GenomeNet

Database: RefSeq
Entry: NC_042507
LinkDB: NC_042507
Original site: NC_042507 
LOCUS       NC_042507            2745854 bp    DNA     linear   CON 16-JUN-2019
DEFINITION  Pichia kudriavzevii chromosome 2, complete sequence.
ACCESSION   NC_042507
VERSION     NC_042507.1
DBLINK      BioProject: PRJNA545694
            BioSample: SAMN08558011
            Assembly: GCF_003054445.1
KEYWORDS    RefSeq.
SOURCE      Pichia kudriavzevii (Candida krusei)
  ORGANISM  Pichia kudriavzevii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
REFERENCE   1  (bases 1 to 2745854)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Population genomics shows no distinction between pathogenic Candida
            krusei and environmental Pichia kudriavzevii: One species, four
            names
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2745854)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2745854)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 2745854)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP028774.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 01-DEC-2017
            Assembly Method        :: HGAP v. 3
            Assembly Name          :: UCD_Pkud_6
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 93.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2745854
                     /organism="Pichia kudriavzevii"
                     /mol_type="genomic DNA"
                     /strain="CBS573"
                     /isolation_source="lab strain"
                     /type_material="type material of Candida krusei"
                     /db_xref="taxon:4909"
                     /chromosome="2"
     telomere        1..269
     gene            complement(407..478)
                     /locus_tag="C5L36_0Btrna5G"
                     /db_xref="GeneID:40383851"
     tRNA            complement(407..478)
                     /locus_tag="C5L36_0Btrna5G"
                     /product="tRNA-Gly"
                     /note="PKUD0Btrna5G; codon recognized: GGA"
                     /db_xref="GeneID:40383851"
     gene            1339..1422
                     /locus_tag="C5L36_0Btrna11L"
                     /db_xref="GeneID:40383829"
     tRNA            1339..1422
                     /locus_tag="C5L36_0Btrna11L"
                     /product="tRNA-Leu"
                     /note="PKUD0Btrna11L; codon recognized: UUG"
                     /db_xref="GeneID:40383829"
     gene            4468..4540
                     /locus_tag="C5L36_0Btrna3A"
                     /db_xref="GeneID:40383834"
     tRNA            4468..4540
                     /locus_tag="C5L36_0Btrna3A"
                     /product="tRNA-Ala"
                     /note="PKUD0Btrna3A; codon recognized: GCA"
                     /db_xref="GeneID:40383834"
     gene            8201..8282
                     /locus_tag="C5L36_0Btrna4S"
                     /db_xref="GeneID:40383847"
     tRNA            8201..8282
                     /locus_tag="C5L36_0Btrna4S"
                     /product="tRNA-Ser"
                     /note="PKUD0Btrna4S; codon recognized: UCU"
                     /db_xref="GeneID:40383847"
     gene            <8643..>9125
                     /locus_tag="C5L36_0B00100"
                     /db_xref="GeneID:40382508"
     mRNA            <8643..>9125
                     /locus_tag="C5L36_0B00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464361.1"
                     /db_xref="GeneID:40382508"
     CDS             8643..9125
                     /locus_tag="C5L36_0B00100"
                     /inference="similar to AA sequence:RefSeq:NP_013616.1"
                     /note="PKUD0B00100; similar to Saccharomyces cerevisiae
                     YML094W (GIM5); ancestral locus Anc_8.873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320220.1"
                     /db_xref="GeneID:40382508"
                     /translation="MSVDLNTLQPQQLMAVKQTTQTELAHLQSSYDALNVARKKYKDC
                     ISSVNNIVKSGEQEMLVPLTSSLYVRGTNAVDKFKIDIGTGYFVEKDDKEATSFFDKR
                     INKLSSDSGKLQALIEEKLQLLNKINGVIREKIALAQQQQQQQQQQAQQEKAGTQQDA
                     "
     gene            <9623..>11173
                     /locus_tag="C5L36_0B00110"
                     /db_xref="GeneID:40382509"
     mRNA            <9623..>11173
                     /locus_tag="C5L36_0B00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464362.1"
                     /db_xref="GeneID:40382509"
     CDS             9623..11173
                     /locus_tag="C5L36_0B00110"
                     /inference="similar to AA sequence:RefSeq:NP_012382.2"
                     /note="PKUD0B00110; similar to Saccharomyces cerevisiae
                     YJL153C (INO1); ancestral locus Anc_1.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320221.1"
                     /db_xref="GeneID:40382509"
                     /translation="MPSIKVNTDRVTYTKDTLTSNYTYENSIVTKSNDTFEVNNVSTD
                     LTFKLDLKVPKIGVMLVGLGGNNGTTFVAASLANKHGIEFQTKEGPLKANYFGSVTQS
                     STIKLGIDENGEDVYVPFNSLVPMVNPNDFVISGWDISKLNLYEGMKRAQVLEYDLRE
                     QLKTYMEKIQPLKSVYYPDFIALNQDSRADNCINRDGESGEVNTKDKWSHVEAIRKDI
                     SNFKKDNGLDSVFVLWTANTERYSDLIKGVNDTSENLLKSIKEGHEEVSASTVFAVAS
                     ILEGCPYINGSPQNTFVPGVIDLAMKNDVFIGGDDFKSGQTKFKSVMAQYLVDAGIKI
                     RSIASYNHLGNNDGYNLSSPRQFRSKEISKASVVDDVIASNDILYGNGEKIDHCIVIK
                     YLQAVGDSKVAMDEYYSELMLGGHNRISIHNICEDSLLATPLIIDLLVMTEFLTRVRV
                     SKNGGKDEKMYGVLSFLSYWLKAPLTRENYKPVNALNKQRMAIDNFLRILVGLKPLEE
                     LRFEERLK"
     gene            complement(<11401..>11658)
                     /locus_tag="C5L36_0B00120"
                     /db_xref="GeneID:40382510"
     mRNA            complement(<11401..>11658)
                     /locus_tag="C5L36_0B00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464363.1"
                     /db_xref="GeneID:40382510"
     CDS             complement(11401..11658)
                     /locus_tag="C5L36_0B00120"
                     /inference="similar to AA sequence:RefSeq:NP_878113.4"
                     /note="PKUD0B00120; similar to Saccharomyces cerevisiae
                     YKR095W-A (PCC1); ancestral locus Anc_5.705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320222.1"
                     /db_xref="GeneID:40382510"
                     /translation="MPFPVSVQVNIPFGSIEQARIARDALRPDPVLKSDQSSLEYSVQ
                     DSQLNISVRGVDDRIVRVSVNNVLENLKTIIECFEVFSQSG"
     gene            <12136..>13641
                     /locus_tag="C5L36_0B00130"
                     /db_xref="GeneID:40382511"
     mRNA            <12136..>13641
                     /locus_tag="C5L36_0B00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464364.1"
                     /db_xref="GeneID:40382511"
     CDS             12136..13641
                     /locus_tag="C5L36_0B00130"
                     /inference="similar to AA sequence:RefSeq:NP_010542.1"
                     /note="PKUD0B00130; similar to Saccharomyces cerevisiae
                     YDR256C (CTA1); ancestral locus Anc_8.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320223.1"
                     /db_xref="GeneID:40382511"
                     /translation="MSNNPPVYTTSSGCPISDPFSTQRISVDTEGYEYKTPVGPLLLQ
                     DFKLIDSLAHFDRERIPERVVHAKGAGAYGYFEVTEDISDICSAKFLNKVGKKTKIFT
                     RFSTVGGETGSPDTARDPRGFSTKFYTEEGNLDLVYNNTPIFFIRDPTKFPHFIHTQK
                     RNPQTHLKDANMFWDYLTNNVESLHQVMYLFSERGTPASMRTMNGYSGHTYKWYNAKG
                     EWHYVQVHFISRQGVHNLNNEQAGKLAGENPDYHTQDLFESIEKGEYPVWDCYIQTMT
                     LEQAKKLPFSVFDLTKVWPHSDFPLRHFGKFVLNENPQNYFAETEQVAFSPSNTVPSM
                     QPSNDPVLQSRLFSYPDTHRHRLGPNFHQIPINCPLKSGSFAPQIRDGPMCVDGNLGA
                     TPNYAGAYNCPVQYAAPAKISPKGTDEKYIDEVVPVHWEITDYDFVQPAKFWDVLGRT
                     PGEQEALVHNVAAHVSAAKPFIQERVCDYFSKANPVIGKLIKEELKKLAKL"
     gene            <14924..>16498
                     /locus_tag="C5L36_0B00140"
                     /db_xref="GeneID:40382512"
     mRNA            <14924..>16498
                     /locus_tag="C5L36_0B00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464365.1"
                     /db_xref="GeneID:40382512"
     CDS             14924..16498
                     /locus_tag="C5L36_0B00140"
                     /note="PKUD0B00140; Pfam Domains:
                     Complex1_51K(2e-74)|NADH_4Fe-4S(5.2e-20)|SLBB(6.3e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320224.1"
                     /db_xref="GeneID:40382512"
                     /translation="MLVYNYQDQTVRHVIIHTMFSMKSSSINKQIKSIREARRLFATL
                     ESTPNRVHGGLKDKDRIFQNLYLQNSKKQGAEPWDVKASEKIGDWYKTKEILLKGDKW
                     IIDEIKKSGLRGRGGAGFPTGLKWSFMNPPNWEKNVGPRYLVVNADEGEPGTCKDREI
                     IRKEPQKLIEGCLVAGRAMNATAAYIYIRGEFYNEAVILQHAIDDAYKQGKIGKNACG
                     SGYDFDVYIHRGMGAYICGEETALIESIEGKQGKPRMKPPFPAGVGLFGRPSTVANVE
                     SVSVAPTIVRRGADWFASFGRERNSGTKLFCVSGSVNEPCTFEEEMSLPLRDVIEKHC
                     GGVVGGWDNLLAVIPGGSSTPILDAETCQDQLMDYDALRDAGSGLGTAAVIVMNKQYD
                     VIRGIQRLSAFYKHESCGQCTPCREGSTYISKMMDRFVVGQANEKEIQQALELTHQVC
                     GHSICAMGEAFSWPYQGLVKSFKPLMLERIKQYKAQHGLTDGGLNHGGWYEGAEIKNG
                     EVINNPMPREAFHGHH"
     gene            <17008..>17955
                     /locus_tag="C5L36_0B00150"
                     /db_xref="GeneID:40382513"
     mRNA            <17008..>17955
                     /locus_tag="C5L36_0B00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464366.1"
                     /db_xref="GeneID:40382513"
     CDS             17008..17955
                     /locus_tag="C5L36_0B00150"
                     /inference="similar to AA sequence:RefSeq:NP_009746.1"
                     /note="PKUD0B00150; similar to Saccharomyces cerevisiae
                     YBR187W (GDT1); ancestral locus Anc_8.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320225.1"
                     /db_xref="GeneID:40382513"
                     /translation="MKLSKVLSAFILVSGAVAVYPPPEGVDTNAEGLVTIQNVNQLEN
                     NKNLDTKDSEADQQLPKSSVPSGDSKKKAATSLHDSETLTPFYSFYLAISMIVVSEIG
                     DKTFLIAAIMAMRYPRMVVFSAASSALVIMTVLSGAIGHILPQLLSPTITRTAAAVLF
                     FAFGIKLLRESFETSKDAGVEDELAEVEEEISTVELNELSSDLEKGIKVDASDWKTKL
                     KNLLSYISSPIWYQTFMMTFLGEWGDRSQITTIAMAAGADWDMIILGGSIGHVLCTLL
                     AVLGGKYVSTKISLKTILLGGSIAFFIFSGLYGYSAYYE"
     gene            <18669..>19271
                     /locus_tag="C5L36_0B00160"
                     /db_xref="GeneID:40382514"
     mRNA            <18669..>19271
                     /locus_tag="C5L36_0B00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464367.1"
                     /db_xref="GeneID:40382514"
     CDS             18669..19271
                     /locus_tag="C5L36_0B00160"
                     /inference="similar to AA sequence:RefSeq:NP_116608.1"
                     /note="PKUD0B00160; similar to Saccharomyces cerevisiae
                     YFL046W (FMP32); ancestral locus Anc_8.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320226.1"
                     /db_xref="GeneID:40382514"
                     /translation="MFGRRCIRSFHTSPLNLSIKGPNFNTQRFVDDITRDGKFTEEQA
                     KVAANIIANSINDGIELYASNLITREVLNKMSYKQKVDFAKLKGELQMIDKSDFNSIK
                     NENERLRSELEKMRIKFKEEINKSLSSVRLDLSLEKGRIREESSIYDLKIKETDTRIN
                     QEIYNLKVQIDSVKTTVLQWLFGVCAGTFSLVLAYARLVS"
     gene            complement(<19472..>20227)
                     /locus_tag="C5L36_0B00170"
                     /db_xref="GeneID:40382515"
     mRNA            complement(<19472..>20227)
                     /locus_tag="C5L36_0B00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464368.1"
                     /db_xref="GeneID:40382515"
     CDS             complement(19472..20227)
                     /locus_tag="C5L36_0B00170"
                     /inference="similar to AA sequence:RefSeq:NP_116609.1"
                     /note="PKUD0B00170; similar to Saccharomyces cerevisiae
                     YFL045C (SEC53); ancestral locus Anc_8.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320227.1"
                     /db_xref="GeneID:40382515"
                     /translation="MSFADREFPKTICLFDVDGTLTPARLTVSPEMKQVLKELRKKCA
                     IGFVGGSDFSKQLEQLGPTVLEDFDYCFSENGLTAYKQGKALPAQSFINWIGEDKYNE
                     LCKFILRYLADLDLPFRRGTFIEFRKGMINVSPVGRNCNTEERNEYEKFDLPNKVREN
                     MVLALRENFKDLDLTYSIGGQISFDVFPTGWDKTYCLRHLEDEKFDTIHFFGDKSYKG
                     GNDYEIYTDERTIGHAVTSPEDTIAQLKEIFKF"
     gene            complement(<20523..>21830)
                     /locus_tag="C5L36_0B00180"
                     /db_xref="GeneID:40382516"
     mRNA            complement(<20523..>21830)
                     /locus_tag="C5L36_0B00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464369.1"
                     /db_xref="GeneID:40382516"
     CDS             complement(20523..21830)
                     /locus_tag="C5L36_0B00180"
                     /inference="similar to AA sequence:RefSeq:NP_013778.1"
                     /note="PKUD0B00180; similar to Saccharomyces cerevisiae
                     YMR062C (ARG7); ancestral locus Anc_2.628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320228.1"
                     /db_xref="GeneID:40382516"
                     /translation="MLRHVAKRSFGSLGIPQNKLKYIPKGGFYPKGFKVGSVASHVKK
                     TGAPDLALIHSAKPCTAAGVFTTNKFKAAPVIVDKENLTLKKNEDFHSIIINSGCANA
                     VTGNGGLSDAKDIINYVDKALHGTTYPVSKTLTMSTGVIGQRLQVDKIKSGIDNIVTE
                     IDSQHEDWLKCAKGIMTTDTFPKLISRNFKINGIEYNIAGLVKGAGMICPNMATLLGL
                     IITDAPIESITLQNLLSKSVDKSFNCISVDGDMSTNDTILSLSNGQSGGELITEQSGE
                     VYEVFEKNFKEIAIELAKLVVRDGEGATKFITIKVKNAKNDEEAKQAANSVSNSALVK
                     TAMFGKDANWGRILCAIGYSEIDVEPTKTNVSFVPSDGSAELKLLVNGEPQLVDENRA
                     SEILEHEDLEIAIDLGLEGKGECTFWTCDLTHDYVTINGDYRS"
     gene            <22256..>23911
                     /locus_tag="C5L36_0B00190"
                     /db_xref="GeneID:40382517"
     mRNA            <22256..>23911
                     /locus_tag="C5L36_0B00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464370.1"
                     /db_xref="GeneID:40382517"
     CDS             22256..23911
                     /locus_tag="C5L36_0B00190"
                     /inference="similar to AA sequence:RefSeq:NP_013791.1"
                     /note="PKUD0B00190; similar to Saccharomyces cerevisiae
                     YMR075W (RCO1); ancestral locus Anc_2.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320229.1"
                     /db_xref="GeneID:40382517"
                     /translation="MLRKSEKNNNAIPQRRLRASRLSATQSSADVSGNGGGDGETDGV
                     NAFTEPPLGDSIIVTGQKIEESPTVKIKKELGVFSKGKSSENSLDDSRLQKYVEGLKN
                     RKEVEESTVLSDIRTPLITRENVVSKVGKANSKKNRKKHQLLNRPKDFLDISKKLALG
                     SLSPSESPAQPVASSADEGVENNDYCSCCGMTGMFLCCESCPKSYHFHCINPPIDPNN
                     LPEFWYCKECIKKKAKREALSANSLTVNVGIFSKLFDNILFQDPISFQVPKEIIESFE
                     HISSDRLGDFNDDSFKPAKTYKQLIKEYDDPLNGVYDANGNPYFCYKCGESGLNNEII
                     NCDYCDLSWHLDCVDPPLASVKKLGTKWKCPAHVDDLYKPIRKFKDQSVVPISSIENF
                     ENVMGKLPINANIQINNIEDKLDALKNQIKTLHGNNHDTSKLKFSNLTFQINEEDIVL
                     NFIKQSKVKRLNENTKNIETLMKLQPTLKDYVLSLSQLSNRNILDNEFRVSNLQKLLK
                     VADEELKVELNEFSKEELRELLLVKKMLLRKGKDKVMQFLKSS"
     gene            complement(<24049..>24567)
                     /locus_tag="C5L36_0B00200"
                     /db_xref="GeneID:40382518"
     mRNA            complement(<24049..>24567)
                     /locus_tag="C5L36_0B00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464371.1"
                     /db_xref="GeneID:40382518"
     CDS             complement(24049..24567)
                     /locus_tag="C5L36_0B00200"
                     /inference="similar to AA sequence:RefSeq:NP_012530.1"
                     /note="PKUD0B00200; similar to Saccharomyces cerevisiae
                     YJL004C (SYS1); ancestral locus Anc_5.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320230.1"
                     /db_xref="GeneID:40382518"
                     /translation="MALLSNLRWKINTLIESTIASSNLSVRYASQIILLQVLYYLSAS
                     VIFRVTYAVLGWSYSAGVLLNWTDISVENTFGLTLILLWLFNALVSVVIVTLIIGRSK
                     LVWDFVITIHFLHFVLVWIANGIPKNIYWWLLQIISSVFMIVLGTYLTRKIELRDTFF
                     ENMTDIELANSK"
     gene            <24870..>28685
                     /locus_tag="C5L36_0B00210"
                     /db_xref="GeneID:40382519"
     mRNA            <24870..>28685
                     /locus_tag="C5L36_0B00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464372.1"
                     /db_xref="GeneID:40382519"
     CDS             24870..28685
                     /locus_tag="C5L36_0B00210"
                     /inference="similar to AA sequence:RefSeq:NP_013793.1"
                     /note="PKUD0B00210; similar to Saccharomyces cerevisiae
                     YMR076C (PDS5); ancestral locus Anc_2.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320231.1"
                     /db_xref="GeneID:40382519"
                     /translation="MTEGRRLKFKEEIVSTVSNPISTRELLTRLAELHQELSILEQSQ
                     IDLASLSVVKEQLVNKKLLKNTNRGVQALVCCCLTDVLRLFAPDAPYSSSTLASIFRL
                     FLQQFPFLDDQDSVYYPHYVYMLERIAEVKLIALMTDLDHNEKLIVRLFETFYALTSN
                     ESFDKEKLQPALISILNEVISEANQLDLRVLKLILNKFLANSKNMKNQSNIRVPGFDL
                     SLALCEINSDKLSRLVTYFFSEMILEATKNDDAYDMDYSESDDSEDNKNNSRDGQGPM
                     IDMVQMKKIHTLAVELWRYVPEMLTSVLGLLDNELEADDPLVRSIATDTISKMLAMQP
                     SRINFPATFASTYLNWLKKPFDISISLRRTWINGSAEILEARNDITSDIVNGLLKTLV
                     DSNDKVRLQTIVELKKLKPSTFLDKVMKDSLMDTLFKLIREKHHTIRTEIINFLSTIY
                     NYATKEETHRSHRMIQDIPNHILNLIYINDNTINAEVDIALCEKILPFSSNTEARVNR
                     LLFTLSVLNDKARQSFLAILRRQPQVSKVILQLIAIIEDEEDEHKDQKIGNAVKWLSK
                     GFPPTYNPQESLQSFISLDNKRFFRLLRVISTPSSDYDTIVNGMKEILNRLRDGKLFD
                     QNKLFESVKTGEIYNTIQLLMLRSSNVFLNVDNITELIEINNDSTHQFNQAAKLLLTN
                     ISIIYPENLSSSIKGIVDRLVEKARNIDFCGTRIHSDCWKDLKIIHKFLENGDRVCGN
                     REFYDTLFDFSIKGTVLEAKYSVKIMNKMEEEIKGVYFVKMVHHVWPLNIGSSFFNTH
                     LSALCSLFLCDLISVDHIKEELSEFLASEVLLKNRLKEEENEEAKLSTWISDEDLNYS
                     IENTNCYSKILAMKLLTNWLISISDYPTAEVEQIAKPILSMLSSFINRGGEIVSTNDT
                     PPRFASRLRVHAGIELTKLSQYPSYETLIDQRRINRLILLVQDVEMNVRKLFLEKLKK
                     KIIQNRVSKKFLPLIFFTAFEPEKSLKLTTTTWITALFTKRASSSNTEALIFEKSYIR
                     LLHMLGNHPEFKELFGSYTEVDDSQEGTKHDAFKEMSMFAITHIVYALSLISTFDNIS
                     LLYYLSQRIKQFEAISTIEGEHSDTAIYFISDLSQAALKYIGKVKNWNISIWPNQLSL
                     PSDLFSKLSNDKANENVKTNFIPDKYASAIDELIRLRWRAEHTPAKSRKNKKKHSQLE
                     VQALEDGEDNTGKRNFTKKRKNSDDGGIRSLKEGDQDYVEKSTKGSKYKGVRRSKRSR
                     RVDYNEETY"
     gene            complement(<28802..>30247)
                     /locus_tag="C5L36_0B00220"
                     /db_xref="GeneID:40382520"
     mRNA            complement(<28802..>30247)
                     /locus_tag="C5L36_0B00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464373.1"
                     /db_xref="GeneID:40382520"
     CDS             complement(28802..30247)
                     /locus_tag="C5L36_0B00220"
                     /inference="similar to AA sequence:RefSeq:NP_014893.1"
                     /note="PKUD0B00220; similar to Saccharomyces cerevisiae
                     YOR250C (CLP1); ancestral locus Anc_8.690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320232.1"
                     /db_xref="GeneID:40382520"
                     /translation="MDFGLARIDVEIPAFNEWRVETPKNSTFTLKLESGTAEIFGSEL
                     SPDLTYVFKEEMKFAVATYHGCKISYTCTVPLDLEYISEETILKQMLNLHLAIENCSV
                     GGKYPRILIIGPKDSGKTSLARTLAAYALKTSEKQPMLINLDPHLPHFGIASQLSVAK
                     LYDSLDIETSTIAESLTTGPGTGLYRSQVPHLKCFGLEKFNENLELYKSLISELSVEL
                     DAKMKASKDCGTVIIDTPSFNVSDWKLIQQIVDIFHVDLLLVVGNERLLVDLRKKLTL
                     ESNVTMIKTPRSSGCIEKEAKYERDLQQRSIRQYFYGVERSRLNPFTFHSSVKDFIFL
                     QPNTNEPNAEFLDFMAGDADDIVKTEAADDDYNPAMQSDSHLAVPIKRNWKYKQMLRY
                     IEEPKEVDLINSVVAIIDDKDFNFNKWSKLEGDEKLSELNKFVTTQSVLGYSYVSSCD
                     DTTGKIKLLVPSPVSSMPGKILIVTEMRYQE"
     gene            <30476..>30976
                     /locus_tag="C5L36_0B00230"
                     /db_xref="GeneID:40382521"
     mRNA            <30476..>30976
                     /locus_tag="C5L36_0B00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464374.1"
                     /db_xref="GeneID:40382521"
     CDS             30476..30976
                     /locus_tag="C5L36_0B00230"
                     /inference="similar to AA sequence:RefSeq:NP_012945.1"
                     /note="PKUD0B00230; similar to Saccharomyces cerevisiae
                     YKR020W (VPS51); ancestral locus Anc_1.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320233.1"
                     /db_xref="GeneID:40382521"
                     /translation="MSSTEDSNSKKSASETLREQRAALQNFYKLSQQGPTTRVPPPSN
                     STEEVEKPPLFELPRASFTFSSAEINPIEIEDLDEFVKTEPYQNIIKAEVEALDSLNS
                     SKSEIKSIIYNNYYELIKINNVLEDLVRPQEGEVQFEKMNENLDTIRKNIDKIKAADI
                     DIFNDI"
     gene            complement(<31073..>33430)
                     /locus_tag="C5L36_0B00240"
                     /db_xref="GeneID:40382522"
     mRNA            complement(<31073..>33430)
                     /locus_tag="C5L36_0B00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464375.1"
                     /db_xref="GeneID:40382522"
     CDS             complement(31073..33430)
                     /locus_tag="C5L36_0B00240"
                     /inference="similar to AA sequence:RefSeq:NP_009660.1"
                     /note="PKUD0B00240; similar to Saccharomyces cerevisiae
                     YBR102C (EXO84); ancestral locus Anc_3.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320234.1"
                     /db_xref="GeneID:40382522"
                     /translation="MVEINRRFSRAQFGQQYVPNSSPFPQPIGNQNMGTNSSLNLSEY
                     NNSKTRLQIPPNMKSSDSIFSVGTNATNATKRRFSMRNNAPKNYTTDNYSAPPLPATA
                     HSQIISESYTSFQDMDTVGENDGNESFETENGYKKSPHDVLLELGNSNFNVDQFMKEQ
                     LVNADASQIDDFIQTVDELNISNEKSVKYILTDSTSQVLNVSKAFKETHDGLVSLKPK
                     INELTDVLSQQLEAAQEYLSKIESDGRGNTNLAVPSNINRQSVMFLQSRWNASVKKIY
                     AEVARAHDLLPYSESRHVINTSHRWSELNSITCKHVRPVTITIFNDSILVASKTNSSN
                     TGSALRENSKVFKYTAIYFWSIESVTIQKCALGKASNSKDPSASSHIKSKGSGNTKNT
                     ALLIENKDTNQTFLFSADIEKDFSDTISAIKRARNEVASNKRRSARDSTSAHARADSR
                     ISITLDERSSNLERKIKPEFNQCVLMIDDLMTSVSLELGLKRFDECVGYLKSLEGELE
                     TLSQIAIAVGVPKALLNKSTFPSSKVQVSVFAQHVHLIYNLKSSECRSLTDRLVKTLL
                     VEVECSTSDKKYMKEIIEIFKVLNKEKEAVETYLKSRGKELEDCVGMIRVGGSGLSSG
                     NISIDLMNQQYVVRNDSVSNRRSGIMSRPSSVGGTPESELAVPKKTTDVTVDVVGELV
                     TAYVRELSLVYMGYISRVCDEWNEFFIDESDNPKETQKAKKLSNIRLIEWVNGYIEEM
                     KRSVQLTLMDYDKSGEVFRSSVEIMKNVFDGLKDREMNVDYLLEL"
     gene            complement(<33696..>37268)
                     /locus_tag="C5L36_0B00250"
                     /db_xref="GeneID:40382523"
     mRNA            complement(<33696..>37268)
                     /locus_tag="C5L36_0B00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464376.1"
                     /db_xref="GeneID:40382523"
     CDS             complement(33696..37268)
                     /locus_tag="C5L36_0B00250"
                     /inference="similar to AA sequence:RefSeq:NP_009385.2"
                     /note="PKUD0B00250; similar to Saccharomyces cerevisiae
                     YAL017W (PSK1) and YOL045W (PSK2); ancestral locus
                     Anc_7.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320235.1"
                     /db_xref="GeneID:40382523"
                     /translation="MPYTAPSRSISRSQTSTPSEHSNSNSTRSQSNKDDRFHKFMNQT
                     NDSFLNSPQTNTMSKFYLLDDTTSAESLESVRSNNGKSRSRSSTSSQRGSLLADDLNM
                     SKFYAKQSVHSDSTQDLVDFTTESIQSYSYTPISNNSLTMRMNVLKRSMEILLENPSW
                     LNSSVEKFPNFDSQSIINSVSQGPKLKDLINSERSVSSSTLQTLIQSTLSSDANFSSS
                     PEIPPDSHFLSRRSNSNASSVSTSSLHINFSDELLKDLKDMLKLLKNYQSDDTDTVLC
                     NDGRESPSKPSSPSSSSKFQKGVLDLHELSLANVDKIPKSASSLEDAGRRDFLKIKLL
                     HALATPFINNQKPSSLSSPTSNVAGIPMLTSTSTLGLSELNDQSYSSSSSKKFHASSN
                     AKTKSPKAVFTVSRDSPWNIMNANDLGLLMFGFSKSSIVKMNLIDLIAPRSRDLVINR
                     LHRDKNLVFSGEIIAVKRNNKSLAWTSLWAKRRDNLIILIFEQVVCETIDMIIERKGA
                     IDNGFHVLEILKQNQRLYHKYLKSECLSSFLPSMDRILQNSLKDTFTDDDITSDHDSN
                     IINSLRYFTLKRENGDYVPCAVTSESLYIDNNEHDVKSYIRVNLHSLPYIAGLFLIDS
                     KDYQIQSFNEAIARNLFGTSDLINQNIDLILPEFSTLMELAIRENPNLVHQEGLVLPE
                     HYFRKLQSFIRGKDDNERENLFLACRGVKGKHLDGHFITVDIQLHVTKNGMFLIWITF
                     CRSFSKNVHKLDMIGLDPKSIIHPNSADSQELLKKAHQYQPHHESHHLNDDTTDSNNL
                     PSQLKLLEHKHRDLDSQGSGTTSNISRSSSLRTLNPNTSSISSPVTPKYDEIRRTADT
                     SPLDAIDVALPLESENFSKVNKSFGMSAQKTCAELLQEEEEELQYLREHSLYFPKIIG
                     AEKRTKKFSDFKILKNLGQGAYGKVVFAQYKKDPLYQDCVKAIFKERILVDTWVRDRT
                     LGTVPSEIQILYSLNKYPHANIMRIVDFFEDQNFYYLETLQHGSKGSGAVDLYDIIEV
                     KKDMTEYEAKYIYFQIVAALTHMHSHGIVHRDIKDENIIVDKDYFVKLIDFGSAAWVK
                     DGPFGVFVGTIDYAAPEVLNGQPYEGKAQDVWAMGVLLYTLVFKENPFCSVDEILDSE
                     VKFPGYPKVSSECMDLIRRILIADVNKRPTMQEIKDDPWLDGFS"
     gene            complement(<37711..>38769)
                     /locus_tag="C5L36_0B00260"
                     /db_xref="GeneID:40382524"
     mRNA            complement(<37711..>38769)
                     /locus_tag="C5L36_0B00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464377.1"
                     /db_xref="GeneID:40382524"
     CDS             complement(37711..38769)
                     /locus_tag="C5L36_0B00260"
                     /inference="similar to AA sequence:RefSeq:NP_010442.3"
                     /note="PKUD0B00260; similar to Saccharomyces cerevisiae
                     YDR158W (HOM2); ancestral locus Anc_8.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320236.1"
                     /db_xref="GeneID:40382524"
                     /translation="MKKAGVLGATGSVGQRFILLLSEHPEFELAAIGASKRSAGKRYV
                     DACTWKQTDLMPQQVEDMIVSECVAEDFKDCDVVFSGLDADVAGTVEKEFVDAGLVVI
                     SNAKNYRRDPNVPLVVPIANSEHLEMVANREGGKGFNICISNCSTAGLVAPLKPLVDK
                     FGPLKYVTTTTLQAISGAGFSPGVSGIDILDNIVPYISGEEDKIEWEAKKILGNLNAE
                     GNGIDLDEDLVVSAQCNRVAVSDGHTECVSFKFKKEPAPSLDEIKSCLREYVCEAKKL
                     NCHSAPEQAIHVLEQPDRPQPRLDRNRDAGYGVSVGRIRPDPIFDYKMVILSHNTIIG
                     AAGSGILIAELLVAKNII"
     gene            <40086..>40886
                     /locus_tag="C5L36_0B00270"
                     /db_xref="GeneID:40382525"
     mRNA            <40086..>40886
                     /locus_tag="C5L36_0B00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464378.1"
                     /db_xref="GeneID:40382525"
     CDS             40086..40886
                     /locus_tag="C5L36_0B00270"
                     /inference="similar to AA sequence:RefSeq:NP_015404.1"
                     /note="PKUD0B00270; similar to Saccharomyces cerevisiae
                     YPR079W (MRL1); ancestral locus Anc_3.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320237.1"
                     /db_xref="GeneID:40382525"
                     /translation="MALHIFKTRILVIIGSLVALFMLISKSSVQEVAHSVNVPELDID
                     LSHIKHDSMEMLKEITVHEEPIVDLPCTITNKKTNQFYDLTPLSSIDGNVQAWNSKGF
                     DYGRNFSLGICSSPLKNIGALTSLDFVDVSNKSEVGGYYTNSEGHKVSIGQYNSELKL
                     RGGNLVLEYSNGDICGSGLPKSTLLTFKCDREMQSKARVSYLGNMFNCSYIFEVRTIH
                     ACATAHNEDENAVWGLFIGILFVFALVSACAGTLYKIIKRHYERAVKK"
     gene            <41015..>41746
                     /locus_tag="C5L36_0B00280"
                     /db_xref="GeneID:40382526"
     mRNA            <41015..>41746
                     /locus_tag="C5L36_0B00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464379.1"
                     /db_xref="GeneID:40382526"
     CDS             41015..41746
                     /locus_tag="C5L36_0B00280"
                     /note="PKUD0B00280; Pfam Domains:
                     Methyltransf_15(3.2e-59)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320238.1"
                     /db_xref="GeneID:40382526"
                     /translation="MDEILMGKQQLQGEMRKYWRQRHNLFTKYDNGCLMTRELWFSVT
                     PELISERMAEIIQQEYDLELGENTSVLDMFCGGGGDSISFLKRGWRVLACDNNETHLN
                     CTRHNAQIYGVDRHLETFLVDWTGSESAEYKLFHSMISIKKVDFVFGSPPWGGPTYKN
                     NTTFSAERDLLPFPLHKLLQLSLEFSNKVALFLPRNIAVNELVSVSEDIFPGAEVDLR
                     VVHLSLSGYSKGVLALWTVHGGVNV"
     gene            <42402..>43778
                     /locus_tag="C5L36_0B00290"
                     /db_xref="GeneID:40382527"
     mRNA            <42402..>43778
                     /locus_tag="C5L36_0B00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464380.1"
                     /db_xref="GeneID:40382527"
     CDS             42402..43778
                     /locus_tag="C5L36_0B00290"
                     /inference="similar to AA sequence:RefSeq:NP_009676.1"
                     /note="PKUD0B00290; similar to Saccharomyces cerevisiae
                     YBR118W (TEF2) and YPR080W (TEF1); ancestral locus
                     Anc_3.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320239.1"
                     /db_xref="GeneID:40382527"
                     /translation="MGKEKQHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDSVKW
                     DENRFEEIVKETQNFIKKVGYNPKTVPFVPISGWNGDNMIEASTNCPWYKGWTKETKA
                     GVVKGKTLLEAIDAIEPPVRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKDIKRGNVCGDSKNDPPMG
                     AASFNAQVIVLNHPGQISAGYSPVLDCHTAHIACKFDELIEKIDRRTGKSVEDHPKSV
                     KSGDAAIVKMVPTKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVEKVDKAGKVTK
                     SAAKAAKK"
     gene            complement(<44132..>44866)
                     /locus_tag="C5L36_0B00300"
                     /db_xref="GeneID:40382528"
     mRNA            complement(<44132..>44866)
                     /locus_tag="C5L36_0B00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464381.1"
                     /db_xref="GeneID:40382528"
     CDS             complement(44132..44866)
                     /locus_tag="C5L36_0B00300"
                     /inference="similar to AA sequence:RefSeq:NP_012160.2"
                     /note="PKUD0B00300; similar to Saccharomyces cerevisiae
                     YIL106W (MOB1); ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320240.1"
                     /db_xref="GeneID:40382528"
                     /translation="MSFFNFNGSAIPTIRSTRTFRRTENPSPGDLHSPPTSSLQQQQQ
                     QQQQHEQLQYPYQQKPAILGSGASLAKAVQLPKGEDLNEWLAVGVVELYNQINMLYGT
                     ITEFCSPVTCPRMTATLEYEYLWQDPLHRHSKPMAMSAPAYVESLMTWIQGFLDDESV
                     FPTKMGVPFPKQFPALVKTIFKRLFRVYAHMYCHHFDEINELQLNVHLNTSLKHFVLF
                     ANEFQLLQRKDYGPLDDLVDVMVSDP"
     gene            <44975..>46081
                     /locus_tag="C5L36_0B00310"
                     /db_xref="GeneID:40382529"
     mRNA            <44975..>46081
                     /locus_tag="C5L36_0B00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464382.1"
                     /db_xref="GeneID:40382529"
     CDS             44975..46081
                     /locus_tag="C5L36_0B00310"
                     /inference="similar to AA sequence:RefSeq:NP_012794.1"
                     /note="PKUD0B00310; similar to Saccharomyces cerevisiae
                     YKL128C (PMU1); ancestral locus Anc_2.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320241.1"
