_0A02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463279.1"
                     /db_xref="GeneID:40381372"
     CDS             576372..578108
                     /locus_tag="C5L36_0A02650"
                     /inference="similar to AA sequence:RefSeq:NP_011084.1"
                     /note="PKUD0A02650; similar to Saccharomyces cerevisiae
                     YER157W (COG3); ancestral locus Anc_8.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319139.1"
                     /db_xref="GeneID:40381372"
                     /translation="MHILTPLLPTEKEVIWEKINHKSDLFIEEEEEDKINQGNDNYSL
                     DTVAYLNHIKEENCKFLAQSNQIISQLDTLLAIHSSVTSQTQDFQSESNTLIDNLHFL
                     QELYSSLVDKFKLFNNLDSIVKKLNTANNSKLVLKPSFSQLLQDLDTSIEFINDPQHA
                     NYKDISVYKSRFNQCLVRALSLIRNYITSYIRSIESKNKEQLVNAKPITIDAIINVNF
                     VNDLSHITNLFTQLYIRSTDHASLLEDVYNQYFHSRQSLLSQFIINPHIDSVSFNEDL
                     LTLSTTQIKYFSKLVDKEFEIFKSIFFSPLIDNSINATVLQPHLESLLDPLYYLLRNK
                     ILRESSIDKLSQLITFLIDEPPIFLPILQDAQSRLLFQLQKNEPKPYSRTGKELIITS
                     NSNKNKIYPPIETSISVLETVNGLLPKPVFDDITASFIDAILKSFPHASPSDLQWSLY
                     ILHSLLELQKHVNSWEILYLNRDTQIEWHVTRPWSVKHEFNDCRLKLQLKIDELIQSF
                     AQQVDDNDVRRTWTLCKESVGSDHAAKLMDFIAKVKGSDWRDEMMHILQTENETDAEN
                     VDEEIEVSDLDD"
     gene            complement(<578172..>578462)
                     /locus_tag="C5L36_0A02660"
                     /db_xref="GeneID:40381373"
     mRNA            complement(<578172..>578462)
                     /locus_tag="C5L36_0A02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463280.1"
                     /db_xref="GeneID:40381373"
     CDS             complement(578172..578462)
                     /locus_tag="C5L36_0A02660"
                     /inference="similar to AA sequence:RefSeq:NP_076886.3"
                     /note="PKUD0A02660; similar to Saccharomyces cerevisiae
                     YDR079C-A (TFB5); ancestral locus Anc_8.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319140.1"
                     /db_xref="GeneID:40381373"
                     /translation="MLFNMSCICTKIFTSLFLILFNGNTMARVIKGMMIKCDPSIKSL
                     VVKIDQDYRDIIIEELDDQHLLIDPSKLAFVKKELNKVLADNTYNPFDDEEK"
     gene            <578546..>580945
                     /locus_tag="C5L36_0A02670"
                     /db_xref="GeneID:40381374"
     mRNA            <578546..>580945
                     /locus_tag="C5L36_0A02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463281.1"
                     /db_xref="GeneID:40381374"
     CDS             578546..580945
                     /locus_tag="C5L36_0A02670"
                     /inference="similar to AA sequence:RefSeq:NP_010365.3"
                     /note="PKUD0A02670; similar to Saccharomyces cerevisiae
                     YDR080W (VPS41); ancestral locus Anc_8.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319141.1"
                     /db_xref="GeneID:40381374"
                     /translation="MSNEEPPYFRYKRVTSLPERFFTTDPISASFLSEEYAIFGTHSG
                     MLLITTSTTFKTLKIFKGHTASVLDIDFDGQTFAAASMDGTILIGDINQLDNITKYDF
                     KRPLHAVSLQKPYSKTKSFYSGGKAGDLVYTTRNWLNQRTDEVLFRGNCITMIKYGND
                     RLIWCDSAGIYLKNLSSGQLLKLKAPVEMEKSELYWPKLDWSDDKALTIGWFNSMWKI
                     DVAEMKVTWSDTSTDYLIASIATYSDGILILNYTSKTDGEYYPPDLILIDQNGDEIVN
                     DELPIREYENLNVNDYGLLRTQKSWLLICPNDAVSIEPLWIGDRINWYVQREEFKKAW
                     ELGESMNPYQRLDIGLKEWKKNKDVEFFKKLLNGLNNLEYSNHLVNELNVIYSKYVSA
                     EMLPSKPYSGEKQIDPKYYDQVLNELLYKQEYDQFVHYLHQWDHTLFSVGDICSHMGD
                     ILESEDVPVLRDAYISLSLELEEPENCVKHYIALKDPQLLEFLDSHHLLDRHFQELPL
                     IIYFGVPPKKLEENVEILINNVHEILPQRIIKLFKDNQMDHVNYIYLNKLRKVDPLKV
                     KDFEDEIVSLFAKFNKEELFDFLQVHSKYSIENAIRICENNQCYKELVYLLSKVGENK
                     KALILIIDKMNDPGRAIEFVQSVNEKNLWDFLLDYSMNKPEFVKELLMNVGKLVDPIP
                     VVSRIPVNVKIDGLKGALIDITRNVTLDKKIYDLVMDIISDEYMSISEALRKLKMMGY
                     IVDKEELELVRSDMNHTYIKLREENTEKFGKEEDILGAKWDGDLNNKMGHKSFLQYKI
                     M"
     gene            complement(<580977..>581570)
                     /locus_tag="C5L36_0A02680"
                     /db_xref="GeneID:40381375"
     mRNA            complement(<580977..>581570)
                     /locus_tag="C5L36_0A02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463282.1"
                     /db_xref="GeneID:40381375"
     CDS             complement(580977..581570)
                     /locus_tag="C5L36_0A02680"
                     /inference="similar to AA sequence:RefSeq:NP_010369.3"
                     /note="PKUD0A02680; similar to Saccharomyces cerevisiae
                     YDR084C (TVP23); ancestral locus Anc_8.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319142.1"
                     /db_xref="GeneID:40381375"
                     /translation="MSEPAAVPQDSIARTMYQRLLESSHPIALLSFLTFRLLPIFIYL
                     FGMLFTSNYILYFITIILLVSADFWNVKNIAGRLLVGLRWWNETNELGQTIWVFETAD
                     PNRYINPIDSKVFWLMMYITPIAWVLFAIMSVLKLHLISLILIIIAISLSITNTMAYN
                     KCDKFGKANNIANDVMSSFSIPFLSKLNPFGRLFGSN"
     gene            <582447..>584192
                     /locus_tag="C5L36_0A02690"
                     /db_xref="GeneID:40381376"
     mRNA            <582447..>584192
                     /locus_tag="C5L36_0A02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463283.1"
                     /db_xref="GeneID:40381376"
     CDS             582447..584192
                     /locus_tag="C5L36_0A02690"
                     /note="PKUD0A02690; Pfam Domains: MFS_1(1.4e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319143.1"
                     /db_xref="GeneID:40381376"
                     /translation="MAEKNNNGLSYADRKSILFSMNHPESTSPQSDSQLSTEVEPYVG
                     SDVDIENGVTRKHLNRDSMKIDTDSKLSRELSRILTGTIETKERDANLMLPSLGMDKK
                     FPPDLPPIEDYTVSFDGPDDLMHPHNWPFAKKLIQSVLIGANTLAITFGSAIFAQAIT
                     PLSEIYHVHYVVTTLSVTLYVLGFATGPVVWAPLSEIYGRRPVVVVSSLLFCIFNFAV
                     AVSDRLESILICRFFAGCLGAAPLVVAPAAFADMFDNESRGTAVVIFCMCVFVAPLLA
                     PFIGGFIVANHSLGWRWTEFLTGILAAASFASILLFNVETHHPILLVEKARHIRQTTS
                     NWGIHAPHDEFQLSIEDIVENNLTRPIRMLFTEPILLFVTIYNAFIYGMLYLFLSAYP
                     IVFGKGYGMPLGVAELPYFGLIIGELLGGVFCIYSEGDYINKMKAADGRVIPENRLPP
                     MLVGGVVFPIGLLWFCWTGNYHEHVHWIVPTVSGLFTGFGLITIFNTSMNYIIDAYLL
                     FSASAMAANTFLRSLFGAVFPLFATFMFTNMGTNWAGLLLGLFAVLLILCPIAFIKWG
                     ENLRQKSKYTFDLAQ"
     gene            <585208..>586968
                     /locus_tag="C5L36_0A02700"
                     /db_xref="GeneID:40381377"
     mRNA            <585208..>586968
                     /locus_tag="C5L36_0A02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463284.1"
                     /db_xref="GeneID:40381377"
     CDS             585208..586968
                     /locus_tag="C5L36_0A02700"
                     /inference="similar to AA sequence:RefSeq:NP_013072.1"
                     /note="PKUD0A02700; similar to Saccharomyces cerevisiae
                     YLL028W (TPO1); ancestral locus Anc_4.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319144.1"
                     /db_xref="GeneID:40381377"
                     /translation="MSSSSMTNTGSTLSADKASAVSSHDSGSELSNSSSQLPEVVRPY
                     TGDSFSQNNQDLENGLQEPTDDEKLMRVDTHADLSRELSRKLTGADTIKNDESTPIPK
                     MGLDKDYPPMLPDSSAYTVSFNGPDDPLHPHNWPLKKKLIQCTLIGANTFAIAFGSAI
                     FAQAVLPLSKIYHVHTVVTTLSVTLYVLGFATGPVIWAPLSEIYGRRPVLVMSSFAFC
                     CFNFAVATSDRLESILICRFFAGCLGAAPLVVVPASFADMFGNQTRGTAIVVFSMCVF
                     CGPLLAPFIGGFIVANHRLGWRWTEFITGILAAASFVLIILFEVETHHPIILVEKARE
                     IKRRTGNWGIHAPHDEFELSIKEIVENNLTRPIRMLFTEPILLLITIYNAFIYGMLYL
                     FLTAYPLVFAGGYGMAPGVAELPYFGLVIGQFLGGLFCIYCERDYNKKMAAAGGKIIP
                     ENRLPPMIAGGVAFPIGLLWFCWTGNYHEHVHWIVPTISGLFTGFGLIAIFNPSMNYI
                     IDAYLLFAASAMAGNSFLRSTFGGVFPLFASFMFKNMGTNWAGLLLGLFAVVLIACPV
                     GFLKYGKKLRQKSKFAFDLS"
     gene            <587495..>589606
                     /locus_tag="C5L36_0A02710"
                     /db_xref="GeneID:40381378"
     mRNA            <587495..>589606
                     /locus_tag="C5L36_0A02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463285.1"
                     /db_xref="GeneID:40381378"
     CDS             587495..589606
                     /locus_tag="C5L36_0A02710"
                     /inference="similar to AA sequence:RefSeq:NP_010497.3"
                     /note="PKUD0A02710; similar to Saccharomyces cerevisiae
                     YDR211W (GCD6); ancestral locus Anc_8.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319145.1"
                     /db_xref="GeneID:40381378"
                     /translation="MAPKAKANKDTEDEPKMQAIVLADSFQTRFMPLTSVKPRCLLPL
                     ANVPLIEYTLEFLAQSDVVEEVYIMCCSHSGQIQEYIDSSKWVNLSSPFKKIQTIASK
                     ESRSVGDAMRDLDSRSIINGDFILISGDVVTNLDINQALENHKNYKQNDRDYICTMVL
                     TQAAPMHRSRSIIEPACFVMDKTSNRCLYYQDLPPINGKKASVNIDPEVLEDIEEFEI
                     YNNLIDCHVDICTGAVPTIFQENFDYQTLRSDFVKGVLSSDILKKHIYSYITKDHYSA
                     RVESWQTYDGISQDVLERWAYPIVPERNLLPDQTYTYSSQHIYKENNVILSQSSKLSS
                     SVIIGRDSFVGDKTQVSHSVIGRNCKIGSNVIIENSYIWDGSIIEDNCILKHAIVANN
                     SIIKKNVILNPGSVIGFGVIIDENVIIGNNQRIIRSPMKNSNSSTRIASEDEDSNNEE
                     TFSSVDLSVRDSSVVGMNGIGFLYENTEYQNEELGHIVYEMAELNFSDASIASSTVTL
                     HHSKKKKRSHSSASGFISEDEGENFDHEAIATVERAMENNHDLDTAMLELNTLRMSMN
                     VTYHEVREASCLAMVKRVNHFIDTDTLGVKGACEKIFNKWGMMFERQVFDDADQVDLL
                     LTLQSICNRIDGDNKSLIFVNIAIVLYNIDILDEDNIIAWYNTKESKEMPEIRSKMSK
                     WVEMLENDSSEEEEEGFSDDE"
     gene            complement(<589683..>591677)
                     /locus_tag="C5L36_0A02720"
                     /db_xref="GeneID:40381379"
     mRNA            complement(<589683..>591677)
                     /locus_tag="C5L36_0A02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463286.1"
                     /db_xref="GeneID:40381379"
     CDS             complement(589683..591677)
                     /locus_tag="C5L36_0A02720"
                     /inference="similar to AA sequence:RefSeq:NP_012048.3"
                     /note="PKUD0A02720; similar to Saccharomyces cerevisiae
                     YHR178W (STB5); ancestral locus Anc_5.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319146.1"
                     /db_xref="GeneID:40381379"
                     /translation="MEVSKGRRKSTQYSRKGCTQCKKAHVKCDERQPSCSRCQRKNIQ
                     CVYVFNLINENFGNEHFRKTDDMSSDDSKNIPQKMDKINTENGYSVNIDDSIILKNPN
                     NDYSLLDIPNFLPLPLDGDHIYDKVVLGQEKAISNYHMVHNENIPGLGKAIESEQTKR
                     SNDLESTIMPTQNQIYQYMQDFPREVQLDDLITIEMEEVGLPESPINTHSRQYSGCSL
                     PNLNVFNLPWDCGPFVYFIDVIRKHDPLTSDKNLSIHDQKLIDFVWTFTKLSRFFYTF
                     VLFPDEKLMSVLRLCFKLGTKNPIFQSIVTYHCSLHICRIYSQAKDVRMASEWDLKVG
                     KISFRECINYLKTGLENSTKFADLVTLSFAVLIIFSGNASDKSWRTHLNGNHQLILKC
                     FSVRNTVNLDNPLDRAALELFDIVVEQYKHTSRLAVLSSLGFPSKKIELEKDSFRTNF
                     SIAKNGINYMNGYKSNLGVIFEEVCDIVDVFGQAGIHLSGMNFIYLILTRKVDPRTFE
                     TLHDKGTSILRKIQDIKKNCNYIRLELEDFRMDLTIKYCELISISGLELYVAYFFIGT
                     RDIRLIKKKIQEIVDLIYSMPYKSSCAIITHWSIYISALICLLIKDKKLYQHIFSVLK
                     VFELNGMDVPSISILNNVKSILKTKNYMELLEPKNDYVIF"
     gene            <592457..>594169
                     /locus_tag="C5L36_0A02730"
                     /db_xref="GeneID:40381380"
     mRNA            <592457..>594169
                     /locus_tag="C5L36_0A02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463287.1"
                     /db_xref="GeneID:40381380"
     CDS             592457..594169
                     /locus_tag="C5L36_0A02730"
                     /inference="similar to AA sequence:RefSeq:NP_014771.3"
                     /note="PKUD0A02730; similar to Saccharomyces cerevisiae
                     YOR128C (ADE2); ancestral locus Anc_5.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319147.1"
                     /db_xref="GeneID:40381380"
                     /translation="MDSKTIGILGGGQLGRMIVEAANRLNIKTVILEKGESGPAKQIN
                     ANNEHIDGSFNNIDDIRKLADNCDILTIEIEHVDTDALKTIQRETGVKIYPSPETIEI
                     IKDKYRQKEHLVQHGVAVADSVSVESTETALQNVGLKFGFPFMLKSKTEAYDGRGNYV
                     VKDVSYIREALEVLHNRPLYAEKWAPFTKELAVMVVRNVDGEIFSYPTVETIHKDNIC
                     HTVYAPARVNDTIQTKANLLAKKAVSTFPGAGIFGVEMFLLPDGELLINEIAPRPHNS
                     GHYTIDACVTSQFEAHIRAISGLPMPKNFTCFSTPQTNAIMLNILGSDVPNGELELCR
                     RALETTSASVYLYGKSTRPKRKMGHVNIVSGSMSDCERKLAYIEGSGGLPITKSTENA
                     VSGTSKAPLVGVIMGSDSDLPVMSAGCNILKKFGVPFEVTIVSAHRTPQRMAKYAIEA
                     PRRGLRCIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPV
                     ATVAINNSTNAALLAVRILGVFDGKWISEMETYMNSMENEVLDKAEKLEKEGYEEYLA
                     TYKK"
     gene            <594358..>596040
                     /locus_tag="C5L36_0A02740"
                     /db_xref="GeneID:40381381"
     mRNA            <594358..>596040
                     /locus_tag="C5L36_0A02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463288.1"
                     /db_xref="GeneID:40381381"
     CDS             594358..596040
                     /locus_tag="C5L36_0A02740"
                     /inference="similar to AA sequence:RefSeq:NP_012038.2"
                     /note="PKUD0A02740; similar to Saccharomyces cerevisiae
                     YHR168W (MTG2); ancestral locus Anc_5.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319148.1"
                     /db_xref="GeneID:40381381"
                     /translation="MMVFSVTSGLKRSCFYNYKGVVSLWINRAYGIKPIPDNAPTLEE
                     NTEWLQTLNKSHIKDLRTEREEDFTYRVEERSDIDNEETNSNLLKFKSKKTKRTYSIV
                     KQPTEDDPYHTLSVPANEYFLSSSPFSSLSSKRRPKAESVQTFSDLRVVRLRSGKGGN
                     GEVSFYRDTNIAFGPPDGGDGGDGGNIYVVAVKEMSSLHNLKSRYIATDGTKGKSAQL
                     DGKKGEDVYITVPVGTHIRWCPDPREIRALQKEDYDNYVFHVKTITDDFGSLIPKFIQ
                     FFRNSYNIGKGWIFKEKDEEYHLQRDYFNNLNEKVSVFDAQLKQDELYADTFPLDGID
                     LDKPTEEPVLLLKGGKGGLGNMHFLTPDIRNPRFSKIGRNGLEGNFIFELKLLADLGL
                     VGLPNAGKSTLLRAISNAKPRVGHWEFTTLQPIIGTIPLRIDQPPFTVADIPGIVKGA
                     KMNKGMGLNFLRHIERSGGLVFVVSLGSSDPVDDIKVLIEELSEERLKGKNVLVVATK
                     ADVEGSKQKFLDLKSFVEQLSWKCVPCSGKNKENIEKVKELMAECSGRLDYS"
     gene            complement(<596148..>598520)
                     /locus_tag="C5L36_0A02750"
                     /db_xref="GeneID:40381382"
     mRNA            complement(<596148..>598520)
                     /locus_tag="C5L36_0A02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463289.1"
                     /db_xref="GeneID:40381382"
     CDS             complement(596148..598520)
                     /locus_tag="C5L36_0A02750"
                     /inference="similar to AA sequence:RefSeq:NP_012042.1"
                     /note="PKUD0A02750; similar to Saccharomyces cerevisiae
                     YHR172W (SPC97); ancestral locus Anc_5.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319149.1"
                     /db_xref="GeneID:40381382"
                     /translation="MPEGSCISISLEDVDADQFQIGDYYRISDLGKGKQQSDFEVSGI
                     QSLKQVKSQQQRETIIVRDLINVILGKEGDYIRYKLEESEQSNQTKESLRAVKFSISK
                     DIDFSFIDITNKICEHGSRVLTLVSFEQYFNKTSYGIVMGRLCEYFRNFMKEYQNSIF
                     HYLEESGTEMSILSLFQMLSNRRMQSYGCSIVESVASFYDLIKDIIEEDNKRSKITNL
                     TDMKFENLMTSLKEECSSSSVEDIVYDSRTSKCIKGGIILNLLERHIGISRGFRNSNM
                     LFAQLFEFITTGYLDILNKWLNFGQLDDFFDEFFISEAFPKSDIYNSYFWQNKFAIKM
                     DLLPEQLKSKQLQKKLLLTGKYLRIIKECECDHYFEQIPLSSIKTFRGSNFTILIDAA
                     YNRANILLKRMLNHSYEMRIFVSLMTKYFLLTDGSLVDDFLNHANHELKRSYSSSATQ
                     DILRWYKISYGTKSDDLTYKLFSELLECEFEPHSILEDILQITRTRVTDVNDIMQASN
                     MESLSNLLKANIYPNSIPSSPRRPEADNQRCNKLAISRFSIDIRIPFPLNHIISDSQK
                     LEFQLLFRHSILINFLNKRFEKSWRELGYHTFWTWSFGDPRVRKWVKRARFIHNRMFE
                     FIRIYLYYLNNDVIQVNWCKLDSVMENLDNEEESFDLCGFKFQMTEFLSSTICDSLLA
                     QTDLASSLYGLFTLILVFHEYVMSLRKTILLMDENLLKVQKKRLKLSITFSQQEKENK
                     LKTLIDVMDSYHQTFQRKMSDLCKHLEYHGKIDSPKMLTLQEKLVFGFNL"
     gene            <598840..>601128
                     /locus_tag="C5L36_0A02760"
                     /db_xref="GeneID:40381383"
     mRNA            <598840..>601128
                     /locus_tag="C5L36_0A02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463290.1"
                     /db_xref="GeneID:40381383"
     CDS             598840..601128
                     /locus_tag="C5L36_0A02760"
                     /inference="similar to AA sequence:RefSeq:NP_011761.3"
                     /note="PKUD0A02760; similar to Saccharomyces cerevisiae
                     YGR245C (SDA1); ancestral locus Anc_5.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319150.1"
                     /db_xref="GeneID:40381383"
                     /translation="MVKRKRAAILPTNFALLQNLVRRDPESYYEEFLQQYSHYESMRD
                     IFLLNPSTEDSEEFAEIINFMSFVCSSYPKETAKFPDELATILTKNHAELDPELREKI
                     VQCLVMLRNKEIVTPEYLIKTLFPLLFAYSSNSVNGSGFHSKQLRRQIYTALVSLLKS
                     CNTGSKNQKLNRTTQALLFNLLDQKDGNGVWATKLTRELWRRGIWDDARTIELMTQAC
                     LHPDPKVVISGVKFFLGADKERDETMEENSDDDDIDMEALKHKALVNKKNSKRAKKIE
                     SAAKVLKKKNSSKHSATYLNFSAIHLLRDPQQFAEEMFDNHLSGKNANKFDLDQKIAI
                     MNLVSRLVGTHKLTVLGLYSFFLKYLTPKQRNVTQILAASAQATHDLVPPESINMMVR
                     KIADEFISDGVAAEVASAGLNTTREILARNPAGIDEDLLQDLTAYKGSKSKAVMMAAR
                     SLISLYRDVAPEMLAKADRGKVANMELIHNGPKNVLQFGAQKDTTYGIPGLELLAKWK
                     LEQGLIGKEGEDDWKIPDSDEELEEDDDVEGEWIDVNSDTEINLSEDENGEELPKERN
                     GIKKKYLKYMKKHKKRKVASEENEDSDLELSDDESKKGDSGNKKSKKQIAEEEAKAKQ
                     LKAITETLSHVMTPADFAKLKELNAEAGYEKVTGHQLRNEDNIESSDLVYADKRKMNK
                     EERIASIMEGREDREKFGSRKGKREKEHSTTNREKERKKNFVMMIHKKSVQGKKKMSL
                     RDRQKVLKAHITRQKMGRNLNR"
     gene            complement(<601197..>602516)
                     /locus_tag="C5L36_0A02770"
                     /db_xref="GeneID:40381384"
     mRNA            complement(<601197..>602516)
                     /locus_tag="C5L36_0A02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463291.1"
                     /db_xref="GeneID:40381384"
     CDS             complement(601197..602516)
                     /locus_tag="C5L36_0A02770"
                     /inference="similar to AA sequence:RefSeq:NP_012039.1"
                     /note="PKUD0A02770; similar to Saccharomyces cerevisiae
                     YHR169W (DBP8); ancestral locus Anc_5.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319151.1"
                     /db_xref="GeneID:40381384"
                     /translation="MSTFKDLGLPRWLCDTLAGVKITKPTNIQAGTIPEILKGKNCIG
                     GAKTGSGKTISFAAPMLSKWAEDPCGIFGVVLTPTRELAMQIAEQFSAMGSNVNMKTA
                     LIIGGQSMIEQSNSLKNNPDFIIATPGRLAHIIEEHPDDVKGLRRVKFVVLDEADRLL
                     TDSFTDHLGTCFQAFPASEKRQTLLFTATVTDAVRSLKDKGDNVFVHELDKIDDVVIP
                     ERLKLSFILTPALIKEAILHNLLTTGEFKESTVMIFVNRSETCELVKRILKALDVRVT
                     ALHSEMPQSERTNSLHRFRAGAARVLISTDLGGRGLDIPSVELVINYDIPRDPDDFIH
                     RVGRTARAGRKGDAISFVTPNDLDRILSIEDRVNRKMSEYEKVTDNAVIKDSLKVTSA
                     AKVDARMEMDKENFGERKQRLKEKQLLRSGNGTVQTGKVAKQRKRKN"
     gene            <602888..>604777
                     /locus_tag="C5L36_0A02780"
                     /db_xref="GeneID:40381385"
     mRNA            <602888..>604777
                     /locus_tag="C5L36_0A02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463292.1"
                     /db_xref="GeneID:40381385"
     CDS             602888..604777
                     /locus_tag="C5L36_0A02780"
                     /inference="similar to AA sequence:RefSeq:NP_010578.3"
                     /note="PKUD0A02780; similar to Saccharomyces cerevisiae
                     YDR292C (SRP101); ancestral locus Anc_5.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319152.1"
                     /db_xref="GeneID:40381385"
                     /translation="MIDQFLVFDSSGTVNFNYQPGKNYARVANAFINDVLINERKMRY
                     VEGSEMMGNKNTQGEENAAEAAEAEANAALYEIEEDEEAGDYDGKDSDDNDDNNNRSA
                     KPKIKNAGMTEYSEEMNKYVDADINLGSYIHDGFNLKYLVWTNEKTKKKLYFVMIYAS
                     LITIINPFEFLKNVKILYENCSTDTLKFEKFFHLKLTEITEVKQEPTKTHTELVNENK
                     KGKPETVKRSKKSRKWNADGTFYEDDGKDESELDFSTGDIKPENYSSSNIQQLVGDRK
                     HFGTKTSEGFLVSDLSDEMNKIIISSKKKIVEKEKKSNSAASNAFGFLKKYIGGKKIT
                     KEDVSQIKTAMAQHLIKKNVSPNVANSLMAEVEKDLVGQTTESFTSVEDTAKTSLAKQ
                     LRMLLTPNSSIDLLHEIQSKKERGLGPYSISVVGVNGVGKSTNLSKLAFWLLQNDYRV
                     LVAACDTFRSGAVEQLRTHVNNLVQLSPNKKQIELFESGYGGADLVAKIATGAIKYAK
                     EHNFDIVLMDTAGRRHNDSHLMAPLASFAKAANPDKIIMVGEALVGTDSVLQAQNFNK
                     AFGANRHLDFFIISKCDTVGDLIGSMVNMVFATGIPILFVGTGQTYTDLRTLSVNWAV
                     EMLMS"
     gene            complement(<604900..>606882)
                     /locus_tag="C5L36_0A02790"
                     /db_xref="GeneID:40381386"
     mRNA            complement(<604900..>606882)
                     /locus_tag="C5L36_0A02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463293.1"
                     /db_xref="GeneID:40381386"
     CDS             complement(604900..606882)
                     /locus_tag="C5L36_0A02790"
                     /inference="similar to AA sequence:RefSeq:NP_012041.1"
                     /note="PKUD0A02790; similar to Saccharomyces cerevisiae
                     YHR171W (ATG7); ancestral locus Anc_5.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319153.1"
                     /db_xref="GeneID:40381386"
                     /translation="MNREVSTESHKLIFAPAASVVDSSFFVELSNLKLNVQKLDTSYQ
                     NILGYYNFSALGSEQSPSLILTDNSFVETENKEEFTQRLPSNSYFLSPGKLLNVNSIE
                     EFKRVNKKDFLIDSAMDILQRIRDKSFLHDPALLSSFRILSYADLKKYKFYYWCAFPQ
                     LQSQWEQCETKDSVDYKLQPNEVFDSQFYLINDEGLKKPLSTLFNNSTDSLLKVLFID
                     TCSSTHTTSYILRNFLTALANHNFTLVEVQVLKVNHFNKNFTTLFLNQDLNDNKHNNI
                     DGVPPVIGWERTSHGKLGPKIADLGALINPEKLAEQAVDLNLKLMKWRLVPDLDLDVI
                     KNTKVLILGAGTLGSYVSRCLLAWGTRHVTFVDSGKVSFSNPVRQPLYNYDDCLSGGK
                     PKAATAAENLRRIFPGVNAKGFQIDIPMVGHPIKDEKKEYEDFKKLAQLVDANDAIFL
                     CLDSREARWLPTLLGNVKHKIVINSALGFESYLVMRHGCIDPANNLENQIEGRLGCYF
                     CSDIVAPKDSLTDRSLDQMCTVTRPGLALLASSLATELFVSILQSPMKQYSNHIAHDK
                     TNILGCLPHQLRGYLHNFETLKLSSKNFRCCTACSVPVIREFREHGWHFVKTALNDST
                     YLEDVTGLREFHKNAESAAVLLDEFDELACEDQGIE"
     gene            <607152..>607547
                     /locus_tag="C5L36_0A02800"
                     /db_xref="GeneID:40381387"
     mRNA            <607152..>607547
                     /locus_tag="C5L36_0A02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463294.1"
                     /db_xref="GeneID:40381387"
     CDS             607152..607547
                     /locus_tag="C5L36_0A02800"
                     /note="PKUD0A02800; Pfam Domains: Thioredoxin(1.9e-38)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319154.1"
                     /db_xref="GeneID:40381387"
                     /translation="MFPIRKVLYNLRSETLKRSFHASSCAFEVKEITNPASFRESVLK
                     SPIAFVDFYATWCGPCKMIAPYVEKFSDIHTNINFFKVDVDELSDVAHEHGISAMPTF
                     LVFKHGKVVDKIVGANPQGIHSALVKACE"
     gene            complement(<607893..>609479)
                     /locus_tag="C5L36_0A02810"
                     /db_xref="GeneID:40381388"
     mRNA            complement(<607893..>609479)
                     /locus_tag="C5L36_0A02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463295.1"
                     /db_xref="GeneID:40381388"
     CDS             complement(607893..609479)
                     /locus_tag="C5L36_0A02810"
                     /inference="similar to AA sequence:RefSeq:NP_012040.1"
                     /note="PKUD0A02810; similar to Saccharomyces cerevisiae
                     YHR170W (NMD3); ancestral locus Anc_5.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319155.1"
                     /db_xref="GeneID:40381388"
                     /translation="MSNYQQMNNFDQLNHGHSHGDDFGHQHMVQPQATVLCCNCGVPM
                     DGSTGLVMCYDCIKLNVDITDGIPREANLSFCRNCERFLQPPTNWIKAELESRELLAL
                     CLRRLKGLNKVRLIDAAFIWTEPHSRRVRVKLTVQGEAFQNAIIQQSFEVEYVVIAMQ
                     CPDCAKSYTAHTWNTAVQIRQKVPHKRTFLYLEQLILRHNAHVDTISIKETKDGLDFY
                     YAKQNHAVKMIDFLNSTVPVKYKKSEELISADIHSGTSVYKFTFSVEIAPICKDDLVV
                     LPAKVAKQMGNISRLVLCSKVSNSLQFIDPASLHIEDMQANVYWRYSFSPLADVTQLI
                     EFIVLDVEPTGERRGKWLMADITCVRASDMGGNENEEYYIRSHLGGILHPGDSAMGYY
                     MKNSNFNSDLFEELDTDNIADVVLVKKHYVRSNKRSKNRNWKLKRMANERKDIVATEV
                     LDSRQARQEQERAERDYEMFLQDLEEDDELRQNINLYKSEKKVNFEEGMESEIEEDED
                     APEINIDELLDELDEMNIDG"
     gene            <609798..>610304
                     /locus_tag="C5L36_0A02815"
                     /db_xref="GeneID:40381389"
     mRNA            <609798..>610304
                     /locus_tag="C5L36_0A02815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463296.1"
                     /db_xref="GeneID:40381389"
     CDS             609798..610304
                     /locus_tag="C5L36_0A02815"
                     /note="PKUD0A02815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319156.1"
                     /db_xref="GeneID:40381389"
                     /translation="MEHRGITASGSKNSSGTNTENQHIPRNIHDLSEILLETNLIIDT
                     TTSEPRDVLMTERTALTWVKFSMTLAAISLTIVTNFRLDTSNKNSIRPPYWFPQFSYG
                     ISILFVILSMVTLFIGAGLYAQSIYNYKNHSVSTYSLKLALGFLFFIGLVLLAVNIVF
                     MIAVGGSF"
     gene            <610844..>611473
                     /locus_tag="C5L36_0A02820"
                     /db_xref="GeneID:40381390"
     mRNA            <610844..>611473
                     /locus_tag="C5L36_0A02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463297.1"
                     /db_xref="GeneID:40381390"
     CDS             610844..611473
                     /locus_tag="C5L36_0A02820"
                     /note="PKUD0A02820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319157.1"
                     /db_xref="GeneID:40381390"
                     /translation="MSDILSVDFTRLSSSLSEEEITLLQQYQKLALNLTMVKAKLGQI
                     NEQISSVSEENVQSISKLIIELQATMGTLGTSYKSTVHNVLLSGDSNQLVNRGVDTRK
                     YDDSNQIQETENFETAEMQLQQEGNREGGSRDHINTNNGHNNEQNLNDVDVDVDVDVD
                     VDVDLDSGIDEETMNAVDRIQHELGISADDVDIHRQIADQLEIQNSEDY"
     gene            complement(<611597..>612682)
                     /locus_tag="C5L36_0A02830"
                     /db_xref="GeneID:40381391"
     mRNA            complement(<611597..>612682)
                     /locus_tag="C5L36_0A02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463298.1"
                     /db_xref="GeneID:40381391"
     CDS             complement(611597..612682)
                     /locus_tag="C5L36_0A02830"
                     /inference="similar to AA sequence:RefSeq:NP_009793.1"
                     /note="PKUD0A02830; similar to Saccharomyces cerevisiae
                     YBR234C (ARC40); ancestral locus Anc_6.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319158.1"
                     /db_xref="GeneID:40381391"
                     /translation="MSIPFNLSKLPIYDHCFSADRTHVAVTQDKDVAIYNLSNPKSPQ
                     LVTTLKHHDKPVTALDISADGKIVTCSQDRNALVWTPQPNKTYKETLVLLRINRAATC
                     VRWSPNGAKFAVGSSARVISVCYFEDENDWWISKHIKRPIKSTILSLDWHENNVLLSC
                     GSTDGHLRVFSAYIKGVDSKPLGTIWGERLPFQTLCLDVNLNSWVQDVKFSPDYQFVA
                     GVGHDSSVYIIYPGTGELEVAEVVRVKTSHLPFTSLLFANNSKLICAGYDCHPVVFEG
                     NQAGWIETYSVDDPKKKTAKNVENQSALNMFRQMDLKGSTETKSSNLLTIHQNTITSL
                     RPFQYDANGLIRFSSSGNDGKVVVFEV"
     gene            <612960..>613901
                     /locus_tag="C5L36_0A02840"
                     /db_xref="GeneID:40381392"
     mRNA            <612960..>613901
                     /locus_tag="C5L36_0A02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463299.1"
                     /db_xref="GeneID:40381392"
     CDS             612960..613901
                     /locus_tag="C5L36_0A02840"
                     /inference="similar to AA sequence:RefSeq:NP_116659.1"
                     /note="PKUD0A02840; similar to Saccharomyces cerevisiae
                     YFR004W (RPN11); ancestral locus Anc_8.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319159.1"
                     /db_xref="GeneID:40381392"
                     /translation="MERLQSLLGGRMGGMGGMGAMGSQDTPAIDNAETVYISSLALLK
                     MLKHGRAGVPMEVMGLMLGEIVDDYTITVVDVFAMPQSGTGVSVEAVDDVFQTKMMDM
                     LKQTGRDQTVVGWYHSHPGFGCWLSSVDVNTQQSFEQLNPRSVAVVIDPIQSVKGKVV
                     IDAFRSIPSQVLMMGQEPRQTTSNVGLLNKPTIQALLHGLNRSYYSLNIDYRKTEKET
                     DMLLNLHKKEWTSGLRIENYDQHDCKNLDGSKKLIKVAKQYVERIAEEKTLTEDQLKT
                     RYVGKQDPKKHLIETAENLIEDNNVSIVTSNVNRLAI"
     gene            complement(<613894..>615348)
                     /locus_tag="C5L36_0A02850"
                     /db_xref="GeneID:40381393"
     mRNA            complement(<613894..>615348)
                     /locus_tag="C5L36_0A02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463300.1"
                     /db_xref="GeneID:40381393"
     CDS             complement(613894..615348)
                     /locus_tag="C5L36_0A02850"
                     /inference="similar to AA sequence:RefSeq:NP_116660.1"
                     /note="PKUD0A02850; similar to Saccharomyces cerevisiae
                     YFR005C (SAD1); ancestral locus Anc_8.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319160.1"
                     /db_xref="GeneID:40381393"
                     /translation="MKWQNLFSQLGNQISFLYLSRYGVHFLIVMFCKNACHTNSNRKT
                     QGKMSCSKRPLEDDFLKGEKRAKRGTESDDEFADLEDEVMFKSNELETTNSDMYLDSI
                     NRKILNFELPFECSSTLATTNVFVCLVCGKYLQGSSTSSPAYLHSVDSDHHIFISLES
                     LKFILLPEQKVLSKERESELKDIQLLIDPKFDERMVEKFDKEPMQVETYLREQYTVGY
                     IPILNKLSDLGLKVDNTAVSDNALFYALSHLSKFRDFFINYNYSDTAPLSNQVSRLIR
                     NIWSPYLFRGFTSSYAIENYLSTCKIPPRIRSDLKLFYMWITNTLIKENKSLKPIFTG
                     KLTADSVDKKNLTTFLTLTLSMPQQSVFKDGTSSSIEQHDIETLITQRNFHIKKAPEI
                     LTIYIDRTNHMRIEGIDQELNMSIVKFDPDLLEVNNTFKYRLIGNITYENKVQILNKS
                     QSKWMEFDGVSVKEVEKELLFINNCKLQFWELLI"
     gene            <615465..>616883
                     /locus_tag="C5L36_0A02860"
                     /db_xref="GeneID:40381394"
     mRNA            <615465..>616883
                     /locus_tag="C5L36_0A02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463301.1"
                     /db_xref="GeneID:40381394"
     CDS             615465..616883
                     /locus_tag="C5L36_0A02860"
                     /inference="similar to AA sequence:RefSeq:NP_116661.1"
                     /note="PKUD0A02860; similar to Saccharomyces cerevisiae
                     YFR006W; ancestral locus Anc_8.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319161.1"
                     /db_xref="GeneID:40381394"
                     /translation="MNVITRLMKYPAKNHAKKVQEHFLAKKSCVSAEKTAFFIASAKY
                     KLYPYCDQTAPLRQNRYFHYFTGVDQISGAYILYNLANEKLTLFLPDVDTEDIMWSGL
                     PLSPEESLEQYDVDEVLYAKDVSSVLNDLKKLNFSVFTTDIDEYNQEGFSKAVIPNDP
                     DFFYALDEARLIKDDYEVSLMREAAKITDKSHLAVMSALPIESNETHMHAEFVYHSIR
                     QGSKFQAYDPICCSGPSCGTLHYVKNDDSMDGKTSVLLDAGAEWKCYASDVTRCFPIS
                     GKFSKEHLAIYNAVRDMQAQVMEKIKPGVLWDDLHYLSHKVLIKHFLKLGLFHNGTEE
                     EILGSKVSTWFYPHGLGHLLGMDTHDVGGYPNYEDSDPILRYLRLRRKLQVGMVVTDE
                     PGIYFSPFLIENINEEQKKYVNMEVVKEYMYIGGVRIEDDILVTEDGYENLTKITSDP
                     HEIEKIVQRGLNRGKEGFHVVI"
     gene            complement(<617024..>619204)
                     /locus_tag="C5L36_0A02870"
                     /db_xref="GeneID:40381395"
     mRNA            complement(<617024..>619204)
                     /locus_tag="C5L36_0A02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463302.1"
                     /db_xref="GeneID:40381395"
     CDS             complement(617024..619204)
                     /locus_tag="C5L36_0A02870"
                     /inference="similar to AA sequence:RefSeq:NP_013376.1"
                     /note="PKUD0A02870; similar to Saccharomyces cerevisiae
                     YLR274W (MCM5); ancestral locus Anc_6.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319162.1"
                     /db_xref="GeneID:40381395"
                     /translation="MSFDRADTYATSVLPPQQDVAADQNSEIVKAFKRFILEFRVDND
                     FIYRNQLRENILSKQFKLTVHSEDLIYFHDELHQRLFENPKETIPLFERAITELAKRN
                     MYLTNEEAPAIFPQCQLILLSNDTRISIRDIDSEHVSKIIKISGIIINSSMLNSRASE
                     LTLMCRTCRHTLKIRSSVTLGLPQYPKKCLAPPSPDGDKPQCPPNPYLIVHDKSTFID
                     QQTLKLQETSDMVPVGELPRHITLFVDRYLCNTLVPGTRCEVIGIYDTYQKKVRNTGS
                     INNAAIRTPYLKVLGFQTESDLLRSSGGISRFFSEEEEQEFINLSKIPNLYDRFVNSI
                     APSIYGNEDIKKAITCLLFGGSKKVLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKV
                     SPISVYTSGKGSSAAGLTASVQRDPATRDFYLEGGAMVLADGGVICIDEFDKMRDEDR
                     VAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIFGRYDDMKAPGENIDFQTTILS
                     RFDMIFIVKDEHNTHRDMSIAHHVMNVHTNGGNNEEQAEGEIPIDLMKKYIQYCKLKC
                     APRLTPEASEMLSSNFVAIRKEVKLKESLSTERSSIPITVRQLEAIIRITESLAKMEL
                     SPVATVRHVEEAMRLFNASTMDAIKEGNTDNPEVIGQIENMEAEIKRRLPIGWSTSYN
                     TLRQTFVEKGSFSIEALNKTLVMLERREVIQFRHNRSSVFRCGV"
     gene            <620410..>622092
                     /locus_tag="C5L36_0A02880"
                     /db_xref="GeneID:40381396"
     mRNA            <620410..>622092
                     /locus_tag="C5L36_0A02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463303.1"
                     /db_xref="GeneID:40381396"
     CDS             620410..622092
                     /locus_tag="C5L36_0A02880"
                     /note="PKUD0A02880; Pfam Domains: MFS_1(2.5e-38)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319163.1"
                     /db_xref="GeneID:40381396"
                     /translation="MLTLISQVRSAFRWGRNLVPMEKRNVYVVYGIALVGVTLDNMNN
                     AAIITLQKDLEEKFNTNSSVASWVLSGYALTLGSFIMITGKIADIIGPDTVYLIGLGI
                     MWITSLICALLPHTSIIPLIVFRAIQGIGASSLLPSVLSLMANYFSGPKLKHLQGAIS
                     ALLIALTSIFSIGLILGGAFSVTDIGYRAYFWFTFSLALLCDISLFFLIIPVKKTKGH
                     ESLNMKSLNYISASLVIIGVLLVILGLTEGALGWKHAKAIAPLIVGVFIVIVALVFDS
                     FYLKRYQEKHSNKEKSSDWRLQIDLLFPPEIIKIPNVAVFIICCSLYYAIMLMVMVTA
                     VMFYQDIEHNSPIITALKVSPLGFGLAFGAIIYRPWMYEKFDGNKLFVYSGALTLGTL
                     IWFSRIHYAASNSFWKYGFVSLFLWGYGCNLFFNIYMKIVVDFTPLHLQGVVNGIFQT
                     VSQVFLSIGNALVPSIIGNVTTAHSNEEKNDLQNRLKTILYVAMGFNATFLLLCFLVK
                     TVKKVDRETVENQDKKGNFNGFDDQEKQIVCIPEESCNDSSLSSKINKNEAE"
     gene            <624153..>626969
                     /locus_tag="C5L36_0A02890"
                     /db_xref="GeneID:40381397"
     mRNA            <624153..>626969
                     /locus_tag="C5L36_0A02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463304.1"
                     /db_xref="GeneID:40381397"
     CDS             624153..626969
                     /locus_tag="C5L36_0A02890"
                     /inference="similar to AA sequence:RefSeq:NP_015197.1"
                     /note="PKUD0A02890; similar to Saccharomyces cerevisiae
                     YPL128C (TBF1); ancestral locus Anc_8.630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319164.1"
                     /db_xref="GeneID:40381397"
                     /translation="MSKLHSTEDSISQPSIDAMPSSMDKDANGVYSRDTSENDYDASI
                     QNELDQIESNLEQLSENQKKRRMSKHEMDFLESELNMELETMDVSDFDMHLQKLISDN
                     NSSLGKDKAGNIAEKHENTSSGVIEDLNHKEGEAHENNFSPHNNSGPIVAVDLHSSGL
                     SSAPENNNETQGRGGDVNSEKYVDPDAEFQEPKENQDFDERSTACKSAEKNKAEHVLP
                     QEAGAALIENGDQDSLGNNNEDKDKEKTEQENFNSPVTSESQFQPLSKVLSDADEKTA
                     KRKHESVSDVASKKDKVLEEDVSNRSKKRKKSSIETIQVDSYKGVSIPANSELFKEPD
                     NNSALQAYRNLLHNSEKTAGELSSHVNAQLSALPLQITAPDNLSFNVQTLIHTLPCLD
                     NFATQILIKIAKGPYQKIMEIVSNRESYTSIMFGNLVELFETTKRIYNSEESPFFTVE
                     NVTFGLWKFGHPAPLFLRGKEDTIEGTLRKVNLATFLLATLGLIDLGFFFLNEAFLDV
                     FCPPQNLDPSESLSLIKDESGYDKVTKLDVRNNRYQRSNQTKFLKAQAILYLELKTQA
                     YISAIELGDRSKEDIIHDLFPENMDEILLRRKDPFYETNGSKIERNATVFTPAELDFL
                     KRCDYRKQTLLNTADDNVLMEKYEWIKFLNDLLEYVSKNIGFLIWGPKGKLSSELDKL
                     NAKKDEKVVKAEIEEFKAKLQKDESNVTSDTVKSLPVSPQQDDPIDANGSDMSDISKK
                     GTKAKKSTKNRPSTFRRVWTKEEEEALKEGLKQKGTHWTAILELYGPGGQINESLKNR
                     SSLQLKDKARNWKIYYIKNNLPVPDYLNKATGYAEKFRKMKPLNDVSVNRPKATVGQY
                     SSSTSSALAGGASQGTTNLASTDFPNSNVTTNGNSTNASHDNFENEVYNKMIETLLPE
                     NKTQDKAGDDDASELKELVAEAFK"
     gene            <627280..>629541
                     /locus_tag="C5L36_0A02900"
                     /db_xref="GeneID:40381398"
     mRNA            <627280..>629541
                     /locus_tag="C5L36_0A02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463305.1"
                     /db_xref="GeneID:40381398"
     CDS             627280..629541
                     /locus_tag="C5L36_0A02900"
                     /inference="similar to AA sequence:RefSeq:NP_009599.2"
                     /note="PKUD0A02900; similar to Saccharomyces cerevisiae
                     YBR043C (QDR3); ancestral locus Anc_3.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319165.1"
                     /db_xref="GeneID:40381398"
                     /translation="MATRRPSLSMREGTSDIDSLDSLESNNFRADDIHIYKNHSDGNE
                     EGGSAASAANYDDDDGGGNNNNYNHSNCSNTSSKLETFGSHMNGESITPDTMRKSHTL
                     LSKITTIQLNDTQVVPLKNRRGLLSSLCLIPEYQDARELPTSLRRFIVFIIAFCAMLG
                     PMGTSILLPASDDAVENLKTNITMLNIAIGVYLITLGVIPLWWSNFSERHGRRSIYII
                     SFIMYLCFTIGCALAKDVNMLIGFRVLSGGCAASVQSVGAGTIGDLYPITKRGAAMGL
                     FYLGPLAGPLLSPIIGGAITSNPRFGWRATQWFLICLSGGCCILIIFFLPETLRKQDN
                     KDAIRKILRERLRNKRNPEDTESNVTTENKDLSDTNDKDSLLSPSNNKITPASSGTPS
                     NANNTRDDNEAINEQEVERLNTLLSKISTRVSFGSRSRRGSFVSVVPQGGGNNSNRVG
                     DNEENIDALAIDEDEAPVIDSVAPLSKVPTKGIINIEDYSRNKNDEIANELDQIQDIE
                     KRGRIALLKRYTKIYLYGPLKAFTFMRYPPVFLSIAYSAPCFAALYVQNMTLTYMYSR
                     SPYNFSSVLVGLVYIPNSVTYFIASIWGGKFNDYLLKKKIEKYGIVAPEARFGINVYV
                     AAAMLPGSMLITGWCLDYKEQWVTPLVGTALFGFAQMIVIGVTVTYLADCLPGKGATG
                     IALSNFVRMIMAAGVSFATEPLIKAMGVGPLFSMCAGITAVLSVLLVVIIRYGDHWRE
                     TYNLEKLYDIVDD"
     gene            complement(<629639..>630805)
                     /locus_tag="C5L36_0A02910"
                     /db_xref="GeneID:40381399"
     mRNA            complement(<629639..>630805)
                     /locus_tag="C5L36_0A02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463306.1"
                     /db_xref="GeneID:40381399"
     CDS             complement(629639..630805)
                     /locus_tag="C5L36_0A02910"
                     /inference="similar to AA sequence:RefSeq:NP_010805.1"
                     /note="PKUD0A02910; similar to Saccharomyces cerevisiae
                     YDR517W (GRH1); ancestral locus Anc_1.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319166.1"
                     /db_xref="GeneID:40381399"
                     /translation="MFGFAKKLVSTIESQLSNESIIHQNAEIDESRQGLRILSVKPDS
                     IGAKCGFESWFDFILRMNGNDINAYLQINHQTGSVNYENFFGYIRHEVEVANNNITFT
                     VFSSKGSIIRDVVVTPQEVKDAISRSLNSFNEISLDENQASENALPWSPNLGISFQLT
                     PIKAGFYTWHVLKVHPKSPAYISGIYPGEYILQAQDGLLATGGEDLLSKVLQGQYAKN
                     GDGCELLLYVYNYDSDSVRPVTVVLRSGTIWGGRGVLGCDIGYGLLHRIPEVFGKFES
                     TLEAKDVLAQDNVVNGNIVPEVPLTQPPEFLPRKVTAPNFVSEGEGDSIEQAARTAFA
                     SRKRNLNKHAAVNLEAYFDEQTKLNDNNSTAKTSENSSAHTGLPPPPPPPPKKV"
     gene            <631026..>632186
                     /locus_tag="C5L36_0A02920"
                     /db_xref="GeneID:40381400"
     mRNA            <631026..>632186
                     /locus_tag="C5L36_0A02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463307.1"
                     /db_xref="GeneID:40381400"
     CDS             631026..632186
                     /locus_tag="C5L36_0A02920"
                     /inference="similar to AA sequence:RefSeq:NP_011346.1"
                     /note="PKUD0A02920; similar to Saccharomyces cerevisiae
                     YGL169W (SUA5); ancestral locus Anc_8.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319167.1"
                     /db_xref="GeneID:40381400"
                     /translation="MFIRRRFFSIIGRAMNGTQQYETEVLKVNPSTIIINDEKKSIEF
                     TNSETKKAIETAASLLRSSQVVGFPTETVYGLGASSLSSDAVTKIYEAKNRPADNPLI
                     SHISSVDMIKNVFKTEVPEIYNPLISKFWPGPLSIILPVSDDCPVSPVVTAGQNTFAV
                     RMPENKIARALIQVSNLPLAAPSANASTRPSPTKAEHVLHDLNGRIPLILDGGLCDVG
                     LESTVVDGTVDPPMLLRPGGVSLEEIRKLGHGWENIVLGKKTAGQYEKVRTPGMKYKH
                     YSPTARVILFENFDKLESAIDTYLKNSTITSNTKIAVLTTKHWDTSGGGNLVIPLGKE
                     GEEIQRNLFAALRDADAQEVDLIFVEGVDEGEQGLAIMNRLSKAASDIISNK"
     gene            complement(<632315..>633883)
                     /locus_tag="C5L36_0A02930"
                     /db_xref="GeneID:40381401"
     mRNA            complement(<632315..>633883)
                     /locus_tag="C5L36_0A02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463308.1"
                     /db_xref="GeneID:40381401"
     CDS             complement(632315..633883)
                     /locus_tag="C5L36_0A02930"
                     /inference="similar to AA sequence:RefSeq:NP_009887.1"
                     /note="PKUD0A02930; similar to Saccharomyces cerevisiae
                     YCL043C (PDI1) and YDR518W (EUG1); ancestral locus
                     Anc_1.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319168.1"
                     /db_xref="GeneID:40381401"
                     /translation="MQLSIRTITSVLAAITNILSVRAEDAVAPEDSAVVKLTQDTFKE
                     FIESNPYVLAEFFAPWCGHCKRLGPEFASAADSLVETHPEIKLAQIDCTEERDLCADF
                     EIRGYPTLKVFKGDTENISDYPGQRSSDSIQSYMVKLTLPAVQVFTDGKEIDAKVGDL
                     TESFILQILPEGAEESASNTTFYDVANKYKEHFTFASTSDKDYVKKYANGKKPSYVVF
                     RKGETVDDASVYKGEDIGEEADRLVEFIDVESKPLFGEINGATYQAYTSAGIPLAYYF
                     YSSTEERDVAEPIIKKLAKKYRGELNFVGLDAAQFGLHAQNLNMQEEFPLFVIHDLES
                     NKKYGIDQSKELDNNDIPQFVQKFKAGKLDPIVKSEPIPESQNSSVYHLVGAEHDAIV
                     NSKKDVFVKYYAPWCGHCKKLAPVFEELASLFEGKDVIVAEIDHTQNDVEGVEIQGYP
                     TLVLFPADGSEPVYYEENRSLESMAEFIKEHGSLKIDAFGDAKEEVESTATGAQETEA
                     PEAAAENENAHDEL"
     gene            <636183..>637964
                     /locus_tag="C5L36_0A02940"
                     /db_xref="GeneID:40381402"
     mRNA            <636183..>637964
                     /locus_tag="C5L36_0A02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463309.1"
                     /db_xref="GeneID:40381402"
     CDS             636183..637964
                     /locus_tag="C5L36_0A02940"
                     /note="PKUD0A02940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319169.1"
                     /db_xref="GeneID:40381402"
                     /translation="MRGTLTNLFRRTTIQSVDDVSVNSNRVSETHDSGDYTSKKEDHT
                     TVIEVGTPEEKKNPLGYSVGPLSVIVLIIQGVVGTGIFTGPGTIVKSMGSIGSTYVLW
                     LSCFFLPMFSVFLYVEFAGYYPKRNGGDVAYLEQAYTKPKFLFPTIYAAVSVVLSFTT
                     SSALAVGQYLLSASGAEVTTWHYRGIAIAALTLSCVHIGLSTKWSLRLQNLLGFVKVV
                     FMVFIVILGFVVLGGGTKVKDPHASFTNMWEGTTTQGNNIANSIINVAFSYGGYSYAF
                     GVVAEYSSSKKGQTESEREKSMIRTFSFYVPVSMIVILILYILMITAYYAGGTPDEIK
                     HSGNGVATILFQNAFQNKYATKFLNVMVALSAYGHLVTAVLSHSRGLRECGRQGVLPF
                     PKFWTSTKPFGTPLGPILVTWIVNFIMIVAPPAGSAFNFIVDMGSYSGYIFTLALICG
                     LLKVRRDRKLRNLGTKGQYLPLPCIIILLLFELMVIILAFVPPKHGLIGSDVTFFYAT
                     YPIVTIGLLMLCIAYYFVWRYTLPKLGGYVHREVEYILQNGEIGNTIVKVKLEEVEQW
                     DNEHGTDEYGVAKTVVLKYEDVESQKT"
     gene            638413..638496
                     /locus_tag="C5L36_0Atrna3L"
                     /db_xref="GeneID:40382494"
     tRNA            638413..638496
                     /locus_tag="C5L36_0Atrna3L"
                     /product="tRNA-Leu"
                     /note="PKUD0Atrna3L; codon recognized: UUA"
                     /db_xref="GeneID:40382494"
     gene            <638780..>640216
                     /locus_tag="C5L36_0A02950"
                     /db_xref="GeneID:40381403"
     mRNA            <638780..>640216
                     /locus_tag="C5L36_0A02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463310.1"
                     /db_xref="GeneID:40381403"
     CDS             638780..640216
                     /locus_tag="C5L36_0A02950"
                     /inference="similar to AA sequence:RefSeq:NP_011625.3"
                     /note="PKUD0A02950; similar to Saccharomyces cerevisiae
                     YGR110W (CLD1); ancestral locus Anc_3.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319170.1"
                     /db_xref="GeneID:40381403"
                     /translation="MLKNKNIRIIKRLTHTYKIKMNNMENDNLNSISAELTASSGATS
                     TTYRKPTSPSGAPLSAISPKLFPLPLSDSFKHYWDKKTLEAAQHELLSTLPFYPESSA
                     DHSSKVLRYESPNSLVFPDINEFHIKPKRNVKNDKHLVFIHGYGAGLGFFIKNIEKIS
                     KEHPDWHIHAIDLPGYGCSTRVTFPSRIPFQNYETVEKLFTVPLRDWFVSRGLDEKNT
                     VVVAHSMGGYLSLALQLHEVQGTNYIGESEYENIKSRFSVFGSKKAKELNTKHENQMK
                     ELTNTSANPRRFWNTLILVSPGGIWSKRTPSIAEESTPTWFVKLWNQNISPFSVVRNL
                     GPLGSYLVSGWTSRRFAIDHLFDNSLKKLMHQYSYTIFNAKGSGEYMLNYLLAAGAVP
                     RHPMFDRLEKLKSYSGKTVWMYGTHDWMDYTGGIKSAEKLNQISHGSSTVELVPDAGH
                     HIYLDAFDKFNELVGKEMNGFEKVLSKK"
     gene            complement(<640449..>642557)
                     /locus_tag="C5L36_0A02960"
                     /db_xref="GeneID:40381404"
     mRNA            complement(<640449..>642557)
                     /locus_tag="C5L36_0A02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463311.1"
                     /db_xref="GeneID:40381404"
     CDS             complement(640449..642557)
                     /locus_tag="C5L36_0A02960"
                     /inference="similar to AA sequence:RefSeq:NP_014962.3"
                     /note="PKUD0A02960; similar to Saccharomyces cerevisiae
                     YOR317W (FAA1) and YMR246W (FAA4); ancestral locus
                     Anc_8.796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319171.1"
                     /db_xref="GeneID:40381404"
                     /translation="MVLINVPVGEAKKGETAPRRSYRVKNGAVVRPKGYKCSTVYEYF
                     NEVVERHGKDKRCQGWRDTIKVHTELKKVTKIVDGQETSVDKKWIYYEKSDYKYITFG
                     QLQEIVNNYGKGLIEIGINHSNSDKLHIFASTSPYWMRTFLAAQTQGIPVVTAYDSLG
                     EEGLTHSLVQTGSKAIFTDNELLGKLINPLQKATEVKFIIYSSQLDSNNEAIDVEASK
                     KNIEEIKKVRPDIKFYSINDVIKLGKDKNESIEFHPPKPEDLSCIMYTSGSTGPPKGV
                     VLSHANIVAGIGGVSVNVPDTIITQRDRVIAFLPLAHIFELVFELITFYWGSTAGYAN
                     VKTLTDASCKNCEGDMKTFKPTVMVGVAAVWEAVKKGIISQIEKAPQTTQKVFWAAYH
                     VKETSKKYHIPLVPSLVDTVIFKKIKAATGGHIRYMLNGGSPLSGETQRFITNTIGPM
                     LIGYGLTETCANTCVLIPEHFEFDVCGSLVGSVTVKLIDVPEAGYFAKNNQGEILISG
                     APVLKEYYKNPEETKKAFEYEEGWFSTGDIGEWTSTGALKVIDRKKNLVKTLNGEYIA
                     LEKIESIYRSNKYVLNICCYADENKVKPVGIILPNEAQVKELIFKLGLDKKAKSASEI
                     EISNFIENKKLVKEITKSVLDTGKSGGLNGIELILGCVLVDDEWTPESGYVTSAQKLQ
                     RKKILGSVKERVDQLYAENQ"
     gene            <644120..>645943
                     /locus_tag="C5L36_0A02970"
                     /db_xref="GeneID:40381405"
     mRNA            <644120..>645943
                     /locus_tag="C5L36_0A02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463312.1"
                     /db_xref="GeneID:40381405"
     CDS             644120..645943
                     /locus_tag="C5L36_0A02970"
                     /inference="similar to AA sequence:RefSeq:NP_015146.1"
                     /note="PKUD0A02970; similar to Saccharomyces cerevisiae
                     YPL179W (PPQ1); ancestral locus Anc_6.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319172.1"
                     /db_xref="GeneID:40381405"
                     /translation="MGNPPSRTDLNNSNQTSSSVTSPASQDDPDPLPIRSVNSDNKHL
                     NIDPLIDSNNNFTTNTIITTDVNPLIINNAKKNNSLHLDNHNHYNPHHHHRQSHSHAS
                     SNIQAAQPPRSRYAGIPLDYSVSSSSASSFEDGSFPNSLCGSYLTSPSVSSFSTNLSS
                     SNYQKTTLYPIDETTNSLSTFMASPSSSSPSSPSSTDSQDLPFKLDIDKEASLTSPNS
                     TSTSTSSSSTSTSNTKAGKLSLSVEKLSKLQIGDVKQNNQPNAVSQLTKTLIDTKTNQ
                     PTSKRQINLDLDLIIEKLVASGLAKKNPKYFPLSYDEIRFISSKSRRIFMSQPMLLEL
                     AAPVKIVGDIHGQFHDLLRIFKLCGFPPNSNYLFMGDYVDRGKQSLETMVLLLCLKIK
                     YPENFFLLRGNHETAEITKMYGFYDECKRRTSAGVKTWKLFVDVFNTLPVAATIADKI
                     FCVHGGLSPDLHDLNQIRNIQRPTDIPDEGLLADLLWSDPQDLNELKPQDPKSSKSSS
                     KLKSKSKHKFQDWKPNDRGVSYCFNSTIVKNFCKKFDFDLVARGHMVVEDGYEFYASR
                     KLVTIFSAPNYCGEFKNWGAVMNVNKKLMCSFELLKPKEKK"
     gene            647616..647712
                     /locus_tag="C5L36_0Atrna1K"
                     /db_xref="GeneID:40382462"
     tRNA            join(647616..647653,647676..647712)
                     /locus_tag="C5L36_0Atrna1K"
                     /product="tRNA-Lys"
                     /note="PKUD0Atrna1K; codon recognized: AAG"
                     /db_xref="GeneID:40382462"
     gene            complement(<647906..>649075)
                     /locus_tag="C5L36_0A02980"
                     /db_xref="GeneID:40381406"
     mRNA            complement(<647906..>649075)
                     /locus_tag="C5L36_0A02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463313.1"
                     /db_xref="GeneID:40381406"
     CDS             complement(647906..649075)
                     /locus_tag="C5L36_0A02980"
                     /inference="similar to AA sequence:RefSeq:NP_011750.1"
                     /note="PKUD0A02980; similar to Saccharomyces cerevisiae
                     YGR234W (YHB1); ancestral locus Anc_5.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319173.1"
                     /db_xref="GeneID:40381406"
                     /translation="MSAKQIFEILPLTEDEIAYLQSLLPAVKTSGTVVTSTMYKYMFE
                     TYPEVRNYFNMTNQKTGRQPKVLAFSLYQYILHLNDLSPISGFVNQIVLKHAGLGILP
                     EQYPIVGKCLIHAFKEVLGAAADDHFVEVLTKAYGNLAQTLINAEEEVYKTLPWRGFK
                     DFKVVDLVKESGDVTSVYITPADGFKLKPVVPGEYISFRFKPKGPESDEIEPREYSIS
                     HDLINNQYRISVRNIGLVSDYVNNKLSVGDLIPVHAPVGTMKYDSLSKKPKIAVLAGG
                     IGITPMITIMQSALRDNKSVELYYSNKSLKREPFREELEHLGKLYPNQFTMKTFISEE
                     SQKLTTDDLKHLSQQIYDVYLLGPVSYMHEFKTYLTNEGFDDIKMEFFGPTDPDC"
     gene            complement(<649707..>652058)
                     /locus_tag="C5L36_0A02990"
                     /db_xref="GeneID:40381407"
     mRNA            complement(<649707..>652058)
                     /locus_tag="C5L36_0A02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463314.1"
                     /db_xref="GeneID:40381407"
     CDS             complement(649707..652058)
                     /locus_tag="C5L36_0A02990"
                     /inference="similar to AA sequence:RefSeq:NP_012593.3"
                     /note="PKUD0A02990; similar to Saccharomyces cerevisiae
                     YJR059W (PTK2) and YKL198C (PTK1); ancestral locus