                     /db_xref="GeneID:40382529"
                     /translation="MFLPIWGIRGPPIIFVKFFSYKPDSFSIFSVYRNDELMESSSFN
                     KKHKMSLISANATDKIDSLVPEEELRLFREKRQQSPRTWDFSVVPGFFHQSNPDTDDT
                     VFNGPKVHFGLAKHSWSELVCDLKKLNEEAPEGVTYRLVFCARHGQGYHNVAVEEFGL
                     KAWDDHYSHLNSAVTADGKELVWGPDPFLTEVGERQAKWMNELITEEMQHGFPTITKL
                     YSSPFTRSLQTLTMTLDGIAMRKNSKEDGRWLTPLVVENLRETIGGHTCDKRSSKSII
                     QERFQGWNLKFEEGFQEEDVLWKPDWRESIHEIALRGDRFLQMMFDDTESSDIIYTTS
                     HSGMIKALLMAANHRQFVVPTAGMIPMLVKGVRI"
     gene            complement(<46361..>48226)
                     /locus_tag="C5L36_0B00320"
                     /db_xref="GeneID:40382530"
     mRNA            complement(<46361..>48226)
                     /locus_tag="C5L36_0B00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464383.1"
                     /db_xref="GeneID:40382530"
     CDS             complement(46361..48226)
                     /locus_tag="C5L36_0B00320"
                     /inference="similar to AA sequence:RefSeq:NP_009386.1"
                     /note="PKUD0B00320; similar to Saccharomyces cerevisiae
                     YAL016W (TPD3); ancestral locus Anc_7.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320242.1"
                     /db_xref="GeneID:40382530"
                     /translation="MSQVEELYPIALLMDELRHDDVASRVQAMKRLDTIAIALGPQRT
                     REELIPFLEDIIPEDEDEVIAIAAEELGKFVSLVGGQMYAPLLIPVLEKISACEEPIV
                     REKAIASLNSIAAVLSSDQITQYFIPLINRLAKERWFSLHIAATGLFKSIIARVSPQE
                     RLVLLKLYNDLIHDDSPMVRKASAKELPQLIDILNEMVINDGNGNGSEDSSIWPTVLE
                     MYQTIVNDNQDSVKFLSVDILISILKVINSHKTQNDGDNKNINTDTDTDNGTDKDIEL
                     LFQSLISLIDDPSWRVRYMVADRIVSLIENFNDEKLTLKLVPYILSLMKDNEAEVRKA
                     ISSNIPGFSKLIDSADGQHTIVLNDVIPLVSQLTLDESENVRSALANQITGLAPILGK
                     EMTTEKLLPLLVEMLKDEYSDVRLNIISNLEIVNEVIGIELLSDSLMPAITALANDKL
                     WRVRLAIIEQIPLLAEQLGLSFFDESLGQLCMEWLWDPVYTIRNAAVKNLSKLTKLFG
                     EDWCRDEIINKLIEKSQTKEFHNFICRLTCLQTFDELIHVVSPDIIRDYIYKFIVDLA
                     DDKVPNIRFNVAKSLLDISKALPESKEDIRHILERMTEDNDPDVRYFANQSLQEL"
     gene            complement(<48473..>49534)
                     /locus_tag="C5L36_0B00330"
                     /db_xref="GeneID:40382531"
     mRNA            complement(<48473..>49534)
                     /locus_tag="C5L36_0B00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464384.1"
                     /db_xref="GeneID:40382531"
     CDS             complement(48473..49534)
                     /locus_tag="C5L36_0B00330"
                     /note="PKUD0B00330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320243.1"
                     /db_xref="GeneID:40382531"
                     /translation="MEDEKVRLVYRRAVQMYVHCRFREAMKELLPLVVGVQLTVEGEG
                     GRRRYSGMAVQVLKLFMALLVRPKGWSSQREPEAEAGGGEEEREEKEQEQARIREYVK
                     EGRLYQALRDVQLLTDVEVVLVCLRVELEYGCLYLREHVQEHLERYGFSEVFKFYYGE
                     LVYRDEGLAVCERKIEGDLRLGGKSMEMIEWIREYDQEAAYGGRGDAARDVGNHSNGH
                     WSGYADDDIVYSDSDHEENIGVVKEAITEKQVQHQPKRRTRKKRVITATNPNTATTTT
                     TSSTSTSTSFPILVNMMQLLHILSWKRGCKWKLRNLPHLRRLGIFLLISIFIAVLSRD
                     RVRKLRAPSIWLLNLRWRN"
     gene            <49948..>50700
                     /locus_tag="C5L36_0B00340"
                     /db_xref="GeneID:40382532"
     mRNA            <49948..>50700
                     /locus_tag="C5L36_0B00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464385.1"
                     /db_xref="GeneID:40382532"
     CDS             49948..50700
                     /locus_tag="C5L36_0B00340"
                     /inference="similar to AA sequence:RefSeq:NP_015007.1"
                     /note="PKUD0B00340; similar to Saccharomyces cerevisiae
                     YOR362C (PRE10); ancestral locus Anc_7.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320244.1"
                     /db_xref="GeneID:40382532"
                     /translation="MSRRYDSRTTIFSPEGRLYQVEYALEAINHAGTAVAIKCNEGIV
                     LIAEKKVTSKLLEQDSASEKIYLLNNQTLCGVAGMTADAGILIQYIREASQEYLKIYN
                     KEPNLEHIVKKICNLKQGYTQFGGLRPFGVSFIFAGHDDRHGFQLYTSNPSGNYSGWK
                     ATSIGSNNASAQTILKQEYNDDLDLEGAKKLAIKVMAKTTDSTKLTSEKIEFATVSMD
                     PKTNTPLLNIWHAEDVQRLLDETDTGVKEDEE"
     gene            <51610..>52455
                     /locus_tag="C5L36_0B00350"
                     /db_xref="GeneID:40382533"
     mRNA            <51610..>52455
                     /locus_tag="C5L36_0B00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464386.1"
                     /db_xref="GeneID:40382533"
     CDS             51610..52455
                     /locus_tag="C5L36_0B00350"
                     /inference="similar to AA sequence:RefSeq:NP_011648.3"
                     /note="PKUD0B00350; similar to Saccharomyces cerevisiae
                     YGR132C (PHB1); ancestral locus Anc_3.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320245.1"
                     /db_xref="GeneID:40382533"
                     /translation="MSRLANIVSKLAIPVSAAILVADLSLYDVKGGERAVIFDRFSGI
                     KPQVVGEGMNFVIPWLQRPIIYDVKTRPRTINTVTGSKDLQQVSITLRVLHRPDVMKL
                     PAIYQNLGLDYDDRVLPSIGNEILKSIVAQFDAAELIYMREVISNKIRDELAARAANF
                     NIKLEDVSITHMSFGQEFTKAVERKQVAQQEAERAKYLVDKADQERKAAIIRAEGEAE
                     AADHISKALAKAGDGLLLIRRIEASKDIAATLANSPNVAYLPKGGSGDEGGASSQSLL
                     LNIGR"
     gene            <52754..>55024
                     /locus_tag="C5L36_0B00360"
                     /db_xref="GeneID:40382534"
     mRNA            <52754..>55024
                     /locus_tag="C5L36_0B00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464387.1"
                     /db_xref="GeneID:40382534"
     CDS             52754..55024
                     /locus_tag="C5L36_0B00360"
                     /inference="similar to AA sequence:RefSeq:NP_009349.3"
                     /note="PKUD0B00360; similar to Saccharomyces cerevisiae
                     YAL051W (OAF1) and YOR363C (PIP2); ancestral locus
                     Anc_7.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320246.1"
                     /db_xref="GeneID:40382534"
                     /translation="MTDLSSDSKPFHGTVNTKIACLSCREKKLKCDKALPQCSRCKQK
                     SLNCVYVQHKKTGPKPSGNSGILSSVSTRQPKKITKAPSAKVKPAPVANSISASTANP
                     NARPTSDPNAGSASTSISNSFSPKEATSKNNVETLNSINGMSTLDMANLENLNTYNDF
                     STYKTWKEPKTSSELNTPINYSQFQFPINSPLPNIQPPSLSPSSSSRISVQNFMNPIQ
                     TPDGLFNQTNDTHSSGTSNNRHQFNTSLTNVTNKSFEEIIGLPSLGLTMKDIDKFHAF
                     YFDSNTRIFKYSTQRYYNTFIKDPKRILHYSYMIWTMACFYLKEYESMVDRLYVASLA
                     QMNDYWESNRDSFHSDILSYLHALCLKSQFEFLSGREMRAALTISSSIRLTQMYGYDQ
                     IDLSPTTLGTPAIFFRSFTLSKEQYESTNTLLQDDGLDQDIPLVEERRRVLWEVYAID
                     KWSSLVTGLPCALSVDSLSVIFTKLPSPTTFLPLNSDSDIQNSSSNEKNSYYLHEAMQ
                     KLDNNQVMLDINSSSSKILLLTISENIIKWCKMFLNMVELETLKSLSSIDSIRSKVDE
                     LVKNFESMHNNLLFFDLTTEPLMNIVITNTTTLLYQSVLIKFNSLFDLQLREDPSGNS
                     IAGSEISLFKDILYEVSSMSENIIIRFVKKQRVESHLKKAPVFIVFINSVKSLFQCLA
                     FVYRFNNILNVDIKRKRSLENTIKIASAVINGLPTKTPLVEKTKTIINNGQELLDHSP
                     HLLSFFDSFFDSTKTY"
     gene            complement(<55116..>59576)
                     /locus_tag="C5L36_0B00370"
                     /db_xref="GeneID:40382535"
     mRNA            complement(<55116..>59576)
                     /locus_tag="C5L36_0B00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464388.1"
                     /db_xref="GeneID:40382535"
     CDS             complement(55116..59576)
                     /locus_tag="C5L36_0B00370"
                     /inference="similar to AA sequence:RefSeq:NP_012567.3"
                     /note="PKUD0B00370; similar to Saccharomyces cerevisiae
                     YJR033C (RAV1); ancestral locus Anc_1.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320247.1"
                     /db_xref="GeneID:40382535"
                     /translation="MSVNFLPGQPNHSSDSCCFANWNTIQILAYTSGNNLVILTKNSK
                     HLQTIYLPKDSYTVYLNRSNGKIAIAIDNEVHIYTPEVSNYYNFNFHGRKNIDELEIE
                     WTLEHVIVNENDTSKINSLCWSDYTVPQSDELELQFMELPREFNSKTTCELVTGSDSS
                     LAMHKLYYDKADPEENVKCTLIWFKKQPNPIYKVKFSPNATCIASIGFYDKHVKLWNR
                     NGFSEENLDFELHYLPHDTFVTDIIWKRYVTSNSTTAATKDNTSSKSSESFILKPVNS
                     IIKHDCRLMSDESSIHSSTLKEYYHNTLYTFTYNSNMRVFSTFRLDRGFEIFESGRLD
                     LYQDDPSKRGKGILKTVTFIDNQFLELELEDMLKKFEASSTKLDHSMKMQNKILDLLK
                     LKCELCIVVGSDGVLTLYLLSNLCNVLPSKMTITKLDKLRVDGKSYLSIIKLSKYCLP
                     SHPSDFIVKSIQIDHYSKSSILTLVLHDCFKHTIRVINIDFTSFLQFDRSKYNNEGVP
                     LKHKVVHVGRLAQKFTGHNKSIRRLIRSADGSSVLSLTRFQRTVLWTPISLSNERKTL
                     TKRCVIVTDTPIQNVVIWNNSHYAIVILERKIIVFDCVNTFSNLTAQEVAMLDIDTAL
                     PPDCVFLLPETSKSECHIVMVNKDRSCKCFRFSVHPNNNGDMEYKLEKYFIDPLPNDS
                     NDEIYMLSAVDPVGWMQSIDRVGRAILVTVTPNGRVFIYYVSFSKAKDGNGLIRWHLK
                     DSFKTGINNCSLISVSSINKMALVDETRSKLSIWDMKVSVRDYYEEFENEVIKDLDWT
                     STEFDQGILAVGFKSHSLLYTQLRHDYTNQRLSFVKIKKVDLSHETTHEIGDSIWMGD
                     GNLVIGAGNQLYLSDKKLDATKDEVTRQAIGSLEIRSNDLFHLCAVLNGPLPLYHPQF
                     IIQSVFLGMIPLVKIILLQLSHILREIDLGVRREDDFGFDIQIEKVMTLLSNIVNQNE
                     DFYSKENDDLNEQGFQILIEKLQKIKLPFLTGHQQITLLHTIYILKDITLYQSKVLDI
                     SGLKFFLAMKLFTVNMTNPLFVSTHDSISMRDISFALHSDNRDLLYGLLEEKNGNQLN
                     WNLARSYLLPYWLDITRLQHAMEKIAANEFLKFQRENGGRKDPSTCSIFYLALKKKKV
                     LVGLWKTSFGNPEREKMIKFLSNDFTEKRWKSAANKNAYVLLGKHRYMDAASFFLLAG
                     SPKDAVNVIVRQIKDIPLAIAVARCYDGIDDGVSVRTVIERQMLTDAITTNDRWKLSW
                     IFWILGDKIHSVQSLIKPLHKIKDDVKMNLPDYQWPNIDSVVKTTDTEDPVLLIMYDS
                     LRKRNVKYYQGISMIEPKHEFSFVIKAATMYTKMGCDWLALYLLRTWEFSEANNEQKA
                     YIMQAGQEEEVKLQKPGDILAKFMSPSGSSNSREPPKELPSLLDNYTDFPHTPSILCS
                     PHSEEGKEPSLLDKFSSGTSSTPSSGDVNTKKVNIGASTSGVPNLLDNWA"
     gene            <59813..>60139
                     /locus_tag="C5L36_0B00380"
                     /db_xref="GeneID:40382536"
     mRNA            <59813..>60139
                     /locus_tag="C5L36_0B00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464389.1"
                     /db_xref="GeneID:40382536"
     CDS             59813..60139
                     /locus_tag="C5L36_0B00380"
                     /inference="similar to AA sequence:RefSeq:NP_012568.1"
                     /note="PKUD0B00380; similar to Saccharomyces cerevisiae
                     YJR034W (PET191); ancestral locus Anc_1.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320248.1"
                     /db_xref="GeneID:40382536"
                     /translation="MVASCKDQLKQVAICLQRSPCVMIERHTPKECISKPELTEELPE
                     LCKAHLATFLECKRGIVDMRKRIRGNGTLSTGKYDEQYNKLSSGEFDPREEMKKLKTL
                     DSNQKQ"
     gene            complement(<60251..>61786)
                     /locus_tag="C5L36_0B00390"
                     /db_xref="GeneID:40382537"
     mRNA            complement(<60251..>61786)
                     /locus_tag="C5L36_0B00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464390.1"
                     /db_xref="GeneID:40382537"
     CDS             complement(60251..61786)
                     /locus_tag="C5L36_0B00390"
                     /note="PKUD0B00390; Pfam Domains: Pyridoxal_deC(2e-61)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320249.1"
                     /db_xref="GeneID:40382537"
                     /translation="MTKDVRISCNMEAGRVQELEQIVKPALDIIIQYVKEIDSGSRNI
                     GPRFDNPAELDKKLGLQDIANLFEKSIQQDALDPTKDVLHVVETILNNSVCTWHPGFM
                     DKLYVGTNPIGLLSDMVLSILNTNSHVFTVSPVLTVIEKKVSQKYAFMFGFDGAHAGG
                     LTFSGGSWSNITSLQTARSFKYPDTKTQGTSKYKFAIFTSVHSHYSIDKAAILLGLGL
                     DSVFKVPVNEYGQMNTDVLEAKIKTSIEKGFTPLYVNATAGTTVFGSYDPFVKISEIA
                     KKYNLWFHIDASWGGNAIFSPSRKSKLNGSHLADSITCNPHKMLGVPTTCSFLLTPDE
                     RIFKQANSLNAPYLFHNLMDTEENFDLADGTMGCGRRPDALKFYLSWLYYGQGGFQKR
                     IDHSFDLVRYFVSQLTKTPGFTVVNDFPTPCLQVCFYYNPTNQKLTGEEMTSLTRRIA
                     IALHKSGDFLVDYAPNPDDAIIGEDNGEFFRCVLNSPNIDSELIDKLINSIVSLGKKL
                     ENI"
     gene            <62037..>65606
                     /locus_tag="C5L36_0B00400"
                     /db_xref="GeneID:40382538"
     mRNA            <62037..>65606
                     /locus_tag="C5L36_0B00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464391.1"
                     /db_xref="GeneID:40382538"
     CDS             62037..65606
                     /locus_tag="C5L36_0B00400"
                     /inference="similar to AA sequence:RefSeq:NP_012569.1"
                     /note="PKUD0B00400; similar to Saccharomyces cerevisiae
                     YJR035W (RAD26); ancestral locus Anc_1.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320250.1"
                     /db_xref="GeneID:40382538"
                     /translation="MSPVEQDLNEIVVNDEGIESSTIENGDHSVSEQEVSTIGAIDKL
                     SDVKPNQDNETTDALSVLDIKMMDQAHLEKEVANDADVAILRQELEMEQKRLSKANDR
                     YLKYKGKLLTLEKKLQGPNLKISEKTRLEVQIEELQDNEIVTSLRDVNEIKTRMRDIE
                     LMLHSKYDDVNDATEKLPDETKEEFLIRIGKITAFGTSNAFIEEASDVQAPTHKNLVM
                     PGFNSVQVIDSESAKVIDIANMYGKNPSNDEENDPDFKIDYDEINSDGVVDDSEELDE
                     ILNREGEGKVKMGKNNRKGFKRKSLDEEEDRNIDDGDEFAYKRRLNEWISQRSYLRRK
                     HMPEYVEDPSVPEWEKPHPTIRDAILNDSFKLPGDIHPSLFDYQKTCVQWLAELYNQK
                     TGGIIGDEMGLGKTVQIISFLAGLHYSGNMKHPILVVCPATVLKQWCNEFHRWWPPFR
                     AIILHSIGEGMNRHKRSKHNRSDLEELELNIENEEYGSVQTLAKTKDNKTVQELVDKV
                     VKEGHVIITTYAGVRIYAKYLLPVRWGYAILDEGHKIRNPDSFITITCKQLKTPNRII
                     LSGTPIQNNLVELWSLFDFVFPGRLGTLPVFQKQFCVPINLGGYANATNVQVQAGFKC
                     ATVLKDLVSPYLLRRVKADVAKDLPKKTEMVLFCKLTEEQRKLYQRFLDSGDFKKILS
                     GKRNALYGIDMLRKICNHPQLVDLNTKDKKIIKLPKVKELASKSGKIQVVLALLELWT
                     KEERKTLIFTQTKQMLNILNQLLDSYNKENGQRYNYMRMDGSTPIIQRQELVDQFNKN
                     PVYNVFLLTTKVGGLGVNLTGASRVIIYDPDWNPSTDMQARERAWRLGQKQDVAIYRL
                     IMAGSIEEKIYHRQIFKQFLTNKILKDPKQKRFFKMTDMYDLFTLGDDQVKGTETADL
                     FGAEEKTFDGIKERKTKFRSRNLNRSGAQNLDEGDIDFIEATKAAGVASLEEYDEEQV
                     KEKTMFEDDDSRVLGESHRQPNANIMSEIFQKSGIHSAVEHESILGQGDIRTSASQLL
                     VDNEATRIANEAVSALKASRKQARTKKIGVPTWTGKYGVAGKLASGGNRTRAFSSALP
                     NGVSGRGGSTAQSSATILWNLKRMDKSKSRKQEPTSQVLIDKLVEYMANVEGNFSKSR
                     DILENLDIDVGDKKTVDVIRSMIKGVCTWDRDRKGWILKTEFK"
     gene            complement(<65837..>67477)
                     /locus_tag="C5L36_0B00410"
                     /db_xref="GeneID:40382539"
     mRNA            complement(<65837..>67477)
                     /locus_tag="C5L36_0B00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464392.1"
                     /db_xref="GeneID:40382539"
     CDS             complement(65837..67477)
                     /locus_tag="C5L36_0B00410"
                     /inference="similar to AA sequence:RefSeq:NP_014026.1"
                     /note="PKUD0B00410; similar to Saccharomyces cerevisiae
                     YMR297W (PRC1); ancestral locus Anc_5.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320251.1"
                     /db_xref="GeneID:40382539"
                     /translation="MKLTNITALLIGAYLSTTNAALILPDTLRDSMQNPLKLKDSIGE
                     NVVGKATTFLEKAADITGQNLNDLDDNIKQVWAEMEFKFPNTIKQFQMSSEPQFKISK
                     RPAEFWDFLVENKEKLTDYKLRVKKTEPGELGIDHTKQYSGYLDVESEDKHFFYWFFE
                     SRNDPKNDPVVLWLNGGPGCSSLTGLFFELGSSAIDENLNPVYNPYSWNSNASVIFLD
                     QPVNVGYSYSSASVSDTVAAGKDVYAFLELFFQQFPEYNGLPFHIAAESYGGHYVPVF
                     ASEILSHADRSFDLTSVLIGNGLTDPLTQYPEYEKMACTEESGYKPVLDETECEGMLA
                     NLPRCLSFIESCYESESVFSCVPASIYCNNGQIGPYQKTGRNVYDVRKMCEGSSLCYK
                     GLEYIDQYLNQDFVKEKLGAEVETYESCNFDVNRNFLFAGDWMKPYHKNVIDLLEKEI
                     PVLIYAGDKDFICNWLGNKAWTNELVWSGKEDFQDAKIKKLFSDSGKTQIGEVKNFEH
                     FTFARMFDGGHMVPYDQPEASLTMFNRWISGDYALGTK"
     gene            complement(<68056..>71451)
                     /locus_tag="C5L36_0B00420"
                     /db_xref="GeneID:40382540"
     mRNA            complement(<68056..>71451)
                     /locus_tag="C5L36_0B00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464393.1"
                     /db_xref="GeneID:40382540"
     CDS             complement(68056..71451)
                     /locus_tag="C5L36_0B00420"
                     /inference="similar to AA sequence:RefSeq:NP_014503.2"
                     /note="PKUD0B00420; similar to Saccharomyces cerevisiae
                     YOL138C (RTC1); ancestral locus Anc_3.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320252.1"
                     /db_xref="GeneID:40382540"
                     /translation="MSNFINNKGENNGGWTQSSTNLNAMASTNMIPSESTSSNIDIMS
                     RFSFGSPSKSSFPSLSFSSYHNSNQQQLGSPLDSTRRPSGNQSRVSHMYNNSLLNSTG
                     SNNTYHLQGINNEYNHSRQTSTSPQIPTAPHFVKPLVPTERMYFQASSEILACDRSWE
                     TPNLIAIATPRNLQLLKVSTTDISLETDLVIKQNGRKKISTISDLAFGHQNYGRYLAA
                     STITGSISIYHFDRGTRVKTVLSGHNRAVNTIDFNHINSSLLASGSQDGKIHIWDIKT
                     SSSKPAMTLNCNADAVRCCSFHNKKQNTLAAVFDSGVVEKWDLRKTNTWERRINAHTG
                     PALTVHWHPELDYIVTGGRDKQLQVWNLEGSNDIREPSHVINTTGPISKARWCKGRGN
                     GSIMNTDIAVSYFNDDPNVHIWNLNRKFIPKSIIDGHSAQITQILWRTPKHLISCSKD
                     KTLIQYDVTKEKEFIENIPNGAIAWSPTNTVDFAFVKQTKAQFQGPFNMSANASRAAT
                     NELNPVDEADQSNVSVGSSNNSNQNVGNIGINTATNENSGMQLYEMLSKSPGNGNSVG
                     GSSSLQKHKQGLSRQPSYINKAQIPTPKNLPPPAWITPVHVPLLSNDLEKLHFLSTNY
                     LIRVPPSSDITEVCEFNSMVAASVGLFRDSQTWKSIQMAINLDEEVKHSIIAEEKLKN
                     FTFENSNKVPYSRSDSQLGSSFNSASELVGHRRRESKDTSGCSFKESELSMTYGSEPY
                     EFTRGDESAIIDEEDAKNEVQTDTEGREDSGRKLVNGGEDENHTDKGNTSESQSTRSK
                     VGSVREKLDQVNLGTPSLPFPQASRRGSHAAISRYRYSFTGSSIDLDDEKHGSPLSLG
                     GSPILSRSRSRLILQNFNARNIEETIMPHINKVDTRASKISDAKSQLTAIMKEEQNST
                     LTSTQVASTSKEDGDDASSGQKDRLVVPWNPTDMIKKACEYSSEQGDVLMCATLSLLF
                     ERSYPAAFSKMQAEEWIYTYHEYLLRCGYFNNAATILRIACESHESFKKIGQTKTSVR
                     LLCCHCQKPLLNERSREKYKKNLNRQLDSGDADVYRVDFGFWYCDRCRRLQGQCCYCV
                     EPIKGNAVALIGCGHEGHFGCFRTWFLEQGETECPSCGTTCIH"
     gene            <71750..>72958
                     /locus_tag="C5L36_0B00430"
                     /db_xref="GeneID:40382541"
     mRNA            <71750..>72958
                     /locus_tag="C5L36_0B00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464394.1"
                     /db_xref="GeneID:40382541"
     CDS             71750..72958
                     /locus_tag="C5L36_0B00430"
                     /inference="similar to AA sequence:RefSeq:NP_012273.1"
                     /note="PKUD0B00430; similar to Saccharomyces cerevisiae
                     YIR008C (PRI1); ancestral locus Anc_7.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320253.1"
                     /db_xref="GeneID:40382541"
                     /translation="MSEENAKTIKMYKPTEADMKHYYENFLPFPSIFTWLNHSKVPNN
                     DFTHREFAFEHQNGAYQRYNSFQDAAEFKKKVVKYNPTRFEIGAVYPVEPKDRKTVAK
                     NMMKPLSKEMVLDIDLTDYDEIRTCCKGTSICDKCWKFITLAIKVVDVAIREDFGIEN
                     RIWVFSGRRGVHCWMSDSKIRFLKENGRRAFIEYLDILNVKGKSKKGIFGLKKPYHPH
                     IERSLDILKDHFVDIILEEQGSWDSIESGRELALSIPDIKLRNVLLQKWKDNNISSTD
                     KWVDIGDLYKELGINSFDLVDWRKEMILQMLYPRLDVEVSRQMNHLLKSPFCVHPGTG
                     NVCVVFDPNEREFNPFTDAPNLQQIFSADEFEWKNTPLKDSILLFRNYVDKLLKCEGP
                     TKRENDELDF"
     gene            complement(<73226..>74308)
                     /locus_tag="C5L36_0B00440"
                     /db_xref="GeneID:40382542"
     mRNA            complement(<73226..>74308)
                     /locus_tag="C5L36_0B00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464395.1"
                     /db_xref="GeneID:40382542"
     CDS             complement(73226..74308)
                     /locus_tag="C5L36_0B00440"
                     /note="PKUD0B00440; Pfam Domains:
                     ADH_N(1.3e-31)|ADH_zinc_N(3.6e-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320254.1"
                     /db_xref="GeneID:40382542"
                     /translation="MCNEIKEIRAIGVQDYSDWLNPKEFAYVPQQLRPYDIDIQVKAC
                     GICGSDIHAANGDWGEPYAPLAVGHEIVGIVVNAGPSARFKVGDRVGVGAQCDSCHEC
                     NRCIKGHQNNCHNVVGTYLSSYPSGKPTQGGYASHVRVNSEFAFKIPENLSSVDAAPL
                     LCGGITGFKPLLSAGVKPGSKVGVNGIGGIGHMSILFAKALGAEVTAISRSYAKRDLA
                     FKLGADNYISTDDKESIRKNVDSLDLIVNTGSSFSEGSIQEILSLLTVGGNMTFITAP
                     PSDERLVLNSAVFLANNISIGGSTIGSPKEIEYMLKVASENQIKPWIETLDISEENVQ
                     RAWRRMIEGDVRFRFVLTNYDNYFKV"
     gene            <74762..>76030
                     /locus_tag="C5L36_0B00450"
                     /db_xref="GeneID:40382543"
     mRNA            <74762..>76030
                     /locus_tag="C5L36_0B00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464396.1"
                     /db_xref="GeneID:40382543"
     CDS             74762..76030
                     /locus_tag="C5L36_0B00450"
                     /note="PKUD0B00450; Pfam Domains: TauD(1.7e-106)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320255.1"
                     /db_xref="GeneID:40382543"
                     /translation="MKRKDLHLYSQYKHLQGLQHKPTMATFQRLDHDAAIHFDKDAST
                     ETKDYLTISEDRLKELKYPEWAPTWEKKHDHQFDHIPVFKHIDRGFYGDSEFKSLKDA
                     DGVTFKHVSPKLGLEVDGIQLSDLSDKQKDDLALLVETYGVVAFRNQDFKNQSFEEIK
                     DWGRYFGPLHIHPTSGAPLNQPEFHLTFTKGSISEQKKLFKTKLNNISWHSDVAYENQ
                     PPGITAFAMLQSGPSGGDTQFLDMFEIYDRLSPLMKSILDGLRALNTSRDQANDAIAS
                     GSIQRKNPIDSIHPVVRYHPVLKRKCLFVNRGFTRQILGLKTEESDYLLSFLFDHIQS
                     CLDAHVRLSWDENTVVVWDNRRVLHTRTTDWDTDEIRHAFRVTTVAERPVSTKEEYES
                     WTPELEKSNININDFVISLGPEEYYEKFYT"
     gene            <77001..>78197
                     /locus_tag="C5L36_0B00460"
                     /db_xref="GeneID:40382544"
     mRNA            <77001..>78197
                     /locus_tag="C5L36_0B00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464397.1"
                     /db_xref="GeneID:40382544"
     CDS             77001..78197
                     /locus_tag="C5L36_0B00460"
                     /inference="similar to AA sequence:RefSeq:NP_013043.1"
                     /note="PKUD0B00460; similar to Saccharomyces cerevisiae
                     YLL057C (JLP1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320256.1"
                     /db_xref="GeneID:40382544"
                     /translation="MATFQRLEYDAAIHFDKDASTETKDYLTISEDRLKELKYPEWAP
                     TWEKKHDHQFDHIPVFKHIDRGFYGDSEFKSLKDADGVTFKHVSPKLGLEVDGIQLSD
                     LSDKQKDDLALLVETYGVVAFRNQDFKNQSFEEIKNWGRYFGPLHIHPTSGAPLNQPE
                     FHLTFTKGGVDEYKKLFKNKLHNIGWHSDVTYENQPPGITAFAMLQSGPSGGDTQFLD
                     MFEIYDRLSPLMKSKLDGLKTLHTSKDQAINATNSGGIERKNPIDSIHPLVRYHPVLK
                     RKCLFVNRGFSRKILGLKTEESDALLSFLLNHIEACLDAHIRLSWDENTVVVWDNRRL
                     LHTATVDWDSDEIRHAFRVTTVAERPVGSEEEYESWTPELEEKNIKLTNYIASLDPEE
                     YYEKFK"
     gene            complement(<78664..>80334)
                     /locus_tag="C5L36_0B00470"
                     /db_xref="GeneID:40382545"
     mRNA            complement(<78664..>80334)
                     /locus_tag="C5L36_0B00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464398.1"
                     /db_xref="GeneID:40382545"
     CDS             complement(78664..80334)
                     /locus_tag="C5L36_0B00470"
                     /inference="similar to AA sequence:RefSeq:NP_014081.1"
                     /note="PKUD0B00470; similar to Saccharomyces cerevisiae
                     YNL318C (HXT14); ancestral locus Anc_3.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320257.1"
                     /db_xref="GeneID:40382545"
                     /translation="MVNGISQVSIHSSESFTEFNDINKNGDIKSYDESVISESDEAEE
                     SINNPFLNANFREKYVQLYEETQYECRSRLDHTFKWTKQEQRRITWKLDFIVTAMACL
                     FFASLNMDRSNLAQAVSDNMLKDLHMTTDNYNTGNTIFYICFLCAELPSQLVSKRLGA
                     DVWIPIQMTLWSIITICQFKLDGKHSFYACRALLGLCEGGFIPDLVLWLSYFYTSAEL
                     SIRLSFFWTAMYVTTIINYLIAYGILHMRGIHGHAGWQWLFLIEGLLTLGIGISAFFL
                     MVPSPVQTKKPWNPRGWFTEREEKIVVNKVLRDDPTKGDMHNRQGLDFKMLFQAISDW
                     HLWPMYFIGIVAYIPEGTVGSYMTLLLRDMGFSTFHTNLLCIPYNVLKIITLLSTTWV
                     SERVNNIFGVALIQPLWSVVCFGVLRFWGGNYYEKWQTYALLTVLLSVPYIHAMMVSA
                     TSRNSKSIKTRTVSASLYNMFVQAGSIISSNVYRTNDKPLYHKGNSVLFAFALLMIPT
                     LLATKYFYHYLNIKREKIWNAMSDEERDEYIATTTDKGSNRLDFRYAH"
     gene            <81796..>82761
                     /locus_tag="C5L36_0B00480"
                     /db_xref="GeneID:40382546"
     mRNA            <81796..>82761
                     /locus_tag="C5L36_0B00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464399.1"
                     /db_xref="GeneID:40382546"
     CDS             81796..82761
                     /locus_tag="C5L36_0B00480"
                     /inference="similar to AA sequence:RefSeq:NP_015214.1"
                     /note="PKUD0B00480; similar to Saccharomyces cerevisiae
                     YPL111W (CAR1); ancestral locus Anc_8.600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320258.1"
                     /db_xref="GeneID:40382546"
                     /translation="MSSPVYNHTNNKRLTLIKAPFSGGQGKGGVEDGPAKLIEFGLLK
                     DIEALGWEYTVEDPLSDFDTEEMKADKSDVFGNCKRPSMVSKCCEKIYKSVSDAYATK
                     SFPLTVGGDHAIGMSTISAFIHNNPDGGIIWVDAHADINTPSTTESGNLHGCPVAFAM
                     GLEIETWPPHFKWLAELSNFVKPEQITYIGLRDVDAGEKKILRDLGITAFSMYHVDKY
                     GINEVVQRAMKAVCPTGKTPIHLSYDVDGIDPMYVVATGTPVRGGLTLREGLFLVEEI
                     AQSGNLAGVDIVEVNPALASTEMHIVDTVNTGLSIARCALGDTLL"
     gene            <82996..>84018
                     /locus_tag="C5L36_0B00490"
                     /db_xref="GeneID:40382547"
     mRNA            <82996..>84018
                     /locus_tag="C5L36_0B00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464400.1"
                     /db_xref="GeneID:40382547"
     CDS             82996..84018
                     /locus_tag="C5L36_0B00490"
                     /note="PKUD0B00490; Pfam Domains: Mito_carr(2.8e-65)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320259.1"
                     /db_xref="GeneID:40382547"
                     /translation="MEFMISPNSMLDPVRHFTLSIGSLNCPLPLYQLLELSGCLEMSD
                     NKAAHTRPTENNKKHPPRYAGFIAGVFSGVMKNAVGHPFDSVKVRLQTSSGRFTGPLD
                     CTLKTLRNEGVQGLYKGFTPPLVGWVLMDSVMLGSLTVYRRLVKENIYPDEKKMPLFG
                     HCLAGLLSGWTVSFVAAPIETLKARLQVQYDAKSKIYSGPIDCLIKLWKHDGIRTLYK
                     GLIPTMIFRTNFIVWWGSYEIITNYFTEHTNLSKAATNFWAGGLSATCFWITAYPADV
                     VKNVIMIDGVSNPRFHKYSDAVKYVYRERGGLRGFTKGFLPSILRSFPANAAALAAFE
                     FVMRLF"
     gene            <84380..>87778
                     /locus_tag="C5L36_0B00500"
                     /db_xref="GeneID:40382548"
     mRNA            <84380..>87778
                     /locus_tag="C5L36_0B00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464401.1"
                     /db_xref="GeneID:40382548"
     CDS             84380..87778
                     /locus_tag="C5L36_0B00500"
                     /inference="similar to AA sequence:RefSeq:NP_010525.1"
                     /note="PKUD0B00500; similar to Saccharomyces cerevisiae
                     YDR239C; ancestral locus Anc_8.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320260.1"
                     /db_xref="GeneID:40382548"
                     /translation="MSDKKKNRLSIYNLFGKAPSPEPSAKPQKRKSRPTPYSKINRLS
                     YVLPNDASLKKADYSSIPKLPKNDNKLNPSNRNLEVANKSSKSTSPSPSNNNNNLKIS
                     STVTPPAKESLPLVNSNYNIDSSKENEIHSLGQIPNTPSKANNVGSTSSLSSSIYPND
                     SSSKNLSNSTLPDFARKSSSIYPESMFSPERRNTQKLGNLRSSQSVKRTDLLRKRKPP
                     PTLSLNTESVSENLEPTSRIKAEENEILSDSSLKSSESEFSPLKLMPIISNSSEQNQH
                     KNLLSSDTKLDPANNVMFAPSSMDYDPPKFQSPESNDLNTNNHKHSRTLSSIEEITSA
                     LETFQREQERSFLHNNDRMESINGQIEDHSSEIYNTSQTSDKLTFDHDESLNLESCEH
                     EDYPENSEELLDDESMNKQTKHYDPEGMGGGGLFMKVKDLPSLETGESLPEYIEKLKC
                     TKLNIPEDNKEDFSIELTKPKTLGSDYSSSFEIFYDVPESNSKSSQVTPVLSANQQFE
                     EIARKNEETEDTTKENLSTSVEGEGNAPTEVHSSAADEEGVNDETEGRVSLADVNLVR
                     PVDEYSESSSRSREENSKTHFSTEKMVDHRESVSTETVDDEYGVENWKRYSTETDFFP
                     NVEELKDDMSFSEVSKTSEDQVMITPTEEIAQRELDLDDEIENSFNEMKISDHCANGE
                     AVHAERNGSINDLYPTYTRESDSVEADKDTSKSNNFHTYANFDRSPLLSLDASSSDDV
                     EGDNEGFDSDALQFSPKTTEVPLYRHNSMLAKGVLAENKDITTSASSRFKGKGGLHVM
                     NEDRVSPSVSGSLSFGSSEHKSETAISDDHYSGSYAHELEYSDRIVAPIPDFNSGTSS
                     IDEESQDAVGDFDSEHNFEPILTYDRREDLQVAPIQHSQLTASTPPVPGATHKSKNRR
                     PPPVYPSAGRRPRGLSESTANPELFKNGISKPAEFLDRDKVAEKNADFNEEKSSHDEV
                     QSEGVIKKGEKCSYIETLRQKKGKTNIKSNPSPQILPISIKQNGTISHKKIPSQQLRM
                     SNKGRAFRHGHVTVKPRTRLLASEIDDGELPDATLFHSSQKTKVPVHPDADVIAASER
                     FTQLAKQNSRNNGDLGRINSVLSVRPHYGTGMTLFVANPDSDDE"
     gene            <88397..>91129
                     /locus_tag="C5L36_0B00510"
                     /db_xref="GeneID:40382549"
     mRNA            <88397..>91129
                     /locus_tag="C5L36_0B00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464402.1"
                     /db_xref="GeneID:40382549"
     CDS             88397..91129
                     /locus_tag="C5L36_0B00510"
                     /inference="similar to AA sequence:RefSeq:NP_010524.3"
                     /note="PKUD0B00510; similar to Saccharomyces cerevisiae
                     YDR238C (SEC26); ancestral locus Anc_8.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320261.1"
                     /db_xref="GeneID:40382549"
                     /translation="MRNILITMINSDPMPELLMHIIRYVMPSKDKKLKKLLYFYWEIC
                     EKYDSEGKLRHEMILVCNAIQRDLQHPNEFIRGNTLRFLNKLKEPELLETLVPNCRSC
                     LEHRHAYVRKNAVFAIYSIYKVSDHLIPDAPELILDFLNIENDATCRRNAFVCLSQLN
                     REASLLYIQEQQLESLDPLIQLAIIEFIRKDALQHNELRQQYLQIVTALLDFGNTAVA
                     YEAATTLSVLSSSPASVKNAANKFVELAIKESDINVKLIALERISELHSENEGVLDDV
                     CLDILKVLSSPSVDVRNKAIEIGLKLVSSKNVEDVIKLLKKELQRTTNSNEDKTTEYR
                     QALISAIHSIAIKFHEIASSVVDLLLEFIGELNTSAATEVITFVKQVIDKYPDLRSNI
                     INRLLVSLSNVKSGKVYRGSLWILGEYCIEEPDVQATWKHIRTNIGEIPILGAEKKAN
                     GFEAEEDDLEAKSENRSATKPKVLADGTYATESAYDEPKKDSTVASSKHYKTPIRSFI
                     LDGDFYLASVLASTLVKLLLRLNKLSGRKDLLNALKAEAMLIMVSILRVGESSFVKKK
                     IDEDSSERIMSCIRFLSEEETNVKLLEDAFLDSTIEAFHQQVDGQVEAEIEKLSSTHL
                     NAEQVDDPIAFRQFSNKDAKVIGDDEKELMAVQGGSTQKEDLSSRLNKIVQLTGFSDP
                     VYAEAYVKVHQFDVTLDVLIVNQTTTTLRNLSVEFAALGDLKVIDKPSSSNIPPHGFH
                     RTQTTVKVSSADTGVIFGNIVYDGQHADQSTIVILSDVHIDILDYIKPATCTEAQFRK
                     MWNEFEWENKISVNSSLPTLKEYLDELLKSTNMNNLTPGSIIGDCQFLSANLYSRSTF
                     GEDALANLCIEKSVDGPIVGHVRIRSKGQGLALSLGDKVAAVARKNSNIAVTEV"
     gene            <91381..>92274
                     /locus_tag="C5L36_0B00520"
                     /db_xref="GeneID:40382550"
     mRNA            <91381..>92274
                     /locus_tag="C5L36_0B00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464403.1"
                     /db_xref="GeneID:40382550"
     CDS             91381..92274
                     /locus_tag="C5L36_0B00520"
                     /inference="similar to AA sequence:RefSeq:NP_015439.1"
                     /note="PKUD0B00520; similar to Saccharomyces cerevisiae
                     YPR114W; ancestral locus Anc_3.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320262.1"
                     /db_xref="GeneID:40382550"
                     /translation="MQALYQFREKYSYDDPLAWMKPFVDEHIVPHVPQKFQNTEIVKE
                     NLHTLIFGITLYTTIFQFSKLIFMFPTISNALKSKKNRLDGSVRVVSFIQAIIICVLG
                     IPVFKNEHLSKDHVFASTPYARFYASMALSYFIWDTVISTIYVNLFGVGFLVHGIVST
                     IVFGIAVEKNFILYYSAAFLLFEISTPFLDIRWVGLKFKVLPDFVKLLNNIILILIFF
                     FVRICWGWYQVIKLAKDRYVASDEPGFTTFGACVILGCNFVLDVLNVFWFSKMMTVAV
                     VTIKQMVGFSKKADDEKLKLM"
     gene            complement(<92535..>93104)
                     /locus_tag="C5L36_0B00530"
                     /db_xref="GeneID:40382551"
     mRNA            complement(<92535..>93104)
                     /locus_tag="C5L36_0B00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464404.1"
                     /db_xref="GeneID:40382551"
     CDS             complement(92535..93104)
                     /locus_tag="C5L36_0B00530"
                     /inference="similar to AA sequence:RefSeq:NP_010522.1"
                     /note="PKUD0B00530; similar to Saccharomyces cerevisiae
                     YDR236C (FMN1); ancestral locus Anc_8.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320263.1"
                     /db_xref="GeneID:40382551"
                     /translation="MVRPEVHIPDSPESPYPIYIERTEVIPGFGRGSTDLGFPTANIN
                     VANNKLLTDINPGVYFGYAKLYKSDKLKNGIKDVEVERVDRKSSVVLNYGRHLQDEEL
                     EILPMVMSLGWNPYYGNKEKTCEIYIIHKFSDSFYGADMSAVICGYLRPELNYEGIDA
                     LKKDIQLDVDIGLQNLKKEGYLKCKYLLN"
     gene            complement(<93337..>94998)
                     /locus_tag="C5L36_0B00540"
                     /db_xref="GeneID:40382552"
     mRNA            complement(<93337..>94998)
                     /locus_tag="C5L36_0B00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464405.1"
                     /db_xref="GeneID:40382552"
     CDS             complement(93337..94998)
                     /locus_tag="C5L36_0B00540"
                     /inference="similar to AA sequence:RefSeq:NP_010074.1"
                     /note="PKUD0B00540; similar to Saccharomyces cerevisiae
                     YDL207W (GLE1); ancestral locus Anc_8.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320264.1"
                     /db_xref="GeneID:40382552"
                     /translation="MRFVPHRNPGFQTADIYDDTFTDFSSDYDSDDGFNTELEDTEGN
                     ILHSDVTLPLEELEQLPEFLSEQGLNKRFDLACKLADHKELIPIRQYSPNLKPSSRLP
                     TSESAQTQVERNRDDNLESYFVSRFTEEKLKRKQKLDFLIKEEEERKRKIEEERRRKE
                     EEERRRREAEARRIKEEAEKKAREEAERKRREEEEKRKALEEEKRRVERLEKARREQE
                     EALKKQKEAEHEAKRKLDAARKEEEEKKALEEAKNSIVKPSEIEKLYMKYMDNIKVIE
                     ETILNPVREDKELKKVVGTHKRKINPKFGQLTNSQQQYFRLVTEIRDLILQTQSNELA
                     YKWILNFVSDAIISQAETEVSVKPKSSLPLAKLTLNLMLLFPALRHYMLCKFYRSCPM
                     LIGYSCSEDTEEGRGRMGWMRDEDTGKWENEVQHNERLSGISTLYSVITRLKVDQSYL
                     GYDPSSMKHPLPISHSWIFLARMVDTPSALVTETHFVIVGSWWDACSREFLQAYGRQS
                     AKLLRLIVEKWTRINGKSSAGRVRLQLLGEEWSKGVVKSFPEMEM"
     gene            <95321..>96241
                     /locus_tag="C5L36_0B00550"
                     /db_xref="GeneID:40382553"
     mRNA            <95321..>96241
                     /locus_tag="C5L36_0B00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464406.1"
                     /db_xref="GeneID:40382553"
     CDS             95321..96241
                     /locus_tag="C5L36_0B00550"
                     /inference="similar to AA sequence:RefSeq:NP_010523.3"
                     /note="PKUD0B00550; similar to Saccharomyces cerevisiae
                     YDR237W (MRPL7); ancestral locus Anc_8.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320265.1"
                     /db_xref="GeneID:40382553"
                     /translation="MFIQSIRQFSSTCAVSKVGCAQVKPVHHKVKIIKKFLSPRFPEL
                     KLDPYDIRSPKFKPYLTHPDRVEDHYFNSLQSDLLLINYRHGQQPVYGNKRRQWDMTS
                     PYHLNRPLRKPRGQVVPSATIHPRTYDNVPVLEGVTLNCFVKDAKLYPAQAISAALQL
                     QQITGVKPTPIYAKTNVPNWKLRPGMKMGAKVTLHGRDASQFVSTLTELVLPRIRDFY
                     GISNKSGDRYGNIAFGLSGEHVKLFPEIENNQDSWPQSFGFDITLHTSAQTDADARIL
                     LSGLGFPFTGSERVPKILLNDLANPEEQSA"
     gene            <96588..>99026
                     /locus_tag="C5L36_0B00560"
                     /db_xref="GeneID:40382554"
     mRNA            <96588..>99026
                     /locus_tag="C5L36_0B00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464407.1"
                     /db_xref="GeneID:40382554"
     CDS             96588..99026
                     /locus_tag="C5L36_0B00560"
                     /inference="similar to AA sequence:RefSeq:NP_010075.1"
                     /note="PKUD0B00560; similar to Saccharomyces cerevisiae
                     YDL206W; ancestral locus Anc_8.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320266.1"
                     /db_xref="GeneID:40382554"
                     /translation="MGWIHDPVAIFGDLKLFSECEPPKNGTASEMCLYLTNNCPDLSY
                     LYQRQYYCMNVDYPIMSNVLLWVTNSILTGLLFLILGLLASDYLVPNLSSLSDLLKLN
                     EKLSGLTLLAFANGSPDVLSTYIAMKQGMTSMAVGELLGSANFALTVVIGVLAIYKPF
                     RVNETTFMRDLIVFFLLMVVSLFILFDGKISVSESITLCILYIVFIVLNFLFTDDDGN
                     EIIEGYDKNNTDNKCPMNVGDDCLNPSPIGETLSDRPENSSTNSMASNESNTSVNDYY
                     FAHNVDNLERGRGYKIALIDSLRLAWLWKRKEIKNIPLHSQSININTDIENQSEADEL
                     APLHSPSSQQIKITQHVSKDDEEDINKLDEPLQLKTDTDKKKSEIHKCAIEDSTANSL
                     NDRTIYSSASLGLNRTNSTKKIRNKDEYQILYPCKAYDPSRNNSLINIKQYFQNQDKP
                     TSSTPPLSDVEPFRGKFQIIEENDVGSFASEVHRVGARESMSEGYLSPHSYTKNITGN
                     DDTMTCSRSPSPMIRANPPSLTLIPYVEYTKNSMFTKLCPLQIYTSSLAPHETILSFL
                     IIPLSSILNLIVPVPLPSELQGDILKHELEISTNLFHIQIGVFPLILFDFDMSFTVIA
                     AAITLPLLSILFKKVVPSIYQISFTPVSSVVGFFVVLKLITLTAAGIIAILKDIAEIY
                     SLNESILGLTVLSLGNSIGDVVTNLALAGLGRPLTGLHACFGSPLLYILFGIGACSLI
                     IQLSNNHNSYIEFTVDGSLQLTALSIIMMLFFYSVMIPFNGWMFKRWMGFVGVALWFI
                     LTIANFVINGHKGI"
     gene            complement(<99155..>100669)
                     /locus_tag="C5L36_0B00570"
                     /db_xref="GeneID:40382555"
     mRNA            complement(<99155..>100669)
                     /locus_tag="C5L36_0B00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464408.1"
                     /db_xref="GeneID:40382555"
     CDS             complement(99155..100669)
                     /locus_tag="C5L36_0B00570"
                     /inference="similar to AA sequence:RefSeq:NP_010521.1"
                     /note="PKUD0B00570; similar to Saccharomyces cerevisiae
                     YDR235W (PRP42); ancestral locus Anc_8.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320267.1"
                     /db_xref="GeneID:40382555"
                     /translation="MFDLDFASIPNKEAWISSARQATENPSDFKNWEKLVQLTEILPS
                     INHKTKNTITAHSKEVEKQLVLITHENLVINFPLLEQYWINYAEWHYKFNDLSNCMKT
                     FERALKIIPSSLVIWIAYLEILMKVYYYDHETMIKYFERARISIGYHYYCSIFFDKYL
                     IFLKKNKLEKNYHFILRRIIEIPQHEYLKYFKTYFSLIENANLDTIKYILSGNDLKND
                     FNLSWVDLLNEDTFSKLKTDIRKKFVDLYITTQYYTWKFYEFEKRLKTNYFKPHHELS
                     RLELNTWNSYIEYVEVLNLKIATKEREHSLIKNNQALIQSVYERCLVVTGNYHFFWIK
                     LANYYLNYNNIDLAKETLLRGIYANPIRNLKLRIRLIDLYTITLEFDKAKAIIYELLQ
                     LLPNNLEIFCKMLQVEHFTLPSNVEKLIMNKLTEISKSKNALLENQFDYLFIEMLDYS
                     CIPTSRLRKIFEHFNRKKSTYYIKAKTMFTELYENSGSKHTVEAKKDGWCCEYF"
     gene            <100957..>101379
                     /locus_tag="C5L36_0B00580"
                     /db_xref="GeneID:40382556"
     mRNA            <100957..>101379
                     /locus_tag="C5L36_0B00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464409.1"
                     /db_xref="GeneID:40382556"
     CDS             100957..101379
                     /locus_tag="C5L36_0B00580"
                     /inference="similar to AA sequence:RefSeq:NP_012168.3"
                     /note="PKUD0B00580; similar to Saccharomyces cerevisiae
                     YIL098C (FMC1); ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320268.1"
                     /db_xref="GeneID:40382556"
                     /translation="MSGKVIFKKMYAALERNVAASHETHMREILKKQDALVQYKRMQY
                     VNAGKQLSKEEDEALVEEVKKTFASQMPKLDIGLLKYLDKEQHHPVEEEHLRNLATFL
                     DSQREYVELLERYNPGISMKQTDKVRKTARRVGLDVPE"
     gene            <101662..>102126
                     /locus_tag="C5L36_0B00590"
                     /db_xref="GeneID:40382557"
     mRNA            <101662..>102126
                     /locus_tag="C5L36_0B00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464410.1"
                     /db_xref="GeneID:40382557"
     CDS             101662..102126
                     /locus_tag="C5L36_0B00590"
                     /inference="similar to AA sequence:RefSeq:NP_010073.2"
                     /note="PKUD0B00590; similar to Saccharomyces cerevisiae
                     YDL208W (NHP2); ancestral locus Anc_8.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320269.1"
                     /db_xref="GeneID:40382557"
                     /translation="MAKKDSVKDSAEAEKDNYDLKLPYVLPFAQPLASKKLNKKVLKT
                     VKKAAKAKHVKRGVKEVVKALRKGEKGLVIIAGDISPADVISHIPVLCEDNGVQYIFV
                     PSKEDLGGAGGTKRPTSCIMIVPGGGKKGDKSGKSEEYKESYDEISKEIKNL"
     gene            complement(<102307..>104382)
                     /locus_tag="C5L36_0B00600"
                     /db_xref="GeneID:40382558"
     mRNA            complement(<102307..>104382)
                     /locus_tag="C5L36_0B00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464411.1"
                     /db_xref="GeneID:40382558"
     CDS             complement(102307..104382)
                     /locus_tag="C5L36_0B00600"
                     /inference="similar to AA sequence:RefSeq:NP_010520.3"
                     /note="PKUD0B00600; similar to Saccharomyces cerevisiae
                     YDR234W (LYS4); ancestral locus Anc_8.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320270.1"
                     /db_xref="GeneID:40382558"
                     /translation="MFTLNTRLRFQASKRRFSTATYRLAGQNLVEKIVQKYAVGLPEG
                     KIVHSGDYVSISPAHVMSHDNSWPVALKFKGLGAKKVKNNRQIVNTLDHDVQNKSEAN
                     LTKYENIKNFAKEQGIDFYPAGRGIGHQIMIEEGYAFPGNLTVASDSHSNTYGGIGAL
                     GTPVVRTDAAAIWATGQTWWQIPPVANVVLEGELPKGTTGKDIIVALCGLFNNDEVLN
                     HAIEFTGDAIKHLPVDYRLTIANMTTEWGALSGVFPIDDTLINWYTKRLLRVGPNHPR
                     INNQTLENLRNNKVLADSDAYYAKTLKIDLSSLSPYVAGPNSVKIGTSIEKLSAENKK
                     VNKAYLVSCTNSRLSDIKAAAEVVKGNKIAPGVEFYIAAASSEVQNDAEADGAWKTLI
                     DAGCIPLPAGCGPCIGLGAGLLKEGEVGISATNRNFKGRMGSKDALAYLASPEVVAAS
                     AVLGKIGAPEEVSGAPCKTATEVKKTIIINEKPAGDDSIASAPSGSKTLDGFPECIEG
                     EIVFCDADNVNTDGIYPGKYTYQDDVTREKMAEVCMENYDSEFGKKTKAGDIIVSGFN
                     FGTGSSREQAATAILARDIKLVAAGSFSNIFGRNSINNALLTLELPELIELLRKKYAG
                     SEPELTRRTGWRLKWDIPTSTVTVTNETGEVALTNKVGELGTNLQEIIIEGGLEGWVR
                     AQLKKENNA"
     gene            complement(<104644..>105960)
                     /locus_tag="C5L36_0B00610"
                     /db_xref="GeneID:40382559"
     mRNA            complement(<104644..>105960)
                     /locus_tag="C5L36_0B00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464412.1"
                     /db_xref="GeneID:40382559"
     CDS             complement(104644..105960)
                     /locus_tag="C5L36_0B00610"
                     /note="PKUD0B00610; Pfam Domains: Peptidase_M20(1.1e-38)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320271.1"
                     /db_xref="GeneID:40382559"
                     /translation="MTITSFSQNLKINSKDLVETIHSTAATFGAKGVWGSEPTQTGVC
                     RLALSDIDKQVKDWFVSETKKLGCTIKIDEVGNIFATYPGKYNDHKPTGIGSHLDTQP
                     TGGRYDGIYGVLSGLQVLRTLHANKITPNFPITVINWCNEEGARFPMSLMASSVWAGI
                     KTKDEVYALKDVYDNETTVLEELKRIGYLGDVECSYKTNPLDCHFEIHIEQGPVLEKY
                     GKPVGVLTGAQAYNWLIVKMKGMSQHTGTTPMEFRRDALLATSKVITGVNQIAKKYGG
                     LASIAHMTVSPDVVNVIAGEVEFVLDIRHETDEGLTKIRKDCIELIERASLNEDGNGV
                     RLPYTIEDPYPIKATHFDEMLINIVDESATVIVGDEGKHKMVSGAGHDSCATNLVVPT
                     VMIFVPSVDGVSHNPREHTKPEELEIGFRVLLESILRYDNARLSDL"
     gene            complement(<106190..>107248)
                     /locus_tag="C5L36_0B00620"
                     /db_xref="GeneID:40382560"
     mRNA            complement(<106190..>107248)
                     /locus_tag="C5L36_0B00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464413.1"
                     /db_xref="GeneID:40382560"
     CDS             complement(106190..107248)
                     /locus_tag="C5L36_0B00620"
                     /inference="similar to AA sequence:RefSeq:NP_010688.4"
                     /note="PKUD0B00620; similar to Saccharomyces cerevisiae
                     YDR400W (URH1); ancestral locus Anc_5.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320272.1"
                     /db_xref="GeneID:40382560"
                     /translation="MTIEKKVPVWLDCDPGQDDTVAIIVACYCKYFDLVGISTVHGNV
                     SLENTTRNALRVLTAISKTEVPVYPGEPKPLNNYNEVFAANVHGKTGLDGSCLLPIAQ
                     MQPQKHKDFHRHLAHNIIKYEGKLNIVATGPLTNIAVFFEEYPHLKNRINWISIMGGG
                     FDVYNIGGNAEFNYYCDPFAARKVVEDEILSKRMIQASLDITSKVYLSKTVQERILQG
                     KDFNSTSNFRAMMYEFIDSYNRRMIAQNVPNYKGPIIHDPVALVALLQFENITSKLNL
                     SFDRRSFGIGVAEGSYGAIQSVRPDNKGGIYVLTDIDVEEFWDFVLKSYDEADKHAYM
                     NSVPREKLIQEYAGLSVA"
     gene            complement(107423..107493)
                     /locus_tag="C5L36_0Btrna6G"
                     /db_xref="GeneID:40383857"
     tRNA            complement(107423..107493)
                     /locus_tag="C5L36_0Btrna6G"
                     /product="tRNA-Gly"
                     /note="PKUD0Btrna6G; codon recognized: GGC"
                     /db_xref="GeneID:40383857"
     gene            complement(<109578..>110030)
                     /locus_tag="C5L36_0B00630"
                     /db_xref="GeneID:40382561"
     mRNA            complement(<109578..>110030)
                     /locus_tag="C5L36_0B00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464414.1"
                     /db_xref="GeneID:40382561"
     CDS             complement(109578..110030)
                     /locus_tag="C5L36_0B00630"
                     /inference="similar to AA sequence:RefSeq:NP_015519.1"
                     /note="PKUD0B00630; similar to Saccharomyces cerevisiae
                     YPR193C (HPA2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320273.1"
                     /db_xref="GeneID:40382561"
                     /translation="MIEIRDVTETDYMEWLRLFDLYLQFYNSSLPEEVKKSTFYRSLD
                     YNVPMWSAIAISSETGRPIGLVNYLRHVSTWSTQDKIYMNDLYVDESQRLQGVGKALI
                     DYVYAKADSMETPEVYWCTSTSNHRAQLLYCKVGVFADKVIYKRLPSS"
     gene            112371..112442
                     /locus_tag="C5L36_0Btrna2W"
                     /db_xref="GeneID:40383832"
     tRNA            112371..112442
                     /locus_tag="C5L36_0Btrna2W"
                     /product="tRNA-Trp"
                     /note="PKUD0Btrna2W; codon recognized: UGG"
                     /db_xref="GeneID:40383832"
     gene            complement(<112508..>114265)
                     /locus_tag="C5L36_0B00640"
                     /db_xref="GeneID:40382562"
     mRNA            complement(<112508..>114265)
                     /locus_tag="C5L36_0B00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464415.1"
                     /db_xref="GeneID:40382562"
     CDS             complement(112508..114265)
                     /locus_tag="C5L36_0B00640"
                     /inference="similar to AA sequence:RefSeq:NP_014172.1"
                     /note="PKUD0B00640; similar to Saccharomyces cerevisiae
                     YNL227C (JJJ1); ancestral locus Anc_2.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320274.1"
                     /db_xref="GeneID:40382562"
                     /translation="MKTDYYELLGVSESATSVELKKAYRKKALLLHPDKNPDDIEHTT
                     RLFNEVRVAYETLSDPQERSWYDSHKFQILMEDGDEQSSSACYYEDETNMYYAGTTVE
                     DIEKYMNSNLYKNFDDSINGFYSIVSVLFDKIASEEVTAGKQQKIPEFAKYKDDTSFA
                     TVCDPKELLYPRIGNSKNDFEDTRMFYKVWSGFQSVKTFAWCDEYRYSTAPDRRTRRI
                     MEKENKKLRDTAKKNYNDAVKKFVAYIKKLDPRMDPKFRRQYERQKLSKQREELKKQA
                     EIEKQERQRQRQLFEEQDWQAIDPDDLAEIEAQLDKIYSEEKDIDDASADEANADIFE
                     CVICNKVFKSEKQFEDHERSKKHLKLLKQLKWEMKKEGIELGIDEDGYINEGLDDEDL
                     GASDEFDDALETLSDLDELTNEELEAMIQSQLEEQQVQEALFGEETLEENAVCDEAKH
                     KDNESQNIVCESEEEIDYLLNDDLYDSNHNEERRSQKELRRNKTERKLEELSNLLNGA
                     VLSDDDEEAWCNQKVKAKKGKTKPKINNTRNKATTNTEACSVCKETFSSRNKLFQHVN
                     STGHAAPISKVKKNKRSKK"
     gene            <115022..>116686
                     /locus_tag="C5L36_0B00650"
                     /db_xref="GeneID:40382563"
     mRNA            <115022..>116686
                     /locus_tag="C5L36_0B00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464416.1"
                     /db_xref="GeneID:40382563"
     CDS             115022..116686
                     /locus_tag="C5L36_0B00650"
                     /note="PKUD0B00650; Pfam Domains: AA_permease(3.3e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320275.1"
                     /db_xref="GeneID:40382563"
                     /translation="MEAIKSATGFAPITSTASRFHEISALASPIREIDAVHAEDDDDL
                     LAEIGYKPELMRRFSTFQIFGIAYSIMGILPSVASLLGDALTSGPAGAVWSWVIASFL
                     ILTVGIGMSELASAIPTSGGLYYWTYYYAPDSVAVPLSFVIGLSNTLALCSGTVSVFY
                     GCAQEVLAAVYLTNNDFVITDGKTYGVFAGCIFTGALATCVSSKNVAFLQTLSSACHT
                     GLLVLFLIALPIGTKINRGEFNSRGFIFGDVQNYSDWTTGWQFCLSFMTAVWTIGAFD
                     SCVHMSEEAKNATHGVPIGICGAISVCGLLGFVILICVCACMNPDIETILATDTGFPM
                     AQVIYDSLGNKWAIAFMSLMAVCQWLMGASLVTASSRQIWAFARDNGLPFAEIFKVVN
                     KRMKVPLRAVGLAGLISLAIGCLCLAGSTAAGALFSLGVCGNYLAWCTPIFLKLVFGK
                     DKFKPGAFYLGKILSSINGWIACAWGAFIIILACFPSSKHVDKTTMNYASVITGGCWI
                     LSIVFFFTYKYKYYHGPRSNLEDPIQDTSSESELIKLSANEKADMA"
     gene            <117532..>119196
                     /locus_tag="C5L36_0B00660"
                     /db_xref="GeneID:40382564"
     mRNA            <117532..>119196
                     /locus_tag="C5L36_0B00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464417.1"
                     /db_xref="GeneID:40382564"
     CDS             117532..119196
                     /locus_tag="C5L36_0B00660"
                     /note="PKUD0B00660; Pfam Domains: AA_permease(1.2e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320276.1"
                     /db_xref="GeneID:40382564"
                     /translation="MEAIKSATGFAPITSTASRFHEISALASPIREIDAVHAEDDDDL
                     LAEIGYKPELMRRFSTFQIFGIAYSIMGILPSVASLLGDALTSGPAGAVWSWVIASFL
                     ILTVGIGMSELASAIPTSGGLYYWTYYYAPDSVAVPLSFVIGLSNTMALCSGTVSVFY
                     GCAQEVLAAVYLTNNDFVITDGKTYGVFAGCIFTGALATCVSSKNVAFLQTLSSVCHT
                     GLLVLFLIALPIGTKINRGEFNSRGFIFGDVQNYSDWTTGWQFCLSFMTAVWTIGGFD
                     SCVHMSEEAKNATHGVPIGICGAISVCGLLGFVILICVCACMNPDIETILATDTGFPM
                     AQVIYDSLGNKWAIAFMSLMAVCQWLMGASLVTASSRQIWAFARDNGLPFAEIFKVVN
                     KQMKVPLRAVGLAGLISLAIGCLCLAGSTAAGALFALMVCGNYLAWCTPIFLKLVFGK
                     DKFKPGSFYLGKVLSTINGWIACAWGVFITIVACFPSSKHVDKTTMNYASVISGGVWI
                     LSIIFFFTYKYKHYHGPKSNLDDSAIDGSSDAESVKLPLHEKSDIV"
     gene            <119597..>121195
                     /locus_tag="C5L36_0B00670"
                     /db_xref="GeneID:40382565"
     mRNA            <119597..>121195
                     /locus_tag="C5L36_0B00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464418.1"
                     /db_xref="GeneID:40382565"
     CDS             119597..121195
                     /locus_tag="C5L36_0B00670"
                     /inference="similar to AA sequence:RefSeq:NP_116709.3"
                     /note="PKUD0B00670; similar to Saccharomyces cerevisiae
                     YFR051C (RET2); ancestral locus Anc_3.575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320277.1"
                     /db_xref="GeneID:40382565"
                     /translation="MVVLAASVCTHGGKPIISRQFRDLTKERVMTLLANFPTLLSESN
                     NSQQTSVEDEYVRYMYQPLEEFYVVLITNKHSNILQDIDTLHLFSQSITSILRHVDEK
                     EIYENCFELLSAFDEIICLGYKENLTSSQVINFLEMDSHEERIQEIIERNKELEAAEA
                     SKKKAVELQFKEMMKKSNPHALDQFQQQQNFYSPPPPQNVYTEPEPELQHHHSTLANN
                     NKRSGGTQLGRKQSAFGDNQPLLVNPSASTRRIEQPLYQEQDSRTQSSSLTPANKQPQ
                     IENNGILLTVNEKYSAQISREGTVTSAEVKGDLQIRISNPELAKAQIKLSLNDSSEFS
                     TQYKTHPNVDKKLFNSNSIIGLKDPTKPFPSNDLNLGVLRWRSTLKKTDSEDASGLLP
                     IILTTWVNNNNDGTIGLTFEYEVNTAKNVDEVIIIIPIVNASLESSENDNASLQFTDD
                     GVYIKLTNLLETQSGSFEILCKNTDDEEALFPMEVSFSELKEIDSLKQGSGLVVESVI
                     STDSQDALPYDIYINASNESYYIV"
     gene            <121520..>121897
                     /locus_tag="C5L36_0B00680"
                     /db_xref="GeneID:40382566"
     mRNA            <121520..>121897
                     /locus_tag="C5L36_0B00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464419.1"
                     /db_xref="GeneID:40382566"
     CDS             121520..121897
                     /locus_tag="C5L36_0B00680"
                     /inference="similar to AA sequence:RefSeq:NP_013775.2"
                     /note="PKUD0B00680; similar to Saccharomyces cerevisiae
                     YMR059W (SEN15); ancestral locus Anc_2.625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320278.1"
                     /db_xref="GeneID:40382566"
                     /translation="MINTLGLTSKVKLHLTHSVMWSNIITLNIENLDLQRRQSTPPID
                     ADGMNQLTYVLRGTNPKNHKTEYVIPISKRSVLTLEMISLIFENIQILEDDILDKMLV
                     AVVDHDSSILYYYVHKGVKNYTD"
     gene            complement(<121908..>122840)
                     /locus_tag="C5L36_0B00690"
                     /db_xref="GeneID:40382567"
     mRNA            complement(<121908..>122840)
                     /locus_tag="C5L36_0B00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464420.1"
                     /db_xref="GeneID:40382567"
     CDS             complement(121908..122840)
                     /locus_tag="C5L36_0B00690"
                     /inference="similar to AA sequence:RefSeq:NP_013776.1"
                     /note="PKUD0B00690; similar to Saccharomyces cerevisiae
                     YMR060C (SAM37); ancestral locus Anc_2.626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320279.1"
                     /db_xref="GeneID:40382567"
                     /translation="MTYKIYAWGDGKSIAPFDVSSHILNHLIQENNLKDFELIVNSNI
                     FQSHSGRLPYLVDEDCPNKQATGFVEILKIIKDHTAKSNQHTSPKLNLLYLAFLDDLV
                     ENLELITMYNFFFLKKNYEGFTRGIFQSYLTWPMQYKPPVDLRNHAIEICLENGIINQ
                     ESVPNGEATYFNSNLEDELENLNSEEKKLRDTPVINELQKSQMDQQLAVLAERKTMVS
                     NMQCLNRLKTLLAKFEDFKSKINDPVFELIVNYYMKLNSFDQLPEKFISMWLQREYPK
                     LYKEVTDLKIIPIDNNTEKVPLSTALKKTLTSFL"
     gene            <123110..>125023
                     /locus_tag="C5L36_0B00700"
                     /db_xref="GeneID:40382568"
     mRNA            <123110..>125023
                     /locus_tag="C5L36_0B00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464421.1"
                     /db_xref="GeneID:40382568"
     CDS             123110..125023
                     /locus_tag="C5L36_0B00700"
                     /inference="similar to AA sequence:RefSeq:NP_013777.1"
                     /note="PKUD0B00700; similar to Saccharomyces cerevisiae
                     YMR061W (RNA14); ancestral locus Anc_2.627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320280.1"
                     /db_xref="GeneID:40382568"
                     /translation="MSIPEKRKVENEDPDEYTPEPKRTQVEAPGDENEQDAAEKDIVL
                     DDYRAWEKHLNYIICQGNEEEINRSFEKFLSQYCNDGEKWADYIEFKMKDKTLETVDR
                     IWIESKFAKVLPKIYSIKLWRRYVKYVEFINPITPDNGEKARSTVFKAYKFAIDTVGN
                     DFFKSDELWGDYLRYLYNWQTVNSNESTTKEGMIRSVLKKMISYPSLKLEENWNIFIK
                     FEADLNINKSRKIIADCTPEYLKIKSINDELKKLTKNITELKDRRYVKRQLVKWQKWI
                     EWEKENHLKISPEDVDRRVNYVYNLSVQYCRLIPEVWFNYYYYLILERNDKTKSIDIL
                     EMGHSVNPTSLLLCNEMSRYYESKGDLEKVRKVWLELIERIEKSKTYSNKDEIVSYLY
                     CDLLKVVNRISNIKEVRNIFKLARKYMNIKWNVYVTYAMIEYYNNEAKIANRSFALGM
                     QYFKREVHFVEKYLDFLIDTRDMANFKKVIEISIENFKEVSDDRALKILFNKYYEVEE
                     RIGDSESMNSLITRYSALFGKAKISNFIRSGLKNNFNGVDVVRILDEYKEIAESNDSD
                     VEITGSGSVTSVIEGLKEETRPAEENKREANEENELMAKLQGFLQALPKDAQIQEQIK
                     VLSIGQLMDHFGV"
     gene            <126439..>127896
                     /locus_tag="C5L36_0B00710"
                     /db_xref="GeneID:40382569"
     mRNA            <126439..>127896
                     /locus_tag="C5L36_0B00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464422.1"
                     /db_xref="GeneID:40382569"
     CDS             126439..127896
                     /locus_tag="C5L36_0B00710"
                     /inference="similar to AA sequence:RefSeq:NP_015061.1"
                     /note="PKUD0B00710; similar to Saccharomyces cerevisiae
                     YPL262W (FUM1); ancestral locus Anc_6.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320281.1"
                     /db_xref="GeneID:40382569"
                     /translation="MLAARSLKARMSTRAFSTTSIAKRIEKDAFGDIEVPNEKYWGAQ
                     TQRSLQNFKIGGKREVMPEPIIKSFGILKKATAKINAESGALDPKLSEAIQQAATEVY
                     EGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKTPVHPNDHVNMSQS
                     SNDTFPTVMHIAAVTEVSSHLLPELTALRDALQKKSDEFKNIIKIGRTHLQDATPLTL
                     GQEFSGYVQQCTNGIKRIEIALEHLRYLAQGGTAVGTGLNTKKGFAEKVANEVTKLTG
                     LQFYTAPNKFEALAAHDAVVEMSGALNTVAVSLFKIAQDIRYLGSGPRCGYGELALPE
                     NEPGSSIMPGKVNPTQNEALTMLCTQVFGNHSCITFAGASGQFELNVFKPVMISNLLS
                     SIRLLGDGCNSFRIHCVEGIIANTDKIDKLLHESLMLVTALNPHIGYDKASKIAKNAH
                     KKGLTLKQSALELGYLTEEQFNEWVRPENMIGPKD"
     gene            <128369..>131827
                     /locus_tag="C5L36_0B00720"
                     /db_xref="GeneID:40382570"
     mRNA            <128369..>131827
                     /locus_tag="C5L36_0B00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464423.1"
                     /db_xref="GeneID:40382570"
     CDS             128369..131827
                     /locus_tag="C5L36_0B00720"
                     /inference="similar to AA sequence:RefSeq:NP_009531.1"
                     /note="PKUD0B00720; similar to Saccharomyces cerevisiae
                     YBL022C (PIM1); ancestral locus Anc_8.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320282.1"
                     /db_xref="GeneID:40382570"
                     /translation="MFNQSKRALSYRASLLRRTYALNKRFASGFTAQETKLLLNKIHD
                     DKIGESVKLSSIWKTSSVEVTPFVNPHLETLLKSSKKSTNIGDSHNSIKKDDTADKKK
                     DDEPNNKDQDKNDDNDKGITKRENHSKLSSGSNAAASNLSGPSTPGDSGDGDDSKGAK
                     PKSARSTSSSTLAEVPEVYPQIVALPISRRPLFPGFYKAVIISDVNVIKAIKESLDRK
                     YPFIGCFLFKDENMESDVIESKDQVFETGVLAQITSNVYTKDKDTGVETLTTVLYPHK
                     RIRIDELFPPSAIGNEKSDVSTVSVSDADIEVKAKKQPIEGIIGEKEGDEPINPSDIL
                     NDEQNSSETLIEQPHEPVVVEEENPTEFLKKYPITLANVSNVEDEPFDKNDVVVTSLT
                     AAILDVLKEMSLVNRSFSDQLATFSASLHSDIFNCPEKLADFAAAVTAGSQEDLQKIL
                     DCTNIAERLEMALTVLKKELMNKEMQKKIEKDIEERMSKRHREYHLNEQLKWIKKELG
                     IDDGRDKLIAKYNERVKSLKMPEEVKKIYDEEINKLQTLETVMSEFTVTRNYLDWLTQ
                     IPWGKQSVDNYNIKRAKKVLDEDHYGLKDVKDRIIEFIAVGKLLNKINGKIICFVGPP
                     GVGKTSIGKSIAKSLNREFYRFSVGGLSDVAEIKGHRRTYVGAIPGRVVQALKKTQTE
                     NPLILIDEIDKISHSHSVNGGDPSAALLELLDPEQNGTFLDNYMDIPIDLSKVLFVCT
                     ANTLSTIPGPLLDRMEVIEISGYIEDEKIKIAEKYLAPEAKKNTGLENVNVELSESAI
                     RALIKNYCRESGVRNLKKQIDKIYRKAALNAVESVGEEEIDEIIAEEKEAHATEPVVD
                     AATEKAEKTLGKTDKDSKVEETVLDKIEKEGEEETVATGASEEEPKTPQIVIPDTYKA
                     VIDEKNLKDYVGVPVFTADRLYETTPPGVVMGLAWTSMGGSALYIESVLEHAITKDSH
                     SKLERTGQLGDVMKESVRIAYSFSKMFLTKNFPDNKFFDRAQIHLHCPEGATPKDGPS
                     AGITITSSFLSLAFNRPLRPDVAMTGEITLTGKVLRIGGLKEKTIAAKRAGVKTIIFP
                     KGNESDWNELPENVKEGITPVPADWYQDVFDVLFQDIGKEEGNNVWKAEFDKIAEEEK
                     KEKAEK"
     gene            <132048..>132686
                     /locus_tag="C5L36_0B00730"
                     /db_xref="GeneID:40382571"
     mRNA            <132048..>132686
                     /locus_tag="C5L36_0B00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464424.1"
                     /db_xref="GeneID:40382571"
     CDS             132048..132686
                     /locus_tag="C5L36_0B00730"
                     /inference="similar to AA sequence:RefSeq:NP_014492.1"
                     /note="PKUD0B00730; similar to Saccharomyces cerevisiae
                     YOL149W (DCP1); ancestral locus Anc_3.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320283.1"
                     /db_xref="GeneID:40382571"
                     /translation="MGVLLMLQLKVDASFFFLTGITMSCVDTHAKKSNDTIDSSEESS
                     SQTIEIYKQALTFNVIAKYDPSISQLLHISSYCVIYQYDEDIEDWTKSSYMGPIAVYS
                     RRSIWDNYRDDDIKKLDVQTIVNSEHGEYYRFGLLVLNRAQPENFSLGFLGDKYLKQS
                     EIESDQNLLVEKSDELIIVRDFNGKAFGLWIFDPKDRDYLYQLLMYCIEKLE"
     gene            complement(<132748..>135807)
                     /locus_tag="C5L36_0B00740"
                     /db_xref="GeneID:40382572"
     mRNA            complement(<132748..>135807)
                     /locus_tag="C5L36_0B00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464425.1"
                     /db_xref="GeneID:40382572"
     CDS             complement(132748..135807)
                     /locus_tag="C5L36_0B00740"
                     /inference="similar to AA sequence:RefSeq:NP_014493.1"
                     /note="PKUD0B00740; similar to Saccharomyces cerevisiae
                     YOL148C (SPT20); ancestral locus Anc_3.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320284.1"
                     /db_xref="GeneID:40382572"
                     /translation="MNSGNGMSGQSYDQHLQSQFSSNLNSFMDPVNQLTQNNQSNQPS
                     PLNQFTQTNTVGSGGNNEYSTNQSNQLGMNQMNIPINQQVSSQFMNDHSSMFSNTNSV
                     NDMSSGSPLNHINALNNMNSLGNIGNIDHSTNFSPTSQFNHMNNMSNMNSINSMNNMS
                     NMSNMSNMNSINSMNNMNNMNNMNNMNNMNNMNNMNNMNNMNNMNNMNNMNNMNNMNN
                     MNNMNSMNNINVMGAIANTNNLNKMNNANNGNNMNNINEVRNINSLNNNMNNINPVNS
                     LNSMNYNTMNTMGNLNSVSNMQNLGSVNQVNNSNQANQFTNRNQSFQVPNAHRPGINH
                     QTLSNNGQVSNAEYIQSLLRKLQPEPGMTKQEKFKQLLKNGELTRSDVQLLQRHQAMI
                     KQAHIMRQRQAQQQSLQAQISQQTSRTAGKSIPGKTLPNASGSEGFAGNIAGKTVPGK
                     TVPGKTVPGKTVPGKTVPGKSITAGIRNSRSYSQSPVAGKSMPGAQQAQYQDNMNVIS
                     PMGAGMPVKNASVNMNNHANVPNNQSLNTLVNTSINAPVNKPVNNPINNAQVAKLKQN
                     EQKRLLQQQQQKYFGLTPEQYEKLTPQQKQMVKMQYLRRKAKTHRFYEADQELLKKYE
                     NSPPSMDFHIHEDHYKFGNSDNLIPKSDPSIKDFLRHVAKKQIPDALMEIIKDGNIQL
                     YEGNIILRIFDHRTKARKNGIKNSPSLTKSEPVSQSSDGVTPQKDDKGDLASSKKPFK
                     EYRTILRLTQSGLYEDFCLTTDTQLFGDSFVLTFESELLTATARNVNLQPIQNPYLQD
                     KSLWPTEQMVLPTYDEVNDKMVFPHRKDMREVVNERFRPNKKRKLIDFENYSYKPLHN
                     DESQLNSKYEKVMLIMNESSAHSNISINKQDIELPRFERLRFVESLRRQNLLNKEVNT