                     Anc_1.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319174.1"
                     /db_xref="GeneID:40381407"
                     /translation="MAFPKLIHRKKDSKERERHEEKPKFLHMLKDHVMPKGMASGTVS
                     SSPSKSPFENKQHDAKISGIASQADLPLVQSHPHSAISNAPRHSESHARINSPNSAIS
                     KEEMKKQLDEAKPGLPSIDDVQKPSRKMTYNPYGLNNITAGGSNANKNVVRTFTLDDA
                     VEDANNTLPKPVANPNDYLPPIFQDEHPVLTDLYELTPNEKSIGTGASASIKKINKRG
                     NVRDVYALKKFILFKGEKPEEFYQRAAKEYIIHKNISSGFHIVKVFSLVRVPHIPFPQ
                     EITGGWGLILELCKTDLFSLIEKKSWPTTKSCDKLCIFKQIAFGLKYMHDHDVSHRDL
                     KPENILLDGNGIVKITDFGVSDYGHVIPGDFHSPIAMSTQLVGSPPYQPPEVQNLNGV
                     DRSKRTPYNPFLMDYWSLGIILFVLFYQNVPFQSADKRCPEFRDFDMSYDKYCSRNTN
                     FRKDKLVPNLVGTSPAQTPKLTPTLDGRPIGSGGLASTPISRIPSIQAHTIPSSAAIA
                     RSSNVNIPTAVPPPTSSHNNNNNNGSSPNSPSHLQTKNDFSMIKTRSNSAASSNSSLN
                     KQFGTPGHSKTSTINSTAPSSSNLSLLGLNKAAGPGPEYRFARKFPSSHVARMAWRLA
                     DPKPESRWGLFDLFNDETFQNLEMCICEHSKDGCYPYIENEDHHENHHQSHREDHHQS
                     LFKDVDDESFHDANEDEGIQFTATNNREPSGSMVNEGHGELKGLSSGSTGSNTPAHIQ
                     TTTGDNVIQLADDFDNGLLITSNETTKKASTEHVKKHSHLLTY"
     gene            complement(<652479..>653189)
                     /locus_tag="C5L36_0A03000"
                     /db_xref="GeneID:40381408"
     mRNA            complement(<652479..>653189)
                     /locus_tag="C5L36_0A03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463315.1"
                     /db_xref="GeneID:40381408"
     CDS             complement(652479..653189)
                     /locus_tag="C5L36_0A03000"
                     /inference="similar to AA sequence:RefSeq:NP_012924.2"
                     /note="PKUD0A03000; similar to Saccharomyces cerevisiae
                     YKL002W (DID4); ancestral locus Anc_2.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319175.1"
                     /db_xref="GeneID:40381408"
                     /translation="MFQWIFGKRMTPQEQLRRNQRQLDRTQRELEREKVKLQQQEKKL
                     ISDIKKSAKDGQTKTMNIQARDLIRTRKQITKFDKMKMQMQAISLRLQTIRSSNEMTS
                     SMANATRILSGLNAGSLNIQQLSRISNEFQKSFDMMDQKQEMVDDIMDDIMDDEIEDE
                     DEEEIDEVVNQVLDEVGISLNDKLRDVSVSALNGETVSANQPQRQAVTVGGGPGPGSG
                     LGSEDEDDLQARLNSLKK"
     gene            <653483..>653848
                     /locus_tag="C5L36_0A03010"
                     /db_xref="GeneID:40381409"
     mRNA            <653483..>653848
                     /locus_tag="C5L36_0A03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463316.1"
                     /db_xref="GeneID:40381409"
     CDS             653483..653848
                     /locus_tag="C5L36_0A03010"
                     /inference="similar to AA sequence:RefSeq:NP_012923.3"
                     /note="PKUD0A03010; similar to Saccharomyces cerevisiae
                     YKL003C (MRP17); ancestral locus Anc_2.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319176.1"
                     /db_xref="GeneID:40381409"
                     /translation="MLYELVAIARVAHPSAAHADAKALASTIGKLVINNKGVVREVVS
                     LGCRPLPKIMSKAGEKHFQGSHFLMLFDSSGAVQREIIRSLKNDPRVIRVNLLRVEDK
                     VNLNPGSSYTRATKVLFQN"
     gene            complement(<654029..>655633)
                     /locus_tag="C5L36_0A03020"
                     /db_xref="GeneID:40381410"
     mRNA            complement(<654029..>655633)
                     /locus_tag="C5L36_0A03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463317.1"
                     /db_xref="GeneID:40381410"
     CDS             complement(654029..655633)
                     /locus_tag="C5L36_0A03020"
                     /note="PKUD0A03020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319177.1"
                     /db_xref="GeneID:40381410"
                     /translation="MMRSRSSKAVVSSYTDPLIELLHSADLNKTKELSNTLVSYIDDI
                     DDIELRKWCIDSLTVLRNLEKIETQLDQWEFHTLDFTIELGNQNSKDTSVEDNIMRGN
                     LAKRVLEKSNAVRKLLSGEKNSINTSIKRARNLTTNSPALVVTDAGTILVELTMRIVK
                     LAKLLDQQVTIGYSRARLTIIGSELKKLVTKNPFLIDKEVAKNYEIFVNNLLNQLNSA
                     AAHNDTVGLWESVKIVGDVEKMFESMKRKAMPEKPEKSNHDEQIKEQLKKQNFTSSNN
                     INSSTIGSSHNKDGDLTDSTLVDYDIEKSVSKLSAKEIFHNDDELIRTQISDHIPELM
                     AAFKKNENTQSSAEPLERQSNHSDDDSEEKEKQMGGSGVSSGNGINVPNYSLFRPSIL
                     NAFYKPKLKEPIYINKSNVIPSEEADRPDSNGKQTQNKENCGIIASTSSLEDSMFLTN
                     ASMAVRLDKMAQENEAQSVLLDKERELRDKEILANNALMKNTRPIVSTSPLLQHLSSS
                     MMSKSIIGNFKTEQSGRENDNANLID"
     gene            <656357..>656821
                     /locus_tag="C5L36_0A03030"
                     /db_xref="GeneID:40381411"
     mRNA            <656357..>656821
                     /locus_tag="C5L36_0A03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463318.1"
                     /db_xref="GeneID:40381411"
     CDS             656357..656821
                     /locus_tag="C5L36_0A03030"
                     /inference="similar to AA sequence:RefSeq:NP_010947.2"
                     /note="PKUD0A03030; similar to Saccharomyces cerevisiae
                     YER030W (CHZ1); ancestral locus Anc_3.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319178.1"
                     /db_xref="GeneID:40381411"
                     /translation="MPEEVEKKVLEETKDENAEKRKVEDAEPSTEPDAKKPKTEEKKK
                     KKKRHDRYADLEEPKTDSDESDDEKEEIDDEKLIVEDEEEDDLQEIDASNIISGGRRT
                     RGKVIDYSKVEQDIQKESETNSAEGDDDEGEDEDEDFKEKEEKDEKEKVNNP"
     gene            complement(<657099..>657764)
                     /locus_tag="C5L36_0A03040"
                     /db_xref="GeneID:40381412"
     mRNA            complement(<657099..>657764)
                     /locus_tag="C5L36_0A03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463319.1"
                     /db_xref="GeneID:40381412"
     CDS             complement(657099..657764)
                     /locus_tag="C5L36_0A03040"
                     /note="PKUD0A03040; Pfam Domains:
                     Ras(1.5e-94)|Miro(2.3e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319179.1"
                     /db_xref="GeneID:40381412"
                     /translation="MSKADEYGYDYEFLFKVVLIGDSSVGKTNLLSRFTRNEFNADSK
                     ATIGVEFATRTLEVDGKKIKAQIWDTAGQERYRAITAAYYRGAAGALVVYDITNSDSY
                     ENVSKWLKEMKDNADSNMVIALVGNKSDLGHLRAVPTEEAQNFATEHNLLFTETSALS
                     ADNVDHTFTQLVQNIYEMVSKTKFDINDENGSNSNDVAKGKTIQLTPAPKDKKISKNS
                     NCC"
     gene            <658241..>661303
                     /locus_tag="C5L36_0A03050"
                     /db_xref="GeneID:40381413"
     mRNA            <658241..>661303
                     /locus_tag="C5L36_0A03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463320.1"
                     /db_xref="GeneID:40381413"
     CDS             658241..661303
                     /locus_tag="C5L36_0A03050"
                     /inference="similar to AA sequence:RefSeq:NP_011308.1"
                     /note="PKUD0A03050; similar to Saccharomyces cerevisiae
                     YGL207W (SPT16); ancestral locus Anc_3.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319180.1"
                     /db_xref="GeneID:40381413"
                     /translation="MSDISIDPTLFRRRLHLIQKNIFSNESFQKVNGVLIAVGSSDEA
                     NTYQKSTVLHTWLLGYEFPATLMYITNKKIYFVTSISKAKYLQPLINSTNNQNLIIFS
                     RNKDPEHNKAQFEKFIAEIDASIVNPDNKSIGVVTKDNYQGKFMNEWSPLWDEAKSKY
                     DLKDIALGISETLELKDEEEQKYLRTAARASVNMMNFFTDEMSKIVDEDANVSNSKLA
                     DKLEGKIDDVKFFKNMENNKLMKKLGKDFDQNNLDWCYRPIVQSNGKYELKFSVEPTN
                     DKLSGPVIMASLGLRYHNYCSNVSRSFLIQPSKEMEKNYEFLVSLQEHLFQYLKDGSR
                     FNEIYNEAIKYIDHHNSSLKSNFVKNIGTLIGIDFRDSAAVINSKNERVLKENSVVNL
                     VLGFSNLNDEEKGSYGLLLSDTIRITGSEPILLTESPKIKKEIAFYFDDDEEVDSNIK
                     KEDGIGNGKPVQQKKEKNVKSESPAVKTENYGNTRVLKAKRRAEQNNSEEGQSQIQKE
                     IQAELHAKRQKEGLERFNPEDAKDGSESRAVFKRYESYVRESQIPNNVKDLKIHIDSK
                     NQTIILPILGRPVPFHINSYKNGSKTEEGDYTHLRLNFNSPGLMISKKEELPYELGDD
                     KQFIRSLTFRSKDGARMTEVLKRISEMKKAAVKRESEKRERADVVSQAQLIEVNRPKR
                     LDNVFVRPTPDTKRTPGFVTIHQNGIRYQSLTRDQRVDVLFSNIKHLFFQSCKGELLV
                     IIHAHLRTPIMIGKKKTYDVQFYREATDMSIDETGNRKRKYRYGDEDELEQEQEERRR
                     RAMLDKEFKAFAESIAEISNGLVDLDIPFRELGFQGVPGRSAVVCLPTRDCLVQLVDT
                     PFMVITLEEVEVAHLERVQFGLKNFDLVFVFKDFSRPVVHVSTIPMESLEDVKAWLTD
                     VDIPFSEGPVNLNWPTIMKTINADPYGFFQDGGWSFLGGGEDSDEEMEEESAESDFNP
                     SDADPEDEEDYSEEDYSEDDDDGDASVSEEEDDEDIAESDVSDEVFSD"
     gene            complement(<661437..>668546)
                     /locus_tag="C5L36_0A03060"
                     /db_xref="GeneID:40381414"
     mRNA            complement(<661437..>668546)
                     /locus_tag="C5L36_0A03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463321.1"
                     /db_xref="GeneID:40381414"
     CDS             complement(661437..668546)
                     /locus_tag="C5L36_0A03060"
                     /inference="similar to AA sequence:RefSeq:NP_009694.3"
                     /note="PKUD0A03060; similar to Saccharomyces cerevisiae
                     YBR136W (MEC1); ancestral locus Anc_3.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319181.1"
                     /db_xref="GeneID:40381414"
                     /translation="MTDQETLLQLSGILDTLISQESPGKDRDSNSINALLGSVLASYE
                     NRQLQTNSTNLTDELSEAQIVSKIFTALKTMFSRNPSLLIEDNRHLSVLKSVFPFFNC
                     LNCPNQLMDDVLFALIQITIDCFKKGFLVYNRLIFQQRDYILNHMEDLLSDVIKSFTN
                     TTNMDTLMIMENIEDNLISFERFHSIYWEKISKISIAVRIIQYLVHPAIDQLYFSHRN
                     AAFSLDSFISKCWFCLENTIINIKFVSENNVIIDKLDNIYSSLLQSTFNYYYNNPTSQ
                     FSRLQMVIQYCHFLLNWSLLCNFKILQVVLSQTLLKLAITLKSVNYEEYLWLNIGLSE
                     SSVRYFEKLIGCVSNPDLKRCLQLLMAAKFHDTDDPSQLVYVKKISQFKDTELQSLHE
                     RMKLSFGFGNLKFSLQTHVLTTDIIEDIQSGKVEKSIKGLSEIQLINTINALGDYACY
                     HSGNYDIKTHSCRICDSSISISSDIMQSVYIHKANMTKDLHEVYTIIDVLLKEHQIQV
                     SPNILISLLHALTKILRSYRPPRLGADSTLLKFIEFGFTHQLRIIRLLTVKLFPLILH
                     APEDEQYEQDFDTILSFLLSLEPESGNYYLFEGTIQGLGELLLVKSIDNKYYIVLSRL
                     IRFMSDVDEFRSNLAIHQLRIVARTKNITPWQLVEPFIPLISRDVLKNRIVRPGLLTN
                     FCIAIELSIPLFLERTLKYTIPYLIDSYKEDHISFISQTLKVPKSELIDTHLDGILAY
                     LYATYDHISKTKLMKILSIYDSKYKGMAFEEMLNCCKGPYLIIHLLAYYSSNPETFNR
                     IKNAVEIISVSLGYGQDGLVASQRLLNRWLLILVQVISTTLNDKKGSNPFYMKIRAIK
                     SIGCLLNLCEKFDACLGQIIMALQLAIQVPDLRFESLLHIKLIAEKVDRKSMRFVFDS
                     LISQFVLEFDGFSKKCQSLTTEIIVNLLKISPEKDVSYKFALRRIPSMKSINFQHVSD
                     RRLLGEFRNRLKSDNLWVFEQVLNDLIQYLENGYINYQKLIREDELVYQVFLSITELL
                     VTNSFKKYDQLDSDSGYKTKIALKSARVISLLGNLDLMKTSSHNTIKTFSGNYYDNIS
                     NFLLVTNLQKQKGADYDHSTMEFLIYFIKNILVRNFVSSVDPEEQKFLAYTIQEFLAI
                     CEIPPLIWHKFDDLTKSILEPLKSSRYKQGMKPRVMDLPIYKYNKEYNAWVKDFSANV
                     LHNCAILADQVLNAPEQISSICTVIPLLDVSISKFVLLYAILFLVIMCPESNIAKKNI
                     QQEFMSILSNDLSLVQNQVIREGLKKYFVTIIEIFQFLKAWSSKVKDEEDASKASNKN
                     NSKIKRTGVQRIGKFLKYFPHDIMAKRCADCDIYEGSILFLENGYKDGIIPKDVFFST
                     LKDMYVKLEDYDQLHGALKLFSTNSLSDKLLQFKFNEDIQISNESLRAIAQYNFDDDP
                     NQKGTTQNASVTELFEVLNKNCEYEQLLLNLKNYEAKVDDGPNQYLINTDWILHGIQA
                     SIYTGDMDNLERWSYSSQNSNAIAISGSDMSILYEIAQGLIALHKQAIPSCCRHIENA
                     IEYIGLAISNSQNFIQKKISDYMILLHSLYDFQILAKMNSRDDKVIQILKNRLDFSKQ
                     DYKSVWKIHSLKSSIYKLHPGKDFQTLYKDSLVEGCRILRENGKLPQATRLITKALVL
                     NENDDNVEMTQASTMLMNVEFSKLFWAQNDYETALKTLKLVVDNLHTKNPYYLDFSLT
                     YLNWMDVSAEGSSDEIKERYNALIRERVYDNSGDVNYQYAVYLNKLLEAQILEESDGS
                     LDYAVIKQYLLAVSASKKYVHEILPKAVTLWLDYYHKYIDIEPTCNITKKLSDSRHNS
                     YQLINKTVEKSVSNLGKKWYIVLSQIISRITHDDKNITELISKVIVELTVKYPWLILY
                     SVFSQARSVDEKRKAIGTMILTKLQDSRNHTDSKTLQLPKLIASGLILLESIMSVCNT
                     TNKFKHPKSGTLYKDLYKDLGFDYPRDSECLALALPIKENVDLLYNLKNDVDKHVIFY
                     SKFHEKVKILFSLQQPKRVRVTGTNGETYFLLFKPRDDLRKDNKVMEFSTVMNDLLSK
                     NYETQTRNMQIKSFAATPLNETTGIIEWVQNVVTLRHIIDGQFKRQNIIINMRNMKNE
                     FGDAKPSEKRAIFESYLDKFPPILGKWMIENFPNIYKWYRARETYTRSLAVMSIVGYL
                     IGVGDRHLDNIMINRKTGIIMHIDFDCMFEKGKKLSVPEIVPFRLTPHLIEAMGVLGY
                     EGAFRKSCELTMSIIRENENILMNFLESFIHDPLMDWRSGSSDGRASDDKALTRIKKQ
                     QEKVYKILRRKIKGILSKEDDNTGYRDSGGLSVSVSLQVDLLIQTAVSHENLSKMFFG
                     WMPYL"
     gene            complement(<668886..>669311)
                     /locus_tag="C5L36_0A03070"
                     /db_xref="GeneID:40381415"
     mRNA            complement(<668886..>669311)
                     /locus_tag="C5L36_0A03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463322.1"
                     /db_xref="GeneID:40381415"
     CDS             complement(668886..669311)
                     /locus_tag="C5L36_0A03070"
                     /inference="similar to AA sequence:RefSeq:NP_009693.3"
                     /note="PKUD0A03070; similar to Saccharomyces cerevisiae
                     YBR135W (CKS1); ancestral locus Anc_3.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319182.1"
                     /db_xref="GeneID:40381415"
                     /translation="MQDLQQEQAQAQEQAKAQAQAQAQAQLQRHQQQHPSHYGASQVP
                     RPKPLTPQERERIFAYRDKYYYSPRYADDDYEYRHVALPRDMLKIIPSDFFDESGTFK
                     ILLEDEWRSQLGITQSLGWVHYGCHAPEPHILLFRKPKN"
     gene            <669887..>672226
                     /locus_tag="C5L36_0A03080"
                     /db_xref="GeneID:40381416"
     mRNA            <669887..>672226
                     /locus_tag="C5L36_0A03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463323.1"
                     /db_xref="GeneID:40381416"
     CDS             669887..672226
                     /locus_tag="C5L36_0A03080"
                     /inference="similar to AA sequence:RefSeq:NP_009691.1"
                     /note="PKUD0A03080; similar to Saccharomyces cerevisiae
                     YBR133C (HSL7); ancestral locus Anc_3.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319183.1"
                     /db_xref="GeneID:40381416"
                     /translation="MPLGLIGLKPQPHTWRKAKEDVAFYKKCFADGYSCFLLPITNQS
                     YKEVCKSYFHSSPKSMDTLNAPFPEFHHTDLHPCLDIYNIVGLVSSWLELDNDDLIIN
                     EFSSQVLINELSYGHHLGIDKYMLSPPKNINNIQVYASNIAKILKLFPSIQISISLPM
                     CQDYNESNKEFFDLYSTWDTWNVIRTLCNYNENLHVSLGAPMTNIPSAVLDRWLHEPI
                     SFYLISVTKFISNAKSYPVLNKFNQLILWKMLQFKSLELPVIILHGVDRIGQENELVE
                     YDSNKKSTYLSYIQHLVSISKKSSFVPYISEFILSELKDSGVSKQFINSPAVLQCPLE
                     PLTENLQDYTYNLFEKDSFKYEQYGRAFIKALIQLNKSWNLEEKPHILFLGPGRGPLI
                     DKFFDALELLQTPSENFTITAIERNPAVMIYLKQRNSQLWKNNVNILNMDARDYDNSQ
                     YAALHSKVNMVISELIGSFGCNELMPECIDSISNSVFCDPHCVFIPQKLDCYVAPVLA
                     PKYWKLALKLSFDKMYIPMIPEMELFSERPEPVWSFVSESKKNNQHLQQTHQGSTNHN
                     DSNSSDNVCTIDNAFSTNNLFRNKHNSRNSRISIQIEKKGTLHGLAGYFKAALFDDIE
                     VSNLPKEVGMRDCVSWLPAFFPLESPLNMFEGQEVSVFMQRICSGPNVWYEWSVQGFL
                     YTLLTNSLAHIPHNSQENSRLTNSSQMLSTSNNPSPKKNSMKHINSPANSYDDANAQY
                     TMSLERNLVSINENKVRLCTGTSRIHNLNGCGFKLKLIQ"
     gene            complement(<672272..>675532)
                     /locus_tag="C5L36_0A03090"
                     /db_xref="GeneID:40381417"
     mRNA            complement(<672272..>675532)
                     /locus_tag="C5L36_0A03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463324.1"
                     /db_xref="GeneID:40381417"
     CDS             complement(672272..675532)
                     /locus_tag="C5L36_0A03090"
                     /inference="similar to AA sequence:RefSeq:NP_014132.1"
                     /note="PKUD0A03090; similar to Saccharomyces cerevisiae
                     YNL267W (PIK1); ancestral locus Anc_1.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319184.1"
                     /db_xref="GeneID:40381417"
                     /translation="MGTKQDQGLSHHEASINAGNYDDSNVQTSIETNHSTYSKGGEKI
                     SNNTNNNGNSFTSSKAVGLDSDFEKLSINTNIIADMKETDLSSTDLFARINSEEFEIF
                     HCISLLQSNPNIAIQYYICKRIEKFPIGELRFFAPQFLQLLVTMENQSMALEEMIKDI
                     CSSDPHFSLITFWHLQAMLQDLSKEPESIGFQTCKRLVNELQYQLFNYSSSKKTTNSS
                     FASSSGVIPKFEINKDFKPNVLPSIVLSSSILSGITVPESTSYVSPIVKMEGKRIKTM
                     VFEVVKDIKKNLTENLTKKNTLNNALLGKSEHKGNILRRTRSIANVPKKRSTSPMPES
                     IRKSSDSVKASRNRDLGFEMIEAYSDLNLPNLRKPSLRGNYFPSKGLHHMHSSSSIND
                     INDSSAQAESESKKTSFDHAHNLAKSMPDLHGNDEAMSDTNTNVSFSPNTSYADFSNN
                     YASDTGSYASSIRNSSDYKDSFEMPDTNSNSSATKPHQYVTLNEEQKKKLLKSSYFKN
                     ETQFVIALQNISIRLSKVPKEARLSTLKAELSILNKDLPCEIDIPMLLPRAKKGKMHK
                     ICRIAINESAVLNSAERVPYLILIEYLTDEADFDPSTPSNRSILRHIEDYEDLGGSDK
                     YKFDLSYNSSNRIASTASTAEMSTLKKGDFDVVEEGDLADVSIVKMTNNYEKFRNTSV
                     MTQVDSLQNMIKNDTSSNLPIPPLTAQSDKENNIATQLRIASIMLTQLESSSSPLPQH
                     QSLQIKNKIINSMQTMQEGFANNIDTEGAGERKLSNDMKVAGLSYLGEDWETKKARIR
                     QESKFGHLENWDLFSMIAKTGDDLAQEAFACQLIHLMANIWYQDKVKVWVKRMKILVT
                     SISTGLVETITNAVSVHSIKKALEQDMIKKNEQPINGVISLKDHFRRLFGEENSRRYK
                     LAQDNFASSLAAYSVICYILQIKDRHNGNIMFDSEGHIVHIDFGFLLSNSPGSVGFES
                     APFKLTQEYVDVLGGVESYHFKKFKRLTKEAFKSLRRNADCIINMVELMQTDSSLPCF
                     KAGENTSVLLRQRFQLHLTDEEVDLFIDNFLINKSLNSAYTRLYDQFQLLTQGIYI"
     gene            <675860..>680746
                     /locus_tag="C5L36_0A03100"
                     /db_xref="GeneID:40381418"
     mRNA            <675860..>680746
                     /locus_tag="C5L36_0A03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463325.1"
                     /db_xref="GeneID:40381418"
     CDS             675860..680746
                     /locus_tag="C5L36_0A03100"
                     /inference="similar to AA sequence:RefSeq:NP_009971.1"
                     /note="PKUD0A03100; similar to Saccharomyces cerevisiae
                     YCR042C (TAF2); ancestral locus Anc_1.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319185.1"
                     /db_xref="GeneID:40381418"
                     /translation="MESMSLRATPRTPMTPRTPRSSKKHSKYEIDNIPSQRFKIGYQK
                     VTLDIDLESNSIIGETEITVLPLDSHLKQVKLDCRGIQIKSIIVNQRRAHFSYDDFLQ
                     NIEYMNDEENMVLKDYKYDPYFDSHSKSIGIEQHEMLRAKFFPLFSDQNEPDDPGSSF
                     SKCTSELTIRIPESIKLRLQNANKITISPAGSIRPNETPTTASSFLNSDKAYTPLNIK
                     INYIVKNSKNGVQFYGGKHTTIPRDKWYCFTLNNDIGCSTSSWVPCIDNFYEKPAWDV
                     NIVVPKTVGNIGTSMLIGTKEATKALQKMAAQNMMLADSENKITGSKDQKSETGDDGD
                     EDEDESSDKMEDIPITVVVPELVSSREGPHPMDVAKKLVNFQFYNPVCAHHLGFAVGC
                     FEKTPMVDVKPGTNDFNVHQQMIKQDYADSPIEVSLDASNSNKVPCLLYYHPGRKEEV
                     LNSTIFLYKVFDYYSKEFSSFPFTSFSLLFIDHLPAETCSFAGMTIASSHLLYGPKHI
                     EPIFDTTEKLCVALAEQYSGVHVLPKTLNDIWCTIGIARYMSYQFMKKLFGTNHYKFL
                     FEKRCELLCDIDIGKRPLANQLFRFPINVDQDLNFINLKAPLVLSILDRRITKTDKLF
                     GLSRVIPKIFLQAMSNDLVNGNNLSTSHFQRVCEKVAHHKLEAFFQNWVYGNGTPIFR
                     ITQKFNKKRVFIEMTIRQMQASSLNNDEDNMANKDLVRKDQTLNFVDQANTFLIDHQN
                     LKVQPAFFGPVNIRIHEVDGSPYEHIFSINDSLVKFDIQYNTKYRRKKKEKKEEEELD
                     ERDDKEKEIRRKDKNDEPVINTLGDVLTTAEETRNWDLKEDDNDAGIQTGITEEDKGD
                     AFEWLRFDADKEWICKYTINLADEKFEAQLKQDRDVEAQYEAIRHFATVNRPGLFHAR
                     VLLRTLIDARYYYGIRVEAAKALAKISSEENDHIGMRFLLKAYKHLYCYDNKIVKGYS
                     ELDAHEYLPRPTDFSDFSNLYVSQAILESLSKVKNKSGDAPIELKKIMLNIFKYIDGS
                     TNQFDDTLFHCSLVESLGNLIIASNKEIPSLDLDLQFDIASTPGDICDQFNSSAIQEL
                     NRYQKMDEWSPSYNNLITLTVIKQKIRLVTAGLARMSFMDVIKYTTSKYNDDIRLFAF
                     KSLLLLGGFKNRNILHYFFSTMKLDNSPGFRYNLNKTLVECVGIAAYTSLPSLLADEE
                     FLVTPEVNSLKSNRFIQIEHSISRLSSHSRADEIARKSIQSSIEMIRNDLGVGKGLRK
                     ELWDTAYSCLVPINTRRNVLDIMMVLYEAKDSFMISTNLPSDKHIVCKVKNKSTDSLD
                     PSSLSYVIALKREPRFKIQLPILKLVGKGDPKKEVEMDDVVSNTENEGLLMSAPILTL
                     SPKKPRKKRAGSVTYENNGNQFNVRIRFHKKNQRNYKRLENPRIISHDPSLPLRYVRF
                     NLRTNTVCVSTNEEFDSLLKQETFNVNIRINSEKWRSYLKKIDSERSIGITEIKTKGG
                     ADSELTNLVSFGAHSSEDSKSCSDTQGKLATAKRDSNEVDRSEHTHWEQVNLKNQDGA
                     STTEENFGTPVKLKLSLKPNSEGRAFDHSHEQATSNFASTSSENTTVVSGSRKKSQNS
                     NTVSPKKKQIPKIKLKLK"
     gene            complement(<680808..>683306)
                     /locus_tag="C5L36_0A03110"
                     /db_xref="GeneID:40381419"
     mRNA            complement(<680808..>683306)
                     /locus_tag="C5L36_0A03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463326.1"
                     /db_xref="GeneID:40381419"
     CDS             complement(680808..683306)
                     /locus_tag="C5L36_0A03110"
                     /inference="similar to AA sequence:RefSeq:NP_015416.1"
                     /note="PKUD0A03110; similar to Saccharomyces cerevisiae
                     YPR091C (NVJ2); ancestral locus Anc_3.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319186.1"
                     /db_xref="GeneID:40381419"
                     /translation="MHLIFRFILTYLFGGVSFVPLTLLLIWYLSPQTSEIPEERTKQD
                     ELKAEQESLKHGEPIGYRTLRAGELFYRQNSGKKASYSGWITVTKEFYRFPQINSEDF
                     KSNAENAEMDTESNVLTDGTTGSSGIFSKMMKTGNNSNNHAAGSGVNSVDDENESDPA
                     AHGTGKLRTIRKRNRFFGVIKHGNLFLYSNETQKDVKHAIVLDNYIVALWPRDLTDGQ
                     LFTKRSSIVLIKKADKVEEMEHLVDILEGKALNITLPKSSRYLYADTSIEKEDWYFSL
                     LRATSGEYNMTGHSVFDKLNPTLMARPLYCNTSDMIDLIETLNSTEHQLSSKWLNALI
                     GKLFLATYKTEEFKTAFKNKIEEKLKKIRTPGFLDQLQIQRIDVGHAAPFITNPRLKS
                     LSPEGDLEVLVNFSYAGKAMVEISTKLFLNIGVGFKQRQFNIIMKITVNKINGELMVK
                     LKSEPSSRLWYTFTGMPDIDLEIEPVLSSRNISYGIITTILENKFKDAIKTSLVYPFF
                     DDFIFYRSPQELFRGGIFDRTVRTKTNEQDIGSSHAMEKPRSGDNLEVEAEKTTISNA
                     SVQSKGSINTSCSKHSEQPSQLSTIPSLVDGDESNQQKSTDSVTSEQIKGTVIKSYAK
                     IKQWYKKQPATEDNKTSSKANRVLTVNKEEYNPPEMISNRRRVTPRLESTMDSAKAET
                     FSSGVSHSNARGEAFINLERKRAGSQASKFGSVSSMEDVFRAQRTHASPGSPKMFVNE
                     KYGSVSSNTPNVAEFGAASQPWVKPSPENGNAESFIATSVIGKEMSHEGPDEYQDNVN
                     DLETSQKLSSKRRPPPVMTRVIPSTETKTEYEPI"
     gene            <683549..>684100
                     /locus_tag="C5L36_0A03120"
                     /db_xref="GeneID:40381420"
     mRNA            <683549..>684100
                     /locus_tag="C5L36_0A03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463327.1"
                     /db_xref="GeneID:40381420"
     CDS             683549..684100
                     /locus_tag="C5L36_0A03120"
                     /inference="similar to AA sequence:RefSeq:NP_009680.2"
                     /note="PKUD0A03120; similar to Saccharomyces cerevisiae
                     YBR122C (MRPL36); ancestral locus Anc_3.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319187.1"
                     /db_xref="GeneID:40381420"
                     /translation="MFATTFFSKTALNTNTVPQIRGYAGRVQIQSALPKRPLKKIRVG
                     KARPAIYFKFNTQVELSDGSVITRRSQYPKDQLRMITDQRNTPLYNPSKPDASLLDAE
                     SKGKLNKFKSKFASFDQSGKSAEEVEKEAKKAEEERLLRLKTGNITQKTEKDTDDLLD
                     ILSESYEEVKLGGNLAQKEKRKK"
     gene            complement(<684223..>685683)
                     /locus_tag="C5L36_0A03130"
                     /db_xref="GeneID:40381421"
     mRNA            complement(<684223..>685683)
                     /locus_tag="C5L36_0A03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463328.1"
                     /db_xref="GeneID:40381421"
     CDS             complement(684223..685683)
                     /locus_tag="C5L36_0A03130"
                     /inference="similar to AA sequence:RefSeq:NP_012833.1"
                     /note="PKUD0A03130; similar to Saccharomyces cerevisiae
                     YKL090W (CUE2); ancestral locus Anc_2.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319188.1"
                     /db_xref="GeneID:40381421"
                     /translation="MADLELTESLLKASELFPDVPIHHISHVLQVSNDNLDTAIEQLL
                     NYDLIKENIANSADPDLSEKGNIGHREYIFPKDVGESSAERGDQSSYETAKGFKKENS
                     EGGTKKTINNELELIKLEQIIERIEMQDYVMDLLGIEESNRDLVDWFLEQNKFDKLNS
                     ICDIMLNLNPELPPNRQSRLSFAKTSLNDIVPRNLLAKGSTSMSDLIKGDQQNAPISQ
                     FNLYWDEIKGFIKSNPELDLPDKFYMLCINWFQNDVAKVIHLAVELNTCFVKCKSKNP
                     RKKRDQKVLDWAQVTYALNTPNHGKSHEIDSTEWNVLKPSLQDLSLRADSPKTLESLE
                     QKARNLKNVRNVTNDKHLKAYYSNSIRDTKHKIRQHKDYVQISEVSSRVERAKTSHCI
                     DFHDLTVQNAMTALEQVLTYWWDLEMHNRNISNTKFELVNVQHVPPFKIVTGRGLHSS
                     GGIPKIKNATIKYLQLHKYKFEENASSIQVTGKRRI"
     gene            <685985..>687952
                     /locus_tag="C5L36_0A03140"
                     /db_xref="GeneID:40381422"
     mRNA            <685985..>687952
                     /locus_tag="C5L36_0A03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463329.1"
                     /db_xref="GeneID:40381422"
     CDS             685985..687952
                     /locus_tag="C5L36_0A03140"
                     /note="PKUD0A03140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319189.1"
                     /db_xref="GeneID:40381422"
                     /translation="MSDTTSQRNHQEQVPGGANAHITNDRNLTPRTLEEAGITLHPDG
                     HYTLPAVEVQYRGGHTQTLLIDVGSMMVQPTVITTTSLATVSDLLRNRGNGTSNNSER
                     GNQDLFDSAGQNFFPPSHTQASFADGPVSSDQHTDNSAREAPTTNNSTTDSENRRPIR
                     GLDYPAFDVSSNGIYNDDSQPASRILGRLFERALGTRASSIPPTQTTNTPSRNTPEVS
                     TEEADTTTSSSTLHTVSPSTMNPVHQTPSESRNIILTVNYVYGSNSDNNSGSLLLYVP
                     NIDDNNEENVGVLVRLTTEIALRTIATALKKSAGVSKEIFDQLEVKRVEELNESDSEC
                     PICYDKYVNKDECSTMKRKRVDGEEEPKNGYIKRAKNNSGESTPLEDSSKDEPKEEGS
                     KSSLKHYPVAMKCGHIFGASCLQEWLKTNNSCPLCRDKLPNKLETENNGARYITITLP
                     NLARIIGISRPLIQNFNNRQMTFTLSDDQDSVPNDIVIDTRSPFPNTSNTAPTLDIPE
                     RSPQIGETNSTNSAGGNNGNTPNNGQSLLNFIRDVISSFAPRNTSGNGRVTQHTPRPF
                     RSVSRTPPQFGGIFPPLGVESRRTANGVETRELSSLDNSSTVSMAERVREATRPGDSN
                     EEGTNFQHEHASGVRPSNDNSSTDTNTGTNP"
     gene            <688211..>690130
                     /locus_tag="C5L36_0A03150"
                     /db_xref="GeneID:40381423"
     mRNA            <688211..>690130
                     /locus_tag="C5L36_0A03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463330.1"
                     /db_xref="GeneID:40381423"
     CDS             688211..690130
                     /locus_tag="C5L36_0A03150"
                     /inference="similar to AA sequence:RefSeq:NP_013189.1"
                     /note="PKUD0A03150; similar to Saccharomyces cerevisiae
                     YLR088W (GAA1); ancestral locus Anc_8.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319190.1"
                     /db_xref="GeneID:40381423"
                     /translation="MALLEVIQRKLVRTGSLNKLTRILPRVSFFMTISAVIFLLQLAL
                     DGQYRHTYISENAMMPGQAHTFFRESEWNFVRGYRNEVVNMMNYSLNEKTKAVEELLI
                     SMGYKTNILEYTDPSTGEVKPTLYAIYHVPKGDDTEAMVLATPWNATDGRLNVGALSL
                     TLGLARYFRRMSIWAKNIIIVFPQDGGDALRHWVDAYHTSLENTAGSIESAIVLDNPS
                     SRDHIGYIELEYAGVNGQLPNLDYVNTIVQVAENEGIKVSLNHTPFGQLWTNDFYSRV
                     VALIGGIFDIAGSGIKDFGNAQAFSGWNIQAVTLRAKEGDRNDITSLGRIVESTFRSV
                     NNLLEKFHQSYFFYLLLGPKTFVSIGMYLPAGALTAASFLVASLNAWISGNNTSIDVT
                     SNLKKSLSFKTSQLIYAILTIVILIFSFAIYAYKTTICQNPEDLVYRYFVIPFFIVSL
                     LPLLPIRVRISSDFSRALSMGALFYMGYMLVGLMILNFPLSLILGIITSPLNFVKYSE
                     KMGWRRKLMNTTFLITSCPSVWLIIFGVLQHTHFPLDDVRNLFQYFEYPLLQTEIQKV
                     LDFIESVSLSFWMEGPVELFVGLTQAYKRVQCWTWYYTCLTWFPVWTCLAIVGSFDVY
                     PDTVNVEMDRIKKDQ"
     gene            complement(<690294..>691811)
                     /locus_tag="C5L36_0A03160"
                     /db_xref="GeneID:40381424"
     mRNA            complement(<690294..>691811)
                     /locus_tag="C5L36_0A03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463331.1"
                     /db_xref="GeneID:40381424"
     CDS             complement(690294..691811)
                     /locus_tag="C5L36_0A03160"
                     /inference="similar to AA sequence:RefSeq:NP_010396.1"
                     /note="PKUD0A03160; similar to Saccharomyces cerevisiae
                     YDR111C (ALT2) and YLR089C (ALT1); ancestral locus
                     Anc_8.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319191.1"
                     /db_xref="GeneID:40381424"
                     /translation="MLKRYFSSSRIMSKSLKDIALASNFKPASRLGDKDLNPHTLVAK
                     YAVRGKIPTMAEQLKGTLQSDPDALPFDKIIFSNIGNPQQLGQKPITFYRQVLSLIEY
                     PDLLENEKAKEIFPQDAMDRAREIMQNLSSVGAYSHSKGVKYFRDTVARFIEDRDGYP
                     ADPEQIYLTAGASTAVSYLLSLLADGPKTGFLIPIPQYPLYTASLALNNATVLPYYLK
                     ESDNWSVSASEIEDSIVESKEKGIIPRCIVLINPGNPTGAVLSEDAIAEIVDVAAKHG
                     LVIIADEVYQENIYEGEFVSVRKVLKKLQELNPSKYENTQLASLHSTSKGMIGECGQR
                     GGYMELIGFDDSVIQQVIKLASISLCPPVVGQALISLMVNPPHENHPSHGIFHNEKWG
                     IYKQLKERSHNLFLAFNKMEGISCQEPQGAMYCFPSLTLSERAQAEARREGMEPDEFY
                     CVKLLENTGICTVPGSGFGQVPGTWHLRTTFLAPGSEWIEEWAKFHQRFMDAYRN"
     gene            complement(<692377..>693918)
                     /locus_tag="C5L36_0A03170"
                     /db_xref="GeneID:40381425"
     mRNA            complement(<692377..>693918)
                     /locus_tag="C5L36_0A03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463332.1"
                     /db_xref="GeneID:40381425"
     CDS             complement(692377..693918)
                     /locus_tag="C5L36_0A03170"
                     /inference="similar to AA sequence:RefSeq:NP_010135.1"
                     /note="PKUD0A03170; similar to Saccharomyces cerevisiae
                     YDL146W (LDB17); ancestral locus Anc_7.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319192.1"
                     /db_xref="GeneID:40381425"
                     /translation="MNEVSNQPSKNVGDIGSMKEFWELADELLYTKLYYDETTKEYIT
                     SWKQTETTESEINTLLVSYIALISKYREIVGDHLGEVCAYLLDIESYQKHREFCLRKM
                     LSLLIYSVDCNLNNLELNCDVLGGEILREVNESISMNEQFINIIGCIMIKEHERDNQL
                     MNILKEYQGFTVLSKVVRNYAAITKRTGDIYTQNYSPYLILWFDLCKDNNFVDEIDNI
                     YEDEIIFLFDKLKVETRIEDEVNYIKFRLLLILNEQYVYQCGLKVQNGKKTNLVVYQM
                     VRKIQYFQTFTEILVLNFNREMDTIDQILMMKYLYVVFSNEKTNRLVYLNDVKIIVDI
                     IIRQLYDIPIKASSYIMDIYLRVLKCMLTKTNLRRHSYKREELVAVLEYLRGEDVNEH
                     TRRLIDRCLQCSFFNPLTYANTQDNRSEELLPIRKVTPLIPPERSHSLPQLVQSPQPS
                     PPSFSLPPPPPPPPSRLRGRESSVSSLSTSSSQTSGQGLSRLSSAKPPPPPPPPARTT
                     SRRIV"
     gene            <694165..>694917
                     /locus_tag="C5L36_0A03180"
                     /db_xref="GeneID:40381426"
     mRNA            <694165..>694917
                     /locus_tag="C5L36_0A03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463333.1"
                     /db_xref="GeneID:40381426"
     CDS             694165..694917
                     /locus_tag="C5L36_0A03180"
                     /inference="similar to AA sequence:RefSeq:NP_013312.2"
                     /note="PKUD0A03180; similar to Saccharomyces cerevisiae
                     YLR211C; ancestral locus Anc_7.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319193.1"
                     /db_xref="GeneID:40381426"
                     /translation="MSLGLVDVYGEEQNAERSTYSGDIPNAIQHHEKAISELNMIIEK
                     IIQKKQHENDEFGVIDSLVVMRKQIESRIDQLRKIKPNSSSLDGNTIVKNKEAVESIP
                     LLNSALADIQVSLLKNLNIRLKDHNSSKKIPFVNNFEINKIEHELQLLNFKSSHNINH
                     RNELLTKLNMLYYGEMMNQREFIKDVVDIVKLCESRASIDKDWKKIDQITDDRLLGIV
                     NELQERINRLEREKLHMEHEIITLKEKLNRNI"
     gene            complement(<694932..>696254)
                     /locus_tag="C5L36_0A03190"
                     /db_xref="GeneID:40381427"
     mRNA            complement(<694932..>696254)
                     /locus_tag="C5L36_0A03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463334.1"
                     /db_xref="GeneID:40381427"
     CDS             complement(694932..696254)
                     /locus_tag="C5L36_0A03190"
                     /inference="similar to AA sequence:RefSeq:NP_010134.1"
                     /note="PKUD0A03190; similar to Saccharomyces cerevisiae
                     YDL147W (RPN5); ancestral locus Anc_7.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319194.1"
                     /db_xref="GeneID:40381427"
                     /translation="MSSDPFQKPQKDFTETLNEQFVQIDELIKSNYREALDKLLLLEK
                     QTRQASDGASSQRIMVKLVGALVENKDWELLNEQITLLSKKHGQLKDSIQVLIQEVLK
                     NLDKITDLDTKINTIETIRVVTENKIFVEIERAHATKILSDILLKEKNNLDKACEVLS
                     ELQVETYASMELEDKISFILDQITLNNMKGDFQFSKILSRKILVRTLEKFANLKFRYY
                     ELVNEIALFEDDYENVVKYNMNIYSIPKVQGNLELSLKYLKTVAIFVVLTPFSNLQND
                     LISRVVIDKNLSKLPIEEELIKIFTTKELISWKSLESSLVSKLLSEEVFDQETEKGKL
                     HLSDLKKRVTEFNLRVISIYYSTIKLDRLCELLELDQLQTENYIIELVNKGDLYAKIN
                     RPFKVVTFIKPKTENELLNEWSSDIDRLLESVETVEHLINKEEMIHGK"
     gene            <696522..>705470
                     /locus_tag="C5L36_0A03200"
                     /db_xref="GeneID:40381428"
     mRNA            <696522..>705470
                     /locus_tag="C5L36_0A03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463335.1"
                     /db_xref="GeneID:40381428"
     CDS             696522..705470
                     /locus_tag="C5L36_0A03200"
                     /inference="similar to AA sequence:RefSeq:NP_013188.1"
                     /note="PKUD0A03200; similar to Saccharomyces cerevisiae
                     YLR087C (CSF1); ancestral locus Anc_8.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319195.1"
                     /db_xref="GeneID:40381428"
                     /translation="MDTASKFELRSVTSSVNMNWVFLVDWVIIFFAATVFIFYFNRIL
                     GEVITLTATHILLRRKKIKFSIQSMKVNLLAGRLFMKNLSVITKDEIILVHTAVLTWK
                     YWVQYVRKSQFYVQEENLNDELNSKLPSRFLLEVEGLEIFSFNKSGAYDNIESILKQE
                     SASKSSESYTKKSYKVSFDSSNISTNENANIRRRKSESSSNDTFNYTQNSVSDTTEEY
                     TSEDSEVMDSTFLDFLPFEIVVHRGSFVLGNKNTPSLFVAYYSSMKGNVDATLPGCEL
                     DYYRTLYDFTVSNLKVDLRTNVTYESIDSLKRKMESFQKKKRAKLARMYKGFKGLIEK
                     FEAIRQKRGKADVQDSSNTQNIEGATEEWHGLERYLSAFSTSDSQLNMELNTSESDKS
                     KINGSEYAKHSNICDVEVFKINYYYDSQGLVPSNPISKTIKEDPDIGNNGPAPMFGCD
                     ITILGTTVNYGPWAEKQRGSLHQLMFPTLYRNTIPFQRLKPGMRRQYASFDMSIECGS
                     DVIVRVPHREESKDISFLQSPNLNNRHFGWLDLKLGKGSITDISISFSPTVERGTENK
                     INAVFLKPVISTSVNHDILFAADEHIFNGSIAFPLEWNGLCDWKFENISKGADIYLLR
                     EHITQISDLLGDFSSGEPTPYELFRPFIYRFNWKMYEYTFYLIINEGNIINNPLDGTI
                     NTYLTIKGSDLKLTTKIPLVHPYKKSNTIDYCLETSYFTLAIEHPASSTFSNFIQNNE
                     IGESNNFKMQGSYTYFSLIDIDAVDTIIIHCTCDDTTLKAHGFVIKYFMSLKDNYFGD
                     HTHFQNLLEFRESFGKQKEIINEGKRMKNETDLLFSFCVDNGCLVFPCHLYDCSSHLA
                     LHFDTLDIDLRNNNYYMDLQANFQDARGRYIPDCDELEIFANTKHKVDFVPELVIDEL
                     SIHSIRIFGLPPVEPTYYCRWNFDSSTIKIDAEPIFLDALSRTAKSFKFGYADLENSL
                     SLMVTPVRDVLNLSFKCSNIYLKIKRQDYYFQVNIANILLRLSDQPTVFYNSLLELVI
                     ESIVAECYQNDVQLLKFNSSLEMKNFGQKKDAFEYMKEQALHLKKHDAPYHRTPFIIP
                     EFAKDRKYFKEQDSITSSLYIPDPPLPLTNQSVEMLIGTFPLRIQEKLADFSTTLDEN
                     DEDDYDDYQKFSSNLEDFGVLKDLDPSCEYDSIPVRLPKLEVFVSPKIAPVFVDIVSN
                     MTEFTIDCFLDALQTDFVDAFKFKQENKSLKMKFECPMITVKVSEHIESEAYCFLGVS
                     DFVFAFSKSNVGSSESSNIYSIVKSINIDIVKNTSDVLRAYFFNILVKRSVGTKEILT
                     FDLEDTALFVDPIHIPWLLDWAYSYQNDIQLAIKNWNQYQKDKRLANVELLYDLSRAG
                     IDYNIIHDPPCITKPSYITGFSKNHIRMDGNWMIIPRLRHVLKNLPGEWISLKDEIFK
                     NKTWEAPRDAESEVGVIFSNWRVWDNHKKDDNFIFKKVFNIEQATTKNLLSTYKIALK
                     TIKLTINPFANAVIVENIFMLINEGELSQEIKTIALPLLDKPIEKSLDINIKVSFLRT
                     NFTKISRLLPRLYPLAQNLKQSISAFNSETEESDSDYANSDLGSTDSLHGIPRYEEVA
                     PVLITANFTLDEYTHAFGIDKSKVVFYGQNTTLTSSIVRAEEMMSCTINLKNDYIGSE
                     FNIDTIPIFDLRCYMHTSTLVNTGSFRRGNTVLYLTNQKIKADFLPDSKQIVSAMKVL
                     FKDELSPIYHVVGVFKNSKKAESDSAIPQKRLSVIEWLKEDFFQTLDFQLSASMKTST
                     VIFHVELISPFFTNLQIIDPKFSFKLSKFGFILEYYMPSSKWSIGSQVGNYVYNYFTV
                     TIDKMKTMLASHYQNKSNQVLSKIVGGFLRINFAQNDLIQMIQKFQGDFDIARSNFEL
                     LKISIEQMTHMLQTTNKEECSISAPQKSSFDIEDIFRLVHVTFDFTFGNVSSLLNINE
                     NKIHLDWAKPTIFIKTYANKLKKFSPHGRVTFPHFRLSVGLNGVQGITTFLDINTLVE
                     VKTPIDRGNRLPKLEVKSDYCRVILNPSIVEELIDIVTDISSLWKPSASRLDSKVQHS
                     DFEDKFEAIFSFFSINIVTNNFCVGWLFEESVLECHPNVIAPGIILGFENASISCAKD
                     AGKLNMSGMYLSTAHGYMSSTFYSKTSEKESNNRAFFPSFNLVYIVDSRDNSFKLRSQ
                     VNGEKVDFKFQTDIFSITGPLKYSILSINEKLSLAKGKMNLNVNEKHGDNDHKDLLIT
                     RKNKQYTFEFVFEFAGASFFIYNPNIGINDTIPILSLHSPKLSSVFRYTHNHLKSKRH
                     SILLSALVSETNNKISCLCVPVLHDLKQSFKDMMSKGNTSIQETTKKDSSSIDVVGLT
                     KNLDINFSLTIKPQYLSLTCEPRANIEAEVVLGAIHLIAKTDQEILSLVLHVQFLKSE
                     LKHAYSKVTSGSVQMEGLSVNSSISRISENQKFSTVISLKSADAFVNIPQRQDLDLFR
                     DFWLPNNSTGSIFVPKGKSESNKKTFTSILREVSSTAAFPWVLTLFISKISARVELGS
                     SLGTLNVEIFNVDALTVKSIDWDSNFRLQFEVVKIQATGRLDGILMANKVRMTSSVVW
                     KRDNEVLSIPLVLLSIGIHSLETRISLDYHPFFILEVLNVGVTSFNQREPTSHDKLKL
                     SLKLESLRVYMTALMASNFVDVYTIGLRIRQDTRLSYRQVLNDAKINLEKSESVNVPA
                     PSETFFKMIQKLKTYLNVDIGMVRVQIYPSSLTDRQAMVVKLGHSQAYFYQNSVRSLV
                     NHLELKISDITVSLSSYKKRPTIESLNNSNGIQEYIKTANKIVDDNIFVFPSVNISMK
                     TLQGVNSNTVQYKYFCKFDGKVAIKWKIGSVYFIREMWYTHATTLSNRLTALRIYTSD
                     EYTEDTEENYKQSTLEAVNLESKLKDVESDAKYTYVPQAPPEIETPQLKDLGNATPPM
                     EWFGLHRDKFPNLTHQFIVIGLQKMIRGVEGKYSKVLK"
     gene            <705548..>709495
                     /locus_tag="C5L36_0A03210"
                     /db_xref="GeneID:40381429"
     mRNA            <705548..>709495
                     /locus_tag="C5L36_0A03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463336.1"
                     /db_xref="GeneID:40381429"
     CDS             705548..709495
                     /locus_tag="C5L36_0A03210"
                     /inference="similar to AA sequence:RefSeq:NP_011018.1"
                     /note="PKUD0A03210; similar to Saccharomyces cerevisiae
                     YER093C (TSC11); ancestral locus Anc_7.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319196.1"
                     /db_xref="GeneID:40381429"
                     /translation="MILRDRVKREITHTQLLKDGAVKMLGTSSLSNSARIQAVEQLHN
                     AMDDIYRYKQQLDLLDSMENLKRVDTKEKVEVINIQLNLEILIEKLKTTDEPEEQVKT
                     CNEIAKIFQNEDAKLKLPSISSMIPIIWPMLMSDSASVKSAGFQLLKYFINNYDDVVI
                     LFYQYFKHHQHEKYYYYPYVKYSTIEVDPYLDLDLNLDSDNERDPVSINPIHNISIKP
                     LTKKNKISDFTIQKWQPLLLIIAEVLFDDDLMTIYQCTLFIDRVLLLGGVEFINTLGT
                     RSLVYCLNMQLSKFTFDWETLVERIRVIVTLLDVLCTIGEKNGKLAYECNVFKELISY
                     TISNPFINPIFQQPTIAGFQMEQFQDSLRDISMICLPTFLHVLQKNSVYLVNSDFCER
                     IIASLEDQRGSHVTEIIQILLCTWSGLGLFLDDNNKCLKMLLDGLYDGRKRAILNIIS
                     YVLGIRGDIKLYNWEKANSGTHNINDEGMASKDSIRVCEFRSVFLSACLESQILDLFD
                     DISDGLENEIAPILRKVFEISEKKRLKCRYIMKNERLNELIKQNVESKIEIEDSIFLK
                     TTTISSINSLVSLTGSTSLLTDQIGPNFLKLKLKTMNENIDIKPLIWSTHVPQTKEYR
                     DWNWKLIGTLLRGVLWNDRFFEDALKGTKFFKRLISFYKPQKAGFVQIKKKERVSNSR
                     KVVFDDDRIENSGGGIERYKSKIHEITKSDQEEQHEDDQDKLEKTLTNYEYKEYHQPG
                     EVYIENGKSLFSLLLSKREGVEILRDSGIIQTLTISLLKCSGEVKVEGLFGDKRMSET
                     LSAGYLSMIGVISSYSSGVSLMEEFDMIDAFFQIREENVLIELTKELDVMKSGLIRKF
                     IEKQSVVGSKKVRLNVISRMNKLLDKEYEDYTIDKWVVKILINAIYDFNNEISNKGIQ
                     GIIKYLEKGGDIAYVLSYNPDIGELKEVGGEVYGSGILWYILGYDLGVEYVNEKYGGL
                     VERIVEEWVDRREEWVQRIEIGLYEELRGIRAVENDYSPEKKRYNCFELFERLVKTDS
                     GISSVVKINDNIVSHINDGQLDAIAIYSLGEFGRSENGIMILEEEGVVETVVSICDNR
                     HNYAHITWRIRGAAFSALAAWRMHPLGVELVEEARASATCPSSYAYGRVTYRDTNIDI
                     CTELGGVHIDEGTSPSIWGGKSTTILTPISASTQVSASASATVSASVSASALEIIPES
                     TLTNKGSRETPSESAPEEWTSTLGVRDLLRGVLATGGSAMAGLAESGDVRAETEPVLE
                     ERLAKIAAEGRSAAQILKSQKALKEKDISRTRYWEKNAEFALALFGEGAMRGH"
     gene            <709848..>710606
                     /locus_tag="C5L36_0A03220"
                     /db_xref="GeneID:40381430"
     mRNA            <709848..>710606
                     /locus_tag="C5L36_0A03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463337.1"
                     /db_xref="GeneID:40381430"
     CDS             709848..710606
                     /locus_tag="C5L36_0A03220"
                     /inference="similar to AA sequence:RefSeq:NP_010672.1"
                     /note="PKUD0A03220; similar to Saccharomyces cerevisiae
                     YDR384C (ATO3); ancestral locus Anc_5.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319197.1"
                     /db_xref="GeneID:40381430"
                     /translation="MSNYDLEKQVSQDEHLETANNNSPPVGLYDSQSFNSNHVVHKVT
                     TSDDGNYIYLGKKKFAKDDLLQAFGGTLNPGLAVAPSHKFANPAPVGLCGFALSTFVL
                     SMINAGAMGVSNDSVVVGLAMFYGGFVQFCAGMWEMVMENTFGAVALASYGGFWMSFA
                     AISIPWFNIASSYDDPIEFQNAVGFYLLGWSMFTFMLTLCTLKSTLAFFSLFFLLAVT
                     FLLLAIADLGKSPNCKTAGGVVGVIVAFIAWYNA"
     gene            <711024..>712082
                     /locus_tag="C5L36_0A03230"
                     /db_xref="GeneID:40381431"
     mRNA            <711024..>712082
                     /locus_tag="C5L36_0A03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463338.1"
                     /db_xref="GeneID:40381431"
     CDS             711024..712082
                     /locus_tag="C5L36_0A03230"
                     /inference="similar to AA sequence:RefSeq:NP_012222.1"
                     /note="PKUD0A03230; similar to Saccharomyces cerevisiae
                     YIL042C (PKP1); ancestral locus Anc_7.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319198.1"
                     /db_xref="GeneID:40381431"
                     /translation="MQRLQTHKLIQRLATNALPSTRKTLLTTSIYPSANQTLETLLIL
                     ISKRLESMSKLPYIGMMNVNMAKIWTSYISSCQDLLNYTNAGDYQDLMHFQIGNDLQN
                     KQFVSILEKLLIDHADNIPFLRDGLTESEIFKNDESKEREFLNLHLKERILMRLIASD
                     HIEKSNGNLTGVADRNLDVLDVLHKSIDFVDSMTLMKYYEKVKIDIETRIVDNNGDDK
                     LVFPYISTHIEYVLNEILKNSARATIENNSSEPIKILVILNKLEKTLQFRVSDSGGGV
                     PPHILPHLWDYAFTTVNETSKSDTLGLDTGVHDNIVAGMGYGLPLSLIYTKIFGGDLN
                     LRSVWGKGTDAYILFKGI"
     gene            complement(<712148..>712615)
                     /locus_tag="C5L36_0A03240"
                     /db_xref="GeneID:40381432"
     mRNA            complement(<712148..>712615)
                     /locus_tag="C5L36_0A03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463339.1"
                     /db_xref="GeneID:40381432"
     CDS             complement(712148..712615)
                     /locus_tag="C5L36_0A03240"
                     /inference="similar to AA sequence:RefSeq:NP_010970.4"
                     /note="PKUD0A03240; similar to Saccharomyces cerevisiae
                     YER050C (RSM18); ancestral locus Anc_7.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319199.1"
                     /db_xref="GeneID:40381432"
                     /translation="MFKRSLHTSRSAYDAAPFKNINEAFKSATSMQSKIQTTVINDRF
                     IPNMTNKKTYDPFDFSISAQRYQTKVNKAQMANYMKSSSFNSREINPTDFYVIPHLLN
                     GYMNSSGQILHRDVTGLSPRKQKQMAKAIRRARAFGFLSSVAKDVSTFDKRNL"
     gene            <713525..>714916
                     /locus_tag="C5L36_0A03250"
                     /db_xref="GeneID:40381433"
     mRNA            <713525..>714916
                     /locus_tag="C5L36_0A03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463340.1"
                     /db_xref="GeneID:40381433"
     CDS             713525..714916
                     /locus_tag="C5L36_0A03250"
                     /inference="similar to AA sequence:RefSeq:NP_010971.1"
                     /note="PKUD0A03250; similar to Saccharomyces cerevisiae
                     YER051W (JHD1); ancestral locus Anc_7.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319200.1"
                     /db_xref="GeneID:40381433"
                     /translation="MSVRRSGRNRTRIDYAALNETHTIQEHNVHPHTQAFKEFHDAST
                     LDDKVCVIENPLETFDDEKLRDLVYKTRLLKPILIRGANPNVSDTYNSNIQLSFEIPA
                     YDMDQVTEKVGEDHKVPVMDVMTQNNSPFWNMAKWRDYYQQSREERDKVRNVISLEIS
                     ETELGREIKIPKIVEDLDIVYKLFEDNSKLNFSQLLDESGIVPPKVQKYILMSIAGSY
                     TDFHIDFAGTSVYYSPISGHKQFILFPPLKRNLEIYKKWCLSDDQNKTWLPSLIPTLK
                     QSEIARLRQTRTPEAYLNNGFAIDIFPGDLLLLPSMWIHSVYTKENSIIIGGNYLNLL
                     SLKTHLQAHQIEIATRVDEQFKFPNFVKFVWLIAYYLIKNNDYDEAIHEEIVSLLNFL
                     KEQWTFVSKAGGKSFTRRDRLLVSKIKSAIPKEVIGDVPAFLEELKIKVDKTCDNSEE
                     PTRKKLKVENSNT"
     gene            <717490..>721017
                     /locus_tag="C5L36_0A03260"
                     /db_xref="GeneID:40381434"
     mRNA            <717490..>721017
                     /locus_tag="C5L36_0A03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463341.1"
                     /db_xref="GeneID:40381434"
     CDS             717490..721017
                     /locus_tag="C5L36_0A03260"
                     /inference="similar to AA sequence:RefSeq:NP_010136.1"
                     /note="PKUD0A03260; similar to Saccharomyces cerevisiae
                     YDL145C (COP1); ancestral locus Anc_7.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319201.1"
                     /db_xref="GeneID:40381434"
                     /translation="MGTLIDRFEDHDGPVRCVAFHPTQPIFVSGGDDYTVKVWSTQTR
                     KCMFTLTGHLDYVRTVFFHNELPWIISASDDQTVRIWNWQNRKEIACLTGHNHYVMCA
                     QFHPKQDLIVSASLDQTVRVWDISGLVKKHSAPSSSSPYGNGSMNQFDQYNRNQPPQQ
                     DIFGNTDAIVKYVLEGHDKGVNWASFHPELPLIVSGGDDRSIKLWRMSETRAWEVDGC
                     RGHTNNVPCVLFHPTEDLIISVGEDKTIRTWDLNSRSPVKQFKRENDRFWMVVAHPNI
                     NLFAACHDSGVMVFKLDRERPASTINPSTQELFFINNDNQVQKYNFGSKATSLPLLSL
                     KKIALPWNKIRNISYNPSENSMLIQVGDNDNGVYSYFNLPKEVVGALEPSIRGEGKAN
                     SAYFIARNRFVTFLRSSHKLDVHDLNNNITKSITLDSDVKDIVPGIPGCVLLLKGSSV
                     VLFDVQQKKELGTLQMNNAKYAVWSNDHQHLALLSKHTIVIVNKKFETVMSMHETIRI
                     KSAAWDDTGVLLYSTLNHIKYVLLNGDRGTIKTLENTLYITKVSGNSCYCLNRKGEVE
                     AFTIDPTEYRFKKALINKKFNEVLRIIRNSNLVGENIIAYLKKSGYPEVALQFVEDPE
                     SRFDLAIECHNLAIALEEANKIDSKPIWERLGKEALIQGNTQVTELVYQKLHLLDKLS
                     FLYLTTGENDKLNKMANIAEAREDIGSLFTNSIYLGDVERKIQTFINAGLTPLAYATA
                     KSSGLEELADSILEQSGLSIDDVSLPKNITKKPLGVLKPVNKFVENWPLGEAKLSFFE
                     QALSGNFEDLSIEESKVTEDNANEIMDDAIEYQDDDEPIDDGDAWDLGDEELDVDLDV
                     EEELEETNTDVSKLPKELRSWVKNAKTPGAYIAAGKFDVAAGMLNKQAGIKNFAPLKD
                     RFMEIYTASKLNISTFDEAGIKTSLPVYINDIEKADEAGKIVGFVPGYDELENLVQEG
                     YKLFKANQLEDSIQIFRKVIYIIATLSLNSNDEEEKCKEIMNICKEYILALQIELTRR
                     ALPATEVKRNLELAAYFSHMKLQPAHRLNALQVAMTQSFKAKNYHYASYFASEFLKIM
                     STGSRAEQAKKIQAKADSIATDAIVIDYDPFADWEICAGDYVPIYGNDIVREKVLGVG
                     YGKSWKGKICKVTQISEIGGVGSGLRLKN"
     gene            <721370..>724003
                     /locus_tag="C5L36_0A03270"
                     /db_xref="GeneID:40381435"
     mRNA            <721370..>724003
                     /locus_tag="C5L36_0A03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463342.1"
                     /db_xref="GeneID:40381435"
     CDS             721370..724003
                     /locus_tag="C5L36_0A03270"
                     /inference="similar to AA sequence:RefSeq:NP_014040.1"
                     /note="PKUD0A03270; similar to Saccharomyces cerevisiae
                     YMR309C (NIP1); ancestral locus Anc_5.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319202.1"
                     /db_xref="GeneID:40381435"
                     /translation="MSSFFYTSYDSESSSDEDTLYYSDDERYLEQKQKLEKSILITGD
                     DESDSGEETMSESEEEAPKPQASAFLKSSSAEAESSEEEESDEDWSADSDSDSDSDVA
                     PKGRNYFLKSDFLKGSTNDSDDEENEKKVVKSAKEKYLDELADLTDKIENLSMVEEWV
                     RLADEFDKLYKLSYKHNQYHIPIPRSFIKALAILEDAIKNDSSAAPESTKKLSASESK
                     SLNILKQKVKKEAKIYVDQLDIYRKDPEAYEAGSNEPQLVADDLDSEKELSITHANLF
                     SIVQSILETRGKKGVDINEQLSKLSQLLQVAQMTYEKIVLLNLIISLRYELHTKDDYM
                     PTGQWNLACQNINDLLDVLDNDKSFVVTESAPTNDDITKTPPANSEGKHLVVGSVASH
                     VERLADEFTTHLLYIDPNSSEYIAVLKDEAKLYKTIVRTQIYLTQIISPSNYGDLEGD
                     QLCRIVLKRLESIYFKPVQLIVLSELNVWNSLVEEIYEFVPKISSESAESSNEQTNSL
                     IDSLCSHLYQYSTGISSSISRKRAALMQAYYYAASSQFFRARDILHLTHVQATIHTSE
                     PGVQVLFNRAIVQLGLAAFRAGLIEEAQTILNEVVTSPHTRDLLGQGKIYFSNSSNSS
                     DPSSNEKGKFVPFHMHVNIELVDVVYYISSLFVEVPSMALHSYQGSTTGAINAANAEA
                     QASSQSGKKAVSRSFKRILDYTERQYFQGPAEETRDFVFDAYDELVRFNWKKASEILT
                     GLRVWGMMPGLSSTHVEGKSGAELLNQMLTETCKTEALKTWVYVNGGIVKNYSVAKLA
                     SRFELAEEKVSSILGGLIYREEIRAHLKFNAKGNKLIVFEKKEDGMSEIVRDLTDKVN
                     SILERNEKLSSGGYQIMLKKK"
     gene            <724514..>726634
                     /locus_tag="C5L36_0A03280"
                     /db_xref="GeneID:40381436"
     mRNA            <724514..>726634
                     /locus_tag="C5L36_0A03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463343.1"
                     /db_xref="GeneID:40381436"
     CDS             724514..726634
                     /locus_tag="C5L36_0A03280"
                     /note="PKUD0A03280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319203.1"
                     /db_xref="GeneID:40381436"
                     /translation="MSNDAGFRPASKIQIIKDHPNMTPHKTSPKQKFHTIKNFLKNKS
                     SFTDLRMFQEKKEDKNTRSTNVSNNSFKEDPNYKPVDIKWKIPKKKRSLGSLLPSHES
                     KELFLNNYADEVKDFVPPAYTKNLPSTPNSTQAGVYRNPSISTKGSSKASSSPKKTSF
                     SLEYDHTLSTPTFSTAETFVSDDWVPPGTIRGTYVHDWSNDSSPRSFIESRKVERFDK
                     PMLVSTPSTPCKSRTFDKLSLSVNGSTLKPPNNPFPSPCTLSTENDLAIDNGNLTVID
                     EGISSTTLASQSNSHAGSSESCSVHSKDSFKSQFSFLRNRTSSVKFYKSKEQMQKENA
                     KNAEKIERLRIKEFLGTDENSELLNEDYNYIDFDEDDETDELFNRDLFGLEQTGSPPG
                     LELNDEDNEVAPNGLEITGISYSHDEVDNENLCDPGNRSIYGNNIEGEAFEEYEYKEP
                     SGLELTDSEEDPKENTETIKSEGGYRYEPPSRLELTDSEEEGNDINKNIEYDSSADIS
                     IEEVKENEFEISHSNLSKELLSMLNRNDSNLTFKSTTSDISIKHVPSQKFQRHKSVKY
                     HQLSADIESSCYSDGHIWENSSALEEVNQIPEDYDFEAANTFQPNPRKQRFSTMLSLH
                     SNDSNLSAISDVDSNCDPTRQHLWKKLVIKNAVGNQRIERIHLDDRTITLYNRKPGVE
                     PENDQSSISSYDTNDRGELATIAE"
     gene            complement(<726744..>727517)
                     /locus_tag="C5L36_0A03285"
                     /db_xref="GeneID:40381437"
     mRNA            complement(<726744..>727517)
                     /locus_tag="C5L36_0A03285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463344.1"
                     /db_xref="GeneID:40381437"
     CDS             complement(726744..727517)
                     /locus_tag="C5L36_0A03285"
                     /note="PKUD0A03285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319204.1"
                     /db_xref="GeneID:40381437"
                     /translation="MLSNSRQSYEGNYISQRLNECKEGAVSYRSNPELGKEQIQPIYH