                     NGLNSETSNVGGYTGLSGLRGVNTKPFSAGLPTKNDNITEVKANTQDDEKKTTKPNTK
                     VPASKKKADKPKKPRKPTKKQLAAQAAAENGTPVETKKKKTPAKKKA"
     gene            <136597..>138678
                     /locus_tag="C5L36_0B00750"
                     /db_xref="GeneID:40382573"
     mRNA            <136597..>138678
                     /locus_tag="C5L36_0B00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464426.1"
                     /db_xref="GeneID:40382573"
     CDS             136597..138678
                     /locus_tag="C5L36_0B00750"
                     /inference="similar to AA sequence:RefSeq:NP_015140.1"
                     /note="PKUD0B00750; similar to Saccharomyces cerevisiae
                     YPL184C (MRN1); ancestral locus Anc_6.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320285.1"
                     /db_xref="GeneID:40382573"
                     /translation="MSNINNYISHQLKSDPNHQQQYQFPLPSTQNNAYNNIPMQQSQS
                     YSMNNESIYSQQMEKNTSNSHYSLLSQSNLQNLPFNPQISTSVTPLSSLNPNSVPLMM
                     QNSNATSLLPPNNNQSQLLPASVAMTPQLSVNSQMGLNDLSSPELNTSLNMNSNSNAT
                     PSPIDTFGNYNPELSNVPSRTVYLGNIPKDVTANEILNHVRSGTVESIKLIPSKNCAF
                     VSFLDEKPATLFHSDAILKRLAINNQDIKVGWGKPSPVQPVVASCVQRYNATRNVYIG
                     NLPDGITENELRQDVKEFGEIDTIKLLLDKRIAFVHFTSIIAAIRCVQSLPLVEKYKD
                     RRIFYGKDRCAFITKTQQHNAAQYLGLNPNQDNFLTQVNRDLIANALVQQSNAAAMIA
                     TSTGGNANLGNRTIYLGNLHPDSTIEEICNVVRGGILQNIRLIQEKHVCFITFIDPIS
                     AAQFYAMSSLHGLIIHNRKIKVGWGKHSGPLPNSINLAVGNGASRNIYIGGLDKIPEI
                     VFSKEKLFNDFKEFGDIEQINFFQERHCCFVNFTNISNAIKAIDGIRNNPDYQKCKIN
                     FGKDRCGNTPRQFQLGSNSSSNSNNHNSSISSNGNSNANTNINSDSTTSSYINDGLST
                     HLKNINLQTSSTNANSTQFSSHVEQSSEGDDDDDDDDNEYIDEAKIRYQPLGIIIDKQ
                     SNSTQNSMNGH"
     gene            <139260..>140957
                     /locus_tag="C5L36_0B00760"
                     /db_xref="GeneID:40382574"
     mRNA            <139260..>140957
                     /locus_tag="C5L36_0B00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464427.1"
                     /db_xref="GeneID:40382574"
     CDS             139260..140957
                     /locus_tag="C5L36_0B00760"
                     /inference="similar to AA sequence:RefSeq:NP_010982.1"
                     /note="PKUD0B00760; similar to Saccharomyces cerevisiae
                     YER060W-A (FCY22); ancestral locus Anc_7.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320286.1"
                     /db_xref="GeneID:40382574"
                     /translation="MQNLVQYARKTSQFVDSLGVETKGIHRYLPNERNNEQSIRPYIS
                     TLGLWISGCGGLTAMSSFFLGPLLFGLGYKDTLICGILGLLLGCLFAAYCATMGPRSG
                     LRQMCSSRYLFGPWMVRIVGLITIIGFLGWSVTNSVLGGEILKWLSGGKLSLSVGVII
                     VCIVSLVVALFGIEYIMMFEGFIGIFVMIVVLLLYIISGKEYTQYTNLPTIGTDSLTK
                     IGNRISFFTLAYSTTTTWGGCASDYYVVFPENVPQSTIFVFTFFSIGIPSLFSGVIGM
                     LIGNAAVGNKLWNDTYEEKSLGGLLNLVFDRWGNFGKFLLVILWLSLITNNIINTYSS
                     ALSVQLLDDLAYRYLPRWFIVIIIFAITLVCSLVGRDHFSSILSNFLPMLGYWVTIYF
                     ILLLEENVIFRSTRLVKLFRKELYEELYLSRLQMGEDYTTSNDSEKAEEFRMVNNTVT
                     SSNGLSLSSPSTSSASSTLVKGNTVPPFSTVSSVPYYNFEAWNDKYVLTNGIAAVFAF
                     CCGVAGAVVGMNQVYYVGPIAKIVGEYHADLGVFLAMGFAGLSYPPARYIELLYFKK"
     gene            complement(<141078..>141689)
                     /locus_tag="C5L36_0B00770"
                     /db_xref="GeneID:40382575"
     mRNA            complement(<141078..>141689)
                     /locus_tag="C5L36_0B00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464428.1"
                     /db_xref="GeneID:40382575"
     CDS             complement(141078..141689)
                     /locus_tag="C5L36_0B00770"
                     /note="PKUD0B00770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320287.1"
                     /db_xref="GeneID:40382575"
                     /translation="MPVDGEETHLVFKLYDPSKLHHRVNVAGTFNNWNPNGDLLSFDL
                     KTKTWLLDLLVDLPVNERVLYKYIVDEGTWICDGEAPSTKDELGNENNVTYVVAITRD
                     QPEAGQKDNGPLNNTSDHENELFEPSEDAVQDGGSAPSSGESDTHNDVPQASQVLTRR
                     NVHKSDFPDTPNVEEHRPTTSFWDQVKWFFHYLLSWFYPQTQT"
     gene            <141964..>142959
                     /locus_tag="C5L36_0B00780"
                     /db_xref="GeneID:40382576"
     mRNA            <141964..>142959
                     /locus_tag="C5L36_0B00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464429.1"
                     /db_xref="GeneID:40382576"
     CDS             141964..142959
                     /locus_tag="C5L36_0B00780"
                     /note="PKUD0B00780; Pfam Domains: DUF1749(1.6e-114)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320288.1"
                     /db_xref="GeneID:40382576"
                     /translation="MWILYLLRIFDCYLQLFLRMWFLKKTRKDLSTMNRIKGSLLEYA
                     FKKHAFEYGDLNSENVLIFVGGLTDKLATVPYVPFLSGELNKMGWSVVQIEFTSSHIG
                     WGTGSLARDHSEIAELVRFLKSKQGGARKKIGIMGHSTGCQNTIYYFCKAERNKDYDE
                     LDFGIIQASVSDSEAVSMFGNEATKLVEEGLVLAKEHLERGQPKELMPYKYSQLFFDT
                     PLNAYRFYSLYSKRGDDDFFSSYLSDQELKSIFGKIDKPLLCLYSGADEFVPEKIDKE
                     LLLKRFSEATPNGLWSKNSKVISGALHNLGDGSRDGAVAELGRAVVGFLTEEVGC"
     gene            <143283..>145094
                     /locus_tag="C5L36_0B00790"
                     /db_xref="GeneID:40382577"
     mRNA            <143283..>145094
                     /locus_tag="C5L36_0B00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464430.1"
                     /db_xref="GeneID:40382577"
     CDS             143283..145094
                     /locus_tag="C5L36_0B00790"
                     /note="PKUD0B00790; Pfam Domains: Mem_trans(2.5e-33)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320289.1"
                     /db_xref="GeneID:40382577"
                     /translation="MSVHSDLPLGQVIYTAVKPIFKIYLIMAVGFYLARKNILTVDTS
                     RNISSIALNVLIPSISFQKIVTNINNTMIKEIATIVIVGFFMMFSQALIIFGVGVAAG
                     CPRNWWGGLILCGLLPNISDLPIAYLQTMETAGIFANVDLGVSFVMIYLCLQMIIQFP
                     AGSYRLVEWDFKTERLMQQKSDKEKGADGANDIGDLEQCVNIDGDSVNYNIGNNENNQ
                     NNDNDNDDNNDNHNVNDADQGHNTSSHSSLSKELHQIPGSNNIPNVIVGATDSSTMLS
                     SIDSESLNSNASRLTPRSSNFHELAHQASIVRKTTQNSGNDLRRNISHISNISMLQND
                     KIDQPPEDLNDIVRVYSKYNNSAVAPDVPTPQTSKTIQSELKKSINLKKIGKNEQKFQ
                     HKFISSIKKIDWKSTIKETLHIILDSLKMPASFVLIISIVICMIPWVQALFVNSPQVK
                     LPPAPDKQPPLSFIMDFAGYIANAQVPFGLLLLGGTIGRLKIETFPKKYWKVPVSIMF
                     MRLFIFPVIGCAFNSKIHKDGLFYGQDILYFLSNINFCLPPATSLLYLTAFYTPIDGK
                     YHVQMDLLSLVYISHYIFLVVCLPFTATYTMKVSLGY"
     gene            <145364..>146956
                     /locus_tag="C5L36_0B00800"
                     /db_xref="GeneID:40382578"
     mRNA            <145364..>146956
                     /locus_tag="C5L36_0B00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464431.1"
                     /db_xref="GeneID:40382578"
     CDS             145364..146956
                     /locus_tag="C5L36_0B00800"
                     /inference="similar to AA sequence:RefSeq:NP_011267.1"
                     /note="PKUD0B00800; similar to Saccharomyces cerevisiae
                     YGL247W (BRR6); ancestral locus Anc_3.571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320290.1"
                     /db_xref="GeneID:40382578"
                     /translation="MFGYVSLSGFFIRTDFRFFETMEEIAKDDLNGPATSTPEKLNGK
                     FKLDLSEVSKNVVNLTPKGDHNSPGYQDKKYPDPVMNVPNQGDTFYSESLNRLRMLDQ
                     STNYHIDKNDIEDHDLTPLFKKLPSNKFQISSSTPINEKVVGDPNYKEIKFSKGTRNI
                     FNLSPDIETMKTNVNISSISSSNPVKCAFNVFDKKNVSFSSRNSSFASKCLHKPRKRP
                     KKSENSSFSDMFETHTSTQERNHLATSYSQSQKINTTGINSSTSHSFNGNKISFYEFV
                     QSLVSDPERIANFTLILQVTLNVILVLIFLGFGAFAFIAIKRDVDRKISIYVSDVLHQ
                     INSCRREYLRNNCAPEMRVPALEYKCNQWDACMEQDPESVITSMAYFEVLADCMNAFF
                     HNITLKSLLGIGCLTLFCVVAPNIIFSKFRSTTINSAQYTPERINSDEILAVKQGPNK
                     PPLHTPISESDRIHDAGNSNVASNRKQLTGTSVRFNPNISYSFYDLDNDEKNQSDLKN
                     EIVESEEDDDSLPGNQRILMGA"
     gene            complement(<147097..>148995)
                     /locus_tag="C5L36_0B00810"
                     /db_xref="GeneID:40382579"
     mRNA            complement(<147097..>148995)
                     /locus_tag="C5L36_0B00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464432.1"
                     /db_xref="GeneID:40382579"
     CDS             complement(147097..148995)
                     /locus_tag="C5L36_0B00810"
                     /inference="similar to AA sequence:RefSeq:NP_010991.3"
                     /note="PKUD0B00810; similar to Saccharomyces cerevisiae
                     YER068W (MOT2); ancestral locus Anc_7.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320291.1"
                     /db_xref="GeneID:40382579"
                     /translation="MSYDNNSDYLFSEDEDDICPLCCEDMDITDKNFKPCPCGYQICQ
                     FCYNNIRTNPELNGKCPACRRLYEDKNIEYRNITAEEWKLQKAKIEKKKREKKLLEKE
                     RKDAEQAKRHHLAGMRVIQKNLVYVVGLNPPCSYDDLIPLLKSEKYFGQYGKINKIVI
                     NKRNPNQVSSFHQSSSNPGYGVYVTFARKEDATRCIAAVDGSISDGKVLKAAYGTTKY
                     CSSYLRGQPCPNPNCMFLHEPGEEADSYSRHDLTSKASSKEKIEDYDFSPQNSPRPQL
                     SQLNSNNSNINLQSGNMFTSKPLPSENEGPALPPTVSWAKVKPQGGSLPSSDPITASL
                     SASAFPSLNDALYQNKTSSQTDLQQQVNQLQKQQQFQLQQLLQKSQQLQKQQQDQQDA
                     SNQDEATNNQVHPKKKEKKEKDHQSPVVLDISAISFKGVSDSLKHMDESNFTYSIDDK
                     FKTPEFSISSNIRLFHCLDLGALPNEKKLGLMNEEDKSRLSVLTESLLFSPFTRNYNY
                     RAYLQAANASKIKAAQAQAQAEAEAVALGSPEQLKSTLTPSQIQAQLQHSSSFSSGVN
                     PTQAFLQQRLMQQQQQQQQQKILDPRVSASASPIPPPPGLHSNIGNDAKSNSQELLSQ
                     LMGKKVTV"
     gene            <149327..>152452
                     /locus_tag="C5L36_0B00820"
                     /db_xref="GeneID:40382580"
     mRNA            <149327..>152452
                     /locus_tag="C5L36_0B00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464433.1"
                     /db_xref="GeneID:40382580"
     CDS             149327..152452
                     /locus_tag="C5L36_0B00820"
                     /inference="similar to AA sequence:RefSeq:NP_011273.1"
                     /note="PKUD0B00820; similar to Saccharomyces cerevisiae
                     YGL241W (KAP114); ancestral locus Anc_3.564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320292.1"
                     /db_xref="GeneID:40382580"
                     /translation="MDSTESLIGMRRLLENLLSPDNSVRIQSELEFKHFMESDANSLS
                     YLLIQTALDDSLALATRQSALLQIKRIVPLVWSPAFDKFVGPTPINQKIKGILRNSLL
                     KLVADPDSKIRSSASYAIVQIAAVDYPDEWPELLGHLYDSTTNPDSSMFNIIGSLSVL
                     QEIFDDVVTDQQFFEGGVAIQVLKTCETLLQNKFNSAEVKVETLRLLKSLCQSFDNAD
                     FDINGREQFCNSVIPQIYQLVISTSKNVSAEPFVNSLTAWELKYETYYILDYFMNSFS
                     NLLESFASASFNLLLQDFSVQSEVYQQLLMSDIDTIEFDKIFTDVKQFYSSQRERKEP
                     YPFLTTSMSKEVEFMQTLIEIQNVDNPVHLSNILDLLAHVSILPSSKIEDYNSDFNQF
                     VTDESGLNVEIAIRDSIRELLSDINENANHILIDLLMEKLNKLGDLKANQLKAETIVF
                     LLSCCFENDDTIVQAPSFDLEKFLNSSLNLLLSGYIVSEEFQFLAARFILMIPRFLFK
                     FANKCKQFGVSAFTKICSVISKLGGVDDFFIVKSSILISLQYYNYFIRAKEFGTLVQN
                     ELLGLVTQVSTEATEDTNMTLLDVMTIIISIDNLELTKNSHTIELILTIGFKNDSNFT
                     MSSAMFECIEDILKDIPKPNYDDIVSFVFPFLLQKIVEVKEEYSSDIDLCLQVLGSFL
                     KVNSSYQIPGEIFYNTFSVINKFILVCQDDELIQSSTEALIELVRHSPELCSKFIDPE
                     TKETGIQILLRNTAKLLSPDMSDRAIVKLGDLVNLLITNFNQSIGSYLDEILRALTVR
                     LVHATEVPTIENMILIFNALTISQPSSTINFLKSFMIDGKPALVKVLPLWFQAYEVMR
                     GYDSILSNVRAFIEIYKLNDRDIKGIVVDGDPLPQQVPDGIIVTRSIAKRMSIKYKQI
                     PADAKIVSLLLEELKNEITAGDHGAAVGHIRDVDNDNDYDDVDDDDDDGWEDVEDLGR
                     QTLDQLKDYVDEQKSLKRDRVGNNDDMKELLISFFKECTVQNTSNFEDIYNQFMSDNQ
                     RKLLSEYLLFA"
     gene            complement(<152557..>154131)
                     /locus_tag="C5L36_0B00830"
                     /db_xref="GeneID:40382581"
     mRNA            complement(<152557..>154131)
                     /locus_tag="C5L36_0B00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464434.1"
                     /db_xref="GeneID:40382581"
     CDS             complement(152557..154131)
                     /locus_tag="C5L36_0B00830"
                     /inference="similar to AA sequence:RefSeq:NP_011270.1"
                     /note="PKUD0B00830; similar to Saccharomyces cerevisiae
                     YGL244W (RTF1); ancestral locus Anc_3.567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320293.1"
                     /db_xref="GeneID:40382581"
                     /translation="MDSDDDLLELAGIGSEEESDYEPDNSKPSRGSKRTIDESDDDEN
                     DEGEEDDDDIGELDPEEDPYPLEGKYKDEEDKNKLMQMDEMDREAILYERIQEKEKFR
                     ERRFLALRARQNKVESKTLTTGSSAKKMKTSKLSELKKQREKKSAREARRKRGDYEEE
                     DEDDDLIDDADEDDDLRELAGYNDEEEEDYGFYSDDYGSRESRSRSRYDSSQHKEATL
                     KEINEKIRSSRKVLEEFLYRDEFDSCIPGTFVRVNIGLNRNTQRSEYRMALVVEVKRG
                     GKPYKLSGKPCNTYLKVSQGNSQHVVDISCLSNSEFVPEDYDLYKKLVVSSSQQLPTV
                     GYVEMKFNDLRNMATRILTDADINKMIAKKEELVVTQNAANTVKKLGRLREELQVALE
                     RGDPNLAKSLQKKIEDLGAMFNGSKNTSKLAELNIRNQKSNQEYIRKAEKKLVETKRK
                     QLQNNDFNDPFSRLRTNPKVFYKSSNKQDGNEVKDEKQVIDEKEEKNKIKNSIFRREG
                     IDALIKTIDIDIDFKL"
     gene            <154451..>156565
                     /locus_tag="C5L36_0B00840"
                     /db_xref="GeneID:40382582"
     mRNA            <154451..>156565
                     /locus_tag="C5L36_0B00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464435.1"
                     /db_xref="GeneID:40382582"
     CDS             154451..156565
                     /locus_tag="C5L36_0B00840"
                     /inference="similar to AA sequence:RefSeq:NP_683716.1"
                     /note="PKUD0B00840; similar to Saccharomyces cerevisiae
                     YFR048W (RMD8); ancestral locus Anc_3.568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320294.1"
                     /db_xref="GeneID:40382582"
                     /translation="MYNTTTYTSQNAGRRDQLPAEKSQTSTAKRSPSILVTDVRKNQI
                     RAPFAGHKLQQQKSKDERTQDRVSNFVKSMRRSSNSKYSKISISNLTSNISDIPSSRQ
                     RELPRFMTNDPLVSRRNSQKIPQYTKNLPSRTSKVTEKLVLIPEQESNHSVDGSREKT
                     TNENIFQEVNKRTKAEKLTKEQREVEYPRVTAYLIAEGFNLKLTSKFLAKNHCVLPRL
                     YDEVLYIPYSLPLLPGENGYRVQSNTSLKMQRGIKLMEQFIDKSEERDHHYEFYSGAD
                     HENKDATDIDEIVNSPNQNDFDPSEPQFFVSNSPTDSLLEQEAEESRSDSNGSCKSNI
                     SADLKTSSSSDLNHSHKKIDNHEKDDMDKYAHDTKRRNSFKKGLPDLSKHAEMFILDY
                     GVVVFWNFSEIHEKNILADLVFAKIEPGEFDEEEEDDDDDDDDDDDDDGENDGQEDSD
                     EIYPENNYGGNVENHNDTAVPGVCKPSDSTKCTSESSGDESEEMRQTELSLIIKPVPE
                     HDIETEEFHFEYNKDVPTPRIYNDMITLKSGDHLIKLTMSHAIAQSTKLSLFESKMSG
                     VLNSISRLPKALALTGQLQNYTSKRLLAKTGRLFQLRSEVNLLSNVLDTPEYFWSIEP
                     GLHPLYTAVRDYLEIEQRVEVINDRCKVFLDFFDILSDSLAEKKMTKITKMLILAIGL
                     SVIVSIFEIFVRYLIISKLKST"
     gene            complement(<156671..>158806)
                     /locus_tag="C5L36_0B00850"
                     /db_xref="GeneID:40382583"
     mRNA            complement(<156671..>158806)
                     /locus_tag="C5L36_0B00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464436.1"
                     /db_xref="GeneID:40382583"
     CDS             complement(156671..158806)
                     /locus_tag="C5L36_0B00850"
                     /inference="similar to AA sequence:RefSeq:NP_011269.2"
                     /note="PKUD0B00850; similar to Saccharomyces cerevisiae
                     YGL245W (GUS1); ancestral locus Anc_3.569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320295.1"
                     /db_xref="GeneID:40382583"
                     /translation="MSYTLKIAGKAPAVDYALMSAAAFVNTSTDASVKLEFLDSKTIS
                     KDVNASAQLLKDGESVATDSAEILNYLATEYPSAILAKEESQKWIKFAYEKLLVKDFK
                     KLSLDLETIEQHLNLRSFFVGYKITAADIAVWGALRANPVMGSVIKNSVYINVTRWYQ
                     FLESDKRFSEMATLLSSSLAELKKAAKGGKKETHKANFEIDLIGAKEGEVVTRFPPEP
                     SGYLHIGHAKAAVLNQYFANAYKGKLIIRFDDTNPSKEKTEFQDSIIEDLELLGIKGD
                     RITYSSDYFDKMYELAVQMIKEGKAYCDDTPLEKMRAERMDGIKSERRDRSVEENLEI
                     FTKEMKNGTEEGLKNCLRAKIDYTALNKTLRDPVIYRCNLTPHHRTGSQWKMYPTYDF
                     CVPIVDSLEGVTHALRTIEYRDRNAQYEWMLEALHLRKVHIWDFARVNFVRTLLSKRK
                     LQWFVDKGYVENWDDPRFPTVRGIRRRGMTVEGLKNFIISQGPSKNIINLDWNIIWSA
                     NKKIIDPVAPRHTALVSKDLVTVNIVDGPELHSEKKPKHKKNPAVGEKDVYYSAKVLI
                     EQADAEAIKDGEEVTFMDWGNVICTKVNKDADGKVVSIDAKLHLDGDFRKTEKKLTWL
                     AAEKNTKVELVDFDHLITKDKLEEGDNFEDFLTKETMFVTDAIADVNVEQMKVGDIIQ
                     FERKGYYILDAIKDGLYTFFTVPDGKQKK"
     gene            <159514..>160710
                     /locus_tag="C5L36_0B00860"
                     /db_xref="GeneID:40382584"
     mRNA            <159514..>160710
                     /locus_tag="C5L36_0B00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464437.1"
                     /db_xref="GeneID:40382584"
     CDS             159514..160710
                     /locus_tag="C5L36_0B00860"
                     /inference="similar to AA sequence:RefSeq:NP_011268.1"
                     /note="PKUD0B00860; similar to Saccharomyces cerevisiae
                     YGL246C (RAI1); ancestral locus Anc_3.570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320296.1"
                     /db_xref="GeneID:40382584"
                     /translation="MQETYSIRKFSENSTVKRPKEIGSFSRDIENRIHIDDSQLSYYY
                     LPDGDLDGNPGINLGAGLASFRKNPKVDYGDFAGLLGSIMKYEQEHGKKVNAKIISWR
                     GLMKKLMLLPYDNRERFIFNIVVFDGQLFIQSDFEFRKYCEEQDEESLNDIQRKFIYS
                     GYKFETIATLPKPWAECTRKEIEKRNKLEVNNIEQYCSVVRTTIGSTSLVLGAEVDCV
                     YDYKPCDGSDPLAHYVELKTTGPLNDPTKVANFENKLLSTWAQCFLVGIPRIIYAFRD
                     GSLQVRSIEEFKTEEIPLLIKNNPINVQKHKQNPNLKVVNKSMQSIKYLSGILQWLEQ
                     SIDINDESKTYTLEFNPSKNSMFVTLSPNPEDITTKLLSPYNEEKGGMLTEEFKAWRK
                     ELKGKK"
     gene            complement(<160962..>163211)
                     /locus_tag="C5L36_0B00870"
                     /db_xref="GeneID:40382585"
     mRNA            complement(<160962..>163211)
                     /locus_tag="C5L36_0B00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464438.1"
                     /db_xref="GeneID:40382585"
     CDS             complement(160962..163211)
                     /locus_tag="C5L36_0B00870"
                     /inference="similar to AA sequence:RefSeq:NP_116664.1"
                     /note="PKUD0B00870; similar to Saccharomyces cerevisiae
                     YFR009W (GCN20); ancestral locus Anc_1.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320297.1"
                     /db_xref="GeneID:40382585"
                     /translation="MSNLGLQVRQAAGSIDTVVADYAVGYMQHIQSSTEDAVLSQQLD
                     IEKEVSFIQNLLISAGGDQVKVKTLGDKLTESLTKQLKNNMAKLEITGDTSKRLLDIS
                     LLNTKQRELDSSLALLQSADIEHTGRSIESRVDKKKLQKAEAKIAKKVAKRNNKFVKY
                     EASKLINEQSTEDYDSFFLKVNPIEFGAGAGKSKDIKIDTFDLYVGDGQRILSNASLS
                     LSYGRRYGLIGQNGIGKSTLLRALSRRELDIPKHITILHVEQELRGDETTALQSVLDA
                     DVWRKQLLHEEQTINERINQIEKLKEEFEEESLEMKKLENEQADLTDKLEEVHDKLSE
                     IESDKAEARASSILYGLGFSQESQHRQTKSFSGGWRMRLSLARALFCKPDLLLLDEPT
                     NMLDVPSSAYLGNYLQSYPATVLVVSHDRAFLNEVATDIIHQHSERLDYYRGANFDSF
                     YNTREERIKNQKREYENQMAYREHLQQFIDKFRYNAAKSSEAQSRIKKLEKLPVLEAP
                     EEEKKITFKFPDPEKLSPPILQLLDVSFGYDPKNLLLNHVDLDIQMDSRIALVGANGC
                     GKTTLLKVLMGDNIPLDGSVSRNSRLRIGYFAQHHVDGMDLSKNAVEWMSEKYPGKTD
                     EEYRRHLGSFGITGPLALQRMQLLSGGQKSRVAFAALCLTEPHILIMDEPSNHLDTSG
                     LDALADALKNFKGGVLMVSHDVTMIKEVCKEIWVSEDGTVKRFDGTIDDYKKYILTKA
                     DASGVVKKH"
     gene            complement(<163450..>166386)
                     /locus_tag="C5L36_0B00880"
                     /db_xref="GeneID:40382586"
     mRNA            complement(<163450..>166386)
                     /locus_tag="C5L36_0B00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464439.1"
                     /db_xref="GeneID:40382586"
     CDS             complement(163450..166386)
                     /locus_tag="C5L36_0B00880"
                     /inference="similar to AA sequence:RefSeq:NP_014621.1"
                     /note="PKUD0B00880; similar to Saccharomyces cerevisiae
                     YOL021C (DIS3); ancestral locus Anc_1.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320298.1"
                     /db_xref="GeneID:40382586"
                     /translation="MTTATKRKRISSGLVVAQKVFVRSRNGNALKVVREHYLREDIPC
                     NSKGCEICANLYVAGPTGEIPHPVLSSDPLNIKSEKIGKHYLVIDTNIVLNAIDILEN
                     DKVFYDVIIPQTVLNEVRNQSYPIYMRLRTLTKNEDKRFVVFHNEFKASTYLDRKTGE
                     TINDYNDRLIRETAKFYNLHLSPTGIKTLLITGDKANKLLAAKDNIMAFTVHEYINLL
                     PNSEELKDILPSTESFDKSINEIKYPEYYTSARLMGGIKNGSLYQGNISVSSYNFLEG
                     TVSIPSMPKPLLILGRENLNRAFNGDQVVVELLPKNKWKKPSTEIIDEEIVNKDGVGD
                     DDDKELIISDKERKLLTQEAIKAQGAESEEERIVPTGRVVGIIKRSWRLYVGQLSPSS
                     VRKDEVVSNAPKNVFVILMDRSLPKIRIRTRRAKELIGKRIVVAIDSWESNSKFPSGH
                     FVRTLGEIEDKDAEQEALLLEHDVEYRPFSKNVLACLPKEGHDWKVPENLDISDPQLK
                     KRRDLRDRLICSIDPPGCVDIDDALHAKRLPNGNYEVGVHIADVTHFVKAGTPLDQEG
                     ASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVLWEMDEEANIINVEFTKSI
                     IKSREAFAYEQAQLRIDDESQQDELTKGMRILLKLSKRLKQKRLDAGALNLASPEVKV
                     HTDSETSDPNEVEIKKLLDTNSLVEEFMLCANISVARKIYEAFPQVAMLRRHAEPPAT
                     NFEQLNDVLRIKKGLSISTESSKSLADSLDRCVDPKDPYFNTLIRIMATRCMMAAEYF
                     AAGNFSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIDYEPLHEIHMDKNKM
                     DLVVKNINKRHRNAQFAGRASIEYYVGQVMKNNQSDQEGYVIKVFSNGIVILVPKYGV
                     ESLIKLEVMGDVNSAVFDEDNYSLSFVDKSGSKRSVSVFDKVDVSIESILDDFTGKRR
                     VQLYLK"
     gene            complement(<167026..>168231)
                     /locus_tag="C5L36_0B00890"
                     /db_xref="GeneID:40382587"
     mRNA            complement(<167026..>168231)
                     /locus_tag="C5L36_0B00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464440.1"
                     /db_xref="GeneID:40382587"
     CDS             complement(167026..168231)
                     /locus_tag="C5L36_0B00890"
                     /inference="similar to AA sequence:RefSeq:NP_009713.1"
                     /note="PKUD0B00890; similar to Saccharomyces cerevisiae
                     YBR155W (CNS1); ancestral locus Anc_8.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320299.1"
                     /db_xref="GeneID:40382587"
                     /translation="MVEISEIDNDATVDYIVGEWEKKQAEEESQKSAKANKINNGEPE
                     LPPQLAEASSKSTDEIMAELNKLPFFMNTLDDNDGEERSEIEALKALAYEGEPDEVAE
                     NFKKQGNSSYKGKAWKDAIEFYTKGLSVNCGVKSIDAALYLNRAACNLELKNYRRCIN
                     DCKECLLRQPKNVKACYRAARAYFAIEHYHEAMEVLNFAHSIDDKNPAVNSLMKKVQD
                     KIKYTEELKEKRRKKEEEQIKVAQDLEAAIRARGITSIKSSYGTETIGDAKIHLEDPH
                     DIETQLIIPTIVIYPTVNEFDVISEVSELTTPMELMELVMNRPDEYFADGKHDNFRPK
                     KLEAYMETEDGGLVRIPKKSPINSVLMSQTPRVPLFDNILRIYFVPKVDSAEWIKKWK
                     KQDALSKRN"
     gene            <168578..>170215
                     /locus_tag="C5L36_0B00900"
                     /db_xref="GeneID:40382588"
     mRNA            <168578..>170215
                     /locus_tag="C5L36_0B00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464441.1"
                     /db_xref="GeneID:40382588"
     CDS             168578..170215
                     /locus_tag="C5L36_0B00900"
                     /note="PKUD0B00900; Pfam Domains: MFS_1(8e-35)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320300.1"
                     /db_xref="GeneID:40382588"
                     /translation="MLACVSGIKNVALKGRSMVPLEKRNIFFIYFFILLGTTLDNLNN
                     GTMLTLAGDIQERFNTDSSTTSWVLSGYALTLGSFIMVTGKIADVIGPHNIFLCGLTT
                     IWVCSLVCAVLPQVTIIPLIVFRAIQGIGASSLIPASLSLTANYFSGKRAKFLPTAIG
                     FLLIALTSSFGVGIIIGGAFSLTSIGYRSFFYFSFAVGLLCNIILYFMIIPIEQTEGH
                     KQLDLKNVDYVAALLVIIGTLLMILGLTEGGEGWVSAKAIAPLIIGFLVVLAALFFEG
                     IYLKRFRKKHTLQDRNTDWRLSVEFLFPPEILHIPNIMVFLTVTGLQYATEIMFIASG
                     VQYFMFVEHNSPILASVKIFPVCAGIIFGALTYRPWMYEKLNGNKLFVISAILSLVGV
                     IWFSRLDYTVANSYWRYCIFSAFIYGYGINIFFNIYMNVVIESTPLHLQGVVNGILQT
                     TSQVLLSIGNALVPSITGNVSYATTEEMKQYLQDKYRVIFYIMMGFQGVVLLLMIFCI
                     QNNPSKRESEEDLQSVDCLNIEKDEEVFEKVESKGIN"
     gene            complement(<170380..>173862)
                     /locus_tag="C5L36_0B00910"
                     /db_xref="GeneID:40382589"
     mRNA            complement(<170380..>173862)
                     /locus_tag="C5L36_0B00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464442.1"
                     /db_xref="GeneID:40382589"
     CDS             complement(170380..173862)
                     /locus_tag="C5L36_0B00910"
                     /inference="similar to AA sequence:RefSeq:NP_012575.3"
                     /note="PKUD0B00910; similar to Saccharomyces cerevisiae
                     YJR041C (URB2); ancestral locus Anc_1.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320301.1"
                     /db_xref="GeneID:40382589"
                     /translation="MDLPSKLDNTESVTKFLRNKDTSVDEIYNFVIDILYNDNDQNCL
                     PYKEKFILELLIDRISQSSKLTQKFKQSEKTWKLFNFIWNKCKADSRLISVRSKVLSR
                     LKFGEVFTKIFAELSAAGLYKNTELVDELLKTVDSIINSTRIHLSDDQNVMIINHLLE
                     FAVKEPQYTTETHQRLLSLVIVFFQQNNKGNLKYDNKHRAEFAKLCLPNLLMAMEKHA
                     TPKIKDSLSSIIVQLLFSETDPDNVVSLIGCFSKAENASSLGESEILDLLRLIIPKIS
                     IGKLEEVAQILVSAFPQYSAVLIKEIAEMNKSLSSTFLSNLVEEALGRKDGDSHKLII
                     YSIRRNADICLKYTDKICELCQENSEFSMPLLKELFDSYAKNRDLDLFVKIWSDLISK
                     YPGSIFESDSFIDYVSLKYVTLSNTQLSALVETEVNEYIGSPNQNPIFLLSICKGLLK
                     AVSGSIQNAVSKTLLHNLLHLKALLVSLVALKGQYCWKLRFYIFSLFDVEELADDAKY
                     LVNQKHENDSYYFFTMLRIFEQNTDLANDKFTKNLDSFYRKKSDSRFKSVLFSRFFMI
                     LEELLEVNKIKKFVEVFLKESNQEVVRKVFSNPLIQTRPKIMSCLIEECIKHNKMTNY
                     LQFISVYAFTKTQRQQVLDLMVERLDDHSSMLIIENILKMPTYKSKLETEFDSLLKLA
                     RKGCQFSSIIVKIMNIHLQQPTESAKYIHQFTNSIAEVINKISPRTLLDSTDYLELFL
                     LFVKDCTFNDPKMNTLKEKLIETAVKEITHLLSDTDNLSAENIEWILTFLTEINFCSK
                     VEVKIDSLKVIVSQLGEKYTCHREMKLTIFRYICSLDDIYKPSYVIALFLVLNTRELD
                     DTIDLYLSKLASREEDFLETWINIHKSFEESNPEDIESYIRLFTLMIKNVQKPTVAEK
                     VKTIHRVFVSSISQIYHEVLKNDYLTKDIVALLNCLKTTLSTKTWIFTQYATELNLAF
                     ISHISSMLLNREDEHLVKNCYVELCQVTSSVILYQRKRISNRHHMINSVLTSLLKTLL
                     ARAHYIRGEGSLAFERLVSNLCEPNANNLYVKQTDNSSKDIEINNALSQIKSAMRKFI
                     PVVIFNYITFYLKYQVDPSIKHELENAIFMMIDLLTLNELNYINRSLDHQSRQVFRNI
                     YEEYKKFYKWNENS"
     gene            <174131..>176776
                     /locus_tag="C5L36_0B00920"
                     /db_xref="GeneID:40382590"
     mRNA            <174131..>176776
                     /locus_tag="C5L36_0B00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464443.1"
                     /db_xref="GeneID:40382590"
     CDS             174131..176776
                     /locus_tag="C5L36_0B00920"
                     /inference="similar to AA sequence:RefSeq:NP_012576.1"
                     /note="PKUD0B00920; similar to Saccharomyces cerevisiae
                     YJR042W (NUP85); ancestral locus Anc_1.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320302.1"
                     /db_xref="GeneID:40382590"
                     /translation="MESKTNTSSFGKTFGNESANSVSEFNFSNTNDPKLQNANPNRFN
                     NKADSSTEHKTTSFLFGGSAKPAFSFGANVSDNKSNGSGEAKGESASFNFGNTAPAIS
                     DSKVHHLNGNKLKENKNKKTGNAEKPTKTSREGELPRGDQKSPEGNQLLESYVVPPMN
                     DLTNHNQMEISDEEAFYDVDIDENTNLPIRRINYSESKSPLLSNEHLKFAISSRDDKG
                     VVYVAPSNKDIEDKEKTKLFPFDLLPQLDKSFEYRDFLNSTYKDFEQLLKDKKYEHFL
                     SEEEEDFVGVPSVLKKQMEDRQMVLKEIMSSLLMNMQLLIKNKIKKDFVNLEDQWVLN
                     YEEIINVLYLLNALHFGNKDETTVLFQQWIERIDIQPTEELVETVFKESDKPYENPLF
                     WSNYVKKLLMRGSFSNLVDDFKVSMYEELKDSDTELFEIIDEFVNLISLYDPIKFSYD
                     MKAFLHWKQLAVALRENSVNVETNHAIIQAELLELLSIISGSSKTINECSASWYECFI
                     GHFLYQMPSKQLIPKYIDNALDVETYPKPIPGVEAWDSICVDLLKNKFLSVIASIEAL
                     DKSIGTFVAILIEAAGLLSTYSEEIGKDDAISKKQTNNSISASIDRMVEDLALTYLSN
                     QELFPIGVGILINTGNSKSREILSEVLPTYEIKDSDDFEWVLSVCSQLKLSKTMATIQ
                     QIQGEKFFEKHLIPNALSCFAASHTSEKVVSTVWRLFEDTLIRGELDEELAVQLFESD
                     FAKNNGLLRQCLSPLYVLNEIMKPGGLHNRTWTSRLLSLFDFRYLPSFYKAGLVVLLF
                     ENLNQNVFTLENLALIIEQFNRFESHINADSEAKLKCEALYKLMVENRSTRAYPLTFA
                     QLLHTVRRGIAMDVSFTFLDDTQYQ"
     gene            <177066..>177866
                     /locus_tag="C5L36_0B00930"
                     /db_xref="GeneID:40382591"
     mRNA            join(<177066..177127,177284..>177866)
                     /locus_tag="C5L36_0B00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464444.1"
                     /db_xref="GeneID:40382591"
     CDS             join(177066..177127,177284..177866)
                     /locus_tag="C5L36_0B00930"
                     /inference="similar to AA sequence:RefSeq:NP_011996.2"
                     /note="PKUD0B00930; similar to Saccharomyces cerevisiae
                     YHR128W (FUR1); ancestral locus Anc_2.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320303.1"
                     /db_xref="GeneID:40382591"
                     /translation="MSGHDNVILLEQTNQLKCLYTIVRDKNTKRGDFVFYSDRIIRLL
                     VEEGLNQLPVKPVTIETPTGSTYEGSQFMGKICGVSIIRAGESMEAGLRDCCRSVRLG
                     KILIQRDEETATPKLFYVKLPEDISERYVLLLDPLLATGGSAAMAVDVLIEKGVKPDK
                     ILFLNVLASPEGIQVFKEKYPAVKIITGHIDEGLDEKKYVVPGVGDFGDRYYCI"
     gene            <178115..>179263
                     /locus_tag="C5L36_0B00940"
                     /db_xref="GeneID:40382592"
     mRNA            <178115..>179263
                     /locus_tag="C5L36_0B00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464445.1"
                     /db_xref="GeneID:40382592"
     CDS             178115..179263
                     /locus_tag="C5L36_0B00940"
                     /inference="similar to AA sequence:RefSeq:NP_011997.1"
                     /note="PKUD0B00940; similar to Saccharomyces cerevisiae
                     YHR129C (ARP1); ancestral locus Anc_2.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320304.1"
                     /db_xref="GeneID:40382592"
                     /translation="MGESYTQPIVLDNGSGTIRCGFAGDDTPRVNYSNVLGRPKYKKV
                     QCLPSDISEDDTFVGSQAQLKRGFLKLSYPIEHGTIEDWRTMELIWDQVFNHDLSNAG
                     SKTEISLNDHSLLITEHPFTQRKQREKMCEILFETFGFSSLNIGMPSILSLYATGRTT
                     GVSLDVGDGVCCISPIYDGFALPGSIKRMDLAGRDMTRHLQLEIMKNGYTMNSSSEFE
                     IVRNMKERMCRVSSSKLDIRELLDNENESFKLPDGKFLDIPSSSLSRPCELMFQPELF
                     GIEGMGVHELLYNSIMRTDVDLRGEFFETIVLSGGSTMFKGFGSRMIKELRGLDNEIK
                     IKLFASPERRNNCFIGASILSNLSTFNRMVVSRKQFQEDPDCVFDKYY"
     gene            complement(<179498..>181327)
                     /locus_tag="C5L36_0B00950"
                     /db_xref="GeneID:40382593"
     mRNA            complement(<179498..>181327)
                     /locus_tag="C5L36_0B00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464446.1"
                     /db_xref="GeneID:40382593"
     CDS             complement(179498..181327)
                     /locus_tag="C5L36_0B00950"
                     /inference="similar to AA sequence:RefSeq:NP_009991.2"
                     /note="PKUD0B00950; similar to Saccharomyces cerevisiae
                     YCR065W (HCM1); ancestral locus Anc_6.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320305.1"
                     /db_xref="GeneID:40382593"
                     /translation="MDRNLTSSPLSDYNDLADKRETRSMSMSKGTRTKEKSNIRIQSK
                     LKPQTNTVNSELLPAANLSSPSKKSELKTPPHSTLRTSSRSCDDTSNSLHSLQRDGKS
                     NGLLSPEFSSPSLYERPLEVQQQHHHHHHRHQYQYQNQPQLQQPQAPNSIFKPANINI
                     NIIHDSPNTDTFEDPLRSPNFNRKRRRQSITENHHTQQQLKKKSSNKLVCTEQHESDF
                     VLPNPEDMPEITFTGNTKPPYSYASLIGMALLRAPDRRLTLAEIYQWISDHFKFYKKG
                     EVGWQNSIRHNLSLNKAFQKTEKLKEKKGHFWQIVPGFEHIFCNIKETKRNGGGASSS
                     SSSSSSLSSSSASLSTSQNLKNSKRNNPQTPKSQSFTTDTDRDDDKDNEIDLFHSDMV
                     STPLSKSTMSHESYALNARYIHNRNASDGLSSIPEVNISATPTHLFSDISPGPISIAN
                     TSVEFATSFSSRANFEFSPIKPIENGPIGPILEPVTPKLNQNCPLPSIASQLKSLQHI
                     PPSNSKNANTSRIRSTPFHQLNTPDNSFSNSSRKYWASPSYLDDFYTSPVNKPLLSNT
                     SHMQNIPSITTNVFGSPIVGKSLSFSTNEIFGIDICHISNDDE"
     gene            <182427..>185027
                     /locus_tag="C5L36_0B00960"
                     /db_xref="GeneID:40382594"
     mRNA            <182427..>185027
                     /locus_tag="C5L36_0B00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464447.1"
                     /db_xref="GeneID:40382594"
     CDS             182427..185027
                     /locus_tag="C5L36_0B00960"
                     /inference="similar to AA sequence:RefSeq:NP_012570.3"
                     /note="PKUD0B00960; similar to Saccharomyces cerevisiae
                     YJR036C (HUL4); ancestral locus Anc_1.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320306.1"
                     /db_xref="GeneID:40382594"
                     /translation="MKESYHSPSRYFKWTERLRPGKKREKSSPPSEPSKISRNTIPNN
                     LESSTSLEEGASTRCTCCGTLLRYPKDQVRIKCLNCNTYFTLNLDVPPFPTVAKSAIF
                     DDPIPLAGYNTLKLAIQKDRDLLKQSLSSNVSPSVSSNSPISSSNSSHRASTHILYPN
                     VEKLVEKSFGSLENLNSCFQLDTNRQVHPPSPNLNIRDIRKFYTLLLELPSKRPIFKL
                     LTCSLYLLKHPPLNLEFHQLNWILILLENPLLYESITSNNRLSPHFNEISFEITRRLI
                     GILSNVDESCYFCLIHWWSKLSQSDRRRKIEYVNLYLNFHITRLYTHCLNEKLGKSKI
                     TFKNTENNYNYKKPFDANVKLQIGFYSECWHLKTACRVMSFLFTANKRATHQLPDSTF
                     YNTLVDFVNLYQDYDIWQFNNSYDKHEQHYDHCHNPNSNFRPMISDILLMDYNKSYLG
                     ISIQDGVYKRSQFTFCSYPFLISLGSKISILEHESKRVMGLKAEEAFISSIIEGKNSD
                     IYFKLSIRRNDIIHDSLMQIRSHPTEVRKLLKVEFVNEPGIDAGGLKKEWFSLLTKEL
                     FDPLNGLISYSNENSVAYLTTHHNPRKIAYESYHLLGIVLGMAIYNSIILDIHFPPVI
                     YKKLLGFESSFDDLKEIEPLLWKNLKSLINLKDAGTLGLSFEVTVEDVTGQLRNYELI
                     KGGSNIKVTNDNRLEYILKYSKFLLDGIIDKQFGQFKRGFDHVMGTPSFTLFTPNEIQ
                     KLVAGDETFENDKYDVDILESICKLKNCKKSDNVVVWFWEYFRDLSVKKQRKLMRFVA
                     GTDRIPATGLQSMQLKISKLYDTGRFSNRLPVSHTCFNELCLWNYESKEVLRDKLDMA
                     ISESVGFTLK"
     gene            complement(<185101..>186201)
                     /locus_tag="C5L36_0B00970"
                     /db_xref="GeneID:40382595"
     mRNA            complement(<185101..>186201)
                     /locus_tag="C5L36_0B00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464448.1"
                     /db_xref="GeneID:40382595"
     CDS             complement(185101..186201)
                     /locus_tag="C5L36_0B00970"
                     /note="PKUD0B00970; Pfam Domains: PALP(6.5e-96)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320307.1"
                     /db_xref="GeneID:40382595"
                     /translation="MTPLSGIRLFHTTRAARMSYTINKSAITTENGILSAVGNTPLVK
                     LEKLSKETGRNIYGKAEWMNPGGSVKDRAALFFIEKAEERGHIKQGGTIVEGTAGNTG
                     IGLAHICRAKGYKCVIYMPNTQSPAKMETLRLLGAEVHPVPVVPFDNPENFNHKARRH
                     AESMENAYWTNQFDNLDNRQAHIESTGPEIWNQLNGKVDAFTCSSGSGGTWSGITRYL
                     KTVNPKVKSYITEPPGSCLYSYVKTNGESLAREGGSFTEGVGQGRVTNNVAQDIKLAD
                     DSFLIADQKSLNMVYKLIDEEGLFLGGTSGLNVAGAVEAALLLPEGSNVVTILADSAH
                     KYASKIFSKKFLIEKNLYEDIPEHLKKYASLE"
     gene            complement(<186803..>187906)
                     /locus_tag="C5L36_0B00980"
                     /db_xref="GeneID:40382596"
     mRNA            complement(<186803..>187906)
                     /locus_tag="C5L36_0B00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464449.1"
                     /db_xref="GeneID:40382596"
     CDS             complement(186803..187906)
                     /locus_tag="C5L36_0B00980"
                     /note="PKUD0B00980; Pfam Domains: PALP(6.6e-95)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320308.1"
                     /db_xref="GeneID:40382596"
                     /translation="MLSKGTVRFFHSAKPLATSSYKLNKHATVANGFLSAIGNTPLVK
                     LEKLSKETGRNIYGKAEWMNPGGSVKDRAALFYIEKAEEKGLIKPGGTITEGSAGNTG
                     IGLAHICRAKGYKCVIYLPDSQSASKMETLRLLGAEVHAVPVVPFDHPENFNQRARRH
                     AESMENAYWTNQFDNLESRQAHIETTGPEIWAQTQGKVDVFSCASGSGGTWAGVTRFL
                     KDQNPQIKSFISEPPGASLYNYVKSGFKSTEIEGVQSFIEGAGQCRVTGNIAHDIHLV
                     EDAFLIPDQDSVNMLYRLIDEEGLFVGGTSALNVCGAVEAAKRVPEGSTIVTILADSA
                     HKYAQKLFSKSFLQDRGVYNGIPDHLKKYASLE"
     gene            complement(<188627..>189580)
                     /locus_tag="C5L36_0B00990"
                     /db_xref="GeneID:40382597"
     mRNA            complement(<188627..>189580)
                     /locus_tag="C5L36_0B00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464450.1"
                     /db_xref="GeneID:40382597"
     CDS             complement(188627..189580)
                     /locus_tag="C5L36_0B00990"
                     /note="PKUD0B00990; Pfam Domains: PQ-loop(1.2e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320309.1"
                     /db_xref="GeneID:40382597"
                     /translation="MPILTLQCTSMDLETVTKSIGWTYVLVWGVANYPTVISNTQLKS
                     VQGISIDYMYFNLMGFVLYTLYTGSMYSSALVRREFFEETHEWPLIKLNDVIFGIHNL
                     FTNSVIMSQAYCWGFKKNDNQRLSCMAKLVLSCVFAYLMGGGYYIYTSQGWEPVPNVF
                     NWSRLLTSLGLVKIAMSVCKNIPQILYNYNRKSTHGWPILMIWLDFVGALLSFVQLCL
                     DGYIVGDLSTIFDNKPKLFLAVQVFIADFIFFLQHYYLYYKRDIETFGAVNYGAIEQD
                     ERFLLEHTHDHDHLPGIMSTSTSSSCPVSNTDKDELQRLIN"
     gene            complement(<190284..>191405)
                     /locus_tag="C5L36_0B01000"
                     /db_xref="GeneID:40382598"
     mRNA            complement(<190284..>191405)
                     /locus_tag="C5L36_0B01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464451.1"
                     /db_xref="GeneID:40382598"
     CDS             complement(190284..191405)
                     /locus_tag="C5L36_0B01000"
                     /inference="similar to AA sequence:RefSeq:NP_014686.1"
                     /note="PKUD0B01000; similar to Saccharomyces cerevisiae
                     YOR043W (WHI2); ancestral locus Anc_5.639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320310.1"
                     /db_xref="GeneID:40382598"
                     /translation="MSHQDIITQVQPDGGLGATEMGAPQDEFMEDEYNTEIKMNMRGH
                     MFTITREDLMALPESILLCLFPNGIFVDIDGNVITNLTEDDVVYVNFAPECFQYICQV
                     FDVAVRDLHRMHQLNTSPNYDINDPNILNDRPVIIVLREDLDYYCIPPGKGLDVDQMR
                     RIKYRVGVELVKKRRIFDGFGYVAGKQLKPAEQHLMDMLCNSGFSHEEEWGHRSLEPD
                     KTVIFSLTLARLNNNSTSSHRNEDEETNSTNGTSGLDSSNTSIASASGTNLASMNSNG
                     EDRGRSKEKKKSRLSTLASSLSRAGSRVRHKPNPNNTKLLLFWRKPARKCWWNHSVVQ
                     VDIGDLALRDTHGNSIDTTAIKVHIRRVWTLELSIIGIQ"
     gene            <192017..>192811
                     /locus_tag="C5L36_0B01010"
                     /db_xref="GeneID:40382599"
     mRNA            <192017..>192811
                     /locus_tag="C5L36_0B01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464452.1"
                     /db_xref="GeneID:40382599"
     CDS             192017..192811
                     /locus_tag="C5L36_0B01010"
                     /inference="similar to AA sequence:RefSeq:NP_012601.1"
                     /note="PKUD0B01010; similar to Saccharomyces cerevisiae
                     YJR067C (YAE1); ancestral locus Anc_1.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320311.1"
                     /db_xref="GeneID:40382599"
                     /translation="MNTTRELYKEKSHSASKCLEDSAGYACNSTTNISVISTDVAAGP
                     DDEMKLSSLVPPFLKKGGRVQRLGRLGKRRDGEKDKRTATGNNGGCNSGGFSLNGDGE
                     NSSNDRENPVGDDCNGDVDDCKDEEDDDEEDDDDVWGSDCADAAVETNRDIEALRRRQ
                     ENRGYLEGLTKGKAEGLQNGFDIGYPTGSQLGGLVGEVVAELLWRESIGQIDSSTRLQ
                     AMEDLRISNVLSAEYFDVNFNIDNVREHPLIAKWLRYFNGLDRQNA"
     gene            complement(<193343..>200842)
                     /locus_tag="C5L36_0B01020"
                     /db_xref="GeneID:40382600"
     mRNA            complement(<193343..>200842)
                     /locus_tag="C5L36_0B01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464453.1"
                     /db_xref="GeneID:40382600"
     CDS             complement(193343..200842)
                     /locus_tag="C5L36_0B01020"
                     /inference="similar to AA sequence:RefSeq:NP_012600.1"
                     /note="PKUD0B01020; similar to Saccharomyces cerevisiae
                     YJR066W (TOR1) and YKL203C (TOR2); ancestral locus
                     Anc_1.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320312.1"
                     /db_xref="GeneID:40382600"
                     /translation="MLAKAAYVNSNQDINKSCNLVISLLHPLTRFSTLLNTNIYRGMS
                     QGQVQFQQRLPQGTSSEMQNFTLDQIFSELKSNDEICRIKSSESLKSHFILISRDVAS
                     SEQLAVYTSYINKKIHDLISSNKVNEQLGGISAIDALVDILYSSMDDSQLQQFSSSSS
                     PSATSSPVEGSLDLIALYANYLRGLITSNNQVIMKKASYTMGRLAIPGFVMSAEFVDA
                     EVRRSLEWLISEKAETKRHAAILVISSLAKHSPALLYQYVKHILTNIWIGLRDSKLTI
                     REDSAICFRNCLDIVYQRDNELRNYWFGKFYNEAFSAFKVAGGKESTNDSSEYNATIN
                     QQLSSTSPEYIHASLLVFRELVNQGTTILGSKIDEIYETLLKVKDHRSYDVRKEVTII
                     VPKMASYDKIKFVDRYMHRVLLYYISQLKIGKDKAIILMSIGDIAIEARNNIVNYLNG
                     IVLETIRDGLSQSSIKVQRELAPACCYCLSKLTIALGAPLTKFINAYQILKLLLKSPI
                     NDNTLSVLRIFSKSLPSLEPIINDRLINTISFCLSGYPFQHPGSPDFERMFDFDLAYN
                     FRYNMLIKESDEFNENTIDELPLLAGFEKSRYFQVSDTIVILQALKALRVFEFKNYDL
                     NEFVQYAIVSFIDHDNPEIRLQASVTSAHLFRRSTICFERSAHSLKSVEFVLSKLLTI
                     AITDPVTEIRLEVIKNLDHRFDAHLSQSKNVKLLFMTLNDEDFEIKKEAFKLVGRLTF
                     FNPAFIVPPLRKILIQLISNLEYGAQSSRVKEESCELLGILISSTDSLTKSYTTQLMD
                     ALLPQTTDPHAVVCAASIKTIGNLAEVSGDLILPFVPKLMPVLIDVFEDQNSNLKRNA
                     AIKTLGQISGSSGYVIQPLLDYPQLLGLLVNILRLETSPTIRRETVRLLGILGALDPY
                     KHREVERRGRDAETVARQNAPHIDMELLMKGKSPTNEDYFPTVVIQTLIKILHDNSLG
                     AHHLMVTQAMVSIFQNLGLKCVSYLESVIPAFNSVMHNCPTSMLNIYFQQISELVDIV
                     KLNIRPYLNSVFSLIKEFFPNVKLQSQIIGLIERVSEALEDEFKLYMLDLVNIFLGVL
                     ENDLSAGYVSTLRVLKAFVIFGSNLEPYTYMIIPSLVKLFEFAPLNIRKASIECIGRL
                     TKAIPLSEYASEILQPLLRLLSNYEGTNLRTTAMTTICSLLLQMGPDFKVFIPVVSSV
                     LIRSKLQFPLYDQFIDRLNKGRPLPSGVVLYPDIEEKQEAAKRTEPKQQRLVVNAQTL
                     RAAWDCSTKRTKEDWQEWIRRLSIELLKESPSYALRACTALATVYPQLARNLFNCAFA
                     SCWNELHTQYQGELAQALCVALSSVNSSPDIHQTLLNLTEYLEHDEKSLPIRIQTLGQ
                     YAQRSHAYAKALHYKELEFIQEPSIPTIESLISINNQLQQSDAAIGILKYAQEHHGLQ
                     LKETWYEKLQRWDDALHAYSEREKEEPNSPDITMGKMRCLHALGEWELLSTLAKDKWS
                     DSTPEIKRAIAPLAAAASWGLHQWERMDTYISVMKKDSPDKAFFNAILSLHNNNFNEA
                     MQQIDKARDLLATEVTALVSESYNRAYGVVVRVQMLSELEEIIRYKELPAGSPQRVHI
                     IDTWNKRLLGCQKNVDIWQRMLKARALVVKPKQDMKIWIKFANLCRKSGRLRLAEKSL
                     NSLLDEGTTGKPGNKASPHVVYAQLKYMWSRGQNVEALNHLVDFTSKLSRDLGLNENE
                     SITQPLPKNIPGISEDIEKFTKLLARCYLKQGEWKIALDDNWIEQESSSILGSFLLAT
                     HFDPKWYKAWHNWALANFEVISPQSKHRQNFIINENNGAGNVPKIDIANKKININMIL
                     RYVVPAVKGFFHSISLSNSNPLQDTLRLLTLWLDYGGFEEVSNTLQEGIQMIKIDTWL
                     EVIPQLISHIHQPDPTVSHSLLGLLSELGRAHPQALVYPLTVAIKSESKLRQKAALTI
                     IDKMRAHSSVLVDQADMVSGELIRVSVLWHEMWYEALEDASRAYFNDRDVDKMFSILE
                     PLNEMIAKGPTTIRETSFVNAFGKDLRDAQGWLHQFKRTKDVTYINQAWDLYYTVFRR
                     ISKQLPILQNLDLQHVSPLLLNAHDLELAIPGTYVAGEDIVRIKKFDPTLIVITSKQR
                     PRKIHIYGSDGKTYTFLLKAHEDIRQDSLVMQLFGLVNTLLANDPECFKRHVDIQKYS
                     AIPLSPSSGLLGWVPNSDTFHVLIKEYRDPRKIYLDVEHRVMLQMSPDYDNLTLLEKV
                     EVFTYALDITRGQDLYKVLWLKSKSSESWLDRRTTYTRSLAAMSMVGYILGLGDRHPS
                     NLMMDRITGKVIHIDFGDCFESAIMRDKYPEKVPFRLTRMLSYAMEVSGIEGSFRITS
                     ENVMRVLRDNKDSLMAILQAFAYDPLINWGFDFNIQRVIEQSGLSIKLPENNYAELLR
                     SGQINEQEASVMASRYKAAVRDARAACVLKRINDKLTGNDFKRYKALDVPTQVDKLIQ
                     QATSVENLCQHYIGWCSFW"
     gene            complement(<201018..>201989)
                     /locus_tag="C5L36_0B01030"
                     /db_xref="GeneID:40382601"
     mRNA            complement(<201018..>201989)
                     /locus_tag="C5L36_0B01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464454.1"
                     /db_xref="GeneID:40382601"
     CDS             complement(201018..201989)
                     /locus_tag="C5L36_0B01030"
                     /inference="similar to AA sequence:RefSeq:NP_011557.1"
                     /note="PKUD0B01030; similar to Saccharomyces cerevisiae
                     YGR043C (NQM1) and YLR354C (TAL1); ancestral locus
                     Anc_4.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320313.1"
                     /db_xref="GeneID:40382601"
                     /translation="MSQLEQLKKSGTTVVADTGDFESIAKFTPQDATTNPSLILAATK
                     QPQYAKLIDIAIDYAKSKGSTKEEQASLALDRLLVEFGAEILKIVPGRVSTEVDARLS
                     FNRDATIKKAIEIIELYKAQGIDKERVLIKIASTWEGIQAARELESKHGIHCNLTLLF
                     SFVQAVACAEANVTLISPFVGRILDWYKASTGKEYTSETDPGVLSVRNIFNYYKKFGY
                     KTIVMGASFRNTGEIAALAGCDYLTISPSLLDKLANSNDPLPKVLDASKAKELDLEKV
                     SYVDDEPDFRFLLNEDAMATEKLSEGIRKFSADCEALYNELLRRVSA"
     gene            <202511..>203827
                     /locus_tag="C5L36_0B01040"
                     /db_xref="GeneID:40382602"
     mRNA            <202511..>203827
                     /locus_tag="C5L36_0B01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464455.1"
                     /db_xref="GeneID:40382602"
     CDS             202511..203827
                     /locus_tag="C5L36_0B01040"
                     /inference="similar to AA sequence:RefSeq:NP_012599.3"
                     /note="PKUD0B01040; similar to Saccharomyces cerevisiae
                     YJR065C (ARP3); ancestral locus Anc_1.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320314.1"
                     /db_xref="GeneID:40382602"
                     /translation="MSSINTPAVVMDNGTGFTKLGFAGNDSPSWVFPTAISTRVSGSS
                     GNKPAAPSKPSFLSSGSSAAESKLGSGTSIHGNRNMADLDFFIGDEAIEAAKGPSYSL
                     SYPIRHGQIENWDQMERFWETSIFKYLKCEPEDHYFLLTEPPLNPPENRENTAEIMFE
                     SFNCSGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAI
                     KNIPIAGRDITSFIQTMLRERGEPDSSLRTAEQIKQKFCYVCPDIVKEFRKFDNNSEM
                     FAKYMIETVDHRQAYVDVGYERFLAPEIFFNPEICSSDFLTPLPVVVDQVIQASPIDV
                     RKNLYKNIVLSGGSTMFKDFGRRLQRDLKTMVNDRVEASERLSGTKSSGVQVQVISHK
                     RQRNAVWFGGSLMAQTSEFKSYCHTKRDYDEYGPNIVRNFSLFGVP"
     gene            complement(<204462..>205469)
                     /locus_tag="C5L36_0B01050"
                     /db_xref="GeneID:40382603"
     mRNA            complement(<204462..>205469)
                     /locus_tag="C5L36_0B01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464456.1"
                     /db_xref="GeneID:40382603"
     CDS             complement(204462..205469)
                     /locus_tag="C5L36_0B01050"
                     /inference="similar to AA sequence:RefSeq:NP_015329.1"
                     /note="PKUD0B01050; similar to Saccharomyces cerevisiae
                     YPR004C (AIM45); ancestral locus Anc_8.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320315.1"
                     /db_xref="GeneID:40382603"
                     /translation="MLALRGFKHSARAVRYSHTLALLETSGSSITPASLSTITAAKAI
                     NKPITALLVGPNAPEAAKEVASLAGIQKVVIQSDKRYEHYLPEQLAPLVASLIKGEKS
                     PAVTDISSVVVPASAMGKSVLPRAGAILDLQPISDITKVVDASTFVRPTYAGNAILTV
                     KSNDNIVMTSIRGSAFSPAVEKSDAAAPIEEITPVDAEVKTVWVSESLMKSDKPDLAS
                     AKIVVSGGRALKDKKTFEALLNPLASKLGAAIGASRVAVDEGFCDNSLQVGQTGKIIA
                     PDLYIAVGISGAIQHLAGMKDSRVIVAINKDEEAPIFKVADVGLVGDIFEIVPELTSK
                     I"
     gene            complement(<205854..>208040)
                     /locus_tag="C5L36_0B01060"
                     /db_xref="GeneID:40382604"
     mRNA            complement(<205854..>208040)
                     /locus_tag="C5L36_0B01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464457.1"
                     /db_xref="GeneID:40382604"
     CDS             complement(205854..208040)
                     /locus_tag="C5L36_0B01060"
                     /inference="similar to AA sequence:RefSeq:NP_012076.3"
                     /note="PKUD0B01060; similar to Saccharomyces cerevisiae
                     YHR206W (SKN7) and YJR147W (HMS2); ancestral locus
                     Anc_4.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320316.1"
                     /db_xref="GeneID:40382604"
                     /translation="MSDVKTDNGGPLAGSSRGTNQHAQGQQVQQSQGVVPVVGQSTDF
                     VKKLFQMLEENQFGDVVKWSDDGDSFLICDTNEFTKQVLPCYFKHSNFSSFVRQLNKY
                     DFHKVKISPEVKQRYQLENVWEFKHPDFNRFDQTSLENIKRKVPTKKESADTVSAANC
                     VPVVSYRKLEDRVKFLEKQNNALNGQVSQLNANVAKLNQKYESLIPNLLLTKDINVSL
                     TRAIDILAKSVTSMGIQLPPLNLPQLDIVNEPIQMMPMQVQIPMTSQYVQGQHSQQQL
                     CQPANQQILPTQQQQQQQQPQPQPQPQPQPQQQQQQQHQNQQQQPATTTPTSAAQQQT
                     PSQLHQQQQLSQSHQVTQTKPPSQQMSPYISPPDKRKSIVEPIVSTQIDANSRLLNRP
                     PNTPLHVLLVEDDDVCIQLCKKFLMKYGCTVIVVTDGLSAISAVEQVKFDLVLMDIVM
                     PNLDGASATSIIRSFDKDTPIIAMTGNYQRNDLVTYLNHGMTDILAKPFTKDDLFMIL
                     EKHNINKKFNKIVESPVQASVHSAPVATSAQVISAPATHPVDNVSQEHSKQQQHEQRL
                     QPPSQRQGQSPNEQPHPNSLPQQTQQTPQQQQQQQPAQQQQQSQTPTQQVIQQQPLQQ
                     QQQSQTPTQQVIQHHIKEESKNVGFSDAQIQVSSQPHDTPNTNIHMQSQRQHDDILTP
                     TLLESTGLTPETNAVEDVDMSAMLGVNMNINVENEYPDIFKRRKLL"
     gene            complement(<208369..>210210)
                     /locus_tag="C5L36_0B01070"
                     /db_xref="GeneID:40382605"
     mRNA            complement(<208369..>210210)
                     /locus_tag="C5L36_0B01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464458.1"
                     /db_xref="GeneID:40382605"
     CDS             complement(208369..210210)
                     /locus_tag="C5L36_0B01070"
                     /note="PKUD0B01070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320317.1"
                     /db_xref="GeneID:40382605"
                     /translation="MDNRDIEDVLNMDITSLLESCELYQGYTVPERTVPSSTPDNTLD
                     LDIDKYLNLPLETRSKSCNPPLEEGANGDSIVDDNLLEEIDQLINASAISHGIPTSEI
                     GPPKESSSCFNGTGGGNAATNGTVPGTVDMYPQRSITKKPSYKRLSTTPQSPSSMKRI
                     ARSPTQQSNTQFGMAHAAAMLATNNSPSKNCSNMVYHENAKAAAAQAIGSAQHRKPIT
                     FKTSVKRNANYQNAKLKNASIQSSNASVYSTHSKISNVSNNSSTFDSFYSPSTDTLET
                     IISFDQPRRFTSDNIESRHSTRTSSTSSSHELVALTPSPVVSPRYQQITFTPPNTIGK
                     SPHSEPLTPISKTTMKFSQLSTKSPEKKTFPSLESVANAANTTPQLSVWKTRPQHPKT
                     QHVNHSKPKLSPSHSSKRPPHRNTLKLNTFVDRQQSEHQYPFPTPYHQTSSLSPPLQV
                     PPPPPPLPSSSKSSSFSPKQYTQSNAGYNLLDFSNSPITIVSNYTTKNYRNSVTSTTS
                     SNSTISNTSTHTNNAPKQPNIAPSKSIIGPSFKYTNSYAYAKEKSSTNSHKHVKSETR
                     PLNTGPVKCDFRSLVNTFNKKEKRKQHPKVYSNMNQGMSEFQVNIGK"
     gene            <210727..>211143
                     /locus_tag="C5L36_0B01080"
                     /db_xref="GeneID:40382606"
     mRNA            <210727..>211143
                     /locus_tag="C5L36_0B01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464459.1"
                     /db_xref="GeneID:40382606"
     CDS             210727..211143
                     /locus_tag="C5L36_0B01080"
                     /inference="similar to AA sequence:RefSeq:NP_015266.1"
                     /note="PKUD0B01080; similar to Saccharomyces cerevisiae
                     YPL059W (GRX5); ancestral locus Anc_8.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320318.1"
                     /db_xref="GeneID:40382606"
                     /translation="MFARSLLRPLASTLRPALSMRRFLSDETRKAIEEAVHSAPVVLF
                     MKGTPGAPACGFSRATIQLLGQQGVDPAKFAAYNVLEDDELRQGIKEYSEWPTIPQLY
                     VNNEFVGGCDIITNMSQTGELAELLDEANALIPLEE"
     gene            <213277..>214311
                     /locus_tag="C5L36_0B01090"
                     /db_xref="GeneID:40382607"
     mRNA            <213277..>214311
                     /locus_tag="C5L36_0B01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464460.1"
                     /db_xref="GeneID:40382607"
     CDS             213277..214311
                     /locus_tag="C5L36_0B01090"
                     /inference="similar to AA sequence:RefSeq:NP_012907.3"
                     /note="PKUD0B01090; similar to Saccharomyces cerevisiae
                     YKL018W (SWD2); ancestral locus Anc_2.657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320319.1"
                     /db_xref="GeneID:40382607"
                     /translation="MSLSSLPSVSLGESQVKNLTPVKLFPGKDTPFTSLAHNPQGTFF
                     ITTSPAGSLQLYDALRGRHSKTIYSKKYGCSNGTFLLKASQQSTPSSCVIASTIPASN
                     NNKANNALRFLDLNTNSFIRYFTAHTAQVTSVVSSTSTYYGFDTFYSASRDGTIRVWD
                     SRTETPNSTLAGMGRNPVISIDPSGSIMAIWNGSKRVVNLVQVDYFPNGLISSIPVDV
                     NGDVECMKWAGNLLIVDVPGRDKIVIDTLQHSVVSRLVGVTEFVTDTDDVVRSGSLDI
                     TPDSKWCFGGSGDASILAWSLHDLSPKQRPIIIDSLVDKQAIPRIVVHNPKLACLVTA
                     DTEIVLNLYS"
     gene            complement(<214313..>216622)
                     /locus_tag="C5L36_0B01100"
                     /db_xref="GeneID:40382608"
     mRNA            complement(<214313..>216622)
                     /locus_tag="C5L36_0B01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464461.1"
                     /db_xref="GeneID:40382608"
     CDS             complement(214313..216622)
                     /locus_tag="C5L36_0B01100"
                     /inference="similar to AA sequence:RefSeq:NP_012908.1"
                     /note="PKUD0B01100; similar to Saccharomyces cerevisiae
                     YKL017C (HCS1); ancestral locus Anc_2.656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320320.1"
                     /db_xref="GeneID:40382608"
                     /translation="MADNKTLSSKFIEALSAEKKEDYEQTHQLLSTTPPKVLTQNGLA
                     ILNLVIENIRTSLGGKIILELVPDPSISGKGDNINNPLANNDFKSGDIVKLDPYPPSN
                     LKKLQNSSNEKDQWESIENSTTIEGVVTSSNNMRINIVLANSDTQEYINERAWKLQTS
                     NTRLWLVKVSNEATYRRMESTLRKLSEYSLDGIADGMYAPDIVQYLLGRISYSVPTDI
                     PASLELVNKGLNKSQVDAIAFSLVSQISIIHGPPGTGKTSTLVEYVLQHLQMYPNKRI
                     LITAPSNIAVDTIVERLSPHLSTKLIRVGHPARMLSDIRKHSLDYVVELTTGEELTGI
                     EKDIAKLEIEVRKPRTSKVYIDRKSMWAEIKDLKREFRIRSKKSVREVLIGSKVVVST
                     LHGSGSWELTSNIYGFVGEKTPQGGTGFFDTVIIDEVSQAMEPSCWIPIVNHAPSRLV
                     LAGDNKQLPPTIHLTDGKDFRVLSNSLFDRIVKVYGGDEFKIPFVKFLNIQYRMCEKC
                     MVFPSWEWYHGELKAADSVKDKKVVDLLREYTAEPKEIVKGKPKGRTKDKSKRIRKSN
                     KASVELVTKKIEVLEVDEADPDLIEQYIWYDTQGGTCSESIDDSTIGSGSKYNIGECY
                     IVQEHIKKLIRLGVRERDIGVIAPYSAQVSRLRSLIRNGSLEDEYGEDTEDGHDVYPD
                     VEISTVDGFQGREKEIIILSLVRSNFEINKAEVGFLSDFRRLNVSITRCKKQLVIVGD
                     METMERCGVQMLQDWCEWCTEHADIRYIE"
     gene            complement(<216987..>217559)
                     /locus_tag="C5L36_0B01110"
                     /db_xref="GeneID:40382609"
     mRNA            complement(<216987..>217559)
                     /locus_tag="C5L36_0B01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464462.1"
                     /db_xref="GeneID:40382609"
     CDS             complement(216987..217559)
                     /locus_tag="C5L36_0B01110"
                     /inference="similar to AA sequence:RefSeq:NP_012909.3"
                     /note="PKUD0B01110; similar to Saccharomyces cerevisiae
                     YKL016C (ATP7); ancestral locus Anc_2.655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320321.1"
                     /db_xref="GeneID:40382609"
                     /translation="MYVDRGNPRALFRTHRIMSVASSAASKLNWSKIIPQLGLTGQTA
                     SSLTAFKKRNDEAKKVLYTLKEQPTEVDFGAYSQLKNSKIVSTIKSDVASFKPSTIDL
                     SKQLNIIEAFEVKAIENAKKTESLVLAELSELEKTLDNIESARPFDQLTVEDVVKARP
                     DVEDKVQDMVSKGRFEVPGYKEKFGDLVIM"
     gene            <217966..>220842
                     /locus_tag="C5L36_0B01120"
                     /db_xref="GeneID:40382610"
     mRNA            <217966..>220842
                     /locus_tag="C5L36_0B01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464463.1"
                     /db_xref="GeneID:40382610"
     CDS             217966..220842
                     /locus_tag="C5L36_0B01120"
                     /inference="similar to AA sequence:RefSeq:NP_009840.3"
                     /note="PKUD0B01120; similar to Saccharomyces cerevisiae
                     YBR281C (DUG2); ancestral locus Anc_1.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320322.1"
                     /db_xref="GeneID:40382610"
                     /translation="MLNRSLDTALEETPSGSCTPPTSLSPRTHNVELVSSSFSYHHES
                     LNSTSQLTTDKTTTFKKSLLHRWTHKDSILCVAASPKRKLLYCGTQNSTIIVLDLVTF
                     QKKLELQTHTGSVLCLKLSECEDTLFSGGSDSLVKIWKIEDVIDKDSSIAISNAEFTT
                     NLVPTHTIYSLLDVGDIFSISWIEELKTVFIGAQNASLSFIHIDPDITSSPNDHIQFM
                     PSNRFDKFFDSNGTKIKKNSSILTPSLPSSTSADLLTDKVQVIQIPVNNIISYAHNGY
                     LYALDYITIADPLTSTIGGNMAEDYKHIIISAGGDGEIRLWGYSSQKSLVHLKSLEDA
                     QADSIYSLAIHKPTLTVYAGSSDGNIHVWDLTTFQLIKTIQIDNSGDVYTLAVLSNDN
                     NSPEWLLVGTDSGIVKKQLTNSLDNLDLEIGTNNSTIIQITKDDPCLTLQTFKINNES
                     YLVGAGSDKTISLWPLHDINDTCSVNTLKNNDGGFEHHKKYSRKDKNFFTTENFLAIL
                     GELISFKSVSKQPDLYMGECRKCANYLTVLFKSLGATKTQLLPVENGGNPVVHAIFKA
                     NSQKIKNGFEPTRLLWYGHYDVIPASSTTWDTPPFAMTPSDGYLYARGVTDNKGPLLV
                     SIFAIAELYSKNELDSDVVFVIEGEEESGSWGFQNVIFNNIMEICDFKKIDWILLSNS
                     YWLDNNNPSLNYGLRGKLEIQVEIWSDRPDRHSGVDGGVYVEPSMDLIKILSKLDNNG
                     KIMIAGFEKIYENDERLNQDGDIAHHLEEWERPLYKEISSRIPDININELLRKWRLPS
                     LTLHKIEMSGPDNDTVISQKAEAKLSIRIIPGQELDDVKQAFNEYVNQCFNELNSTNH
                     LNIKIMHEAEPWLGNINSSGFKVVSECVEEEWGIKPILVREGGSIPAIRFLEKAFQSS
                     AIHIPTGQSSDNAHLNNERVRIVNLLKSREIIKKAAKKLVKEDL"
     gene            complement(<221564..>221812)
                     /locus_tag="C5L36_0B01130"
                     /db_xref="GeneID:40382611"
     mRNA            complement(<221564..>221812)
                     /locus_tag="C5L36_0B01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464464.1"
                     /db_xref="GeneID:40382611"
     CDS             complement(221564..221812)
                     /locus_tag="C5L36_0B01130"
                     /inference="similar to AA sequence:RefSeq:NP_011885.1"
                     /note="PKUD0B01130; similar to Saccharomyces cerevisiae
                     YHR021C (RPS27B) and YKL156W (RPS27A); ancestral locus
                     Anc_5.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320323.1"
                     /db_xref="GeneID:40382611"
                     /translation="MVLVQDLLHPNPASEAQQHKLKTLVQGPRSFFMDVKCPGCLQIT
                     TVFSHSQTAVTCDSCTNVLCTPTGGKCKLSDGCAFRRK"
     gene            <222376..>223347
                     /locus_tag="C5L36_0B01140"
                     /db_xref="GeneID:40382612"
     mRNA            <222376..>223347
                     /locus_tag="C5L36_0B01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464465.1"
                     /db_xref="GeneID:40382612"
     CDS             222376..223347
                     /locus_tag="C5L36_0B01140"
                     /note="PKUD0B01140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320324.1"
                     /db_xref="GeneID:40382612"
                     /translation="MTPDTSKVSSALRTAVGRCSKNPQPRITLSTAQIVLVSLVFTIL
                     QEISTLKLNIAGPVVCLIILLMIAVGTYSIAHQLPLSTSLCRMKLKLVVREIRNSTQG
                     VHIDICTTITVVLLAAWILSVWKSGTSFLVWCFVVWIYNLSDRTHVTHTNTVISFSSS
                     SSKRCISANHIGSASNDCINIQRNSAFDHNCLTSSAHINQLEAKIFKMEKKLLELEDD
                     KVQLNLLLYAFNHNLNDKFNHLEKTLFDKTEQVQSNIFKINASLSPLKRKRKHVCLNI
                     VKLYFKCFLIAVLPRWVIIPLKRLKKNLENLMSIVRTMLKFRRSFYS"
     gene            <223438..>224748
                     /locus_tag="C5L36_0B01150"
                     /db_xref="GeneID:40382613"
     mRNA            <223438..>224748
                     /locus_tag="C5L36_0B01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464466.1"
                     /db_xref="GeneID:40382613"
     CDS             223438..224748
                     /locus_tag="C5L36_0B01150"
                     /inference="similar to AA sequence:RefSeq:NP_010592.1"
                     /note="PKUD0B01150; similar to Saccharomyces cerevisiae
                     YDR306C; ancestral locus Anc_5.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320325.1"
                     /db_xref="GeneID:40382613"
                     /translation="MANKNRPKKNRGAFYKKYVYGESAEKYVEQLKVQSTASEWYDNS
                     SDHANSDLEKSTNINITGKAETQGKLKLPLELILTILKLTPNPYCTNHLLVCRTVYWS
                     FLKDIYENPKLKANNLLDFLDIISGDNAALVRNPEESVSNGKNVKLQLKRKFQNTVKC
                     LDLSNVIQSGKNSNMSKLLRRTSPSLEIFVSSQSSFGPAPLISLRGCSKLKILDLRLV
                     NETVNLVELFKSCECLTLLEQLSFPRSSVVCDEYDFNWPPNLWYLRLQGGVSDTFAMN
                     VRFPHTITCLEFAYCPNLTSSGLDYILGNIGINLKRLSITYPMPKIGDQGADHVFYYC
                     PNIRSFCVDVAYISWELFGDEYLVTLEEYDRPLKNIVIESVGYMGMCDKLTPNDITVA
                     VDEERLPCLKTLGLSSLLGWDFRGEDMEDMVSELHHHGIEVFKI"
     gene            complement(<224871..>225338)
                     /locus_tag="C5L36_0B01160"
                     /db_xref="GeneID:40382614"
     mRNA            complement(<224871..>225338)
                     /locus_tag="C5L36_0B01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464467.1"
                     /db_xref="GeneID:40382614"
     CDS             complement(224871..225338)
                     /locus_tag="C5L36_0B01160"
                     /inference="similar to AA sequence:RefSeq:NP_013474.3"
                     /note="PKUD0B01160; similar to Saccharomyces cerevisiae
                     YLR370C (ARC18); ancestral locus Anc_4.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320326.1"
                     /db_xref="GeneID:40382614"
                     /translation="MAVLPLKTQFKGPAIPAMEEYDIIDEILDLFRANTFFKNFEIKG
                     ASDRTLIYGILFVSQCLNALSPITNYNNAVRILTNLALDDFAIPGDIGFPLNALYLSP
                     ANKNDAMFLRQYLAQFRQELANRLLQRLYQQGPDQPSKFWLAFGRKKFMNKSL"
     gene            <225943..>230412
                     /locus_tag="C5L36_0B01170"
                     /db_xref="GeneID:40382615"
     mRNA            <225943..>230412