                     SYLPPIPGIGNHQVYQNTGNVFNGSYVSAQDTLMSHNSVSSKATTMSIPKIDKHMTVN
                     ANSNRFSTGLEQNQELPENDFIKRQPRSPVKTCYHQDNTYSSINTSRFSIHSFEQTSV
                     TNISTNKVVLINDMPYPVELHFPAKISDRKKSFQGRELSSSIPKNRFDSSIDNTYSQE
                     VSSCSIIGNEIVECDTKTNNYDHPHEYDNVIQVIDSYIE"
     gene            <728660..>729217
                     /locus_tag="C5L36_0A03290"
                     /db_xref="GeneID:40381438"
     mRNA            <728660..>729217
                     /locus_tag="C5L36_0A03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463345.1"
                     /db_xref="GeneID:40381438"
     CDS             728660..729217
                     /locus_tag="C5L36_0A03290"
                     /inference="similar to AA sequence:RefSeq:NP_014024.1"
                     /note="PKUD0A03290; similar to Saccharomyces cerevisiae
                     YMR295C (YMR295C) and YGR273C (YGR273C); ancestral locus
                     Anc_5.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319205.1"
                     /db_xref="GeneID:40381438"
                     /translation="MGLFGKKKEESKSKEYDTKLTAEDEKKMKTRSQNLHDPILSAVN
                     DAQPFEEMNTHNRTSSIGNGVLTDIFGQQITNPDISNPTRARDERPLDTIRSFEYAIT
                     GDPIYHEQLESHIVGWRVRDDFQLGNGAQNANQVQYDEYGQPIYTNNRPTQQYVEQGV
                     YTPTAKTETVEKKKGFFSFGKKNKS"
     gene            <729585..>732755
                     /locus_tag="C5L36_0A03300"
                     /db_xref="GeneID:40381439"
     mRNA            <729585..>732755
                     /locus_tag="C5L36_0A03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463346.1"
                     /db_xref="GeneID:40381439"
     CDS             729585..732755
                     /locus_tag="C5L36_0A03300"
                     /inference="similar to AA sequence:RefSeq:NP_012138.1"
                     /note="PKUD0A03300; similar to Saccharomyces cerevisiae
                     YIL128W (MET18); ancestral locus Anc_2.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319206.1"
                     /db_xref="GeneID:40381439"
                     /translation="MSTHKELINEFIASTDTSAQERSVDEIVKLLQDNSLTLLAFIQA
                     LQLYITSTNDDIRVSTFKLLSQILCKISSSKLYPKDIDVLMAFLYSKLLDRPVVKFVL
                     SSIFSLVSMKFFNNENVNCVLEKLIENYNPKEHPQSIREMALKIVSHLNSSFPQSSYS
                     NNKMIECFLHVSENEKDPSNLLLIFQILQSISKCLDITNFTQPLFDTMFRYYPISFKS
                     STEAQETMIYSLKNSLNTSLASNDLYAEELFPNLIEKYNTATLTQVKLDILTTISTVS
                     QYYSESTIREHILQLWNTLKYTIMNQELAQLVSIPSILSYYEKSSNDTDQIFHSNLIA
                     VKHLANKLDHDSKLLIYDDLSSSLLITERNRRFLQSYLTLAIISLPTENSLNEGNDDI
                     LDKTLSNLFSEEQPTDQIRSKRLVLVALSYYTSNIKFVKHLLPWRDQILALLQASLSS
                     SGLETTLRALAIQLTVILILSPRLQDSTSGLEIGLFDEEAAILITKLGELLIENGAKD
                     AIDSNKVIESELLLAIAKLAKCNRLEDIVNHQVLDRLLNIIGKTDYTLTQKLTLVSYL
                     IKLSQTPSLAESVIIKLSEFLSVDNPDTATYGVPENVILQSITSLTNALSMDHDTVNL
                     TMRLLPVLFRFALNRGAELSVYQVDYLASVSRRLIAGMKHDEAEKLVLESMTFFSGLF
                     PRVIADFSDIQNAENFYRRFSLDEGNIKITHIPILLSMIQGLDVSIELKSRVDMVLLG
                     KHLSMYIVNNEVLPLTRLEILVGVSVIFNKYLSLGDLDSIFGVVDGDIEELQLWALYG
                     LIMKCDEHATEKFVRMLTTLNFRKATKAVSIIFNPIPEMQDALREKKDVDEVSFNNGL
                     DIGPQLLLAFKKEKPSLMMVRSKNKLAVSNLTIRAIWKQKILEFILSKKDELSSTQMD
                     YIVPLILTFVPEEMYASHLESLLPKLIQIVQTCDDNRVILSVLKIVCNVIAEENGRVF
                     MKGYVDTVMEICLTYALQNKDFTLKKQALKTLLGMCLFKTSLVVSFKKRVTKLCEVNL
                     DDHHRDIRMLSVSVRQAWEDLGLDGM"
     gene            <733116..>733952
                     /locus_tag="C5L36_0A03310"
                     /db_xref="GeneID:40381440"
     mRNA            <733116..>733952
                     /locus_tag="C5L36_0A03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463347.1"
                     /db_xref="GeneID:40381440"
     CDS             733116..733952
                     /locus_tag="C5L36_0A03310"
                     /note="PKUD0A03310; Pfam Domains: Complex1_30kDa(1.4e-45)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319207.1"
                     /db_xref="GeneID:40381440"
                     /translation="MLTKRLVSVASRQFRSIATTATRFSAATKVEQTVADLPNPRDLP
                     RPDFKEIEAPIYNPKEKYKEQTAELHKFGTYIMGCMPKYVQQFSVWKDELVLYCAPSA
                     LVPLATFLRDHTSSQFKACMNQTAADFPERTNRFDVIYDFLSVRFNSRIRIKTYTSEV
                     RPVPSLVPLFPGNNWLERETYDMYGIFFEGHPDLRRIMTDYGFEGHPLRKDFPTTGYT
                     EVRYDAEKRRIVYEPLELTQAWRNFTVGSSVYDQTGPGIDSTPAEFKLPEPELEEEEP
                     KK"
     gene            complement(<735956..>736924)
                     /locus_tag="C5L36_0A03320"
                     /db_xref="GeneID:40381441"
     mRNA            complement(<735956..>736924)
                     /locus_tag="C5L36_0A03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463348.1"
                     /db_xref="GeneID:40381441"
     CDS             complement(735956..736924)
                     /locus_tag="C5L36_0A03320"
                     /note="PKUD0A03320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319208.1"
                     /db_xref="GeneID:40381441"
                     /translation="MIKVVEDQNQNYHQFPQQHHQQQLPPPLSSIPPPPQQQRLSPSI
                     YQLQQQIDQIPASSPMLPLQHNQQYLFSQAQAQVSTPRGSPISYSSINGPHPYQAQLQ
                     NSAYLYYNNQRLVSPPYYPQQASNYQLSDEYFYQSQLYQQRLMQQQQQQQQQQQQQYV
                     AQAAQYQQQYYIQQPNYIQKRKYKLWTEEEDRLLIDLKKNKLFSWKEIALRFTDRTLH
                     ACQFRWRKISPYITEHGSIEIDRHILENGSENETESDNDNDNSNELNNDTTYAEGDEG
                     DEHEENNDELQDEESSEVYDASFGTSSSSIEVESDRRQYKIKDILN"
     gene            742730..742801
                     /locus_tag="C5L36_0Atrna1T"
                     /db_xref="GeneID:40382470"
     tRNA            742730..742801
                     /locus_tag="C5L36_0Atrna1T"
                     /product="tRNA-Thr"
                     /note="PKUD0Atrna1T; codon recognized: ACA"
                     /db_xref="GeneID:40382470"
     gene            <742959..>743459
                     /locus_tag="C5L36_0A03330"
                     /db_xref="GeneID:40381442"
     mRNA            <742959..>743459
                     /locus_tag="C5L36_0A03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463349.1"
                     /db_xref="GeneID:40381442"
     CDS             742959..743459
                     /locus_tag="C5L36_0A03330"
                     /inference="similar to AA sequence:RefSeq:NP_013151.1"
                     /note="PKUD0A03330; similar to Saccharomyces cerevisiae
                     YLR050C; ancestral locus Anc_8.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319209.1"
                     /db_xref="GeneID:40381442"
                     /translation="MNWDAVYFYYFVIHTPITLLMDSTFVIPHEYQLSIQRKLSEFHI
                     KQNQDFIAIEKPLWIQIFVVWELIFQLPFFIYGIMDYFKNNKTGYSVHSWPMFLLYGF
                     NAGFTSLVCLIYILSEGPTHGLSTGSLINLFSLYVPTTLLPFYMMYDFYHRIGKLLKE
                     DKPKVL"
     gene            complement(<743494..>743847)
                     /locus_tag="C5L36_0A03340"
                     /db_xref="GeneID:40381443"
     mRNA            complement(join(<743494..743730,743821..>743847))
                     /locus_tag="C5L36_0A03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463350.1"
                     /db_xref="GeneID:40381443"
     CDS             complement(join(743494..743730,743821..743847))
                     /locus_tag="C5L36_0A03340"
                     /inference="similar to AA sequence:RefSeq:NP_011551.3"
                     /note="PKUD0A03340; similar to Saccharomyces cerevisiae
                     YGR037C (ACB1); ancestral locus Anc_4.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319210.1"
                     /db_xref="GeneID:40381443"
                     /translation="MVSETFTQKAEAVSNLPTRPTDNELLELYGLYKQATVGDNNTEK
                     PGMFDFKGKYKWEHWEKLKGTPQEEAEQKYIALVDELLAKYSS"
     gene            <744118..>746898
                     /locus_tag="C5L36_0A03350"
                     /db_xref="GeneID:40381444"
     mRNA            <744118..>746898
                     /locus_tag="C5L36_0A03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463351.1"
                     /db_xref="GeneID:40381444"
     CDS             744118..746898
                     /locus_tag="C5L36_0A03350"
                     /inference="similar to AA sequence:RefSeq:NP_012756.1"
                     /note="PKUD0A03350; similar to Saccharomyces cerevisiae
                     YKL165C (MCD4); ancestral locus Anc_1.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319211.1"
                     /db_xref="GeneID:40381444"
                     /translation="MSSYKVSKRNILLGVGVVFHLVYLWSIFDIYFVSPLVHGMDQHR
                     STDVAPAKRLFLIVGDGQRADKTLGKIYNPSSGKEEYLAPYLRSIILNEGTYGLSHTR
                     MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMFKH
                     GATPGKIDTWMYGHEFEDFTQSSIELDRFVFDHLYQLFDNSTNDEHLNEEIRQEGNVF
                     FLHLLGTDTSGHSYRPYSSEYYDNIRYTDSEIEKLVKRVNEFFNDEETAFVFTADHGM
                     SDFGSHGDGHPNNTRTPLICWGKGCRKPVYIDPSSNEYLNDVFERKEMENWGLDHIKR
                     HDVKQADISLLMSYLIGANYPVNSVGELPLDFIDDMESNKIKGLYYNSMTLLEQYLVK
                     LQEVKENQFSFKGFKKFEVKPIDRYKQEISELIEKMGDDPSLEVVAIQRIEEFNSAIL
                     EGLDYLQKYNWVLIRTIVTLGFVGWIVYSYTSFLQMFIIPSDSVEKKGKAGIFSKFLF
                     LSIGSSTSYFLYLQKLPLNYHFYLLFPVFLWYEIYKFRHDLIKGFNLFFQGLSTLTTC
                     IIFVFIIAFFESIAIGFENREIFSIIYVLMSIGYPILIFGKKWNLKNLSLSILWCFTC
                     LGLSIFPIQNPVKVENINMIISSGLIMAIVGIVSFTFLRREMSKVTRGTIIFQILLIF
                     ISMYSTAKAVISLTKRSGLPKDAQYIGWLVLVTSLILPSIIHAKNSNSDYRVRFLIIF
                     LTFAPTFTILSISFEGYFYVLYTMMLYLWIVLESQAKHSSLTLLRISLVGFFNLQISF
                     FGTGNVSSISSFSLDSVYRLLPIFDPFPMGALLMLKLIIPYALLSTGLGLINLRLGFE
                     KYSVTSLLISVCDLLSLWFFYMVRTEGSWLDIGVSISNYCLAIFGSLFIGIVEVGSGI
                     VLNGVVVKTKSE"
     gene            complement(<747120..>748904)
                     /locus_tag="C5L36_0A03360"
                     /db_xref="GeneID:40381445"
     mRNA            complement(<747120..>748904)
                     /locus_tag="C5L36_0A03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463352.1"
                     /db_xref="GeneID:40381445"
     CDS             complement(747120..748904)
                     /locus_tag="C5L36_0A03360"
                     /inference="similar to AA sequence:RefSeq:NP_014369.3"
                     /note="PKUD0A03360; similar to Saccharomyces cerevisiae
                     YNL029C (KTR5) and YIL085C (KTR7); ancestral locus
                     Anc_2.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319212.1"
                     /db_xref="GeneID:40381445"
                     /translation="MWKPQPRYRWKLLRLFHSHIRIHNYSVRLWKFIVLVVLLSISIS
                     SYAYSNKRYQPSNKNCSKYIESIANYDDRFLEDAIKKCPISERPFSSSVDGPFSVGCK
                     DPFVENQNQRLNAAFVVLARNSEIDGVILSMRSLERRFNQWFNYPWIFLNDEPFTEEF
                     KTRVAEVASGEYKFGVIPKDEWSFREQSPTNENHLFFEEAIENQGDRGIMYGNMQSYH
                     SMCRFYSGYFFNHPLVEQLDWYWRVEPEVEFYCDLTYDPFLEMERKGKKYGFTIAIKE
                     LMDTVPSLFRYTKHFINEYDIQLPNTWKFFTHNYRFFKGSNENQYLDVTNLNEFFNKL
                     ELMTKITYSNNQILKGSDDKSFLEYFVLNSKTPLNKPINERYDNENFNMCHFWSNFEI
                     ASTQFFKSHEYQSYLSYLENSRGFYTERWGDAPIHSLAIGMFLSLDEIHYFRDIGYKH
                     STIGHCPFNSMNQKKYKSSPAFKHQVLPEDEIKYADYDQPAKTNWIEASGCRCRCPSD
                     HQEVENTSGSCSSLWLKLTSDDYVEGVQDPNFIGGLGEFNSLDLDKIEELAIRKLEIW
                     LQKGYKIKDWRLSDKERDRLSTLYINKR"
     gene            <749561..>750436
                     /locus_tag="C5L36_0A03370"
                     /db_xref="GeneID:40381446"
     mRNA            <749561..>750436
                     /locus_tag="C5L36_0A03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463353.1"
                     /db_xref="GeneID:40381446"
     CDS             749561..750436
                     /locus_tag="C5L36_0A03370"
                     /note="PKUD0A03370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319213.1"
                     /db_xref="GeneID:40381446"
                     /translation="MKFPLLDVQRIRHQTWLYRQLKVNPVEAVVRQVRWGKPGPSKRL
                     LKEVSHARRGNRFYEDPPKEERDRLKEEAYFQGQVHKYRPRNIAFELRRELEREYMDY
                     KGAIEARERAVVGDELRSELSLDELVILFSKKLSNSTVIDVPIPLEQSLPSPTTTTTA
                     ETTTTTTAETLPSPSSTTSRSPSGKSGHLSNEAQIYRFLSCVAHAPDGVRPVVARVQL
                     QMVIEELLKGGVLGASSIAVGHVLYNRHWKLLGVEGNLSVARVLQDVCRDATAARVAS
                     ERALKLRKECLQISG"
     gene            <750893..>751654
                     /locus_tag="C5L36_0A03380"
                     /db_xref="GeneID:40381447"
     mRNA            <750893..>751654
                     /locus_tag="C5L36_0A03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463354.1"
                     /db_xref="GeneID:40381447"
     CDS             750893..751654
                     /locus_tag="C5L36_0A03380"
                     /inference="similar to AA sequence:RefSeq:NP_013059.1"
                     /note="PKUD0A03380; similar to Saccharomyces cerevisiae
                     YLL041C (SDH2); ancestral locus Anc_4.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319214.1"
                     /db_xref="GeneID:40381447"
                     /translation="MMMKNFIRNMATTAAKTPNLKTFKIYRWNPDTPDVKPHMQSYTL
                     DMNKTGPMVLDALLKIKNEHDPTLTLRRSCREGICGSCAMNIGGRNTLACLCKIDKDS
                     GKDLKIYPLPHMYIVRDLVPDLTLFYKQYKSIQPYLQSDKPMPERENLQSIEDRKKLD
                     GLYECILCACCSTSCPSYWWNQQEYLGPAVLMQAYRWMVDSRDQATKMRKDMLQNSMS
                     LYRCHTIMNCSKTCPKGLNPGGAIAEIKKSMALDA"
     gene            <752400..>752951
                     /locus_tag="C5L36_0A03390"
                     /db_xref="GeneID:40381448"
     mRNA            <752400..>752951
                     /locus_tag="C5L36_0A03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463355.1"
                     /db_xref="GeneID:40381448"
     CDS             752400..752951
                     /locus_tag="C5L36_0A03390"
                     /inference="similar to AA sequence:RefSeq:NP_011832.1"
                     /note="PKUD0A03390; similar to Saccharomyces cerevisiae
                     YHL031C (GOS1); ancestral locus Anc_4.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319215.1"
                     /db_xref="GeneID:40381448"
                     /translation="MSQRASLLKLSTQLSNKLAKLNTNDSPELREEINQLLVTFEKNA
                     NNQRFKDELYRHKQDFKRITSHYDAIIARNQLLNESFQDDEAEQHYSTTNESAYLDER
                     VRVQNQHSIMDQLLTQVAETRDEMLRQRKVLDGLAGRMEGIILKMPGLNVLLTKIDAR
                     HRRQAIVLTTVSLICLIILWFTL"
     gene            <753414..>754436
                     /locus_tag="C5L36_0A03400"
                     /db_xref="GeneID:40381449"
     mRNA            <753414..>754436
                     /locus_tag="C5L36_0A03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463356.1"
                     /db_xref="GeneID:40381449"
     CDS             753414..754436
                     /locus_tag="C5L36_0A03400"
                     /note="PKUD0A03400; Pfam Domains:
                     ADH_zinc_N(1.7e-33)|ADH_N(6.3e-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319216.1"
                     /db_xref="GeneID:40381449"
                     /translation="MTSTIPEKQSVIIFEETGGPEVLKYKTDYPVPSISDDEILVKNK
                     YSGINFIEYYFREGVYPISLPHIPGSEASGEVVAVGRNIKDYKVGDKIAYLGFDNFAQ
                     FTKVNPTYVHVVNLGGDATDEQLKLYAAVLAQGLTGVVFIKDAYDVQKDDYILVTAAA
                     GGVGLILVQLLSKLKKAHVVAVASSDDKLAKAKDNGAEYLLNSSKLSYDEIADEVLKL
                     TNGNGVQCVFDSIGKDAIDMSIKVAAKKGTIVNYGIASGEIESFEISRLQAKNIKLVK
                     PNLFTYIEEQPVFDHYTKSLFGLIDSKLLNVDISKVYPLKDYKEAAIAMEARKTTGKL
                     VLQIPQ"
     gene            <756202..>757884
                     /locus_tag="C5L36_0A03410"
                     /db_xref="GeneID:40381450"
     mRNA            <756202..>757884
                     /locus_tag="C5L36_0A03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463357.1"
                     /db_xref="GeneID:40381450"
     CDS             756202..757884
                     /locus_tag="C5L36_0A03410"
                     /note="PKUD0A03410; Pfam Domains: MFS_1(1.5e-34)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319217.1"
                     /db_xref="GeneID:40381450"
                     /translation="MLAVTKKTINFFSWGRNLVPLEKRNIYVAYGIALVGVTLDNMNS
                     AAIIILQQDLEKKFNTNSSVASWVLSSYALTLGSFIMVTGKIADIIGPDTVYLVGLGI
                     IWITSLICALLPHSSIIPLIVFRAIQGIGASSLLPSVLSLMANYFTGPKLKHLQTAIS
                     ALFVALTSIFSIGLILGGVFSLTSLGYRAYFWFTFSLALFCDISLFFLIIPVRKTKAH
                     NSLNIKNFNYISASLVVVGVLLIILGLTEGAEGWRHAKAILPLIVGLFTIVFALFFDG
                     FYLKRYQEKHSNKEKSSDWRLQIDLLFPPELIKIPNVAIFLICCSLYYAVMLMVMVTA
                     VMFYQDIEHNSSIITALKVSPLGFGLAFGAAIYRPWMYEKFKGNKLFVYSGALTLGGL
                     IWFSRIHYGTSNSFWKYGFISLFMWGYGCNMFFNIYMKIVVDFTPLHLQGVVNGIFQT
                     VSQVFLSIGNALVPSIIGDVVVAYSSEEKNHLQSRLKIILYVAMAFNALILVLCCFVK
                     TVRQVDREAIEKNIDQETIKSSTDEEKGSEQEIGSSSSESSLSCEKDYCESK"
     gene            <758570..>759829
                     /locus_tag="C5L36_0A03420"
                     /db_xref="GeneID:40381451"
     mRNA            <758570..>759829
                     /locus_tag="C5L36_0A03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463358.1"
                     /db_xref="GeneID:40381451"
     CDS             758570..759829
                     /locus_tag="C5L36_0A03420"
                     /note="PKUD0A03420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319218.1"
                     /db_xref="GeneID:40381451"
                     /translation="MEIIDQLAEKITLDELRQNVLSEDTSLPRDTEILNRITTEYLLQ
                     HEEPTLKWAITLIDVATVIDVSYAMHTLVNLLTYVYPLKFTIEEFSPFFFSSDDGCTK
                     RRKLLTNNFRLQGKVKPGSRLLLLYRNLVTRIPQWLPDNLKIIANWKDFIISSFDITD
                     KLLQTHDWHMFPSLYRGAESKFSQSARKSAFLDYISLQSRLFDANLIASINDATVQPQ
                     LYGISKIIDISTKGKVVKWSLDEDAFIQQIRTKSGYWSLRLQLLILLEYIHSQQTGAF
                     QEMVKLGMKEYSKAKLPTLPPIQSNNKVDAHLKKAWSVLKTRKFNEKCIRSIFNQERT
                     WTKMKVKQFTHPKMDQPLRESKISKEMKKRPKFVHRLGTPTLSRLWRVDDTNLSSLSE
                     SILPSSYALSHSDFYIAKENAFNFLNE"
     gene            <760068..>763109
                     /locus_tag="C5L36_0A03430"
                     /db_xref="GeneID:40381452"
     mRNA            <760068..>763109
                     /locus_tag="C5L36_0A03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463359.1"
                     /db_xref="GeneID:40381452"
     CDS             760068..763109
                     /locus_tag="C5L36_0A03430"
                     /inference="similar to AA sequence:RefSeq:NP_116686.3"
                     /note="PKUD0A03430; similar to Saccharomyces cerevisiae
                     YFR030W (MET10); ancestral locus Anc_7.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319219.1"
                     /db_xref="GeneID:40381452"
                     /translation="MSTHTSASELSQATATSPSGIPLDPSQIKGRIFTSKYNVILGTS
                     YLLSDKIFNFQIPTDQSTSPLSLWASLKRTNAESNVPSIVDLDITSDAGNLILGYLKN
                     SSNTTTVFATADALTNIAPALLQHPNEYHSLPLSFQVSTLSYDFNAKKLSNTYTDALQ
                     IAKTLNIPVLTSTNAKEAQYFTVVSQVLAKLNIANIHLFNGKSVSVNETLNVSNADDL
                     KKTFTELYNVLKGSIIGVPKTTVVSLALEKLNTVLGTKFGVFEYFGNKDASSIYAVFA
                     IDETVVEFARSTDDNVHDFGILLIKSAVPFESAKFNEFVGTNAKNINVVAETTNGVSS
                     LRLDIQASLFFQGRFNVQVSDVSVTDLTNKFNKKGKSYRFLLNDNSKFIEFPAKLANA
                     ISFDEDIQFTPVYDNSINAGLFDVTISTGPYEKVDFLLVEDINIFNSVNVFEFLNAGA
                     SLVILCDGFDTEKIEKKLSTQIKKLLALKEIELQLLDLEAIGEHDETKGRTSSIAIQS
                     VFWTLTHPSLIKHSVVTKILQFFGSEAELLASVIADQVENAKAIGLKTLKYNAEWSTL
                     EDNEDDEFSVIGATSFAPNPREAFMDNVNVQIEKPHELVKKLMFKEAYGTTKSLRPDQ
                     PVKNFVVKVKENKRLTPSDYDRNIFHIEFDVSGTGLTYNIGEALGVHGRNNAELVGEF
                     IKMYGLDANELVEVAHKDNSDLFEIRTIEQTLIENLDLFGKPPKRFYESLIEFASDED
                     EKKELEKLISPAGAALFKKFQEEEFYTFADIFEIFKSVRPSAQDLVQLISPLKRREYS
                     IASSQKLHPNEVHLLIVVVDWVDNKGRKRYGQCSKYLSDLQVGQELVVSVKPSIMKLP
                     PLTTQPIIMAGLGTGLAPFKAFIEERQYQLEHGAEIGEIYLYLGSRHKRQEYLYGEYW
                     ESYMDANVLTHLGAAFSRDQPKKIYIQDKIRENLDELRDLIIDKQGHFYLCGPTWPVP
                     DISACLQDVVKADAAKKGIKVDAAKAVEEMKEEGKYVLEVY"
     gene            <763876..>765420
                     /locus_tag="C5L36_0A03440"
                     /db_xref="GeneID:40381453"
     mRNA            <763876..>765420
                     /locus_tag="C5L36_0A03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463360.1"
                     /db_xref="GeneID:40381453"
     CDS             763876..765420
                     /locus_tag="C5L36_0A03440"
                     /note="PKUD0A03440; Pfam Domains: MFS_1(5.6e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319220.1"
                     /db_xref="GeneID:40381453"
                     /translation="MSEKESASMSSGHKTSSESNNYQDVELNVKEGTGELQLTDEEKK
                     QKVDQLASEMNISQKKLMWKIDLCVVPPFCLLYFLAFLDRVNVSNAKVYGIEKALGLH
                     GNQFATALTVFFVPYIVFEVLSNYLIKIIKPHVWLSVMIFLFGLVTLLVAWSKNFGGL
                     VVCRLFLGIFEAGSFPAIFYIIANFYTSGESLKRIAFFFNCTCLAGGCAGALAYRIND
                     LHGVHGFDSWQWIYIIEGAFTMGLAIPLYFAVSDFPEEARFLNENERSFLKQKLELYQ
                     GNSGFEIKQTWKDIATVFKEPMLYITAICYFSLVVPSYCYAFFAPTVIAELGYTAMEA
                     QRHSIYPWLATMGFSIILAVTSDMSKIRLPFALIASAVSIAGLSIVFSCYDANARYAG
                     CFLTAMGLYSCMPILICWMSLNFSGHTRKSVGTAFVIGFGNIGGIVSSFIFPNNEAPR
                     FKKGFGICIAFACLAFLLLAVYAAYLRWLNFRKDTDSYRQQWNEKDERSQIVRGDLNP
                     DFKYWL"
     gene            complement(<765643..>767712)
                     /locus_tag="C5L36_0A03450"
                     /db_xref="GeneID:40381454"
     mRNA            complement(<765643..>767712)
                     /locus_tag="C5L36_0A03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463361.1"
                     /db_xref="GeneID:40381454"
     CDS             complement(765643..767712)
                     /locus_tag="C5L36_0A03450"
                     /inference="similar to AA sequence:RefSeq:NP_011365.1"
                     /note="PKUD0A03450; similar to Saccharomyces cerevisiae
                     YGL150C (INO80); ancestral locus Anc_2.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319221.1"
                     /db_xref="GeneID:40381454"
                     /translation="MDSVDGDRRSRTHRSHQAPTVRSLERPMQTMDDPLRPMRVTSRR
                     WFKRKVDISTPHSIPSVSQLQSSIERESGGSSSHPNEGDCNSSLNMSLSEDVHETSYC
                     SEDYIRELLKPSHWQKEDINPSDRMVEGLNVELLDHQVLGLRFLLRREGATPEERTYL
                     KSAKVILNGEPVTYYNRGGILADDMGLGKTVQTIALILSSPFKGGEPRTTLIVCPASL
                     VTQWCTEIADKAPSLKVLAFHGTKRPSDPKVIHSYDIVVTSYSTLGSEDSKSDSPLYS
                     SSFKFKRVVLDEAHSIKNKSTKSHRACYKIVADLRWCLTGTPIQNNVDELYALFRFLR
                     VNKFENEMVWELKIGQGLKSRDVHRMTEVIKTLHGILNKFMLRRTKQLLLDNNVLLVT
                     KKIYRETLDFTPFERGMYNQMVDQYRKEMKERKKNAQAQLQYMEEYTRLLRLRQLCCH
                     WRLLFKDLQIDKSLNTKISANSVDTEEAGVDDILSSMKEMTLDESAENTSNTSKDMVH
                     PIKVQRVLNILARDKQSDVRKTIIFSEFTSMLDILGNVLTKEKIKYARYDGKMDKKSK
                     DKALEIIKNDPDVFVLLCSLKSAAYGLNITSCSRVILYEPFWNPAISAQAIDRVYRIG
                     QTQNVEIYEFFISDTVEMRIRRIQESKRKLMDSVVDKNVDSTMAIVGNGLSRKELFDI
                     LEIADPG"
     gene            <768282..>769484
                     /locus_tag="C5L36_0A03460"
                     /db_xref="GeneID:40381455"
     mRNA            <768282..>769484
                     /locus_tag="C5L36_0A03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463362.1"
                     /db_xref="GeneID:40381455"
     CDS             768282..769484
                     /locus_tag="C5L36_0A03460"
                     /note="PKUD0A03460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319222.1"
                     /db_xref="GeneID:40381455"
                     /translation="MATPFEHQCHQIERLLAIRSVHRDAAHRNSQGKGPLGSRQMNKS
                     NTGSGSSFNSMSTHMMSGAHLGTLVQNFKSKSNRRQVASQTQTSGNYKTPYKYGVDGN
                     YPFQQTPAEYVNASNPMNLLQQLQRQQQQQQQLYIQQQQQQQQQQQQQQQQQQQQVQQ
                     QQQQQQQVQQQQQQQQQVQQQQQNGNLLESFLYQQLSNQSQQSLHSPALTAASIGFDY
                     NNLTSSTLNTPTEEKNPDIFGNGSINNNMVDPTSLLPLFNRTPSSTSNNDTPQTASQS
                     RLPSLNFNTLLDHQENAQRPNSSMASLDSSLPSTHSTVASATDARNDSPNMVSDLLGN
                     SPALTSVSNLNNTIGSNATAPPPVDPLESIWKKSKETEAADGLEKSYLESADLYKSKD
                     SAVFGKTF"
     gene            complement(<769764..>770873)
                     /locus_tag="C5L36_0A03470"
                     /db_xref="GeneID:40381456"
     mRNA            complement(<769764..>770873)
                     /locus_tag="C5L36_0A03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463363.1"
                     /db_xref="GeneID:40381456"
     CDS             complement(769764..770873)
                     /locus_tag="C5L36_0A03470"
                     /inference="similar to AA sequence:RefSeq:NP_011362.3"
                     /note="PKUD0A03470; similar to Saccharomyces cerevisiae
                     YGL153W (PEX14); ancestral locus Anc_2.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319223.1"
                     /db_xref="GeneID:40381456"
                     /translation="MSQQSNTRQEMLDNAVSFLTDPSVADTPMAKKIQFLESKGMSNA
                     EINQALTIAATQQQTHKGPPPAPPIPAGAGVPSTGGGLGVAPFPYYAPPPPPAPRSYD
                     WKDYVIMGTTSAGIMYGAYQIVSRYLLPKVIPPSQSKLDEDKESLEREFQRVEAVLEQ
                     LEKDQSEFISRQDEKTKLIDEALMEVDAIVKATNEKNLRNEETLKYLKLEVDSIKTTL
                     LKNLEAQKSTISSELKELEEKTDNLISFIDSIDSKKETEGYRQSGTEIPRPSPSPPAN
                     LLTNNRSTSSVSVPTEPKYELDIPPPSSVPSAKDILNENYKSTSSTSLPPPAEVTTTE
                     PSSNIPAWQLASAQKSKIGNSDASIPAWQLAAQDN"
     gene            <771265..>775236
                     /locus_tag="C5L36_0A03480"
                     /db_xref="GeneID:40381457"
     mRNA            <771265..>775236
                     /locus_tag="C5L36_0A03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463364.1"
                     /db_xref="GeneID:40381457"
     CDS             771265..775236
                     /locus_tag="C5L36_0A03480"
                     /note="PKUD0A03480; Pfam Domains:
                     SNF2_N(5.1e-105)|Helicase_C(1.1e-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319224.1"
                     /db_xref="GeneID:40381457"
                     /translation="MSLEPEVKTEGKDLQNEAGLGQVKDGSRTTLADADELMKVFQKK
                     LRAVVNMDHTANTTFNDLKLMNDEFQFLATTNGIYLDRKFTDKLRTQVDKMNPSTDIY
                     DKIFKRQKQAREEAGALDHLKSTVLDYMVDVQTEREYILQNLNESNSSSKLSPDENPY
                     VAPLRVNYIDPIKNLAFNGFNAKATQEPNRPQRRSRRTSSVKTNENQSTASKPNTRGS
                     KGKSKKNSLATTAITNNVVKSKRKRKPTVRADEILDDEEFETELTAILENQQEEEEPK
                     KKRRRGKNTVSTEDAVSHTENVKPPEPVIEESLSQKQLKSLERHYDNTYISIWKDLAR
                     KDGPKAYRLFQQTAQAKSINMRKTAQLAMRECKKWQSKTTKQQKDLNAKARRNMREML
                     SFWKKNEKEERNLRLKAEQEALAKAKKEEEEREAKRQARKLNFLINQTELYSHFIGRK
                     IKTSEMEGEMGDKNIPSSSSTNSNGKHLSEDQVDLSLATKDFNALNFDEEDEAELQKR
                     AAANAQSALLEAKNKAQQFNHGVKRADNNSDDSADESDEEDNEGELNFKNPSSAGDLV
                     VDQPKLLNCTLKEYQRKGLNWLANLYEQGINGILADEMGLGKTVQSISVLAYLAETHD
                     IWGPFLVVTPSSTLHNWQQEITKFVPDFNVLPYWGTAKDRKVLRKFWDRKNIIYNRNT
                     PFHVVVTSYQLVVADQQYFQKMKWQYMILDEAQAIKSSQSTRWKSLLNLQCRNRLLLT
                     GTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFSKDIEAHAQANSKLNEEQLRRLHAI
                     LKPFMLRRIKKNVQSELGDKIEVDVYCDLTNRQKKLYRMLRSQINLMDLIENNKRIGN
                     NEEVESLMNVVMQFRKVCNHPDLFERADTKSAFSFSSYSMTGNLLKEVNEPLLELNYS
                     TRNLIEYRIPKLIIDDLLLPSFEKENLTDKERMIKKMFSVYNAESLVSNEKNEMNVLK
                     FVRESPSEVKRIVNNNVLINAVNNRNYGQTTRDSRAKLIEEIYGHDEKNSVVLSSQVS
                     DKIPNHMRDAIDSVSKAMYMRSFQKGYHDNARAPPVELVISKSNLNSIKNDVLFSPTI
                     RQALLPLNLDTQAALIENEVPLKDWPKAEMLPEEESNYMGGGTIRLPSMERFVLESAK
                     LKKLDQMLVDLKKGGHKCLIYFQMTRMMDLMEEYLTYRQYKYIRLDGSSRLSDRRDLV
                     NDWQTNPELFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ
                     VTVYRLLVRGTIEERMRDRAKQKEHVQQVVMEGKVDVLEQPEEREKSDKKEMALWLLE
                     DDK"
     gene            <775546..>776613
                     /locus_tag="C5L36_0A03490"
                     /db_xref="GeneID:40381458"
     mRNA            <775546..>776613
                     /locus_tag="C5L36_0A03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463365.1"
                     /db_xref="GeneID:40381458"
     CDS             775546..776613
                     /locus_tag="C5L36_0A03490"
                     /inference="similar to AA sequence:RefSeq:NP_013884.1"
                     /note="PKUD0A03490; similar to Saccharomyces cerevisiae
                     YMR161W (HLJ1); ancestral locus Anc_2.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319225.1"
                     /db_xref="GeneID:40381458"
                     /translation="MADCTPEQAKLVDEILSIQRTDYYRVLKVDKSASDVEIKKSYRK
                     LAIKLHPDKNKHPKASEAFKVIAKAFEVLGDESKRKLYDMTGTDPDSRSAGASGGGAG
                     HPGAHFNNFQGFGGGFPGFQGGFQPGPGMGGGLNEDLLNMLFGMGGLGNNGFSFTFGG
                     NGFPNNGFYYSNQPGMNARRRAAQNANAQRQGQGARRGAAGREQAQWTQYIVQFLPLL
                     IILFSIIINSLTGDSSSNYNNARQFHGRVPKYGFEKGAGLDVERTTPNHNINYYISEK
                     TLNNFQGRKNADTELAGLDKYVEGQYINELSQTCQREKNYQRELIESAQGIFYNDWDK
                     IERAQKMTLPHCERLRELNLL"
     gene            complement(776747..776818)
                     /locus_tag="C5L36_0Atrna3F"
                     /db_xref="GeneID:40382491"
     tRNA            complement(776747..776818)
                     /locus_tag="C5L36_0Atrna3F"
                     /product="tRNA-Phe"
                     /note="PKUD0Atrna3F; codon recognized: UUC"
                     /db_xref="GeneID:40382491"
     gene            <779731..>781497
                     /locus_tag="C5L36_0A03500"
                     /db_xref="GeneID:40381459"
     mRNA            <779731..>781497
                     /locus_tag="C5L36_0A03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463366.1"
                     /db_xref="GeneID:40381459"
     CDS             779731..781497
                     /locus_tag="C5L36_0A03500"
                     /note="PKUD0A03500; Pfam Domains: G_glu_transpept(2e-138)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319226.1"
                     /db_xref="GeneID:40381459"
                     /translation="MTFRRPLEFVTNSRRSAVYSLNGMVSSTQPLANSAGTEILSKGG
                     NAMDACVAMSACLALLEPASTGIGGDCFVLWYDSKEKKVSGLNGSGRSARNITLDWLK
                     KSRSRDVNGFRLAEDSVFKVNVPGAICGWYDSMKKWGSGNVTFKEVLAPAIRLAEEGY
                     PVSQISASLWKNEEEKLKRMNTKCSRETLGLFLPNGTAPREGQVVRNPEVGRALRIIS
                     ERGKKGFYEGEIAEAIIRELNSRGHVMTREDFSEHKSTFVDPISYEFLGHKLWEIPPN
                     GSGIIALMTLGLIKQLSTKGAVDLKKLKHNSSDYLHVIIECLKVAFKESEEYVNDYEH
                     FHLRTGIDQNHLISQVLSDDYLYEEIKGFEMGQASDIRNVPNSIFKSDTVYFTATDKF
                     GNACSFINSVYEGFGSGIIVPGYGFTLHNRGGNFTLNAQSKNCIDGNKRPYHTIIPGM
                     ITNSHGDELYASYGIMGGYNQPQAHVQVYMNMLLFGMTPQEALDAPRLTLTSDMRFRD
                     EDLGCGSDGPVSNGHTVVHLEEGITGDVKVELERRGHVVGDIVEGHARRKFGRGQIIR
                     REGQVWSGGSDMRGDGAAVPGG"
     gene            <782669..>787894
                     /locus_tag="C5L36_0A03510"
                     /db_xref="GeneID:40381460"
     mRNA            <782669..>787894
                     /locus_tag="C5L36_0A03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463367.1"
                     /db_xref="GeneID:40381460"
     CDS             782669..787894
                     /locus_tag="C5L36_0A03510"
                     /inference="similar to AA sequence:RefSeq:NP_014933.3"
                     /note="PKUD0A03510; similar to Saccharomyces cerevisiae
                     YOR290C (SNF2); ancestral locus Anc_8.753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319227.1"
                     /db_xref="GeneID:40381460"
                     /translation="MDFNTQFNILGQSKPQSQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQPQSQQQQQQQQQILLQQQQQILLQQQQQQELNSNGNAGATLNQQLRPTALTIS
                     QIQDIYKRLQQLKFQHGNAVTRMPEYIKLSMFLAKDPNFQKIQSHLQQKARQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHHNGSPAFNQF
                     NNSNYNSPLGPNTSFSSSPNDLLAQQRRQILLKQQQQQQQAQAPLQQQQREQAQVPLQ
                     QQQSREQLLQGQNSTPAQLTGSPVSNQQPSNQPSSIFHPIQAHILKFQIATFKKFIQN
                     QPLPPELTTLITASYEQLQRQRFQQAQNGQPIQPPPPPPPQQQQQQQQSPQIQLQQPP
                     PQPQPLQPMPQVESQRSPPASSPAQQVLLNNQFSNHQQDIQNLYRQANIQKQVQAQQL
                     QKIQPPKKENEKEQKKAQRKQKKVANLDTTAGFATPSALQLNQPIDETPVKKNYILPP
                     RPPQSLGNLEKLYPNAKIENVYNPLARVDSFIIPNVTSEFSFEFFNTPKSKIYTPSVY
                     PNALDLETANELKKLHENLLIQLELENLEEIARHESTYKYDFEAFKLLPYQRALRGYV
                     LSGIFHQNMLLINHLPNFSAKVRSINLEDASLTNALYLEQKKLKNEKERSDLINKQQS
                     LLNASDSYKKILMDKKSKYQKLAKNLTAFHQQTEKEEQRRIERNAKQRLQALKANDEE
                     AYVKLLDQTKDTRITHLLKQTNSFLSSLTDAVRDQQKETVEKMVKVGHTEDGIVEQPD
                     EGIDSDESDYENEEERERRLVEKKQDLDYYKVAHKIQEKIEKQPSILVGGTLKEYQLR
                     GLEWMVSLFNNHLNGILADEMGLGKTIQSIALLTYITEAKKLPGPFLVIVPLSTLPNW
                     NNEFDHWAPSLKKISYKGSPAYRKELAQQVKSGDFNVLLTTYEYIIKDKYLLSKIKWV
                     HMIIDEGHRMKNTKSKLSYTLNEFYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFN
                     SVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKSLPN
                     KVERVIKCKKSGLQAKLYSQMLKYNKLFVGDKENKAVGIKGMNNKLMQLRKICNHPFV
                     FPAIEDMINASHQNNDLIWRTSGKFELLDRILPKFKATNHRVLMFFQMTQIMDIMEDF
                     LRFRDIKYMRLDGDTRADDRTELLKDFNAENSPYDVFLLSTRAGGLGLNLQTADTVII
                     FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSIEEYILEKAHQKLDIDGKVIQA
                     GKFDQKSTAEEQEALLRKLIENEDQQNEKDEDLNDEDLNELLARNEDEIKKFREVDAE
                     RERQWNSELPRLYSEEELPEIYNQEPEPEEEPKENLLMNYGRGTRERKVTQYDENMTE
                     EQWLREIDGLVSEDEEKFPKKRPRKSLKKKKEESREGTSDSINEDATEDTHDDKRMKS
                     SSKKIGIKTTSPSRTPEVSDGISAPLVRRRKNFGSLPLSREIYPSEDPTPKDRAELQM
                     RMSAILDHIQNYANPVGRKLCKIFNSKPQRRLYPDYYVIIKNPIAFDTVKRRVNNWTY
                     NTLEEYMFDIHLIFKNARLYNLETSVVYSDSMILESQALKKYVEYIHKPLDFSEFDLR
                     YGLHKPNGDPISDPTVRWDEEKQEAYIIEEEEEEEEDEQEGKKKEDNERYTNAEADEA
                     KRQKTMKAEKVVCYK"
     gene            complement(<788041..>788829)
                     /locus_tag="C5L36_0A03520"
                     /db_xref="GeneID:40381461"
     mRNA            complement(<788041..>788829)
                     /locus_tag="C5L36_0A03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463368.1"
                     /db_xref="GeneID:40381461"
     CDS             complement(788041..788829)
                     /locus_tag="C5L36_0A03520"
                     /note="PKUD0A03520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319228.1"
                     /db_xref="GeneID:40381461"
                     /translation="MLFPSDVTYDEKLCRLQINNLRKTRPIVESESKFHIGHIYREIQ
                     YEFEQISLRVNLDPEESEDVDFAKSLFSQTDTIIGAPSLINTLIHECIKHNCSPQFLR
                     DVIDQYDSNGEVSGMRLLVALNRLRRGIWEYNILERVEYIERMYLTWSFRKCVFEMEA
                     INEVKPSLYNRPTLITKLLFKSNHYPKLENESSNSMVIFDKLHDEFLESSSANSDKEV
                     FSFNLISSTMLLDCMRRAGLDVDSPLETSNPSYHCEAISKKRKL"
     gene            <791781..>793772
                     /locus_tag="C5L36_0A03530"
                     /db_xref="GeneID:40381462"
     mRNA            <791781..>793772
                     /locus_tag="C5L36_0A03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463369.1"
                     /db_xref="GeneID:40381462"
     CDS             791781..793772
                     /locus_tag="C5L36_0A03530"
                     /inference="similar to AA sequence:RefSeq:NP_010421.1"
                     /note="PKUD0A03530; similar to Saccharomyces cerevisiae
                     YDR137W (RGP1); ancestral locus Anc_8.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319229.1"
                     /db_xref="GeneID:40381462"
                     /translation="MVSHRVHQTQLSDNIQAQFIYENTPIFAGSDDFSLLIKFKYTGK
                     HGFRVHLNNPFDKSNSTKEGPVNKNELRSQIPVEDAPPEEPQSSGWFGSRLSSQLSNA
                     TRAVFFNSFEKVPEQEKPAIKNAKETLFLGFSQILGYYFINDSIVDYTIFRDLQRSTI
                     IEGKYAGIKGLEVSKAENSDSDGFFSGFSALYSSELNSLDGTGTNENLQFIPFFSSDQ
                     NIIFSELEFDPNRWTDETASHESIKSFYLRCKLPKDLPPTMATEAVQINYKFIFCYQL
                     MEGQNIISRTAFVPLKIQTYIDKYGRQPIFHLQNSRLNQHLENFIVNDVSKHPEVSRH
                     NSSINTDSKKINFFKLKKQSEKTKSDSMYPFDGENKKDKPISSSMSQLELSSYSKNDI
                     TSFLDIVEELDRSDVNDIIKVQEKFDKKMDEKKVFKFNVRENLLQILADYKSVQRQTI
                     AEKDYQSLIEYDHILPKEQQIKFVIKQNHEILATVLLNKGIFNLGSLINLNIALHNEI
                     YDTTGLEIQLLKHQIFHREEYIKKGTYGEVSSRLDKNILESIMCEKMISTFKTSNVNT
                     DILIPLETEPQFKTNFFQIKYYLQIRFITVNNARRASEGSECEQLNYAMKNIFTDTNG
                     SMLFQGKEILGDANEFYIRIPVIILPTYEQDFGFITTTS"
     gene            <794113..>798168
                     /locus_tag="C5L36_0A03540"
                     /db_xref="GeneID:40381463"
     mRNA            <794113..>798168
                     /locus_tag="C5L36_0A03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463370.1"
                     /db_xref="GeneID:40381463"
     CDS             794113..798168
                     /locus_tag="C5L36_0A03540"
                     /note="PKUD0A03540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319230.1"
                     /db_xref="GeneID:40381463"
                     /translation="MEMSNGLANIPVFNRPHIQGDQLRSDRKTLSNISSDFVPKSDQK
                     LPSMEQNRTSKTTLNFTDIKTSTQKPSEPRHDAHLLSIRKHRSSFTSTSSAGSPLSKR
                     HKYDSDGTLRTEISTSRTFPLRKKYSRIVQQSSHGNEFPSSVSKQTTIGIASEGKNKS
                     PCFPARRRLKAGSINMFNSAPSNQTNLNKTSIGVSDLTHLSSSSIGASGKEVFVHDGY
                     LFSSPEKSPSIKHKKQVAFSSEPESPSSSPLKNNKGEPKSILKLPGSEYVSKSFITLE
                     TMLNLDLSKNESWPPGVILQIPSNHPNIKKKVHECALGLIDKQFHKQYQVYASLNHMI
                     KENPKVTYGENIFTKDIVRNIIASVQLELLKLLKEFKEGSNPFQQRTASQGLKLIVFL
                     NPLATNLSGLGILFDICTDLLKSENISKGVTSSVFQFVKVLPEKYYGKMESIGTSIVQ
                     MKHFTSASVTCEKLNILRRFVILQPVTMSKCSYQIISYVLFTILNTDVQAYQKVLNSA
                     ISVLTCLANNKESKAMVVRILSEELESSFSSIKTSTEIQLHSRMTIAQAICETLKYLI
                     HINYSVQAAKIWTYLLYLVSFNRKKFILENWDSYIYFEPVFRELLENPDTVIIALESW
                     KVMVYNFQTLTIKDWETEQLKHKLNSLLFPFFNTKLIVGGTKLKQWSNHQSYVILYAR
                     IYYAMRLKMEEITFGPHLALLLDHVLTPLYSLTEWDTTFSYILKSVFLSDRYLHVEDP
                     NACFWFSEFEKWKGRLLPLPKMIFRNPEVFSVILRYNTTTGSSRSFNILQSTINISVY
                     YPLENLKLACPYKEYCQFACSVGEAILEIFEHHIYQNRSADELFSLVKDMDDSTKFVR
                     RDTENHTALLMTRVINKISKTGNDAILLSFLALCFRSCDRIKLFYCCMVSDIFDNASL
                     INHFQEKIDTFILFLNYAENLEKIEIPESEQIKMVSNFEKMMMVFDNQSYSILFPKYI
                     SFLKNCRVLCTVTDELKFRMLLAILKLNKKCSGDIDKFCEQTPIDFLQSGLRFFDNET
                     EDYDHALELVEFLRSFRNIESIPQSWLDEISYKLGLLVHPEIEFDTELHDKLKIIGSR
                     LSLKESNRIKKLAIRRKVNHSPLIADSISGFSDNINRKKKVDYELSKDDTSNDTITSK
                     SVSTPIDLKAINKIDSSSSKKPRNMERESEHRDKTINKNSFVRENSNFGEAPIPIRNL
                     KSFIIDSINIEEEIGELPTVRVPSSSPKPNISQEEHTSPAKRTRSRQNVELSSIESLD
                     EWTARLRMKTRKDRRENKKESPENSGVGSQSGSGTCKSEETKSLLTQTDMDQFKVLLK
                     KFNSRPFFVTQEEKDELESSILSLLLKLKHQ"
     gene            complement(<798248..>798973)
                     /locus_tag="C5L36_0A03550"
                     /db_xref="GeneID:40381464"
     mRNA            complement(<798248..>798973)
                     /locus_tag="C5L36_0A03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463371.1"
                     /db_xref="GeneID:40381464"
     CDS             complement(798248..798973)
                     /locus_tag="C5L36_0A03550"
                     /inference="similar to AA sequence:RefSeq:NP_012296.1"
                     /note="PKUD0A03550; similar to Saccharomyces cerevisiae
                     YIR030C (DCG1); ancestral locus Anc_1.21a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319231.1"
                     /db_xref="GeneID:40381464"
                     /translation="MTATSIKILVINPNSTKEMTKSIEFEINTLHISQCVEIDYYTGP
                     THTRKAAPPSINNNEDAEQSTQACLQDFQENPKYLEYDGYLIACYSDHPLVYQLPKLL
                     SSQRVVMGIFQASMLYSMQYATSGCKTAILTSSIAWEKLLDDAIIKYCGNVDVFPDAR
                     FNHSLACNIPVLELHHEKHFPVIQNKITQLQNNNVGIILLGCAGLSCLHQKMKRFAPN
                     IKFVDSVKVGIKLLIAYVDIGET"
     gene            complement(<799172..>800746)
                     /locus_tag="C5L36_0A03560"
                     /db_xref="GeneID:40381465"
     mRNA            complement(<799172..>800746)
                     /locus_tag="C5L36_0A03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463372.1"
                     /db_xref="GeneID:40381465"
     CDS             complement(799172..800746)
                     /locus_tag="C5L36_0A03560"
                     /note="PKUD0A03560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319232.1"
                     /db_xref="GeneID:40381465"
                     /translation="MYTNMLRSKTLEKLLFDRTRICRLFSALANPATLQQAVFGMHKS
                     APLELRRKSFDDLMRQLDENEELWKDNALVESEIHHNMVELINGPDQDYYMKELQKCN
                     GWLSIYSLIHDRLYYNAVQGVFRHPQYIPNETFEYLCLQLLKNDQLKLFMDAIDKNSP
                     NHFYKVSQNIYEKFIRLCIERRQDDLLAKFIEKYIIYTGDTEVIKYQACHIDWQLGES
                     ILNFFYSCGNIKAYSKTAALMILLAKQLPKSEKLARELRFKSRVQKLQMYTDKLGPYT
                     VLENGMFHKFGLIANKNAKFDKHLKPFANSLFSYYKDQQLTLETCILLIEYMHGLHTQ
                     EFKESFSKKLNPDIQMARIYRSVIRKTADPDPLILKNYTDIINMANDKNNKHMKDGLP
                     VRRTQNQRFSEEEALNPDDIKPFKPKALQIILYVLHERAKNVKIPQSDELRDIIVTAV
                     LLFQAMIKVRSLKPSVDCVQLMMDLVRMHPATAPHVTLLQPLYDKVKGQLPENQIPKR
                     LRPQESPLKTPPPDST"
     gene            <800992..>802185
                     /locus_tag="C5L36_0A03570"
                     /db_xref="GeneID:40381466"
     mRNA            <800992..>802185
                     /locus_tag="C5L36_0A03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463373.1"
                     /db_xref="GeneID:40381466"
     CDS             800992..802185
                     /locus_tag="C5L36_0A03570"
                     /inference="similar to AA sequence:RefSeq:NP_011081.1"
                     /note="PKUD0A03570; similar to Saccharomyces cerevisiae
                     YER154W (OXA1); ancestral locus Anc_8.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319233.1"
                     /db_xref="GeneID:40381466"
                     /translation="MFALRSTIVRCGLRSSANRSVPLVGLRAESPLLSAVRFNSSESG
                     ESKTSQILHNIENIIDSEERKIDDKLGFDEDLLAKQELLSQTDLTSDQLGYLKSVGLV
                     DGWWPSDLIQQSLEYVHVFSGLPWWATIAVTTIGFRLLLFPLFMKSSDTMARSQAIMP
                     ETKKIRKEMTHAMSVGDRALQQRKQLELRVLNQKNGVKYSRMFLSPVTQMVYSVGSFF
                     GIREMANLPVDGLTTQGTLWFENLANPDPYIGLHLISASLYSIAFKFGGDTGNAQFGG
                     TMKKVFMVLPFASIAFTFNMSAAVMVYFSANGLCSIIQSQLLRNASFRKMTGMYPLPS
                     KEQQAKIQQKGVLDNFNETWKEMQENNKIRAAKEEEAMKGVEMARKQATSNRVIIKSK
                     KTKKN"
     gene            complement(<802451..>802702)
                     /locus_tag="C5L36_0A03575"
                     /db_xref="GeneID:40381467"
     mRNA            complement(<802451..>802702)
                     /locus_tag="C5L36_0A03575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463374.1"
                     /db_xref="GeneID:40381467"
     CDS             complement(802451..802702)
                     /locus_tag="C5L36_0A03575"
                     /note="PKUD0A03575; Pfam Domains: L51_S25_CI-B8(3.5e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319234.1"
                     /db_xref="GeneID:40381467"
                     /translation="MVALSPAIRELRFLLPQTASSLKSFVLNAYPSIKQQHPHLPVLI
                     RECQGIQPTVVVRLEKGVEVKKHVANFSDAELKSFLQNP"
     gene            <803241..>803813
                     /locus_tag="C5L36_0A03580"
                     /db_xref="GeneID:40381468"
     mRNA            <803241..>803813
                     /locus_tag="C5L36_0A03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463375.1"
                     /db_xref="GeneID:40381468"
     CDS             803241..803813
                     /locus_tag="C5L36_0A03580"
                     /note="PKUD0A03580; Pfam Domains: GST_C(5.3e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319235.1"
                     /db_xref="GeneID:40381468"
                     /translation="MSLGTLYILPGSSRNSWLPGLVKYLGLDVKVVSIRDIDNYKSIF
                     PLGKAPAFEATNGFKVTEVAAVVEYLILQSAKPELLGSTKEEKVSNTRWFSFTNTDVG
                     NTMVAWNRRPQDSPEEVATRKENVHNLFKYLNNHFASSKYVVGDNITVADLYLYTDVT
                     KINANGIPLDGYPHLEKYISTVSVHPALSG"
     gene            <805120..>806784
                     /locus_tag="C5L36_0A03590"
                     /db_xref="GeneID:40381469"
     mRNA            <805120..>806784
                     /locus_tag="C5L36_0A03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463376.1"
                     /db_xref="GeneID:40381469"
     CDS             805120..806784
                     /locus_tag="C5L36_0A03590"
                     /inference="similar to AA sequence:RefSeq:NP_015000.3"
                     /note="PKUD0A03590; similar to Saccharomyces cerevisiae
                     YOR355W (GDS1); ancestral locus Anc_7.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319236.1"
                     /db_xref="GeneID:40381469"
                     /translation="MSQDHLTSSEEFSDFPTEKSNESVPTSPEATSSIQKELVNKPLI
                     KTLVSTSPSVSSISSPAPTSLNEEPIEKKEKKEKKEKKEKKEKKSSKVINFASGVSTS
                     VPLTGERPRPTPHASMEDDVLLAIFIILYENDNDCQGMTVKQICDILVEKHPDMSKLS
                     SKTSNLVSAKLNAYVKKVEKGDASIHYALSRDWADSSPKRMVYVYRGILSPEYPAYVM
                     KIIEEHREREAMNDSASLNANPDNTPIERVEFEADMNDSTLVYTSKLKADLLGKVDGR
                     TSSSSSLSQSLSSLHSVSPAGLQLNKVSPFGNGTIDFGISQLSVPYDVAPVTASLNIS
                     MPVKPDEETNRILSTTSDFSLRKGNEFLPTIPDSDDEYSLLKGDFDDDNDADDDESSI
                     YENHGYYKRGSDLITERIPSSLGKRSKSISFVNKRPKSASSSIPQNISEAAIKNRQPT
                     MSPDSPPKRIITAAAVTPRVPRKTLANTPNAAAAVAALRAVALSPYNGSVTDSVNSIT
                     SSIMSDTTVEPSISAKWLETVRSGFLNQDIESPENVSLAELDILFA"
     gene            <807384..>810869
                     /locus_tag="C5L36_0A03600"
                     /db_xref="GeneID:40381470"
     mRNA            <807384..>810869
                     /locus_tag="C5L36_0A03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463377.1"
                     /db_xref="GeneID:40381470"
     CDS             807384..810869
                     /locus_tag="C5L36_0A03600"
                     /inference="similar to AA sequence:RefSeq:NP_013132.1"
                     /note="PKUD0A03600; similar to Saccharomyces cerevisiae
                     YLR032W (RAD5); ancestral locus Anc_2.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319237.1"
                     /db_xref="GeneID:40381470"
                     /translation="MGNHNTNSRFFDHTLKTTLPKKEKTADVLEIEHDRFMKFKDELT
                     ALFPEMTETTAYSLYNKFANRDDSLESASNAYLDNSNNYSNCGFETLNKRDFKSGKGD
                     DMKIAKSTTPIPQKKRSRVNGIDIFVQNHENSSKKQKHVEEYVNKKEPLEWKKYIGTL
                     NVQCWCTRSIFNLGSIYRENRLIFTKSPSNDVIYVSQQAEGSPYKRELGRVVEDISEI
                     IGPLLMENAMEFESKLFYVDTTRLSTGDSFIIRTRCFLRGSIFENETSLGEHDDFVIE
                     QLKVMKDSNGKINAGTRLKSAILKLFKLIELKTDKELEREHLTLIKAGSTHDILSDQN
                     MEKEPIYAGDISTENSDGTELSLNQVKDLYKSTELSVLQEILPESIPDNFNIELRTYQ
                     KQGLSWMLQREKEYDNVGLNNVNLENKEKEFIIAKLMALEKSLNPLWKEYTWPPAPEN
                     IPQSYEPDNIGDKFYLNMYKGTCSTVKPVINSDCKGGILADEMGLGKTITTLALIFSC
                     PKDRLYESLPNDHMAKVNDYAYQTTLIVVPMALLTQWEKEFTKVNGDAKKNFCYIYYG
                     SGTLGNLKSILCGKNPPRIILTTYGMIQSEWAKSNRVDSRSGLFSVKFFRVILDEGHN
                     IRNKSTKTAKAVNSIRSERNWILTGTPIINRLDDLFSLIQFLRLRPWCYHSLWRHCIS
                     VPFETGKDIDVATDLLKSILDPILLRRTKNQRDKDGNFLVTLPSKEVIIEKIKMTKKE
                     QLIYDWLKEKAVSSFKESYRAGLIFKNYTTILTQLLRLRQVCCHVDLIKNTSDTSKEA
                     IVDDDVDVRKNTQSKLINQTNEEVLSLIRTIEMNEKQQRLPLDTINKLKSEIYELYPR
                     LEENECSICTEALDIDTCVVTECKHCFCLGCLMEHFEFQLTHKSGTLEEADENDILAN
                     QEQLMKAQEVFCPMCRTQINQNRLLKTLRTSETNTDSLRNLNNDGFLTTQGPVEKRDY
                     FIRPYTPNGQSSKINALLTHLEMIKCQSPGDHVIVFSQFTSFLDLIEEELHKYKNEYK
                     VHKFDGRLNLEQRHRVLNDFEEPVKSGETKVSILLLSLKAGGVGLNLTVASKAFLMDP
                     HWNNAIEFQAIDRIHRVGQCKDVKVVRFITEGSIEERMLQIQEKKNQLGEALTITDEE
                     RRKRKLEELQSLFNE"
     gene            complement(<810909..>812117)
                     /locus_tag="C5L36_0A03610"
                     /db_xref="GeneID:40381471"
     mRNA            complement(<810909..>812117)
                     /locus_tag="C5L36_0A03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463378.1"
                     /db_xref="GeneID:40381471"
     CDS             complement(810909..812117)
                     /locus_tag="C5L36_0A03610"
                     /inference="similar to AA sequence:RefSeq:NP_013846.1"
                     /note="PKUD0A03610; similar to Saccharomyces cerevisiae
                     YMR127C (SAS2); ancestral locus Anc_2.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319238.1"
                     /db_xref="GeneID:40381471"
                     /translation="MSKNSSIDLQAPQNSLRRSGRNKISGPNDHPPDQAEVKSEDNGD
                     EYGFLNYRNVRRMRLGKYEFDTWYGNSALFKVPFYDRNINSFRTSLSFKDESIASANV
                     SPPKAKSLASKKLPPKEYVINPKKKDIWLDLLYVCPYCFKFTDIRVEWEQHINCCGFR
                     RKLPGKVMYSDGEVVIRKIKGFYNKLFCQNMCLMAKFFLDNKSVFYYLDYFDFYVAYQ
                     MLDRIEVPMGFYSRELLSWDLNNLSCICVLPCYQHRHLGTKLIDFSYQLSRYEQQISG
                     PEHPLSPLGKLTYLKYWCSSIAKVFVYGSLSNKKFVTLQMISEITGFRIEDILMTLSC
                     MKVLYQSGTKTKNMDYYQDSFKYSDHYIFVEDEKNYKVMIDKKKMKRWVVDNMIENVD
                     LLNKNCFVFY"
     gene            <812377..>816183
                     /locus_tag="C5L36_0A03620"
                     /db_xref="GeneID:40381472"
     mRNA            <812377..>816183
                     /locus_tag="C5L36_0A03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463379.1"
                     /db_xref="GeneID:40381472"
     CDS             812377..816183
                     /locus_tag="C5L36_0A03620"
                     /inference="similar to AA sequence:RefSeq:NP_013847.1"
                     /note="PKUD0A03620; similar to Saccharomyces cerevisiae
                     YMR128W (ECM16); ancestral locus Anc_2.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319239.1"
                     /db_xref="GeneID:40381472"
                     /translation="MAKKVHYGKAGGQFVDEVEPNGTPEGVIEDVIDNSMASIENEKS
                     KRKRKLKEKLIEEHKEKITRKKKKRLDKYIEHQMKREEKEILLKKLEETKIDTSILKS
                     AKLIGSGDRKTKKEKIIEAMELERLGKSTDETKELLYEQREVKNWSDLLQEDQNIEGE
                     PANEEFKSTSTTSSGFIDFRPAQPFSGMGTGFGFSNIEKVVKKKKKKNYSWRNKIEEE
                     TSKRKTEEDEMDFESDSSDEELEAQSGAESEDIDVNEEPSKDGKIENVTDEKSDTDSD
                     SDGVEEENNSSVDGDDNDDDDGEDEESEDDGEDEESKDDGEDEESEDDVEVEVNIKKE
                     HTKKALDFKEWAEEQVRKLEGREAFSAPQGPQMNYKAIVREEDLDDGLKEDFVPINEN
                     LKRKIVTVNVVRDASIQEARSKLPVYAEESRIMEAIHHNDCVIICGETGSGKTTQVPQ
                     FLFESGYGVSDSDTPGMVGITQPRRVAAVSMAKRVSTELGNYSDRVGYQIRFDAKVKE
                     DTSLKFMTDGVLLREMMTDFLLMKYSALVIDEAHERNINTDILIGMLSRVLKLRREYH
                     EKQPSKYYPLKLIIMSATLRVSDFSENKVLFDTSPPILQVDARQYPVSVHFNRRTSYN
                     YTEEAFRKTCKIHRKLPKGAILVFMTGKAEIVSLVKKLEKEFPFKNNKSKELPLSEKD
                     ELIDVKVDVNNADIEAEEIDFDVNEMDIKEDYNEADDEDDSEEEEGFEEELEEDQTAD
                     DPLYVLPLYSLLPTSEQMKIFEDPPKGSRLCVVATNVAETSLTIPNVRYVVDCGRAKE
                     RKYDEESGVQSFEIGWISKASADQRAGRAGRTGPGHCYRLYSSAIYESEFPQFSKPEI
                     LRMPVEGVVLNMKSMGIQTVSNFPFPTAPNRQTLKTAEKLLQYLGALDKEKSQITAMG