                     /locus_tag="C5L36_0B01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464468.1"
                     /db_xref="GeneID:40382615"
     CDS             225943..230412
                     /locus_tag="C5L36_0B01170"
                     /inference="similar to AA sequence:RefSeq:NP_011584.2"
                     /note="PKUD0B01170; similar to Saccharomyces cerevisiae
                     YGR070W (ROM1) and YLR371W (ROM2); ancestral locus
                     Anc_4.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320327.1"
                     /db_xref="GeneID:40382615"
                     /translation="MHLHHNSKKSGKHVDSLKAQFSETHSAMPLSDIPSLPTPRVKSP
                     IYEHHVQEQLNHHLYEQLSSPVKSNYSASASVSQVYSTRSSPSRQQLQTHPIQLTKSN
                     TSTTAYAPTPSTSSESSLSLGNYPGQNTNSSKSQVTPTNPKFNEDQLLSVYNTPLERP
                     NSTRTPSSDSATSHTSIHQQQHYQQQLRHQHHQLQQEQQHQLQQQQQYFNQNQQSLSS
                     QAITQQRIPSYNFQHQHTQLSSPAYERMNTRTPQAAIFNQQQAAPQAKYQQQQIQQKQ
                     HNYTEIVSNTPQVPLPQQAQQQPTLLQKRNIRGKLPPINTQPTMDYDDDFNDSPLTMR
                     KGPSSLASDLPNPHALCEQNDQSKTSTAITATTPSIYRPQTELLPGKAFGIKQRSGSE
                     YSNSSRQKSQIESAKRSPSLPVTREGFSSNVTPLSYQSQHNEVPKSPSQDNVNPSSSI
                     RKSPIIRQSINFLKNARNFSSSSINQMDSPTITGHSSAREMEKYHFPSKQATSNGRTI
                     PQKVDYNANSVRKSRSFSTLTRRVTSNSSLRQSADKGKIASATSLASSALVSSVSVKK
                     RYIYPALLSEVADAFLHEIKLSCHFKYGIEYRNSFSGAEAVDILCKVTRTRDRNLGII
                     IGRSLDAQRLFHDVTYEHRLRDNKNEIYLINDEFLYDQSSDNFRRQNSIASNMTQNDE
                     YSVSTYNNTKNEKPPPEKQICGVFTLLTECYSPTCTVEKLCYSVSCPRRFEQKMRQEA
                     QLKSLVRSDSHSLFTQDDQKQYWQLSVPKSLLNSLDKREIKRQECIFETINSEKTFIK
                     DLEYIREFWIRPLSETKIIKDKERDHFIRNVFHNINEIWEVNHKFAEALIRRQQKNPY
                     VETIADIFLEYIPQFTPFLTYGAGQVIGKYEFDRQRRHNPLFRRFIEDTAKREESKRL
                     DLSSFLSKPTTRPARYPLLLKSIKDHTDPESPDYKRLGSAIELLEKMLTKINYETGKQ
                     SDKMNLFQIKQKLIFKPGELVDLKLSADNRKVIYQCVLKKKGYQEKEKQGEIHVYLFD
                     HCLLFVKIGYVNKREVYRVYQRPIPLPLLFFSTTETAPTMRAIRKLASKTGSAPSHIG
                     PSLNSTMVPLNSTVCKSPLSFKYLGTHEYELTLYGTPATQKILSSKIEAQTNKILADN
                     DVYTLTPLCSNFFDSQNRINCVVPFDGGRKLLYGTDSGVYVSDRSSSNNTRVKVIGKV
                     NVIQAEIIQEYQLFIALCDKKLIYWPLSTLQDGDPNKNAKLGKELMNHVSFFKTGVCD
                     GRMLVCAAKSTSNIVRIFEPVDPIQQKKQKKKFNNNKEDIHFSSEPVSINFLKTKLCV
                     GCSSGFQIVSLVNNSMEELLDPADTSLEFATGKEGLKPLNIDRINSDFLLSYSSFSFF
                     INHNGWRVRPKWMIEWEGVPHAFALWYPYLLAFDSNFIEIRSVQNGDLLRVIVGENIR
                     FLHASSQEIMYAFVDDRGYDVVASLDFWDKSMKNSRSRGNTVSGNSQVEQLSA"
     gene            <230714..>234898
                     /locus_tag="C5L36_0B01180"
                     /db_xref="GeneID:40382616"
     mRNA            <230714..>234898
                     /locus_tag="C5L36_0B01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464469.1"
                     /db_xref="GeneID:40382616"
     CDS             230714..234898
                     /locus_tag="C5L36_0B01180"
                     /inference="similar to AA sequence:RefSeq:NP_012056.1"
                     /note="PKUD0B01180; similar to Saccharomyces cerevisiae
                     YHR186C (KOG1); ancestral locus Anc_5.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320328.1"
                     /db_xref="GeneID:40382616"
                     /translation="MAQELRHGFLNDPLYLDDLQSHYFSHYDLKRNSTSGNPSPEDDE
                     YKITDWKSATNKKKTSMAALIMCLNIGIPPPDVERPQEYPVLEAFVDPSSYPDPKLAL
                     QAIGKSLQTNYESISSRTKYKQSLDPSVEDLKRLCSTLRRNAKDERILFHYNGHGVPQ
                     PTHSGEIWVFNRGYTQYIPVSLYDLQNWLGAPYIMVIDTNAAGHVIENNKKFIQKRID
                     DEANNHTDIASVSPVSAYIESMQLGACQSDEMLPMNPDLPADLFTCCLTRPIEMSIKW
                     FVLFSPLREKHYYDSLKNKNGVIEIPGKLTDRRTPLGELNWIFIAVTDTIAWTTLSRP
                     LFKKLFRQDLVIAALFRNFLLAKKLMPEVGCHPISDPPLPDISNHPMWESWEFAIDQI
                     LAQMLKKKESEAEEVDMSDIPQLQTTDNDTNGKNDSVQIANKPVPLSNGWNYQHCSFF
                     QQHLTAFEVWLQYGSAIKEPPQQLPIVLQVLLSQAHRLRALHLLSNFLDLGTWAVYLA
                     LSVGMFPYIQKLLQSPSPDLKPILVFIWTRIMSADHENAKQELLKDRGYNYFTQMLTL
                     QPRPSQPLIGDAPLVIESPAVNNNVTFADQKAMSAFVLTMFVKDHKQGQKAAFSIEVV
                     RICIGYIETSESPLLRQWSALLISGMVKDYLEAIVLIMRSGATGKLLQLIGDPIPEIR
                     ASLVNAFTNFVLMPKEYEDLEDSYGLKEELNQQDLSIATEIINLSFDGSPLIRREVVC
                     FFSRFVVKYLQFFLVCAFSQLEEEVTLIDNPSMIDEIRRKSPAYGSIFFTIWKSLLIS
                     SEDPHDEVKNHAQEVIDYVMIKLNESKLGDVASEMEDYLLEKRGVGEDRSNSIDSKLF
                     AKITENQKYNSMKSSSRNNTVGKKSLEKVTKRVQSLNLDSRLKTEMENKNNDSKSSAS
                     STYAFSIAEKVSKLKSWLNALSGTDGEQSTNSHILANYLSHQPTTFPYGSNPKPKTPR
                     FVPRVRKDGYPILPFTSKFLEYSSEYFQESQLGPKEEDEPGSEEYMRRIWRRNRNEAI
                     IAATQPQKSLALEGDWKNIVVRLNNVTQPKLLKFTQFEKWISVVDERDNVTTFDWGKN
                     KELCKFSNGNPFGTKITDVKFLNEDHVPLLMSGSSDGVIKIYKNFNDIENCLLLTSWR
                     ALNDIMLTPRSVGLISEWQQSRGTLLVTGDVKVIKVWDAPREKCVMDIPIRSTSQITT
                     LTSDQVGGNIVIAGFQDGSMRVYDRRLEGKDSLVKVYKPSTFAEKSPLRNVHMQRGGM
                     RELVSGNSSGLVQLWDIRQDSPIVRFRAFEKTMTTAFIHEHAPIIACASKEVDMYTTS
                     GTRVSRISNSGFISTLHGGTRNNMYINSLTLHPHRMMMATNYNQSSEITLYECREKAD
                     PSADFYSREELIGGFQ"
     gene            <235214..>236422
                     /locus_tag="C5L36_0B01190"
                     /db_xref="GeneID:40382617"
     mRNA            <235214..>236422
                     /locus_tag="C5L36_0B01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464470.1"
                     /db_xref="GeneID:40382617"
     CDS             235214..236422
                     /locus_tag="C5L36_0B01190"
                     /inference="similar to AA sequence:RefSeq:NP_011773.3"
                     /note="PKUD0B01190; similar to Saccharomyces cerevisiae
                     YGR257C (MTM1); ancestral locus Anc_5.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320329.1"
                     /db_xref="GeneID:40382617"
                     /translation="MTMSSEIAGAIEEDEDMFDQDLKGAEGVQVNAIEPSRIPKFSVN
                     GAKSPNADLTLSQRMLSACAGSLLTSLVVTPFDVVRIRLQQQELLYPVQSEGTTCCRK
                     VFWENQPNEKPMGSIKGNFCQPNTCFQEGDKISGTFQGIKKISSQEGFTTLYRGLGLT
                     LVMAIPANVVYFSGYEFLRDSSPFKQSNPVLNPLMCGSIARVLAATSVAPLELIKTRT
                     QAVPSSQGMTSGGILRMVVRNSINDVKQRGLSSIFKGLGLTLWRDVPFSGIYWSTYEY
                     ITHALKKDMYIGESNNYINSDSSLFLRSFIGGSLAGITAAFFTNPFDVGKTRMQVSME
                     DEKKMGSLASKTNSKDTIFKFISQIYKNEGIGALYVGLVPRSLKIAPACAIMISSYEM
                     TKKFFKEKSA"
     gene            complement(<236633..>237880)
                     /locus_tag="C5L36_0B01200"
                     /db_xref="GeneID:40382618"
     mRNA            complement(<236633..>237880)
                     /locus_tag="C5L36_0B01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464471.1"
                     /db_xref="GeneID:40382618"
     CDS             complement(236633..237880)
                     /locus_tag="C5L36_0B01200"
                     /note="PKUD0B01200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320330.1"
                     /db_xref="GeneID:40382618"
                     /translation="MTEKLGKIPPMEKLGSNNCSATHSPTSNFTGTSLHSGCGINSSN
                     AERAIGHLERGKESITNLALLFRPKLEKIGAVTPGKASSKILWNDFRDLAKHLSKSGK
                     LIDRNSKLLKDWAATFETDEISMLVLEYQKFALLHSNINKKLAERMEVLSSKVKPLNR
                     VEIQRNVDLAKYIKAKRSFEDFKKKSTDQATMAQLQNDVNYYSTSLKASQLSLEKTVR
                     EDVRPAIFAFAYAFKASTISINKICQETLLDFDEFERMIKNPDSIYESKLNLTGFDLL
                     SGISDLSCSSARIERSPSLPERSTDASYNIRQNNDSLISFIGEDQNSLNDGEKPLRLE
                     ETEYKSHYHFTKPAKIFKPFGSDPRDLENPELHERFNEKLSFDTAANYNTYVQRNAGD
                     QNNSTVKISHYMNQQDTSVWSKT"
     gene            <238214..>241342
                     /locus_tag="C5L36_0B01210"
                     /db_xref="GeneID:40382619"
     mRNA            <238214..>241342
                     /locus_tag="C5L36_0B01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464472.1"
                     /db_xref="GeneID:40382619"
     CDS             238214..241342
                     /locus_tag="C5L36_0B01210"
                     /inference="similar to AA sequence:RefSeq:NP_014543.1"
                     /note="PKUD0B01210; similar to Saccharomyces cerevisiae
                     YOL098C; ancestral locus Anc_3.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320331.1"
                     /db_xref="GeneID:40382619"
                     /translation="MVISYFKEQCNFKVDYAPAKVKKWRSSRTGLQVTLIDQASPVVN
                     GYFAVATEILNDSGCPHTLEHLIFMGSKKYPYKGLLDILGNLAFSSTNAWTATDQTVY
                     TLSTAGWEGFKMLLPVYLDHLFNPSITDEACYTEVYHVDGEGKEKGVVYSEMQGIENQ
                     SWFIQNLESQRTLYKNSGYKSETGGLTKNLRTLDAETIRKYHADNYRPDNLCIIISGS
                     VNEDELMKLMTDFDSELDSLPETPNKRPFVDTPIDLPLSETITKNVLFPDKDESSGNI
                     MMSWIGPDSRNTVLDQAIDILGKYLTSSSVSLFSQNFIEVDDPWATDTGFYTESYILS
                     GMVLSFDNVPTEKLSTFPQKVLDLMREHCDVSKFDIIRLRDLVEQTMWKYVHKSEKSP
                     ETLAYIAIYEFEYGKDSGKDLENYSKTLDEFKELLEWDVAKWVDVFRKYYVDNHCAII
                     IATPSKELYNKNKIDNEKLLNERKQTLGLEGLKELEKKLEKAQEVNNKEIPAQILSSF
                     GRPNPSSIAFNKTESITVGSTKDTINGTSDSLKKIIQDTPDNFSIFAHYENYESNFAT
                     IHLLFSSFEIDEKHLPLLRIFENLTTLPVVESNGEITPYEEVVKQVKRDTISCYFGNS
                     FNGKFEEFMDFSITVKNENYSKAIEWYKKLLFQTKFTQERVTVILKKLIKSLPELKRS
                     GSYMLRYLYNKHCYTTRSLLRSSEIITNEQYLKDTLQKIEAGNFKEIENQLDEIRSKL
                     FDNKNIKLVVFGDVNKIENPVSSWAGFVGDTSADKITELPYQYKTLSDVGEKKSKKCF
                     IITTPGSESSYLDLATHTTVFDFTSDDSFKILLGSEYLQCVEGPFWRGIRGAGLAYGA
                     NCYNRATIGELGFSIYRGADVEKSYSVAKDIVENHANGKVAIDESLLNGAVSSIVNRL
                     AETQSNYSQTATEEFYSNILLKRGPDYKKKLMTALSLITKEDLIDIFKRYFVNMFNPD
                     TSLCFISCNPTKSENIATFFGNLGYEIEVEHVSVENDDIDGDESTDYGSEDDSESGSE
                     SDSEGESEGEDE"
     gene            complement(<241464..>242289)
                     /locus_tag="C5L36_0B01215"
                     /db_xref="GeneID:40382620"
     mRNA            complement(join(<241464..242162,242269..>242289))
                     /locus_tag="C5L36_0B01215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464473.1"
                     /db_xref="GeneID:40382620"
     CDS             complement(join(241464..242162,242269..242289))
                     /locus_tag="C5L36_0B01215"
                     /inference="similar to AA sequence:RefSeq:NP_011751.1"
                     /note="PKUD0B01215; similar to Saccharomyces cerevisiae
                     YGR235C (MOS2); ancestral locus Anc_5.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320332.1"
                     /db_xref="GeneID:40382620"
                     /translation="MSSTILKAGLLVSSTSITYLTFSESIKCESKRTFYNDEPQQVSV
                     SETTPSEPQLSKFVKEEQSIESLLEPRIKSAREELYKYFELSKKYYIEKSEQYFKAER
                     EVFSTASSLHDRREEFFPDALYVITGGLFGSVLARKKNILIRVLAPVATGLLSFKLFF
                     PKTFNNVFGFLENVEKEKLPAVHTKQVEFAEKSEELVKSTSSTIVESSKEVEGFLAKV
                     KRSIGEYTGLNVDQIITEKKK"
     gene            <242582..>244096
                     /locus_tag="C5L36_0B01220"
                     /db_xref="GeneID:40382621"
     mRNA            <242582..>244096
                     /locus_tag="C5L36_0B01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464474.1"
                     /db_xref="GeneID:40382621"
     CDS             242582..244096
                     /locus_tag="C5L36_0B01220"
                     /inference="similar to AA sequence:RefSeq:NP_009612.1"
                     /note="PKUD0B01220; similar to Saccharomyces cerevisiae
                     YBR056W; ancestral locus Anc_3.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320333.1"
                     /db_xref="GeneID:40382621"
                     /translation="MGLLKTLKNKVTSISEIAPSAPAAPIGREPTDRSIYQSRQNFGV
                     NFGSLFLLEKYIFDEMFVDDAGVELDAIKNCFKKDGVDKTRERLEHHWKNYCSDSDWE
                     WLKEKGIQSIRIPFGYWLVDGGSFTKGTSFESLAGAYAKGWSILKKFYIEKAKQYQIS
                     ILVDLHALPKGANTGDHSGEWFKDPDFWNDSNAINLAVEICAFIAKDLADYDNICGIQ
                     IVNESVFSNNPSGQEKYYRKAANAIRKVNSDVPIIISDGWWPDQWVNFLDRFSNGDVG
                     SLGIVIDDHIYRCFSDDDKNKKIEEIIEDLDSSVLTGLSKPADFIIGEYSCVLDSRSW
                     DRSQGCNRDDMVRAYGNKQCKLFKERANTGHYFWTFKFQHGDGGEWGLVPMISRGCIP
                     SRNSSVNLPSKEDFDRNLKEMLQGHENYWKAQNPNENYEFWRYKEGFTTGWHDALSFA
                     RFNNSRIGRMVAWTSSRRKEHVNARKSSPFLWQWEAGFQEAIRKFEEVSNKAFI"
     gene            245530..245611
                     /locus_tag="C5L36_0Btrna12L"
                     /db_xref="GeneID:40383830"
     tRNA            245530..245611
                     /locus_tag="C5L36_0Btrna12L"
                     /product="tRNA-Leu"
                     /note="PKUD0Btrna12L; codon recognized: CUA"
                     /db_xref="GeneID:40383830"
     gene            complement(<245746..>249519)
                     /locus_tag="C5L36_0B01230"
                     /db_xref="GeneID:40382622"
     mRNA            complement(<245746..>249519)
                     /locus_tag="C5L36_0B01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464475.1"
                     /db_xref="GeneID:40382622"
     CDS             complement(245746..249519)
                     /locus_tag="C5L36_0B01230"
                     /note="PKUD0B01230; Pfam Domains: TIP120(1.1e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320334.1"
                     /db_xref="GeneID:40382622"
                     /translation="MASRKCINDLLVMTKDTDPDLRFMALNDLEKEMSNTINHIASYE
                     VDEYARILLTRLNDEFPEVRTQSLKCFESLPYRLKVDILPVVRTLINKKPKKVSITST
                     IYTMALHNILENLPLIEEVHVGIINIVLPEIFSDREKFKLEIDYIEILTDLIEYSGKY
                     FNQTQIFQTLGFLTEVIFTADAIISKKSISAYGSLSKNIESIEIIENFLKNITQLTNS
                     YKNFYEGQSKLLSVISVSFASNSLSFEPFALQLWEIISSCLKVNELGDLDQDYENQQE
                     KDNLRVEALTAALSLFKNCKSDNTYFLTGDCLDICEVLIKYDPYGDNSEDDEESNALA
                     DDIKDYNDFEDEDGDSYSDYEDDEDADDDNCSWKVRLEALNVLSCVIENFPQRLPLAL
                     KKCFNDIMILLDIEKNKNVLLRLCETLSFIFELSSPDGAYYNLLNSKNMAETTNGRRL
                     SDVSMACNDDPYALFVGSAENINEKILKLIRSNEAVVNDKPEAFLKLVSNITRTLGGV
                     GSHYVESYIVALNQSWNSIPYTVQTHYFYSAFLENDKIDSFGDGLPYFVNFLKNCLSN
                     RSNQKMVLEGMSLINEIFETQCLGDGDYNSTIRNNDIVTQLSYLLVGFLLGKLTDRNL
                     SSEMRLQALNSLTSMCLKAQLDKETVKSILNALTETLSTEVLAFNTLNAIKKFCSSGK
                     INFAISPEWIKAILGYILQYFKISELSGTCVKTVSIITSSGFFDEADGKSILLAIGTL
                     FSNKMFTPLNCVDIGITLTNILDKVNITSDMTTFISVLIELSKFDEFDEVLPDLMEKI
                     LLQTTDSSLSQAIQSFDDISDIKVSKLLAVLMVTSKNYTSIDNIIQNIQSGNDVYFSL
                     VFLNQVLKSVDLKTELGLFLNGYSSNESNVVNMTMKTVSTIVCKYPDNYLPQFMVFLK
                     GNASTPAFKTLANILDHVHLSHESASHLFKLIIDVQRSSPQLDNTTEYSNAADCLGAL
                     AFKYNLLPDLLDVLSATKSSHLTLLITLGDTVKYTFGNTQFLENAELSQLVKYSEMTT
                     NNFIFHSNLLIKEVGAFNLNLILSKKVNIAISLMNKIVPNIVETEIKPNKSFIRVQMI
                     GPYKYKIDDGLNFRKQIFESIYNLFKVLEDNRGLEFLCDIEWRLLFTKYFDCGIKDDQ
                     TISSVTLLTTLKIFEHQPEIFVHNFGDVQIFESFLERCRKVLNKKIADNAVKQDIEKQ
                     TNLVKSLIRFLKRTERLVESNHLLLSGSQLSAWKALISETKAKFLIYKTEEVD"
     gene            complement(<249863..>251992)
                     /locus_tag="C5L36_0B01240"
                     /db_xref="GeneID:40382623"
     mRNA            complement(<249863..>251992)
                     /locus_tag="C5L36_0B01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464476.1"
                     /db_xref="GeneID:40382623"
     CDS             complement(249863..251992)
                     /locus_tag="C5L36_0B01240"
                     /inference="similar to AA sequence:RefSeq:NP_015333.1"
                     /note="PKUD0B01240; similar to Saccharomyces cerevisiae
                     YPR008W (HAA1) and YGL166W (CUP2); ancestral locus
                     Anc_8.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320335.1"
                     /db_xref="GeneID:40382623"
                     /translation="MVLINGVKYACERCIRGHRVTTCTHTDQPLMMIKPKGRPSTQCD
                     FCKQQRKIRNSHVKCKCTKKIGSKVIHDKDCPCHLDGQCTCCNKGKKSKKKDEKDKEK
                     EKELGATTKAKRKSSKKSIVESPNIDVEDKPLTTTIQTNTPTARETKSSPIKIEESEM
                     LLNVDTSLPNFSSQNNNITNIYSMSNDDASNGIISPTSTDLKFDNEYIDPDTRNSLMQ
                     QWDMSSPPMGNSESLYSLLSDNSYMNNSNNNPTPNNVNANSNTNNNTNNNVNTINNRF
                     SRQIGLDPLQNFRSSKSTPNNQNSDYQSPTSPTLQRGLGEISIPVDEYMGPLNKMNVH
                     FRNFLNTLTDQPQLDNIISPNSISPGQISNGEPNVVQLNTNQSTDSSNGGNNRTNSFY
                     DFTPATPGNGLLDIFENNVPTSKVYQNQNNQPSKVNEPDSLFPLFPLIGPLNTDNDLS
                     QSNVQNLNSKQSNSLNTSTYSVINGGNMTQQANPNQTNKVNQIPTKMLRNTTGSSLTS
                     STSYQSLHSNYSTNSLTNHHNHHHNHHHQPHHNGSHGHTSNSHFHPYQSSHAHRSSSF
                     LALSPTNSYNSSTDSLAASFADVPQLLTAEDGIQGGFTGEKLANAKTNTTLMDDIYTT
                     KTYTDSHSINAKRLSQNAQQIKNHAQQIKHEMQDDMTNGNLTNEHLDLSIIGSIPNTS
                     TLPTQQNAPQTFQYEDHLIESLLQNDF"
     gene            <252981..>253886
                     /locus_tag="C5L36_0B01250"
                     /db_xref="GeneID:40382624"
     mRNA            <252981..>253886
                     /locus_tag="C5L36_0B01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464477.1"
                     /db_xref="GeneID:40382624"
     CDS             252981..253886
                     /locus_tag="C5L36_0B01250"
                     /inference="similar to AA sequence:RefSeq:NP_012389.1"
                     /note="PKUD0B01250; similar to Saccharomyces cerevisiae
                     YJL146W (IDS2); ancestral locus Anc_1.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320336.1"
                     /db_xref="GeneID:40382624"
                     /translation="MTIVDGENHPRVWATLITGANYLPGVLTLNYSLVRARSKYPLVA
                     LYTDKLDRKSLEALHKDKIATLKIEALEPCIGELHLQIDSRFIDTWTKLYVFKSYQFK
                     RIVHLDSDMLVLQNMDELMEMEMGDFKFASTHACLCNPYRFKHYPPSWNKQACVYTYH
                     DKHMASRFDIPKHMGPSSHLGLSKLNSGILVVEPSVETFDMILDALQDKEKTCNYKFP
                     DQDLLADVFYKKWLSISYIYNCLKTFKNCHSSLWDLSQIKNIHYILSPKPWDVDRNYL
                     DDSGTFEMWWNMNDERLRMSNSPCS"
     gene            complement(<253857..>255245)
                     /locus_tag="C5L36_0B01260"
                     /db_xref="GeneID:40382625"
     mRNA            complement(<253857..>255245)
                     /locus_tag="C5L36_0B01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464478.1"
                     /db_xref="GeneID:40382625"
     CDS             complement(253857..255245)
                     /locus_tag="C5L36_0B01260"
                     /inference="similar to AA sequence:RefSeq:NP_013723.1"
                     /note="PKUD0B01260; similar to Saccharomyces cerevisiae
                     YMR010W; ancestral locus Anc_7.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320337.1"
                     /db_xref="GeneID:40382625"
                     /translation="MGYLVISPEYVPYVSTIANFIISFTPLLSYGSTVLSIRKRQSSQ
                     GFSIDICGTMLVSSILRIFYYFNDPFEVTLLRQCFVMVFIQTILLRTALKYRSEDAVH
                     FEKYDGHWDSFYNKVLELNKEQIDNTFEKYEIGDQYNNYNIQNIIVGIFVALFRLAYI
                     NGVLTVSAAFKLLRDVVSLFDYHYIRPFNYWQWKEPITFWKFLLGFVVCAGIIQITFN
                     GNEYLGICFGSISFLVESSLPLPQILLFQRVQNVENFKIILLLSWLGGDITKISYLLF
                     GTENVGLLFIFAAFFQMSLNFVITYQFFYYKFNPNLNSEHIITHIPLSHAPVNIRPPP
                     RSSTLAYISRPSINETNIIPQSRASSISFSGIIPTNSNVNIVQQNQHYQSHRKSISLI
                     EEDDGIDIAEGVKMNIDYTLEDVNDCDEENEGNNENETLLNTQQQQLPFEKGVDPLVE
                     QVRSRTGTIGHA"
     gene            <255660..>256664
                     /locus_tag="C5L36_0B01270"
                     /db_xref="GeneID:40382626"
     mRNA            <255660..>256664
                     /locus_tag="C5L36_0B01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464479.1"
                     /db_xref="GeneID:40382626"
     CDS             255660..256664
                     /locus_tag="C5L36_0B01270"
                     /inference="similar to AA sequence:RefSeq:NP_012287.3"
                     /note="PKUD0B01270; similar to Saccharomyces cerevisiae
                     YIR021W (MRS1) and YKL011C (CCE1); ancestral locus
                     Anc_2.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320338.1"
                     /db_xref="GeneID:40382626"
                     /translation="MTGLKDLILQEGLKKDFLVRIMRKLGYYHSGLTKGELIDTLVKK
                     IEENDNANGDLVSLDMGLKNMSLARFSNEQGKKPTLIQWFKRDLESGVKVSFHPLKYS
                     HISKEFITTFLIKQGCQTLVFERQRYRTGGSSNVLESTLKTNTIEAMLCMGVSMHNLY
                     HPSKEIQIHSVSPGMMVDYWQSEFSTMLKQEQKKSKEFRVSLTLQMLRDSLSKNKLLP
                     PEIQLASPIMHHRFELSDTILDNLSTGLKDDNIKKEWDHIWKFKSLSRKLWELVYFIN
                     RFNISPYTVPLDKYWWGSVKGDDLADSLLHGLAYSEYIKAREDFRKNVKEHGQINSYR
                     "
     gene            complement(<256893..>258290)
                     /locus_tag="C5L36_0B01280"
                     /db_xref="GeneID:40382627"
     mRNA            complement(<256893..>258290)
                     /locus_tag="C5L36_0B01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464480.1"
                     /db_xref="GeneID:40382627"
     CDS             complement(256893..258290)
                     /locus_tag="C5L36_0B01280"
                     /inference="similar to AA sequence:RefSeq:NP_012046.4"
                     /note="PKUD0B01280; similar to Saccharomyces cerevisiae
                     YHR176W (FMO1); ancestral locus Anc_5.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320339.1"
                     /db_xref="GeneID:40382627"
                     /translation="MSAVPRIAIIGAGPIGLGFAKAIAAEPNAKEIFKTIDVFERRPQ
                     AGGLWNHTGDKSNVTFSLSESKTNPRALKVTDNDPHLSPMYKYTETNIVKQMMRYKDY
                     PLPENSNTFPNRTEVLNYLVEYQKTVPDFVNFKFNSKVSSLLKNQNNNTWEIKLKDNS
                     DSLVYDKVILAHGHFDTPFVPKTEGLLNWFKNDPTSVSHAKYYNDVDNYKDQKVLIIG
                     NSASGIDISTQLLTVAKSITMSCATEPMFKGIVEDQTEQVDRIVKYDFENNRSVVTAS
                     GKVISNIDKILFCTGYLYEIPFLKSYMSGPNAVITDGSNLKHLYKQLFYIPDPSLVLA
                     GIPKSIIPFPFAEAQGQYVARILSGRLQLPSTEEMNADYAREVAERGEGSSFHIMGNL
                     KDAEYCNEMYELVQSTADEGFVASYWDDHMKDLRVKTLELKKQRFHDLIKYANDLRSK
                     GLPFVSLKQDTTTVN"
     gene            <259061..>259909
                     /locus_tag="C5L36_0B01290"
                     /db_xref="GeneID:40382628"
     mRNA            <259061..>259909
                     /locus_tag="C5L36_0B01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464481.1"
                     /db_xref="GeneID:40382628"
     CDS             259061..259909
                     /locus_tag="C5L36_0B01290"
                     /inference="similar to AA sequence:RefSeq:NP_012263.1"
                     /note="PKUD0B01290; similar to Saccharomyces cerevisiae
                     YIL003W (CFD1); ancestral locus Anc_7.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320340.1"
                     /db_xref="GeneID:40382628"
                     /translation="MNTLEEKPRSLKGVKHIILVLSGKGGVGKSSVTTQLSLTLANEG
                     YKVGVLDIDLTGPSLPRMFGIENSKIHQAENGWVPVHMPVSSEPGCANMKLMSLGFLL
                     TNRGDSIVWRGPKKTGMIRQFFKDVIWGELDYLIIDTPPGTSDEHIAIAEELNKCPEL
                     IDGAVIVTTPQLVSVNDVRKEINFCEKAAFKILGVIENMSGFICPHCAECTNIFSKGG
                     GEKLAKELNLEFLGAIPIDPTFVDMIENQGTLKKEKNETLCELYAHSKMSPLFKSVVE
                     QITESD"
     gene            complement(<260015..>261055)
                     /locus_tag="C5L36_0B01295"
                     /db_xref="GeneID:40382629"
     mRNA            complement(<260015..>261055)
                     /locus_tag="C5L36_0B01295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464482.1"
                     /db_xref="GeneID:40382629"
     CDS             complement(260015..261055)
                     /locus_tag="C5L36_0B01295"
                     /inference="similar to AA sequence:RefSeq:NP_010911.3"
                     /note="PKUD0B01295; similar to Saccharomyces cerevisiae
                     YEL005C (VAB2); ancestral locus Anc_7.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320341.1"
                     /db_xref="GeneID:40382629"
                     /translation="MPKAFPKTKLPPERSFGLSHILSNSESGHDDLQRLNDSVIKTID
                     LYNKDLTEQLTSLVSVEHELADKLENVKEVYDVVHNIRSEDISDAQILELEDQASDKQ
                     TKKKSLGLGMSMFGVNKDENNKFQTFKKIDDTLVELVENSAVQKRRLDEMITRLQRLE
                     LSINKRERLFDDKSSNKVHYENLFNYGMKILKKQNRREQTKATTKTSIKSISPSQKST
                     PKKSQVKSDFASPRSKIPTEKLEQYQEIEKELITKKIEQARNSITINSSSTNTSICNL
                     RGNMISKDVSNPILFMIGRRDPLPACTITDEVITTKPGYGTSSLGNDNCNPSDESVDA
                     LVDELKKIVHVD"
     gene            <261325..>264447
                     /locus_tag="C5L36_0B01300"
                     /db_xref="GeneID:40382630"
     mRNA            <261325..>264447
                     /locus_tag="C5L36_0B01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464483.1"
                     /db_xref="GeneID:40382630"
     CDS             261325..264447
                     /locus_tag="C5L36_0B01300"
                     /note="PKUD0B01300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320342.1"
                     /db_xref="GeneID:40382630"
                     /translation="MSDHNQTQLHKTATISSKEWVSPFRASGGKNVKAEKLATLETAE
                     DESRKIPNKGETVDAGVATQKELQKDEEAESEEALETEEPLIKTEESDIDDDAEDEEP
                     LENQEAAAIEKEQNEEEEEEAFKPATDSEDASQVAEEVVLPNARDAKVSEPAATEESK
                     APAKEVKPALQEIPQNIKKKPKMLGRYKENFNIASQVMNKNHIEYLDRRIDLGAGLVL
                     TEQQIYDLAKKKLEPLMKQIDNRVAENNARDAEKAAKIEEGIRKKDEAVVAQSLASYK
                     SIIENKKKEVQAEHDNKFKELEDKAAKSKEDYEKYLEDEKDGIVKDDEDSKKAEEKAV
                     DDHLENKKKLLTDYFETKENKAKELEEVKTKQTEESNLIEKFDKDTSDLRENYPNLQS
                     KLEAKKAELEELIKKSEALVKEKHEKHESHRKAVYRKKVADRSFNIINSTYSKAAANV
                     ALLGTQIGLLENRFNAHSTKIEHLNTAGKERLVNKKADASKAADTWDQHLSQVRLEEA
                     QKQEQIRIAAEEERKRIELEKKEEEERLAKEKEEEEARLAKEKEEEEARLAKEKEEEE
                     ARLAKEKEEARLLAEKKKKEEEEEAARVAEEVQRLKRLNSLKEEKIALQKKLEEQKKA
                     ELAAGSKKEKSSNVGTAAIAAGGAALGATGAAIGATIGGVSSGAGNAVAGVTSNLPTM
                     GKTLDPFKNFSTDASETSYQDELKNSTANTSSAMEKSLNPFYTGDFNDKDDLPSTIHE
                     EEHSQHTSELPKGEKKDVDGNVEEVVQESKPEGDSKTVDNEVEIPTTSSTAAAPVANR
                     RRSMVEEALAHKTPEELAKINVPLEQQVKLSPKKTSVKEPASPAPRSRSGSFFKRRNS
                     LSRTNSIKADNSKQTQSRSRRNSTASSSSKSATPVSAPVTKSPVKAKSPTASSTPIEK
                     STDKFPESSTDANATVRSLAPSGLSTAEVSEAKAVRINTDHETPKKLTSKEENDEEDD
                     VDSDLEPASVNPVFTEKIGGPEVPASTTATSGAPAKIEEDSDAYTLETVDSAEFKANR
                     DDPNYMVLKT"
     gene            <264772..>265716
                     /locus_tag="C5L36_0B01310"
                     /db_xref="GeneID:40382631"
     mRNA            <264772..>265716
                     /locus_tag="C5L36_0B01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464484.1"
                     /db_xref="GeneID:40382631"
     CDS             264772..265716
                     /locus_tag="C5L36_0B01310"
                     /inference="similar to AA sequence:RefSeq:NP_010912.1"
                     /note="PKUD0B01310; similar to Saccharomyces cerevisiae
                     YEL004W (YEA4); ancestral locus Anc_7.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320343.1"
                     /db_xref="GeneID:40382631"
                     /translation="MILASSIPAYIGFMITGCCFNVFTFEKLLEIDNKTTNLITFAQN
                     IFIFLAISLYLAYTHYWDNRKARLSITSWNVAVPILLQTLGANVNNFVFQYNLSMPTH
                     IIIRSSGTVTTLLLGWVFFNKKYTLRQIIGSTLIAVGTVLFTLNAGQQLESSSRSSIM
                     GVCLLLGTTIMNSGLSLYKESIYTRDGSKMDWKGALYYNTVYGLLFYIPLVGTIKQEL
                     LSLWRSNQSFGELLGWNLVTQMSCILGVNLLVFKVSALSFTIILLIRRFLSLFLSMYI
                     FETPVGQWGIFGIGLVILGSLTYSLNNNRPVSVVKKDQ"
     gene            <266080..>266619
                     /locus_tag="C5L36_0B01320"
                     /db_xref="GeneID:40382632"
     mRNA            <266080..>266619
                     /locus_tag="C5L36_0B01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464485.1"
                     /db_xref="GeneID:40382632"
     CDS             266080..266619
                     /locus_tag="C5L36_0B01320"
                     /inference="similar to AA sequence:RefSeq:NP_011289.1"
                     /note="PKUD0B01320; similar to Saccharomyces cerevisiae
                     YGL226W (MTC3); ancestral locus Anc_3.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320344.1"
                     /db_xref="GeneID:40382632"
                     /translation="MTMLARLFIRSVRERGVWALERACGGPIFRTRSSVTSQMCGCKA
                     QQVGVAMTRREYSASGGGETVSDDHEEEYYVDVSNIESRWAGLGFDAQQDIISYLNVK
                     QEFGWEYLSKDEKRAIYYIAYGKWGPRDPAVMSSAEFVFKLMTNMLLFSVLGFSLLNY
                     AIDQEKIAEFNGAEESTSE"
     gene            <267701..>269842
                     /locus_tag="C5L36_0B01330"
                     /db_xref="GeneID:40382633"
     mRNA            <267701..>269842
                     /locus_tag="C5L36_0B01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464486.1"
                     /db_xref="GeneID:40382633"
     CDS             267701..269842
                     /locus_tag="C5L36_0B01330"
                     /inference="similar to AA sequence:RefSeq:NP_015485.1"
                     /note="PKUD0B01330; similar to Saccharomyces cerevisiae
                     YPR159W (KRE6) and YGR143W (SKN1); ancestral locus
                     Anc_3.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320345.1"
                     /db_xref="GeneID:40382633"
                     /translation="MPPRNLTTISPHIGNSDPSSVSSDDNSNFNEENPFNHEISTSDF
                     HDPYTNHSYDDSSLSNNNSQSNLNPNVPVLNPKESLSSSPEIKQHALGYNSSFRDSTS
                     SSLLNPFASTNRLSTLANENKANEYDRYPKNLSNSRINSMHSLNTKQQQQLHQYARSP
                     NTDSDIDSNESGSSNPFMIDTDFSPFGGYPASSFPLLIDEKEDDDYLHNPDPIEDAEY
                     EKHRMWYDFKAMDTKSGFALGGVLFFVFGGLALFVILPALTYTDAAHHHDKISSGKML
                     ASLVGSNAESKNGGIVLLTQYVYPTLSAIRTSLVDPDTPKDAYTRKSRTGDEWQLVFS
                     DEFAAEGRTFYDGDDQFWYAPDFHYDATKDLEWYDPDAVTTANGSLVLRMDAFRNHNL
                     NYRSGMLHSWNRLCFTQGVMEVSAKLPNYGNITGLWPGMWSMGNLGRPGYMATTDGVW
                     PYSYESCDAGITPNQSSPDGINYLPGQRLNVCTCKGEDHPNPGVGRGAPEIDILEGEV
                     DTNIRVGVASQSMQIAPMDIWYMPDYNWVEVYNASITSMNTYAGGPFQQAVSAVSTLN
                     TDWYALGEGERYFQKYSFEFLNDDDTGYCTWYVGDNPTFTVHANALAPNGNIGWRRIS
                     KEPMSMILNFGISQNWAYIDFPSIVFPSYFEIDSVRIYQPKDQISVTCDPHDYPTYDY
                     IEKHPLAYKNWNKTSWTAAGYSVPKNSLVGC"
     gene            <270273..>270968
                     /locus_tag="C5L36_0B01340"
                     /db_xref="GeneID:40382634"
     mRNA            <270273..>270968
                     /locus_tag="C5L36_0B01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464487.1"
                     /db_xref="GeneID:40382634"
     CDS             270273..270968
                     /locus_tag="C5L36_0B01340"
                     /inference="similar to AA sequence:RefSeq:NP_013808.1"
                     /note="PKUD0B01340; similar to Saccharomyces cerevisiae
                     YMR090W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320346.1"
                     /db_xref="GeneID:40382634"
                     /translation="MTLRLAVIGANGKVATKLMKRLAQLKNEFDTVAFIRNEAQAPKF
                     TKLGIKYSTEIDLTNTPVEGITEALRGFDAIVFSAGAGGKGLDLTFSVDLDGAIKVKE
                     SIENNNSNQRLILVSAIKAKDRSYWWDTDLRSYYIAKKYADQIIESSDINYTILQPGY
                     LLDTDATGKIADPKKVNNYADTVKGQHEKISIPRDDVALTIIESLRNKNTNRKVIPLI
                     SGDIPISEALKNL"
     gene            complement(<271025..>271912)
                     /locus_tag="C5L36_0B01350"
                     /db_xref="GeneID:40382635"
     mRNA            complement(<271025..>271912)
                     /locus_tag="C5L36_0B01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464488.1"
                     /db_xref="GeneID:40382635"
     CDS             complement(271025..271912)
                     /locus_tag="C5L36_0B01350"
                     /note="PKUD0B01350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320347.1"
                     /db_xref="GeneID:40382635"
                     /translation="MEEAQSKRRKLDDKHSGAKTESRMESSDKQQLNVSDLENDDLSE
                     HSNEEECCLALSDLDDLEDFDDGETHIDASDPLEAEYLTKYPKITKLINNASDSSQLM
                     AVNFIRLLEKHQVDPFASYDLDVEEIVEDEEYIINQCNNLDDSQRRDLWDEYCRVQGE
                     AEITNKVSNFIEYDTPELQFVSFLKSLNEFKFPKFYTDFNRQIKRKSKVDNDQRYDHL
                     CGCTSQNVRQQIYNKWVQFYKLPVAEKSKALAGELGKYKNKTFDQVLELIKTKKLDLW
                     EIYFLPEDEINELKGTVFS"
     gene            complement(<272186..>273742)
                     /locus_tag="C5L36_0B01360"
                     /db_xref="GeneID:40382636"
     mRNA            complement(<272186..>273742)
                     /locus_tag="C5L36_0B01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464489.1"
                     /db_xref="GeneID:40382636"
     CDS             complement(272186..273742)
                     /locus_tag="C5L36_0B01360"
                     /inference="similar to AA sequence:RefSeq:NP_010321.1"
                     /note="PKUD0B01360; similar to Saccharomyces cerevisiae
                     YDR036C (EHD3); ancestral locus Anc_3.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320348.1"
                     /db_xref="GeneID:40382636"
                     /translation="MLSYTKLSLNRQRLSLLRNMATATSKNLVEFHVHGNARTVTLNR
                     PDKLNALNTEMCDAIIPRLVEFSKSKSANLILIKSSTERAFCSGGDVVQCAKFNLDNH
                     SKKSLDFFKSEYNLNYLLSIYGKPIVSLVNGIVMGGGVGLSVHGPFRVVTETTRFAMP
                     ETSIGFFNDVGTSFWLPKLDANLGYYLSLTGDELIGFDTLLAGFGTHYVPLNRFTELT
                     ERLSALELPVLATDRRKNTIFNRNNSEALFPIVNSLIEEFSIQIPKNHQFKYSLKELN
                     TIERCFDPNTQKSVKDIIKALEDDGSSFALETIQKLRSKSPLSLELNFKLLLKNKDAS
                     IQEALSRELKLAGKLMTNYRDNDFNSFINNKLIEKNKTPITSTVYKTIDDVSTETVSE
                     LISLDVYNPKVPSSANEVEAKDQLENEIELLNSLKIGNFNELGERVSNFNQYPHHMGL
                     PTQAEIEAYVKGTEESKDEEVMVTFKETLDYFQMKYDNKAGVDAKVKMVLNRKTQPSP
                     VDSEYIQWVN"
     gene            <275029..>276051
                     /locus_tag="C5L36_0B01370"
                     /db_xref="GeneID:40382637"
     mRNA            <275029..>276051
                     /locus_tag="C5L36_0B01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464490.1"
                     /db_xref="GeneID:40382637"
     CDS             275029..276051
                     /locus_tag="C5L36_0B01370"
                     /note="PKUD0B01370; Pfam Domains:
                     FA_desaturase(3.1e-33)|Lipid_DES(2.5e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320349.1"
                     /db_xref="GeneID:40382637"
                     /translation="MASRHEFFWTNEKDPHVYRRKAILKKYPQVTKLTGPEPLTKWIS
                     LAVVLLQFTIAYLLRNTSPLSWKFLLIAWGVGGFASQNCFLCIHELSHNLGFRKPLYN
                     RLFSIISNLPIGIPYSASFQPYHQLHHKFLGDEVYDTDLPTRLEALLLSSVLGKAFFT
                     TFQIFFYAFRPMFVTQIEFTAIHLLNVVVQFVVDYYIVKYWGWNSLMYFLLSSFFAGS
                     LHPTAGHFVAEHYIFDPPAQFKEFESPPPMETHSYYGPLNMLTWNVGYHNEHHDFPYV
                     AWSKLPVLRETAPEFYNQVPEIKSWCWIIVDFIFNHDVTMYNRVKRHTAGPRARRSVD
                     YNDNSK"
     gene            <276370..>277215
                     /locus_tag="C5L36_0B01380"
                     /db_xref="GeneID:40382638"
     mRNA            <276370..>277215
                     /locus_tag="C5L36_0B01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464491.1"
                     /db_xref="GeneID:40382638"
     CDS             276370..277215
                     /locus_tag="C5L36_0B01380"
                     /note="PKUD0B01380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320350.1"
                     /db_xref="GeneID:40382638"
                     /translation="MPAKNTLDYLERVLDPVAKRTRGRHSILLLNPSLAQYRDTIAGL
                     YRHLEYDPPTEILTAIPQRDVLNYTCIKPTAESASAIGPVEIYTICQDNYTNLRLLNP
                     LRTCSADITVVVFIDIERNRLMETVNGHNYIERSDQNSLAVFKETCIRPILEETTTIL
                     NDTSLKFKSCIVCVTNASLLLYNSLTTSPVDYIQQFLRTKLLHHTTETGTFDYLVYFR
                     NSISTTPTTPTQSTTSHPQSLFFNLLCGQQIDDSFNIQESSLHPDIFICAAKDSSSRI
                     ALLAE"
     gene            <277443..>279641
                     /locus_tag="C5L36_0B01390"
                     /db_xref="GeneID:40382639"
     mRNA            <277443..>279641
                     /locus_tag="C5L36_0B01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464492.1"
                     /db_xref="GeneID:40382639"
     CDS             277443..279641
                     /locus_tag="C5L36_0B01390"
                     /inference="similar to AA sequence:RefSeq:NP_011792.1"
                     /note="PKUD0B01390; similar to Saccharomyces cerevisiae
                     YGR276C (RNH70); ancestral locus Anc_5.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320351.1"
                     /db_xref="GeneID:40382639"
                     /translation="MSQSQVLKEVEDDNAMHHRVARLSITVDDDSYKEHQKFLTSLKS
                     QSENQESSAFSGDEETPYNVPVATTNERFPKSSKKRKNEKRKQRKLQKKLERQQQIEN
                     GTALLREMIDNSNQNTSAIDDDDDDGGDGNGNDNGNRDNIPLHLLAKERGSKRRRSSA
                     ALNVGMIVRKKKFLNDKPKLTVLGDRNKKASISSIRDLLLYSLTDMDLVPRWCNLTNR
                     RSVDKFVIVFLRGLTNKEFGMPDLKKEVDPLLISKYNLNGNLDSFGKHFKEVIPMIAP
                     GSKKCIYSTYSSLVSYTLSNKQKAAIQKENENRKIVLPDLYLTLEELLFNNYPIHKDV
                     PGATTEMIDKTSDYKSTVNFHHDGSRTFALDCEMCLSVNGRVLTRVSLCDFDNNVIVD
                     KLIKPDEPIIDYLTQYSGITEEMLEGVETTVEDIQEELLSIISSNDTLIGHSLESDLS
                     VLKIKHPFIVDTSVCYDHPRGPPSKASLKMLMSTHLDTAIQKSFSGHDSVEDCISCME
                     LVKLKIAKGYLYGKSYNMESLFKRIAQNNKLVKTAEGEKIPKKSLVVGYSPVKNFGHH
                     ETQVQCNSDDEIVDKFVELQPDNDLIILKMRELEWFKNFSQNNIVEGLKLPDDVNEMY
                     RKVNDRMEKIYDNLAPNSILVVCSENGDTREMLRLQSQTKVIKFKVEKDTEEKPVHVK
                     DEKFTEDTWEQLGKALDEARDTLFLCTLKPSDFKPSASTEPESLSTIIGN"
     gene            <279870..>281504
                     /locus_tag="C5L36_0B01400"
                     /db_xref="GeneID:40382640"
     mRNA            <279870..>281504
                     /locus_tag="C5L36_0B01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464493.1"
                     /db_xref="GeneID:40382640"
     CDS             279870..281504
                     /locus_tag="C5L36_0B01400"
                     /inference="similar to AA sequence:RefSeq:NP_010267.3"
                     /note="PKUD0B01400; similar to Saccharomyces cerevisiae
                     YDL017W (CDC7); ancestral locus Anc_3.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320352.1"
                     /db_xref="GeneID:40382640"
                     /translation="MVFVAMDRESRVTELVCQSKEAEEAAGVETGYEELIQEGHKVID
                     NAPVPGDGELIIKEEHTCDNKERLRRHRKADKLEHALNQSILEQARNEKSRQDGDVSE
                     RKRRRNSASKSEATDMREDRPYSQVNGMSTISRGSDEYTTEELKMVLGSNYTVSPAIK
                     QEIYDLNCSFPNLDQSYRIFNKIGEGTFSTVYLGQKVGDSLSNEKPRDTSLVALKRIY
                     VTSSPQRIYNELNLLYSLRGSQNVAPLLDVLRFEDQVIAVLPFYQHSDFRDFYRDLPL
                     YGIKTYMHELLLALNFIHERGVIHRDIKPTNFLYNPFTRRGVLVDFGLAETQSECISS
                     KCPCYTRSEFKNVYRQLEVENNSQFPKNGYLKDDQRPGRRANRAGTRGFRAPEVLLKC
                     NNQTKSIDIWSAGVMLLTLLSRRFPFFNSTDDVDALMEITAIFGVEEMKKCAAIHGLG
                     FECNYPRFKDRIKLETLVANAVLMDCKEGDTFADDSPAWELLCAVDKKGTVSESSLGQ
                     EYRDAFEVLNECMVLDPLDRPSASELLTYPFFSDVV"
     gene            complement(<281696..>282856)
                     /locus_tag="C5L36_0B01410"
                     /db_xref="GeneID:40382641"
     mRNA            complement(<281696..>282856)
                     /locus_tag="C5L36_0B01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464494.1"
                     /db_xref="GeneID:40382641"
     CDS             complement(281696..282856)
                     /locus_tag="C5L36_0B01410"
                     /inference="similar to AA sequence:RefSeq:NP_013664.1"
                     /note="PKUD0B01410; similar to Saccharomyces cerevisiae
                     YML048W (GSF2); ancestral locus Anc_1.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320353.1"
                     /db_xref="GeneID:40382641"
                     /translation="MSTGVVKRKVQFNEETLTEQVLELNPKTYDIYMRMNHSAEYDFC
                     FQVNDQTTFKDLFKIFKLPMVFSPSIFYSKDPTGFSVSTHPGYLSRTGTVVFDTYAHK
                     QKYLTRISNLNDKISQHCLPGQLIVPTFERRYFLHFSVISFFLAWLFVDLPEHIAPIK
                     GLSPTYRLTDVICYFIKEFLDKPDIAQHFHDGIYAPVDVIEQWIYFSFHLIKCTMLYF
                     FVWSGLFNPYSFRKPALAVTKDELIEIGWTGVKKGGKADVQDGYRSSLIQEHGTIIGI
                     FNAGKLEYVKECFIDLQRGEGYDYKSPIDPNVEVPFKLTKELLMKERKFLATELAKMP
                     YENAYKELKRYRKNGPLVPCVQLKEMVERKFAKIDESIRQKAYNNPVLKKNQ"
     gene            complement(<283291..>283911)
                     /locus_tag="C5L36_0B01420"
                     /db_xref="GeneID:40382642"
     mRNA            complement(join(<283291..283614,283909..>283911))
                     /locus_tag="C5L36_0B01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464495.1"
                     /db_xref="GeneID:40382642"
     CDS             complement(join(283291..283614,283909..283911))
                     /locus_tag="C5L36_0B01420"
                     /inference="similar to AA sequence:RefSeq:NP_011485.1"
                     /note="PKUD0B01420; similar to Saccharomyces cerevisiae
                     YGL030W (RPL30); ancestral locus Anc_4.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320354.1"
                     /db_xref="GeneID:40382642"
                     /translation="MAPKTKKNSDLMNAKLALAIKSGKYTLGYKSTIKSIRQGKAKMI
                     IIAANTPVLRKSELEYYAMLSKTAVYYFQGGNNELGTACGKLFRVGVLSILDAGDSDI
                     LSIGQN"
     gene            <284416..>284880
                     /locus_tag="C5L36_0B01430"
                     /db_xref="GeneID:40382643"
     mRNA            <284416..>284880
                     /locus_tag="C5L36_0B01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464496.1"
                     /db_xref="GeneID:40382643"
     CDS             284416..284880
                     /locus_tag="C5L36_0B01430"
                     /inference="similar to AA sequence:RefSeq:NP_011484.1"
                     /note="PKUD0B01430; similar to Saccharomyces cerevisiae
                     YGL031C (RPL24A) and YGR148C (RPL24B); ancestral locus
                     Anc_4.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320355.1"
                     /db_xref="GeneID:40382643"
                     /translation="MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRK
                     NPRRIAWTVLFRKQHKKGITEEVAKKRSRKTVKHQRAIVGASLDLIKERRSLKPEQRK
                     AKRTEALAAAKEKKKADKEKRKAEKAKLVASGAKISKQQAKGAFQKVQATSR"
     gene            complement(<285228..>286916)
                     /locus_tag="C5L36_0B01440"
                     /db_xref="GeneID:40382644"
     mRNA            complement(<285228..>286916)
                     /locus_tag="C5L36_0B01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464497.1"
                     /db_xref="GeneID:40382644"
     CDS             complement(285228..286916)
                     /locus_tag="C5L36_0B01440"
                     /note="PKUD0B01440; Pfam Domains:
                     Sugar_tr(3.2e-89)|MFS_1(1.5e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320356.1"
                     /db_xref="GeneID:40382644"
                     /translation="MMGKCNSLSQASTEPVNNQTCEKSVADHHKSIDLDIEQALAENR
                     HDISPEFFCNSLAGSSPHLNLKSTGSTIILCHTSDDVILSIFPLLCYTLLVSLGGLVY
                     GYDIGTVGGIVDIPAFVRKFGDHSTANGDKVFKPITKGCLVSIACLGGFVSGFVSNQT
                     IPLIGMRFTLSLAMLVYMLGIILALIAPTYHVVIVSRLLNGLAVGISTVACPMYISEI
                     TPVKYRGVLTCFNQLFTTIGIVIGSVTMYFSATRFNSDNNAQFLYPLCQGGFLSLLAA
                     ASIWLVPESPQWLARKENNVEKVKKALSRLNYLNINDEKVIDNTVKLYDIQAVNRSNI
                     EMNGKRARSIIRGEPKYLFRTIIGILIYGFQQFTGINFFFFYGLTIFKGIQVKSPYQI
                     PVMLGVINLFFSSLSVYTISKFPRRHLLLFGSISLSSLMVCFTIAGAILKNKFDVTVP
                     LILISCAFIAVFSITWGPIASVVISEMYPSTIKVKAMSICGSCAWIFNFMISLIIPTL
                     TKYIGLGVGGGFAFATVCGGVFVYFFVPETRNTTTTVLDFHYQEKGRLYRRLCR"
     gene            <288067..>290079
                     /locus_tag="C5L36_0B01450"
                     /db_xref="GeneID:40382645"
     mRNA            <288067..>290079
                     /locus_tag="C5L36_0B01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464498.1"
                     /db_xref="GeneID:40382645"
     CDS             288067..290079
                     /locus_tag="C5L36_0B01450"
                     /inference="similar to AA sequence:RefSeq:NP_011487.3"
                     /note="PKUD0B01450; similar to Saccharomyces cerevisiae
                     YGL028C (SCW11); ancestral locus Anc_4.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320357.1"
                     /db_xref="GeneID:40382645"
                     /translation="MNFQISLIFFTFLQVILAAPLPYYVTVTAPDTYVTTIIPVAEVI
                     ISDGQTTTIQLTTLVTQTSPAADPTTLATETNLPADPTTENTETTPETTVDSVTPATS
                     ETTSTPALTTSDCTSTSISVDSNGVAHVWVTLDKTVLVGTDGVPFDTQTEQLPQATET
                     PVSTSSTQTSVDLVGNNNVAAATLSTDTTSSFTSATTGSTSPTTQSTPNTTNTSSEDS
                     TSAISTTLATETTSSSSAQDSSSETSLSMNTDAAGKDKPFVTTWANGEVFYSSLPFSL
                     VPSEEVAPNVALTTTTLTNINDAPTTTALLSLVSSSDKLLLPTLTVGLPKDKNVNTNM
                     ADPATVSVTNTKQVTTPVIVTTSSTSSTTPTADSTSSSSPDDVLQDEQTSTSAASSSA
                     SSDSGLLTKAPYSIVYSPYNNDNSCKSYTTVYTDLKLIASKGIKEIRIYGNDCNYLTT
                     VLNVANKLGLKVNQGFWISQDGANSIDDAVDNFITYISSGAAEYSWDLFSYITVGNEA
                     IISNYCSVDDLINKISEVKGKLNAAGYSGKITTSEPPVSFENNPQLCTDSEIDFVGIN
                     PHSYFDVYSSADNSGVFVAGQIEIVKQYCGDKDIVVTETGYPSAGNVNGDNVPSVENQ
                     RIAVQSILDVVGTDVTILSTYDDYWKQPGPYNIEQHFGIIQLLPSV"
     gene            complement(<290354..>291451)
                     /locus_tag="C5L36_0B01460"
                     /db_xref="GeneID:40382646"
     mRNA            complement(<290354..>291451)
                     /locus_tag="C5L36_0B01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464499.1"
                     /db_xref="GeneID:40382646"
     CDS             complement(290354..291451)
                     /locus_tag="C5L36_0B01460"
                     /note="PKUD0B01460; Pfam Domains: DUF706(2.1e-194)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320358.1"
                     /db_xref="GeneID:40382646"
                     /translation="MEHQTDRTGRPGDGRKVRKVEVVNDKKYQNLDKAKLLDKIDDDI
                     QELNLLKSKLRRLEENKFQMQERIKILDSEEKKAESSNTSDNETPSPADWKDNTHTQI
                     IKASESRQYRQYELAFDRVKLFYKEQHQKQTVAYNIQARINFKSKIRDRMTVWEALMK
                     LNKLLDESDPDTELSQIDHSLQTAEAIRKDGKPRWFQLVGLIHDLGKLLYFYDSQGQW
                     DVVGDTFPVGCKFSKKIIYHEYFRDNPDSKNPLYRTKYGIYTPHCGLDNVMLSWGHDE
                     YMYHLAKEQTTLPPEGLAMIRYHSFYPWHSEGAYKYLMDEKDKELLECVQAFNPYDLY
                     SKSDIRYDIEELKPYYLELIDEFFPNKIVEF"
     gene            <291954..>293279
                     /locus_tag="C5L36_0B01470"
                     /db_xref="GeneID:40382647"
     mRNA            <291954..>293279
                     /locus_tag="C5L36_0B01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464500.1"
                     /db_xref="GeneID:40382647"
     CDS             291954..293279
                     /locus_tag="C5L36_0B01470"
                     /inference="similar to AA sequence:RefSeq:NP_009585.1"
                     /note="PKUD0B01470; similar to Saccharomyces cerevisiae
                     YBR029C (CDS1); ancestral locus Anc_3.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320359.1"
                     /db_xref="GeneID:40382647"
                     /translation="MASKNTGKTVKGGEKGKTKQGSVEKSSDAGEKQSNTRHDVVVNE
                     REKKKQTFIVRTIWTLIMVSSFLAILAAGQFWTIIGVLLLQIGVFRECINITTQRAKI
                     EELRYTNELNWWFLITTIFYLDGRNLIKNYLTNFVVSDYTSVIAIKLVLHHKFICYIM
                     YVIGFVGFVASLRKGSLKFQFAQLCVTHMTLLLIILQGHCIINNILHGMFWFVVPAGL
                     VIINDIFAYLCGITFGKTQLISISPKKTVEGFVGAWICTTISSFALVYAFSSMNYFIC
                     PVSDNFYSNIFSHIECDPNSVFIPQVYRLPTFLIDILHKEYIQVKPVYFHSMVIATFA
                     SLIAPFGGFFASGLKRAFKIKDFGDTIPGHGGITDRMDCQFLMGSFSYLYYETFISSH
                     YLTLGKILQTVIINLEPAEIILLIKSLMSYLFKSGIVDETTYTKVVNAF"
     gene            <293599..>294636
                     /locus_tag="C5L36_0B01480"
                     /db_xref="GeneID:40382648"
     mRNA            <293599..>294636
                     /locus_tag="C5L36_0B01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464501.1"
                     /db_xref="GeneID:40382648"
     CDS             293599..294636
                     /locus_tag="C5L36_0B01480"
                     /note="PKUD0B01480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320360.1"
                     /db_xref="GeneID:40382648"
                     /translation="MSDFYSEIVPVSAEEEEVYESIPPNHNRKVTRREENEDEDIVIE
                     EINHSKLQSLNEEFESKVRDKLLYSNRLNGNENKELIKKNRLLRFKFLENELRALMVE
                     LKEENQEDEKPLLDKVNKMVGDISSFKLEQDLDSFVNYWDERLKNVCIPNSKDKKVDI
                     FSKTQVSDTSDVELESRIAKLERILESRKTDVSLPDAISDLEMKIEAFLTNKQNLQNF
                     EEEIGTLINNCEEYMNKSKTIHDKSEIVPLTDRKLCFLYEKLKRLPEFSQMSMELVSR
                     LKSLNHIILESTGTIEFMKNLENDFTSIESKLSAWEEKLDSLEDQLALDRDIFNISVL
                     KLSGSNELHKE"
     gene            complement(<294668..>295783)
                     /locus_tag="C5L36_0B01490"
                     /db_xref="GeneID:40382649"
     mRNA            complement(<294668..>295783)
                     /locus_tag="C5L36_0B01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464502.1"
                     /db_xref="GeneID:40382649"
     CDS             complement(294668..295783)
                     /locus_tag="C5L36_0B01490"
                     /inference="similar to AA sequence:RefSeq:NP_011689.1"
                     /note="PKUD0B01490; similar to Saccharomyces cerevisiae
                     YGR173W (RBG2); ancestral locus Anc_5.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320361.1"
                     /db_xref="GeneID:40382649"
                     /translation="MVDIVGKIKEIQDEMARTQKNKATEYHLGLLKGKLAKYRRMLLE
                     PEPGSGGSNKGQGFEVQKSGDARVCLIGYPSVGKSSFLSKVTKTKSEAAAYEFTTLTS
                     VPGVLEFEGAEIQIVDLPGIIRGASEGRGRGRQVVATAKTADLIIIILDATKSHQQRQ
                     HLERELEAIGIRLNKEKPNMSIKLKKTGGIKMNTLTPPKYIDEKMVASILKDYKIHNA
                     DVMIRDENVTVDDLIDVINEQHIVYTPCLYVYNKIDSVSLEEVDRIAREPNTVVMSCE
                     LDLGIQDVVDEIWYRLDLLRLYTKRRGSPPDFKGPMVVRHDSTIEDVCNSIHRDFKDQ
                     FKYALVWGSSSKFGNAPQKCGLNHKVHDQDVVSIFTK"
     gene            complement(<296032..>297411)
                     /locus_tag="C5L36_0B01500"
                     /db_xref="GeneID:40382650"
     mRNA            complement(<296032..>297411)
                     /locus_tag="C5L36_0B01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464503.1"
                     /db_xref="GeneID:40382650"
     CDS             complement(296032..297411)
                     /locus_tag="C5L36_0B01500"
                     /inference="similar to AA sequence:RefSeq:NP_011351.1"
                     /note="PKUD0B01500; similar to Saccharomyces cerevisiae
                     YGL164C (YRB30); ancestral locus Anc_8.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320362.1"
                     /db_xref="GeneID:40382650"
                     /translation="MHKSLTVLPHTGQLSYPISTANKANLVMDQLLSKAGSTLVTFAV
                     RSSVQVASSYVIKSVGTLMDKVPHNERKKLDRKREMLQNKIETVTYSIGVIQLMAARG
                     NSNLDSVLRLADYLKEDIDEFTKDITRFTSGNPNKQLSSETIKLIEKMIDELVEKIDK
                     IVPVLNLVLTTYGASSVSNFQDYVSPGRLLNATVLVNKSNDELKGMAEGKRSPVGPQF
                     SLTFYNIYYNPNTESHITWREKYARCKFQIFRKHHPEMEYYYELEVEEDFDDERYHDT
                     EESPGSITYDIRQIAKLFFSASGRLLKLEDKSTPVLVFKMRDDLIESQEREDVVSAEE
                     SQSETGVEWIAFGDYETPDNTSSDEDEDGEEEDDDENDAGGNNQIKVVESKAIETTKP
                     QKNTGSGSPLALLEYLIRLCTLQANDQTPLLEVKDERLRLYLSDENYMQNVSNKLTTL
                     NKKMEELKI"
     gene            complement(<298569..>299918)
                     /locus_tag="C5L36_0B01510"
                     /db_xref="GeneID:40382651"
     mRNA            complement(<298569..>299918)
                     /locus_tag="C5L36_0B01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464504.1"
                     /db_xref="GeneID:40382651"
     CDS             complement(298569..299918)
                     /locus_tag="C5L36_0B01510"
                     /inference="similar to AA sequence:RefSeq:NP_116655.1"
                     /note="PKUD0B01510; similar to Saccharomyces cerevisiae
                     YFL001W (DEG1); ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320363.1"
                     /db_xref="GeneID:40382651"
                     /translation="MLNRCLMLIPKIRLSGQSIRIFARFQSMTAGKMETQSNDYSNWS
                     RKQLLSKIYELEGRNSKLEQSDTVDEKVVENLPKTKKQKTFDFSKYTKRKIALRFSYL
                     GWNYQGLALQGERTELPTVEEKIMEALFRIKLIGSINQEECDFSRCGRTDRGVSAMNQ
                     VISLTVRSKLTEEELKDPKNDEKEIDYIKSINQALPDDIRVHSACLRPPKDFDARFSC
                     TFRHYKYIFNGDGLDIDAMNTAASYYLGENDFRNFCKIDASKQITNFKRSILVSQIDP
                     IEGEKNMYVFNLKGTAFLWHQVRCMVAVLLTVGQGLEAPEIVKELLDISLNPSRPTYK
                     MAHDIPLVLYDCGFTDNVKWTSGPMRNFNVNASVNGLWNDYKIKAIISDFMRSFCNMK
                     YKDDSQKIHINLGDGLGQAMKKYIMYEYRPKLETAEQINSKWRGKKLESKKRPHTNI"
     gene            <301269..>303107
                     /locus_tag="C5L36_0B01520"
                     /db_xref="GeneID:40382652"
     mRNA            <301269..>303107
                     /locus_tag="C5L36_0B01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464505.1"
                     /db_xref="GeneID:40382652"
     CDS             301269..303107
                     /locus_tag="C5L36_0B01520"
                     /inference="similar to AA sequence:RefSeq:NP_116654.1"
                     /note="PKUD0B01520; similar to Saccharomyces cerevisiae
                     YFL002C (SPB4); ancestral locus Anc_8.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320364.1"
                     /db_xref="GeneID:40382652"
                     /translation="MKPEATSVSWESLSYKIQPWIHDAMISLGFTSMTPVQASTIPLL
                     SQHKDVVVEAVTGSGKTLAYIIPVLEKITKLLEENELKKGHFGALIVAPTRELADQID
                     TVMNSILELQPENVKNIKSQRLVGSIQSVREDLSTFLLEKPQILIGTPGRVIDFLSNN
                     SVKTSKCEILILDEADKLLDIGFINDTQSIVRFLPSQRRTGLFSATISGAGNEIFKTG
                     MTNPVKVTVKSSSLAAAAAPQSLNLSYMVVKPSLKLKILFNMILKFRFKKAIVYFPTN
                     FAVTHFYSIFTHLLEKSEHVQGELDIVISSLHGKLDAKPRMKTLSKFAEGYATKSVLF
                     TTDVAARGLDIPDVDLVIQLDPPTEPDVFLHRCGRTGRANRIGNAITMLSEGREEEYV
                     NFLDIKNIQLRKQDVPSVSDKESEWYNQEFKSWLLVDRIRYDHSVRCYVAYVRYYSKH
                     VASSIFRLSELDYYSLAKLHGLTRFPKMPENKYIKSFPEDGWIDDSIDFDHYQYKDTA
                     KEEARLQELKTERRKKERKEKALLKKELKEKNSAWSKKVESKETKLERREKMAKRREA
                     VEAEIKRQREQEDSDESEVEVDWKDLVRANKKKKAKVQSNGFFDDL"
     gene            complement(<303182..>304339)
                     /locus_tag="C5L36_0B01530"
                     /db_xref="GeneID:40382653"
     mRNA            complement(<303182..>304339)
                     /locus_tag="C5L36_0B01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464506.1"
                     /db_xref="GeneID:40382653"
     CDS             complement(303182..304339)
                     /locus_tag="C5L36_0B01530"
                     /inference="similar to AA sequence:RefSeq:NP_011526.1"
                     /note="PKUD0B01530; similar to Saccharomyces cerevisiae
                     YGR012W; ancestral locus Anc_4.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320365.1"
                     /db_xref="GeneID:40382653"
                     /translation="MSGKAFVYSVIVSVSASILTYKIIKSLNGAAKDVPRKRENVADL
                     IGNTPMVRIKSLSEATGCEIYAKLELANPGGSAKDRVALSVIRHFEEIGELVPGRGDV
                     LFEGTSGSTGISFAMLCNSLGYTAHICLPDDTSLEKLQLLDSYGAEIEKVKPASIVDP
                     NQYVNAARKGALALRNDKSTQANGVFADQFENDNNWRVHYNTTGPEIWEQMDHNIDYF
                     ITGSGTGGTIAGCSKFLKSVSRKVKIFLADPQGSGMFNRVKYGVMYDTVEKEGTRRRH
                     QVDTIIEGVGLNRITHNFLQGEHCVDDAIRVTDEQAVRMARFLSSNDGLFVGSSSSIN
                     AVAAVKVAKNAAPGSRIVIIACDSGSRHLSKFWKEALKVDKNLTLEDVLNV"
     gene            <304514..>305161
                     /locus_tag="C5L36_0B01540"
                     /db_xref="GeneID:40382654"
     mRNA            <304514..>305161
                     /locus_tag="C5L36_0B01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464507.1"
                     /db_xref="GeneID:40382654"
     CDS             304514..305161
                     /locus_tag="C5L36_0B01540"
                     /inference="similar to AA sequence:RefSeq:NP_013853.1"
                     /note="PKUD0B01540; similar to Saccharomyces cerevisiae
                     YMR134W; ancestral locus Anc_2.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320366.1"
                     /db_xref="GeneID:40382654"
                     /translation="MNFGDNLTKLYERARTNDAVVLFNAFTNKYILRTLNKTEFTSHL
                     VQSAPSRIVTVTLIYMGILLAAYEIVLHTGVFLGIWKNPADEVFKEIPVHCAHVYVNI
                     NLIKKEDARRKHDQSVKPKYLLKYPIVYHFEFSPEEYAHEEFGTDLKFLKGKVQQWFL
                     TSEVYHHNKEEISEEITMDDFKFYNKHRELLVGDDKYLCDLDIGTGETVYCVIHY"
     gene            complement(<305186..>305929)
                     /locus_tag="C5L36_0B01550"
                     /db_xref="GeneID:40382655"
     mRNA            complement(<305186..>305929)
                     /locus_tag="C5L36_0B01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464508.1"
                     /db_xref="GeneID:40382655"
     CDS             complement(305186..305929)
                     /locus_tag="C5L36_0B01550"
                     /inference="similar to AA sequence:RefSeq:NP_014154.1"
                     /note="PKUD0B01550; similar to Saccharomyces cerevisiae
                     YNL245C (CWC25); ancestral locus Anc_1.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320367.1"
                     /db_xref="GeneID:40382655"
                     /translation="MPSDLNLKKSWNPKLLKNREIVWQREQELLREHRKNQLHKAKLD
                     EINEKNELLSLTEPSKDLTKRKDKNISWMYGSEQSASTDGEKIDEDILLGKRSVVDAL
                     VDNAKKDKKLTRMEKVMKTGEGYINQDNQSGEMSTKKKIAKLSKDDPLYTMKLQQIKR
                     QEYLARQEKANSLRARIETNKKTSRNSEGRFEKDHGMHNRCKNKEHSAKGGKHNNYRS
                     VERDSREYDPRYKKNNSRYGYRDNYRVRD"
     gene            complement(<306404..>306947)
                     /locus_tag="C5L36_0B01560"
                     /db_xref="GeneID:40382656"
     mRNA            complement(join(<306404..306702,306917..>306947))
                     /locus_tag="C5L36_0B01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464509.1"
                     /db_xref="GeneID:40382656"
     CDS             complement(join(306404..306702,306917..306947))
                     /locus_tag="C5L36_0B01560"
                     /inference="similar to AA sequence:RefSeq:NP_014155.1"
                     /note="PKUD0B01560; similar to Saccharomyces cerevisiae
                     YNL244C (SUI1); ancestral locus Anc_1.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320368.1"
                     /db_xref="GeneID:40382656"
                     /translation="MSNIENLKSFDPFADTGDDETEVTNYIHIRIQQRNGRKTLTTVQ
                     GLPDEYDLKKILKVIKKEFACNGNIVKDDELGEVIQLQGDQRLKIMEFMVQTLGIKKK
                     NIKIHGF"
     gene            <307183..>310401
                     /locus_tag="C5L36_0B01570"
                     /db_xref="GeneID:40382657"
     mRNA            <307183..>310401
                     /locus_tag="C5L36_0B01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464510.1"
                     /db_xref="GeneID:40382657"
     CDS             307183..310401
                     /locus_tag="C5L36_0B01570"
                     /inference="similar to AA sequence:RefSeq:NP_014156.2"
                     /note="PKUD0B01570; similar to Saccharomyces cerevisiae
                     YNL243W (SLA2); ancestral locus Anc_1.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320369.1"
                     /db_xref="GeneID:40382657"
                     /translation="MFSSLVSREGETKRSRKTSSNMFSSSRHVTDISTAIKKACTPED
                     TASKRKHVRACIVYTWDHKSSKDFWETMKVVPLKNTDTQLFKALILIHKVLQEGHPSA
                     LVGGFKNMEWISNLDTLRTLDRRFQVLIPEYVNYILQKLRFHHNHRGFNGTFEYEEYV
                     SLRTVSDPNEGYDAILDLTSLQDSLDSFGRDIFATVRNNNSECIISALVPIVAESYGI
                     YKFLISMLRAMYKMSDSAEILEPLKSKFEDQHERLYDFYANCSNIRYLTTLITIPKLP
                     FEAPNLIIQNDEDENVNLPPLTEQKTAATTLRHSPTPFEQENERQQQQAPIATQPTGM
                     VRNAFVEQQQLYEQQQQQLEQQRQAELQQQQQQQLAQQQYWEQQQRQQAEAQQLAQQQ
                     LLLDQAQRHAQGRVAELERDILTLKGQYDNDQLMLQSYDQKVQALENELASTTQTAQE
                     QLASKDEQLNLLQEQVEYWKNKYESLAKLYSQLRTEHLNLLTKSKKIQQKAASAQEAI
                     EKREKLERDMKAKNIELADLIKERDRARLELERFKNGTKTDLQTLQLEKDELEQKLAT
                     LDRAQSANLTAIFNQHNKELQELQNKFKDVTLNAPSDEKLKQLEEQLQEKDLEIEMMQ
                     QTMDETIKDLVKTQNSREEKSEMQNKLNSTKVLGLIDAILKSGINRIQDAVFELDSPM
                     QAGNLNSSPEYVLTLLEKSSGLVTDFASSFNNMLVDGDNANEALVIDSITNFTTSISD
                     ILLNTKGLTRLTKQDDFQDDLIDTAKDIAEISEVYLESLYHSNLVNKSIDDQTDIVIN
                     GNIDVQEILQTLLQLVESMKTPSSKIDLSKVDGELSDLVDKEMEHASRVIEEASVHLS
                     SLLNQPFDVSMSSIDIEVNKSILAAASAIITAIKYLIRASIESQEEIVNNGRGSHSKT
                     SFYKKNNKWTEGLISASKSIAYSTNTLIRIADGVLQNKHSNEELVVASREVAASTAQL
                     VSAARVKSQFMSKTQNKLEDASKKVNLACKQLVDQVNKLIIGKHEVEDIDYSKLSIHE
                     NKTAEMEQQVEILKLENALSSARKRLGEIRKFSYKDDDSGEE"
     misc_feature    310398..312401
                     /note="mating type locus Ya region"
     gene            complement(<310491..>311300)
                     /locus_tag="C5L36_0B01580"
                     /db_xref="GeneID:40382658"
     mRNA            complement(<310491..>311300)
                     /locus_tag="C5L36_0B01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464511.1"
                     /db_xref="GeneID:40382658"
     CDS             complement(310491..311300)
                     /locus_tag="C5L36_0B01580"
                     /inference="similar to AA sequence:RefSeq:NP_009868.3"
                     /note="PKUD0B01580; ancestral locus Anc_1.121; MATa1 gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320370.1"
                     /db_xref="GeneID:40382658"
                     /translation="MYEMSLGKDVGTIILPILTICSLTSEFCDKNETRKPLNIELPRL
                     ESMSGIPTTENSNLRRLIDDCQDSFEKEVGILMNNDLPLTLVEDLFKRYKEFFWEKYK
                     LMNNLIDTPRLPEHLTFDDHWILDDSLSLENLNDIPMLQPYQLSDFEITQAEITTTSD
                     ILGEPLTIELSGSQLSEQNTPIFSQNFGIYDYLNSITNEIESSTTDSGHNRRHRPSKD
                     VKEKLEQIFTKVKNPNSVEREYIAKKCNMTPTQVRIWFTNKRARQIKTRDT"
     gene            <311575..>312245
                     /locus_tag="C5L36_0B01585"
                     /db_xref="GeneID:40382659"
     mRNA            join(<311575..311841,311904..>312245)
                     /locus_tag="C5L36_0B01585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464512.1"
                     /db_xref="GeneID:40382659"
     CDS             join(311575..311841,311904..312245)
                     /locus_tag="C5L36_0B01585"
                     /note="PKUD0B01585; MATa2 gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320371.1"
                     /db_xref="GeneID:40382659"
                     /translation="MAKLTDSGSTRNRSESVSQNVGAVEFVQVVKQEHGYDEKEYKKI
                     LRSEIEKESKKPRNIFLIYRSLVKQYLMNYLSIKGFTEISEESGKLWKSRSSEVEHYV
                     KYLAEQEERFFENEQTQRLKDRSSSASEKLKEKTLSQLTVDGYNGREPKGETVKKDVF
                     RVYKPKKRKRSGVRSKMKSLRSKQNRVEDIFCVPNIEFQDIK"
     gene            complement(<312347..>313684)