                     KRMSLFPLSPRFSKILLIANQEGCLPYVIALVSGMSVGDPFLTEYDIGIQINETEEKN
                     YINESSAETRDDYQESEQQMSQKDIEKRRKLRHKFNKSNEMFSKLDRFSDSLKLLSAI
                     CASDHIPRKKRSQFYQDHFLREKQMTEIEKLRKQLTYIVKLHTSKESIAVSNKVSDEE
                     LRLPKPNKKQVQAIKQMLAAGFIDQIAFRLDLIDKDVKLGNNTKIMNVPYLSPAFIQN
                     SRQDESHIFIHPNSIILKSGKAPEYLVYSHLQRSSGKSDKVRLHPLNDITPTALANVG
                     KGTGLITYSKPLGLPITTLDDKGVETRECHVVPRYGAVLLSTGGVDLAPQKVTQKKIA
                     GAWEVV"
     gene            <816426..>818135
                     /locus_tag="C5L36_0A03630"
                     /db_xref="GeneID:40381473"
     mRNA            <816426..>818135
                     /locus_tag="C5L36_0A03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463380.1"
                     /db_xref="GeneID:40381473"
     CDS             816426..818135
                     /locus_tag="C5L36_0A03630"
                     /inference="similar to AA sequence:RefSeq:NP_013133.1"
                     /note="PKUD0A03630; similar to Saccharomyces cerevisiae
                     YLR033W (RSC58); ancestral locus Anc_2.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319240.1"
                     /db_xref="GeneID:40381473"
                     /translation="MDGTLFATSLENLAFIYSQLDSVGVLTAEFPNGDMFFENDIQKL
                     NYAFLRFLDSNPELDGSSKTTVQSKLDSGVYTSIYELFHDLKIASIVKILEHENNPSL
                     YAKVDKFYRIATETLLREAIRLGVSLKQTKKGLGGDKAGDSTTNSSNVDTDAADVMEN
                     QEEKIQEKLSQLQPLDSTDGLVASLEKDFNIITSVFYNSTGKALSVFSSGNIPFFTSL
                     NRYQSELDDREPIIDPSLGINITNVIPNISLSNVDNMSKFSDTNIKIPNIRQILENYM
                     HPNWLRLISSQWLKHGSDITSLNFSFAPSYDETQSIISNDWKGLTWCQQVGFKNLVDI
                     KEKYNELLKMQSESLEANEESVKNPGESSIPSSSSDKNEATDECKTTGEIKELEDGKV
                     EEKDGAVLENFELKTNDASAGEINGAVELQNHPGEISLKEKIDLENVFQYDEMELIGD
                     DETQIVQSGKVQSTISDLLCELSELRQQRLEKQKKHARYNKTLLAAGGKINKPAVEEV
                     KLYNKIRRLITGLIEHKNITPVDLNIDIDKRIPVLQHTYQGTLPASFAVSNQKTSRPK
                     RRR"
     gene            complement(<818229..>819479)
                     /locus_tag="C5L36_0A03640"
                     /db_xref="GeneID:40381474"
     mRNA            complement(<818229..>819479)
                     /locus_tag="C5L36_0A03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463381.1"
                     /db_xref="GeneID:40381474"
     CDS             complement(818229..819479)
                     /locus_tag="C5L36_0A03640"
                     /inference="similar to AA sequence:RefSeq:NP_010342.3"
                     /note="PKUD0A03640; similar to Saccharomyces cerevisiae
                     YDR057W (YOS9); ancestral locus Anc_3.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319241.1"
                     /db_xref="GeneID:40381474"
                     /translation="MFVEYRSVLLLSLLLLSSCGLGKSTRSYDKKYQIYRHLNKANET
                     FIQNACDTLSFKCYSLYVDQLEYHCLIPLVNDTLETEKVEAKDAAQLEAEKDQAIEVI
                     RNFNLEMRGKVALKPAGYWYYAVRFDHDIHQYHVGASGLPDYNYKLAAWSNNDPSISF
                     DSKPYHKEPEAEDPYAIKSNFEVIETEDKTKYVSQRISNGETCDLTGLPRTTTINYFC
                     NVNLKSPLIVSVNEWRTCEYIIDLQSSYFCDYDMWMPPKTLMNHHIDCYPNTDTFETL
                     GEKIDIHGLVLDPLTEGVFLGRRGESRRFVVLLTKDYNLWNVNGIDQDVQFEHLLSDI
                     ASGFQKYTRNLKLSTYIDDISTIVLLDDTFKLGFETYDGSGSYIGNIMVEHDRNGYFV
                     SYFTDEDIPEESNWLEYESILMLQ"
     gene            <819868..>821013
                     /locus_tag="C5L36_0A03650"
                     /db_xref="GeneID:40381475"
     mRNA            <819868..>821013
                     /locus_tag="C5L36_0A03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463382.1"
                     /db_xref="GeneID:40381475"
     CDS             819868..821013
                     /locus_tag="C5L36_0A03650"
                     /inference="similar to AA sequence:RefSeq:NP_009602.1"
                     /note="PKUD0A03650; similar to Saccharomyces cerevisiae
                     YBR046C (ZTA1); ancestral locus Anc_3.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319242.1"
                     /db_xref="GeneID:40381475"
                     /translation="MSAPVIKVTISSVLPFSPISSFTWRISRALSFNLAKAPIRKMTT
                     NVPEKQAVIYYQQNGGPDVLKYTFDYPVPTITANEILVKNKYAGVNYIETYFRKGIYP
                     TTFPFIPGREAAGEVVAIGKDVANYNIGDKVAYIGTKNFAQFTTLDSKKTTIINLGKD
                     ASDEQLKLYAASLIQGLTALTFIDEAYKVKEDDFILVTAAAGGVGLILDQLIGKIRGG
                     HVIAVASSDEKLAKAKENGAEFLLNSSKLSYDEIADEILKITHGKGVQATFDSVGKDT
                     FEMDLKVVARKGTIVSFGNASGTVEPLLINRLSPKNVKVLRPQLYGYISEADEFKYYS
                     KSLFDLIDSGKLKIDIYKVYPLKEYKEATIEMEARKTTGKIVLEIPQ"
     gene            complement(821127..821198)
                     /locus_tag="C5L36_0Atrna1E"
                     /db_xref="GeneID:40382457"
     tRNA            complement(821127..821198)
                     /locus_tag="C5L36_0Atrna1E"
                     /product="tRNA-Glu"
                     /note="PKUD0Atrna1E; codon recognized: GAG"
                     /db_xref="GeneID:40382457"
     gene            821582..821673
                     /locus_tag="C5L36_0Atrna2K"
                     /db_xref="GeneID:40382481"
     tRNA            join(821582..821619,821637..821673)
                     /locus_tag="C5L36_0Atrna2K"
                     /product="tRNA-Lys"
                     /note="PKUD0Atrna2K; codon recognized: AAA"
                     /db_xref="GeneID:40382481"
     gene            <821808..>823283
                     /locus_tag="C5L36_0A03660"
                     /db_xref="GeneID:40381476"
     mRNA            <821808..>823283
                     /locus_tag="C5L36_0A03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463383.1"
                     /db_xref="GeneID:40381476"
     CDS             821808..823283
                     /locus_tag="C5L36_0A03660"
                     /inference="similar to AA sequence:RefSeq:NP_013937.1"
                     /note="PKUD0A03660; similar to Saccharomyces cerevisiae
                     YMR210W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319243.1"
                     /db_xref="GeneID:40381476"
                     /translation="MQAYMFVLELIYSTISKLGIPIPFFQNTCVVLVTSYILWAIFSN
                     FNIINRVNVSYSYNPIHFYNNELKKPVCMEEFIHENIPEFRDKSWSLFNPFLFNGHLQ
                     TMFAGIRKFKNVDKLYFHRQIRYAGDGGCVALDHVIGKDEFFNYDKSKIVYPKNQPKK
                     LDECTRYMTQDELDIQSKGSDDDKAIVITLTGLSGSSAEAYIRCLYKKLEKISEFELF
                     VINSRGCGNSSLSTPKLFCALWTEDIRELVKYFKKVYPNRKIYLFGVSLGSIVLSNYL
                     AQEGENSGVELGIALASIWDLRTSSYFLENGFISSLFYSTAMTFPLMMLLKSHSNELL
                     QDPTFKSQYTNKLVRKIWKLKDFDNVFTSKLFGFTCADDYYTHASPIYKLDKIKTPYV
                     NISSLDDPITGGLQVGALPLDQAKYNPFISMINTSLGGHVGFFKWNNERWYAEPLSKL
                     IIQFHEKLSCKPGFEIQVDDKYIPKPVLIDGKLPINKHLVN"
     gene            complement(<823569..>825251)
                     /locus_tag="C5L36_0A03670"
                     /db_xref="GeneID:40381477"
     mRNA            complement(<823569..>825251)
                     /locus_tag="C5L36_0A03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463384.1"
                     /db_xref="GeneID:40381477"
     CDS             complement(823569..825251)
                     /locus_tag="C5L36_0A03670"
                     /inference="similar to AA sequence:RefSeq:NP_013023.3"
                     /note="PKUD0A03670; similar to Saccharomyces cerevisiae
                     YKR097W (PCK1); ancestral locus Anc_5.708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319244.1"
                     /db_xref="GeneID:40381477"
                     /translation="MAPTAVDIHNEYKQNVSNEQEIPFNKTERKSSIASKLGLNPDAK
                     IHYNSAVPILYEDGLKEKGTTISSSGALIAFSGSKTGRSPKDKRIVDEETSTDNIWWG
                     PVNKKVDENTWNISKSRAIDYLRTREKVYIIDAFAGWDPRYRIKVRIVCARAYHALFM
                     KNMLIRPTTEELKNFGEPDFTIWNAGQFPANVYTKGMTSSTSVEINFKSMEMVILGTE
                     YAGEMKKGIFTVMFYLMPIRHKVLTLHSSANQGKKDGDVTLFFGLSGTGKTTLSADPH
                     RELIGDDEHCWSDHGVFNIEGGCYAKCLDLSAEREPEIFNAIRFGSVLENVVYDPVDR
                     TVDYSAANVTENTRCAYPIDFIPSAKIPCLADSHPKNIVLLTCDARGVLPPVSKLTNA
                     QVMYHFISGYTSKMAGTEVGVTEPEATFSACFGQPFLVLHPMKYAQQLSDKMAEHSST
                     AWLLNTGWTGQSYVKGGKRCPLKYTRAILDAIHSGELAKQEFETYPTFGLQVPKTCPG
                     VPESVLNPSKYWATGEADFKAEVTNLAKLFAENFEKYSAECTAEVVAAGPAL"
     gene            complement(<826607..>828226)
                     /locus_tag="C5L36_0A03680"
                     /db_xref="GeneID:40381478"
     mRNA            complement(<826607..>828226)
                     /locus_tag="C5L36_0A03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463385.1"
                     /db_xref="GeneID:40381478"
     CDS             complement(826607..828226)
                     /locus_tag="C5L36_0A03680"
                     /note="PKUD0A03680; Pfam Domains:
                     MFS_1(1.2e-32)|Sugar_tr(5.3e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319245.1"
                     /db_xref="GeneID:40381478"
                     /translation="MTLHKNSNEGVQASGFELQDNLDVPHSNASFQSFKSDEAEQAHN
                     NEHLMEKPQFNKATISNYCKTRFTELFPTKQSMAANKHLLNPLPGLRMIGFKQWLLIL
                     SGFLAWTWDAYDFFSISLNTVQLAKDFDKTVKDITWGITVVLMLRSVGGFFFGYLGDK
                     YGRKWPLIANLMCVCFLEIGTGFIKNYSQFLGVRAVFGIMLGGVYGNAAATALDDCPA
                     EARGFISGFLQQGYAFGYLLAVVFKRAIADNSPHRWRAMFWFGAGVCFLICCFRAVLP
                     ETKAFQRNKEIERYNEEHGIHQRSFKEKATTSLKIYWLMIIYMVLLMAGFNFMSHGSQ
                     DLYPTLLTVRYNFSDNATTVTNCVANIGAITGGIIIGHFSNFIGRRLSIIICCIIGGA
                     LIYPWAFVDNANINAGAFFLQFFVQGAWGVVPVHLSELAPPDFKAFVVGIAYQLGNLA
                     SSASSTIETTIGVHFPMTSPGGEPIFDYAKVMAIFVGCVFAYVLLITFIGPERKSVSF
                     EEPVDEDIEINEKIKHNEEIEAGSNLGTSRA"
     gene            complement(<829987..>830655)
                     /locus_tag="C5L36_0A03690"
                     /db_xref="GeneID:40381479"
     mRNA            complement(join(<829987..830445,830599..>830655))
                     /locus_tag="C5L36_0A03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463386.1"
                     /db_xref="GeneID:40381479"
     CDS             complement(join(829987..830445,830599..830655))
                     /locus_tag="C5L36_0A03690"
                     /inference="similar to AA sequence:RefSeq:NP_015353.1"
                     /note="PKUD0A03690; similar to Saccharomyces cerevisiae
                     YPR028W (YOP1); ancestral locus Anc_7.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319246.1"
                     /db_xref="GeneID:40381479"
                     /translation="MDFKSIQTQAQQYLSKIDQHTKKIGVLDQFEQQTKLPRSYAVLG
                     AAGLYMLLVFLNLGGIGQLLSNLAGFAFPGYLSLKALKTQTKSDDTKLLTYWVVFAGL
                     QIIEFWSKTILYWIPAYFLFKTLFLVYIALPATNGAELIYTKILAPATDRFITVDPAS
                     DLLNKVQEKTE"
     gene            complement(<830937..>833534)
                     /locus_tag="C5L36_0A03700"
                     /db_xref="GeneID:40381480"
     mRNA            complement(<830937..>833534)
                     /locus_tag="C5L36_0A03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463387.1"
                     /db_xref="GeneID:40381480"
     CDS             complement(830937..833534)
                     /locus_tag="C5L36_0A03700"
                     /inference="similar to AA sequence:RefSeq:NP_015354.1"
                     /note="PKUD0A03700; similar to Saccharomyces cerevisiae
                     YPR029C (APL4); ancestral locus Anc_7.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319247.1"
                     /db_xref="GeneID:40381480"
                     /translation="MKENDNILKGNKKRTKEINLGEYNRYPFIYTYVYHSLCRFNRQL
                     LAASIMGSLKTFIKAVRNSKTIAAERAVIRKESAKIRSSFRDPHLDNEKRRKNIQKLL
                     YLYILGEPTQFGQVECLKLIASTKFSDKRIGYMVAMLIMDESQDILTLLTNSLDIDMK
                     NANPLIIGLALTALGNLTSPELAKDLYPNVEKLLNSSQSYIKKKAALVASKLVEKDPV
                     LCEVYLPYLDNLLNEKSHGVLLGTLVLINTIYFNDNSCHKQLVQYIPKILSHIKLLQS
                     SSYSPEYDVKGIPDPFLFVSLLKTVRILLSSSNIYSNDDMKYNSDYLLESVNDVLTQV
                     CAKFENTKGSGYSILYEAVKTIFTIQSDSSLKVLGVNILSKFLIQKDNNIRYVALDTL
                     LQVIEYEPLAVQRHRNTIVGCLHDGDISIRRRALELTFGITNQQNIKLLFKEILKYLK
                     VEQDEDLKHYITSQMTILCENYNSNVEWTLNTMISMLNIAGNYCNDNILSTILSIIMQ
                     SSGNQELIKETLVRLVKTFNSGLYDQYGLSLVTVWCLGEYSDLIIDNNNAEMNESKIF
                     DIINSILAVSDFSNDDEKLKIKIYVLTACLKLSVKFKIPSNVEKLRMIISNASKDINL
                     EIQTRAVEYLKIFGEPMTIRRGLLERMPAPPVKKQEITSLLNRTTLYGENAVKDTNQG
                     SSKASKSGDLLLDLLGDDDTSNKTNSNSTLSKGINGKEKDNVIDLLSDIFGTSSINAT
                     TSNNNGNTIDSKEPESLEVFNDGSIRVGFIVEKVASGSCELQAVVKNISTNTITGISV
                     LCAVSKQQNLQLSSIAKTTLNAQDYTPLTLKITGKPGSKVKVRVKLGYILNGKVDRQF
                     DYVNSENTL"
     gene            complement(<833821..>834486)
                     /locus_tag="C5L36_0A03710"
                     /db_xref="GeneID:40381481"
     mRNA            complement(<833821..>834486)
                     /locus_tag="C5L36_0A03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463388.1"
                     /db_xref="GeneID:40381481"
     CDS             complement(833821..834486)
                     /locus_tag="C5L36_0A03710"
                     /note="PKUD0A03710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319248.1"
                     /db_xref="GeneID:40381481"
                     /translation="MIKTSSYNWIMKGTDKEVEQWEKIDPIASIRVLSPVPSKGSLPR
                     KIYCNTKVKLYNVGDWYGLNQLAETARKTKFRSTRSPGTHGTFYNWLKSRLNLNEPTC
                     SEFLSKHETYLFKIKNKRQFLMFLNSKLNELHHASENSRLNVVPLPPNCATRWISKFL
                     KLVCIITLLLLISSISILLLFLHTDVIESCFIHDEDYQSLVKIFKKKLFLLLQRENIS
                     NYC"
     gene            complement(<835587..>836264)
                     /locus_tag="C5L36_0A03720"
                     /db_xref="GeneID:40381482"
     mRNA            complement(<835587..>836264)
                     /locus_tag="C5L36_0A03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463389.1"
                     /db_xref="GeneID:40381482"
     CDS             complement(835587..836264)
                     /locus_tag="C5L36_0A03720"
                     /note="PKUD0A03720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319249.1"
                     /db_xref="GeneID:40381482"
                     /translation="MYLHHINYFHNNYNSYQPLPTPMYSVPPTPLSLKDEVKQSHFSQ
                     PFQCQHPCQEGPDQNVRPFYLYKGLDPQREEQFKIYPVSNGPNAVLGANVNRSDAVMA
                     AAAPPSPSTSTSSESDDESSVLDNELIKEIKDSATDKLKYKCNYPGCRYKGTFLSKDY
                     IRRHIREQHKREREHVCQGFHSNGEMWGCNKRFSRPYQLINHWRGQRSLKRCGVPESE
                     LRRCGVL"
     gene            <837959..>838495
                     /locus_tag="C5L36_0A03730"
                     /db_xref="GeneID:40381483"
     mRNA            <837959..>838495
                     /locus_tag="C5L36_0A03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463390.1"
                     /db_xref="GeneID:40381483"
     CDS             837959..838495
                     /locus_tag="C5L36_0A03730"
                     /inference="similar to AA sequence:RefSeq:NP_010160.1"
                     /note="PKUD0A03730; similar to Saccharomyces cerevisiae
                     YDL123W (SNA4); ancestral locus Anc_7.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319250.1"
                     /db_xref="GeneID:40381483"
                     /translation="MCFCCCDILCCDCILVILAVFFPPLPVCIKRGLCSCDLLINICL
                     CTLGWVPGMIHAWYIILSDPYVVIDDEERQIFIVTPQPSSSVVVNKRPDQTRIRFTHP
                     EPFAESLNSVHSKNNNDINNQNPSPLSSPIPQSNYIPSPLGQANYGTIANDEEVDPNT
                     DLPPDYESAMNETAKQFR"
     gene            <838770..>839726
                     /locus_tag="C5L36_0A03740"
                     /db_xref="GeneID:40381484"
     mRNA            <838770..>839726
                     /locus_tag="C5L36_0A03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463391.1"
                     /db_xref="GeneID:40381484"
     CDS             838770..839726
                     /locus_tag="C5L36_0A03740"
                     /inference="similar to AA sequence:RefSeq:NP_009734.1"
                     /note="PKUD0A03740; similar to Saccharomyces cerevisiae
                     YBR175W (SWD3); ancestral locus Anc_8.585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319251.1"
                     /db_xref="GeneID:40381484"
                     /translation="MPVATPAKYKLRYSLKDIHDGSLVSTVKFSPDGLKFATCCSAGS
                     IKIWSSQTGELLTTLRGHNDGISDIAFSANNEYLASGSDDLTIRIWDLKFEETLKLLK
                     NHTYHITCLQFDKRSRILISGSSDENIRVWDCKRGESMRTLSAHSDPVSSIDLSFDDT
                     IIVSGSYDGLIRLFDTETGGCLKTLIYDKEGSSFPISYVKFSPNSKFVLSSSLDGVLR
                     LWDYMNNKVVKTYKGINNSPVAEKFSLGTNFITFNNELMINSGDERGNLVFWDLQSQE
                     ILFTLEASGKSSPIMNTDSFNNGQFLVSVSLDGELCVWDYVS"
     gene            complement(<840951..>841346)
                     /locus_tag="C5L36_0A03750"
                     /db_xref="GeneID:40381485"
     mRNA            complement(<840951..>841346)
                     /locus_tag="C5L36_0A03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463392.1"
                     /db_xref="GeneID:40381485"
     CDS             complement(840951..841346)
                     /locus_tag="C5L36_0A03750"
                     /note="PKUD0A03750; Pfam Domains: Histone(1e-31)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319252.1"
                     /db_xref="GeneID:40381485"
                     /translation="MSGGKGGKAGSSEKVSTSRSAKAGLTFPVGRVHRLLRKGNYAQR
                     IGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHV
                     TIAQGGVLPNIHQSLLPKKSAKAKASQEL"
     gene            <842005..>842397
                     /locus_tag="C5L36_0A03760"
                     /db_xref="GeneID:40381486"
     mRNA            <842005..>842397
                     /locus_tag="C5L36_0A03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463393.1"
                     /db_xref="GeneID:40381486"
     CDS             842005..842397
                     /locus_tag="C5L36_0A03760"
                     /inference="similar to AA sequence:RefSeq:NP_010510.3"
                     /note="PKUD0A03760; similar to Saccharomyces cerevisiae
                     YDR224C (HTB1); ancestral locus Anc_8.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319253.1"
                     /db_xref="GeneID:40381486"
                     /translation="MAPKAEKVASKAPAEKKPAGKKTAAATDNKKRTKARKETYSSYI
                     YKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVR
                     LILPGELSKHAVSEGTRAVTKYTSAATA"
     gene            <842834..>845251
                     /locus_tag="C5L36_0A03770"
                     /db_xref="GeneID:40381487"
     mRNA            <842834..>845251
                     /locus_tag="C5L36_0A03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463394.1"
                     /db_xref="GeneID:40381487"
     CDS             842834..845251
                     /locus_tag="C5L36_0A03770"
                     /inference="similar to AA sequence:RefSeq:NP_011644.3"
                     /note="PKUD0A03770; similar to Saccharomyces cerevisiae
                     YGR128C (UTP8); ancestral locus Anc_3.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319254.1"
                     /db_xref="GeneID:40381487"
                     /translation="MSSIIYDPFVVNSLPRLPPKTDVFKSCVSSQIKDANSNSFDVAI
                     SGSYLATFITRPSPKMIWSYALSPQTIVTSMDSFDFEEISDNQKFQHNHQVTDGKIFA
                     VGINERKANKLRFISYGTEEKKSSSLDDENQSSSLSTVNEEDKQSNEMEHIKEVKDRS
                     INVDDKIAGLKFSKNSKYVYSVSSNGTISVYKFSVDSGDDENPIFKRKAESSRNKASV
                     IFHQFIKPEELKVNSRNDKIDYLLITAEKTESQSSIDVSVFSINDDEILEISKSTIDS
                     LNDVNNIHITYDISGKLIILENEPKLTIKAYDLPFVNNGHRIEIGGVFKHERKDSPTS
                     VACASSNRILVTKGSTVALIDIQYEALLSSLDLYSRSKDTDNLKPPRDAVLLNVPSVN
                     GNTLKSKKTFALLILKNTKENYSQIQHVSIDVGLGKLRDALVSLPSVDDSQSDQFTSF
                     TSYFTKQDQQHSGVNKSEAEKLNSQINQSNDELGEVYSKLVEIKNSGDVRLLENSIVS
                     YLKNKPFGELFEDGEFKAYEYEKDRFVDPKFFTQLTLLLFEHDIKTDTITLDVSNEDS
                     IPEYGLTYILTHPLFPIKYSHGLLRLLEPLPRLQRQAIVTCANIPCGDFIMELSSCEN
                     DEIFKDIMTRLNDEFSGEEITKETMKIMRQQSHVGKKDSFNLDRIINKIIKLNFGFEV
                     LNSFIDSNGLILSLHYSNDDHQLSKLIKQTQLKVDSLIEDTQLLTLVNQCLTNAEASK
                     QGKASKSSKKYKRKDKKKSEAHENGEQSIEVGLSKLDMILKVGTESQGSKKKTRSSTY
                     TIDRLVI"
     gene            <845535..>846179
                     /locus_tag="C5L36_0A03780"
                     /db_xref="GeneID:40381488"
     mRNA            <845535..>846179
                     /locus_tag="C5L36_0A03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463395.1"
                     /db_xref="GeneID:40381488"
     CDS             845535..846179
                     /locus_tag="C5L36_0A03780"
                     /inference="similar to AA sequence:RefSeq:NP_010590.3"
                     /note="PKUD0A03780; similar to Saccharomyces cerevisiae
                     YDR304C (CPR5) and YHR057C (CPR2); ancestral locus
                     Anc_5.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319255.1"
                     /db_xref="GeneID:40381488"
                     /translation="MMKLLASVFAIIAAFFLLISQSNASGELAELPEITHKVYFDITK
                     GDEPLGRVVIGLFGDVVPKTVENFYKLSISDDPKFGYKGSSFHRVIKNFMIQGGDFTN
                     HNGTGGKSIYGSKFPDENFKLKHDRPGMLSMANAGKNTNGSQFFITTVKTPWLDGRHV
                     VFGTVVEGFDVVQAIENSKTGYGDKPKEPIVIADCGAIEDIAEHETEPKAKDEL"
     gene            <846908..>849928
                     /locus_tag="C5L36_0A03790"
                     /db_xref="GeneID:40381489"
     mRNA            <846908..>849928
                     /locus_tag="C5L36_0A03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463396.1"
                     /db_xref="GeneID:40381489"
     CDS             846908..849928
                     /locus_tag="C5L36_0A03790"
                     /inference="similar to AA sequence:RefSeq:NP_011641.1"
                     /note="PKUD0A03790; similar to Saccharomyces cerevisiae
                     YGR125W; ancestral locus Anc_3.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319256.1"
                     /db_xref="GeneID:40381489"
                     /translation="MSSYYDNDNNEFVKSVSIPKASDHHRHPSVSNNALARSFVYSSF
                     KPGSSFSPNSKSLQVHSSDSIHEDSADLAEIAVTDFNNIDSEYSNPPLILTKDDSGTT
                     LNDSYSTQVMSDQNGVPSPLLLPNQKPSYGSYDDSGSEYHSYFEDPEALRNQGHHFSL
                     KETLDFWRNADSETLLNECLYRPMSYMPAVFLGTLLNVLDALSYGMIMFPIGESVFSG
                     LGPTGLSMFYVSTVISQLIFSLGGSAFKNSIGSEMIEVTPFFHQMAINIMIKLQNDTR
                     FVNDPTLNSRIISTTIFTFAISSIVTGLCFGILGKCKLGKLVGFFPRHILVGCIGGVG
                     YFLIITGIEVSSRLEGGIEYNLPTLQYLLNPLPFLQWTIPLGLAFILIFIQHHNTNPL
                     IVPAYFIGVFIIFHSLIMIVPSWNLDMARDFGWIFSAQESNEPWYGFYNYYDFGLCDW
                     WLVVHELPTMLALTFFGVLHVPINVPALALSIGMDTYDVDRELMAHGASNFISGLAGS
                     IQNYLVYTNSVLFIRSGADSRLSGVLLAIATACIMVVGPSLIGYIPVCVVGALIYLLG
                     YELLKESVWDTIGRLRKFEYMTIIIIVITMGAFDFVIGIIVGILLACVSFVIEAGSKK
                     VISEVYTGEYARSVVVRHPKQLEFLKNVGKQICVLKLNGSLFFGSIGGLEQEVRNMFD
                     IANYRKQPIKYLILDLNSVLTFDFSATEGFKRIRNLLMEKNCYFILSSVTDNSPIVES
                     LRFCGLWENEEHEEKIQMFNNLNSALEWCENIFLKNYKDLKSSPRFSSITNMKKSGMA
                     LYTGETSTTGSDPSVFVGTPRQIQFMNAARKYNQHEQKEQDLILTKLSESGRKMSNSQ
                     LKQPLYLLLQIMQGLSDKSDESFWQKLSPYLKRVVYKPGEAVYEKNINQPSLYFFESG
                     LINYEIGFNNLKFNIRSSELPLTMFGDIIITNSDRSFKYIAETTCVVWVLDSKSIKNL
                     EKENNLIYEELLAVYIRYSTQRSESVISNVLISY"
     gene            <850337..>852037
                     /locus_tag="C5L36_0A03800"
                     /db_xref="GeneID:40381490"
     mRNA            <850337..>852037
                     /locus_tag="C5L36_0A03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463397.1"
                     /db_xref="GeneID:40381490"
     CDS             850337..852037
                     /locus_tag="C5L36_0A03800"
                     /inference="similar to AA sequence:RefSeq:NP_011977.1"
                     /note="PKUD0A03800; similar to Saccharomyces cerevisiae
                     YHR109W (CTM1); ancestral locus Anc_5.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319257.1"
                     /db_xref="GeneID:40381490"
                     /translation="MPLFAEDIDNCEELEKWVKSMNVSYNSDVNVKNTPDRGVGLFFK
                     PTKTNGEQTELLRIPHMSSFNIYTIRKLCDDKLEADDKKVLKRCLQIVFTICYSASES
                     LILIAYMIGLLMICEKRKIHASVGDDRRWLDDMKGYIGILMKTKVGNLYTDQQNVLED
                     FLAAFKGNAVLKSSITDVISEKWIEVETAINEEFSEEFERINVSEILQICSAVRSRVL
                     EIPREVETEVCGEEEEKEGRDSDEETNDDFYVDVTLVPVLDFVNHDNHMRNAHFDVDR
                     DSKDIVLYYENDKANTQGTNEEAGGAGEEKKEVEVFISYDKYEDIHFMFANYGFIPQS
                     RGTKVIELPILGYNENSKLDNYKASMRLYEIKQSPNVQFAVEFAETGEICDVKILDEE
                     FYSYLIFDDRLKWREEEDEQVAENEENEDTEEEQPKDEDAGSAATLQLEFERGYRRCE
                     RLVNQLSDERYNELQHSFYDYLGEYLLKFSKRVSIFATITREYELPNGETTNILKLLE
                     FYGQLCKAMRKILVARHKFESHPLADPYTASGYLSRRMLPLYNFENILAGVEMGDLTL
                     "
     gene            <852505..>853590
                     /locus_tag="C5L36_0A03810"
                     /db_xref="GeneID:40381491"
     mRNA            <852505..>853590
                     /locus_tag="C5L36_0A03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463398.1"
                     /db_xref="GeneID:40381491"
     CDS             852505..853590
                     /locus_tag="C5L36_0A03810"
                     /note="PKUD0A03810; Pfam Domains: Zn_clus(5.7e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319258.1"
                     /db_xref="GeneID:40381491"
                     /translation="MSVSEYHDHSTSSKKRVSKACDSCRLKKTKCNGKQPCERCSLNN
                     KICVYTERKKSKEKNYTAEYVELMDNRLTMANKSLIKLCELIKLNNLEEIANLASRLD
                     YNESDNLNPISINQAIELINDINVEKKSSSNPSPEVKSAIKYPIFSSDSSESVLSPPN
                     LDISSSDEMNSYNKMYNNDLNVQLQHLNSNPSPVEEYDPSVLGFATGSLGDNPTDTNS
                     CNSCDHNSSLLKNFSYNQSFDNSINPLLIPTDSFTSVSEFSSMSNQISYTQYSEFVSP
                     SSITSATSDLIFSNFEDNRPITNNATHHRSSISNGSIRKVCHHNKGPQIGSRSPKSLN
                     GQNSSKLILGSTSSIPLPVRYEVTESL"
     gene            complement(<854015..>857290)
                     /locus_tag="C5L36_0A03820"
                     /db_xref="GeneID:40381492"
     mRNA            complement(<854015..>857290)
                     /locus_tag="C5L36_0A03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463399.1"
                     /db_xref="GeneID:40381492"
     CDS             complement(854015..857290)
                     /locus_tag="C5L36_0A03820"
                     /note="PKUD0A03820; Pfam Domains:
                     Chitin_synth_1(1.7e-81)|Chitin_synth_1N(1.9e-
                     18)|Chitin_synth_2(1.6e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319259.1"
                     /db_xref="GeneID:40381492"
                     /translation="MPNYDNPFAINDTDDESSYQHSILGNHEIPLTLGPFEHEHEVNG
                     ITNNIHGHRRQISVDQLQVPTNSARIISSPRRYDGSHNIRDSTDPFNTAFDDDDDDDA
                     IGNGGDYGEREENWNPQEDMRSVNTFHNYSLDSNIEGHPMDSVSMRTNKTNGVNVYEY
                     DHSDNSNMYETSTANILNAHGDTNSNFEYSPAHSNQQLNQHNNSQSGDRNLSFHRPDF
                     SYYSDEFSPIFQDFERDIDEPELDNNDLFQDEVMNDQNDLKDGNFADKCDNRVELIDG
                     KYYSFDYPVPSQLLNRIPFNGAKNLTEFNRLRYHAITADPKDYTDEDPIIKDYIQNYP
                     LRQNIYPIKRDTELMIVCTMYNEDEILLARTLKGVFKNIKTMYNLKENKDVHPWGKDS
                     WKKIVVVIVSDGKLKIDEKSKALLTLLGAFQEGIMQESVNNDKVNAHLFEYTTTFGIG
                     KFDYNRENHSYNVPLVTEQTIPVQLMFLLKEENKQKINSHRWALNFLCPNLNPKVVVL
                     LDVGTEPGPDSIFKLWKAFKDPKVGGSCGEIRAMLGNHASPNDESSIWRKIGRFIYFK
                     FSDFVMCTINPLVAAQNFEYKMSNILDKPMESSFGFVTVLPGAFSAYRYEALKGEPLR
                     AYFHGEDMKSATSKPAGILESNMYLAEDRILCFELVAKSEKSYLLKYVHNSYAVTDVP
                     SHISEFVNQRRRWLNGSFFAALYSNLHFYRLLKSTHSIGRKIALVIEVIYQTINILLS
                     WFSLSIYFLVFRILTQNIRDTFVGEKVGNILAIVFLWVYIAAFVLTFIISFGNKPNDA
                     KYLYLLVFALFACVVIYMTFCVIVLTIESVHLIKQQIGDYSSFTASIALKYFENSKFR
                     DLTVSLASTYALYLIGSLIFFDVFHLIACTIPYVLLSPAYINVLSVFAFCNINDISWG
                     TKGSVTIEAPKKKAVNDDNDEKNILLLSENLENPDDLFKKAQLCMEGKNPDNDGEKAA
                     KLESDLILENIKKSEKNYALGRTYTVSLWLICNFILLVIILRTGGLEDYSDYKNGTDT
                     STSTSGLSKRSYWNNMNVANIFMTVILWLVAALALVRLIGCIYYRISFFFKERKFHRS
                     LVV"
     gene            complement(<857636..>859312)
                     /locus_tag="C5L36_0A03830"
                     /db_xref="GeneID:40381493"
     mRNA            complement(<857636..>859312)
                     /locus_tag="C5L36_0A03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463400.1"
                     /db_xref="GeneID:40381493"
     CDS             complement(857636..859312)
                     /locus_tag="C5L36_0A03830"
                     /inference="similar to AA sequence:RefSeq:NP_011639.3"
                     /note="PKUD0A03830; similar to Saccharomyces cerevisiae
                     YGR123C (PPT1); ancestral locus Anc_3.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319260.1"
                     /db_xref="GeneID:40381493"
                     /translation="MTSGEDGIQVQVENALKKLSIRDVFVDAEEEIFSGTTYIDEHGR
                     KFDTRERVVKTVEMPTLEIPTDEQLFVDGVPDYRFLMRHFRREGKLSYSQIFRIIDAA
                     TIIMRKEPNLLKVDIPSVVVGDIHGQYYDMLGMFEMFGDPSKTQYLFLGDYVDRGDRS
                     IEVLILLYAMKINFPKRFWLLRGNHESERMTSYFTYKRECIQRYSEELYEKSLESFKA
                     LPLCAILNEQFFCVHAGISMSLWDLEDINKIDRFKVDIPGEGLLCDLMWSDPTDDYDT
                     ETIHKDDIEHYFRFNNERHCSVFYTYIAVQSFLESNKLLGIIRGHQPQDSGYRIYRTV
                     ESSGFPSLITIFSAPNYCGTYANMGAALVYNGETFNIKQFDTSPAPYFLPDQMNVFEW
                     SLPFVAEKVIEILSAILNICTEDELNKSEIILDKRSIEVLKAIDSSIAAEEEEYVSHT
                     HDKDRRKSTTPVVRDSILKKMALVGRMSKVLKKMREKCEKVQELKALDKYDINFHGLV
                     DGREVMHKKSHSFEDVRNIDLENEGLPPTDEERAAEEAQKERDLEHYMHM"
     gene            complement(<859660..>861438)
                     /locus_tag="C5L36_0A03840"
                     /db_xref="GeneID:40381494"
     mRNA            complement(<859660..>861438)
                     /locus_tag="C5L36_0A03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463401.1"
                     /db_xref="GeneID:40381494"
     CDS             complement(859660..861438)
                     /locus_tag="C5L36_0A03840"
                     /inference="similar to AA sequence:RefSeq:NP_013537.1"
                     /note="PKUD0A03840; similar to Saccharomyces cerevisiae
                     YLR433C (CNA1) and YML057W (CMP2); ancestral locus
                     Anc_4.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319261.1"
                     /db_xref="GeneID:40381494"
                     /translation="MTSRDLTAKEKLNAHENTVKIENALRKMKDRDVTNSQDPTIYID
                     DNGEKFNTRERIVKSVTPPTDKIPTDEELFPKPTGLPDYKFLREHFKREGKLTQNQTL
                     RIIHMATKIFEKEPNLLYVPSPVTVCGDIHGQLYDLCKLFDICGDPDTTSFLFLGDYV
                     DRGSYSLEVLILLYAMKINHPKTFTMLRGNHESKQMTQHFTFKSECLVKYSIDVYQAS
                     LKSFCTLPIAAIMNKQFFCVHGGISKDIKYISDIEEINRFQMDFPSHGAFCDLMWSDP
                     SNSFDDEEYGSKKVRNFEENYERGCSYMYSYNAVCSFLERNNLLCVIRAHQAQDKGYR
                     MYKKTPTQQFPSVITLFSAPNYCGTYGNKAAVLKYDVTTMNIRQFSAQNEPYHLPNFM
                     NVFTWSVPFVAERVCEILYSVLNICTEEELEMETPLSKELTQSLLKIQQECKLRGKMS
                     QIPKEKQSPATVADATNATHGSSAVSTSSEALVGNEQTTDAKTLANAALRKKILAIGR
                     LSRMFHLLRQESEKVEQLRAYSGGLSLPKGVLVEGSEGIDEKISHFERVRLADLRNEA
                     MPKSTEEQIKESDDKYRKLWERVTRK"
     gene            <861810..>862430
                     /locus_tag="C5L36_0A03850"
                     /db_xref="GeneID:40381495"
     mRNA            <861810..>862430
                     /locus_tag="C5L36_0A03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463402.1"
                     /db_xref="GeneID:40381495"
     CDS             861810..862430
                     /locus_tag="C5L36_0A03850"
                     /inference="similar to AA sequence:RefSeq:NP_013539.4"
                     /note="PKUD0A03850; similar to Saccharomyces cerevisiae
                     YLR435W (TSR2); ancestral locus Anc_4.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319262.1"
                     /db_xref="GeneID:40381495"
                     /translation="MPEILLNDPGALIADAPNKNLLPFPTDKQDANFELGVSMIIHGW
                     HTLTTAVDNLWGGPQSEEKRDWISGVVVDEFTNNYEIDIIYLHELLLGIMEDEFFITL
                     EDGSTVEIATKIVKCYKECKDSIFENIQAMYTKWAAKQQNKQKVIVSVGEDPVNPDIS
                     DDEEGTTDDHNGDDMDVDDVELVQSQPKAKQEPEIDDDGFTIVRRR"
     gene            complement(<862530..>865907)
                     /locus_tag="C5L36_0A03860"
                     /db_xref="GeneID:40381496"
     mRNA            complement(<862530..>865907)
                     /locus_tag="C5L36_0A03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463403.1"
                     /db_xref="GeneID:40381496"
     CDS             complement(862530..865907)
                     /locus_tag="C5L36_0A03860"
                     /inference="similar to AA sequence:RefSeq:NP_013540.1"
                     /note="PKUD0A03860; similar to Saccharomyces cerevisiae
                     YLR436C (ECM30); ancestral locus Anc_4.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319263.1"
                     /db_xref="GeneID:40381496"
                     /translation="MGSPEVKLKLKSHLAKIVDVATDLNEVSLYWQKFWTLPTSVDDI
                     VAVFLPCDIRYIRDNHRSAFTKLIHSITNRLIYLTKLKKFPSANFPYIELLNCIRLLT
                     VILPFLYEKPSLLFIENDVFWNRIYRTPFYSSHRAFHENISSDTAYSDVSGLDGSVHP
                     RPDSGVALDNTVGITHQDTERHEKPVGSELIDSCLDLLFTSEFTVENTRERNQNSNFA
                     NFNQLTVWEPGYEAKGLYQDPKLKYDSNRLEIVRFLLVLFSRNMYCLPSSVVKVGSRF
                     LTYFVSATNGRKYYILCLSLLNTLLRSLQSNGDKARVNEFSDPEHKNNNGLEVPDENH
                     KKIRILMVTNAIQLFTLMIAYSLPKNDIDFLFGSGILSRDETARNRTRMFLNKVNTSK
                     DMNFIIRSLTGSLLGPVLDDENNTFTSLMKTSKLLGSGEVHLFSKEIMIVILEFYQCN
                     SKFRVYFAEIAGAQYFIALMYYITKFKDDGKYKRYLKLCVYNLLYLSSEFRMANKLLI
                     AFDPDIYESLPNISRTPTFPTSYRDYLILQICNLLISKQDFEYSLQLCQVLYNLICIH
                     VLVLEHSRKGDLEITQNRRFSVKDLSKCPPTQVSYAASALVMQLIAKMSSFDNLAKEY
                     ENQSENLSLLLRACCHAISRDPTESVILLYTFSKNANLLNRLSNNLTRLSEDRFRQIL
                     IDEKKEFDMAIQNRQMQFRKLLYQQVHDDEDNEDYIDYTTELEKYDALKSKDSLDFPP
                     ISRQNTQTTLDSIPSVRSMPALTRQTSQISISNASPKIGNGAFENSIDPLCKSNGSLP
                     LQKSADDNNDHNRKQSDSLIIDLDREGFSAGFPIGMTSISKGKRRYYAKYSQKWPGKE
                     ALSMLRESAKMVNSLVVVETSNLSGNQLGNASYVIQKLMRLDLEGLMNNIPKSKIYDS
                     SKMSYSPLKLKWNHHILGWYLSVIWGDIFANYNCYEEKGLLAEISSGLSVIKRASSSW
                     GFGSWKFGNKNSLPKSSPLSLESNSDDKNLEQHNSTSYGDNILENPVWIGTHIQLFKV
                     NPELLRDHYTMLNNKSEIFYSTGLGAIFSPVLGDSSWKRNSTTTSHLNQRNGSSVFTE
                     EFWKRQGGRGLVDRRGSDHSLKSHFNHESLSGRPSIS"
     gene            complement(<866470..>866949)
                     /locus_tag="C5L36_0A03870"
                     /db_xref="GeneID:40381497"
     mRNA            complement(<866470..>866949)
                     /locus_tag="C5L36_0A03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463404.1"
                     /db_xref="GeneID:40381497"
     CDS             complement(866470..866949)
                     /locus_tag="C5L36_0A03870"
                     /inference="similar to AA sequence:RefSeq:NP_013541.3"
                     /note="PKUD0A03870; similar to Saccharomyces cerevisiae
                     YLR437C (DIF1) and YML058W (SML1); ancestral locus
                     Anc_4.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319264.1"
                     /db_xref="GeneID:40381497"
                     /translation="MQEIKRQNRGSMFSGSDSSVSDETTERLQTIGMRIRQSVSMGYK
                     VPDSSTCGLPSYMNDYEQQQSINNTRRIPLPSHLDGSTPPALDYNGSTASSLAGWEQE
                     INSSITDNMHNINKYYNVTPHNEPSCLKRGFANVEGKELDVGDYVQRYGPLSFNDEF"
     gene            complement(<867177..>873089)
                     /locus_tag="C5L36_0A03880"
                     /db_xref="GeneID:40381498"
     mRNA            complement(<867177..>873089)
                     /locus_tag="C5L36_0A03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463405.1"
                     /db_xref="GeneID:40381498"
     CDS             complement(867177..873089)
                     /locus_tag="C5L36_0A03880"
                     /inference="similar to AA sequence:RefSeq:NP_013526.1"
                     /note="PKUD0A03880; similar to Saccharomyces cerevisiae
                     YLR422W; ancestral locus Anc_4.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319265.1"
                     /db_xref="GeneID:40381498"
                     /translation="MSLENARRAIGMQPSGSSSSKNSAQEHTPWCATDKLLHAEIITS
                     FMPLEYPKIGESVSKHIAKNLRNLYPGDKVYIFETLAVNEKLTWARGYVVIQPLPADF
                     ISASVDIKKLPEDKVYTCIFPLNCAKVLSHSELEMTVGQENSMFESFDEFDDSLSFTE
                     SEFSTSSSKTKRQVRPQLPMSDSIVSNNLSDEIKLTLKTISSTLFAVYSKNRFDFFEK
                     LVKIYYELDDLRLNLQNDLLTKHETELAKQKVILLLSKFAKLSASGGGLINRSKHSKS
                     DIDGKESIIARDEKTAELYQFPEKSNGIVNPGKIAQNQLLSSLSPHYISSSHVNFVSP
                     KNTKFVESTPSNIVVDFKEVVGSSFILPKGYAGMKAYMYLRNQKKRLTEAFCISINSD
                     QKLQIDNLAAALFTNIPANEVEGGKIYLVAILTENININENNNSSLKVIRKGLSAGVA
                     DISRIFSHKKGHLVSGQSHRFQIKLFSSFMDGQKQEVKLFAGMNQMMAKSLTLVNNGW
                     GELIDRIISGSSKGVAVNPRAEKLILSIKELKLSDYNKSILSIISGGNGNFNNVAWSG
                     VPSLLYNPLEEEVEKLILKLSKVVNKGMKLQSNNFITVHIRASSPDICFSKGKNEELL
                     SSWKFLSVSPDESVEEMIVVRNLPTTINSGKDYLIFDLFVDGNYVGCSKYLLRSGSEI
                     YDTGITSRTPASVDFNVNNSVIATAEIMLEYVGKTFNQDHVVQSVLNWKSVFGTDLVK
                     NEITFIEALGKLKRLKLSALIRHFSKFCFELLCMYDLASSSNLPDLKKAVFEALIHLL
                     DVSIARNREYVSLFEDMLNEFGSFVPKLGEKLMSSVSKIFSDFKQEWNASGRALCRTS
                     YLILKLASKCIGNHEEYKTQVLLFASSINGFLSSNAEIVLPDQLLILETLELYLDIFG
                     PYFEIRDLIKFVIEWTGANKLKGLGILEDANATALINKKRNREHSFLINKLIFINRLV
                     NTPDYYRGDPKDVELFINSALDMILSIFRDDSIDMECSRLALGIYLSLVNATFGQDKV
                     YLDTSEHLYILLIRLLPFLSESFDKYRKYCSSNGFFKKKRTFTYLFQSSFPFTEHTMD
                     SIVTDVTLVELLVEFEIIVIYTAKVFDYYRDTFYKTDNPNFGIYSDLLCKFGVPDITS
                     FESLNSILRMTERMISSNFYPSSWLSLRSIALQGSYLLIDLVTPFLPTPNGENISLWN
                     LYIRLMLKASTSKPVALEHLEPTARKGCLELTTDLRTKIAPMIGTAWNSLGLPLSEAN
                     KARFRIEVCGGYQGPVLSFNDYELLKRLMLFILQRNSECLSVGIMIYWTIIANELIEK
                     DTLFEFEKHAVISLYGIFENDLTYSPKSLEIENLVTSIQTVTTKMDKEDEDYSEVVRF
                     AKIIARYLASLVQLDQVPNGEEFDDDRAFHRLSISSFLMNVDRPELFQGFICDMYGNY
                     LEKKNYVQAALSLELLANTWEWDVDVYLPECHRPKLPSQTAFKRKVDLFKIIASNFVK
                     GNKLEQAVDIYNEMLEAYTKFNFDLSGLSFCHTELGKLYGQLENVDRLESTFFKISFI
                     GSGFPESIRSKEFIYEGLPYEHITSVHSRLNRLYPGSRIISNEDEANKLLVDIPFGKF
                     LFIKTVSPKKESYNGKLSFMAKQYIDNKNLNTFMNTRRLPGATGIHNLWTEEITYQTY
                     MTFPTLMNRSEIKFTTVVKIPPIKNAIKSLMLKTDELVNLEYLICQNLKDNIKLSSIA
                     SSSMFNSVSRILAGTVDSPVNGGASQFKIFLSKDSKVDIGESEEEYADDCDKLKECYD
                     ELIKAMNRLLKFHGLIIPGSLKLQHDSLVELFSKNFKEEIEELQLDVSSTLDYNELMS
                     SLTSTNIYSKQRNNQSSSAFNSNSNSSFNKFAFMNSSSSIHGSNSRRYSSVPSHHSSH
                     HGSHHSHHGSHHASRHGSVFAIQRTAAHLTGNSRFSARDDESTVSYMDESISRQSQSM
                     NKSSKKNLLNYN"
     gene            <873352..>874128
                     /locus_tag="C5L36_0A03890"
                     /db_xref="GeneID:40381499"
     mRNA            <873352..>874128
                     /locus_tag="C5L36_0A03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463406.1"
                     /db_xref="GeneID:40381499"
     CDS             873352..874128
                     /locus_tag="C5L36_0A03890"
                     /inference="similar to AA sequence:RefSeq:NP_014769.3"
                     /note="PKUD0A03890; similar to Saccharomyces cerevisiae
                     YOR126C (IAH1); ancestral locus Anc_5.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319266.1"
                     /db_xref="GeneID:40381499"
                     /translation="MGYTDHNKFLMFGDSITEYAFNQFPQGCEQPQYALGAALQQAYV
                     RKLQVVQRGFSGYTSRDALPLAKSILKAEHDDVPESQKIKIAYCFFGTNDARLRGTSD
                     CNAESIPLDLFLENMKKTVNEFRTRNIPLIVITPGLHDSKLWDSTHPEDLKTGDYRTN
                     ERNKLYQDKLREAIPEIPMVMLYDVMAEWMRTNSKLGWDDLSELLYDGIHLSGEGYRL
                     LFNELMSTIKNYYPEVHPDNLEFKFPDSKTLTEDTFANIE"
     gene            complement(<874188..>875300)
                     /locus_tag="C5L36_0A03900"
                     /db_xref="GeneID:40381500"
     mRNA            complement(<874188..>875300)
                     /locus_tag="C5L36_0A03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463407.1"
                     /db_xref="GeneID:40381500"
     CDS             complement(874188..875300)
                     /locus_tag="C5L36_0A03900"
                     /inference="similar to AA sequence:RefSeq:NP_013508.3"
                     /note="PKUD0A03900; similar to Saccharomyces cerevisiae
                     YLR404W (FLD1); ancestral locus Anc_4.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319267.1"
                     /db_xref="GeneID:40381500"
                     /translation="MLIAAPLFLFRSWVYTFISVVTALLVLLPSSVIIYLHFQSTLVP
                     QSTPIMKLQFQYIDNSGPFSLYNLSESAISQVKPWEDANKNIFTHIEQVLTIHMKYLK
                     LTNGNEIGGIRLSVLNNSAMPEFKKSTSFDNRKVWPFKSINEKNNELTIFRADRKYKS
                     WNEIIGKSFAKNVPFLSSIDENINKKISGLLDYIMPRWTIQLLVPEGLQYLFSWNNLR
                     DVFTKRDDFKRGEFDFHSSNNINKNKYLQTYDLMETFGEFDNFNIHTFSTGFILFEGQ
                     LKYQDINDTSLLVELDTDDVFVVNAYAKLEYVLKGIRWWVYWWPGMCFLFGVGFIWAV
                     SLSTCLSVSWGGYILWNIFMKMFDSTQKSSSRYIRD"
     gene            complement(<875653..>879078)
                     /locus_tag="C5L36_0A03910"
                     /db_xref="GeneID:40381501"
     mRNA            complement(<875653..>879078)
                     /locus_tag="C5L36_0A03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463408.1"
                     /db_xref="GeneID:40381501"
     CDS             complement(875653..879078)
                     /locus_tag="C5L36_0A03910"
                     /inference="similar to AA sequence:RefSeq:NP_010210.1"
                     /note="PKUD0A03910; similar to Saccharomyces cerevisiae
                     YDL073W; ancestral locus Anc_4.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319268.1"
                     /db_xref="GeneID:40381501"
                     /translation="MLLPNSVSRRAQTPHRSPKQSLTSHSRSSSVKSQSSLSLSAPNA
                     AANSSNTLHSPNTSLHSFFFSKSPSIRKNGNRNSTITNSNNGNNNENINTNSNTNSNT
                     NNINNGGNNIPFQSADLRKDTIKSLDQYLSKFVSIKIPSGASASSSSAATSRANILRL
                     HLLPQLRYPISPFSNLHEFLSTSISDLNPELLLLEAKTLLNWWTELLNIVFLDYQTVS
                     SLDRNCYYESVSRLFSHNIWLLFQINHSYSSQFSDMYDSYKSLLMKTFELAYLKINSK
                     SLSVSMSIFIGKVFAYAFFNLNDISRGLSFLLNTKLVKYKKIFNLFVNHSFTSNPKNE
                     YSIVFNQVLADLKTQFPSHLTHFITSTSHPRDVNYIIESHFINSVPPPRDKINGIRET
                     KGIWVSRWSSYDSISIFCSFFRNYLSYSSVYLRTFPSLIIDELHIYGIPGFMCFMTHI
                     SEIFNHQIRKSIAKNSHTPNKFKNFNLSTPTSATSSTSSTYNDNILIVPKISLESSIE
                     KCFNVFRDTIFNPRNEYEKLLKGGLVKSFENIIKLIVVKTSLLDNVMVDMVMDIFTQF
                     LKHIETPSSFSDSNNAENFSYLDWTFWLDVLVRLVDSDNLSCQVKALSTLYQIWDLIP
                     SHVFTSANGRWILSPSEPIKLNLIYYLVSDHHWFSFFGHYMPLVRNIYNKLLIWKILG
                     LSSIENIVLVHENFKRQDFKDESKIKVLILSKLMSTYYTTENVIFKPTDPILNKKFQI
                     VKHEGNDDRNRDKKSRLYPFEVLDDSAYINNRSKSKISKSKSEASITSKSKFSSSSLG
                     KDKLSKKKWMGNLFKKTSSASSNSYKDDNSSGGLSKFLGLSNRTERKEVSNSNNIASN
                     SSMSSVSSSFSSLELNSVDANSTLEVNDQSHSIDYSKPPEWTNNTDIANELWEFKLLR
                     NDSKIKSYLSKLNQINDKDAILKYSRDNDEILIINEEPRLPRVKITKKNDYLIKHDME
                     SVESLIDDEIGDDDIIDLQGGFDDFEGLGSFDLNNNKHDPFSTGTIIYHDGINDSIKN
                     VIKNTPASQMYLANGILEYNEEVKRFETFMQEKCNNILSVVQADFENSTTNDSWDHES
                     NTALSKSSSSLLEIKLETNFGGNYRITNSDYENLKKQIPSIVPELGTDKVNAF"
     gene            <879836..>881692
                     /locus_tag="C5L36_0A03920"
                     /db_xref="GeneID:40381502"
     mRNA            <879836..>881692
                     /locus_tag="C5L36_0A03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463409.1"
                     /db_xref="GeneID:40381502"
     CDS             879836..881692
                     /locus_tag="C5L36_0A03920"
                     /inference="similar to AA sequence:RefSeq:NP_013507.1"
                     /note="PKUD0A03920; similar to Saccharomyces cerevisiae
                     YLR403W (SFP1); ancestral locus Anc_4.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319269.1"
                     /db_xref="GeneID:40381502"
                     /translation="MDTQLGNHPSAMAVHHQQHTQNSSEPINISFSRNNSIYHNNPKL
                     RRESIAQSQGIGGVSWGSVGIGSWLKDEVFMLQHQHQYQNPNLNLNQSQTQNQSQTQT
                     QNHNYQQHQNQHLAHNNSSNNLININSAAPHSSNHQFRHGSINLYNGNFNNSNAMDLR
                     NDSIMMVSDSIPNSSYLADLEANYCKDYSCCGQLLPTLHDLLKHYEEMHIGNDFSSNN
                     FQQDGNFQSNDLNNGLQPQLNLNTGTNGNLPHHSNALSNDSNSRVRNNNSIGAVSTNE
                     VFLNNHLNTKQNFNNNNKKFNMSSKPDKISSFNLNLTYDHHGDNLQSNDLHKTLSNFE
                     FDNGINANNGKHDEMNFDFPNNSANNIFQNDSLVKDLENQAKMFHQQVQQQQQQQQRL
                     QQLHTHQQRHNQQQQSNNNQFNDNSTTGGGNHNSIPINNTNSHLLNDLINNGNGGSVI
                     SSPSLKNHDSLNIDLDHDTQFQMDVDDDISMSIDSNTPGIHQSINANINSTSNTVNSN
                     SHHDVCIADPARRLYAIEQREERPFQCPVIGCDKTYKNQNGLKYHRLHGHQNQKLREN
                     PDGTFSVINPDSNSPYPHGMAFEKDKPYRCEVCGKRYKNLNGLKYHRAHTTH"
     gene            <882216..>882746
                     /locus_tag="C5L36_0A03930"
                     /db_xref="GeneID:40381503"
     mRNA            <882216..>882746
                     /locus_tag="C5L36_0A03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463410.1"
                     /db_xref="GeneID:40381503"
     CDS             882216..882746
                     /locus_tag="C5L36_0A03930"
                     /inference="similar to AA sequence:RefSeq:NP_010211.1"
                     /note="PKUD0A03930; similar to Saccharomyces cerevisiae
                     YDL072C (YET3); ancestral locus Anc_4.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319270.1"
                     /db_xref="GeneID:40381503"
                     /translation="MAFQYVLTFTLLVVEMALFALISFPLPSKFRRPLLQTLSTPFNS
                     PQVQMVLRCVFVFIGIMFADSVNRTMKVGNELAGDLVTGGVTRAEIQSRKFYSQRNMY
                     LCGFTLFLSLILNRTYKMVFALLAMKEKESKLMNESKVDEKLHEENEKLRLKIKELEK
                     EKENLLKKSKALSDEY"
     gene            complement(<882803..>884659)
                     /locus_tag="C5L36_0A03940"
                     /db_xref="GeneID:40381504"
     mRNA            complement(<882803..>884659)
                     /locus_tag="C5L36_0A03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463411.1"
                     /db_xref="GeneID:40381504"
     CDS             complement(882803..884659)
                     /locus_tag="C5L36_0A03940"
                     /inference="similar to AA sequence:RefSeq:NP_013505.4"
                     /note="PKUD0A03940; similar to Saccharomyces cerevisiae
                     YLR401C (DUS3); ancestral locus Anc_4.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319271.1"
                     /db_xref="GeneID:40381504"
                     /translation="MSELESGKRPIEESVESEPKKSKVDHFANGVAPIKTEFIISYTN
                     DNAIDDDAAEAAPTSEQLGDSRDQKGQGKGKGKNKNRGQNKARKLVQTKEDLKVCPSI
                     IDPEAGKPCLKGSECNWCHDVDAYLAQKEECFEGPCPVKEELGYCPQGIRCRWLYSHF
                     DKDTKKLTYEEGYVRDENKGEVNFISLDDKRMLYKKKFDFPVSEVALEMYDKERLERF
                     DVEKRKELEAAYNEAKIKAGEKKKLDYKNKKVVSPLTTVGNLPYRRLMKTLGADITFS
                     EMALANSLITGQNSEWALLKAHKSEYPGFGAQIAASKPWQAAKSAEVIYRFASNVSEI
                     NLNCGCPIDLLFKKGEGSALMLSSNRMKNLLKVMNDSSGDIPITVKMRMGVKDNKPVA
                     TEIVSKLLDAGDIGAITVHGRSRQQRYTKEANWDYIEQVGKIVKAYNEQYEEKKDVSD
                     RPNPVYLIGNGDCYTYEDYYEHVGREGIDTVMVARGALIKPWIFEEIEARQYLDKSAS
                     ERLRIIENYSRFALQHWGSDDFGVNTARRYLCEFLSFTYRYIPVGILEKLPPKLNQRP
                     PKWRGRNELETLLGSSDYKDWIKISEMFLGKANENFTFIPKHKSNAYETPRN"
     gene            <885148..>886272
                     /locus_tag="C5L36_0A03950"
                     /db_xref="GeneID:40381505"
     mRNA            <885148..>886272
                     /locus_tag="C5L36_0A03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463412.1"
                     /db_xref="GeneID:40381505"
     CDS             885148..886272
                     /locus_tag="C5L36_0A03950"
                     /inference="similar to AA sequence:RefSeq:NP_013509.1"
                     /note="PKUD0A03950; similar to Saccharomyces cerevisiae
                     YLR405W (DUS4); ancestral locus Anc_4.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319272.1"
                     /db_xref="GeneID:40381505"
                     /translation="MSGATYKEIDHAINAKQVNATDKGLDKRTTPYMGYIAARNPDDK
                     PINIIKRCQKEGRPVFIAGPMVRYSKLPFRQLVRDYQCDIVYSPMILAREFVRNENAR
                     LSDFSTNDSDRPLIVQLGVNNITDLIRCVEMIHPYVDGIGINCGCPIKEQVREGIGAA
                     LMSNKDLVSEMVYEVKKRWGDEICIETKIRVHDDINETIDFVKEVEKAGVDFITVHGR
                     TKNTRSSQPANFEKIRIIKESVGVPVIANGDCFSLKDAYSIIETTRCDGVMAVRGILN
                     NPGLFAGHAKCPWGAIEKFWHYSTSYGLPYKLIQHHLSCMMEGLITRKQLIGLNECEN
                     LIELIEWFDERYQLKRPQDPGFGEGVHIPVRLDRSDMPNL"
     gene            complement(<887320..>887664)
                     /locus_tag="C5L36_0A03960"
                     /db_xref="GeneID:40381506"
     mRNA            complement(<887320..>887664)
                     /locus_tag="C5L36_0A03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463413.1"
                     /db_xref="GeneID:40381506"
     CDS             complement(887320..887664)
                     /locus_tag="C5L36_0A03960"
                     /inference="similar to AA sequence:RefSeq:NP_010208.1"
                     /note="PKUD0A03960; similar to Saccharomyces cerevisiae
                     YDL075W (RPL31A) and YLR406C (RPL31B); ancestral locus
                     Anc_4.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319273.1"
                     /db_xref="GeneID:40381506"
                     /translation="MAKELKDAVTREYTINLHKRLHGVTFKKRAPKAVKEIKKFAKLH
                     MGTDDVRLDPKLNVELWKKGIQGVPFRLRLRISRKRNEDENAKSTMFSFVEAVNVASA
                     KGLQTVVVEDEE"
     gene            complement(<888185..>889069)
                     /locus_tag="C5L36_0A03970"
                     /db_xref="GeneID:40381507"
     mRNA            complement(<888185..>889069)
                     /locus_tag="C5L36_0A03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463414.1"
                     /db_xref="GeneID:40381507"
     CDS             complement(888185..889069)
                     /locus_tag="C5L36_0A03970"
                     /note="PKUD0A03970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319274.1"
                     /db_xref="GeneID:40381507"
                     /translation="MLQAAHTDLLNKSNFVVIGSEEGIYRANPQGLEEWIKRCNWEGE
                     KNTMKEINFIGMANYCKSLLLSTSFQGFDLQLQDVIDIWEMRLISMYIAFLLGETRLS
                     IGRGGGIPREMIVTESMIKFEASTMLSQMYKLERHVNRGSNQSGSNDVHDSDDGNDCN
                     DRHRTKILLTWLKFGGKDFPLVEFYYKEVFKARATRNVSYLKSLKFALIAVLTKRNEL
                     VNVYTLIRDDELMNKLQDTIESDEQPLERLSRLHLRMCLSFLTPSEPLNIKTVNLFVK
                     MGKNRLYNVLAAALAART"
     gene            <889709..>890320
                     /locus_tag="C5L36_0A03980"
                     /db_xref="GeneID:40381508"
     mRNA            <889709..>890320
                     /locus_tag="C5L36_0A03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463415.1"
                     /db_xref="GeneID:40381508"
     CDS             889709..890320
                     /locus_tag="C5L36_0A03980"
                     /inference="similar to AA sequence:RefSeq:NP_013511.4"
                     /note="PKUD0A03980; similar to Saccharomyces cerevisiae
                     YLR407W; ancestral locus Anc_4.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319275.1"
                     /db_xref="GeneID:40381508"
                     /translation="MTRKLKHSRSIGEKLRDKCSSAMHSLKVISNAVLQHNDDLEEVE
                     QLFDNDTEEEHLRGDYVSVLKSENKKISQGGDIPTQQRLSKDKVSTSSDATNTSPTPI
                     PTVTGASETVSNGAELWEKQREEWLTPTYSIAEIEERKRLHSLAYLTSNPDENIYQNI
                     YRNLVIHGKPLKCGLNMADGFKVIHQGWENTNMFERVARGGVP"
     gene            complement(<890581..>890937)
                     /locus_tag="C5L36_0A03985"
                     /db_xref="GeneID:40381509"
     mRNA            complement(<890581..>890937)
                     /locus_tag="C5L36_0A03985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463416.1"
                     /db_xref="GeneID:40381509"
     CDS             complement(890581..890937)
                     /locus_tag="C5L36_0A03985"
                     /note="PKUD0A03985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319276.1"
                     /db_xref="GeneID:40381509"
                     /translation="MDDRVKRVIEREEAKKIANIELREKYRRVLRQTLMEFDVPGQQH
                     IVYENEKMLDKAEEELEGHVKRMERLGGELEERVEHVEKKLEKCNSELIQRRVELLNQ
                     QIRILESAVKYIQDNK"
     gene            <891246..>893942
                     /locus_tag="C5L36_0A03990"
                     /db_xref="GeneID:40381510"
     mRNA            <891246..>893942
                     /locus_tag="C5L36_0A03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463417.1"
                     /db_xref="GeneID:40381510"
     CDS             891246..893942
                     /locus_tag="C5L36_0A03990"
                     /inference="similar to AA sequence:RefSeq:NP_010206.1"
                     /note="PKUD0A03990; similar to Saccharomyces cerevisiae
                     YDL077C (VAM6); ancestral locus Anc_4.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319277.1"
                     /db_xref="GeneID:40381510"
                     /translation="MPNVFNPVQEICPLQGNPISITNSDEITYVATPNVIFSTEPTEC
                     TKLRRLLTSSVRIKKLQALPDIGILTIVFDDHVELRNISNLSNLNDRCFQSLNLRVED
                     IVTYSSSNASQAPSRSSSSDILSLATVVIDKPITSDRDNPANPDAFITLLALLSKNQI
                     TILKWNNREYVDRYNLYVSNIKFLKFTSTEDLICMSSTKPNILIHINLQTSKISHHDL
                     TRFLHLRSSMLSFTNSHHLASLGYYDNRILFLKFDEFLNVDYTNFDSYNATKISNGHF
                     KKSQICFPFIFLIYDNSLEVRSVKDFKLFQAIRANRIIDVGYHDMRLSILSKNDIRTI
                     TAFPYNRILEGLYSEKDYDNAILLIENLDIHYFLSTDDESKRENVNLNQFKFIKLRKF
                     NLLKAVDLMNDGSENDFALSIDLFSEFLAPPKLVVENIPKPIKLILNNERSNSNNEAK
                     DLSASDRFCINQLIKYLTDSKRKLLRFKDSKDTVFQFGNMEISLSIYQDNDPGFSVDE
                     NLILIDDYLFKCYLLVNVKMIGPFLRLNNYCDFDMVEEKCKALCLSEQLVAFYSSRND
                     YTKAIRLLNEQEKYDDLLAFLQRMVQNDDPPIDLIFENLKTLISALKNNDDTDPFYLV
                     FLNESFDYSNVHYDDIIRHLQQEKWKQYLLDYLEFIFTHENKTNLQVTTQLLNIYFED
                     IDGNSAKIQKLFEKGHYNANQALARLKTHSKSEHAKRLMVSPLQKLGRYDDILSIYVH
                     ELKDTKEAVNFALNMRDIKNDSLSRGLIFKIIDMCLLEKDHSSIVQFVLNNANLDFIN
                     FEEILIKLPNDMSMNLMSSLLLMNLKNMNTINHRLVVKNELLRANLTHLKLDKMNLER
                     KMVRLTSSSVCSKCGRYFNKSEILCFHPNGNILHYKCSKVTY"
     gene            complement(<894013..>896847)
                     /locus_tag="C5L36_0A04000"
                     /db_xref="GeneID:40381511"
     mRNA            complement(<894013..>896847)
                     /locus_tag="C5L36_0A04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463418.1"
                     /db_xref="GeneID:40381511"
     CDS             complement(894013..896847)
                     /locus_tag="C5L36_0A04000"
                     /inference="similar to AA sequence:RefSeq:NP_013513.3"
                     /note="PKUD0A04000; similar to Saccharomyces cerevisiae
                     YLR409C (UTP21); ancestral locus Anc_4.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319278.1"
                     /db_xref="GeneID:40381511"
                     /translation="MSTAVVKRQKNETIPIKSLVKKSKIFSPFRTIGHVSDGSPFAIG
                     TLGATFYIVTIVGKSFQIYDASTLHLLFVSSRQTPDSISCVTARSHFVYCAYGNKVGI
                     FRRGRLEHEIEIPNSSDDPNFKINKLLVFNAYLVAITDNRVYVYENKAPTDKYPTEFY
                     TSFQVNSIYGSIVDLIHMPTHMNKIVIATSKHLLVYNVKTGKNVYTSKEFAETITTIT
                     PAPVIDFLAIGTTEGVCKIYNIKKAKTMKTINTGSKSLVTSVSFRTDGNPHVVLSLRN
                     GDLFFYDLNKNARIHLLSNVHKEEYGGVSKVQFLNGNPIIVSTGGDNSLKEFVFDPAL
                     SETNSSIASPPRHLRSRGGHSAPPNSILFSDENAHFIASGSLDRTFWLFSLRKDAQSQ
                     EMSQKENKVKNGQMQAGASGKYKMKFPPIVSMVQENAREGDWDNILTAHQDETFARTW
                     NSKNKKVGKWKLDTIDEGIVKSIAISQCGNFGFVGSSNGGIGVYNLQSGLLRKKYKLH
                     KKTVTGIALDGMNRKMVSCGLDGIVGFYDFSQSRYLGKLEFDSPITQLCYHRSSDLFA
                     IALDDLSIVVIDAISQKIVRQLFGHTNRITAIDFSNDGRWLISSSLDSTIRTWDLPTG
                     SCIDGIKLPKVATSLKMSPNGEYLATAHVNDVGISLWTNKSQFKKITTKHIESEDDFA
                     NMLLPNVSGEGGSIMLEGAFEDDEVDFNEGIYISPPVLDEKLITFSNNPRNKFNAVIY
                     LENIKQRNKTKEAPKKQENLPFFLELTGLKAGNSAIENELGKNVVDEMNQRAVQGEST
                     SKLLDLDASKEYKFETDFTKLLRLAKYDEFIKLVVDMTPSQIDFEIKSLSVSSPFSEI
                     VSFLDAMKFGIKSNRNIEMIVAILFVFLQSHSDAIFGIKKLATEEDNEDAKKVVAALR
                     AFEFVNNKAMDRLDELTKYCSSVTNFISTT"
     gene            <897124..>900741
                     /locus_tag="C5L36_0A04010"
                     /db_xref="GeneID:40381512"
     mRNA            <897124..>900741
                     /locus_tag="C5L36_0A04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463419.1"
                     /db_xref="GeneID:40381512"
     CDS             897124..900741
                     /locus_tag="C5L36_0A04010"
                     /inference="similar to AA sequence:RefSeq:NP_013514.1"
                     /note="PKUD0A04010; similar to Saccharomyces cerevisiae
                     YLR410W (VIP1); ancestral locus Anc_4.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319279.1"
                     /db_xref="GeneID:40381512"
                     /translation="MEEESIPIPISSNSNLSEMPVPPSISRAVSSASNLSIDSSVFPD
                     QDELHSEHDEKHDEDPIPLTQESLDQHKRAIASIAPILEDFVPVLSKSEIVSPSQDAL
                     SRTVSNVSALSISHSHPSQHVASTSGDGIEVEKRKSIEHKEPINTSVSHTSATSKEPI
                     PEEEIKESKEKAFKRSSTSSNLSKSRSGSMSKNIPESSPHTVSSSDSFNSILKTRSFS
                     SSSMNDIPSGPKLPRIGTIGVCAMDNKVLSKPCRQILQRLIAHDEFDTVIFGDKVILD
                     EAVENWPTCDFLISFFSTGFPLEKAIAYERLRKPYCLNDLVMQKALWDRRLCLEILKA
                     AGVPTPYRLVISRDGGPQVDEELRRKLEAIGIDCSEVDEPDWRMVDDDTLMVDGKTIK
                     KPFVEKPVDGEDHNVNIYYSKKNGGGGRRLFRKIGNKSSEFDPDLNDIRTNGSFIYEE
                     FIDTDNFEDVKAYTVGTEYCHAETRKSPVVDGIVRRNTQGKEVRYPTELSDVEVEMAA
                     KVSRYFQQTICGFDLLRTNGRSYVIDVNGFSFVKDNKDYYDTCAKILRAKFLEAKMLR
                     DESMVPKPIHEKKQKWIFKGFVSVIRHADRTPKQKFKYSFRSPIFISLMKGYKEEIII
                     REVRDLNVVLQTIKVALERNLEDPRKLRQLEGALEKKMTFPGTKIQLKPALNKETEEI
                     EKVQLILKWGGEPTHSARYQATDVGEQFRQDIQLLNKAALDDVRVYTSSERRVVASAQ
                     LFSKSFLSEDELPEDFLKVRKDLLDDSNAAKDLMDKVKKKLKPLLRQGEEAPPQFAWP
                     PKMPEPFIVIKRVVELMNYHHKIMDENFKTQDVERFQTEWCCGEDPFLFKERWDKLFQ
                     EFVSVEKVHPSKISELYDTMKYDALHNRDFLQNIFIRKTKEDEQEKETTKELLGSLVK
                     QYPINVLVMNDFKVNDSSLDATSSLPLDGSASNPAGSIGWVLSSSYKPKVNSKNSNRK
                     DSPFDDPKFNLLRELYRLAKVLFDFICPQEYGIEDNEKLDIGLLTSLPLAKQILSDIT
                     EIKETNKAGTRVYFTKESHIYTLLNILYESNVPMKIARNALPELDYLSQIVFELYESE
                     GLDGHKKHSIRLSVSPGCHTQDPLDVELDEKHYISCIRRINLTRHLDMDLVQQKLKSR
                     FTRVSLPKKFTPVNISSPLTSDVKVEKDKDKLKEEGKDKLKGESKDQHNGKNKDKDIN
                     N"
     gene            complement(<901285..>902493)
                     /locus_tag="C5L36_0A04020"
                     /db_xref="GeneID:40381513"
     mRNA            complement(<901285..>902493)
                     /locus_tag="C5L36_0A04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463420.1"
                     /db_xref="GeneID:40381513"
     CDS             complement(901285..902493)
                     /locus_tag="C5L36_0A04020"
                     /inference="similar to AA sequence:RefSeq:NP_012740.1"
                     /note="PKUD0A04020; similar to Saccharomyces cerevisiae
                     YKL181W (PRS1); ancestral locus Anc_4.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319280.1"
                     /db_xref="GeneID:40381513"
                     /translation="MRKCKVFVGNSHPQLGKLVCENLGIEPAPATAKKFANGETSVQI
                     GVSVRDEDVYIIQSGSPDVNDHIMELLILISACKGGSAAKITAVIPQFPYSKQSKMKK
                     HRGAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYAGPTLAKWIKENIA
                     NYGDAVVVSKNPGGTKRVTALADQLKINFAMIHTDRRRSVDDYNGLMKHKNASTVSTL
                     ANDNINADIQTARIVKGHVIEDDESATPTSIPLKPHLLHKESELNFENNNSDDEDEPE
                     FNAEEKLITLVGNVQNRPAIIVDDMIDKHTSFIAAAEHLRMNCGANSCYIVATHGIFN
                     NDCLERLDDCPYIDGVIVTNTYPIPEDQMKKCKKLTVIDVSPIFAECIRRDHFGESIS
                     VLFDSLASIV"
     gene            <903242..>905227
                     /locus_tag="C5L36_0A04030"
                     /db_xref="GeneID:40381514"
     mRNA            <903242..>905227
                     /locus_tag="C5L36_0A04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463421.1"
                     /db_xref="GeneID:40381514"
     CDS             903242..905227
                     /locus_tag="C5L36_0A04030"
                     /inference="similar to AA sequence:RefSeq:NP_011897.1"
                     /note="PKUD0A04030; similar to Saccharomyces cerevisiae
                     YHR032W (ERC1); ancestral locus Anc_5.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319281.1"
                     /db_xref="GeneID:40381514"
                     /translation="MTHQFTHTTSERRASTAIVGSVGRPGLFVPQDFIKYNKDQIGSA
                     LTSLEDGLDPDELEQDELEGGYPLYADEGNDSTNDNGNDNGNGNDDDPSMSSRLLTPH
                     RPCHSNSFSNANSRRQSFLLSEEAALLKANRIPIRRLSTGLENTTSLYSSTNNSTGVA
                     ERSNAAEYNYISPNNICTDRVCDVENDEAIVESWDAAVKMGKLKTTVAIELKSISRSS
                     IPLVITFLLQNSLSVCSILAVGHISSEALAGITLGSMTCNITAIATIAGLASSLDTFL
                     PQAYGAKKYHLVGIIFQRCVVLIFTIMSLVCLSWWFFAERILINFLPDPKSANYATQY
                     LKVNSFGIPGYILFETGKRFLQCQGIFDASTYVLFVCAPLNALMNYTLVWVMGLGFIG
                     APIAVSITYTLMAVGLYLYTTRTRNQINPMKCWTKFEISRVCRNWGELVKLSIPNLIM
                     IVSEFLSFELMTLLSSYLGTKPLAAQSILATMASLTYQIPYGVSIGAGTRIANFLGAQ
                     LPESAFIACKSSFIFTLVIATLNCSIFLFGKGFIASIFTNDEEVIELSSRVFPWLAFM
                     QIFDALNSTSAGCLRGQGLQRIGGYVNLFSYYIVGLPLAAFFAFSWPAAHPMGLSGLW
                     AGSTVALIIIGCVQSYCVLNANFDQLVDDAIRRSNSY"
     gene            complement(<905982..>907337)
                     /locus_tag="C5L36_0A04040"
                     /db_xref="GeneID:40381515"
     mRNA            complement(<905982..>907337)
                     /locus_tag="C5L36_0A04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463422.1"
                     /db_xref="GeneID:40381515"
     CDS             complement(905982..907337)
                     /locus_tag="C5L36_0A04040"
                     /note="PKUD0A04040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319282.1"
                     /db_xref="GeneID:40381515"
                     /translation="MNSGESLWLENNNRMASGRLAKRQESKLSRFIRQFDSSNISPSH
                     GGITTKTISAPIAFNHVAHIDATNYNHNRIDDMSLSNDVGQIQHTQLQDTGTGAEKPN
                     VSHTPLVSHGQQGDLPLIRATSFGRTNPAPPPTRSVSRHMPTIPPSRSDHSINTMLQN
                     HSRHNSVSTLPTTSIYTSTSSTSFRMSLASESSASIPPSPAIEDTKSRPLLLLNKSTD
                     TFSPDEHTPTAVLFTSPPIYEEAESPPAPARRAPLPPISIDPIERFKSLVRKHNCVDK
                     FSKSPSNANSNSNLALDLDLDLDIYQDSDTEGDEDTVKLEKLELSSPVEAVVAEFTFR
                     KQLKEFTRTKNCRNSIMMMMKVEQDPSEREYLAKLLDKTQFEIRKFIETLNTRNSLAV
                     SNMLEEDPKAFLDSVSFGDTDSIIDTDFQFNETESDFFKDLQIGCSCNTSLDSLRQLD
                     L"
     gene            complement(<908132..>909241)
                     /locus_tag="C5L36_0A04050"
                     /db_xref="GeneID:40381516"
     mRNA            complement(<908132..>909241)
                     /locus_tag="C5L36_0A04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463423.1"
                     /db_xref="GeneID:40381516"
     CDS             complement(908132..909241)
                     /locus_tag="C5L36_0A04050"
                     /inference="similar to AA sequence:RefSeq:NP_010599.1"
                     /note="PKUD0A04050; similar to Saccharomyces cerevisiae
                     YDR313C (PIB1); ancestral locus Anc_5.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319283.1"
                     /db_xref="GeneID:40381516"
                     /translation="MSNAVATESTPYVGNHGDPPRSESSMNGLVSGAVSEPGYQNLDD
                     AITGASHWSSPVDEAGDVVTAIWEDDSQVTQCPTCKLKFNFFNRKHHCRKCGRIYCSA
                     CCGNYCTYIPGSTVVEPEEDGGNQRVTWALRHVEFRTCNVCFKEIKMLKEALGLTEAG
                     NDSINENYNDNYNDGDGDGDGDSDGDGRGVSIIRNDGSYMRTEGNTNRELSPPERVSY
                     DDTQTQECSSIVKTVIPCEDTIERSDSVEDINDRDRCPICGECLKDQEEAQREEHVRL
                     CIQEQEFGSPQHHEGALKRHVNRMLISYIPKDADFAMVSVNEDNECVICLDEFHPGDK
                     VARLECLCCFHYDCITDWTRKKGYCECPIHSLTVE"
     gene            complement(<909708..>911237)
                     /locus_tag="C5L36_0A04060"
                     /db_xref="GeneID:40381517"
     mRNA            complement(<909708..>911237)
                     /locus_tag="C5L36_0A04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463424.1"
                     /db_xref="GeneID:40381517"
     CDS             complement(909708..911237)
                     /locus_tag="C5L36_0A04060"
                     /inference="similar to AA sequence:RefSeq:NP_010229.1"
                     /note="PKUD0A04060; similar to Saccharomyces cerevisiae
                     YDL054C (MCH1); ancestral locus Anc_4.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319284.1"
                     /db_xref="GeneID:40381517"
                     /translation="MSFLEKKIRGIYDRHGEFRVYLIAFVLSILGCLSLGILTLFSIF
                     ADPLQKLLDYPQSTINKIIVIHVLGLNISTPLSGFIADAKGIWILPLFSFSGYTFSFT
                     LLKYIIKHNLHEYYTYLCFFILGCSHVSFLFSCLLNSARSLGRYYRTLAISTPNLMIS
                     ISSYIQIQIITIFYSPNYTSLQEYETNFMNLLNFFMILLTSSTILSLVGSLLTDLANK
                     YQTVTEESPEADIDDFESFNTSPLLTGAATVLHSPGPSIIGSPMPWYVDEEGIANLDT
                     GMSMISSGYLSLAENDTPYQVKVNKFAKDFMMYPLLLCCLVAIGSTEFFIANLNAILN
                     NLDAPGKLDSSLETMSIASTLTRFIIMLSTDYVCSRFKISRLTIFTLCVMSCGASHIY
                     LSSSPIASLNFPLVVVSNSILNSTVFTLFPAILASIYGIEILGTTWGVCSGSSFFGNM
                     ILNFLYSFDFQENCVRGLQEKMMICSTMTFFSSGLALLTFGGIVFSVRNRYIARASAF
                     F"
     gene            <911745..>913448
                     /locus_tag="C5L36_0A04070"
                     /db_xref="GeneID:40381518"
     mRNA            <911745..>913448
                     /locus_tag="C5L36_0A04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463425.1"
                     /db_xref="GeneID:40381518"
     CDS             911745..913448
                     /locus_tag="C5L36_0A04070"
                     /inference="similar to AA sequence:RefSeq:NP_012586.1"
                     /note="PKUD0A04070; similar to Saccharomyces cerevisiae
                     YJR052W (RAD7); ancestral locus Anc_1.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319285.1"
                     /db_xref="GeneID:40381518"
                     /translation="MPYGRRRNNTNTDEGGVKGPSSALTSFLREQGISAEQIRLRYEQ
                     SKRQKEPGGTTEVESGVEIPVEEVTNRDLEIKINTGLDSDEEEVDYEKPLSKRQRLEQ
                     TVNVSSGTDLYCMECDQDFTISVYSKKMERDGKIGYLCPSCSKIQIRRERLAKRHEIE
                     ARRRRKKIAAALLDKKQFKLPSLQDFCINVITENINSVEALGEIGTHNKMKICRILAK
                     NRSLNNKTITLFLDGNTKKLEFWDCSKIDKNSLDKIAVYCPNLESLTLNMCGQLHNDN
                     LQYFGSKLNNLKSFHLNGPFLINDNAWQSFFESKVGKNLKQFTLINTHRFSNDSLVCL
                     LENCGNNLESLTLSRLDSLDSKPVFDLLPHFLSSLKHLEISYPHSKNLIDDDLIINLL
                     AVNCDSLESLNLDRCSDLTDRFLTEGLKPFGSHIRKLSLTDLDQIDDAGVGVLFDDWK
                     INGGLTDINLERCTLLTDDSIYKMLSHSSETLVRLKLNSVKLISKSLFSKLSRNTTFP
                     LLTFLDLGFVRSVDDSVLAILSRICPKLEILEVYGNNRCTERALIRENLTVIGRQTDS
                     I"
     gene            complement(<913519..>915492)
                     /locus_tag="C5L36_0A04080"
                     /db_xref="GeneID:40381519"
     mRNA            complement(<913519..>915492)
                     /locus_tag="C5L36_0A04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463426.1"
                     /db_xref="GeneID:40381519"
     CDS             complement(913519..915492)
                     /locus_tag="C5L36_0A04080"
                     /inference="similar to AA sequence:RefSeq:NP_013667.1"
                     /note="PKUD0A04080; similar to Saccharomyces cerevisiae
                     YML046W (PRP39); ancestral locus Anc_1.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319286.1"
                     /db_xref="GeneID:40381519"
                     /translation="MSDNSLLHNFPQWEKLLGKLEDDPFSDIFWNELIMHHEKLANEH
                     ADLLRSRKELRLLMYSDFDRLLTKYPYYAKYWTRYTKIVKLLEGVLPSIEILKRATVV
                     FPHSLELWVDYLVNLLTNRVKSDDEIQKLLEHAEDKVGFHFLAHDFWDIYLKWAKSRF
                     GQNSIEYVKVLTKVIKIPLHQYAKYNEEFQKLSQYFAVLDLVSKEELILYIEGKKTKD
                     VISNYDDYIEMNSQDLVKDYFGDLLKEVQIRSQEKWKFESIVRTSFTLSMVTNEELVN
                     WNKYLDYEEAYHSKMPNSNEKELISLYERALIPTCLTSDIWIRYNRYLIQNNGQRNHI
                     IANFNKACDHFVPLDSKDIRYMYIRYMELKEKNIESCKSIYVSTIEKLPNDSELIDHY
                     LEFLINHESKENQRTLIDDLIKCAHLFNKEYGSDNHLDKKRKPTHNSAKNNLEINSPE
                     IRHLKGLINFWTAGQLIVNACKYMWFVDKDIRRTRDTFMSFLNTEAVKSSKPYWFMAF
                     KFELSQRNKKNLTHIIQQVRSYSTLSISAINLLLTEYTAFMLKNLSASELKQFDRDLY
                     KNIIETDFQSSTHMKTYLKTRLAGGSDSEIIDKRLLRENGHPAATSEGRPQIINSILL
                     TEVTKSENDPYPLPRFRNVEKAGLNVKHIHESL"
     gene            <915767..>916843
                     /locus_tag="C5L36_0A04090"
                     /db_xref="GeneID:40381520"
     mRNA            <915767..>916843
                     /locus_tag="C5L36_0A04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463427.1"
                     /db_xref="GeneID:40381520"
     CDS             915767..916843
                     /locus_tag="C5L36_0A04090"
                     /inference="similar to AA sequence:RefSeq:NP_010877.3"
                     /note="PKUD0A04090; similar to Saccharomyces cerevisiae
                     YEL037C (RAD23); ancestral locus Anc_1.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319287.1"
                     /db_xref="GeneID:40381520"
                     /translation="MQIILKDFKKEKIPVEIEASDSVLSGKEKLASIKNCDVDQIKFV
                     YSGKILQNDKTFESFKVKEGDQIIFMISKAKKVDQPATTTSETAAPTTSNENTPAVDS
                     AASTPTPANPSAEEVSEFTASTFAQGSVRETAVQNIMAMGFERPQVERALRAAFNNPD
                     RAVEYLLSGIPLPAEPEESSAPAAGPVNSPTSETTAATESTATQNPGENLFEQAAAAN
                     AGGEEEASGDMMSQVREILQTQPEMAEVVLQQLAASNPQLAEFIQSNPEAFLRYITEG
                     DQTALATALGVPSEYIDAEQGGLEGEGEGGEGYQIQITQEESEAIDRLCELGFDKNLV
                     IQVYFACDKNEEMAANLLFTDHAD"
     gene            complement(<917005..>917772)
                     /locus_tag="C5L36_0A04100"
                     /db_xref="GeneID:40381521"
     mRNA            complement(<917005..>917772)
                     /locus_tag="C5L36_0A04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463428.1"
                     /db_xref="GeneID:40381521"
     CDS             complement(917005..917772)
                     /locus_tag="C5L36_0A04100"
                     /inference="similar to AA sequence:RefSeq:NP_010876.2"
                     /note="PKUD0A04100; similar to Saccharomyces cerevisiae
                     YEL038W (UTR4); ancestral locus Anc_1.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319288.1"
                     /db_xref="GeneID:40381521"
                     /translation="MEQTTRYRNVILDIEGTLCPISFVKDELFPYFLKELPSVLDQYK
                     FPLDPTKKSNDVIERILTQFPSETYQRKESLLRYINDLVDKDIKDSTLKQLQGFIWEN
                     GYTTGSIMAPLFEDAVEAMKLWSGLCDGLYIYSSGSVKAQKLLFGNVKTVHSNGSVEW
                     SDMNNLITDYFDTVNIGNKTDVKSYEKILEKIGVDVNDTEGKKLCLFLSDNPLEVRAA
                     LSAGLTSFIIEKPGNYPLSSDDRDICPVITNFQALFG"
     gene            <917961..>919313
                     /locus_tag="C5L36_0A04110"
                     /db_xref="GeneID:40381522"
     mRNA            <917961..>919313
                     /locus_tag="C5L36_0A04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463429.1"
                     /db_xref="GeneID:40381522"
     CDS             917961..919313
                     /locus_tag="C5L36_0A04110"
                     /note="PKUD0A04110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319289.1"
                     /db_xref="GeneID:40381522"
                     /translation="MNEVEGIPPSELKIKSGLEPPDIKIQSEPSAIIYEDLIPENLEK
                     HPTSDCNRCKKKFAQLGPKPFKMCEHCRIAQRQRTKRWQKKTKEKEGVCKRCGTELPM
                     DNPNNYVLCGNCRKISNKNKSERYLKGKCIHCGNPNMGDSGYKVCQTCREKDRIRRLN
                     LSNEGLCNRCSKELPKDESTHRVCLKCRIKKRMNSGHAHYNPKSIRSTDSNKLPSQLT
                     TQGDTTLYTEIGDLYTAKCDSDARNNQTAGKRQFDADQLSSKRQKMEPTHPLGTSSQM
                     KEQTKSCEVDISVYEKELTEKLLSETFMQQDHSELNQQLKQLTRYTSHSQQDNGTLAE
                     DDSKFDDQSVLVDLNGLGDLDIDYHMDVSDTIGGHHNTNDCNVNADHDEEEDNDDNGD
                     EEDDDDYDENEKMLRHVREVQAGLLSNTSEPSDAEIAAAVEAVAVAAAVARGNKQKDS
                     "
     gene            <920656..>922215
                     /locus_tag="C5L36_0A04120"
                     /db_xref="GeneID:40381523"
     mRNA            <920656..>922215
                     /locus_tag="C5L36_0A04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463430.1"
                     /db_xref="GeneID:40381523"
     CDS             920656..922215
                     /locus_tag="C5L36_0A04120"
                     /inference="similar to AA sequence:RefSeq:NP_011355.1"
                     /note="PKUD0A04120; similar to Saccharomyces cerevisiae
                     YGL160W (AIM14); ancestral locus Anc_1.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319290.1"
                     /db_xref="GeneID:40381523"
                     /translation="MAAIIWEKDALMENTFQLLKRHGSLHKVNIKYGYILFGVSILLV
                     ALRTLALWFYDKSWKKSSRSTTYLRLARFPLALSMAVLVLAITFLMFVNPHLEKISVL
                     IKRTGRLSYALIPLDLFLAAQPAWFSIDNYLDTIKLHKWVSRIIVTLGMLHGIGFFVY
                     YIENNTLNKVFKFENLLGVVVFVLSPVIMLMFKPVRSISYQFFYLFHTIFLMAMIFLI
                     EYHARPGVGFFLFINICLLISQYAKKYYYSKDITMTEIVEHPGSDYKIVKFPKSLLPE
                     SYLPASHVRIGYSKWSPLFVFLPSHPYTVATTYQDHDLLSSLVIKPSKFQLQPFETYS
                     IIPVFKSSLSQNFFDTAENVSIVCGGSGISLGLGIFEYFKRCKVADGRDIKLKFIWIT
                     GKEDDLFILNELNVQGVDIFVTSSDSDELDAVQDAFVDSANDVSDIPLTNLPNESRDS
                     FGSVLHKYENVAVLGKRPNLEVMLRTNMSKTIDYANKWVIACGPPSLISDCENIARQE
                     KCRFFSEEYAF"
     gene            <923136..>923434
                     /locus_tag="C5L36_0A04130"
                     /db_xref="GeneID:40381524"
     mRNA            join(<923136..923141,923216..>923434)
                     /locus_tag="C5L36_0A04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463431.1"
                     /db_xref="GeneID:40381524"
     CDS             join(923136..923141,923216..923434)
                     /locus_tag="C5L36_0A04130"
                     /inference="similar to AA sequence:RefSeq:NP_076899.1"
                     /note="PKUD0A04130; similar to Saccharomyces cerevisiae
                     YKL018C-A; ancestral locus Anc_2.658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319291.1"
                     /db_xref="GeneID:40381524"
                     /translation="MAIGKVVHVAFDLTLAAGFLAAIKKNTGITPDISVIGQPDVEYY
                     AYKYLDYGDYVYDKSVDFMRKSQFFVKNLF"
     gene            complement(<923597..>925732)
                     /locus_tag="C5L36_0A04140"
                     /db_xref="GeneID:40381525"
     mRNA            complement(<923597..>925732)
                     /locus_tag="C5L36_0A04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463432.1"
                     /db_xref="GeneID:40381525"
     CDS             complement(923597..925732)
                     /locus_tag="C5L36_0A04140"
                     /inference="similar to AA sequence:RefSeq:NP_013025.3"
                     /note="PKUD0A04140; similar to Saccharomyces cerevisiae
                     YKR099W (BAS1); ancestral locus Anc_5.713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319292.1"
                     /db_xref="GeneID:40381525"
                     /translation="MADTHKKNSATDSPTLGEAAPSPLIVEKPAVGSIDHLAISKSLG
                     YQIFRKNRRNAWSAEEDECLKSLIIKQYIKTSKLEKYNNEPIDIKSIDWVDISNNMIT
                     KRRGKECKKRWVSSLDPFLRKGKWTAEEDQALIKAFKIHGPAWQKVANDIEGRNEDQC
                     SKRYTEVLNSDTRERLKPWTLEEDLILIKQVKEYGTKWRQISQALPTRPSLTCRNRWR
                     KIMTDIAKDSASDTIKKAVGVLDENGKPIVQFKESELAKVSKKDKKDTKAGKEKKRSI
                     SDKDLSPAESMASDNTDLSDKPANKRQKAGGIDNTPTPPSITPTFTKTTTMYPRVATP
                     SRTQTDWSFSLLDPRTKEEMKSYSGNIKTQELAHYLIDLARFNGVTLTVHQHIHHHYS
                     STPAGVNTDPQANLSRYGHFNYLPPLTEVPKLTSSSSPDNTVDSNNSNKNYNENSLFR
                     LLNSEERAKANNNSSVHEKPPTFNGESRSNSQNMSEENSKPHRQQFYPSNVTLAGANL
                     NTNQVNSNFPHSAHQINPSTSNNDSNNNSGSSRNNNKNNDSRSNSGKKTYVTEDIDEE
                     LDFWETMRSMNNPRNTKPVSQHHPLHYYQPSNYKEQSPYQPSDSFGIQRFPNMATPFT
                     TNANENQKQTTSVAPSNQNFGLYVGAEEDEEEDEDEEGEQYGMYYSVFANRTHVNEGE
                     YSRHGEVNSSNGGATGLVNSGYLMPFNPS"
     gene            complement(<926626..>928623)
                     /locus_tag="C5L36_0A04150"
                     /db_xref="GeneID:40381526"
     mRNA            complement(<926626..>928623)
                     /locus_tag="C5L36_0A04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463433.1"
                     /db_xref="GeneID:40381526"
     CDS             complement(926626..928623)
                     /locus_tag="C5L36_0A04150"
                     /note="PKUD0A04150; Pfam Domains: HTH_AraC(6.3e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319293.1"
                     /db_xref="GeneID:40381526"
                     /translation="MMKLLIVLWIRCWCIQPFFYKNTVPCSFFFSFSELHLPQWMLWS
                     LTLCLTNLTSILLSYFSVGDNHRLSTKQQQDKHTMFYLSDTSKWQAFKNKDPFAADKF
                     FVCHIGLNVCCRPNCGFSFSDEDSKSIIFVDTVEEALEKDFRLCHHCLPNLNEKSDYI
                     LRENFVTIDLELLFSTIDAVNKKIGFTPPLIKKGQQFYKQAIMQIKNARLQKKLLQFT
                     NNDKLPQTNELEHLKMIDMACRHIALAALSTLFGLQFIYNDKLVGRDDSIKKMDQQGG
                     SEYSRRYSYTEEHQKTPGDDETQWSPYRVEKGIFIMQHQRLKTNKRKGGALGFKELAA
                     KSQLSPWHFHRTFKNMTGITPKQYGDRCFEYLEHKKHSLPHSFVSDSSIIVNAKLANP
                     SFISDSSKDGSKKRVSRSALFLLNIDTTITPSTVPMPIQVPVPLPVPASVPIQYNYIT
                     NDFVNNNQSLNSHVNIEEPKMPPQSPQLFDEVFSSPNRGFPQSSPHSTELFLSPQEQE
                     LTLFFSNYANEYSSRMPSLVDANAASPTSLSAPASYVAFDSINTQPTRQYPLDNGIQS
                     MFSSNTSREENFPKSASALNNIPDDIEWGNPFNTDTRINVTSVDYFDDCFKYTDPTNY
                     EHQCLLKQLRLQNLLENKISDLTSIQWEEDNNLADINTFIN"
     gene            <931296..>932888
                     /locus_tag="C5L36_0A04160"
                     /db_xref="GeneID:40381527"
     mRNA            <931296..>932888
                     /locus_tag="C5L36_0A04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463434.1"
                     /db_xref="GeneID:40381527"
     CDS             931296..932888
                     /locus_tag="C5L36_0A04160"
                     /inference="similar to AA sequence:RefSeq:NP_116669.1"
                     /note="PKUD0A04160; similar to Saccharomyces cerevisiae
                     YFR014C (CMK1) and YOL016C (CMK2); ancestral locus
                     Anc_1.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319294.1"
                     /db_xref="GeneID:40381527"
                     /translation="MSKNSRRGRNYQKYNDGYPVNQQNRGRNYQKNTYANEYHEEYAE
                     LQDERYGNAPPNRNIGKQRFNNRNAGGRLPTGPRGFQAEPNETYQNDEPNYKRRTEHD
                     QYYSKSNYKQRRYPNEYYEHGYHHDNGYNTGVPIDRDADDDDDVFHQLTNSSRKPAPS
                     SLSISSSTKGQEKPDLFKYMVKCNITGSVHERIQQVGEGTYGKVYKGKNLITGELVAL
                     KKLRLEAEREGFPITSHREIGLLQSFDHENIVGLSEIMVEKNQVFMIFPYMSHDLSGI
                     LQQSNIQISLGEKKNMFQQLLKGIEYLHSKRVIHRDIKGSNILISNDGVLRITDFGLA
                     RMMKNIDENLVSPNYTNRVITLWYRPPEILLGSTDYGREVDIWGIGCILVELFTRRAI
                     FQGNNEIDQLLKVYDTMGTIKTNEWPDAFKLPWFEIMRPNYKSDSKFKERFGSLLSPQ
                     CYDLALQLLRMNPKKRMTASGALRHPYFKEDPPVCPLNFLKTVKGEWHEFEAKQKRRY
                     LQKQAKQQQQQQQQQQQLVQKS"
     gene            <933776..>934279
                     /locus_tag="C5L36_0A04170"
                     /db_xref="GeneID:40381528"
     mRNA            <933776..>934279
                     /locus_tag="C5L36_0A04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463435.1"
                     /db_xref="GeneID:40381528"
     CDS             933776..934279
                     /locus_tag="C5L36_0A04170"
                     /note="PKUD0A04170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319295.1"
                     /db_xref="GeneID:40381528"
                     /translation="MQILPRLLAKFSNEPIIDLDEETSKTYCTTEKELPTSKQIEKAI
                     QTGLIHEPDIITQPLIGVTSTVNPIPNKATFHLLKRHKASTLWNSSNITNYQQLRNKK
                     ENRHRAKSGVDVVAIIAVNTDARRDATTVNTAIRTKYSSSVPLVARVCNAMTRLGLSC
                     RSGHLQL"
     gene            <935517..>937109
                     /locus_tag="C5L36_0A04180"
                     /db_xref="GeneID:40381529"
     mRNA            <935517..>937109
                     /locus_tag="C5L36_0A04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463436.1"
                     /db_xref="GeneID:40381529"
     CDS             935517..937109
                     /locus_tag="C5L36_0A04180"
                     /inference="similar to AA sequence:RefSeq:NP_011931.2"
                     /note="PKUD0A04180; similar to Saccharomyces cerevisiae
                     YHR064C (SSZ1); ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319296.1"
                     /db_xref="GeneID:40381529"
                     /translation="MATIGIAFGNSTTSFATIKDGKVDVIANPDGERFISSALSYVDG
                     DEYHGQQALSQIVRNPRNTIVNFRDFIGVPFTDIDARYSKLAAHPVELNGKVAYEING
                     NKLSIDEVVKRHLKQIKNAAEDYLGQSIESTVITVPTNFSDVQKQDIVRIAGEAGLKV
                     SQLINEPTAALLAHLSNKDLLKEDKIYVVADFGGIRSDAAVIAVRGGIMTLLATEHST
                     TLGGAELDDALIDFFAADFQKKFKADAKKTEKSLAKLVAASIITKKTLSNVQTASVSV
                     DSLAEGFDYMSSINRLRFELVGRKVFSEMIEFIESLIKKAGLENLDIDAVLLVGGTSN
                     IPKVASTLSLIFPESTEIHAPAIDSKLPNPNELNCRGAAIQASLIAGFDDEEIQESLQ
                     PVVVNTEHISAPIGIKDTDGHFLTILPRETAYPIKKTISFTSNSNNVEIEFYEGKRNV
                     KETVVEPEQFSDDEEDSEEEEPEIVREVEYVPGTLLAKMVLNGVGAGKPVDVIVQIDR
                     EGKMHLTGRSGDVIVKGEVSQA"
     gene            <937609..>939471
                     /locus_tag="C5L36_0A04190"
                     /db_xref="GeneID:40381530"
     mRNA            <937609..>939471
                     /locus_tag="C5L36_0A04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463437.1"
                     /db_xref="GeneID:40381530"
     CDS             937609..939471
                     /locus_tag="C5L36_0A04190"
                     /inference="similar to AA sequence:RefSeq:NP_014723.2"
                     /note="PKUD0A04190; similar to Saccharomyces cerevisiae
                     YOR080W (DIA2); ancestral locus Anc_5.689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319297.1"
                     /db_xref="GeneID:40381530"
                     /translation="MPPNENIFKEGVNLFKQQRYEESITIFKNLVKEYQLEDQPGDTQ
                     RKNFVNLLDCLSASYSKVQKLDRSIKCAEKMIDVDPFGCKGYLRLAKVYRLQDRENNA
                     YEILKHGYLKIKEEKMKPQYTLFNETLYKQLKEELKLAKKRKGFRERSYDPLKDFPDE
                     IIGIIFSEFSPYFNLQCLIVSKLWYKRLVCVPYIFNNCHLKKNIRKQEFDRFLGFVSL
                     VSPGSHNFVKSINIQPHKTVEQTIINDIFKREIKVENLSIELESLNLFSLTRSMKNSK
                     LELSSIKSLSIDLPIITNENTSIEAVLSKCPNVSKFVIKIPKYDSRSHDTLNTPITFP
                     SLTSLTIVVERSMQKHQLNNVIINNFLLRNDFPSLEHLSFSKVNLCFEVFQKIITTKL
                     KTIELELVPNICIIRLTNLLISQVGNKVEGRLEELRIVENDVTMEVPSPNWELELTKF
                     QVYKNLKTLVLRHSHVTPKLLLAILISTSCELEELHLILNSNIVFGSNRPSTSNRPLY
                     GSVDIIELIEKIPRIKQLSLVGCFGMDNTAIIRMAKHIAIGNLFGHLSYLNLSLNKID
                     GRGILQLLGKTPKLKLETLVINFTKVDANTVRYLRELRVCKKIEYKMDDRVSLL"
     gene            <939726..>941555
                     /locus_tag="C5L36_0A04200"
                     /db_xref="GeneID:40381531"
     mRNA            <939726..>941555
                     /locus_tag="C5L36_0A04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463438.1"
                     /db_xref="GeneID:40381531"
     CDS             939726..941555
                     /locus_tag="C5L36_0A04200"
                     /note="PKUD0A04200; Pfam Domains: F-box(5.9e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319298.1"
                     /db_xref="GeneID:40381531"
                     /translation="MSVLYDDIFEGLIDGIHAFESGLVNAALYILEDTLIKTDQFYEE
                     NGIHHESRINIQMQLAKVYIWLRQFQKAVDILKSALESSPENVPVLYRLFLLYSDAYP
                     NEKMALKVYLRAESVMKENGSLDCNHRIYKNFVTRGEKIKCKRQSFFMFKDDTEEIDK
                     QNLMKQLPIEILSNIFSMLDPKSLINLLLTCKGWRSTILESPHLIGAFTLSRDITFKK
                     LQSYLRLFDQKVSTSEIILDKLSIAFNSRDELPLMKLLLSSGLRSKSLNIEIREAIQP
                     QICTLIKESKPLLFTQQTHLSITIEKEAQSISFVDNILPMMTNLQTLYISFRNLSSPK
                     QKSSSPLIDLPRLRFLNIKNEGKHDQVERFVSALTIHNVESLTIDTRSTNIFLKCIRT
                     ANKLKHLKMRMIPIELFLYDFMIEGRPGYERVKELETLEFDTCPSSVDHIFGPRVQFK
                     EFNNLRVLKFRNSQITVTTIEAFFKTCKKSLKELDVLEKSLLSYKGSNTNNNGTFSLK
                     NVLETCTGLEELHITDNKINSSNFTQIAFDIAMLTRPMKLNCLELSNSSIPSSSYIVL
                     FLSIKTKLTIKRMIIHQQNPDVQLISFSEELKRSKVVGEFCFI"
     gene            complement(<941596..>942795)
                     /locus_tag="C5L36_0A04210"
                     /db_xref="GeneID:40381532"
     mRNA            complement(<941596..>942795)
                     /locus_tag="C5L36_0A04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463439.1"
                     /db_xref="GeneID:40381532"
     CDS             complement(941596..942795)
                     /locus_tag="C5L36_0A04210"
                     /inference="similar to AA sequence:RefSeq:NP_010373.3"
                     /note="PKUD0A04210; similar to Saccharomyces cerevisiae
                     YDR088C (SLU7); ancestral locus Anc_8.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319299.1"
                     /db_xref="GeneID:40381532"
                     /translation="MNRDRKAAANKGPPNKRTYVNSETGRKVNDYIPKFISSTPWYYE
                     NEALKVDSQSRKRKSDDEMYRLIADKSVDRLKHQRLDPEGKVVPYNEAKSGSDIVDEF
                     VAICDDDGEDQVDRCSDGIANDKTDDNDNNDNKNKSRKEDTSSLRRKVREWKKKGRCG
                     NCGGKHQKSECFEKPHSISYIYRNDGDNNRQDKRGVTYVKKEAKDWDEVKDRWRGVDI
                     NEEYGEIVDNLKKKEERLLSKFVEDNQDADRNDKDTIVKAIMKDNPLALDPNDKIITR
                     SLEDKPRYLEVIKTGEELRYNPKSRVYKDLKEGYLNERGQFVRYLTGEAAEFEKLKKF
                     AKSVQSEQQKKWRQDSENTEKVVNPEYATEISPTAAMLKMKEKEEKDKLVKKAKKKAL
                     LEKYGAL"
     gene            <943164..>944033
                     /locus_tag="C5L36_0A04220"
                     /db_xref="GeneID:40381533"
     mRNA            <943164..>944033
                     /locus_tag="C5L36_0A04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463440.1"
                     /db_xref="GeneID:40381533"
     CDS             943164..944033
                     /locus_tag="C5L36_0A04220"
                     /inference="similar to AA sequence:RefSeq:NP_010372.3"
                     /note="PKUD0A04220; similar to Saccharomyces cerevisiae
                     YDR087C (RRP1); ancestral locus Anc_8.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319300.1"
                     /db_xref="GeneID:40381533"
                     /translation="MAMKTNAFVRQLASNKRQVRENALSTLKKFLSHEEKAKKLDSND
                     LKKLWKGLFYTMWFCDRPLPQQRLANSLASLFSEDIVDEKFCDFVEAFWSIMMKEWKE
                     LDKWRLDKYLMLMRYVVRECLVRLRQNKWDEQAVETYLSCLKKVVLKDDVKASRAITY
                     HIIDVWVDELERVIFGDDDDDDDDDDDNDNDDTHTSEQRVKLRKEILEQENVPMDVLL
                     APFKELATRGHSEALVKRVRLEVLRDERLVELDIDLSVQGDHKHTQADGSDSAEEEEE
                     EEEEEEEWKGFGN"
     gene            <944344..>944544
                     /locus_tag="C5L36_0A04230"
                     /db_xref="GeneID:40381534"
     mRNA            <944344..>944544
                     /locus_tag="C5L36_0A04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463441.1"
                     /db_xref="GeneID:40381534"
     CDS             944344..944544
                     /locus_tag="C5L36_0A04230"
                     /inference="similar to AA sequence:RefSeq:NP_010371.1"
                     /note="PKUD0A04230; similar to Saccharomyces cerevisiae
                     YDR086C (SSS1); ancestral locus Anc_8.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319301.1"
                     /db_xref="GeneID:40381534"
                     /translation="MADMEKMTDAPVEFLRDGARFLQKCTKPSQKEYMQLIRAVGMGF
                     IMMGVVGYLIKLIHIPIRYLIV"
     gene            <944858..>946201
                     /locus_tag="C5L36_0A04240"
                     /db_xref="GeneID:40381535"
     mRNA            <944858..>946201
                     /locus_tag="C5L36_0A04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463442.1"
                     /db_xref="GeneID:40381535"
     CDS             944858..946201
                     /locus_tag="C5L36_0A04240"
                     /inference="similar to AA sequence:RefSeq:NP_011088.1"
                     /note="PKUD0A04240; similar to Saccharomyces cerevisiae
                     YER161C (SPT2); ancestral locus Anc_8.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319302.1"
                     /db_xref="GeneID:40381535"
                     /translation="MSFLSLLSSVTKDKKIQEKAKHAQLGNHPPNPSTSLQDTLAKNT
                     PLQTPNRPSIARQVGRKPSKPQPSFTPSNVYDDPAVQRLKEARRVERERLAQKNQGKR
                     QTSTRTRAPSSPNGSVTSAGNSRHRSKSTTPTATTTVEKRNNRKDLDLSLPEVSKSRF
                     KFKPSIHGGRAASPTQKTSTGGTAGSGPNGKPSKMSFKELMDKASHIEKPKVALPPII
                     THRKQEKPRPSKAYQSLKKSRNQQLAVDNARLKPTSSTTRPLSNERLTSKSVSPVRDI
                     REPSFAKPSPELLRKLKNKKKNMQLKQRPYRTSTSSSNSSRRKKDAYDIDAEEEEDDD
                     FGYYDDQYDSQDDGFIVDDEEEEEEYRMTQRERKFSDLRSQGYSRDEIWEIFSRGKKR
                     GYYQDDYDSADDMEATGNEILEDEERTLKQAKLDDLREQRLLEEHARRKNKLLHK"
     gene            complement(<946275..>949235)
                     /locus_tag="C5L36_0A04250"
                     /db_xref="GeneID:40381536"
     mRNA            complement(<946275..>949235)
                     /locus_tag="C5L36_0A04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463443.1"
                     /db_xref="GeneID:40381536"
     CDS             complement(946275..949235)
                     /locus_tag="C5L36_0A04250"
                     /inference="similar to AA sequence:RefSeq:NP_011089.4"
                     /note="PKUD0A04250; similar to Saccharomyces cerevisiae
                     YER162C (RAD4); ancestral locus Anc_8.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319303.1"
                     /db_xref="GeneID:40381536"
                     /translation="MSVPSQYKDLLRNALQQERTIKWTNGSTQAPLKSPKRRRILSPV
                     ERMRELKKKKETDGEPKDERYVIHINDEDNDDISMKRSFEGQKSERPDPLSGKHDEDN
                     KEGFSDTGDLDKSEEDEEIDSDEFEDVDLDGTSFMDDADGDESENEEINITIQKNAHN
                     KRATKGSVISSEERIFRRKLHLMHLFVMVGHGVTRNAWLSDPKFLLNLQKQIPLKLKK
                     ELQEYQQHRQKSNVTAQSKTRRLLDLLRHLMEYWQRVWKIDSRAPVLYKKLWPEIKNQ
                     RILPNMKKQRLSKENFHASILSHVGSRDISAQGFVALLRSLNLQARLVFSIQPPDFTN
                     MKKCEDKSEDKDSMPREASKWSPRKTSKPANVKENLLSALRSRKAYTNTVTKTQAQHR
                     EEFAEKFGGWPVFWAEVWDKDSKKYITIDPIVKKLIEVVSWKSKLEPPMNSIRNNAWY
                     VVGYDRVGGIRDVTRRYAKEYNAKVRKKRITRDPKWELWWASLLRGACSKKRLNDNRV
                     DKFEQIEFEELSLKEGMPSNVGDFKGHPVYVLESDLKYNEILYPKISCGGLSNKGKSK
                     KASNGFIPVYKRKNVHIVRSARGWFMKGRVLKMGERPMKIRKKGTNTNTRKKGREDDF
                     RLSDSDIGNGDNDDDTRLYAEFQTEKYVPPPVIDGKIPRNAYKNIDIYEPWMVPEGCV
                     HIRNPYAEKAARLMGIEYVPAVVGFDFKSHREVNTKIQGVVTFDEFKDAVELVCEGLK
                     EVEEEDNKIREDIINLRAWKVLLTRLKINRRLIAEHGEVEDDDEDAYKVNDNDSGEDV
                     SNDDSNGIGGGGFLYNSSITLPASSRTRSRYQHEDMPIYERSDLSASDFEDEVADENN
                     IQYKNIPLALQRKGKLRKAAAKPKSGETPSSPVDAPVGTLSVAEGGMLNEKDDLVYNP
                     EGSDGYNGGEDSDSSEEEVDEDDERMKELDKDMDFGDLDDVHVENDSAEANSSGDNRT
                     APTPNDDYEFEFSE"
     gene            <949551..>952055
                     /locus_tag="C5L36_0A04260"
                     /db_xref="GeneID:40381537"
     mRNA            <949551..>952055
                     /locus_tag="C5L36_0A04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463444.1"
                     /db_xref="GeneID:40381537"
     CDS             949551..952055
                     /locus_tag="C5L36_0A04260"
                     /note="PKUD0A04260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319304.1"
                     /db_xref="GeneID:40381537"
                     /translation="MIRCIRGRPCVSSCYQRRMSPVSSMQRLKKSLHQSIVQAPLKPI
                     RSFQMFSSSQHCFNRVPLDTANISKEIKPLWLSSLLKKQSGMPITQAYQQIYSQEPTI
                     FDNAQNNSSIQQFLSYILINNNNGTDPVNMFNNFTIPKLTSSVESAFIIILHTIIKSA
                     YIEYSNDYLDLYLNKLSQELNLKPTELFISEEVEKKCLFKEALERSDFQIALQILQTR
                     LHETYGWTKNREARHDNIITWINTLFEPSTTQCLISLTKSKSIPDIIAYDLLQRRISN
                     ELEYKYYFELYRNHSSELNLLDQEKLYHLKQYDTKYNRFLNIPTLFNNLFQFALRRNI
                     EDLPLLIDLFLNENNISSEHSLQQISELIWHLSYDHTGEYMSKPSRYYHISHSKLVRA
                     VNKMTESNKSLELDVTTMLGVSNLTYYRNHGNSIRMFKNAKKQFSHWQLSAFKSSEFK
                     SVTPRSSNNKIENGELLHNIKIDNNIKFLCNSIMLLAVSNENKDVIGKDLSNIFKKIE
                     PEILMKYPDVWEFVIIKMKYHGLINEKMIGMIFQEYLKFNSSYNINNYFVLDAIINNT
                     GKSENLFSLIENLGLDKMDDNNIAHIISKFYKFAKNNSHKSESEACLEKARELYQMQQ
                     FKSTRVNASYLLGESIFSPESTFERYNSISAYFKTTQISISSLFVSVYKLHELGIYNS
                     TLWNEQKPLSFAMSEFDQKISKSYGDTADGLLYPNDNLLTIYIQVMKVFGKNKELHAL
                     LDRLVNLKYPLGIQLFSVYLESLNEFDRNELIRCLNAYDVRFQKLSECRSEYDLRRVK
                     ARLPKVAASGSFEGFVRNLDMNWDIVRRWNWPGRKT"
     gene            complement(<952211..>952969)
                     /locus_tag="C5L36_0A04270"
                     /db_xref="GeneID:40381538"
     mRNA            complement(<952211..>952969)
                     /locus_tag="C5L36_0A04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463445.1"
                     /db_xref="GeneID:40381538"
     CDS             complement(952211..952969)
                     /locus_tag="C5L36_0A04270"
                     /inference="similar to AA sequence:RefSeq:NP_010375.1"
                     /note="PKUD0A04270; similar to Saccharomyces cerevisiae
                     YDR090C; ancestral locus Anc_8.223a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319305.1"
                     /db_xref="GeneID:40381538"
                     /translation="MVKENTASTVLSTIGTVIWCVQLIPQIYFLHKRKNAEGFPPIFM
                     ALWCISGVFMAIYFIISDSYIPLQLQPHLFTVLCSVAWFQSMYYPPNEYGRLKILAIA
                     TTFYGLWTGLEVGFSVWLRPVYSKGTKWPDLIFGIIATVFLTIGLLPPYFEFAKRKGR
                     VVGINFVFLAMDSSGAVFSMVAMIIGTFDVMGMILYAMVIVLEAGLFLSQVIWLLRFG
                     RENSDDTHLDLESVYDMESKRVDDSGRYTDCDCE"
     gene            complement(<953251..>953946)
                     /locus_tag="C5L36_0A04280"
                     /db_xref="GeneID:40381539"
     mRNA            complement(<953251..>953946)
                     /locus_tag="C5L36_0A04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463446.1"
                     /db_xref="GeneID:40381539"
     CDS             complement(953251..953946)
                     /locus_tag="C5L36_0A04280"
                     /inference="similar to AA sequence:RefSeq:NP_011090.3"
                     /note="PKUD0A04280; similar to Saccharomyces cerevisiae
                     YER163C; ancestral locus Anc_8.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319306.1"
                     /db_xref="GeneID:40381539"
                     /translation="MTIDEDASLWIFGYGSLMFKRPLHHMPISDTFERYDGYIEGYIR
                     RFWQSSSDNRGTPEYLGRVVTIIPAEEVLYNEKMQESLLKHELNHEKYRQLLQEFSNA
                     NDEFEEKEKLNAISSLLKVKGCVYRVPPQHAKLAREYLDLREQDGYTVENVEFICDGD
                     GRRINCQVYVGTPENTSFVGAEEDDKTAAIIHKAVGPSGPNDEYLLRLQEQDPCDTYL
                     LNLKNIVLSKKAA"
     gene            complement(<954220..>955110)
                     /locus_tag="C5L36_0A04290"
                     /db_xref="GeneID:40381540"
     mRNA            complement(<954220..>955110)
                     /locus_tag="C5L36_0A04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463447.1"
                     /db_xref="GeneID:40381540"
     CDS             complement(954220..955110)
                     /locus_tag="C5L36_0A04290"
                     /inference="similar to AA sequence:RefSeq:NP_010699.1"
                     /note="PKUD0A04290; similar to Saccharomyces cerevisiae
                     YDR411C (DFM1); ancestral locus Anc_5.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319307.1"
                     /db_xref="GeneID:40381540"
                     /translation="MSELSQFVVSIPLVTRSMTLTSLVMSGLNALNIVPITTFISDFP
                     TIWKKLELYRLLTGFLIPNPQAMQGMMEIYMMYSFSRGIEEGKFKKNLPDYLYYLGIV
                     LPTILVGVFLSMPPLYSLSPALLSALTFTWSVHNYSEQVNFYFMPIRASLLPPVSLGF
                     RLLVDGQTSFFLSLIGTGAAYVYNCLETHSYGPLVSIITGKQPEIDRSNSRLGTVHTS
                     TQTWFYSTGFLEAPEWLVRVVSRLTGTDYTSPIYNRRGFAVKRRESGGSGPNNFSGRT
                     TGKSTATFRGEGRRLGTSSN"
     gene            <955895..>957478
                     /locus_tag="C5L36_0A04300"
                     /db_xref="GeneID:40381541"
     mRNA            <955895..>957478
                     /locus_tag="C5L36_0A04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463448.1"
                     /db_xref="GeneID:40381541"
     CDS             955895..957478
                     /locus_tag="C5L36_0A04300"
                     /note="PKUD0A04300; Pfam Domains: DUF1237(2.5e-149)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319308.1"
                     /db_xref="GeneID:40381541"
                     /translation="MRELTKIVIISVAVFLYFCWPAKVTDSTNPSINSSKGLPLQCQD
                     YTKYATEKHAPLSRGPLELSFMRPPLECRTFTSDVIERVIGEFKSKMTDFDLFRVLEN
                     TLPNTLDTTILWFRDDEVEPRTFITTGDIHAEWLRDSARQLSVYQEFIGSDSKLKLLI
                     KGAILQQAEYIKAAPYCNAFQPPPQSKVKRNPSSIDSVTPIPPWDVVFECKWELDSLA
                     SFFTLLNDYIENSKEDSILDHLLVKDAIQMIYTVLRRESASTFDEHGNQRPHPYTFKR
                     HTDIGSETLPLSGAGNPVNINTGLVRSAFRASDDACIYQLHIPSNMHLVTELKRLVPV
                     LKKHEISVMGKSLSILLESMAQSIDDGIMKHAVFRHPDFGDVFAYEVDGFGSINIMDD
                     ANIPSLLSIPDLGYTSSSDSIYLNTRKMILSKEGNPYYFRGAHFEGVGGPHVGLQYAW
                     PMSLLVQIRTSEDDEEILHLLELLKETTNGAGLMHESVHINSPNGKLYTRPWFSWCNS
                     EFGKTILDLAKRKPWLLFN"
     gene            <957860..>958378
                     /locus_tag="C5L36_0A04310"
                     /db_xref="GeneID:40381542"
     mRNA            <957860..>958378
                     /locus_tag="C5L36_0A04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463449.1"
                     /db_xref="GeneID:40381542"
     CDS             957860..958378
                     /locus_tag="C5L36_0A04310"
                     /inference="similar to AA sequence:RefSeq:NP_013657.1"
                     /note="PKUD0A04310; similar to Saccharomyces cerevisiae
                     YML055W (SPC2); ancestral locus Anc_4.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319309.1"
                     /db_xref="GeneID:40381542"
                     /translation="MEFKKVPLYSVPALKGECDVHIADVFGSLGYEESFGLMDTKLII
                     GYTSVAIAGLMYYLEKQYKNDFTNAEYVYYLQILVGFFFTLQGILYLFSKFIERDIKY
                     RGTKKGKTVTVSTSTKSKTNVNYKMDIEIDHKHHECVFPLNEVFFDDGYLSMDAFKEK
                     IVTFVGSIDKSK"
     gene            complement(<958387..>959340)
                     /locus_tag="C5L36_0A04320"
                     /db_xref="GeneID:40381543"
     mRNA            complement(<958387..>959340)
                     /locus_tag="C5L36_0A04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463450.1"
                     /db_xref="GeneID:40381543"
     CDS             complement(958387..959340)
                     /locus_tag="C5L36_0A04320"
                     /inference="similar to AA sequence:RefSeq:NP_013530.1"
                     /note="PKUD0A04320; similar to Saccharomyces cerevisiae
                     YLR426W (TDA5); ancestral locus Anc_4.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319310.1"
                     /db_xref="GeneID:40381543"
                     /translation="MSPKYFIPSPPVVQLGFNIDTFIYISLLTIFSPVFVWLEVYLGI
                     VSVQSALILDSLWVLRTLNLCYKTAYKSDKESKVVLITGGSNGLGFRIVQTLQNDRSI
                     SKIQVIDLHPHAQFSSMSKVEFIKFDFNQEIEELVSMLDLNSIDVLICNAGIRQTNTI
                     SKLPVSKIKSIINVNWLNHLLLIQQYVRVENTKKHLVFIGSLLGFVGPTKLGVYAATK
                     SAILSIGDSLREELPSSTTVSVILPGQMNTQMFADVQVNEFLAPVIDASLLSERICSI
                     INDNLNGTFSYPTYGRFLPVYRVLPWGLQKFCRWFSGMDNV"
     gene            complement(<959603..>961441)
                     /locus_tag="C5L36_0A04330"
                     /db_xref="GeneID:40381544"
     mRNA            complement(<959603..>961441)
                     /locus_tag="C5L36_0A04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463451.1"
                     /db_xref="GeneID:40381544"
     CDS             complement(959603..961441)
                     /locus_tag="C5L36_0A04330"
                     /inference="similar to AA sequence:RefSeq:NP_010429.1"
                     /note="PKUD0A04330; similar to Saccharomyces cerevisiae
                     YDR145W (TAF12); ancestral locus Anc_8.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319311.1"
                     /db_xref="GeneID:40381544"
                     /translation="MQNMNDEKQQQMQQMQQMQQQQQQQQQQQQQQQQQQQQQPIPEP
                     TVGMTSNSGASVPQQGPMQQQAQQNRLSAQAIHQQARQLFRQYSVEKEAAENAGLGTP
                     EGDAHMAKADRIRTILVSYSKRQKLLQQQAAQQQGGQVAQNRENGPTIRQQTGQISQQ
                     QQQQQQQQLSQQIPPVQSNIAPVNSAGNPGTPGMLNVPSASPSMDNIAEARSQSLSQQ
                     ISSLGNNTASATSTNSNNDSQRIDASMIQQLTPAQQLQLKKRQLLKKYQQILSMSEQF
                     KKNLLLIEKRAAEPSIDEATRKHLREKEHEVRTRLENCTNCTQQITHQLRLAQQQAEQ
                     LTQLDRSNSTPASGTATPTPSTAGRAASTQGSPPVSGATAGATPQGKPPRAQKKSATR
                     KQGKNADQGDGSTNTSKRSNPDANANEQSTKKQKNDTTVGGGNSEKDRAKFQNLNIPD
                     ALDVKSSNPAAVKMNNRPTILGGNALNAPALANPAMVKPRPFEIEGERVLNKRKLKEL
                     VNSVASEEGETEINIDGDVEELLLDLADEFVSSVTSFASRLARHRNADNLDVRDVQLH
                     LEKNWNIRIPGYAADEIRMLRKFVPSTVHNSKLDGVAINKSVNKES"
     gene            <961510..>962397
                     /locus_tag="C5L36_0A04335"
                     /db_xref="GeneID:40381545"
     mRNA            <961510..>962397
                     /locus_tag="C5L36_0A04335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463452.1"
                     /db_xref="GeneID:40381545"
     CDS             961510..962397
                     /locus_tag="C5L36_0A04335"
                     /note="PKUD0A04335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319312.1"
                     /db_xref="GeneID:40381545"
                     /translation="MSFTKHYLSWCLFYFPQTQKLYNESEKSTKIRKKKSKSETMATC
                     LVNRLKISTLVQLGEDKTMLDLESKPVLSSLKEENKNLIASVDDYVLDYNLFVLNSVR
                     EVLESNDNQLVSFIQALIASLPDEYSNLIYNPIDDNGKINLSTTSKLQERLLNLLIQE
                     RHRRDIIALNKQFEEKIKYLELENPFKYEIKSPYYKAFLGAKDEQADQFHKLALLQSL
                     EYDFEHNLDEESDYKTDDDLLEHFLDDAIVNFKLDGNVKEEDVMNSEIVKIMLPLAAQ
                     VIMGDDEEVEDESELKESS"
     gene            complement(<962432..>965362)
                     /locus_tag="C5L36_0A04340"
                     /db_xref="GeneID:40381546"
     mRNA            complement(<962432..>965362)
                     /locus_tag="C5L36_0A04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463453.1"
                     /db_xref="GeneID:40381546"
     CDS             complement(962432..965362)
                     /locus_tag="C5L36_0A04340"
                     /note="PKUD0A04340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319313.1"
                     /db_xref="GeneID:40381546"
                     /translation="MDWGVPTLDPKRNKQSDYFKSLYGAEDNTLEIDDNSRATPPLSN
                     FFINKGQLDDIPSLFNPIRTSSASTSPNSRRSSRFFSNSSSTSPKMHNIKESPPKRFT
                     KARLNNVENRDYLIESPTSIYRSLPPIPSPTERAITRGMEEMSILDSPTTPQSTTASF
                     FKMPMISPSSSDPQIKKKKSYSADSPTSLNKRSSTIFSMDFDEMPLDMQIICDARTSG
                     YVHDMDVFVNQSYGEFWELSMDEGKCYKQWSKSQFETQSLLFEILMNLKKIKFNLHRL
                     IFIYGRNLKDDGVISIEEYEKTFGVLTEFYYFLETLLKKKLKPLFDNTFFVDDHRVLK
                     HLANWFNQLNDQYLYISKSVVFLSKLATNEDVRNLILGISKQDIQSVTNRSAVSPLDL
                     FSSYFIKLFTSIEMLFDRLKSVYKESKNINNFDLTFKLKDTLKKINSISDSTSDFQKK
                     INFNEKLTFMNQVDYSHFQMIGLFDHHRKFGEPLQLEVKSNLTWHNASLVAFDNYLAI
                     FSVKSGILNTSSKDEYTYFKQPIPIQYLQFDTFIENEYKIIMIKDIGNKSTHQFRRIN
                     DVTIAILDRFLKDIIVLQNEFWEGSINSHVQFKVFNSYNFLSKPKNYYPYVLEVPSKC
                     NILENMVEFGQDLDIDEDCLVAFTDVLSCDYFTSKSCQPYEKFVVLGTKDGIYMGKLN
                     KSKSFKKVHKITNIKKLVVLNNEVIFCIGNESLYHLSISKLYEAYQKSKTWDINIFEE
                     NKRHVTDFTIGYQSSVQISGCPYLFVWNKNNVSFTELRRENDWKFNWQGFKTHYNVGR
                     LQTVYANNFALSHTIDNYAIWNLSKLSDIRSIGLNRFDIKDITKHEVPIAIFPFPNEM
                     EGISEILVVFSKFCTRMKNVKGKYVQSNDEIIWFGMRCESASFDCQEKVLITVNEQCI
                     EVRSLYDDKNMKSKLIGCLVGPNIKLLNEMPGKPIFRFNVASANGEEYQRQVIFKIRK
                     VLNK"
     gene            <965907..>967818
                     /locus_tag="C5L36_0A04350"
                     /db_xref="GeneID:40381547"
     mRNA            join(<965907..966360,966704..>967818)
                     /locus_tag="C5L36_0A04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463454.1"
                     /db_xref="GeneID:40381547"
     CDS             join(965907..966360,966704..967818)
                     /locus_tag="C5L36_0A04350"
                     /inference="similar to AA sequence:RefSeq:NP_013536.3"
                     /note="PKUD0A04350; similar to Saccharomyces cerevisiae
                     YLR432W (IMD3) and YML056C (IMD4); ancestral locus
                     Anc_4.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319314.1"
                     /db_xref="GeneID:40381547"
                     /translation="MSLLNCANALSYLNEYKQKDGLSVSELMDSRNNGGLTYNDFLIL
                     PGKIDFPASVVSLESKLTKKITLKAPFVSSPMDTVTESAMAIHMALLGGIGIIHHNCT
                     PEEQAAMVKKVKKYENGFINDPFVISPSTTVGEVKKMGETYGFTSFPVTETGKVGGKL
                     IGIVTSRDIQFHENASSLVSEVMTKDLVTAKKGVSLSEGNEILRSSKKGKLPIVDVEG
                     NLVSLLSRTDLQKNQDYPNASKSATTKQLLCGAAIGTIESDRERLRLLVEAGLDVVVL
                     DSSQGNSVFQLNMIKWIKETFPELEVIAGNVVTREQAASLIAAGADGLRIGMGSGSIC
                     ITQEVMACGRPQGTAVYNVTEFANKFGVPCIADGGVQNIGHITKAIALGASCVMMGGM
                     LAGTTESPGDYFFRDGKRLKTYRGMGSIDAMQKTDTNANASTSRYFSEGDKVLVAQGV
                     SGAVLDKGSITKFIPYIYNGLQHSCQDIGVRSVKELTEKVNSGDVRFELRTPSAQFEG
                     GVHNLHSYEKKLHN"
     gene            complement(<968147..>968917)
                     /locus_tag="C5L36_0A04360"
                     /db_xref="GeneID:40381548"
     mRNA            complement(<968147..>968917)
                     /locus_tag="C5L36_0A04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463455.1"
                     /db_xref="GeneID:40381548"
     CDS             complement(968147..968917)
                     /locus_tag="C5L36_0A04360"
                     /inference="similar to AA sequence:RefSeq:NP_013546.1"
                     /note="PKUD0A04360; similar to Saccharomyces cerevisiae
                     YLR441C (RPS1A) and YML063W (RPS1B); ancestral locus
                     Anc_4.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319315.1"
                     /db_xref="GeneID:40381548"
                     /translation="MAIGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPTTFEHRDAG
                     KTLINKSTGLKNAVDGLKGRVFEFNLADLQGSEDHAHKKIKLRVDEVQGKNLLTNFHG
                     MDFTTDKLKSLVRKWQSLVEANVTVKTADDYVLRVFAIAFTKRQANQVKRNTYAQSSK
                     LREVRKKMIEIMTKEVSNSTLAQLTGKLIPEAIGNEIEKATQAILPLQNVHIRKVKLL
                     KQPKFDLGNLLSLHGESSVDSKGKKVSSGFKDVILETV"
     gene            <969609..>970211
                     /locus_tag="C5L36_0A04370"
                     /db_xref="GeneID:40381549"
     mRNA            <969609..>970211
                     /locus_tag="C5L36_0A04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463456.1"
                     /db_xref="GeneID:40381549"
     CDS             969609..970211
                     /locus_tag="C5L36_0A04370"
                     /inference="similar to AA sequence:RefSeq:NP_013647.1"
                     /note="PKUD0A04370; similar to Saccharomyces cerevisiae
                     YML064C (TEM1); ancestral locus Anc_4.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319316.1"
                     /db_xref="GeneID:40381549"
                     /translation="MDTYNQEKNTVTLKVGLIGDAQVGKTSLMVKYVENCFDEIYTQT
                     LGVNFMERTINIKNTEITFSIWDLGGESEFTNMLPLVATDAIAILFMFDLTKKSTLTS
                     IKDWYRQARGFNRTAIPFLVGTKYDMFVELPEHEQEEITRQAKKYAHAMNAPLIFSST
                     SASINIQKIFKIVISKAFDLRVKIPEITHIGEPILLYQDV"
     gene            complement(<970253..>972553)
                     /locus_tag="C5L36_0A04380"
                     /db_xref="GeneID:40381550"
     mRNA            complement(<970253..>972553)
                     /locus_tag="C5L36_0A04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463457.1"
                     /db_xref="GeneID:40381550"
     CDS             complement(970253..972553)
                     /locus_tag="C5L36_0A04380"
                     /inference="similar to AA sequence:RefSeq:NP_013547.3"
                     /note="PKUD0A04380; similar to Saccharomyces cerevisiae
                     YLR442C (SIR3) and YML065W (ORC1); ancestral locus
                     Anc_4.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319317.1"
                     /db_xref="GeneID:40381550"
                     /translation="MAKTRKDMEGWDIVLEGKTGMRHARRTKASGIKLCRKSDNLTIV
                     EGDCISFILDSESNYKVNGIGFIKDINFGIDRFLAVNILWMVKYTSNLDSILPLLPNN
                     EKYTNVDVFLSPFLDPIKLSQIIRKVQVVSIHTFHKLQGTSEEPETDVFTCRRFTDET
                     STYFTDVVDWDTMMDSFKENKDEFYDSVKMLTMKSKSPVKKTMTTRRVSAPSTPTKGK
                     AIKKKKHISDSSDNSDLEIKEIKAVKVDTKYDDDDVDVDDDDILYSINADQNGHMPTS
                     EDEIEDVIEDFKPVKRKRGRPRLSPIKSAKLTHPKLPIVEPETADFLDGEYSTTQMLV
                     KAKKILGTGTKLKFLPCREREFEQIYRGLKSSILSQKGCCIYVSGTPGVGKTATIREV
                     IKQLSAKMAIESNGHKMFNFLEINGLKLIKPQQAYDHLWTKLSGMKTSTNNSLNFLQR
                     HFEADSEDEEVLKGSSKLPLVVLLDELDQIVTKNQAVMYNFFNWPTYPNSKLIVVAVA
                     NTMDLPERLLTNKISSRLGLSRIQFTSYSYNQLSEIIKHRLEQLSKDNENLIIAKDAI
                     EFASRKVASVSGDARRSLMICIRAVEIAQNEYMNKSKCERENLDGKYTVTIMHIMKAV
                     NETSSSPVVGYLNSLPFLSKLVLLCIMLRKKRLGIAEIRLGEIYDELSNQAQVLLFSE
                     LKKSLKGEDLGLLDILFGSGKNRMMGSVINASLFILKDLEENGILIMQSLRIERDRLV
                     RLNISDDEILSILKRDPMIQEIITFI"
     gene            <972922..>974322
                     /locus_tag="C5L36_0A04390"
                     /db_xref="GeneID:40381551"
     mRNA            <972922..>974322
                     /locus_tag="C5L36_0A04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463458.1"
                     /db_xref="GeneID:40381551"
     CDS             972922..974322
                     /locus_tag="C5L36_0A04390"
                     /inference="similar to AA sequence:RefSeq:NP_013548.1"
                     /note="PKUD0A04390; similar to Saccharomyces cerevisiae
                     YLR443W (ECM7); ancestral locus Anc_4.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319318.1"
                     /db_xref="GeneID:40381551"
                     /translation="MLWSNIRYYSQFPFVNLSRRAKFIFALRQTTLLVCLLLGIALLI
                     HNALRLPYLILNFKHSDLASGLYDAIKTSSNRQPNLMMASEIKLLASYISSEIQGTPE
                     KIEANIFGWCSINYNSVYDVPDMDQDITSAWVESFNEEGTNNITVVCSSNGGNDIFDF
                     RGQLSQVGLNSILSYAYSASFRTDDQLSTNTNSYIPDERYVNLMKQRDSYVHRYRSFI
                     IATAVLQMLLFFYTFFYYSLRGNNMDDEKIHWVPKNIAAVSAAIIYLLTILSFAIIIS
                     IMLFTKKDVQNELSSFGIYVNYGSKAVGLLITWLVLTTLFFLLWSGPVWCNRSVRRKE
                     ISNQSLVGTTEGESSNHEHRNLDDLQLTDDEYDDLYSTSIYANPFIGELDVGFKTDIP
                     DWKYRSSDSEDTNMEEAKVDQNENPFSEEIDVPLNHSSRRRGFKKPPPPQLPSSSETM
                     IDLIPMSPILHQEKNN"
     gene            <975191..>975502
                     /locus_tag="C5L36_0A04395"
                     /db_xref="GeneID:40381552"
     mRNA            <975191..>975502
                     /locus_tag="C5L36_0A04395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463459.1"
                     /db_xref="GeneID:40381552"
     CDS             975191..975502
                     /locus_tag="C5L36_0A04395"
                     /inference="similar to AA sequence:RefSeq:NP_013645.1"
                     /note="PKUD0A04395; similar to Saccharomyces cerevisiae
                     YML066C (SMA2); ancestral locus Anc_4.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319319.1"
                     /db_xref="GeneID:40381552"
                     /translation="MSKIFGMQKISAEPTSVAELTLAERLVDFLSKTILSNSFDRGKI
                     QESIVNVFDSNDTMIFKFSDYGYCKKTSTEKKLISECHAMSTGTDIPSVMTKDITYSL
                     I"
     gene            complement(<976123..>976692)
                     /locus_tag="C5L36_0A04400"
                     /db_xref="GeneID:40381553"
     mRNA            complement(<976123..>976692)
                     /locus_tag="C5L36_0A04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463460.1"
                     /db_xref="GeneID:40381553"
     CDS             complement(976123..976692)
                     /locus_tag="C5L36_0A04400"
                     /inference="similar to AA sequence:RefSeq:NP_012735.1"
                     /note="PKUD0A04400; similar to Saccharomyces cerevisiae
                     YKL186C (MTR2); ancestral locus Anc_4.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319320.1"
                     /db_xref="GeneID:40381553"
                     /translation="MMGFQQQMNGNTMSNMSNMAQQQSDQDHTSRVEQFLSKLIESLD
                     QQNPTPTSPPLPQLTQQPRIIINGTPFGSRDQFQQLWISLPASNHQITSLDVHFLPSG
                     NTGLGQFIVLAHMKVRFDESGKNKLGETALFNNSTVSSTRVLWSHWFGVTLSCVIDSS
                     MLNNPNSECISCWDYRFTENPTKSIFKVE"
     gene            <976979..>977311
                     /locus_tag="C5L36_0A04410"
                     /db_xref="GeneID:40381554"
     mRNA            <976979..>977311
                     /locus_tag="C5L36_0A04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463461.1"
                     /db_xref="GeneID:40381554"
     CDS             976979..977311
                     /locus_tag="C5L36_0A04410"
                     /inference="similar to AA sequence:RefSeq:NP_012784.1"
                     /note="PKUD0A04410; similar to Saccharomyces cerevisiae
                     YKL138C (MRPL31); ancestral locus Anc_2.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319321.1"
                     /db_xref="GeneID:40381554"
                     /translation="MFGPFRATSVNFSGLLWKRPWRLSSHQKRRQRFRMRTVDSNIEA
                     LYEGLTANGMSAKKITDLKFNFPKESEMAPRDKYTVFNKHARGYRKGVHFVPKWTKLS
                     LRENPENF"
     gene            complement(<977474..>978094)
                     /locus_tag="C5L36_0A04420"
                     /db_xref="GeneID:40381555"
     mRNA            complement(<977474..>978094)
                     /locus_tag="C5L36_0A04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463462.1"
                     /db_xref="GeneID:40381555"
     CDS             complement(977474..978094)
                     /locus_tag="C5L36_0A04420"
                     /inference="similar to AA sequence:RefSeq:NP_013835.1"
                     /note="PKUD0A04420; similar to Saccharomyces cerevisiae
                     YMR117C (SPC24); ancestral locus Anc_2.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319322.1"
                     /db_xref="GeneID:40381555"
                     /translation="MMESLASTISETASVIEIHDDLALIDNINNKLSSLDNYKQHDIE
                     TLNLRLEELQQQLDNIVASINTLKSSTDGKATRTELNKLNNEIFNSARNLTSLNMKIN
                     SLKLSYNENLRKLDSLESDLAALTENFINHTSSVSMDAGPQDPRLIEENSNLIKLKLY
                     QSLGLKINFQTGEVLILNKKKKNITLLKLDDSYTEYFISNFIWDNI"
     gene            <978665..>978988
                     /locus_tag="C5L36_0A04430"
                     /db_xref="GeneID:40381556"
     mRNA            <978665..>978988
                     /locus_tag="C5L36_0A04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463463.1"
                     /db_xref="GeneID:40381556"
     CDS             978665..978988
                     /locus_tag="C5L36_0A04430"
                     /inference="similar to AA sequence:RefSeq:NP_012785.2"
                     /note="PKUD0A04430; similar to Saccharomyces cerevisiae
                     YKL137W (CMC1); ancestral locus Anc_2.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319323.1"
                     /db_xref="GeneID:40381556"
                     /translation="MGWYDGNSGKTRISGLPSWVLTPAEEKQVLEEYQKEVWRKCDEY
                     VKEFQKCEASAGFGVWFKCKEEGKAMKACVEHHHQYEYVDEIRDAFIKKKMKRAQEVA
                     QSEDK"
     gene            <979773..>980243
                     /locus_tag="C5L36_0A04440"
                     /db_xref="GeneID:40381557"
     mRNA            <979773..>980243
                     /locus_tag="C5L36_0A04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463464.1"
                     /db_xref="GeneID:40381557"
     CDS             979773..980243
                     /locus_tag="C5L36_0A04440"
                     /note="PKUD0A04440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319324.1"
                     /db_xref="GeneID:40381557"
                     /translation="MSSFLDRWLYRDNKSAHNVGTRNGNTGSFYSQTGAKQSTPYYPE
                     GGAAYPRRASGGTAPNLQNVPWSYYKNVETHRRGSAGSMEAMGPVEPVERLDPMERVK
                     AAAHAEALGGAEMPVGATAQVRARPVGMDAAGAILPDVVRRPSGASSVSSTENE"
     gene            <980832..>987509
                     /locus_tag="C5L36_0A04450"
                     /db_xref="GeneID:40381558"
     mRNA            <980832..>987509
                     /locus_tag="C5L36_0A04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463465.1"
                     /db_xref="GeneID:40381558"
     CDS             980832..987509
                     /locus_tag="C5L36_0A04450"
                     /inference="similar to AA sequence:RefSeq:NP_011733.3"
                     /note="PKUD0A04450; similar to Saccharomyces cerevisiae
                     YGR217W (CCH1); ancestral locus Anc_5.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319325.1"
                     /db_xref="GeneID:40381558"
                     /translation="MPAINPQDESEMPPRIILSRGTTDISQSVSRSASRNALGNGDNG
                     RLSPRNSNLLESVYMDEDGSFSANDETENDVTSNNDLKSFHSVAEDYKRLSMFSKHHD
                     VDGDHQDPSFLDTLADTSKSLFNKTTTTTRKLHPHGEKKPLKIEIPSSHEDESNWPAI
                     TPILKTPARFRKSQELDEDLSSVLDEALFSSVWMPTDSAPPQNTRHSPKKTVNADSHQ
                     NLRRRKASSASYNTDSFNYDLELNDAIPMKDLSTGINNGIKVDNYMASNQSQQDVFLQ
                     VPDQTRPMIVIDSSNNSSLLDMSLNISQQSLPQTIKDAKAKPVSRKQGISKMFAKLSN
                     VVNADSPHIDESDEEDNFDNRQDEQEAATESEHQSETMSRDAPTGSSRLFQEELPSNK
                     RYSNGSILKLYMDEIDRKNHQNDDIISVLNIEQTDEISVSSNEEPPPSHEIPGNGDDI
                     NGGNAPRLYGNSLKIFPPDSKLRSLCYKIVTSPITNQFSVLLLTTQVGWLAFQQWKAE
                     YGFVFNKGPTNADWAMLSYYILYTLEMLAKIVAFGLYDDSQMIEALRLQRYENELQKF
                     YKRTFQRLKNSKFFNKDKRNPKISLPLSPVSGATHTDDPFDDSYAINPFEQHVVTPES
                     ALEQPQEIDDTYETPDALHHNKLNHSTRYAYLRTNWNRVDFVSILSFWIQFGMTFNYK
                     DIQKVQVFRALMCLRILRLLNVTRGSRIILRGLNDAASQSKSVILFLMLFWILLSIIG
                     VETFESSFRRQCVWTNPNNSSDTYLHELQFCGSYFEPGTLEILPYLNQFGEPSKIAKG
                     FACPVNSKCIIGENPYNDHLSFDNIVYSLQSLFVVMSANTFTDLMYYTMDSDTMASSL
                     FFICGIFILDVWMINLVVAVILHSYKTEERLQKPHISWLEKSRQRYQQFVSNSKLIKL
                     WKKVEYIFVLIILISFIYGCTKTREDGVFPKQYNTWDFITSIILMVEVILRFMIFVLA
                     GDWKMFFFSGFNIIDLFLATVTLVISSPTVYNSISSVAYGWLSIFGILRFYRVIVSIK
                     PVRESWKIALKRVKPFVELIIFGALLLFFVSIIMSRLFEGVVPEEEMSDTPWAMYNLP
                     NSIVSLFIIMTTENWSDILYVVEQYSNSTFNAMCYGCFLIFWFFLSNTVLMSIFIAII
                     TDNLELSDAEKKINQIKQFMKSCIKQSKNSSEEGIIDLVRNKFVAGSQSEEANDFLAR
                     MNELMLANGKPPIDISKYEVGDDDTMKGRILMMKRDIIESSFYKKVQPSIDAAKHHIK
                     VFYYNYIRRSVKLLFLGRKDDENRIYSRDSEANNLNENHNFQRPQNVDRSLLVFTNEN
                     PIRRFCQMFISPTNLKRTEGRQPAPKCMITFSIFMFLSSIVVVILACYETPLYRMSKL
                     SYNIYNSWMVYPDAIFIVIFTVEFFMRVIADGLLFGPRAYFKSFYNFLDFYVLMSFWV
                     PIVSVLSDNYTLLVTFDAVRAFRTFRLLTINKQTQMVFNIAIISGAMKIISAALVSLS
                     LLIPFSLWGLNIFSKEMSSCVDGVSALNDCRFEYTNTVFKWNVLSPNYVETPLLYFDN
                     FGNSFNSLFQILSLEGWVDLLGDVVNITTYGEQPNLFYTPGNGFFVIFFIFVATIFII
                     NLFISIIINNYQVQTGIAFLSNDQYGWYEVKKVLSRVTLGKGINESNMSYWQNRVYNF
                     ITKKKGIWSRYTAFILLLHFAALVSECYPDSYNGESVRTGIYLFTTLNLFINQTLFLY
                     AIGMKAFFTKKWNIIITFLITTAFIMSAFALNYRSKNVFYNLYKVCLVSVLCLAIPQI
                     DALYQLLKCGSTALVSLLTILYTWLVLYLAFAIAMNQVFGLTKIGPNTSGNINARTVT
                     KALILLFRNSFGEGWNYIMDDFKLSMPYCTSYGQYTDCGNIIGAQIFFIVWNILSMYI
                     FLNILISVVITNFSYVYHGSGPHKLITREELRKFKKAWRKFDPNGTGFIYEHDLYRFL
                     SSLDGVLSYHVYPKYVSLGSIYRRVVLDENPGNGYDVKINVTRLEEILSLIDYGEIRQ
                     RRLRYARLVSELLNTATIVPVDNESHHQVGVIRKIPFSDSLQLVGFYSTFEDSTCLNL
                     EDFLRHSAQIRLINRELRKEKILLTIKMIFTRLRYKYALDKGRVFEKLKNADSLSEKQ
                     QIKEELRKQLKGKDISLEVLMDRLNDTDEGHPVFSNQLYRAMSQSSRNPFNDGYVLRN
                     LDDDEISVVDSSSGESDDYKDIFNKTEFTVKSKRS"
     gene            complement(<987601..>989154)
                     /locus_tag="C5L36_0A04460"
                     /db_xref="GeneID:40381559"
     mRNA            complement(<987601..>989154)
                     /locus_tag="C5L36_0A04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463466.1"
                     /db_xref="GeneID:40381559"
     CDS             complement(987601..989154)
                     /locus_tag="C5L36_0A04460"
                     /inference="similar to AA sequence:RefSeq:NP_011727.3"
                     /note="PKUD0A04460; similar to Saccharomyces cerevisiae
                     YGR211W (ZPR1); ancestral locus Anc_5.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319326.1"
                     /db_xref="GeneID:40381559"
                     /translation="MSASETDHVDKKPKVEISESQQQEEKQEQQENLFKPVGEVAAET
                     EDEPQAVVNQGLRKTGAEDAQGHAVQEIESLCMNCHKQGVTRLLLTSIPYFKEIVLMS
                     FQCPHCGFRNSEIQEASEIQEKGATYILKIECAKDFERQVVKSHTCTSKFLELDFEIP
                     PQRGQLTSPEGLLNETVENLKQSQAERKESQPEVYNKIEEFISKVQKCLNCEEGSLPL
                     TLVLDDPAGNSWIEYVPGEPQHKWSCTWYPRSPAQNVQLGLISEDEVAQREREINKAK
                     AAEAKKLVESKNNVEDNNPRSHIVGGDSEIENFENEVETFRATCSGCYAPCYTHMKLV
                     NIPHFKDVVIMSTTCDHCGYKSNEVKTGGEIPPHGTKITLYCDDPEDLARDILKSETC
                     GMQIPELNLDLTPGTLGGRFTTIEGLLRQVKDELHARVFTQTSDSMAPDVKARWNTFF
                     DNLDKAIDGKIKFTVHMTDPLSSSYIQNVYAPDPDPNMKIEQYERTQEENEELGLLDM
                     KTENYDQAT"
     gene            complement(<989420..>990193)
                     /locus_tag="C5L36_0A04470"
                     /db_xref="GeneID:40381560"
     mRNA            complement(<989420..>990193)
                     /locus_tag="C5L36_0A04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463467.1"
                     /db_xref="GeneID:40381560"
     CDS             complement(989420..990193)
                     /locus_tag="C5L36_0A04470"
                     /inference="similar to AA sequence:RefSeq:NP_011036.1"
                     /note="PKUD0A04470; similar to Saccharomyces cerevisiae
                     YER111C (SWI4); ancestral locus Anc_7.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319327.1"
                     /db_xref="GeneID:40381560"
                     /translation="MSTDGSDITRAVLDGNVGIVKNLLSKDPKLVFTKDEDSRTPLHW
                     AVSLQKPEMVKILLDPYSNVTEDVLKSLEKTEIDIDDMVDDSGWTPLHIAAAAGSFEI
                     FKELATHVSLPDVQLQTSTGQTCLHYAVSKNNYEIVNFLLTHLGASTRIKDKKGQLPI
                     HRAAAVGSTRMVDILVQTGKSPVDPADSFGYLPIHYALAEGHGEVAVQLVVLGSAWKT
                     PVSSGESTLSIAVDDKVRSFFKSTLLNEGLAEEADFESL"
     gene            <990449..>991390
                     /locus_tag="C5L36_0A04480"
                     /db_xref="GeneID:40381561"
     mRNA            <990449..>991390
                     /locus_tag="C5L36_0A04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463468.1"
                     /db_xref="GeneID:40381561"
     CDS             990449..991390
                     /locus_tag="C5L36_0A04480"
                     /inference="similar to AA sequence:RefSeq:NP_011747.2"
                     /note="PKUD0A04480; similar to Saccharomyces cerevisiae
                     YGR231C (PHB2); ancestral locus Anc_5.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319328.1"
                     /db_xref="GeneID:40381561"
                     /translation="MNNNDWQRFARDLQRRAEEISKSSGGPGRSGFKPGSGGSPKGAL
                     FSIGGLVLVGAALVFGQNTLYNVNGGERAVIYDRLSGIKPTVVGEGTHIKIPFLQFPT
                     IYDIRAKPTTIASLTSTKDLQMVNISCRVLSRPDERELPTIHRTLGKDYEQKVLPSII
                     NEVLKAVVAQFNAIQLITQREKVSSFVRENLVRRAAYFNIMLDDVSLTAMTFSPEFSS
                     AVEAKQISQQEAQRATFVVDKAIQEKQYMVVKAQGEAKSAELIGDAIKRSKDYVELKR
                     LSTAKEIAEILAKSPNRVFLDNEALLLNTVTDSRSKK"
     gene            complement(<991727..>994990)
                     /locus_tag="C5L36_0A04490"
                     /db_xref="GeneID:40381562"
     mRNA            complement(<991727..>994990)
                     /locus_tag="C5L36_0A04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463469.1"
                     /db_xref="GeneID:40381562"
     CDS             complement(991727..994990)
                     /locus_tag="C5L36_0A04490"
                     /inference="similar to AA sequence:RefSeq:NP_011035.1"
                     /note="PKUD0A04490; similar to Saccharomyces cerevisiae
                     YER110C (KAP123); ancestral locus Anc_7.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319329.1"
                     /db_xref="GeneID:40381562"
                     /translation="MDQQFVQQLENTLSMVLLPDNEAIKQATNHLKNEFYNKTVSLPA
                     LIQILQSSSNEGVRKLAAVEAKKLAPKFWDELDDQIQQSIRDSILPFAFTYPKQDIRH
                     STSRLIADIAYIDLEQGKWGNLLQTLVSSATDPNKETRETATFVLYCILEQLPLSWNE
                     HTASFLELFATTLQDNESPVVQINTVLCLEALSNTIDEDEALLNSLAGPFSSLIPSML
                     QVLQNSLHYDDTDKTKELFTAFNYLVMLDMKLLGDHFISIVQFMMQTAVNMEIESPIR
                     GFALSNLTQCVSYRKSKVVQAQIGQQLTQTALRIAGEEDDTVEDQLSTESEENENEED
                     EPPTLAIRLLNILAYELPPNQVIQPTLEAVTSMLASQNPYERRAALLAIAACVEGGPD
                     YLSVQLPKIIQMVAAGLHDNSIIVKAAALKCLAILGESLKDAVAEYYETLMQPIISII
                     DSTDKILVYKFATYALDTLIEYMASDAIKNYIEPLMNKLFHMLDSAQSSSLKSAIVSA
                     IGSVAYASGKYFIPYFQNSIQLLEKFIANISVTEGMTEDDIELRAQTFENISSMARAV
                     GSEAFGPYAEPLMNASYSAIQSDNSRLREAGFAFISNMAKVYGEQFASFLPKIIPEIQ
                     KCLEQDEFQLNTEDVDEESLAENLNFSSGIATEKEVALVALGELAVGTKSAFAPYVEG
                     IMGVLIQQITESLSIGASCITIMWKITKAMYDAFGLSDTTAALIKTVRENTAELLVEE
                     VDVNTVVTCLDEFYQYGKDMGKIAIIDDSDSKSLSTLLEQLQLILNNQHPCQEKDEDM
                     PSDEDTNETDAVIYDSALEVLISLATAINAEFPQIFAQFKDVIYAQIQSKSKSKRVST
                     LGCLAEITHNMKTNNPYSQELLEIFVNKLGDDKSSEVRGNAAYGVGIAIEFANFDASS
                     AYQTILESLFTLLNKADKEALKNEDGDEETAETINRTFANACGCVARMTLKHSAAVPV
                     DAILPALFEHLPLQTGFEENTPIFEMVIKLATEENAWINGNPQAIVSFFSGVFIKEAE
                     KDKLIAESTLGREENIERLNQFASDEIKSKVVEFLKWFNSKHNGLVAADATLASVIA"
     gene            <995403..>997205
                     /locus_tag="C5L36_0A04500"
                     /db_xref="GeneID:40381563"
     mRNA            <995403..>997205
                     /locus_tag="C5L36_0A04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463470.1"
                     /db_xref="GeneID:40381563"
     CDS             995403..997205
                     /locus_tag="C5L36_0A04500"
                     /inference="similar to AA sequence:RefSeq:NP_011396.1"
                     /note="PKUD0A04500; similar to Saccharomyces cerevisiae
                     YGL119W (COQ8) and YBR230W-A (YBR230W-A); ancestral locus
                     Anc_6.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319330.1"
                     /db_xref="GeneID:40381563"
                     /translation="MSAKTVYHLYNVAAGAAKVVKKAVEVGTKDCHLLNSIKGNDALF
                     TEAKIVSEEAKAKAANRPFSDANVESQAHHYDEFGDSETDIFQIAKRKSAKARGSAVN
                     DEAEIDIYKAAKGESDKVHKKKGHGNKQQKRELHTSRMLSEDDKKGSKVEVIGSKKEP
                     AVKLTQASIPSSRLGRLFHYGTLAASMGAHVLKDTATHYAKTGKVPEMKSVILSPRNI
                     ELMARKFSQMRGAALKVGQMLSFQDNSVLPPDIQKILLRVQNNAHYMPADQLEKTLAF
                     ELGEDWRSRLFASFDDIPIAAASIGQVHTAVTRKGLEQVVVKVQYPGVANSIDSDLDN
                     ILTLLTSTKMLPPGMFLEKSIANARVELKWECDYIREANNIVRYKEMLANEKVFEVPK
                     VYHDLSDEHVLTMQRMRGTEIAKGDWPQDVKDRISTEIMRLTLKEIYQYRFMQTDPNW
                     ANFLYNEQTDKIELLDFGACRDFDKEFTIPYANCLRAAVREDREAAKKYSIELGFLTG
                     LESEAMTNAHVDSIMVLGEPFRAETSFNFEGQTITDRVRTNIKLMLNERLTPPPEETY
                     SLHRKLSGAYLLCARMKATISSKIFEDVIGLEYE"
     gene            complement(<997284..>1000268)
                     /locus_tag="C5L36_0A04510"
                     /db_xref="GeneID:40381564"
     mRNA            complement(<997284..>1000268)
                     /locus_tag="C5L36_0A04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463471.1"
                     /db_xref="GeneID:40381564"
     CDS             complement(997284..1000268)
                     /locus_tag="C5L36_0A04510"
                     /inference="similar to AA sequence:RefSeq:NP_010050.1"
                     /note="PKUD0A04510; similar to Saccharomyces cerevisiae
                     YDL231C (BRE4); ancestral locus Anc_2.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319331.1"
                     /db_xref="GeneID:40381564"
                     /translation="MSSATSSDDIEDVTDFTITSIHEDAPRGALNRTKSTASFLQAPK
                     RKSSVILATTGQKIQRSYSSYNCTDNDNNLPRQEQQINIQEAINRENSLLAYIRSLFT
                     RPIFKSSFAYLIASLFVYSPTISNMLGTSDSKHLTCTVVVYFHPSRSVGSMLQALLFV
                     SYSLFFGIGVSVFVFTCISLTSIDNDSSFIVVPTVLLVSVFLGMISFWKHRVTKPTFN
                     TASSLAAILIISCVIKVYSRMLDTSDKVTIPWEKIASIISCVLCGCLISVVVCFTLWR
                     KWAKKELAIAVGKASLEIGKTMSILCDSFLSIDNTGEEFVKRRSEITNTFKTLKAQIG
                     KLDGLLEESMFECCSQGREQEYKLYKGLVYSCKRLLADLGGLRRSLEFKWELVEYYEE
                     LRGNDDQISDEAMQRTEQSAAASDIDHREVEKPEELINLFIYHLGPSAKSFVFTMNQI
                     LGGKFYDEEDTINNTATQYMHSLEIAKELYEFHQTEAIDSLYKQDIFAKHEGMDEKIN
                     QEEVAATCANFSFSVTQMSIELENYLNLMISLYDYKESPKRSYGFLKFWKRDAYSHAD
                     AERSQLIPIELDTEKKSFGYSIWKMLKFTRGVDFQFGFRVGLGALILASLAFLDSTRH
                     IFNEWRGEWALVTYCIIMNKSLGGTAMTVKWRFLGTFIGAFLAYWVWQLFFPVVSIMA
                     VSGFLVSLPCFDIILNWKANNAFGRFILLTYNLTVLYSYTMSLSGIPNDGNDWEGGGD
                     PIIWEIAFHRYFGVSLGVIWALLITMTLFPVTARGRIKRGLSVLWLRMGLIWRRGALN
                     SHLDEYQQKKLDGLRGLKVCHSIMGELRTLLKQAPMELRLKGAFPTEIYTKLMDGTEG
                     VLDAYENLNSIVDVDPILSPIEGVVLDNLNEEITELQNRVFSMFYMLASALKLGLPLA
                     GDPASTENAMLKLLSKLADVRKTVEARKEVGKSAGLKNTDFVLFYSYCLVTNFIVNEL
                     TSLMEELIHLYGQLDEESVQFI"
     gene            complement(<1001410..>1004007)
                     /locus_tag="C5L36_0A04520"
                     /db_xref="GeneID:40381565"
     mRNA            complement(<1001410..>1004007)
                     /locus_tag="C5L36_0A04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463472.1"
                     /db_xref="GeneID:40381565"
     CDS             complement(1001410..1004007)
                     /locus_tag="C5L36_0A04520"
                     /inference="similar to AA sequence:RefSeq:NP_015520.1"
                     /note="PKUD0A04520; similar to Saccharomyces cerevisiae
                     YPR194C (OPT2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319332.1"
                     /db_xref="GeneID:40381565"
                     /translation="MIEVTEKKVGDVNEKQFYTESVETTVLDTSYKQRLYEKLGHEDI
                     VGDETIEDVEFLFEKIQETTIPDALDILEHVLEDHYQDPNYPAEDFEKIQELVAAHSN
                     PDTYDDKDLFDPETVYQIKLHAVLNEYFSPYPEVRAVTSPIDDPDAPVETIRSYLVSF
                     IWVIIGSGVNEFFSHRMPSISLTSSVIQMFIYPTGKAFSYIFPDVGFTLFGTRHSLNP
                     GPWGFKEQMFATIVFNVCSAGVYISYNIIVQKMDVFYGQKWVSAGFQILLALGTQTLG
                     FGFAGILRKLVIYPTRNVWPSILPTIAFNRALLKPEAKENINGWTISRYTFLIITIAA
                     SFCYFWLPNYLFQAMSTFNWMTWIKPSNFNLAVITGSVSGLGLNPLPTFDWNIISMNS
                     PLIIPWFSQANQFIGTMIAFFCIVGVYYTNYKWTGFLTINSNSIFDNTGESYQVQKVM
                     SNGKLDLAKYAQYGPPYYTAANLVVYGAFFAIYPFGFIYTLWEDWTNVKKAMIGFFDM
                     LKNPKSLFTESNFANYKDPHSRMMSRFKEVPDWWFYIVLIISLVLMIVCVKVYPAETP
                     VWGIFFAIGINFVFLIPITIIASVTGFQFGLNVLVELIIGYAIPNNPNALMTLKALGY
                     NIDGQAENFISDQKLAHYAKLPQRAVFRGQIFGTILQIIVVLCVVNWEMSNVKGFCTP
                     HQESKFSCPGEVTFYSASVLWGAIGPKKVFNELYPILRWCFLIGFLLVFPCIAAKKYL
                     PKLTRDFQPTLIIGGMLAYAPYNLTYYYPSFVFSYIFNYFIKRRFLSWWEKYNFILSA
                     GLNTGTAFSAVIIFFAVQYHPKLLNWWGNTVSYAGADGQADGYQLSLLDPSSQPGGYF
                     GIRIGNSTN"
     gene            <1006290..>1007180
                     /locus_tag="C5L36_0A04530"
                     /db_xref="GeneID:40381566"
     mRNA            <1006290..>1007180
                     /locus_tag="C5L36_0A04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463473.1"
                     /db_xref="GeneID:40381566"
     CDS             1006290..1007180
                     /locus_tag="C5L36_0A04530"
                     /inference="similar to AA sequence:RefSeq:NP_014871.3"
                     /note="PKUD0A04530; similar to Saccharomyces cerevisiae
                     YOR228C; ancestral locus Anc_8.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319333.1"
                     /db_xref="GeneID:40381566"
                     /translation="MTDLKEVAPEPVELSASMGPSTSTPSENRHGSVLRAIGILNKVQ
                     TYSVLPFSAFSCLHILGVVITPAIFGTEAGDDMIGLGREIYHVPLVEYGILGSAAVHV
                     ISGVSLNLARKYYRYLKYGKSNIKKRQSGDDKLIVPGKEEDIEVRDADKGLGGITSVL
                     GAGSRVSFTSRYLGLSPLAFSGYFFLALLTGHVYYERVSPIVVDGDSSFVDLSYVAYS
                     LQKTFLKTYFGLNTLVLVGSYHMLVGMNRILRRFTLKQRKMTYKAIFVLATLGAVSLW
                     RISQIDVLPAMAAKFHSYVP"
     gene            <1007675..>1009825
                     /locus_tag="C5L36_0A04540"
                     /db_xref="GeneID:40381567"
     mRNA            <1007675..>1009825
                     /locus_tag="C5L36_0A04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463474.1"
                     /db_xref="GeneID:40381567"
     CDS             1007675..1009825
                     /locus_tag="C5L36_0A04540"
                     /note="PKUD0A04540; Pfam Domains: Mito_carr(1.6e-80)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319334.1"
                     /db_xref="GeneID:40381567"
                     /translation="MQSSIDMIFDKHSKRYPDSGEKVLKYSDFKHLVSCDEFKHSDFV
                     YLSKVASSIPLDIFSIMFMVSDPENKGYMEKEDFRKLSQQLLIPRGKDADFDTDINKL
                     LFFVFKIYENKTFKTNGSNIYNLNHPIKKESFINFVKTYNKSDLSYLNNLIDNTDKLD
                     FDHFSQLMNELPKIKLNQSFQSLKNGNNQIDPSQLKQIAQTIFYNKLPPLIADHLEEF
                     ASNKYGSAITYDDAFNLLKMIRDLPKLNYLTYEKISHDKNASKKIFLTSSSLYNYIQQ
                     TKSRNKHLESISNEEILLYFSWNRFSNDYLKKNPSIHADELLAILTDDLVIPNENTYH
                     SDGLSSIFKSIHSFVLGSVAGMIGATIVYPIDMVKTRMQNQKGNSLYTSYLDCFKKIV
                     RNEGLLGMYSGLLPQIVGVAPEKAIKLTLNDLVRAYGLKQSKNNEISPTWEIIAGSTA
                     GFCQVIVTNPLEISKIRMQIQGEQAKFYKEQGKIFHPKSVFEIVRELGLRGLYRGAPA
                     CLLRDVPFSSIYFPSYAHIKKNIFGLDPGKPGKRSSLEAWELLVAGAVAGMPAAFLTT
                     PCDVVKTRIQSKPQPGIQPYVGISNTFKRIVKEEGAGALFKGGIARVCRSSPQFGFTL
                     AAYELFQKTIPLSLFYDTESQTQNRVNQQDFAKNNSDGNQVNSSPGESTTTIFESSKR
                     FKLSSSASTADLNPTLLALTNYYQSLKDKEDKKK"
     gene            complement(<1009949..>1011028)
                     /locus_tag="C5L36_0A04550"
                     /db_xref="GeneID:40381568"
     mRNA            complement(<1009949..>1011028)
                     /locus_tag="C5L36_0A04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463475.1"
                     /db_xref="GeneID:40381568"
     CDS             complement(1009949..1011028)
                     /locus_tag="C5L36_0A04550"
                     /note="PKUD0A04550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319335.1"
                     /db_xref="GeneID:40381568"
                     /translation="MDTLDDEQKALLWRNLLSIVSVIGGFRPSEDITKLRNENEQLRQ
                     ENRLLRKQLETFTQTTPRVARTSQSEIYDEDPDLTDISPTKSEQDSQTSNVSNVSFPK
                     RRLLEESLDFDNVKKIRVESDVDVSQIYDSQGSNQHEECVDFHSLLSNKKINLTGNPK
                     MNRPWYREDFTTNPEYVEYISDRGVPIKMLPPHIRKYYIRQKDYIRKLAIKGFEVEDS
                     PLKDKENCDFGGPVTPVQNPDIYYLDSSIREVCKYEINASNLDKYLKTYPNILKSDTA
                     REWEVEDSLQTSDVCADFLLTQEVLERNAMARERSGLKGLQMLFQACLVVEGGKQVGK
                     YVFKKEEYNTLVCSGNFVIDLGVFA"
     gene            complement(<1011189..>1013009)
                     /locus_tag="C5L36_0A04560"
                     /db_xref="GeneID:40381569"
     mRNA            complement(<1011189..>1013009)
                     /locus_tag="C5L36_0A04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463476.1"
                     /db_xref="GeneID:40381569"
     CDS             complement(1011189..1013009)
                     /locus_tag="C5L36_0A04560"
                     /inference="similar to AA sequence:RefSeq:NP_013402.1"
                     /note="PKUD0A04560; similar to Saccharomyces cerevisiae
                     YLR299W (ECM38); ancestral locus Anc_6.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319336.1"
                     /db_xref="GeneID:40381569"
                     /translation="MAMFPLRNKPYPLYVGTAVLLLVLLTTLSRHQKVPFPRVPDVPA
                     HIPFTKSPTWNPDTNVTAYSTSGMVASDSEYCSQMGVDILKLGGNAADAAVTTCLCIG
                     ATDTMFSSGIGGGAFITAKNSTGAISIDAREMAPAGAYSDMFKGREHKSMYGGLASGI
                     PGELMGLWTLYESHGSKNVTWQQLLEPVAEFVERGWRIDKRLAYALQIQKSAFAYFRK
                     DWDFVFKSGTNKLLEEGDLMKRKALAKTLRYVGKKGGFAFYDAEDYIARSLAAKNQEW
                     EGVITPDDFGKYKVVIQDASKLENFTAKNLTVYTANGASSGPALIYGLSILNEFENPD
                     FHDYDVEETHKLIEVMKWMASARSYLGDIGVYNTNKTQMRDHEKRYAKFRDPNHIKEV
                     KGRITQKTHPWQEYDPAYEPNDPNGTSSLSVVDSQGNAVSITTTINLLFGSCVHDPVT
                     GVIFNDEMDDFSLPHTKNAFDLEPSVFNYIEPYKRPLSSSAQSIITDSEGNVELVIGA
                     AGGSRITNAVFQGIIRTFLQEKNITDTIANPRFHHQLIPDVVTMESPQSDDFISSLEN
                     KGHNVRLDIPRSAMNGIRVRNGEMWGQGDWWRKFGVAVGV"
     gene            complement(<1013237..>1014172)
                     /locus_tag="C5L36_0A04570"
                     /db_xref="GeneID:40381570"
     mRNA            complement(<1013237..>1014172)
                     /locus_tag="C5L36_0A04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463477.1"
                     /db_xref="GeneID:40381570"
     CDS             complement(1013237..1014172)
                     /locus_tag="C5L36_0A04570"
                     /note="PKUD0A04570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319337.1"
                     /db_xref="GeneID:40381570"
                     /translation="MVLHNDKWKRKAKWAVEKKHRAQGKGTLNKSADSDKAPHDENDE
                     NDENDENDGSDEDYEHDEDEENARFGNSWRFADPVVDESILKDPEYQAQIQAKQREEE
                     ERSRYMRELVSSKVQGKPEENLETMKQVKSFKEMRKKGLSNLKFGSDSESGSEDEDGD
                     GESNSQLGEPIVREFTDSEKAKFLALQEKIRHQKEVDLLKAKINKVNHKGTAKVLEIH
                     TEKGKDNYRHLVDAKLHQMTENKDDLDELVGQMLGIDLKNAKVDETPHEGTFDLDNVI
                     GNVPSNVTRHPSRSKGTVVPVKLEEADEDFLDSLI"
     gene            complement(<1014447..>1016150)
                     /locus_tag="C5L36_0A04580"
                     /db_xref="GeneID:40381571"
     mRNA            complement(<1014447..>1016150)
                     /locus_tag="C5L36_0A04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463478.1"
                     /db_xref="GeneID:40381571"
     CDS             complement(1014447..1016150)
                     /locus_tag="C5L36_0A04580"
                     /note="PKUD0A04580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319338.1"
                     /db_xref="GeneID:40381571"
                     /translation="MTSIRPQATVVSVDDMGLTSVLSGHHEKIIVNHTVDHDEAVILA
                     LGYKQEFKREFSLLTTFGVSFSVLGLLPSIASTLWYSLAYAGNAGITWGYLIGMTGVL
                     GVACSMAEISSAFPTSGGLYYATAMLAPPKYKALLSWIVGWSNYFVQITGAPSVAYGG
                     SSMILALKQIIDPDYEIQDWQNYLLTVALTFVAAIVASLPTKWIAWINSCSTVLNLVF
                     LFISFVVILGGNNRKAQGLPKFNTDKIAWKLDNLTDWPDGICILLSFMAVIWTMSGFD
                     SPFHLAEECSNAQVATPRAIVLTAVVGGLLGFVFQLAMAYTIVDVEAAVNDDLGQPYI
                     AFLNQVLDRPSVMCLASFAIILAFSMTFSCMIAASRVLFSYSRDNCFPLSKYWARVSP
                     LTQTPVNAVWMNWFIGVLLLTLMFGGVAIDAIFSVGAIGSFISFTVPTLLRITYARNT
                     FKPGPWNLGKWSYASGWLAVSYTTLMIPILCFPQYRGSNNTPQLMNWTVLVYWGSMFL
                     AIAWYFIYAHKIYHGPKSNLGDAIVDEVDESNVIDAIVSKGGEVRYASEEVSNEKSEN
                     V"
     gene            <1018196..>1019233
                     /locus_tag="C5L36_0A04600"
                     /db_xref="GeneID:40381572"
     mRNA            <1018196..>1019233
                     /locus_tag="C5L36_0A04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463479.1"
                     /db_xref="GeneID:40381572"
     CDS             1018196..1019233
                     /locus_tag="C5L36_0A04600"
                     /inference="similar to AA sequence:RefSeq:NP_011930.1"
                     /note="PKUD0A04600; similar to Saccharomyces cerevisiae
                     YHR063C (PAN5); ancestral locus Anc_5.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319339.1"
                     /db_xref="GeneID:40381572"
                     /translation="MSVYILGAGGVGTLLASSLTKQFAVNFIVRNQAKIEHLRKTGNA
                     FQIKRLYDNDRVLDYRIKSAVTAHDIPDEHIEFLLVSVKGFDTIKSLSPLLAKINEKT
                     RILLVQNGMGVVDELYGTLWKDKSKRPIIYQGVISHGVWQPQEWANTYNYNHAGYGSL
                     KVCQIPRELSNPTESGQIEEDDVINALLKSDLNVSTHTYKELLVYQIQKLLVNSCMNS
                     TTSIVDVINGGLANIEEVDTLFTSIVDEGLRILYEAYPSLQSSPLAKELLNTKPLVEF
                     VKHVGFGVNGKNSTSMRQDVLNLRKTEIDYINGHIVSKAHELGKEAPVNSTIKTLVNL
                     KAKVLINQAGK"
     gene            <1019477..>1020649
                     /locus_tag="C5L36_0A04610"
                     /db_xref="GeneID:40381573"
     mRNA            <1019477..>1020649
                     /locus_tag="C5L36_0A04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463480.1"
                     /db_xref="GeneID:40381573"
     CDS             1019477..1020649
                     /locus_tag="C5L36_0A04610"
                     /inference="similar to AA sequence:RefSeq:NP_013651.1"
                     /note="PKUD0A04610; similar to Saccharomyces cerevisiae
                     YML060W (OGG1); ancestral locus Anc_4.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319340.1"
                     /db_xref="GeneID:40381573"
                     /translation="MTITWQKLLLPPNEIDLNTLLRCGQAFRWRKINNVWSCALNNQI
                     LLLRETDQDDTHILEYTTLDGSFPNMDTTKFIHSYFNTFTSNLELYKQWREKDTYFPV
                     KSEGSTIMGVRILSQDPWETLLSFIISSNNNIKRISQLCEVLCIAYGKEVGYYQNLPY
                     FTFPKPIEFLPINDPKELSSKHIETLEYELRGLGFGYRAKYISKTVRLMIENPEFWET
                     LNNDNSWSEDGDEKCIEFLRQFPGVGPKVADCVALMGCKRHDLVPVDTHVWNILRSTY
                     RKEFEKWVDSLSIKEEEGEDGAKKLTTKDKARTSEIPKSSLKRSLFNKAVDVKIYPFV
                     KRFFREYWGVKAGWAQSVVFSEMVKLDNGINDVEEYEKLLDKVRSFKGDGFKRRKI"
     gene            complement(<1020703..>1022523)
                     /locus_tag="C5L36_0A04620"
                     /db_xref="GeneID:40381574"
     mRNA            complement(<1020703..>1022523)
                     /locus_tag="C5L36_0A04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463481.1"
                     /db_xref="GeneID:40381574"
     CDS             complement(1020703..1022523)
                     /locus_tag="C5L36_0A04620"
                     /inference="similar to AA sequence:RefSeq:NP_010953.1"
                     /note="PKUD0A04620; similar to Saccharomyces cerevisiae
                     YER036C (ARB1); ancestral locus Anc_3.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319341.1"
                     /db_xref="GeneID:40381574"
                     /translation="MSISASKAKREAKKAAKLAEGKTKKKLTKKEKEKLENQDAGESA
                     AETIEKLKLQQDKDGLSDRVTTGVLDSLITSRDIKLSSVSLLFHGKVLIQDSTLELNY
                     GRRYGLLGENGCGKSTFLRALAAREYPIPENLDVYLLNEPAEPTEYSALEYVVREAEA
                     TLAKMEKEVEDIIVEDGPESLLLEPLYERIDEMDPSTFEARAAVILTGLGFNSKTILK
                     KTKDMSGGWRMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKKFDRILILVS
                     HSEDFLNGVCTNMIDMRMKQLLMYGGNYDAYAKTRAEQETNQMKQYQKQQEEIAHIKK
                     FIASAGTYANLVKQAKSRQKILDKMEADGLIQPVVPDKVFNFSFSEVERLPPPVLSFD
                     DISFSYDDNPENNLYEDLSFGVDMDSRIALVGPNGVGKSTLLKIMTGDLQPQKGRVSR
                     HTHIKLGVYSQHSADQLDLTMSPLEFVRQKYSHISQDYQYWRGQLGRFGLTGEGQTSQ
                     MATLSEGQRSRVVFALLALEKPNILLLDEPTNGLDIPTIDSLATAINNFNGGVVVVSH
                     DFRLLDKIAKDIFVVENKTATRWDSSIAEYKKKLAKNVVL"
     gene            <1023140..>1023778
                     /locus_tag="C5L36_0A04630"
                     /db_xref="GeneID:40381575"
     mRNA            <1023140..>1023778
                     /locus_tag="C5L36_0A04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463482.1"
                     /db_xref="GeneID:40381575"
     CDS             1023140..1023778
                     /locus_tag="C5L36_0A04630"
                     /note="PKUD0A04630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319342.1"
                     /db_xref="GeneID:40381575"
                     /translation="MSMSLEVFQEENPNGGNLNANTENIEEDWPDMEIDPYVGLVRTI
                     ENMQLVEVPFYKLKWKRIATSHGNLDYDLTKESLAQFEDNVINLISNIEIHPVVKEII
                     YRMLSSWDIEALTSHGLDAAFLDLRVDGKTVHKYREYKELMEIVEMKISDIFSAVNFD
                     CLMDGVKQCPTFSQCTNILRLRDGRDKFNLSTLSIAHKYYVVRETLLSQERG"
     gene            <1024085..>1025758
                     /locus_tag="C5L36_0A04640"
                     /db_xref="GeneID:40381576"
     mRNA            <1024085..>1025758
                     /locus_tag="C5L36_0A04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463483.1"
                     /db_xref="GeneID:40381576"
     CDS             1024085..1025758
                     /locus_tag="C5L36_0A04640"
                     /inference="similar to AA sequence:RefSeq:NP_014052.1"
                     /note="PKUD0A04640; similar to Saccharomyces cerevisiae
                     YMR319C (FET4); ancestral locus Anc_1.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319343.1"
                     /db_xref="GeneID:40381576"
                     /translation="MVEREEEREERRSLVNKIAMVSWAVIKAILIPPSKGDIKMRCEM
                     ATHKNEEFEQEECCKDLVEDSCTEDKFDSRIFKFRNAINSFFRKEKDHVVFNEELEED
                     EYYITSPLDAFIGYAVDVAGSITVLIIVFALLIGWIIWGCLTGAGDTWQIVMQDGQSI
                     QTYVWNTFLMRQQLDGTEKFLLLYGKLKSRSNTEKRLIERIVENRKNNGFDFNIYSDK
                     VDEFEKRGEIEFKSKSMFDKVSDLVGKVVGSLPTVVLYWMGIFAWIGCGAIPINEGTV
                     EEPQMNTFSNTWQMYVNTATAIELLITTVFLENIRGRSSNYILKQTQTFNELDSDLEY
                     LLRDINKDYYENDLVIVKRNPRDKIQKLISLYAHIVGNGLGLIISICVFSAWLGIGNT
                     MKWNSNWWLIIGTYTGLMGFIDGFALREIFFSITNYESEKYRDLLKDSQDMIDLLGLP
                     IELEPPKKKMTLSDRISIYINRICSNKYSVVFAVVVVLGLIILASGLRWSETAQIICN
                     TPTMIIEGFFLLILVQAHDWANEERIEILSELTRSRVIIHDYITKNSRC"
     gene            complement(<1025946..>1026449)
                     /locus_tag="C5L36_0A04650"
                     /db_xref="GeneID:40381577"
     mRNA            complement(<1025946..>1026449)
                     /locus_tag="C5L36_0A04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463484.1"
                     /db_xref="GeneID:40381577"
     CDS             complement(1025946..1026449)
                     /locus_tag="C5L36_0A04650"
                     /inference="similar to AA sequence:RefSeq:NP_010163.1"
                     /note="PKUD0A04650; similar to Saccharomyces cerevisiae
                     YDL120W (YFH1); ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319344.1"
                     /db_xref="GeneID:40381577"
                     /translation="MYRFIPLIKRVNFRPCYSVSRICLYPVERVRLPTWKRFNAITAS
                     TDGSTIPDDVKNLTLEEYHKNSSETLDIILDDLDSFFEENRIMDADVDSDSGVMEINV
                     SEGTYIINKQPPTKQIWVSSPISGPRRFDLHNGQWICLRDNTKLCELLNEELNLMYGK
                     LSWSQKF"
     gene            <1027066..>1027551
                     /locus_tag="C5L36_0A04660"
                     /db_xref="GeneID:40381578"
     mRNA            <1027066..>1027551
                     /locus_tag="C5L36_0A04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463485.1"
                     /db_xref="GeneID:40381578"
     CDS             1027066..1027551
                     /locus_tag="C5L36_0A04660"
                     /inference="similar to AA sequence:RefSeq:NP_013990.1"
                     /note="PKUD0A04660; similar to Saccharomyces cerevisiae
                     YMR263W (SAP30); ancestral locus Anc_8.815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319345.1"
                     /db_xref="GeneID:40381578"
                     /translation="MSQSTRQSARNKQKQAYVVPVQKEYVAKYVHNNHPDNANRESQG
                     GVFDFSREELRNYRLKYLNTDNILTPDTHTFQGVLLGGSTNRIAHETATVAREREGRA
                     QGESGVYGTRTEGDLQSAVREHAGESLTVRESDVLVNFVYKVRREQEEGAGKFRVRFN
                     H"
     gene            complement(<1028260..>1029432)
                     /locus_tag="C5L36_0A04670"
                     /db_xref="GeneID:40381579"
     mRNA            complement(<1028260..>1029432)
                     /locus_tag="C5L36_0A04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463486.1"
                     /db_xref="GeneID:40381579"
     CDS             complement(1028260..1029432)
                     /locus_tag="C5L36_0A04670"
                     /inference="similar to AA sequence:RefSeq:NP_013605.1"
                     /note="PKUD0A04670; similar to Saccharomyces cerevisiae
                     YML102W (CAC2); ancestral locus Anc_8.817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319346.1"
                     /db_xref="GeneID:40381579"
                     /translation="MGIVVTAKTLALHWHDGANAIYSISAQPLKDGESLRIATGGGDN
                     NIRIWRLLTNSNGEVDGVKYLSNISKHDRAVNCVRFNGQGDLLASGSDDGSVLLFCRS
                     EEIVREFGDDEDEILESWVLVGGHRGSAGMSMKEVYDIAWSPDARLLCLGTMDGTVGV
                     VDASSGALVSTVRAHAQNVQGVSWDPLGEYIVSLGGDRCINIMTFSMGILKSISKSCK
                     IFYGENLETLFRRLTWSPQGSLLVAPCGIINNGANTTNGGTITTAENAVYIFTRASLT
                     TPGPARAVAMLKFRKPPLVVRFSPYRFEPSSSVAHNDAESPVFTGGNRDDACYLFAVA
                     TADTVSVFESTTLRCVCTVGNIHYAGITDLTWARAGLLLVASTDGFVSAVNIRYEG"
     gene            complement(<1029834..>1032365)
                     /locus_tag="C5L36_0A04680"
                     /db_xref="GeneID:40381580"
     mRNA            complement(<1029834..>1032365)
                     /locus_tag="C5L36_0A04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463487.1"
                     /db_xref="GeneID:40381580"
     CDS             complement(1029834..1032365)
                     /locus_tag="C5L36_0A04680"
                     /note="PKUD0A04680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319347.1"
                     /db_xref="GeneID:40381580"
                     /translation="MSLSSRNLRPQYHHTQQQHPPRAMSMTSSLRGSGVSRSTSMNGY
                     SMRIQGRTQRPGSVNSRANSLTGGYAYQSRQAGGSSRNTSRANSLKSNSTTTKIVKTT
                     EEKDESGRTKTITKTTIERRGDVKIVRTTIIQPANEAIDELDELNEFNEMDELDELQG
                     FDDSGNDGADHHEENEHYEGNENDYLHPSPDPRVNGAASAAAAALGLRRQLHPVSSGP
                     IRVQRNQQVQPIPQVQKRVQSPPSRRSEVRFSDFSSTGDDYPMYEEDEHEELAHVGGN
                     GSECHSPNSPVVRKDSVTASPETPSSFHARAQSRLSEIQEVTENYDYTSEDQVDTVDM
                     NQQMGNRVAAKEIPGEDTTTNGVHGPPAITNIMPTPPHSYRNLSAPVQSKDAPNTHLQ
                     SNGEDTESYGSNNRAPRRLKSVLKNSSSSSMVNSPLTPEHTGFENFGGYSSTVGVGTG
                     QVSHPRRTLSPAPALGPASKPLAVTPAVVTSERKELTPEEMYALALQAAEKKVYGDRI
                     EGGGSDDLTSRNTIKNANIGESKNISGKTAVGKSQSGVPYKSNAQGVGFRMHSMREPG
                     PKVSRFSREYNEAGGMKKLLKSKQKEEKRGWESERKARAGELVEELKPQVEHEVEMMP
                     VDAEVELAILQKQEELGKSIGGLGEQVEGKSVGSPSSPSKLKRMFGLGKKKAHSRGGS
                     VDSSSKKLFTFGKPDGSLNDSKAKRASAETAVPDADVAGHGVTGLGLEPTVVPGVEMP
                     TIVENGGLRDGDGDGYTNGGEEAGLNMSLRGASVGDSVEPEEFTDALSSLDVPVEKMV
                     VNAREGAGNVETSVTGKGREDASRVEKEEGGKVKRNNRFMKFFNL"
     gene            complement(<1033028..>1035553)
                     /locus_tag="C5L36_0A04690"
                     /db_xref="GeneID:40381581"
     mRNA            complement(<1033028..>1035553)
                     /locus_tag="C5L36_0A04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463488.1"
                     /db_xref="GeneID:40381581"
     CDS             complement(1033028..1035553)
                     /locus_tag="C5L36_0A04690"
                     /inference="similar to AA sequence:RefSeq:NP_013939.1"
                     /note="PKUD0A04690; similar to Saccharomyces cerevisiae
                     YMR212C (EFR3); ancestral locus Anc_8.727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319348.1"
                     /db_xref="GeneID:40381581"
                     /translation="MHSFFKQKHQKLILQCYPSPKLSIAETKPNQAELSYLVFYASSR
                     RTKLEKVGIFLLKKTASDISHKRVGHLKVTLYILQELIEKCSEDIGFLTPYFLSIMND
                     VVSLGDLSVCQLANEVFVKYCALIQPTQRQILSLDSNVLKTFIAVLNKFLDFSHNNQK
                     EWLRISLNTSLAIADYIDFSFVHLERINLIKKSLDMILNMLKDTRFDDELIRTQTTST
                     QLSPNDLDLDKHAIQCLKSFFDTSSKRQLDESTNSVLSYILKENAEIRWSNAIFAICT
                     RKTHIELRHRILILFLQKTDKYVDIHEVEVSKYLLKIVSNLLNNPVLQFIGLPVLDIV
                     NKVIQFEKSMIINNDSETLKSSYSEVLVNLASRIYYNTQLDDILACFLNSYYYEYTNN
                     GSNKLTESQFFHFTEAIIADIKDILIISEKPEVRLKISPFVLSTFNHLYILFPFDAFA
                     NIKDTLELLWLKLIDEFYLFDKQYQEEANQKVPGKRQEVYSIPNVEMCILNNIDNNLF
                     LFLEGIEKIISSIPSDEVKKQISITCTTMAQTFKINFLLNYLKFSSNWLADEEDFKYP
                     LSLLLLGVLSTQIEGGSSLAALIDSKIAYSQQKQMWPKYIGYTPTSPASSHGLTNEEL
                     YELLSNIDSVSQWIHRISMSQTSSLAKKIPKPFTNHMVMSTSNSFLSLPGNGSLRAAL
                     RNGGQTNGSVTSSNENNDITDDNESNELEYSEDMSFLSPNGFNIPGSSSLRSGWSSMR
                     SGHLSRHINLQELKQSKNNTVSEGELSRLVKTRTNTTLGPLNANTAGGPPDRGLAKVH
                     TLTAGSTHVPPPSAALPKEKSNTSGLAFSITGIDFDEDEDGET"
     gene            <1038495..>1040315
                     /locus_tag="C5L36_0A04700"
                     /db_xref="GeneID:40381582"
     mRNA            <1038495..>1040315
                     /locus_tag="C5L36_0A04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463489.1"
                     /db_xref="GeneID:40381582"
     CDS             1038495..1040315
                     /locus_tag="C5L36_0A04700"
                     /inference="similar to AA sequence:RefSeq:NP_013940.1"
                     /note="PKUD0A04700; similar to Saccharomyces cerevisiae
                     YMR213W (CEF1); ancestral locus Anc_8.728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319349.1"
                     /db_xref="GeneID:40381582"
                     /translation="MPPVYVKGGMWTNVEDEILKAAIAKYGLNQWSRVSSLLTRKNAK
                     QCKLRWNEWLDPRIKKLDWSPDEDKQLLNLAKLRPNQWTSIAMFLKRTANQCIERYQE
                     LLTGHLGDGEGEGAFLVGNVESGEAKGTSAFSGLNLNPESKPARPDLEVMDEDEKEMI
                     SEARARLANTQGKKAKRKARERVLEESRRVAELLRRRDLKQVGIDAKLRPKKTFKEQM
                     DYNADIAFERRPEKGPFDTSEEVQLNEREKVLFDRNTQVKGTFNQEVEAQKRKEKKRK
                     EHNKRLVEYTQSKRKRDEEDDENEELYAKEMSKRRRLDFNTPGSITDLDDIVEDAVQD
                     LDARKSIVLSRKKDVISSFDISKAEKKEEKKRIKEQRKHLHSLLDSLPTPDDDFDFDV
                     EMLENDEMVQGDSTKKPRLIAIDKNEQRRVEIQKRKLLLSQINELVSPQVAKRKNLPL
                     IKSASVSGLNDEAKLKLLDIIKGRLPDYHESTLEELKAHISAWEEVERRTEQCITEDG
                     RYDNIETKVELPNHELIKMIKSYTEESSKFEADIKDIFNRDTDRDVVAKILNCQSELE
                     QIENEIWTNEEIYKLEREYIDSRKSQLQASLDKLNCLING"
     gene            complement(<1040517..>1041002)
                     /locus_tag="C5L36_0A04710"
                     /db_xref="GeneID:40381583"
     mRNA            complement(<1040517..>1041002)
                     /locus_tag="C5L36_0A04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463490.1"
                     /db_xref="GeneID:40381583"
     CDS             complement(1040517..1041002)
                     /locus_tag="C5L36_0A04710"
                     /inference="similar to AA sequence:RefSeq:NP_014919.3"
                     /note="PKUD0A04710; similar to Saccharomyces cerevisiae
                     YOR276W (CAF20); ancestral locus Anc_8.729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319350.1"
                     /db_xref="GeneID:40381583"
                     /translation="MATTYTIEELYSFEKNACLPEGVDLQPFLNLVATVTEILRHLDE
                     TFPRRKSFNHSRPQKKKQPKEIVDEDGWTTLVTEKHANEDPVEGTVNSDSAVVEESTE
                     TEPAAANNKKGKPATGKIRINAAKISSGKSSVGDARDTIAITQVSKFNAFDALALDDD
                     E"
     gene            <1041269..>1041790
                     /locus_tag="C5L36_0A04720"
                     /db_xref="GeneID:40381584"
     mRNA            <1041269..>1041790
                     /locus_tag="C5L36_0A04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463491.1"
                     /db_xref="GeneID:40381584"
     CDS             1041269..1041790
                     /locus_tag="C5L36_0A04720"
                     /inference="similar to AA sequence:RefSeq:NP_014895.2"
                     /note="PKUD0A04720; similar to Saccharomyces cerevisiae
                     YOR252W (TMA16); ancestral locus Anc_8.695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319351.1"
                     /db_xref="GeneID:40381584"
                     /translation="MAKSLLKVEKKISKSKKSLHPKGRKAQHLARASLREERVNKKKL
                     IHTMRKSEENLIVDFFQEYVKAAKEEESFDLGTMKSLIESFIDRDHDELEQLRSARRP
                     GRPTTKKQDLLEFRLKQETHVYETGWKVPDLRDAENVQKLRAWGGGHGGLTSIKFILV
                     KKHESETGDVEMS"
     gene            complement(<1041843..>1043195)
                     /locus_tag="C5L36_0A04730"
                     /db_xref="GeneID:40381585"
     mRNA            complement(<1041843..>1043195)
                     /locus_tag="C5L36_0A04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463492.1"
                     /db_xref="GeneID:40381585"
     CDS             complement(1041843..1043195)
                     /locus_tag="C5L36_0A04730"
                     /note="PKUD0A04730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319352.1"
                     /db_xref="GeneID:40381585"
                     /translation="MFKYIRPIRSIRGLHQIKHSSETIGHVLDKFANNPRPSTLEPIK
                     YPIAAATAPPPPGYNILRSKYSSEMDALVKFVQAKGNEIKSHISKSEAMDILEEYISG
                     SSKINKIHSNLTPKQRQLLKIAAAKANKGIRKEDYAIRGIIGLYMKRNWLVWNYTLSN
                     NGIHVAEDTETGYDFSIIDSEEDFGDSNWEEGSENENEREVRKDKEAGVKQKNEAAAA
                     YAGHNDGGYVSMLKRLGKVHRSSIVHVLPQMTMLQAHPTINHAILEEKDIDRLQNFLT
                     SANETSKYREELVFRAKTNYELTKSMMDGENTLIRGDFFYPECIPGTQIHLNDILFRR
                     CIALQDSLRVKDPMFAVMVYQDGSSSVLDNADGVVWDGEIENVFTMFPKLKSPQSFQK
                     NFVRFVSRGWIPVLAREKEIVMVKSKQEYYRQIIKKLAIGGLSIGVTVGTASYYSGFI
                     "
     gene            complement(<1043513..>1045921)
                     /locus_tag="C5L36_0A04740"
                     /db_xref="GeneID:40381586"
     mRNA            complement(<1043513..>1045921)
                     /locus_tag="C5L36_0A04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463493.1"
                     /db_xref="GeneID:40381586"
     CDS             complement(1043513..1045921)
                     /locus_tag="C5L36_0A04740"
                     /inference="similar to AA sequence:RefSeq:NP_010537.3"
                     /note="PKUD0A04740; similar to Saccharomyces cerevisiae
                     YDR251W (PAM1) and YPL032C (SVL3); ancestral locus
                     Anc_8.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319353.1"
                     /db_xref="GeneID:40381586"
                     /translation="MAPYSILSIGCHPNIAFYNWRLNASNSVDLSLVESTDLSDASYQ
                     PNGLPNQTFYSWSSEQFGNERYSLNNVFKTLDDYILHAKNNHLDFIFLSAISLQSLST
                     ICSSLNQIIKYQLDKHNVPTIIVESTNFVNLEPFVKMSLQLNENDAELVPIISIMSDF
                     DVREVGNKNFLLYKSKKESELVYVGKSGRENSYTSIEIGLINKIADLFESAKIDVYKL
                     NTPLEFLSYQWKFALPKITVEPLSIIFENPFPSDLQRQILAKPLISGLIFEIITVIKT
                     MGCKLFNSYDNEDSLLLRLSQLYPPVKLSDDASEAPKLYYDFFNQNQLYLDLLLLQPI
                     LIADDFQVKTPYLEFLYAVMSKYNTNNFSTLDNETSIFWLRKNSENVRQLKLKQDELV
                     LENSLREKKIAQNHQLLSNPSPPSTSASNINNQAIPQNRLSNTPPRAQYQQKTLNRSS
                     TDPQIDPEMEELSDMVQSYGVINQTPNSSSRRQSVGNLQPPFTKSHQQDAPSPNLVPQ
                     QSLPHGLPPQGLPPNQQLFNQLPNQQPQGRKSYYGGPPPQQQQQQMNNYPPMHQHQQY
                     SQQFQPANPYSSRDDVSYMSRTSHMNGPGGMNGMGGMNAMNGMGGMGGMGSMNGMNGM
                     NNFDTSFNSMGSANAVPTMGNRQFKPTSRKSSRKSTAIMANQLVNEYPGMTQSRSNSN
                     MLQLNRMSMNPQGNMRGNASSQNLRQMPSNSNFKKPQGMSQAPSQFGAEASLSPPPMN
                     GSGSDGPSNGSSGSLPKQAPVDLVPVPEATPAPTPAYIPQSKENDEKKKKKRGFLGIG
                     KKKS"
     gene            <1046940..>1047623
                     /locus_tag="C5L36_0A04745"
                     /db_xref="GeneID:40381587"
     mRNA            <1046940..>1047623
                     /locus_tag="C5L36_0A04745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463494.1"
                     /db_xref="GeneID:40381587"
     CDS             1046940..1047623
                     /locus_tag="C5L36_0A04745"
                     /note="PKUD0A04745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319354.1"
                     /db_xref="GeneID:40381587"
                     /translation="MNTTQKYFLLTDTAATLFWTYVLARLVILYPLTGARFLPGGLAD
                     FYLSVLVGTCALELFNYASIFRHVRGTPTIYNALPKPYWVNLLLTNSTRLLLAFVIYN
                     YPKVARTNAFPLLVASQSIKELFRWYYNIEKVRLYNNVSKTAVAIRKITFLIATPLEA
                     SSIFYILFQSLPVESYQDALLPYDTRIKTLLKAILLGYFPAFYALYKRSIYKYFFVHS
                     RETYQKKQK"
     gene            <1048184..>1049836
                     /locus_tag="C5L36_0A04750"
                     /db_xref="GeneID:40381588"
     mRNA            <1048184..>1049836
                     /locus_tag="C5L36_0A04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463495.1"
                     /db_xref="GeneID:40381588"
     CDS             1048184..1049836
                     /locus_tag="C5L36_0A04750"
                     /note="PKUD0A04750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319355.1"
                     /db_xref="GeneID:40381588"
                     /translation="MSNNESLIPKLWKTPNSSPSRSSSQSKRASGSPTSPSRIPILPS
                     YKQRNNGGNMAVYRNRNKNTSVDDHLSLIQSHLSTEVAAERASIAMANKQIDQQLDLK
                     RKHERHLKLLQRELNNVNARLQEYQLGIPIKESELKSETVNVENQIDELESQYELKKM
                     EITKKFIHDEERFVKDLDALVEDAQTEDSQARDMKLAKLELLNEEKKSLMEKIGLAKG
                     AFAEELQSLKEKYKDEEDKQRAKLGNLKETVLSERKKLQKQYDSLKREYDDLKEKDIS
                     TDGEILRCKSNIEATEKSIQELKYRLLDLRTLIDHLQSDLETASSLCTEFENGEFQST
                     KREWEEANDCLQLERYKRLKLEIQIRNVSGIPSILIMESKLNQSFKQSKLREFLKPDN
                     YDWKLEVLTNMENSLNGISQSLIICNESDTKLAEMAQQVQSHLQKTVANNDRFKTSQV
                     SIEIPLLSDLRKTYPQIPDIPTSYAAILLDNHNPITGASRCSLIFMVHISKSIQLSEL
                     PLFTITQTNLCATNVTDSWEPELIRITGIPPVTSRKAYEFLN"
     gene            complement(<1049983..>1051962)
                     /locus_tag="C5L36_0A04760"
                     /db_xref="GeneID:40381589"
     mRNA            complement(<1049983..>1051962)
                     /locus_tag="C5L36_0A04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463496.1"
                     /db_xref="GeneID:40381589"
     CDS             complement(1049983..1051962)
                     /locus_tag="C5L36_0A04760"
                     /inference="similar to AA sequence:RefSeq:NP_012434.1"
                     /note="PKUD0A04760; similar to Saccharomyces cerevisiae
                     YJL101C (GSH1); ancestral locus Anc_1.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319356.1"
                     /db_xref="GeneID:40381589"
                     /translation="MGLLSLGTPLHWNESKKLADHVRENGITQLLNSYRISQPRDNDT
                     FYWGDEIEYMMVSFNEREKSLKLSIDHDFVLDNLSEEGKSFQKSLDNDVLFHPEYGRF
                     MLEATPLRPYNGDHLKDYFYVEENMHIRRKLAIEEIEDPNVYPLTLTSFPLMGVKDFC
                     SPSTIVQGNSSKSLFLPDEIINKHVRFPTLTANIRRRRGQKVAINIPLYKDVNTRSLD
                     ARDPSIPRRSLFPYSDKEAHYNFLHPAAKPGHIYMDSMGFGMGSSCLQVTMQAKNIND
                     ARYLFDSLVNIAPFMLAVTAAAPVFRGHLADQDVRWNVISASVDDRTPFERNEEALPE
                     HPLYGGHEDHLQGKSRMQKIPKSRYDSIDQYLGGSKFFKSEYNDIDVPINQEILNRLI
                     QNGMDEDLSRHFAHLFIRDPLVLFSERIEQDNESSMDHFENIQSTNWQTLRFKVPSQD
                     STPGSNKPGWRVELRPMEISITDFENAAYSVFSILLSRAILHFQLNNYLPISKVEENM
                     KRAHHRDAVNNDLFFIRTNINDSGDATIKELSLNEIFNGSPNFKGFLPIVREYVDIAF
                     PEIDTVSSKKLEMYFNLISGRASGSILTTAKFMREMIVNHRDYRKDSIVPESAAYEFC
                     QFAKKLSVYEPEAVSQFFSTQIAQYLNDNKYHEIF"
     gene            <1052998..>1053714
                     /locus_tag="C5L36_0A04770"
                     /db_xref="GeneID:40381590"
     mRNA            <1052998..>1053714
                     /locus_tag="C5L36_0A04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463497.1"
                     /db_xref="GeneID:40381590"
     CDS             1052998..1053714
                     /locus_tag="C5L36_0A04770"
                     /inference="similar to AA sequence:RefSeq:NP_014499.2"
                     /note="PKUD0A04770; similar to Saccharomyces cerevisiae
                     YOL142W (RRP40); ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319357.1"
                     /db_xref="GeneID:40381590"
                     /translation="MSLETLDLVVPGDSIKLASSNNITLGPNIVVAGDSTLHPTTAGF
                     FVSKNTNKATTLNYVESARGRYVPQVGDLVLGTVVGQFGDYYRISLNENSVDVILNIF
                     SFPNASKKNRPRLQVRELIYARVASTEKNVDVELSCIDPVTGKDGGFGPLNGGYVFNV
                     STAYSRFLLFTPNAPVLKKMVEKLQFEIAVGVNGKVWVKSDTPKSTMLCAEIISESEK
                     WKQSEIPEKFELLLKKFKKL"
     gene            complement(<1053829..>1057212)
                     /locus_tag="C5L36_0A04780"
                     /db_xref="GeneID:40381591"
     mRNA            complement(<1053829..>1057212)
                     /locus_tag="C5L36_0A04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463498.1"
                     /db_xref="GeneID:40381591"
     CDS             complement(1053829..1057212)
                     /locus_tag="C5L36_0A04780"
                     /inference="similar to AA sequence:RefSeq:NP_014074.1"
                     /note="PKUD0A04780; similar to Saccharomyces cerevisiae
                     YNL325C (FIG4); ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319358.1"
                     /db_xref="GeneID:40381591"
                     /translation="MPLSRSTTPLNDQNVSFNDSHSTILQNQVDDARVESNPIIPRPR
                     KFILTKYTIYVTTLRMYIVGSNTRETVFRILEIDLTSTEKLIVMEDNVYFTRNEIMEV
                     LNGIEDSSEGGLVKKLTAVGLLGFIRFTKCYYLLVVKKRREVAVLGSHEIYHIEDTQL
                     ISVTNNPKEVEKSPLETRYIQTFQNIDLNKTFYFSYSYDLTNNLQTNMLRNKRQSLHM
                     NGDTELSYVFEFNERFIWNGALLEPIFQTFDKVYDWFQPIIHGFVDQVKNSVFQIQFY
                     ITLIARRSHRYAGARFFKRGVNDEGDVANEVETEQIVADMLTSSFHDPAAGFYNNPRY
                     TSFVQHRGSIPLQWSQETVPNLRMTKPPIELSVIDPYFSRAALHFNNLFERYGTPIQI
                     LNLIKEREKTPRETKLLDAFNQCVDYLNQFLPENKKLDYTAWDMSRAAKSRSQDVIKW
                     LENYSERSLNTTGFFHNGRTIHDTQLQQGICRTNCVDCLDRTNTAQFVIGKRALGHQL
                     HALGIIEENYLEYDSDVTNVLTEMFHDHGDTIALQYGGSHLVNTLQTYRKINQWSSHS
                     RDMIESIKRFYSNSFVDAQRQDAINLFLGNYVYSPEQPMLWEMNTDYYLHNRRITSEL
                     NGTNSYTHWFNDNFLVDRKQHENEEWERNVPDRTILELQKRGLLVIKVDPYPGCFENY
                     WNIKYGYRNYVSLNELFEFTMNSTRQYSYPNDQKHNYYKQALGENENKKEKTSIGSSN
                     PTRLGIISLFKGRNNCNNGKTSSELPRRSKFGSFSERLRGTSPRLIFDPEYEDDNYFS
                     PFKSRKPHRELRILYATQGQEDAVAGDSLSEDEEDLLLEKYASLRKVYIENDQEKQLM
                     FEECTLLLHSLELLSKTEKYYEIIKKSFDDHYRGMQDKGEEGFISFPVIKSTINEETF
                     SGMLLEKLENNEKEKKLDNISVFKQETNVDESLSVFERDLPDLSKLSGLFRNHCVDLP
                     KVSNENIELYNQSLGINSKIPVVGLEKLASTTMDEDPLPKSKENDVKKNYYRQLIQEY
                     KYLENPFLNMSDSKKYRHQVKLLKETHQSKHARDVSFFNASHYEQNALALNHSNDSTP
                     NLGSNSLSAISDAHDFYHYTSFSRIGNNPLKENVGGLQN"
     gene            <1057626..>1059695
                     /locus_tag="C5L36_0A04790"
                     /db_xref="GeneID:40381592"
     mRNA            <1057626..>1059695
                     /locus_tag="C5L36_0A04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463499.1"
                     /db_xref="GeneID:40381592"
     CDS             1057626..1059695
                     /locus_tag="C5L36_0A04790"
                     /inference="similar to AA sequence:RefSeq:NP_014500.2"
                     /note="PKUD0A04790; similar to Saccharomyces cerevisiae
                     YOL141W (PPM2); ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319359.1"
                     /db_xref="GeneID:40381592"
                     /translation="MKSEVDIYSSVTQKQLEKKNKSKDFPESVKNEKKSKKVVHDLFV
                     QGTNDSSIVSKRSVEILYADKVDENPKHFFQYFVKKSPRRTPVINRGYWIRMKSIRMA
                     IDKIVKQQPHGQRINIINLGCGYDPLPFQLLDDEKNYDVKLFCIDVDFPELIGYKSQM
                     IRMAPELTSLIGEEYDQKTNAPGVTIRTDRYATMGCDLTDKKLYIQQLDSFMANDTAT
                     TNIFVAEVSLAYMTPTTANPIIETSSMFNNSHFLILEQLMPSGENHPFAKRMINHFKK
                     MEAPLQCVHTYPTIEDQISRFKSLGYNEVNARDLLGCWELVPPKLRIRVEQVEAFDEW
                     EEFIFFGQHYINLHATNQRGVEVYPFQYKPLYQNLSVTNSKYYFEIQQEVPHIQRKFH
                     SCFELGEAKFLTSGTNQARLADTVSLMSCVHPVHTPSTFKARVSAASITVNNRAFLIG
                     GRRVPGMGIDEVWEFLQNGERYEWRQRNPMNEGRVKHTVTQYEDGVLVYGGSDGNQFS
                     WYDIKSDEWIALDGHSEFHGLESAKLINCNNDIFLLGGKYHICDSESRFEFNSTVYRV
                     EIDLRCRSFRLESVMKHETLARYGFGVFWTGSQVLLIGGVGKKLYNQNDTIVELDLKK
                     RTVRSVPLDDKTWEQNSIIIGSDVVSVDKQAWLVCGGAVCYGFGSVWGKIMGIGIGAE
                     PTKRLEV"
     gene            complement(<1059928..>1061685)
                     /locus_tag="C5L36_0A04800"
                     /db_xref="GeneID:40381593"
     mRNA            complement(<1059928..>1061685)
                     /locus_tag="C5L36_0A04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463500.1"
                     /db_xref="GeneID:40381593"
     CDS             complement(1059928..1061685)
                     /locus_tag="C5L36_0A04800"
                     /inference="similar to AA sequence:RefSeq:NP_012550.1"
                     /note="PKUD0A04800; similar to Saccharomyces cerevisiae
                     YJR016C (ILV3); ancestral locus Anc_5.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319360.1"
                     /db_xref="GeneID:40381593"
                     /translation="MSILRQRRAFSSAARAAKKFNKYSSIITEPKSNGASQAMLYATG
                     FKDEDFSKAQVGVGSCWWSGNPCNMHLMDLNKACADSVEKAGLKGMRFNTIGISDGIS
                     MGTSGMRYSLQSREIIADSFETIVMGQHYDANIGIPGCDKNMPGVLMAFARHNRPSIM
                     VYGGTILPGSGTCSGVPKQLDVVSAFQSYGQFLSGEFSEEQRSDVIRHACPGPGACGG
                     MYTANTLASASEVLGMSLPFSSSSPAVSELKKQECSNVGLAIKNLIEKDIKPRDIMTR
                     SAFENAIRYTIAVGGSTNAVLHLIAIAHSANIKLTIDDFQKLSDETPLLGDFKPSGKH
                     VMADLGKVGGTPAIMKFLLKEGFLDGSTLTATGKTMKENLDELPGLSENQDIMRPVSN
                     PIKATGHLQILKGSLAPEGSVAKITGKEGTRFEGKAKCYDREEDFITALEKGEIKKGE
                     KTVVVIRYQGPKGGPGMPEMLKPSSALMGYGLGKDCALLTDGRFSGGSHGFLIGHIVP
                     EAFEGGPIGLVRDGDKIVIDADKNAIDVLVSEEELAERRRQWKRPELKYKRGTLYKYV
                     QLVSDASKGCVLDYDNNDK"
     gene            complement(<1061925..>1063889)
                     /locus_tag="C5L36_0A04810"
                     /db_xref="GeneID:40381594"
     mRNA            complement(<1061925..>1063889)
                     /locus_tag="C5L36_0A04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463501.1"
                     /db_xref="GeneID:40381594"
     CDS             complement(1061925..1063889)
                     /locus_tag="C5L36_0A04810"
                     /note="PKUD0A04810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319361.1"
                     /db_xref="GeneID:40381594"
                     /translation="MAILNTRRLIRYVVFVSLIALAYHFWPVSQIEKWSGEITAEEKN
                     EYIDSILNPKQNSIYEGNNNLKAEFNPDSGDFDQPDVIDIKKVNKALNKMNMKPINED
                     SQLSDSSKVENEKIDILTNKLMDREYTPSSNLVGFLGTQFLKTNQDYYADLTCKDTTY
                     NPTSDDRKIVYSEPLSLDDDLIEVRKWLLNSRYANLVKAVDPRANDGTFLSDISHWYK
                     KSGSSTWLPDEQLHMVVSTIVYAPNDREEPLVSFLRLQLFNNNWEEVKGRRIRYTQLS
                     EKEIDSAIKEYAKSNEERHLERISLRFPSILNIPISGKPGRGTLGPNDPKILYKEGEY
                     DSEPVIVFNMMTADGKRNMFAVSPFRAPKGPELEHPILKFKNVGSSISKKLSVDKNWV
                     PFFDGINIGDSKSSRGYIHFAYTLDPLVIVKCSLDSGKCIKVQDNVKFSANAKNEEAF
                     IRGGTPFYPVPRQVIQALNDVEHKRLQMWVGFPNVLIKENACHNDIYRPVFSLLVKED
                     GIYRVELLTGPLDLGISAADVCSNNGNAPSSVIVAQGISFWDVASTGVQENENSLPYY
                     KDHMGIIIGEGNNKIEMFVLKNVLNYALGVYTFGTYLFGNYDIEGPNGVAVRTQKVCE
                     CALKNALLYGESVGPGNGANYRDPTVEVWN"
     gene            <1064388..>1065479
                     /locus_tag="C5L36_0A04820"
                     /db_xref="GeneID:40381595"
     mRNA            <1064388..>1065479
                     /locus_tag="C5L36_0A04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463502.1"
                     /db_xref="GeneID:40381595"
     CDS             1064388..1065479
                     /locus_tag="C5L36_0A04820"
                     /note="PKUD0A04820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319362.1"
                     /db_xref="GeneID:40381595"
                     /translation="MSQKSTLSEASFSPRETATAPLEDDVMAANTANPYFTKPYYPAT
                     IGNPLGVSIPVTRSSCLPRNKKVLVANKNVENNAVAVEKPSRKCYISEMKDVVSGDVQ
                     HVKDMTHKRILQKDTRKAGPQTRHNVGRGSDLEKVFDPLPNVPPPSLAGANNTNSSRV
                     NVPISTDIIDSLQSSNQPSPIAPQLIRSGVHYITSEERAQRDRQVVHALNVISQSMEP
                     AVRTVDAVREHILKCCHPEEGAKPTKVQELVSFLLGIPFAVVRCLWNFVALQAYLIFN
                     LTLIFGLFLGFPIHLGLFIIGMFLFWLKIIYDVIQDIMHRDDPLYQSNLSADATVGTL
                     LSASVAIYYTYSEQRQKTFGVVWANDNPK"
     gene            <1065551..>1066681
                     /locus_tag="C5L36_0A04830"
                     /db_xref="GeneID:40381596"
     mRNA            <1065551..>1066681
                     /locus_tag="C5L36_0A04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463503.1"
                     /db_xref="GeneID:40381596"
     CDS             1065551..1066681
                     /locus_tag="C5L36_0A04830"
                     /inference="similar to AA sequence:RefSeq:NP_010009.1"
                     /note="PKUD0A04830; similar to Saccharomyces cerevisiae
                     YCR086W (CSM1); ancestral locus Anc_6.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319363.1"
                     /db_xref="GeneID:40381596"
                     /translation="MFFFPDIKHQRFRIYVFFFFVFKSDISKLTNMSTDGKEKNGDIE
                     GENSPVEHSTPAVRKESLFDETNSAEEVDFPKDLPGSQSITQTANSYRETDSDSYSDT
                     SDNDDLEEEDSEVEDENDNDNAYRDVKTNSSKTEHPFRDTAEATEKNHCPTDEDIPGY
                     KQIVSLFRKKQLNGMSKILKSIDQQLPRDFREYKHAVAAREKRAERLISRLIKENLEL
                     KRKIGTYKKGGRKIINDSIPDNSYPVQHTRLSNPNIFSTIISSTTEADYERCSTIISM
                     LELLTGVRCLVLKETANDIQFTLEQRGESKFHYYQLLIEKSGNSDITYIPIWSKPDHF
                     SGDWDENVNAVKKSLRSYLQSEFKFPPNAILKFQNELSVYLN"
     gene            complement(<1066730..>1067194)
                     /locus_tag="C5L36_0A04840"
                     /db_xref="GeneID:40381597"
     mRNA            complement(<1066730..>1067194)
                     /locus_tag="C5L36_0A04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463504.1"
                     /db_xref="GeneID:40381597"
     CDS             complement(1066730..1067194)
                     /locus_tag="C5L36_0A04840"
                     /inference="similar to AA sequence:RefSeq:NP_010011.1"
                     /note="PKUD0A04840; similar to Saccharomyces cerevisiae
                     YCR087C-A; ancestral locus Anc_6.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319364.1"
                     /db_xref="GeneID:40381597"
                     /translation="MVSFSCEVCNDTVIKKRLPQHQRSCRGAYFTCIDCNTTFQGNDH
                     NYHTSCITEAEKYEGALYKGKKTKKQQHPQFQYKKPVKNEKPKEEPKKEDKKEEEEEE
                     KIDLSKYTKHTTSLYKVFKAAKKNHKSIADKTEFLKSIKVSLNKDGSYNLSL"
     gene            complement(<1067395..>1067754)
                     /locus_tag="C5L36_0A04850"
                     /db_xref="GeneID:40381598"
     mRNA            complement(<1067395..>1067754)
                     /locus_tag="C5L36_0A04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463505.1"
                     /db_xref="GeneID:40381598"
     CDS             complement(1067395..1067754)
                     /locus_tag="C5L36_0A04850"
                     /inference="similar to AA sequence:RefSeq:NP_012531.1"
                     /note="PKUD0A04850; similar to Saccharomyces cerevisiae
                     YJL003W (COX16); ancestral locus Anc_5.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319365.1"
                     /db_xref="GeneID:40381598"
                     /translation="MFDSKTFMGKREREAYEKSFVGRYQKLVKKNSFLYFGLPMMLSI
                     ALGSVLLSNFTALRYERRDEKVKEMNEEDALSMINNRRKVDIKDEYYKLQGLLEEHED
                     WEPKRVERLPGESENKW"
     gene            complement(<1068021..>1070681)
                     /locus_tag="C5L36_0A04860"
                     /db_xref="GeneID:40381599"
     mRNA            complement(<1068021..>1070681)
                     /locus_tag="C5L36_0A04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463506.1"
                     /db_xref="GeneID:40381599"
     CDS             complement(1068021..1070681)
                     /locus_tag="C5L36_0A04860"
                     /inference="similar to AA sequence:RefSeq:NP_015199.1"
                     /note="PKUD0A04860; similar to Saccharomyces cerevisiae
                     YPL126W (NAN1); ancestral locus Anc_8.626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319366.1"
                     /db_xref="GeneID:40381599"
                     /translation="MPDEYNVSLTSGGQLIPHLNRLSTDGHYSITFFNNHITIYFIQS
                     RLAIRTFHEIPGLTFSNIVDTCISPINNNLIYVATHSKVFIINWYDNVKIPLVSTISL
                     SLSLSEKMFDIVKIINFQEKSETVVNLLLKAKKQYAIVSYDLDKNEILRTYKVYENIQ
                     QYAVSSNLKNLAFSNSSGAVQVFTFDDENTAELTSFQTTYNTSGSQIVKIAVSTDQTD
                     PLLAIGTSHGPVILLFDLLSSKPTQRTLKWHIEPVKALTFNHDQSYLLTGGSEKVLVY
                     WNIITEKQQFLPRLNGVIEDIQINYSVPSLVGLSLNVIDNDFQYIVLGTTDLLSKLDI
                     NTPHIYSGLNKNNQLFKNIQRDVSSFNKSKQFTKIKHDYKLGFRIHPSSNHLYLPAGR
                     HLQIYDYLHNTQIDNLAVAPAIQQYGKVGIENKISDPMVVGFEFIKCAKTNSKDWLVT
                     CDVEIRGEAEDITNPSIERWETLRFWRNSGGNQQNDKLAVSDSWSLQTKMLRPHDEFQ
                     ITSINPAPDAYFGGEALLTADVCGNVKLWRPNSQGIWSLRKFYSSGSEFNNSTAPSKK
                     AENATNIINSEGTLCSWSSDGSMIAVGRNGKVILLDVNTFEPIHTIEPAIHASRFHTH
                     ASIDGKSEEKVTISKPKDAQKRYIDMHLQDNHLQSIDFTSNGKLLVIQARTHLCVVDI
                     LKNRVIFGLLLSGEGGKSGYGGSFVRLVPRSKRDINDEDSTDLEENTTDELMVVGKYM
                     NSKGSVKSKVTLWNISDKKSTIDCKWCYNSSEPIVGAEWSPAWGKWIIIDIKSNIGEI
                     GFGTSTRNELLVKSSKEQEENWIVSSLLDNARTINRATTISVSSRKNSDGDGAFNDRV
                     GLHSTAFDGILDNLEGVSVSTLFERVLKVV"
     gene            <1070962..>1071198
                     /locus_tag="C5L36_0A04870"
                     /db_xref="GeneID:40381600"
     mRNA            <1070962..>1071198
                     /locus_tag="C5L36_0A04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463507.1"
                     /db_xref="GeneID:40381600"
     CDS             1070962..1071198
                     /locus_tag="C5L36_0A04870"
                     /inference="similar to AA sequence:RefSeq:NP_014853.3"
                     /note="PKUD0A04870; similar to Saccharomyces cerevisiae
                     YOR210W (RPB10); ancestral locus Anc_8.627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319367.1"
                     /db_xref="GeneID:40381600"
                     /translation="MIIPVRCFSCGKVVGDKWETYLSYLEDDHMSEGDALDRLKLKRY
                     CCRRMVLTHVDLIEKFLKYNPLEKKEIVDEERAY"
     gene            <1071690..>1072211
                     /locus_tag="C5L36_0A04880"
                     /db_xref="GeneID:40381601"
     mRNA            <1071690..>1072211
                     /locus_tag="C5L36_0A04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463508.1"
                     /db_xref="GeneID:40381601"
     CDS             1071690..1072211
                     /locus_tag="C5L36_0A04880"
                     /inference="similar to AA sequence:RefSeq:NP_012546.3"
                     /note="PKUD0A04880; similar to Saccharomyces cerevisiae
                     YJR012C; ancestral locus Anc_5.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319368.1"
                     /db_xref="GeneID:40381601"
                     /translation="MESVFRQFHNYDFTKSASFQSTLEQVYQQYLIVLSDKDLEVKQD
                     ISNGVFNPERIPEADRLQLQLQTKIFVFCSETDHILELGEYEQWLQKTEMPDTNIEKQ
                     VEDSQMEDMQDPNIVEGDDQSEYTSNYQAVVDMIVHNKPIPGIKQIPSTVLDPAEASE
                     STLQQRKKPWETK"
     gene            <1072392..>1073858
                     /locus_tag="C5L36_0A04890"
                     /db_xref="GeneID:40381602"
     mRNA            <1072392..>1073858
                     /locus_tag="C5L36_0A04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463509.1"
                     /db_xref="GeneID:40381602"
     CDS             1072392..1073858
                     /locus_tag="C5L36_0A04890"
                     /note="PKUD0A04890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319369.1"
                     /db_xref="GeneID:40381602"
                     /translation="MDAFKESVYGLLGEEEEEGLFGKDTFVLSPEDLEILNNDVQRQI
                     LDEEEDLFDDSHEEEKIQKSTGEQHKLKLGGSREDPEEVKGSKRFKSVDPDAEYDQTH
                     FLYDPPTKYKNRFILFLTPLLVVALLSWYVYDKFNDQPISPMMSHKLYVLEQDVSSLK
                     HLTMLKDRVTNLEKQLSELRESFQSYNTLVPKNHCLSNEKIESIHTTQDQYPASIQAV
                     APLPIGSSSSLASPLHPSLSLLQQPHSLKYYNVIPKCQLHRYLTTFPPLPRRRKSVLS
                     RIIHGFPDFLKRSINPPSTNTIDGIKLLSSTNNPRNVLSESAAFWQNPMSEPIYFTIT
                     IPDPIHVHEVGIYHSRQPPIATKSRWFKAAPQNVELLIRPVPSDYENVLSIFSHLNQD
                     IKLNLKIKNEKDAKGWIRAGSMKYDIHQNRAYQPFVWSTETRDALSGFYIQNIMFVIY
                     TNWGDEMLALDTVRVYEAVERDSDSGVDDSEVPYLGEM"
     gene            <1074009..>1075283
                     /locus_tag="C5L36_0A04900"
                     /db_xref="GeneID:40381603"
     mRNA            <1074009..>1075283
                     /locus_tag="C5L36_0A04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463510.1"
                     /db_xref="GeneID:40381603"
     CDS             1074009..1075283
                     /locus_tag="C5L36_0A04900"
                     /inference="similar to AA sequence:RefSeq:NP_014852.1"
                     /note="PKUD0A04900; similar to Saccharomyces cerevisiae
                     YOR209C (NPT1); ancestral locus Anc_8.625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319370.1"
                     /db_xref="GeneID:40381603"
                     /translation="MKFEPVITSFLDTDLYKLTMQAAIHRNHPGVSCKFLLTNRTPDK
                     KLNREGYEWLCLQIASLGELKFTEEEIEYLKGKLGYLGSDHFQWLRTVKLRPDTEVTI
                     VPEVTDGMYDLTITAYGDWETVTLYEIPILSLLSEAYFRYVDTKWTINGELVAEYVNG
                     IAKTENLNIVYAQAAHKTKSLSESNCKFSEFGTRRRRSFQVQDAVMRGIVSVPNSTCV
                     GTSNVLFAMRYGLEPVGTIGHEWMMGIGAITGDYTHANKKAMEEYVNTVGHQHAGLAL
                     TDTYGTPNYLKQFDEPYVGWYVGVRQDSGNPEEYASTIADWYREKGYNDKVICFSDSL
                     NVEKCKHLKKVCNEIGIGCIFGIGTNLTNDFDTKPLNIVMKLVECGEGHAIKISDNIA
                     KNMGDERTVFRVKKELGYIEKEWDEGDESNRW"
     gene            complement(<1075608..>1077179)
                     /locus_tag="C5L36_0A04910"
                     /db_xref="GeneID:40381604"
     mRNA            complement(<1075608..>1077179)
                     /locus_tag="C5L36_0A04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463511.1"
                     /db_xref="GeneID:40381604"
     CDS             complement(1075608..1077179)
                     /locus_tag="C5L36_0A04910"
                     /inference="similar to AA sequence:RefSeq:NP_014245.1"
                     /note="PKUD0A04910; similar to Saccharomyces cerevisiae
                     YNL154C (YCK2) and YHR135C (YCK1); ancestral locus
                     Anc_2.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319371.1"
                     /db_xref="GeneID:40381604"
                     /translation="MSRHQQSPAVAAAAIAASNNMSTLNYQSNTNVSNVPQYSQNQSS
                     IPPHQSQNPSSNQLQTQGGQGGGVNSSNSSSQVVGLHYKIGKKIGEGSFGVIFEGTNL
                     INGIPVAIKFEPRKAEAPQLRDEYRTYKHLSGCKGIPNAYYFGQEGLHNILVIDLLGP
                     SLEDLFDWCGRKFSVKTVVQVAVQMITLIERVHQNDLIYRDIKPDNFLIGRQGLPDEN
                     SVHLVDFGMAKQYRDPRTKQHIPYREKKSLSGTARYMSVNTHLGREQSRRDDLEALGH
                     VFFYFLKGQLPWQGLKAPTNKQKYEKIGEKKRTTPINELCNGLPIQFGRYLESVRNLQ
                     FDAEPDYEHYRQLLLSVLPEIGQVADGHYDWMDLNGGRGWDLAINKKPNLHGYGHPNP
                     PGEKRKRANKHIQNQQLQQQLHQQQHQQQLQHQQQYQQQQSQSHQQQYSSQQIPHQNS
                     ATQPISSPLSQQKQNPQPLLQEQHTPNLSSLGGEDAKPLPNLPNHQYSKDHAKNSPQK
                     DDESDKGCFAKVMCC"
     gene            <1077639..>1079417
                     /locus_tag="C5L36_0A04920"
                     /db_xref="GeneID:40381605"
     mRNA            <1077639..>1079417
                     /locus_tag="C5L36_0A04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463512.1"
                     /db_xref="GeneID:40381605"
     CDS             1077639..1079417
                     /locus_tag="C5L36_0A04920"
                     /note="PKUD0A04920; Pfam Domains:
                     Fungal_trans(3.1e-14)|Zn_clus(5.5e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319372.1"
                     /db_xref="GeneID:40381605"
                     /translation="MVMKTIACVACKRRKVRCDSSKQVPCSNCVRYGKHCIASDDRRS
                     LRPTYQELETLRERVKQLERHVQELNSDVLIQREEVMQEASPVYPKPRSFQSLYRHKV
                     NIYGPPSIFDEDGEDGEREGENLDDEEGGDGAENNMKKRKMDMYKNERLGYLGENVDT
                     ISDCSSERSISKRNNLSKIVLVSPVNKLNKDPKVIQFVKTFFQWFYPDLHMFIPRETF
                     LVEFYHPRREQVYCNIALVYAICAIAGGGDGYYEVARKQMEKPSSAVIGIQGNILLGL
                     YELRKGDRRKAWLSVGLGLRIGLESGFHLKLERANKLMVLFRSRIYWGCFIIDHLMSF
                     LLGRPPMLRIEESSIEESEKVPDLEWIKEFNFAGKGILDVSATLRAIVSLIIIVDEWI
                     LGRCEDVELINGHLQRWRNELSEEMQWDEGKLKSKAYHPPDVVHIMYYYMVFIGINRL
                     YGEGEFLDNAINEGVLVIQTHIEAHGIMRCTLLMHCLARTILKVRPGHSLCVGILEER
                     VPNTGADHDAGVNALSSIGVGRGGGDDDAQNAVYNVTQNGNYNMQTGDTHTNHFLDME
                     LDLSDTADSDMNMILDIERWFTLLPE"
     gene            <1079883..>1080650
                     /locus_tag="C5L36_0A04930"
                     /db_xref="GeneID:40381606"
     mRNA            <1079883..>1080650
                     /locus_tag="C5L36_0A04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463513.1"
                     /db_xref="GeneID:40381606"
     CDS             1079883..1080650
                     /locus_tag="C5L36_0A04930"
                     /inference="similar to AA sequence:RefSeq:NP_014362.3"
                     /note="PKUD0A04930; similar to Saccharomyces cerevisiae
                     YNL036W (NCE103); ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319373.1"
                     /db_xref="GeneID:40381606"
                     /translation="MSAPSTATQNLKNLKAAAPQSVVGADHAPHVNPNYPFTLSKNSS
                     LGDYLQANRLNTEKLNKSHPEILPLSGQGQQPHTLWIGCSDSRINECQALGCLPGEIF
                     TLRNIANVISSTDISSMSALQFAIEVLKVKKIIVCGHTDCGGVWASLSNKKAGGVLDT
                     WLSAVRHVRAQHLDELREIEDINDKCRRLVELNILNSINTIKKNPSFVEYHARGDIEL
                     YALIYDVKTGYLNEIPLEDDTYAEVFHLHDNDGEPVH"
     gene            complement(<1080770..>1081822)
                     /locus_tag="C5L36_0A04940"
                     /db_xref="GeneID:40381607"
     mRNA            complement(<1080770..>1081822)
                     /locus_tag="C5L36_0A04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463514.1"
                     /db_xref="GeneID:40381607"
     CDS             complement(1080770..1081822)
                     /locus_tag="C5L36_0A04940"
                     /inference="similar to AA sequence:RefSeq:NP_012418.1"
                     /note="PKUD0A04940; similar to Saccharomyces cerevisiae
                     YJL117W (PHO86); ancestral locus Anc_1.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319374.1"
                     /db_xref="GeneID:40381607"
                     /translation="MQNRGIYPERPPTLAEALYSGKKFNKPENGDEILERLGLPPTSS
                     VPQKKEEAPRRNLKKEPKKEPKKEKKTEIKQVVKQVDAHLDAPLPDTSESKIHAQFIK
                     PEECEAVLNLQMDYILKRKSDMIKFIFRSRFFMSLFFLLLSAVSYNRIGEYFNPYTMK
                     DPFSLLKNGYFLDDLFILFFQVLLFIAISFTWLRIVSAPLEKESKKVAENAEQYFGCD
                     IKQYASVKNVNKPRKEDRDLVKQVKENTYCINYRDVPVAFLATTPGKEVKIVGFAVRR
                     VYIKAELLKDLLGMMFKSGVRKAEVELFNFEEFDIGIFRKIGFTRTKREKFSKWWILT
                     GVTRDTYSFDMDDIEF"
     gene            complement(<1084813..>1085448)
                     /locus_tag="C5L36_0A04950"
                     /db_xref="GeneID:40381608"
     mRNA            complement(<1084813..>1085448)
                     /locus_tag="C5L36_0A04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463515.1"
                     /db_xref="GeneID:40381608"
     CDS             complement(1084813..1085448)
                     /locus_tag="C5L36_0A04950"
                     /inference="similar to AA sequence:RefSeq:NP_014455.1"
                     /note="PKUD0A04950; similar to Saccharomyces cerevisiae
                     YNR057C (BIO4)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319375.1"
                     /db_xref="GeneID:40381608"
                     /translation="MKMQPIFITGTDTDVGKTFISALLVKRWGADYWKPVQTGLNEDI
                     GDTATVTQMLQASGGIPSNTIIFDPALKYQNPLSPWRCTILENKEEIDITKLNLPPTT
                     NTIIVEGAGGVLVPFTKDKFTTDVIHHLNTPVILVARSKLGTLNHTLLSLEVMKARGN
                     NVVGVILNGEIDDDNLKALEALGARIIAQIPHTSKIEDVLHLIPPLEEVLQ"
     gene            <1085827..>1087152
                     /locus_tag="C5L36_0A04960"
                     /db_xref="GeneID:40381609"
     mRNA            <1085827..>1087152
                     /locus_tag="C5L36_0A04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463516.1"
                     /db_xref="GeneID:40381609"
     CDS             1085827..1087152
                     /locus_tag="C5L36_0A04960"
                     /inference="similar to AA sequence:RefSeq:NP_014456.1"
                     /note="PKUD0A04960; similar to Saccharomyces cerevisiae
                     YNR058W (BIO3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319376.1"
                     /db_xref="GeneID:40381609"
                     /translation="MSEIQGLLDFDRDHIWHPYTSTINPLPCFLVESAKGARIKLATG
                     EDLIDGMSSWWAAVHGYNHPELNQAAINQLKDMSHIMFGGLTHRPAIKLVKQLLEMTH
                     ENLQHCFIADTGSVAVEVSLKMALQYCQSKYGNKNKKTKFLSVNYGYHGDTFGAMSVC
                     DPVNSMHSLYSGYVKENMFVKLPQCKPTDKWDPKYMNEFEEMVKTHSDEIIAVILEPI
                     VQGAGGMRIYHPEFLRNIRLLCDKYGILLILDEIATGFGRTGKLFAYEHADIVPDILC
                     VGKALTGGYLTLSAVLCTKDVATTVCSGKAKGFMHGPTFMGNPLACAIASKSLEIIQR
                     NEWKSQVKSIEEIFNQKLDKAQDISIIKDTRVIGAIAVFELSIPVDMKWFREKFLEKG
                     IWVRPFGKLVYLMPPFIISEKELNHLVDSVIEIIIEFDNLQKEQQNINL"
     gene            complement(<1087305..>1088381)
                     /locus_tag="C5L36_0A04970"
                     /db_xref="GeneID:40381610"
     mRNA            complement(<1087305..>1088381)
                     /locus_tag="C5L36_0A04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463517.1"
                     /db_xref="GeneID:40381610"
     CDS             complement(1087305..1088381)
                     /locus_tag="C5L36_0A04970"
                     /inference="similar to AA sequence:RefSeq:NP_012688.1"
                     /note="PKUD0A04970; similar to Saccharomyces cerevisiae
                     YJR154W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319377.1"
                     /db_xref="GeneID:40381610"
                     /translation="MSFNYEDCTTKTLDRLTLLSRITDVDRGDPSMPCLSETRFIKLT
                     LPEPQPVPKVDQNDFTINKQEATPEKVLDIMKTFGVCKVKQLFTVEEIDQINKELDPF
                     FQAKKDDPRLFPRETVKITETISKSPQVVHKIMSHPLNLGVTHLALDQANVFWIGENL
                     NIGFSPATVASSIGFEIHPGAAGQPLHRDDQSEHNIRRPQTPQTFDYRNETQIGFSVA
                     LSDTTIENGATRFIPGSHLWDHLQKPNQEDCIQNTMKKGDATFMLASVVHSAAPNITE
                     NEVRRILIMFMGRGNSKSKENNYINCDFNYLKQFSVEQLTRMGFRMSEPYGNMLELQD
                     PLTFIKDDYRRRANYSEVCKVLYD"
     gene            <1089149..>1090486
                     /locus_tag="C5L36_0A04980"
                     /db_xref="GeneID:40381611"
     mRNA            <1089149..>1090486
                     /locus_tag="C5L36_0A04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463518.1"
                     /db_xref="GeneID:40381611"
     CDS             1089149..1090486
                     /locus_tag="C5L36_0A04980"
                     /inference="similar to AA sequence:RefSeq:NP_010477.3"
                     /note="PKUD0A04980; similar to Saccharomyces cerevisiae
                     YDR191W (HST4); ancestral locus Anc_8.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319378.1"
                     /db_xref="GeneID:40381611"
                     /translation="MKCASKRSFTEDQKITKKIKRDVLPRVEVKSETDSVEYIKVESE
                     SDEEIKTEEPFPLQPANELLLTLERILSFYKLNNELPHHNVVRKPKLKVRPPQNTVLN
                     IMDLDFSVPLEDQIEMEDLYFLHYALTYSKKTVFITGAGISVNSGIPDFRSANGLFQG
                     LATKTTGSGRNLFDYNLFRDPDSITMFEGMIEKLYNLSKVAEPSPFHKMINDVSKQGR
                     LLRLYTQNIDCLDTQLPDLGTKIPLSFNKQETPKTIQLHGSISLLNCSKCNYISELSK
                     EYFNQGRLIRSCPSCEEMNTVRMVAGKRTQNVGILRPRIVLYNEFHPDGEVIGTITEK
                     DLKSKPDCLIVSGTTLKIPGVRRLVKEMSRAVHSNKGYVIWMNIDEPPQNILDYVDYF
                     DLVIIGDCQVIPGLVKLYDYTKNLQESKKGRSNVSNTSKSKKVVVKTEKANSL"
     gene            complement(<1090604..>1091452)
                     /locus_tag="C5L36_0A04990"
                     /db_xref="GeneID:40381612"
     mRNA            complement(<1090604..>1091452)
                     /locus_tag="C5L36_0A04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463519.1"
                     /db_xref="GeneID:40381612"
     CDS             complement(1090604..1091452)
                     /locus_tag="C5L36_0A04990"
                     /inference="similar to AA sequence:RefSeq:NP_013344.1"
                     /note="PKUD0A04990; similar to Saccharomyces cerevisiae
                     YLR243W; ancestral locus Anc_8.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319379.1"
                     /db_xref="GeneID:40381612"
                     /translation="MSKVGVLTLGPAGAGKTTFCNSIMSYMESIGRTAHLVNLDPAAE
                     PTEFSFSIDIRDLISVSDVQEELGLGPNGALVYCFEFLLDNLDWLDEQIGDYNNDYLI
                     FDCPGQVELYSHVPVVPMLVQHLQQQLGFRLCCTYLLEAPFVVDRGKFFSGALSAMST
                     MIFLELPHINVLSKVDLVKESIAKRELKKFFNPDPALLEEVNDEDKGDYVTGNQKYRK
                     LNKAIAQLVDDFGMVQFLPLDCSDKDSNKSVELIVSHIDDITQWNEGQEPKEPKDEIE
                     IPEDDD"
     gene            complement(<1091784..>1094366)
                     /locus_tag="C5L36_0A05000"
                     /db_xref="GeneID:40381613"
     mRNA            complement(<1091784..>1094366)
                     /locus_tag="C5L36_0A05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463520.1"
                     /db_xref="GeneID:40381613"
     CDS             complement(1091784..1094366)
                     /locus_tag="C5L36_0A05000"
                     /inference="similar to AA sequence:RefSeq:NP_012976.1"
                     /note="PKUD0A05000; similar to Saccharomyces cerevisiae
                     YKR050W (TRK2) and YJL129C (TRK1); ancestral locus
                     Anc_1.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319380.1"
                     /db_xref="GeneID:40381613"
                     /translation="MRRSIYKLEGKLFPVTKRIVPNFIIAHYLYIVLLIILGSVVVYG
                     QKNMSFVDCLFTIASASTQGGLATQQVNDMELYQQITIYFCCFFTSTIFVHGSLTLVR
                     LYWYEKIFDNIKETSMMQYKKRRSKTIANMRSEAHARSQTFANKQYRDSHNASEGLTT
                     RIKRHHDSTNTSAKLSNEKGNVVNLCGDNTVSISPQFPNIKFGDLPKPVKNDLQQSNY
                     ESMTSSVQQDLRRSKGNTTHKRKPMHYKMHKKLIKNKKRNQEKMALPHLNTSTNDFEM
                     VELKQFLNESTMNQGTANFERSFSSPIQIRSGVPNDYFLYSTGSLKPFLRLKKIPKSN
                     TLDYQLPSTTETKKDHFSENYGFKFLKRDLSKVFCKTETGANLEGLSDEEFIINYTFD
                     VPSNYLSWTPTIGRNSNFIALTRKQKIELGGVEYQATMLLSKIIFVYYFGLNVLGSIM
                     MVAYVTSKKEYANVIKADGVAPAWWGLFTSMSSLCNLGLTLNASNLMIVAQNAYVQII
                     SAILILCGNTAFPICLRIIIWTMKKFTRPLTLFHDSLCFLLDHPRRCFTLLFPASATW
                     WLAVVLITLNLADWMVFIVLDFDRSTLNYLPRGYQILCGLFQSISTRTAGFNVVNLAT
                     LNPAIQLGYMVMMYISVLPLAISIRETNVYEEQSLGIYHDQKVHPSEANTTWKYVAEH
                     LRKQLSFDLWFLFIAIFIICICEAGKIQSDPNFGIFQIMFEVVSAYGTVGLSLGYPNT
                     NTSLSGKFSRISKLVIVATLIRGRHRGLPDKIDRAILLSDDKINALDDLESYRYTAGN
                     DTTHLSHTANLRSDVISERELTPEKADFSHKQLTGQITHLLSKTVDYVLTISNIKYFT
                     THQP"
     gene            complement(<1095070..>1095900)
                     /locus_tag="C5L36_0A05010"
                     /db_xref="GeneID:40381614"
     mRNA            complement(<1095070..>1095900)
                     /locus_tag="C5L36_0A05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463521.1"
                     /db_xref="GeneID:40381614"
     CDS             complement(1095070..1095900)
                     /locus_tag="C5L36_0A05010"
                     /inference="similar to AA sequence:RefSeq:NP_012650.1"
                     /note="PKUD0A05010; similar to Saccharomyces cerevisiae
                     YJR116W (TDA4); ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319381.1"
                     /db_xref="GeneID:40381614"
                     /translation="MAWYIESDPFLALRPFPENPSNGLVEHWHEIAFFTIFFHLIMKV
                     APVINSQWFGKFYDDLSKTDKKAKLNYDIRIVGLVFSIMSVLFCIPMFMHPDFHGNPI
                     QGEYPFASFVTSVAVGYFIWDLFYCCIVHYDLFGFEFLFHAFGALLVFGTTYIPFCQP
                     FLCSFLVFEASTPFVQLHWMFTRAPKGMFSPTAITINGVFLISTFFFSRILWGVYATY
                     KSFVLCWPLRNEYPSLLIPTVYLLNGGFQFLNFMWFSKMFKLAKRMVSPPPPQSKKVN
                     "
     gene            complement(<1096216..>1098039)
                     /locus_tag="C5L36_0A05020"
                     /db_xref="GeneID:40381615"
     mRNA            complement(<1096216..>1098039)
                     /locus_tag="C5L36_0A05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463522.1"
                     /db_xref="GeneID:40381615"
     CDS             complement(1096216..1098039)
                     /locus_tag="C5L36_0A05020"
                     /inference="similar to AA sequence:RefSeq:NP_116602.1"
                     /note="PKUD0A05020; similar to Saccharomyces cerevisiae
                     YFL053W (DAK2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319382.1"
                     /db_xref="GeneID:40381615"
                     /translation="MSQEKHWNYTKDIVRTSISGVCAANPYLKYIESERVVYNSHSPE
                     NGEEKVTVVSGGGSGHEPLHLGFVGDALLDVAVAGSIFASPSVKQVLSGIHSKPSKKG
                     TVVVVKNYTGDILHFGLAIERARSQGINAGLLIVQDDVSVGKTKNGKVGRRGLAGTAL
                     VHKLVGAKSFVDGCKASLDDVMDLGQRVIDNMVTIGASLDRVVIPTVHGEEKQDDSDD
                     EDEKIDELGKDEIEIGMGIHNEHGIKRVSPIPTVDQLAETLLAYLLDPNDKERYYVDF
                     DKDDDVVLLINNLGSTSVLELYAIQAIVNEKLFSIYNIKPVRIYTGTFVTSLDGPGIS
                     ITLLNVTKAGGDEILRLLDLPTNAPGWNSAIQSSDWKTLGEQLVKEAPEIHYATSSIK
                     LDPELVKKILLKGCEEVKKVEPKVTLYDTVAGDGDCGETLLAGADSITNSLRDNSIDL
                     TDAVRFFEELGDVVESAMGGTSGGLYSIFISSMSSFLKQQEKSRGAFTVSEEDFADTL
                     EAGLKGLQRYTRARVGDRTLMDALIPFVETFKSTGDINKAAQAAHDGAESTRKLAAKF
                     GRASYVAEEEFRRFDSEGGLPDPGAIGLAALINGFVSAYQS"
     gene            <1098839..>1100092
                     /locus_tag="C5L36_0A05030"
                     /db_xref="GeneID:40381616"
     mRNA            <1098839..>1100092
                     /locus_tag="C5L36_0A05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463523.1"
                     /db_xref="GeneID:40381616"
     CDS             1098839..1100092
                     /locus_tag="C5L36_0A05030"
                     /note="PKUD0A05030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319383.1"
                     /db_xref="GeneID:40381616"
                     /translation="MVMNNIRFSQDIARVAVSREAQWAIYHCDPFDCIYTESKPASIV
                     EQLFSTSLVAVVDNSCAPQQNVLRIVNTSKHTTICELSYESPIIDVSMNRKRLVVVLE
                     DKLLLYDVSCMKLLDKIDIKVGGNYENNRLECRLSQSDSSILAYQQSHPELSISDHLL
                     FQSGNVILLDAIKSRSISIVNCHEASIEKIALSKNGMLLATASTKGTIIRIFSTQTSK
                     KLCEFRRGSLPATITSLSFSTDHRILGASSDTGTVHFFEVPNEVALLGEDDEGAVSES
                     SPKHVQEDLDMRPEFPNSSPLTAEEALEINQLIGESIHRARGSVGKNKSALEKTKQLT
                     SFMWAKSSKYLPQSITTSLTSMLEPKRHFASIHLHPPSSSTIALSDHCCYVATNDGRL
                     LQYALPSPETSSKEPALIRSNSFQV"
     gene            <1100498..>1102477
                     /locus_tag="C5L36_0A05040"
                     /db_xref="GeneID:40381617"
     mRNA            <1100498..>1102477
                     /locus_tag="C5L36_0A05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463524.1"
                     /db_xref="GeneID:40381617"
     CDS             1100498..1102477
                     /locus_tag="C5L36_0A05040"
                     /inference="similar to AA sequence:RefSeq:NP_012226.3"
                     /note="PKUD0A05040; similar to Saccharomyces cerevisiae
                     YIL038C (NOT3); ancestral locus Anc_7.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319384.1"
                     /db_xref="GeneID:40381617"
                     /translation="MKLLHSPREMDKVFKKIIEGLEIFDTLYERHENVTSSSQKEKLE
                     SDLKKEIKKLQRFREQVKNWQAGNEIKDKNSLLEHRRLVEVAMEKYKVVEKGSKTKAY
                     SDQSLAAVDEPKVDNEACEFVRQALETLGQQTESIEAEIERLQPSKKGKRNVQNEEMK
                     KELEELLASHQWHTEKLEIILRLLQNEVLNVDEVMNISEDITYYLDENRAPDFMFDDT
                     IYDDLDLEADQALINDIHLLHEEPSVQPPSSSNSRNDSIPEQGPKSRSSTSNHSGSNS
                     RSNSVQASKPPLVKQSSTSSVGILSSKITNVNNNHDSHENPPVIQSIGTSSNNQATVT
                     TLKPAPVPVTGEIKWSSVVNAVKKKDTSVTPPASKPASMAVPLPTPVNEHMSTMSGSN
                     SVSSPAQTAEAVSIPNSTINSNALNAASVLEALKKQKPKEEVTTNSSTSTTTITSGAN
                     SKNNYTSVSSSAIEKATESLNGNAVTSLSAVHASSSSPTTESVSFGFTKSQKLAAATD
                     GFRFLPPGIQSFILSISKSKDVMTSNYNPFQTINHTPNGTFPSGLKGNSLAEIWNKSK
                     TSSELSSLVSTLNFETLFFGYYYGKSNEERDLTLSALKDKGWKKHKSEVNWYLVESVI
                     SQGEGWCIGDCLVFNVDSWSTTERKNTKIEMIDFI"
     gene            complement(<1102738..>1103970)
                     /locus_tag="C5L36_0A05050"
                     /db_xref="GeneID:40381618"
     mRNA            complement(<1102738..>1103970)
                     /locus_tag="C5L36_0A05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463525.1"
                     /db_xref="GeneID:40381618"
     CDS             complement(1102738..1103970)
                     /locus_tag="C5L36_0A05050"
                     /inference="similar to AA sequence:RefSeq:NP_010598.3"
                     /note="PKUD0A05050; similar to Saccharomyces cerevisiae
                     YDR312W (SSF2) and YHR066W (SSF1); ancestral locus
                     Anc_5.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319385.1"
                     /db_xref="GeneID:40381618"
                     /translation="MVIHLGTALENHVLTQLVRDTRNMMQPHTAIRLRERKANKLKDF
                     VVMAGPLGITYLMIFSQNEKTGSTHLRFSSMPRGPTISFKILEYSLCKDVTRIQRNPK
                     SIGAGAHEFINPPLLVMNGFTNPKDASPDEKLVVTMFQNMFPPISPLETKVGTIRRVL
                     LLNKDKETGEIELRHYVIDTKLVDVSKNVKKLINIKSHLNKKLPNLSQTKDVADIILD
                     PYAQAGFTSDSEVEDDAVVEVNEELDLPKVMTKEVTRDEINDEDEEGEGHSEERHSMK
                     RKKAVKLTEIGPRMKLGLVKIEDGVCGGKVLYHSQFRKSQSEINKMEQRHALRKKEKE
                     ARRKAQAANVAKKNEKKMAKKQRREERRKAGEEVESSDEEKDSSDDEMEDYSDFDVSE
                     DVENGSENNEDKLFDEEE"
     gene            <1104364..>1105773
                     /locus_tag="C5L36_0A05060"
                     /db_xref="GeneID:40381619"
     mRNA            <1104364..>1105773
                     /locus_tag="C5L36_0A05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463526.1"
                     /db_xref="GeneID:40381619"
     CDS             1104364..1105773
                     /locus_tag="C5L36_0A05060"
                     /inference="similar to AA sequence:RefSeq:NP_011932.2"
                     /note="PKUD0A05060; similar to Saccharomyces cerevisiae
                     YHR065C (RRP3); ancestral locus Anc_5.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319386.1"
                     /db_xref="GeneID:40381619"
                     /translation="MSGKVSKAQRKINNKYINDLKKKLAASNKNKEERHVLKPQTDDE
                     SEDELKKEETSTDPTEEEEANLKKSFKDFGLKDDILESIESLNYDKPTPIQAQSLGPA
                     LEGRDIIGIAQTGSGKTAAFAIPILQALWEAQTPYFACVLAPTRELAYQIRETFDALG
                     SNMGLRCCTIVGGMDMMEQARELMRKPHVVVATPGRLMDHLENTKGFSLRALKFLVMD
                     EADRLLELEFGPVLDKILQIIPRKRTTYLFSATLTSKIDKLQRASLNNPVKVAVNNKY
                     STVETLIQTLMVVPDGFKNTYLVHILNEHVGKSIIIFTRTCAHAQNISLLGRILGFSA
                     IPLHGQLTQAQRLGALNKFKSGDKNILVATDVAARGLDIPSVDLVINYDIPTDSKAYI
                     HRVGRTARAGRSGKSISLVTQYDLELILRIEKVINMKLPKETPPKNEILALHDSVDRA
                     SAEAIRQVKQFHSNRKTRR"
     gene            <1105981..>1107825
                     /locus_tag="C5L36_0A05070"
                     /db_xref="GeneID:40381620"
     mRNA            <1105981..>1107825
                     /locus_tag="C5L36_0A05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463527.1"
                     /db_xref="GeneID:40381620"
     CDS             1105981..1107825
                     /locus_tag="C5L36_0A05070"
                     /inference="similar to AA sequence:RefSeq:NP_010529.3"
                     /note="PKUD0A05070; similar to Saccharomyces cerevisiae
                     YDR243C (PRP28); ancestral locus Anc_8.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319387.1"
                     /db_xref="GeneID:40381620"
                     /translation="MFSSSRHLFVVIHLEYLLQQYTKYTHRRMSTHNRPPSLEELLNL
                     KRGWEGKKKSAASLRPKFLTKTERGNHEQGKSFASKATKTPPTKGFQIQSYLEDEHTI
                     KNTGNVNPARQPDEEPKGNHKSKFLFDWDESEDTSSDVQLLVPVKKRIVDELLEIPSK
                     RKKSEVSAYDKMHWTEKPLSKMTDRDWRIMKEDYDIVIKGKSNVILLRNWKEGDFPEA
                     VKKNILSSLNYKDPTPIQRASIPLAISGSDVIGIAETGSGKTLAFLIPTLCYISKLPP
                     VRAFGSPYVLIVVPTRELAQQIEIEYQKFLQNMQFLVASIVGGHTYDENITKLEKGAE
                     ILIGTPGRLLDVLEQKIINLNDCYFLVADEADRTMDMGFEKQLNRIFEQLPPGEKNPF
                     NIGSGERKRTTLMFTATMPPGVEKIISNHMVNPAIVTVGEANNVVERILQDAIQVSDN
                     EEQKMSLLRKILPKYPPPVIIFANYQRTCEQLLEYLSSHQYKCAIIHGNRSQSQREEA
                     IQHMKSGEASVLVATDVAARGIDIPNVSLVINYQMSRSISEYVHRIGRTGRAGKTGTA
                     ITFWNADTDGDILYELKNMIEKSPISYCPKDLMNLDYEITRGMKNIEN"
     gene            complement(<1107872..>1108834)
                     /locus_tag="C5L36_0A05080"
                     /db_xref="GeneID:40381621"
     mRNA            complement(<1107872..>1108834)
                     /locus_tag="C5L36_0A05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463528.1"
                     /db_xref="GeneID:40381621"
     CDS             complement(1107872..1108834)
                     /locus_tag="C5L36_0A05080"
                     /inference="similar to AA sequence:RefSeq:NP_010072.1"
                     /note="PKUD0A05080; similar to Saccharomyces cerevisiae
                     YDL209C (CWC2); ancestral locus Anc_8.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319388.1"
                     /db_xref="GeneID:40381621"
                     /translation="MTDTGPSEVSKNRSPARVQLDPSLVKENSKPDQTGQVFNIWYNK
                     WTGGENNGRRGITHAKHRCNVVLDSGYTRADKHAREGEINRTHYICLYFARGYCCNGK
                     NCDYLHRIPNELDIFSPTVDCFGRERFMDYRDDMSGIGSFGRVNKTLFVSRLSTTTSD
                     MTKRITKAFQEFGELTNVRYIKDKNIAFVTYKLESQAQFAKEAMYCQSLTPGNENETI
                     DIRWANEDQSVGAKRRRIEKEEEMSMEAARKLLQKLKENNSQRKNTTIVTTNEEPGVK
                     DTKPQIDLELKGINIEALQRLKRLRQEQKPSTLYTGYSSSDSES"
     gene            <1108969..>1112814
                     /locus_tag="C5L36_0A05090"
                     /db_xref="GeneID:40381622"
     mRNA            <1108969..>1112814
                     /locus_tag="C5L36_0A05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463529.1"
                     /db_xref="GeneID:40381622"
     CDS             1108969..1112814
                     /locus_tag="C5L36_0A05090"
                     /inference="similar to AA sequence:RefSeq:NP_010413.3"
                     /note="PKUD0A05090; similar to Saccharomyces cerevisiae
                     YDR128W (MTC5); ancestral locus Anc_8.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319389.1"
                     /db_xref="GeneID:40381622"
                     /translation="MNQYVKNDFFASFVQSLKRRSELSYLNLKNMSKTKSPYDSITFG
                     NPLSLRVDSNYLSIMSISPCGRDAVLAGRKGLLVVDLDDPFAAPRWLHHETSWEVADV
                     QWSPHASKPSWIVSTSNQKAMVWNLARPSTNAIEYVLHNHTRAITDIHFHPQNPEMLA
                     TCSVDSFVIAWDLRCPNRPVQQWSDWRSGASQVKWNYKDPNILASSHANNIQIWDIRK
                     GALPMKSIEGHDAKINGLDWSRENKYELISCSNDMSVKFWSFDKEYEKPVYTIRTDFP
                     VAKTRHLPFGNHACGIMPMRGGNNSLYLVNYQGKNGEDKLEPVYTFKGHHEPVKDFVW
                     RSRHSSNSDIDDREFQLVTWSADKDLRLWPITDEIYESVNFKRNQPLPKGEKFVDFEY
                     KSYRPEPPVSTDNKLIIRHKSQRFLGSYNGTVKTAGEFNHLNWISGIKFGQSAFQNTS
                     DDPNSASYGDNSTRPLNLGEEFSNVGHKFPKLRFERISVSTGVLVISLNGPWSSENKD
                     DLIFIRIEFNFPVGYPSPEAIPRFKIEDTYELKSDKKQEILTNLQNISSRLCSHKRFC
                     LETCLRYLLGEKVDVDLELEQALDTYDLNYVSGENDELFSASQNISSNESDGSISDIG
                     YGFEDEDDDDEEEDDDYDDEGENEGESFTAARSKKGTNVHVKKAPFDSTPVSKGCGAI
                     WTASGHLVCFFMSKEQDKEQHLIKFGQQGFSLVRNLKRKPVSSRLQINKQSYNNDERD
                     TDSESSDDSLAEDFNDLQYDRLYRSRVPELLRNVNNSESRHFSSNARSNVVSVVTEKS
                     QHTSNSKNNQNKNLIKIYDFRHLIPAKMELAYEYRILGDEPSLLAQHNALVAEKYGYT
                     TIANCWKMLSVILMKDVVIDADSAANLLKKIGRDSSNLDILNNYRFYWGFHPFGGAWL
                     VKLMFEYFEKVKDIQMLAVLSCILYENDEIKDHPEVPINLPFSHYNKMGKPSLNHESS
                     IVSLQRDSNPLRHDLLNGGKLSPLVHNKVSFDRRNTRSIYPASPVDAIHHRMESVSTL
                     SSYEYDDHSFKSSSPAGDMIMNSIKVSHNRRGIRHKNTTGINLFQGSDIHSNLSVAPQ
                     LSRSVSLHSNVFSQQFSRAVPVRMNSNDKVMADEIPKVNIQMMNTTELDLYENQYCVN
                     IESFVDLKKLEDYRRQYASILFSWGLPANRLKVLKFNYSSKSEASSNDFKEHYGAVGW
                     CEDFKYQATESPLEKWKKFHHKNKCNYCGMAVTKRLSVCSKCNHIMHDSCALEWWETN
                     KMDQCPSGCGCYCLNHVVS"
     gene            <1113177..>1114481
                     /locus_tag="C5L36_0A05100"
                     /db_xref="GeneID:40381623"
     mRNA            <1113177..>1114481
                     /locus_tag="C5L36_0A05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463530.1"
                     /db_xref="GeneID:40381623"
     CDS             1113177..1114481
                     /locus_tag="C5L36_0A05100"
                     /note="PKUD0A05100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319390.1"
                     /db_xref="GeneID:40381623"
                     /translation="MPGQKRRSESKRKFFRAITSRISHHNHVTSPEKDNIKGEPIHSQ
                     YQEISNTHNTLGKTNISGNPLSEHCKAAQDYPCPGNDHNTSIQDETQAIKSLSQSIPA
                     TKGRDNSNYSYLESMKKAPAKKRSASRPESITPTLNLKLKNSKIRNILCNSSATNERG
                     GKFLDIEACSPASANSEASFLSKTESLIINNESKNDMDEYDYKTFSTNHPLRLSKVKA
                     FEQGEMTTKMFFSKFNSNCIKNKDCNKRNTYTRHSTDERLILQVPGISKEHSASMLGY
                     KDESLSAQGAHESRKLTQGGGTHNNAERRILMMKKALKPMSQDDIAYVRLKNSELPNV
                     FQNSSEFLTNLEPQEIEFWELMNKEFEEEMEALREEFSYKMEERSALVDESIIQLLKQ
                     ARGSYSTLDRGKVCLDSEIGQVIQKRVKGIFHEEEMFRLTLG"
     gene            <1114745..>1116756
                     /locus_tag="C5L36_0A05110"
                     /db_xref="GeneID:40381624"
     mRNA            join(<1114745..1114765,1114873..>1116756)
                     /locus_tag="C5L36_0A05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463531.1"
                     /db_xref="GeneID:40381624"
     CDS             join(1114745..1114765,1114873..1116756)
                     /locus_tag="C5L36_0A05110"
                     /inference="similar to AA sequence:RefSeq:NP_010414.3"
                     /note="PKUD0A05110; similar to Saccharomyces cerevisiae
                     YDR129C (SAC6); ancestral locus Anc_8.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319391.1"
                     /db_xref="GeneID:40381624"
                     /translation="MNVIKLQKKFPILDQSELFGLIEDFRNIDIDEKGWADKKDVIEN
                     VSKSGKASYDEVREALKNVSVDASGHVELDDFVELNAKLKEMKSGSGANAPSSGVAIP
                     GAENSETFVRNKAKVVLGSGGRTLHTIDDEERVEFTRHINSVLAGDALVGNRVPFDLD
                     TFQLFDECTDGLVLSSLINDSVPDTIDTRVLNLPKNGKALNNFKLLENANIVLNSAKA
                     IGCIVVNVHSEDIIDGKEHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQF
                     LRLPPEKILLRWFNYHLAAAGWNRRVNNFSQDVSDGENYTILLNQLAPQLCSKAPLQT
                     PDLLQRAEQILVNADKLECRKYLTPKALVAGNPKLNLAFVAHLFNTHPGLDPIAEEEK
                     PEIEEFDAEGEREARVFTLWLNSLDVQPPVVSLFEDLKDGTILLEAYDKVMPGSVDWR
                     HINKRPTNGGELSRFKALENTNYCVAIGQANRFSLVGIEGSDIIDGNKVLTLGLVWQL
                     MRRNINNTLSSLSINGREVSDMDILKWANTMAAKGGKSSGIRSFKDPSLSTGVFLLDV
                     LNGIKPGYVDYDIVTPGNTDEDKYANARLAISIARKLGALIWLVPEDINEVRSRLILT
                     FVGSLMSLRE"
     gene            complement(<1116854..>1117936)
                     /locus_tag="C5L36_0A05120"
                     /db_xref="GeneID:40381625"
     mRNA            complement(<1116854..>1117936)
                     /locus_tag="C5L36_0A05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463532.1"
                     /db_xref="GeneID:40381625"
     CDS             complement(1116854..1117936)
                     /locus_tag="C5L36_0A05120"
                     /inference="similar to AA sequence:RefSeq:NP_013201.1"
                     /note="PKUD0A05120; similar to Saccharomyces cerevisiae
                     YLR100W (ERG27); ancestral locus Anc_8.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319392.1"
                     /db_xref="GeneID:40381625"
                     /translation="MTKGHIRALITGTSGNLGINIAKRLIKEVPADIRLTIIVTSRTL
                     ANANQTIAQLNEYNLQEVRREGVLDFDYSLLDFTDMVSILAAVYELSKSHECLDYVFL
                     NAAQGVYDGIDWIGATVECCTNPIKGVTYPTYKIQRVGVKSNDGLGLVFQANVFGPYY
                     FIHKLIQYKMFEKSVDARIIWISSVMSKPSYLSMDDLQLLKSHESYEGSKRLIDLIHL
                     ATYEKLEKQYGIKQYLTHPGILTSFSFFKFLNPFTYYGMLLLFYIARLLGSPWHNIHG
                     WIAANSQIFTSLYANPSDDLQNVKYGSASRWNGREYIKIEEIDPTGKEDVLKYFEVLT
                     SEWDLKLKDQIVNTRCSSFSDLMETK"
     gene            <1118462..>1119508
                     /locus_tag="C5L36_0A05130"
                     /db_xref="GeneID:40381626"
     mRNA            <1118462..>1119508
                     /locus_tag="C5L36_0A05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463533.1"
                     /db_xref="GeneID:40381626"
     CDS             1118462..1119508
                     /locus_tag="C5L36_0A05130"
                     /note="PKUD0A05130; Pfam Domains:
                     Pkinase(3.1e-93)|Pkinase_Tyr(1.5e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319393.1"
                     /db_xref="GeneID:40381626"
                     /translation="MQEQNFVFNIRDYKVISVIGQGAYGVVAVGHKHNSDEMVAIKKI
                     EPFDRSLFCLRTLREVKFLKRFNHPNIIKILDIQKPTSFESFKDVYLVQEYMDADLHT
                     VIRTHQLSNNHMVYMLYQLLKGVKYLHSAGIIHRDLKPANLLVNEKCDLKICDFGLAR
                     FENDVTKDKNTFLTEYVATRWYRAPEIMLSLAQYSKAIDIWSIGCILAEMILREPIFP
                     GKDYRHQLLLIFEVLGTPSEQDMESIKLQRARDYIKTHASSQRKIPMKKIFRKAHPEA
                     IDFIEKTLTFNPDKRMTIQDCLEHPYVYEFRDPSTEVESEPVPSDFFFFDEFKDQLEL
                     IDLKRMLYAETVTD"
     gene            <1119894..>1120898
                     /locus_tag="C5L36_0A05140"
                     /db_xref="GeneID:40381627"
     mRNA            <1119894..>1120898
                     /locus_tag="C5L36_0A05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463534.1"
                     /db_xref="GeneID:40381627"
     CDS             1119894..1120898
                     /locus_tag="C5L36_0A05140"
                     /inference="similar to AA sequence:RefSeq:NP_009570.1"
                     /note="PKUD0A05140; similar to Saccharomyces cerevisiae
                     YBR014C (GRX7) and YDL010W (GRX6); ancestral locus
                     Anc_3.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319394.1"
                     /db_xref="GeneID:40381627"
                     /translation="MGITLSQKKRKFIIAATLVVVTLLTLLSTTQTQKPNSSAVLSEE
                     TLSALDLDINRVSGKDTTGSAIQVQIPGEKPKHSKQEEIDSNVETKKLTNGNQLVKGK
                     EGEIDESKVRESETKNGSKKIPLVAGDPTAKKAHDKSTSDDDLVSSIKDKDSPLSGGI
                     KADKVLGSAGQKEIHDSKIGNKKVGGGANNNLAMKAQEDAELNGVSHNVGSSFNPHSE
                     FSNILSKSPVVIFSKSYCPYSKKLKQLLKEEYHISPEPVIVELDKHENGKELQEHVGK
                     QTGRFTVPNFIIDGESHGGADDILALHENDELIDLFHSWAGGAAKIKKIGSTTEKNEI
                     "
     gene            <1121147..>1121740
                     /locus_tag="C5L36_0A05150"
                     /db_xref="GeneID:40381628"
     mRNA            <1121147..>1121740
                     /locus_tag="C5L36_0A05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463535.1"
                     /db_xref="GeneID:40381628"
     CDS             1121147..1121740
                     /locus_tag="C5L36_0A05150"
                     /inference="similar to AA sequence:RefSeq:NP_013632.1"
                     /note="PKUD0A05150; similar to Saccharomyces cerevisiae
                     YML079W; ancestral locus Anc_4.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319395.1"
                     /db_xref="GeneID:40381628"
                     /translation="MAVKIRKPQYKERGITWEDQSVVQLASELDLEKHSFGGYFRETD
                     RSKDKVVKKQLQIESGDYKDVERSESSVIHFLMTCDSPVNRFHVNVTSKCIYVLQRGS
                     GVYVCIHPDGRLETFRVGFDVANGERTQWVVEPGVYKAGYLVNSADAANETATDLLWI
                     TEIVVPGFDLDDMKFLDKKLLVEKVGSEQAAKLEFLL"
     gene            <1122172..>1123058
                     /locus_tag="C5L36_0A05160"
                     /db_xref="GeneID:40381629"
     mRNA            join(<1122172..1122216,1122636..>1123058)
                     /locus_tag="C5L36_0A05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463536.1"
                     /db_xref="GeneID:40381629"
     CDS             join(1122172..1122216,1122636..1123058)
                     /locus_tag="C5L36_0A05160"
                     /inference="similar to AA sequence:RefSeq:NP_009604.1"
                     /note="PKUD0A05160; similar to Saccharomyces cerevisiae
                     YBR048W (RPS11B) and YDR025W (RPS11A); ancestral locus
                     Anc_3.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319396.1"
                     /db_xref="GeneID:40381629"
                     /translation="MTTELTVQSEKAFQKQPHIFTNPKAKATRRTKRWYKDVGLGFKT
                     PKSAIEGTYIDKKCPFVGTVSIRGKILSGTVVSTKMHRTIIIRREYLHYIPKYNRYEK
                     RHKNLAAHVSPAFRVQEGDVVTVGQCRPLSKTVRFNVLKVVTSASGSKGFEKF"
     gene            <1123511..>1125934
                     /locus_tag="C5L36_0A05170"
                     /db_xref="GeneID:40381630"
     mRNA            <1123511..>1125934
                     /locus_tag="C5L36_0A05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463537.1"
                     /db_xref="GeneID:40381630"
     CDS             1123511..1125934
                     /locus_tag="C5L36_0A05170"
                     /inference="similar to AA sequence:RefSeq:NP_009605.1"
                     /note="PKUD0A05170; similar to Saccharomyces cerevisiae
                     YBR049C (REB1) and YDR026C (NSI1); ancestral locus
                     Anc_3.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319397.1"
                     /db_xref="GeneID:40381630"
                     /translation="MSEMNDSKDELSVHLDVHSNEGDVVDVVKYATDVLNNGLLNGQE
                     EEEEEADDGEDSNGNHHGNIPRHCLKGPSSHDLGEHRDETDVKDDDAVAVDIDRFRME
                     MESMGEININGLSGDQPVFPTIEAMRTVQQQRKKRQFSSIIDEDIKEFQRWTSRFLVD
                     ALDDSTTDVAIEDSDEYGFPQTTAEHFTDPVDDSGFKRKKIVKNETPDTHATDRKGSD
                     SNLHEQNDVIVDVGQQNGIDLSKKKVNIIKFEGLDIDKEEHLHTTKNEENVDPELSKF
                     DSNTFSDDLINVSLEYLQRRIESGHVGEKIADGADNDVGNRTVDGDNNEDADDDENLA
                     VEEVNRVVNQAVAAVRADAARNEGVEHIEDIKELDGDGDEEHGADTDVIAAAIVAAEN
                     AVRKRLKIDSMGTLDQIKDISIPITNEPTLTTDQSSSKVLNFQKVKVGADGGGLETST
                     KPKKANKKNATTKQTVSKAKKNKEKRDEFELLIKGKLDEAIKKAREKIADLSINSRSF
                     TKEEMDAIDIFIKEYQKVHVMTHEAFLKRIWGNERKKDKFWEVVQHVLPNRTRSSLYK
                     HIRRTYHIFEKRGVWTPEEDKKLKELTETCDGKWKEIGEIMKRMPEDCRDRWRNYVKC
                     GESRNVNKWTKEEEDRLKEIITQVLDHARKDIDGKEQPIREAQVAPTINWNIISEMMG
                     GTRSRIQCRYKWKKIMKMESVNKLQKMDSDTQQWLIERLYELSEKDPYLEANLDWDAL
                     ALTAPSSKIIWNGVDLSTCFARLKTRVDWKGKTFFEIVAQLRDALSPAKCVAQLENNQ
                     AWNVEGETH"
     gene            <1126522..>1130991
                     /locus_tag="C5L36_0A05180"
                     /db_xref="GeneID:40381631"
     mRNA            <1126522..>1130991
                     /locus_tag="C5L36_0A05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463538.1"
                     /db_xref="GeneID:40381631"
     CDS             1126522..1130991
                     /locus_tag="C5L36_0A05180"
                     /inference="similar to AA sequence:RefSeq:NP_013357.1"
                     /note="PKUD0A05180; similar to Saccharomyces cerevisiae
                     YLR256W (HAP1); ancestral locus Anc_1.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319398.1"
                     /db_xref="GeneID:40381631"
                     /translation="MKSEEQSRSQSKDLKTTRKRNRVPVSCRVCRKRKVKCDKQQPHC
                     LNCIKNNVQHLCVYAKPDWAKDSPPPEATIDNDPKPVTVKQEDTNERLELAHSLQKEL
                     DEMKLKVKALESENNELKKKMVNIPTVNEVTSTTSSLLVKPRDTDDLLDSIFNSNILF
                     LAQQGNHYNIHITYQISVFSWMFIIKSDIYLNDLWMKILKLRQHYEYYYHKGTMEKNM
                     ISQYRNFKMKSLSPQIIPKEKTNEHTSKLKNFLEKSLNIKRATNHRVQSPTTLKNDIT
                     GEIEVSTPSSMLLQKQPQHPNKCPVTGVVGVCPIGENIMNSPLKSSNGQNHNAEDTAF
                     DPKTQENKLNDCGRPKKQTTHQHPHLTHRSHHPDIKKCPVFYPVTGNPTVNSKSGTPT
                     NDDQSDMDDMLEDNKVCPLIAGDGKALFKEKLTKMNISAIRESYSKSPMSSMDSPTLI
                     NQKRRSGSLSPSKSKSMPMIPSGPSTPLSDIKPQDSEKLQNYVPIAMKPESSPTSRQN
                     SLKRMASSEYPYGGKMKKLKTISPAFIKSLNYNNTKQIINVIEQHLPPKKIVLLLIDR
                     FFDKIYIHMPYVDETSFRHRVNLIIKASDLNSQRIKLSSIGNQYCEEFLTLCLMLIIL
                     RLSWLSLPDKSREGLNSNELLLMKPENFISLVLVEMVKEIFSNAKILTKPSAIIFQVG
                     LYLRIYSTLSPEDGFDTDNSYTSNANFNNPQQTDPNSRSNSTSMSSSSVNSNDLSGDL
                     TNESPNMNSPVYISMLVQLARTIGLNRDPLNFKNFYPKPNDDEATVARLFRKRHLWRK
                     LWFGLLFVTIEANLSLGDYKKGLPIELDLDPTLGTSVNKTWDCRLPGGIEQGVLENSF
                     KGGKILQRELCVVQSFRESIISYKWIYRGMKLLFNVDEPPSTTELEKIISKLSEIICE
                     KSKYGYGIDLIMGNQEIVNPFRARNSSVWIKKYTNQIKILRLKVHLIIKNMIFTLTYL
                     LFLNHEQKLSKLLGQKHASVEKIEKQRIYIETFFESSLLSAIESFKLFIQFMDEHENA
                     FTNCSTGLLIYPFLLILNHRSHEFLISLILRIQQNSPIIMEVLKKNKIDPKELQKRLF
                     TYVETFIERLDLLTKRYYYAWVLRRLVKFFHNILTNSQKLFKLNFKKMNVSDTGKATS
                     ELKSDTLPSKVHKNEETNHSNNCDGSTTSNNGKSAFEIAFGTSKLPPVTDFTHDDRRE
                     INFNPLISNSDILFNQQQQQQQQQQQRHNHYNLQQGHQQHQPLTNNQPGLSDKGNNND
                     SKIPQTGSNNLTNVLFQNMEADLNFNANMKNTQTTPTIGYDDVNTVPMVSSNSDSSVH
                     MNAELPAIFDDQFLNDIGSFGLDGMNIPGLMGLQRGLSSDGLTPPASALGLNVGNTPD
                     TIIESSALNNEATSMHMGGGFYNAMMGQTGNINSVDHRVNSNVMGRPEMYNPLNEIDF
                     TNIDLNTPVDNLMYGFEMPIPDSGNTRTEGGGENASNAQGSNNLTSSSMWNFF"
     gene            <1132454..>1135342
                     /locus_tag="C5L36_0A05190"
                     /db_xref="GeneID:40381632"
     mRNA            <1132454..>1135342
                     /locus_tag="C5L36_0A05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463539.1"
                     /db_xref="GeneID:40381632"
     CDS             1132454..1135342
                     /locus_tag="C5L36_0A05190"
                     /note="PKUD0A05190; Pfam Domains: Fungal_trans(7e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319399.1"
                     /db_xref="GeneID:40381632"
                     /translation="MSEKLKHLGMVFNNSNDQKFFKIPNYENDRNHSQVTDSNYPEKL
                     VLPPISSFSSSSPSTLNFNDNLSLSSKIIPTIRHPNQTTPMSSFNPYGSTAPLNTINS
                     INHHNLNDSSLPYGSSPRSSVYFPPPISHNSTNGNNINISNNNTEIRTFFSGVSDIGT
                     PIPSLMSDRIRGVRGNEFIMVSRRADLFSHLNISKDSIIDFHKNYIPMLYNHSRVKNI
                     GPLSGISMVIKDPLTRPLKEEVSAFKKRAFDSILNGDEKIERENLKKHSGVEDIEKID
                     LNTKIGLCSSVQNISLFSDWALDDGIKVPSNVKDLIDFILEILPNKKIIWSLIDRFFD
                     KMYPLFPYLDQSTFNSDVGKLIESNRENDLNLTEKVKTLKIQKKLDIAIAGILLVVLS
                     FANDSLLVRVDVSKITRTPLEKYLLDHPLSKHTIAISKFCLNQFDLLKKCALPIFQLA
                     LLIKEYENSNALTDGGDPDSQICISMLIQMAIAIGLNRDPSKFDIRLSKGKVGNLWRK
                     IWYGLLAIDSRRYILYGRSKCISSDLYDTELPFYDKESSNIDNHQLEKVVLEKIKLNF
                     RFDEAMNEITDYVCSLKNKPNVRVLIEKTLNLERMIEESFESLKSILERKNEDSISQF
                     SKIKDFAIVTQALGLLICIYHHLYLSSQSEKNFHAGRFFKKKEIFYWLYVLSNVECYT
                     TNSQRCFGVGYDMIVSFLVLPIIHKGWVVYFSTYISITAYLIKAERYPVNTKRIEMLQ
                     NISKQMTDSSSWYLPCIKLLAKHNFYAWRIFKAHTFILKLIRMKNYFQKSVTQIYNIF
                     ENVSDQDLVLFYDLINYKNYKINNVETITFKTSKSIILHNIVGINRNSEHIDEKQNPL
                     DSPFNFKSQMDKSIAEEIWNQPLEEDEYWKNVFLKKQSNIGQGVNLNGEIVGSEASGH
                     SDLSLNDGSIRTPDLLSSNSPFSGYGGIPETDDFFFDQAIYEMFSQQQ"
     gene            <1135540..>1137345
                     /locus_tag="C5L36_0A05200"
                     /db_xref="GeneID:40381633"
     mRNA            <1135540..>1137345
                     /locus_tag="C5L36_0A05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463540.1"
                     /db_xref="GeneID:40381633"
     CDS             1135540..1137345
                     /locus_tag="C5L36_0A05200"
                     /inference="similar to AA sequence:RefSeq:NP_013354.1"
                     /note="PKUD0A05200; similar to Saccharomyces cerevisiae
                     YLR253W; ancestral locus Anc_1.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319400.1"
                     /db_xref="GeneID:40381633"
                     /translation="MLSLHRNSLKLIVNNSAAASHYLRSGGTSFFKYCRKSSIPKLTI
                     PYRSTCRHYTSRTDQNDSRYKKNYEYDRTEDKPMYGHYIGGVVASLFIGGLIVSPGFR
                     QNTVDTILIAERVGVVTVAMVRCFSLYLWTLNGRYTSEQEYYRALSQTHQKAADITLD
                     ALRKNGGIYIKLGQHISAMTYLLPSEWTETMTCLQDECPESTLEEIIEMFEYDTGKNF
                     NDFFSDFDTKPLGVASLAQVHRAVLRDTGEEVAVKLQHPSLSKFVPLDVRLTKFVFDM
                     MYKVFPEYPLTWLGDEMQDSIFVELDFRYEALNAKKTQEYFKDYLKLTALRVPDVYTS
                     LPRILIMEFISGARLDDLKYLDEHKISRAEVSACLAHIFNNMIFKSGFVHCDPHHGNI
                     AIRYLKKPKNGHNFEIILYDHGLYRTIPETMKVDYAKFWLALIDKNQQDMKIYGKKFA
                     QIDDSHFPLFAAAITGRDFDHALTGDIQAERSQDEIEKMKQAMMDDGMVLNLMSLLAT
                     VPRIVLLILKTNDLVRHLDECLKNPLGQERTFFIMANYCAYTVYQDDMLQNSKYNKKW
                     SINWILGFCTSLTTYYKHTLQLFLYDLVFSVTNLF"
     gene            <1137567..>1141475
                     /locus_tag="C5L36_0A05210"
                     /db_xref="GeneID:40381634"
     mRNA            <1137567..>1141475
                     /locus_tag="C5L36_0A05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463541.1"
                     /db_xref="GeneID:40381634"
     CDS             1137567..1141475
                     /locus_tag="C5L36_0A05210"
                     /inference="similar to AA sequence:RefSeq:NP_010443.3"
                     /note="PKUD0A05210; similar to Saccharomyces cerevisiae
                     YDR159W (SAC3); ancestral locus Anc_8.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319401.1"
                     /db_xref="GeneID:40381634"
                     /translation="MHKNNSSAGGKFSNVNFFQSNSQPASTPSPISNYRNGKNIRKGY
                     NTSDQGNTPNRHTNSSGPLGNHPNKSSTWRQQEHTDQRNRGNSKRTNSSDTDRKIQRN
                     NTGRSSRNKAQQSYQKKQPNSQKKQLQGGVDTSIPKASVCASVKSSENTFQLNHFGNK
                     SDTFEVKYFGNLFKAPETLGFQKIQHRPQRTPKYMLKENVLFDMSSYEINKWDLENQK
                     ILNRRELEYSGDPQLLFEEFVERRSKEREMMEKFNLVDKENAKKSLDDAIVFRGSCED
                     MCPTYERVERVYKNQVSKWEKDPATGQISRNLAIKTFMRPSGQAPPLPSDVRTPMVLQ
                     KTLNYIIENLLPRLPESQSFIWDRTRSIRQDFTFQNNYSGIESIDCHEKICRIHILSL
                     HVMAGVNDPDYQQQQEVEQFNNSLQTLTHMYQAVRSRGGYCPNEPEFRAYEIMSKIRD
                     SELDRYLQTLPQYIQNNKIVQQAIKLKSLIVEGMNTFNCYTEFFRSVLDRNKTPFLLA
                     SISEIHFNEIRYNAFRCISRAYHSKTKLLPTVENLVSWLGYNDVEQLSMTCKLYGLSF
                     INDQDTNAIRVDITALKASFKPSQPQAYTNRISDMINGQSMSQIVNSGMPNKSLNLKT
                     SLTTEQVARESFKGSKVNTEKTDLIFKGFKLARLLEPSVESGFQSFGVPATSFSTNNN
                     ELIPANANFVGFQNGQCHNLSSFSSANPSIKLPIQNSRNPKNNFEEAPHLHTPTFNFG
                     AAVTLPTDLNVKSIPSTFKNEKSDITNPPVLSPKKVDIVTPVETSFPVSQNPPKRKLI
                     DNPDFKSQAIRIVNDISTQVVVKISNKLIKEQVEKEFSSRKKLKKSILVANLSNELFS
                     AFMKEQLYLAALEGRAIATYNRNLKTRILSSIIIKARNALIRKELAQAKLNEVEKFSS
                     DVVKPVVFPKNIRKSIRPTNLLDFNFQMKIFKIDLKNMLEKLEPIGDLSTAVILRERR
                     SQTSKWLLSQLGLLHKSKVEVKNDSNYKLTVELLPENFIPEEYFKGLSSILIQVGTLE
                     GLDNSDKDTLIKCLKRDAKVLAKLQKYLTDFSGKPQFSFVIVYSDAYGYDLPFSAIKS
                     LLMLDNLTSSGITIGFYKLNSLSILQKNSNLSIMKKLGDDFGKVLEQVWAKMCLKSKM
                     LESQSNNSINYVSGMNITSGSMSDATSKDDNSAMAQKSSGTVKRKLGYLHQTYADTKS
                     KRRSYRRTHPLLNASISNSFRCHLRSTASVASETHSKNTNSSVLSSYNNSLMEILNES
                     LRDTSNAIHTEAEIAENKKRLQRVQELSELDVLAENVLNS"
     gene            complement(<1141586..>1144318)
                     /locus_tag="C5L36_0A05220"
                     /db_xref="GeneID:40381635"
     mRNA            complement(<1141586..>1144318)
                     /locus_tag="C5L36_0A05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463542.1"
                     /db_xref="GeneID:40381635"
     CDS             complement(1141586..1144318)
                     /locus_tag="C5L36_0A05220"
                     /inference="similar to AA sequence:RefSeq:NP_010450.3"
                     /note="PKUD0A05220; similar to Saccharomyces cerevisiae
                     YDR166C (SEC5); ancestral locus Anc_8.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319402.1"
                     /db_xref="GeneID:40381635"
                     /translation="MRTMNPERAEDRALLMDFYQLKTLSPKQFDKDTIPSTFKIDISN
                     ENLAEIPKEIVNNLLGDNSTESDEKMKTSSAKNNTSSVGKGSYVDPLGFKSNILDELI
                     DKDILDDTRDPQIGKFMVDSKLFNPRLFLSVVHSDKSLKELLFGIKNLENDIESKKPL
                     LQQLITNNFERTLNTKNSLDKVFNHFSTSNLNAEISDLNDALSSSSNSANQMLNPILL
                     LLSKEKDLTNTVSFIKENRSFIDLPKKLKRYVDEDDFDSVLKEYELGFLFFQKIKSEK
                     NVNPFFDKIWSNVKTVIEQYKQSMIDDLTNTRIDLINSNFKLQLNSKKRNFVVLLKRI
                     VELDPASTPMKTFVKSQYENIIKDLDKGLVRIDYQDLNNTRNAVLKASGSENGNINLS
                     VNAFKLFSQLASPSYDNEQIDSLYERLDSRMVISLWEFFQLYVETVTEGVIGNKIIKF
                     ESMVEFLAHDFVKLLSEKARQVSRKIDEKSIAEMKQFFKSMMKKICDRLTFLFESTTD
                     DLNKALLISEKDGHSAVFPKPGLRNIDDVSTYGFVTPNSNSITTICYCVKFFKTLSNK
                     LVSIKNQKFILNTPEVNSIVEITLTGINKNIIEGCIAAMKHDIQSAVYIDNMEPNESV
                     EGSTRITTFSLNFYQTFVAKIHELHDGRDQTIVELIQHHLLQSVELLLKNIAQNIDKL
                     CDSDPNRFDYYYLVSIYNIRHITTKVLPLILKSFDMNFKTKLTTKKDLEIYKISDSLE
                     SQIFVDYMKEPFANISKIINLGMADINVRSQNVLSKTSTNDIVPASPFLLSSINYINT
                     LKSKLYSFNVRPSFVLDIQSALITKLQKKILENLSSDFTKDAQYQLSIDLMLLVTLLK
                     KYNSKAYDHNKVETSSLEKALTKLSSKFDSASVEKSVHENLSLNYIQFNSFISD"
     gene            complement(<1144854..>1145468)
                     /locus_tag="C5L36_0A05230"
                     /db_xref="GeneID:40381636"
     mRNA            complement(<1144854..>1145468)
                     /locus_tag="C5L36_0A05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463543.1"
                     /db_xref="GeneID:40381636"
     CDS             complement(1144854..1145468)
                     /locus_tag="C5L36_0A05230"
                     /inference="similar to AA sequence:RefSeq:NP_011436.1"
                     /note="PKUD0A05230; similar to Saccharomyces cerevisiae
                     YGL079W (KXD1); ancestral locus Anc_6.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319403.1"
                     /db_xref="GeneID:40381636"
                     /translation="MELDGKNTVRPNHQSSDKHSGNLGLMALEESSEGTSTEYIPGDD
                     GMIENLEELGEEIQISPIWSNSYDTTETATIDNEKPSLVPNDSRFNTVDFVLQSLNGA
                     LNSIEYDKALVIQSKMAGNLNSTTNDVLRKIERLQEALEEHIVKYRRLKEVIIPQIDR
                     NLQEATKITKRLTRHVKEIYPVEYSKGRSKVLENLTEDEEGLFL"
     gene            <1145725..>1148499
                     /locus_tag="C5L36_0A05240"
                     /db_xref="GeneID:40381637"
     mRNA            <1145725..>1148499
                     /locus_tag="C5L36_0A05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463544.1"
                     /db_xref="GeneID:40381637"
     CDS             1145725..1148499
                     /locus_tag="C5L36_0A05240"
                     /inference="similar to AA sequence:RefSeq:NP_015129.1"
                     /note="PKUD0A05240; similar to Saccharomyces cerevisiae
                     YPL195W (APL5); ancestral locus Anc_6.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319404.1"
                     /db_xref="GeneID:40381637"
                     /translation="MSTLTMKERLRGFGISFEKSLEDLIKGIRATNSDHEKLASFFER
                     SIQECKNELKSPDLEVKSIAILKLAYLEMYGFDMSWCAFSILEVMASPKFQHKRIGYL
                     AANQILQRQNNDDALMLMTNLLNKDLTSIDYTEISLAIGGIAAVVTKDLAPIIVDDMA
                     KLLTHTKPLIRKKAVLAMYKIFLKNPESLRIHYDRLIERLDDDDSSVVSATVNVLCEL
                     AYMNPSNYIDLAPKFYKIMKESNNNWMMIRILKLFSSLSLIEPRLKNKLLPEIKAFMV
                     NTKALSLQYECINAILNGNMLSPDDIDTAKLIVSNLLVFFASGDQNLKYVGLLAFIKT
                     CKINQDLIKKHDKIILSSIYDNDITVRETSLEIVNSLVNEHNIVPIITRLTVQLLPYN
                     DQKEQLDKINKKVLAQNSGQDSDDDTDTYIIGATQQPIVVSQKYKYLLVSKIIEICSM
                     NNYENIPSFRWYLGVMTDILKLNVDNKISKIDKMITDQFVDIALRVPSVRHTLVNICF
                     SLCGILEYTGRELLQFKEGLGNCMWIIGEYYDSYLQGESDSDSDSEPDSDSDSFSALQ
                     KQELKDLKQSKLSISEIIDTISKQNILSKLEQLDSYDIITTYVGAIAKMYSKFTSTYA
                     CGGDLSVSQLEFVKNSCLGVIEILSQFETSSNFELQECALSYVEILKLVDNSLENVLD
                     GIKNTETSSASLPTFLTEGYNQLFLSYPLMPVGASAQEKVKIPDGLDLNAAIDEQATF
                     NFHNLYTNLKLEELSIDDVDLPQSDSLHGDYTENQEFSDIDTTRSLSTRHDDEIYYIS
                     ATNYDHSDSSSIAPKKQAKKKSKKTKKFRKEAVLIVDDDDTPARQNSTTVKQNNLTAD
                     ALNLADIDLKKSEEHYPVGDEYQVEEETRKKKEKAGVDGIKIEVPSVALSAARKKPKK
                     KAKKNVAIIE"
     gene            complement(<1148719..>1149618)
                     /locus_tag="C5L36_0A05250"
                     /db_xref="GeneID:40381638"
     mRNA            complement(<1148719..>1149618)
                     /locus_tag="C5L36_0A05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463545.1"
                     /db_xref="GeneID:40381638"
     CDS             complement(1148719..1149618)
                     /locus_tag="C5L36_0A05250"
                     /note="PKUD0A05250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319405.1"
                     /db_xref="GeneID:40381638"
                     /translation="MDVSALTNPGDMEIENTKQQSKMTAVENKSESQPLKRASGNTEN
                     YDLTNGKSSRSTDSTSLNGAETEICSEKDVSKTSKCPSRSTSEYRTLYNHLLEKYKNA
                     NEVAKFLEDFALYLKSLAKYQQLRNNMLVDLLCYLNKHESIDRLEPSSHIEIIRRLER
                     LQKYNSDNKLYSTLLKLEKNETDEDGKKNLLSFEEVVGMNDSLSSDLAIAETNRYPDL
                     YLGIFDRYDLVKKNLCYKNNISSFKDLKAHVKADLKHSLPINYEGSGKRRRVATGTTH
                     PSTTKSQNGVHNVEPIVEKNDSK"
     gene            <1149897..>1151951
                     /locus_tag="C5L36_0A05260"
                     /db_xref="GeneID:40381639"
     mRNA            <1149897..>1151951
                     /locus_tag="C5L36_0A05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463546.1"
                     /db_xref="GeneID:40381639"
     CDS             1149897..1151951
                     /locus_tag="C5L36_0A05260"
                     /inference="similar to AA sequence:RefSeq:NP_011661.2"
                     /note="PKUD0A05260; similar to Saccharomyces cerevisiae
                     YGR145W (ENP2); ancestral locus Anc_4.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319406.1"
                     /db_xref="GeneID:40381639"
                     /translation="MVLKSASSNDISVYQISGTNVSKSLPDWLERKRKRSLKNDIDYQ
                     NRVELIQDFEFSESSNKIKVSRDGQYAMATGTYKPQIHVYDFANLSLKFERHTNTENV
                     DFLMLSDDWSKSIHLQNDRSLEFQNRGGIDHRIRIPKFGRSMVYNDVTCDLFVGASGN
                     EIYRLNLEQGRFMKPFNIESDRGVNSIDINPIHGLLSAGLEDGTIEFWDPRAKQRIIK
                     LQIPEATENGSEISCVKFANNSLNFACGTSDGMSMIYDLRTSHPIITKDQGYGFGIKK
                     IIFLEENGNENANLVLTSDKKIAKIWNRDTGKAYAAMEPSVDINDVEHIPGTGMFFMA
                     NEAIPMHTYYIPQLGPSPKWCSFLDNITEELEERPSDTVYSNYKFLTKQDVAKLGISH
                     LVGTNVLRAYMHGYFIDNELYDKVNLIANPNSIQEEREREIRKRIEKERESRIRSTGA
                     ITNTKVTVNKEYLGHLQSKLGSETAENVVNDDRFKEMFEDPMFQIDQDNHDYKQLNPV
                     SNSLAGPKPLTAAEESDEERLQSKNRNTLSESESESESDSEDEREREAVKQKIKEQLK
                     KKQERKKREREEAKQYMAKVRSLDKSDDANIGITDGKNVSFGKQAKLQVENGKIRKEQ
                     KSNVRIRKNAIGEGEITFVPTKKASKVSFREEDGDTERRGKTKQVTEGRRRASKNVFR
                     GM"
     gene            complement(<1152050..>1153612)
                     /locus_tag="C5L36_0A05270"
                     /db_xref="GeneID:40381640"
     mRNA            complement(<1152050..>1153612)
                     /locus_tag="C5L36_0A05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463547.1"
                     /db_xref="GeneID:40381640"
     CDS             complement(1152050..1153612)
                     /locus_tag="C5L36_0A05270"
                     /inference="similar to AA sequence:RefSeq:NP_015131.1"
                     /note="PKUD0A05270; similar to Saccharomyces cerevisiae
                     YPL193W (RSA1); ancestral locus Anc_6.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319407.1"
                     /db_xref="GeneID:40381640"
                     /translation="MKRTRNDSSENDRKMQKSCVADTGVAGLPAKPKFSYCTQSSPVG
                     DAKFKGRESADQASNVELFPGVSVNLGSQISEANQTPLTSTQDNSNTVSSVQPTPEAL
                     QLFGNILKTLQSQNHSQTQINCNMQPQHAPQYQNQYNCYPNQQFSGQYQGYQQGYNSG
                     YNQQYYNQYNQYGACLQRQPSLYGAQTYPQQLNSHVSQPTQPNQQYAQNQDQSNALMN
                     VFTKFLQNQQAQNNLGAAIPATSASVPQLPQKPTVAKNKTKRKKPKCTPAKEKFNHKE
                     HLNDALSQNKSGQTGCDNSYEDGDNNNNDNNDDENNDYDDLIDEESEWGKNTIQGTNI
                     IFENEEDIQKWIEERKKNWPTTRKVEEKKAEQEKAKKILETMTKAPTDAGNETTPAIR
                     VCNFWMKTKRCRNGEKCLFSHDMADIAKAKAMNHSSRRTHRTSITKPLLNHKIKLVHG
                     IPVQIPQRFTPLNNRGKSLHKLLVEGDQFKSENLELLHLFEKLLQAGVIKQDWDVVKK
                     KLKLDDESLNLK"
     gene            <1153950..>1154861
                     /locus_tag="C5L36_0A05280"
                     /db_xref="GeneID:40381641"
     mRNA            <1153950..>1154861
                     /locus_tag="C5L36_0A05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463548.1"
                     /db_xref="GeneID:40381641"
     CDS             1153950..1154861
                     /locus_tag="C5L36_0A05280"
                     /inference="similar to AA sequence:RefSeq:NP_009409.1"
                     /note="PKUD0A05280; similar to Saccharomyces cerevisiae
                     YAR015W (ADE1); ancestral locus Anc_3.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319408.1"
                     /db_xref="GeneID:40381641"
                     /translation="MSITSTNLDGILPLIAKGKVRDIYEVDSESLLFVATDRISAYDV
                     IMENGIKDKGKLLTQISIFWFNFLKDNIKNHIIADSDEEIFARLPKELSESKYKDQLC
                     QRSLLVRKHKLIPLEAIVRGYITGSAWKEYKKSGTVHGCPAPENLQESQEFPSPIFTP
                     STKAEQGEHDENISQEQAEKIVGKEVCEKVARKAIELYSKAKEYAKSRGIILADTKFE
                     FGITDDGELVLVDEVLTPDSSRFWNTKTYKLGKSQESYDKQFLRDWLTSNGLNGKEGV
                     SMPEDIVAQTSSKYVEAFEALTGKKYV"
     gene            <1155079..>1156599
                     /locus_tag="C5L36_0A05290"
                     /db_xref="GeneID:40381642"
     mRNA            <1155079..>1156599
                     /locus_tag="C5L36_0A05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463549.1"
                     /db_xref="GeneID:40381642"
     CDS             1155079..1156599
                     /locus_tag="C5L36_0A05290"
                     /inference="similar to AA sequence:RefSeq:NP_009410.1"
                     /note="PKUD0A05290; similar to Saccharomyces cerevisiae
                     YAR018C (KIN3); ancestral locus Anc_3.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319409.1"
                     /db_xref="GeneID:40381642"
                     /translation="MQFECDFLIFLDSLGYLEGKIPCFSYIIVPANCALIYYTSCFES
                     WTILMSRNIAADFQDIEIIGRGSFGLIWKVKHRPSGRIFVRKEISYKGISKKEEKQLA
                     SEFEILQSLHHPNIVQVYDIDKNVDKQIINIYMEYCDGGDVSQLIKKYRESKKYIPET
                     LIWQIFTQTLLALYRCHNGIDIEPVASLFQETSNLKIPEVPNLKQVLHRDIKPENIFF
                     MSDNYTVKLGDFGLAKCLGPNTSFTQTYVGTPYYMPPEVVSEQEYNALCDVWSLGCVM
                     YEMCALKPPFTASTHSQLQEKIKRGVYNPIPSCYSNRLKLCISACLITELSERADVNL
                     LLQNTSFKIYRREWELNQQEFELAKREIELKKREISLIRFKEELITREKQAIMIDKAL
                     EDERRLMNLKNDETRKIMRQEFDNVVHAKVEEKIRQFISEFKENQVPLHKLLSKHLTL
                     ETKQQQQQQIPQLQPQSQSQSQTHQVLGSNNYGAPSSPIKLRGPRSYEDVEIPRYK"
     gene            complement(<1156728..>1160894)
                     /locus_tag="C5L36_0A05300"
                     /db_xref="GeneID:40381643"
     mRNA            complement(<1156728..>1160894)
                     /locus_tag="C5L36_0A05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463550.1"
                     /db_xref="GeneID:40381643"
     CDS             complement(1156728..1160894)
                     /locus_tag="C5L36_0A05300"
                     /inference="similar to AA sequence:RefSeq:NP_010265.1"
                     /note="PKUD0A05300; similar to Saccharomyces cerevisiae
                     YDL019C (OSH2) and YAR042W (SWH1); ancestral locus
                     Anc_3.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319410.1"
                     /db_xref="GeneID:40381643"
                     /translation="MKLKLLEVLRNADINKLKYLISQIDNNPTNYDLQRLKDEILLFA
                     VQVAPFSIIQFLVDNGLVEDINSQDNDGNTALHLAANSNRNDVIKYLMSQPSINDCLY
                     NKESKQPIQCTTNIETAQLMDNLRSQHIERIASQLRYGFETRNFELLEQLLTNPRDKE
                     LLDINGTDPVTNDTVLIEFIKKGDKEMVKFILNHGGDPFKRSLSGKLPEEYTLDPEMK
                     KIIEDSFNNQNIMETTAHPQDGSPTYKGFLKKWTNFAGGYKLRWFVLDHHAVLSYYKS
                     PNDMNNTCRGLIHLAHAMLRVNSSENTKFEIIIQNPSDGSPVRWHLMANHATEAQKWI
                     WVLQNAIRYAKDVEKGNGTTAKSHILNEDLPASTSLFQDSNQPFSSMYHPAPIPETKV
                     LSNEAIEKESEGRKTVSSIISDAHEAANDFKELVKATDSETELPLQMSNHEDEEAQDN
                     DTHELENSTNISDSNSSRTHGPAPDRSSMYSSSKQDSIASHDGLHRHQRTGSINSLNS
                     ANSERSSSKSSLAKSLYKKPFKKLSHIGKKTRQSFLPPETHKYQQRNLEAVDSVSSFI
                     SDKSSIVSTPDIEETGQFAESNSNNDDDESESIAKELHNADLNVVRNQMTMQLNTFKD
                     FLNAARTDPGIGKDDLVDMSVSILNTLNMLINQEGQCVNHKYNELIRRLEKQQKISSI
                     WENSIKQLEIEIQDRETKIVELEDKLKAVKKSLRNSVLHGSQLVKKGIPDVPQEREQA
                     SNPSSAAALARKALTANLNTTSAIPPIPSSSPPIDYIKQQQEEERALRHQNEIKSKFL
                     SSEADTSHVSVSSVPPDFAPPPVPSFDPTLTEFLEESDDSDEEFFDAEDDGHVQDMGV
                     LVRRETFKASKKKAINPSPNTNDEYLASTTQQPTFPNTTQLSNATYQNVYEPEDEVSS
                     IQESNENEPGESRNPEKLEQNGEARPEQSLNTQAESHAITEAKFQPKIDEHGHFVVNH
                     HELKSKPQNERFKMILKDHTFEGYEDPLRLSLAPQDTRPKISLWGVLKSLVGKDMTKM
                     TLPVTFNEPTSLLQRNVEVIEYSDLLDKASAIDDSTLRLVYVATFAASEYASTVGRIA
                     KPFNPLLGETFEYARPDKGYRCFAEQVSHHPPISALVAESPSWSYYGESNVKTKFLGR
                     SFDIKHLGTWYCEIYPDNGVQCKDGSQTDMELYSWKKVNNSVIGIIVGNPTIDNYGTM
                     EIRNHMTGDHMKFEFKPRGWRASSAYEVKGEVFNAKGKLMYYLGGHWNSKIYCRPADD
                     KKAEKFLVWEAAPRKEMMFHLTSFAATLNAPQKHLLPKVACTDTRLRPDQRAMENGEY
                     DKASEEKNRVEEKQRAARMQREMKGEVYKPFFFRKAKHPITGEEFWEYEGKYWEERME
                     GKLKNYKDIF"
     gene            <1162118..>1163002
                     /locus_tag="C5L36_0A05310"
                     /db_xref="GeneID:40381644"
     mRNA            <1162118..>1163002
                     /locus_tag="C5L36_0A05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463551.1"
                     /db_xref="GeneID:40381644"
     CDS             1162118..1163002
                     /locus_tag="C5L36_0A05310"
                     /inference="similar to AA sequence:RefSeq:NP_010764.1"
                     /note="PKUD0A05310; similar to Saccharomyces cerevisiae
                     YDR476C; ancestral locus Anc_5.610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319411.1"
                     /db_xref="GeneID:40381644"
                     /translation="MAPEPTRRSRIRDRDDIREEGRSRSNSHGPSYLDHPSHSPALIL
                     SKFNTIYRHSVLDILTYYAGIPTDPNPDNNPLSTRDPNDSLNNDPNVATTLLNSKTQT
                     ANSISNVKLKSIALDEVVVSFKYPNIELEMLKPIPFDKACGNYHEVEQTLIKMSKEAA
                     AARNLSHLRVSGIQYANTLWDLVLIALISLLPIGHYYSNVLYESFFATYFPFMLKLQP
                     YHDYIMYATILIHLMETYFLLFPRFTRYRVPLDYAIEWTVLTLLEGAPSIKRFDRYVE
                     LISSDDVYYDFSNTDYMD"
     gene            <1163227..>1163631
                     /locus_tag="C5L36_0A05315"
                     /db_xref="GeneID:40381645"
     mRNA            join(<1163227..1163295,1163383..>1163631)
                     /locus_tag="C5L36_0A05315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463552.1"
                     /db_xref="GeneID:40381645"
     CDS             join(1163227..1163295,1163383..1163631)
                     /locus_tag="C5L36_0A05315"
                     /note="PKUD0A05315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319412.1"
                     /db_xref="GeneID:40381645"
                     /translation="MLYSELSPGAHTNSKMASFNELMSLYTSYSELTPSFTSSLNTFP
                     LVVSVSFTLLLLLLTLSFSVESKSARKSMLNFIEYTVLSALTALSLSFTILFVSSHVG
                     IYT"
     gene            complement(<1163706..>1165451)
                     /locus_tag="C5L36_0A05320"
                     /db_xref="GeneID:40381646"
     mRNA            complement(<1163706..>1165451)
                     /locus_tag="C5L36_0A05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463553.1"
                     /db_xref="GeneID:40381646"
     CDS             complement(1163706..1165451)
                     /locus_tag="C5L36_0A05320"
                     /inference="similar to AA sequence:RefSeq:NP_015081.1"
                     /note="PKUD0A05320; similar to Saccharomyces cerevisiae
                     YPL243W (SRP68); ancestral locus Anc_6.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319413.1"
                     /db_xref="GeneID:40381646"
                     /translation="MDFPLANTFGVRHELFLQTVDDFHRHRHRVNKKINRLRRSLNII
                     TKDTKHYSEKNKTANLTSSDYELNKGFGDVLLYLIERDLVYAQETRLLMDVHSSKSRE
                     KFLISKYKKALKHVKNLFEIIVNEKNELVVLEVLVIASLIEGSLAISKKKYEKSLNAF
                     SISRCALQFLYSYQELPPQYTKELYYNIIDFIVDPALKVSASQCNTSRANDLAQLSKE
                     QAFQNKHMFPYLSKAIEIISKTNAAYVTPSDQSELKLLKELQWGSYSATIRSDDLSLA
                     IMKINEEVKGIMDEDSTSYDSSLLLYQDATELHTQEMARTEEEYDDSEKQEQYIISTY
                     LKYNYLLLRVRRDITILNGLNAAVERLKNVSKNKLLVSWKECLKVNDAIISSLEEVTD
                     LPGIANDDDLMDYINTLKAYFTIKKQLRLSQAYLISNKYIQALALVSNSRSLIENAKP
                     FSGETEGNLPRNEDLENMKEHVLEEESKLSILASHFNDSDDKIIIGSKYIVDNKDKFP
                     ALSGDNLLSHVAPTKVDIQPVHVKPVLFDIAYNYIGDSSSNSEQELQHVSSESGGRSN
                     EEGEKKKGFFGLFGR"
     gene            complement(<1165571..>1168927)
                     /locus_tag="C5L36_0A05330"
                     /db_xref="GeneID:40381647"
     mRNA            complement(<1165571..>1168927)
                     /locus_tag="C5L36_0A05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463554.1"
                     /db_xref="GeneID:40381647"
     CDS             complement(1165571..1168927)
                     /locus_tag="C5L36_0A05330"
                     /inference="similar to AA sequence:RefSeq:NP_014070.1"
                     /note="PKUD0A05330; similar to Saccharomyces cerevisiae
                     YNL329C (PEX6); ancestral locus Anc_3.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319414.1"
                     /db_xref="GeneID:40381647"
                     /translation="MTVSQTSVGDTEVSIHNSSIISGEKMKTRASHSVSVSVSLSMSA
                     QSSLEFVSLGRRLYAQLFGNETDVMHKMILVRFIGSSVLSTPKVFPVTVKTNLPHNMI
                     EIESLKYLQKYSGDFSILKAVIRRIDKIPPLDHIIASFPPEVYDILKDKSSEFIHRQI
                     CEERESSVDFAVIRTGDISHTLNGEILFTEPYEQGYINTQTAITIVKANGCHSTSINE
                     LTSQEQNFDDFDPFNFDDISNSMILNGKESIECEFNVSTLQLNTLKENTMLDQHSSEF
                     WYEDEMIYMCLTLHDFQKLQCLSGEIVKISSGSYDFLGRIFPFVGPCSFKPNSIYISP
                     LLALTLSNPKRIKISKLRAPNKLVNGERHRITKFIPLAKEVTIARVSTPVTTDKSLQH
                     LFMLNLKKYFESAHRVISFGQLIPIALDSSLARSIYETYSNKNRYPDQIPYGQQDCIA
                     WFQITGGSFKDPNNQGLADIEPGKQYFVNAQRTRMIQSGIVCSDLSSVNIPNISSYLN
                     IQPLFQFPNIYIAPNKVTFPYAKKLRKIFETATKTRGKLELQTIVMLTSNTRFVGKST
                     LLKTVCNDFGYSFVELNGHELLNSGLGMPAATVGIIRGKVDRLVESCERLVILIKHIE
                     SICKKGDEQQLEQKSVDDTLSMNITQLVRDYAKRGVVVVFTSKDADNVSDILRSKVKF
                     EIDVGVPNEPERKEIFKYLVDTEYSSKRSIFNNDGRYKYVARSDVNIDNLALQSAALT
                     ANDLNYIVKNVKLNALNRLRKESKKLEISLLDLIELNGSSVKLISKDFEESINRARNK
                     FSDSIGAPRIPNVKWEDVGGLDVVKSEILDTIEMPLKHPELFGSGMKKRSGLLFYGPP
                     GTGKTLLAKAIATNFSLNFFSVKGPELLNMYIGESEANVRRVFEKARDAKPCVIFFDE
                     LDSVAPRRGNQGDSGGVMDRIVSQLLAELDGMSGSDNGDGVFVVGASNRPDLLDEALL
                     RPGRFDKMLYLGISDTHEKQAKIIEALSRKFKLHPNIDLLKIAESCPFNFTGADFYAL
                     CSDAMLNAIIRTAGDVDRKLHKYNENRPEEDQLNLRQWFDKVATESDMEVLVSEEDFA
                     KARLDLVASVSEEELKHYLRVRENFEGGKN"
     gene            complement(<1168983..>1170503)
                     /locus_tag="C5L36_0A05340"
                     /db_xref="GeneID:40381648"
     mRNA            complement(<1168983..>1170503)
                     /locus_tag="C5L36_0A05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463555.1"
                     /db_xref="GeneID:40381648"
     CDS             complement(1168983..1170503)
                     /locus_tag="C5L36_0A05340"
                     /note="PKUD0A05340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319415.1"
                     /db_xref="GeneID:40381648"
                     /translation="MKEIIGGKGGPHEEKPETDNENHDIMEEDHQTLDNHVNQYFRDI
                     KQFTTTRSTEVADEDIDGTKNGNGITDVTFGDVDLDINLNIDRAISETFAHLSSQHVM
                     DKADGTKLGDPLRNITAENVSITPSTNLPQKVVRPVNLNKHNEHYTKLSASSDSKKVC
                     KFCGKTFQQTGSLGRHLDHQKGNELHPAEEVEKIRGNVARRGNPEEVRLRRQKKAKEY
                     NRRDYVKEKNRLRRRRATCKFNREKEAQQMAFYKNISYPTLPSHPSFPRMVLFFLPPS
                     LWPHDPPTTQTYKTLMVWLETNKDVMTKIPHLSNSNTIQSHISKLTIGFENWQTLSAE
                     SKKDMWNREQRVVLQQLLGELTVFDFAIRDKWAEHLIKEKLEINSSIQTSPEGLGCSQ
                     PKFDKEDTQFIDDSETGNEKPRKQAKNSESQPVVSMIDRMAHMDEIEDMDMDLHHFMP
                     IGGDDSDGSLQNNGEKENEEDGIQNDDDSDIDNNKIGESMTKSHQVAATASSGKIK"
     gene            <1170751..>1171257
                     /locus_tag="C5L36_0A05350"
                     /db_xref="GeneID:40381649"
     mRNA            <1170751..>1171257
                     /locus_tag="C5L36_0A05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463556.1"
                     /db_xref="GeneID:40381649"
     CDS             1170751..1171257
                     /locus_tag="C5L36_0A05350"
                     /inference="similar to AA sequence:RefSeq:NP_013789.1"
                     /note="PKUD0A05350; similar to Saccharomyces cerevisiae
                     YMR073C (IRC21); ancestral locus Anc_2.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319416.1"
                     /db_xref="GeneID:40381649"
                     /translation="MDSNNIKQGRLVNENRQEQRKPKTVFIRVPSNVTHENVSQNQRL
                     FPMAGSPQIASANKREKVRLAPHHSAMDWERRKKTTNVRNLHPSEFPLRVTKEELKKH
                     RNKDDCWVAFGDKIYNITAYLDYHPGGVDILLKNAGRDCTALFMKYHRWVNYERILDG
                     CFIGFLVT"
     gene            complement(<1171318..>1173975)
                     /locus_tag="C5L36_0A05360"
                     /db_xref="GeneID:40381650"
     mRNA            complement(<1171318..>1173975)
                     /locus_tag="C5L36_0A05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463557.1"
                     /db_xref="GeneID:40381650"
     CDS             complement(1171318..1173975)
                     /locus_tag="C5L36_0A05360"
                     /note="PKUD0A05360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319417.1"
                     /db_xref="GeneID:40381650"
                     /translation="MINCVDQQHRFVYSLSVTLIQRAMIVLLDNTLHAYDDPVRLFFD
                     YVRYISRQVTIFRVISTQTSSISEYLTNAKTTGDYLKGEVGPTNFREIWSGQRYGPAF
                     NASIEKYKDIHSKKDDYVSIIPLVNQHDEFLKRWYILNEARSHFKLPHEIAIDPVKRL
                     VKSLKSAIRHFSRNIDVPYPDPNWVLNYFIVTPNQEKKIKEMLKIMKGMGVPLPIVSI
                     VDIIKEYQDVLLEMKCSKFLKDSVPVSDFARYCIVLRHHIFGADPRARKDLVLFWKLI
                     WEEWNCTSDEERSRKMIGDVGLHRGWADDDEMGLFIESSEGSEEEISWNIDDSLECVL
                     EDTIGESSTYTSDVSPRPIAKELVTHPNEGFTDSRFDVDITDTNRTLSLEDTQSLAGA
                     DATDITHDLHKEDQTIDLELKAACAKSSEPQIVLENQDYNEDKSHMSTSSVSENLDIN
                     KNELEMTLVSDHLNETPNEIKGADKETKDEIHVENLGTCELSLVSDTYTSRLSKISPT
                     SPGYDADTNEELCDIDNVNIDQILEDGIEQYFPQSKIVPAKSFRSDSIFSAISTATDI
                     DPDLFKEPGALTAMLDVSSSSAGSSALNSELDNDDIIIPLRSLEGKDETIPEKIDMFE
                     KLSGHTRKHRQLNHGISYEDTVASEAETENVKRILKPAIKRADTSTVLELKEFIENKP
                     ELISLKTVTDFEDPRKAIAKKHSVKKGRSISEIFSALLDDNMRDLSVSAEYKNKIVRP
                     QDLYNRIKIDSDKPWELLSRRTKEKYYGAFLRRYDDVINTPESGKLVLSDLLEIVKVC
                     VDFNDYKHKVIQYAINIVDQDDLSSRQSSTDNDNSDIESLMSLKSRNSHRSIQSLANN
                     QFISSMNMQRGSSNNSFNSMQGLFKTENS"
     gene            complement(<1174182..>1176185)
                     /locus_tag="C5L36_0A05370"
                     /db_xref="GeneID:40381651"
     mRNA            complement(<1174182..>1176185)
                     /locus_tag="C5L36_0A05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463558.1"
                     /db_xref="GeneID:40381651"
     CDS             complement(1174182..1176185)
                     /locus_tag="C5L36_0A05370"
                     /note="PKUD0A05370; Pfam Domains: Cu_amine_oxid(7.2e-172)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319418.1"
                     /db_xref="GeneID:40381651"
                     /translation="MAPHPFDQISDEEVRITVKLIKDAYPNDKPVFAQIDRLDPAKNL
                     MVPYLEAERQGIAPPLIPRRAYAYFYIDQEFHKALINLTFKHIICDERLPEGVIGPLI
                     PDQVEEIEQLSVNHPVCKAEIEKLCLPDNIHVVCDPWIYGTDDPNEKRLLIQCYMYLA
                     NKNHTESNHYSLPLKFSPVFDGLTKEFVRMDYLPSGADEFVINDTTVWDEFPLVEYHP
                     DLNGVTKLREVKPLIISQPEGVSFTVDNHKITWQDWEFYVVPNAREGAVIYDIHFKGR
                     SIIYRLSLSEMTVPYGDPRAPFHRKQAFDLGDCGFGVNGNVLNLGCECLGVIKYMDNR
                     AVTADGDVKIIPNTVCLHEQDAGILYKHVNYRTGNSVVARRREFVVQIIATVANYEYA
                     VQYIFDQVGEIKISVRATGILSTMPIDRDVDVNYGTLVGPRVMAAYHQHLLSFRIDPA
                     LDGHNNTVVYDDVLKMPENTKLNPYNVGFYTERKYVEKAGHIDQSPFTNRAYKIINEN
                     VINPTSKKPVGYKIVMPARQMIMASPDSYNTKRAKFATEQIWVTKYKEDRIYAAGEFT
                     NQSQNDTGLAVWANGEDDVRNTDNIVWCTLGFTHIPKPEDFPVMPVEMHEIGITPFGF
                     FEKNPALDLPQANNAFNKSQLYEENRKNAKSVSSANCCKKASL"
     gene            complement(<1176623..>1177048)
                     /locus_tag="C5L36_0A05380"
                     /db_xref="GeneID:40381652"
     mRNA            complement(<1176623..>1177048)
                     /locus_tag="C5L36_0A05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463559.1"
                     /db_xref="GeneID:40381652"
     CDS             complement(1176623..1177048)
                     /locus_tag="C5L36_0A05380"
                     /inference="similar to AA sequence:RefSeq:NP_013790.1"
                     /note="PKUD0A05380; similar to Saccharomyces cerevisiae
                     YMR074C; ancestral locus Anc_2.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319419.1"
                     /db_xref="GeneID:40381652"
                     /translation="MDDSELQAIRAARLQEMQRNAAGGGPSPGSTAGQATGASSNQND
                     AIMSQLLTPEAKQRLNRVRMVKPDRVQGVENYLLRLYQSGGLRNKVQEKDIVDILDKI
                     ANEERKNATTTIRFERRDYEGGDRDQNDKDDSEDDFFDE"
     gene            <1177300..>1179120
                     /locus_tag="C5L36_0A05390"
                     /db_xref="GeneID:40381653"
     mRNA            <1177300..>1179120
                     /locus_tag="C5L36_0A05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029463560.1"
                     /db_xref="GeneID:40381653"
     CDS             1177300..1179120
                     /locus_tag="C5L36_0A05390"
                     /note="PKUD0A05390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029319420.1"
                     /db_xref="GeneID:40381653"
                     /translation="MVEEALVEHRLDSQKLLGDKQVIDAFDGILVVLHRALVYYIEIA
                     GHLTLAFEKVYDSSITIDSVKYYDGKLFVAYRGCDYALKKENIMLDVLDYQLEVLSKG
                     SFQDASFNKGEVVTAFKLIFNYLMVVLESYNYIVLPLLSGDAYRMLYTANDNNIFFIF
                     ESCGPALYKREIQKTASGCKLIDIPWSVKQVIKYCKSDDYFCVQEFNTDYIIFSSENK
                     ISYFSFTDPSNYFTVDFHGPITSSTKWNDQIIVVFDDKSIFTLDINSKEYHPLIEPIT
                     VWTNSIQNTSNLLILHSPKTGLVTINKRTLQVGYARDTIHTFQRMNASVAAVYAFYSP
                     EDNLIVAYSDGGDSILIKHEDDYTYKYLSNVISIKSAVCNHFNFKENTIILSFAGVYL
                     VSYPLQVIAEFPIDDPLDIKYDYKLDRFIVSTYSNNETGISSLYILTPGLQLDKRMDK
                     KAHFGFYLDVGTQGFFDNTKYYSYIDNKRKESFDVKHRPTDTTDFIYQHNCLIYKSAY
                     DFVCCERSTGVETVTPRITSFTKIDEDRVLLFFNETVSVFDVRTKQVEELLKGKRAFK
                     PTDINLHILDVDNKVKLKLKKGRFLTSISSFYTVIEYEST"
     gene            complement(<1179305..>1180612)
                     /locus_tag="C5L36_0A05400