                     /locus_tag="C5L36_0B01590"
                     /db_xref="GeneID:40382660"
     mRNA            complement(<312347..>313684)
                     /locus_tag="C5L36_0B01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464513.1"
                     /db_xref="GeneID:40382660"
     CDS             complement(312347..313684)
                     /locus_tag="C5L36_0B01590"
                     /note="PKUD0B01590; TGL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320372.1"
                     /db_xref="GeneID:40382660"
                     /translation="MNLLIIFLNLVSAVVQLPLLIFHKLGVEEYLSYFQTPSNRPDNI
                     SAVSQENKTKISPSAKPLHEVATTHCLHQKIIKANDIVDIVHAHGYKVHEHIVQTKDG
                     YLLSIHRILKSSGDKPQNSRVVYLHHGLLTNSELFLLGENKEKCLPFLLVDQGYDVWL
                     GNNRGNKYSRKHLFLSSTDEKFWNYSLDEFAMFDIPNTVNYILRNTQQDSLSYIGFSQ
                     GSAQCLAALSLNHDLNKKINKFIGLSPAMIPQGLNNPIASFLVTSAPGLLYRIFGKRA
                     ILPSVVFWQKLMGPVLYEKVVDKSLVFLFNWKSGNIKTSQKKVGYPHMFSPSSVKSVA
                     HWFQIIDSKRFQMFDEGGASGSRLVYLSGTSGKTNRVASFPTQTITTPCLFVYGKSDM
                     LIDIERTLDNLSCDIQTIGIDGYEHMDTLWADQVENTVFKPIFKYLANLHIRK"
     gene            complement(<313903..>317976)
                     /locus_tag="C5L36_0B01600"
                     /db_xref="GeneID:40382661"
     mRNA            complement(<313903..>317976)
                     /locus_tag="C5L36_0B01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464514.1"
                     /db_xref="GeneID:40382661"
     CDS             complement(313903..317976)
                     /locus_tag="C5L36_0B01600"
                     /inference="similar to AA sequence:RefSeq:NP_010924.1"
                     /note="PKUD0B01600; similar to Saccharomyces cerevisiae
                     YER008C (SEC3); ancestral locus Anc_7.154; SEC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320373.1"
                     /db_xref="GeneID:40382661"
                     /translation="MSQRSHGETGGGQRLFVPTHKPMNSMDLARQYEMDMHNITKYLF
                     KEVDAQGYKLESFVSYVRIIEDSRSPSSRPPANSPLSNKKNRFLILSAKASGRMRLHK
                     AKESSSGVIQIGRSWDFDELTTLELDDGSPTGFVCEMGKRYYWEVHTPKERRVWCTTL
                     LQNFINYTKGNIPRLVNCSIQYFHLEALYDSYRGQGSSMYTGSGNIPASPLSNQNAMS
                     SPVKTSVKSSLRSPLRSPIKSPIKSPTKSHTNIQRSPIKSSSPEVSSLKQRLATPPLS
                     NSPYSPLGNTRTNLGTAVAGNANNAFGLGVGISPVSKSSEVSSDHQDAEREAKKIAEI
                     NKRRQQEIEKRKREELERRRREQEEFEKNEREQNELRIAEEIEERKQKEEQKRLQEME
                     KEREVQRIKQEELEIERQKQQRIDEEKRLKEMEIAKKKAQKQHHQQELLRNEIKPPGF
                     AGIAKRGPPSEALSNAPSQMSFEYGDESQYHHQNVSTESANTIGVDSFIEGYGSSGDA
                     EEETAPLNIGIAQVKQNKDNKMVPSNLSKPVITETIEESDSDRSLKIATDSDIEKLIK
                     NVDGSPMDKKKVIDTEQLHENRIRAFSRVKENATNKLDLLEVLEELGYDPLFDDSESL
                     EKKILKKLDEIQYSKIKTLTDVTSATNALKETISTAFKSCDVIDPVLSLFSVELSTFK
                     DDVHYIEEQGQGLQVEATNEKLLMNEVNDLIHSVEISDSKLQKLLTSKIVLSENNSEF
                     EDILLELYNALKKMNDASSDDPMSANYQLSQMKALQEKKNVFEGSKNKFVSNFTRISE
                     KLFKSVSMSLTTRLQQVTPETFETNFLQTSFMEKSSLLITISGFIAFVKSVSNDGYDS
                     IVNSFVVAFEPFFENMATILLQHLTSVASSKLEEPFSFTLNPSQLIDQEYINSRAKKD
                     SAKTLFNRNNKLSTEASTISSNVETFFSQLVNIMSIEQELIRVLFGFSSSSDCLFENL
                     VKVKLSQRCQKFRNTSNFLKAPIESDRRVGDEIYELMKGIFDPVFGAVLKVIFSLSKN
                     HMLEIPAILSILKTYSQSLAPTCHEYAYGNFTKFEARINTIWTKEIDQQIQNIVHTKV
                     HCKVANFVKAYPVFYRRVNNFIDSLNLVNMTSFGPDEGWYGNYYMVWAIIKAALNKGV
                     EQLQIEIPVFEGIENDEIDIETLTQKHLALLLNYKWLVEETRSLNGFPKELNKSIDDL
                     RDKELREFTGSFIRQFRIGGVIRLVEGMESVLSEHSNPANMNSYSIETIKELMSSFKG
                     DNFKQEISSIAEHLKETLKGRCYNESDPTEDSEYSVAIGKQIEKELYNNCMYTISQHF
                     ISIFTRLSNIVEKHYINFEVPVDKYIINFNFKKYYSV"
     gene            complement(<318217..>319974)
                     /locus_tag="C5L36_0B01610"
                     /db_xref="GeneID:40382662"
     mRNA            complement(<318217..>319974)
                     /locus_tag="C5L36_0B01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464515.1"
                     /db_xref="GeneID:40382662"
     CDS             complement(318217..319974)
                     /locus_tag="C5L36_0B01610"
                     /inference="similar to AA sequence:RefSeq:NP_010242.1"
                     /note="PKUD0B01610; similar to Saccharomyces cerevisiae
                     YDL042C (SIR2) and YOL068C (HST1); ancestral locus
                     Anc_3.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320374.1"
                     /db_xref="GeneID:40382662"
                     /translation="MVEIDRGRPDRMSSTETSVDSNESRPKRTKRSSSVDYSQGLSVQ
                     TDIRNGSTDTTDKEKNSINYIQLDGKKVELEVISSSSSDNSDNSDGEDSSAIEETAFT
                     NATNDNNYENSDNSEDEDGDSDISELEFEQPTSPEDDIGLDLFNKEAVIPPLSEIRIT
                     KKVSSQVRKYLKTEGHGKFLDLFLPPGPTPDDIFTLVKLLGFQPPKIRGLRTLPSDVI
                     LRASITCLKNAINKVIRTRTRLPDFHEIKHVVDALSKAENIIILTGAGISTSLGIPDF
                     RSSQGFYSKMRNLGLDDPQEVFSLDVFRRDPSIFYSIAYMILPPEDSSTPLHAFIKLL
                     QDKGKLLRNYTQNIDNLEGNVGVLPEKLVQCHGSFATASCITCKYNIPGETLYPNLRS
                     KKIAYCPFCESERKALLKKFEKHEDEGLGYSSRFQYVKSFGVMKPDITFFGENLPDRY
                     HDTIKEDIEKCDLLITIGTSLKVAPVSEIVNRIPAHVPQILINRDPINHCEFDVEFLG
                     YCDQAITWICGKTDLSWEIPHPKYKEILDSGLELEVIDQEYGRYRITDADERLKERLT
                     KLEETKKLDIETQGAVRDE"
     gene            <320187..>320462
                     /locus_tag="C5L36_0B01620"
                     /db_xref="GeneID:40382663"
     mRNA            <320187..>320462
                     /locus_tag="C5L36_0B01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464516.1"
                     /db_xref="GeneID:40382663"
     CDS             320187..320462
                     /locus_tag="C5L36_0B01620"
                     /inference="similar to AA sequence:RefSeq:NP_010238.1"
                     /note="PKUD0B01620; similar to Saccharomyces cerevisiae
                     YDL045W-A (MRP10); ancestral locus Anc_3.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320375.1"
                     /db_xref="GeneID:40382663"
                     /translation="MPAKHRPAVPPLPRLRVKNQVAKQQANPCLVVMSQMLNCWASNG
                     EGNAVCRGLEVELKGCMAKGIKVAPPSKPTLNYHAARLLPKIHKQEK"
     gene            <320747..>321826
                     /locus_tag="C5L36_0B01630"
                     /db_xref="GeneID:40382664"
     mRNA            <320747..>321826
                     /locus_tag="C5L36_0B01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464517.1"
                     /db_xref="GeneID:40382664"
     CDS             320747..321826
                     /locus_tag="C5L36_0B01630"
                     /inference="similar to AA sequence:RefSeq:NP_010240.1"
                     /note="PKUD0B01630; similar to Saccharomyces cerevisiae
                     YDL044C (MTF2); ancestral locus Anc_3.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320376.1"
                     /db_xref="GeneID:40382664"
                     /translation="MWKYTRSCRLNRKYSSFTKLGKTFGEIEKDVASNKTESVIDKIK
                     ENTLYKSFFQDYEKLKKDSDSGVSRITSFEEQKSFKQVFDYLSKETNKIGVVKSLETF
                     VNFQSPVQQKSGGLRKENKGQASFFQSTSGPINLEKQYEARMKQNKEIIKALTPTLSY
                     INSNINTTIDMSNFVKTKIISVFVDDSGSSKRLSKSLTKKTSQSTKKQKYDIKQITEQ
                     SLTSPSNPLVDVQTLPILLKFCLNSLTFDFDSISTSLVLIDYIKKHPSIELYGHGLNI
                     DCYNAILIQVWSKTENLTMITCLLDELKVNAVQPDLYTFKIIAKIYLHFMRVKDGLAS
                     EPYILWNNSQDIHKLRDYLRDFRLL"
     gene            <322054..>324291
                     /locus_tag="C5L36_0B01640"
                     /db_xref="GeneID:40382665"
     mRNA            <322054..>324291
                     /locus_tag="C5L36_0B01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464518.1"
                     /db_xref="GeneID:40382665"
     CDS             322054..324291
                     /locus_tag="C5L36_0B01640"
                     /inference="similar to AA sequence:RefSeq:NP_013204.1"
                     /note="PKUD0B01640; similar to Saccharomyces cerevisiae
                     YLR103C (CDC45); ancestral locus Anc_8.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320377.1"
                     /db_xref="GeneID:40382665"
                     /translation="MIITQQQFYREFRKICKISTTHSTCKLAIFVSCFDVDSICSARM
                     LSDYLKRQFIVFQIVPVIGYIDLREKYLKLESEIANVILIGCGATADLESFLEIDISD
                     YLGDDMTPDEAALLIHEGRLGDVKLTRKLYVIDGHRPWNLDNLYGSPIVLCLDDNTTE
                     GMNAEREAFYFLINVPEEEEEEEEEDEEEVEIEDLATDNDEDNDLILNEPLERKRTRQ
                     APKESKKKKQKRLVDEYQEVLENYYQQGSTVSIPSSHQTYDLLSTIGEINIDSLWLAI
                     VGTRSLRDVYRKVYDLVYPGLKNEVQRLQVDIDAYTMRSSNSNNALITSSALNFDISK
                     KADNHGLQSCKEYTLFLLHYWTLYDSFFYSEYVNSKCHLYTNDGRRLLKTLFARMGIP
                     LIQATQNWHYLDLELKRKLDSLVLREAWKFNLREIIIDGFKRNYGFHGSISSGDYVNA
                     VQALLEHGTTRSITKKKVQSNRDDENGGPSGTNNEDNGEEHEDKNQHFLNSFWRAYDS
                     LNNYSEIKKGMEIAKYQQQFIFEKGSEIIQKGMVKTQSKFRVVILNESFTMNSSITKS
                     NNSDSTFNKSMSSLKDDRVVDITTFGNGSQMFQNPLILTKLGNWILNVQADLDEGVLP
                     LVIGAYNSETKTYLVCGLPSRASFDLDGDEEEEEGADDDDDDADDDDDDNSNTSRKNR
                     KDSKKVNKQHVILNAFSVLFEKVTQEINIQARMDSFQSAIIELRKEDLTKFLDGLTRY
                     SQYML"
     gene            complement(<324341..>325897)
                     /locus_tag="C5L36_0B01650"
                     /db_xref="GeneID:40382666"
     mRNA            complement(<324341..>325897)
                     /locus_tag="C5L36_0B01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464519.1"
                     /db_xref="GeneID:40382666"
     CDS             complement(324341..325897)
                     /locus_tag="C5L36_0B01650"
                     /inference="similar to AA sequence:RefSeq:NP_013208.1"
                     /note="PKUD0B01650; similar to Saccharomyces cerevisiae
                     YLR107W (REX3); ancestral locus Anc_8.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320378.1"
                     /db_xref="GeneID:40382666"
                     /translation="MVTPKTSHLTNPKKSSTNSRSIPSDGSITSHCTSNYSLSFPHRS
                     TSSSPSAACKLLPRPVLPYAPIRQDERQHYLRLLHDQYVHCNRNFLNNSQSNDEITRK
                     AVNEEFRIASSTKSKMEYLHVIKKIMFNLKKYGNEGGKTLNRHNNNINKISNIGMDNN
                     NDNQTNHNHKVEKTGEKNSPRGLQSAPAALGNPPFPQYWDELVELCIPLERLKRHNYV
                     IEVPIFPTSDYSPNDRINCGRCGTCFRISEISNMVKCKYHWGKINTSTYQNLNLGKKI
                     YGTDYTNKTYSCCNEPVGQSNGCVTGDHHVFKFDNPIDLHYVKEFQRIEELRSKLKID
                     GNSKTQLLRKEKIKAIGVDCEMCYTDKGFEMMKISVVDFRTEKKLIDSIVHPDGDLII
                     DLNTHVSGVESIPKTALTFDELMIKLAHMTDQDTIIVGHGLENDLNVMRLIYPKIVDT
                     AILFSENQVNVRRKDPLKKLAWKYLSENIQGKEHDSLEDAIVPIRIVKRHIQKLLSMK
                     ERNRLNRNLH"
     gene            <327134..>327946
                     /locus_tag="C5L36_0B01660"
                     /db_xref="GeneID:40382667"
     mRNA            <327134..>327946
                     /locus_tag="C5L36_0B01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464520.1"
                     /db_xref="GeneID:40382667"
     CDS             327134..327946
                     /locus_tag="C5L36_0B01660"
                     /note="PKUD0B01660; Pfam Domains:
                     Grp1_Fun34_YaaH(1.1e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320379.1"
                     /db_xref="GeneID:40382667"
                     /translation="MSDEHSTNTAVPQEQEQKQYAATPVQPYQDLYHGYPVGYDDQVR
                     PPRTGFLRTSWYKRSGKYRPYPTSVSAGLACVATTLFALGLIIAGARHTPSAAGLVGA
                     LFFSSGIVQIITGIWAIVDNNLFGSVFLLGYAAFFMSLGGFLAPFFDIEAAYADGGLS
                     DALGIFLAAWTVFTFLLWTATIKSTVPIFTLMMCLFLFFILYTIAVFGNHKGCKTASG
                     VFCFLTSACAFYAFYDGISYPYSSYSSIPEAKILRMPGAWSMPDDENKIEFV"
     gene            <328505..>328951
                     /locus_tag="C5L36_0B01670"
                     /db_xref="GeneID:40382668"
     mRNA            <328505..>328951
                     /locus_tag="C5L36_0B01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464521.1"
                     /db_xref="GeneID:40382668"
     CDS             328505..328951
                     /locus_tag="C5L36_0B01670"
                     /inference="similar to AA sequence:RefSeq:NP_011388.1"
                     /note="PKUD0B01670; similar to Saccharomyces cerevisiae
                     YGL127C (SOH1); ancestral locus Anc_6.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320380.1"
                     /db_xref="GeneID:40382668"
                     /translation="MTEIPPVDELPSRWEIELEFVQSLANTQYLMYLAQQGCFKDETF
                     LNYLNYLNYWKDPQYSKFLVYPDCLHILTLLQNENFRKQLLNQNFTSILYNDMVDYWR
                     EPLIKDEKEKDKGILNGVSASPEKVKGETVEAGASLSPEKDKQEIK"
     gene            complement(<329178..>331913)
                     /locus_tag="C5L36_0B01680"
                     /db_xref="GeneID:40382669"
     mRNA            complement(<329178..>331913)
                     /locus_tag="C5L36_0B01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464522.1"
                     /db_xref="GeneID:40382669"
     CDS             complement(329178..331913)
                     /locus_tag="C5L36_0B01680"
                     /inference="similar to AA sequence:RefSeq:NP_116629.1"
                     /note="PKUD0B01680; similar to Saccharomyces cerevisiae
                     YFL024C (EPL1); ancestral locus Anc_8.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320381.1"
                     /db_xref="GeneID:40382669"
                     /translation="MASAANAGARFRQRKISVKQTLQVLRQRDIPDFDIEEQQREIQQ
                     IETGVEKGEEEEHHLQQVINASAAKFKGAEVKQVYIPTPDASKVWNEADKFYTRKFNE
                     PDSYIVFSATVEDTSGCPYNMDEIDEEFLEKLNQDFKDEDKCTEDEFEFIASKFDSIV
                     DERQPFLSIDPQQILKFDEIKSVALDENYEKSHDLHYLLAKKLKVKNFKTLYDADTKL
                     NGDNSRDLGILLELFGKQIYEHWKDRRIKRGGGSIFPTLRFEDPSQKDDNNPYTSFRR
                     REFRQARKTRRTDVQSINKLKLLYKDLLRAQSLLQSVAQRELKKNEILQNQRGIFENR
                     KKLKKLVREGNLKLDDIDELFIDKPKKKRLPLGYVPPPSPAPPKESTKNKIKENVQSR
                     AGLKKSSKNDLPKAKGSNKVTDQNVQNNSIHSNKIPQQTIQPYVKLPPCKIPDIDLTT
                     VNTVLRDKLEGIKKAVSDKLIRRRLQDEGWINFTDDPYNPYFDLATPENTVIENKEHL
                     PYSSIVSSMFEVENSREINFSHIFNNNRHYSNNDPNIVKINSFTGTVVKNDRHSSLPE
                     FYDLYGEPSLNNQFGLSRDGINEEFNNKNMLNVSEVLLKVRKRQGRGGRIWIDRKRVK
                     EDEMFEEYLNMPESDDGNEEEICGEETQNLNDVRGTMFSSNKIDKLSPIDEPLFDDGE
                     KMDIDRDSNDGHAEITQNIPNIAVTETNKKKRKNAYDCSGAVKKRLRSRFMFDSELSN
                     VNPIDPSKLNQIGKQTQAVRFGCMLLNKAFDNMHQIRQKQHLLQQQREKLLREQKERE
                     RQLHQMRQHQLASERRGKRDNSQLNDERSKSNKLSKEEKTRNKEKDPDNKKSKTKKAS
                     NSKANNNNNSNINSINNKTNPDSTPTGANVKVKVESNGSSANKENKAEKKLVNSN"
     gene            complement(<332934..>334949)
                     /locus_tag="C5L36_0B01690"
                     /db_xref="GeneID:40382670"
     mRNA            complement(<332934..>334949)
                     /locus_tag="C5L36_0B01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464523.1"
                     /db_xref="GeneID:40382670"
     CDS             complement(332934..334949)
                     /locus_tag="C5L36_0B01690"
                     /inference="similar to AA sequence:RefSeq:NP_015221.1"
                     /note="PKUD0B01690; similar to Saccharomyces cerevisiae
                     YPL104W (MSD1); ancestral locus Anc_8.584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320382.1"
                     /db_xref="GeneID:40382670"
                     /translation="MLRYNQSIKHSFRFRRCFSVSQLNRLELPDKQKTIEKFNFKHFT
                     HTVGDITGKYHQLIGKQVTLNGWIDGAPRKISKGLVFAKFRDFNGEYTQIVSKSEDLS
                     RILRTLKPEDSLSVTGTINLKAQKKKNLANLDGIQQEETWELNVNSFQILNNSNEKAS
                     QLDSLKDTPNQYPPEYRYLQLRLPYYQQALKMRAKAARVARSVLDSMNFTEIETPLLF
                     KSTPEGAKEFLVPTRKHGHFYALPQSPQQYKQLLMASGFKGYYQIAKCFRDEDLRADR
                     QPEFTQIDMEMSFGRSEDIQHVVERLVSSIWGSVKELPLYRVDFETGKLVELEKSESF
                     PKLSYETALQKFGIDKPDLRSTLTFETLTDLFESSFHNNEFNVIEGCVLKEGLKKKKK
                     LPNQLFHDMEYKDRKPFIFKIRNAEELNNWAYKLPIKLKCPIEELNQRLNVAVNDIVA
                     ISDRSELPYENPTPLGRFRQLAIQHFPQEWMRDFSEGSTKQKLDNVFVASWLVDFPLF
                     SPVELESKDGYPTYDYKRYESTHHPFTMAKLEDYEYLASDPLKVKGDHYDLVINGVEV
                     GGGSRRVHDAQLQKFIFQEILQIKNHMSLFGHLIHALDSGCPPHAGLAIGFDRMCSML
                     LGSSNIRDVVAFPKTQAGADPVVESPSTVPAQTLDIYNIGVKDLEEH"
     gene            complement(<335184..>336815)
                     /locus_tag="C5L36_0B01700"
                     /db_xref="GeneID:40382671"
     mRNA            complement(<335184..>336815)
                     /locus_tag="C5L36_0B01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464524.1"
                     /db_xref="GeneID:40382671"
     CDS             complement(335184..336815)
                     /locus_tag="C5L36_0B01700"
                     /inference="similar to AA sequence:RefSeq:NP_012536.2"
                     /note="PKUD0B01700; similar to Saccharomyces cerevisiae
                     YJR003C; ancestral locus Anc_5.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320383.1"
                     /db_xref="GeneID:40382671"
                     /translation="MLSGRSRAFVFRSTLTRNTRYFSVTRSTYIDVKSHNSLNDTLNC
                     LRENADTDPDLKSGQTYHDIINHHASRVEKLPKEEVIEKEYDDLYMLSLTLLKLLENT
                     PEVSQEYKKEILNNLIEKFSQYNYAVSTLALRKLLEDKRNLSLESINQLITHNPGRVD
                     SSWSLYHKLKPEEPHDMIAISALKKLLYGDSVEIKENLHKVDIKKLIQILQIYETVGD
                     KSLIDDKTYLCLMDNLIKLSCTAIVTSMYIPPAIIETLINEDDGTPLNNIDYLYLYEA
                     SINNGVSLSGNALLKTLMPISKLQLTPIVDSENLKLVKSELGVEIKDLAPLSEIVEEI
                     REQILELGLDDTPEMMNNLIKSAGFYSNDLKAAIKYFQNYQTKVPDGTVAQNNLKSII
                     SLVCTYDCIVKEDKKMINVAEVLVPQTPLPAANNLAALMLFHGWFNNSDKAIDIHNKA
                     INLFLKPHEGNEYNRGVLTQSLVLVCLLDKDVELARLIKQRGSENNTLDESFEIRLSN
                     LMKEYGDIIEESKSDDEFRKEMKRIFLRTIREWSP"
     gene            complement(<337280..>337759)
                     /locus_tag="C5L36_0B01710"
                     /db_xref="GeneID:40382672"
     mRNA            complement(<337280..>337759)
                     /locus_tag="C5L36_0B01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464525.1"
                     /db_xref="GeneID:40382672"
     CDS             complement(337280..337759)
                     /locus_tag="C5L36_0B01710"
                     /inference="similar to AA sequence:RefSeq:NP_010104.1"
                     /note="PKUD0B01710; similar to Saccharomyces cerevisiae
                     YDL177C; ancestral locus Anc_7.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320384.1"
                     /db_xref="GeneID:40382672"
                     /translation="MSRWSTSSILTMKKSKFKAFCTPITSSTEIPGLLEDIFKLDKTV
                     QKASHPLMYAWKTTQSNLTDKQGKSAAVELNKLVNLNQGFNDNREGGSGLRILGMLDR
                     LHLVNILVIVSRWYGGTPLGPARFKCMSDVGMEALRNGGYLGFKGKWTDCSKVRNQR"
     gene            <337960..>339132
                     /locus_tag="C5L36_0B01720"
                     /db_xref="GeneID:40382673"
     mRNA            <337960..>339132
                     /locus_tag="C5L36_0B01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464526.1"
                     /db_xref="GeneID:40382673"
     CDS             337960..339132
                     /locus_tag="C5L36_0B01720"
                     /inference="similar to AA sequence:RefSeq:NP_010680.1"
                     /note="PKUD0B01720; similar to Saccharomyces cerevisiae
                     YDR392W (SPT3); ancestral locus Anc_5.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320385.1"
                     /db_xref="GeneID:40382673"
                     /translation="MATTKKTETKAAKRPASAKRKPTKAAPKAKLTSTPDLNRTPQRG
                     DKDNEEDTTDGVHLNEGLDVSPVKKSAIGDYHDNVMDTPRDKNRYKYRVEIQQMMFVS
                     GETNDPNERTTDLIEDIVRDQVVSLMLQAQKTASSRGQRSILPEDLIFLIRHDKAKVN
                     RLRTYLSWKDVRKNAKDQETGDVGAGGTDLLDEGVGSMDNKIMASKQNKTLKLPWELE
                     FMFTEQPLSLNNGEDDVIDEEGREAVLAQIKRLKQNDERTRDMTQEEYVHWSECRQAS
                     FTFRKSKRFREWCGLSQITESRPNDDVIDILGFLTFEMVCSITEEALKVKTSMDRIFG
                     DHDRHKYLFMEPSNDDKPINEDHVREAWRRLQTVPHAKRSLYNFHGGRMLRNVRLI"
     gene            <339336..>340550
                     /locus_tag="C5L36_0B01730"
                     /db_xref="GeneID:40382674"
     mRNA            <339336..>340550
                     /locus_tag="C5L36_0B01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464527.1"
                     /db_xref="GeneID:40382674"
     CDS             339336..340550
                     /locus_tag="C5L36_0B01730"
                     /inference="similar to AA sequence:RefSeq:NP_015391.1"
                     /note="PKUD0B01730; similar to Saccharomyces cerevisiae
                     YPR066W (UBA3); ancestral locus Anc_3.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320386.1"
                     /db_xref="GeneID:40382674"
                     /translation="MRNLQLSYKKILSIPGPFTDPDYEPSLAVEELSNANVLVIGAGG
                     LGCEILKDLALSGIKRISVIDMDTIELTNLNRQFLFKVGDIGQSKAMVAAEVVMERVE
                     GVSITPYLNRIQDFDDEFYRNFTIIVCGLDSIEARRWINSKIVGIAQNYDQIIPIIDG
                     GTEGFQGSVKMIIPTITACFECYLPLIPDRVTYPLCTLASTPRLPEHCIEWAHQIEWG
                     KKYSHEFNADDLGDVSKMYQLALERGKQYGIEGITKEKTLGVVKNIIPAIASTNAVVS
                     GQVCNEAFKFLTSCNPNMKDSMYYNGENGVLFETDEYHKLPDCAVCGIKRVKLTVENG
                     TSIGQFVSKIKDAYKLIKPLFIKDDKELFNFKFDTIDGPVGSKPIENGELIVIDKNIS
                     TSMVVEIIVEDL"
     gene            complement(<340686..>341276)
                     /locus_tag="C5L36_0B01740"
                     /db_xref="GeneID:40382675"
     mRNA            complement(<340686..>341276)
                     /locus_tag="C5L36_0B01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464528.1"
                     /db_xref="GeneID:40382675"
     CDS             complement(340686..341276)
                     /locus_tag="C5L36_0B01740"
                     /inference="similar to AA sequence:RefSeq:NP_013684.1"
                     /note="PKUD0B01740; similar to Saccharomyces cerevisiae
                     YML028W (TSA1) and YDR453C (TSA2); ancestral locus
                     Anc_5.569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320387.1"
                     /db_xref="GeneID:40382675"
                     /translation="MVVPSIQKPAPAFTKTAVVNGTFEEVSLEQYKGKWVLLAFFPMA
                     FTFVCPTEIIAYSEKAKEFKEKNCEILMASTDSEYSLLAWTNVARAEGGLGPLNIPLI
                     ADRNHSLSRDYGVLLEEEGIDLRGIFLIDPKGTLRQITINDLPVGRSVEESLRLLEAF
                     QFTDKYGEVCPANWTPGADTIVPEPTKSKEYFSKQA"
     gene            complement(<341497..>343122)
                     /locus_tag="C5L36_0B01750"
                     /db_xref="GeneID:40382676"
     mRNA            complement(<341497..>343122)
                     /locus_tag="C5L36_0B01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464529.1"
                     /db_xref="GeneID:40382676"
     CDS             complement(341497..343122)
                     /locus_tag="C5L36_0B01750"
                     /note="PKUD0B01750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320388.1"
                     /db_xref="GeneID:40382676"
                     /translation="MITVDIAFSILCYKDQSLHFKDAFDDDLRVTENFMSRITCKEDE
                     LVSQVLIRLGKEYPFLILNYATDPDGERADEFDTLEKVWHNYQSYEGVDCAISERDHV
                     TLHVHGIYESLRDEDLTQFHALIRERPFSTNIMHELKRWNITDESYDIRFPNGEYHSL
                     SGHSYDGLQGTDRMVDQLLTCQEKYVITNDATGEQVELSSQQCFVVSPYDKDGIYKPY
                     FMVSRSGLKLLEKLGPIETLKVRIGHLEDPTVVKSEGNTSASIFQAYSDILGLFTDIS
                     RRDVPLDDSDRRSLHVIETEIIPLLDSLRADVDEPRGTVSNAEKSLVRKIWDFILGFF
                     LVWIWNGLIFNLATVHFLFLLKAAFCIFVCYRLEIPKGVGYVGAIIIYISDTNVIQTW
                     EKIGLRGGIPLVLKFHSLHKKTKEFLEQKFYNTLDILSWALVCYNRQIYNESGEVILD
                     NRRLRENQGASFIMHIVEIIQQIVQDLILLVLTLFPPFSDSVKRVRVRAAAIVDSNAN
                     ANPNANGNGDVDNNGNGNGNGDADVLAPMVDNQ"
     gene            <343565..>344818
                     /locus_tag="C5L36_0B01760"
                     /db_xref="GeneID:40382677"
     mRNA            <343565..>344818
                     /locus_tag="C5L36_0B01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464530.1"
                     /db_xref="GeneID:40382677"
     CDS             343565..344818
                     /locus_tag="C5L36_0B01760"
                     /inference="similar to AA sequence:RefSeq:NP_013304.1"
                     /note="PKUD0B01760; similar to Saccharomyces cerevisiae
                     YLR203C (MSS51); ancestral locus Anc_7.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320389.1"
                     /db_xref="GeneID:40382677"
                     /translation="MFAQSVKQFHQPILQFQQQRQIVGFIRSVLCLDPPQSADVPTVE
                     NRFHPWDSSPYPDLRTRAATIRAKAKCPVTNLDINYTCPISGIPTHHSREAWEQDTEY
                     HQTKKYEILKKVNIYEHDLRSGRPFPEFEFPTNQRRDNLVNFANWDTFFYTRGFVSMD
                     TEFQLAVVTKMLSFPLSIASIVHQYSPYFLKPKGPVSVEGLKSLAALRYSLYPQLRLS
                     TYRDRPMRIFLLNARSESLLPAHVWKELTYLFPGVTFELHFVGPQSYFDREKQQYLVS
                     DRPIIKRLDDTLCFVYHTHDFNVLHEAGDLFPYDPYLDMFIAYHPQMTEKNSVEMWSK
                     SIKGLLESKCPVVVTGYHEENLNKNFDYIMENFKDDLDLIFDKTQNIYGSTKWELNDL
                     NPQEVFQYNQRIFAIRGKRYHAVNT"
     gene            346333..346404
                     /locus_tag="C5L36_0Btrna3Q"
                     /db_xref="GeneID:40383838"
     tRNA            346333..346404
                     /locus_tag="C5L36_0Btrna3Q"
                     /product="tRNA-Gln"
                     /note="PKUD0Btrna3Q; codon recognized: CAG"
                     /db_xref="GeneID:40383838"
     gene            <346763..>348295
                     /locus_tag="C5L36_0B01770"
                     /db_xref="GeneID:40382678"
     mRNA            <346763..>348295
                     /locus_tag="C5L36_0B01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464531.1"
                     /db_xref="GeneID:40382678"
     CDS             346763..348295
                     /locus_tag="C5L36_0B01770"
                     /inference="similar to AA sequence:RefSeq:NP_009982.1"
                     /note="PKUD0B01770; similar to Saccharomyces cerevisiae
                     YCR053W (THR4); ancestral locus Anc_6.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320390.1"
                     /db_xref="GeneID:40382678"
                     /translation="MSQVYRSTRSATEQEISFEEAIITGLAKDGGLFIPSEIPQISKD
                     ALSEWENLSFQELAFNIMRLYIKESEIPNEDLKKLVEKSYSTFRSNDVTPLVKIDSKN
                     NLHLLELFHGPTYAFKDVALQFVGNLFEYFLQRKNANKKEGEERDIITVVGATSGDTG
                     SAAIYGLRNKKDVSVFIMYPTGRVSPLQEDQMTTVTDDNIHTFSVKGTFDDCQSLVKQ
                     VFADEEFNSKYHIGAVNSINWARILAQITYYFHAYFNLKKQVGSEDFHVKFVVPSGNF
                     GDILAGFYAEEMGLPVEKLVVATNENNILHRFINSGVYDRTPAKVTYSPAMDISISSN
                     FERFLWYMVRKTDGKNDDMKTGSIMANFMSSLNSPKGEFTVSPETLAVTREILASASV
                     TNEETVATIRETYQNTSNKYILDPHSAVGIHTCLKTMETSEDKPNTYYISLSTAHPAK
                     FSEVVNLALGEFEGYSFEKDVLPTELKQLSSMEKKIRIIEQADLQTVEAAIVEELAKE
                     KK"
     gene            <348421..>350118
                     /locus_tag="C5L36_0B01780"
                     /db_xref="GeneID:40382679"
     mRNA            <348421..>350118
                     /locus_tag="C5L36_0B01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464532.1"
                     /db_xref="GeneID:40382679"
     CDS             348421..350118
                     /locus_tag="C5L36_0B01780"
                     /inference="similar to AA sequence:RefSeq:NP_009981.1"
                     /note="PKUD0B01780; similar to Saccharomyces cerevisiae
                     YCR052W (RSC6) and YNR023W (SNF12); ancestral locus
                     Anc_6.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320391.1"
                     /db_xref="GeneID:40382679"
                     /translation="MCPCNETCEFSSHVHDQGEFHLMITLSKCISPLTWVLQIKSSFN
                     QDQAMQRVKKLPTGKPDSSTAGRIQAHAQQQQQQQQQQQQQQQQQQQQQQQQPSTTAK
                     SNQPIQLKPTDQSIPPCLKEHFPEKVELYEQLQNRERLLDIMINRKLLDLQDHQQRIT
                     TNELSGESNEETLRIFIYNTSENQPWQRDANQQDVPSEVHPDPSWTLRIEGRLLNDKT
                     PLTDSKRHKMSWFLSGLSVELKPADGDESRPLVLKGVNAPGLNGSSDTLIEWHDDIKL
                     PEAERVSKQFDGMDIRRGGSSIPGSTDDLDREIVANIVIQPKQYPIKLMVNDKSLMEL
                     VGAREITQAECIKRIFYYAKVNQLFDVQTVESDSKDLTNKSSKKIVTIKSDELLMKIF
                     GLPIMTMPQIMEIVGNKLLKPVEPVRINYRINTLKSTTLGEVVVDIKVNRAMLGKKKV
                     NQDLEDINRLITEDVLNKQSLAELIKLDENLKLNIQILNYSKMKYDFYKKFSENPAEF
                     LKQVLQKNEEYLKILSSDSMSFGKDGLVSEELVRKSDFYTDDFLKQHINLLLNSGRI"
     gene            <351397..>351975
                     /locus_tag="C5L36_0B01790"
                     /db_xref="GeneID:40382680"
     mRNA            <351397..>351975
                     /locus_tag="C5L36_0B01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464533.1"
                     /db_xref="GeneID:40382680"
     CDS             351397..351975
                     /locus_tag="C5L36_0B01790"
                     /inference="similar to AA sequence:RefSeq:NP_009342.2"
                     /note="PKUD0B01790; similar to Saccharomyces cerevisiae
                     YAL059W (ECM1); ancestral locus Anc_7.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320392.1"
                     /db_xref="GeneID:40382680"
                     /translation="MARKGGVSKNSRAARRGDADPFTSSEAKELAAIPRLENTDTVSS
                     IIRSSLSKNQRLLNDKVNRLSKNENKLKPGDHIITTHANKKRQHMVSKTVRSKQSKFL
                     NIDGRLSKKIENALNRKKKIANLRKAGWEQINEVAKKSLEDDIVSKINSEKQTNQDLE
                     DQLLDEMRDDDEIVQEIVKKQQNPFALLPEEE"
     gene            complement(<352049..>354832)
                     /locus_tag="C5L36_0B01800"
                     /db_xref="GeneID:40382681"
     mRNA            complement(<352049..>354832)
                     /locus_tag="C5L36_0B01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464534.1"
                     /db_xref="GeneID:40382681"
     CDS             complement(352049..354832)
                     /locus_tag="C5L36_0B01800"
                     /inference="similar to AA sequence:RefSeq:NP_013910.1"
                     /note="PKUD0B01800; similar to Saccharomyces cerevisiae
                     YMR185W; ancestral locus Anc_6.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320393.1"
                     /db_xref="GeneID:40382681"
                     /translation="MSTVDEEKLKQLKKELEKFKKGETIKGRSRTTPLGKLFDQISNK
                     IDGFQLQKDVVGFLYNNFGGDKTETDRIYKRRYVIGQILDSLSEINKLSMKNKESSMI
                     SIPLYDIRIVGELTNILIIHGIYSVVPQGYLIPLDQRKLKNFKIQTAFERIDFKAGAP
                     ILKDILCKMTQIFESDSDLKDLILVGTGFTDTLSIAVLFFFSSDEYRQYLDKLESKSS
                     TYQLLSFYSLLYRNSKQNPKYANFVLSLLTKQILKPNGMESLIDLVMGLREDEDIDIT
                     KINYVVQVIISSKPTGMSAVEYFQNIFTQIYKLLILVNRPLMNTILVEIINDIYLKNK
                     AVIIDFLFKEIWKTFNPEPKKESDDIVLVCGVDLNNAFNVCLSISRSLNRNNQEIINE
                     LFEPVLLKLWYYANFQKEKGKDYGIVVNLIKNIIILGDTKHFVKLIISNLINFQDKWV
                     FGTEDNNLTYIKCNTNEVYTNKDNKFLKLFDEIDFYVDSFVELATKLNDSDSELLNTV
                     LIIVLDTFTSKSFASNLDLPIQRVIDLKLIQSLLETFRIEIEDTPIAVLFFTNTYLTQ
                     FFNSKKSEPDAELRVIDEENDSDDEDGEEAIIQDSENVIALVPVLEIISELRPSRDDE
                     KNQLERLQTLLKQNNASIPTTIKPFTDRIVEIDTHNLVLKPKIDAFNIETILKQINDT
                     SPSIRVYALNNLTEHALSGKTGEGNSNVSVKYTVNLLIAQLKDPEPYVYLNSIKCLVS
                     IISYDKSFLGVLVDQYSHSPKSIDEKLRLGEVITKFVKLNGKVLKQDQVKEIITMCIN
                     IARSDSKLQQRYKDNKDVRMKMSALSILGISCSECGYDIVPYVSDIVDLIHGIITFED
                     SVELKRAAVVIVNDIVRNEKGLGILENYGEKIQILLEFIAEKDTDLLVSGFAEDALNS
                     IEESFQKKLKISG"
     gene            <355051..>355659
                     /locus_tag="C5L36_0B01810"
                     /db_xref="GeneID:40382682"
     mRNA            <355051..>355659
                     /locus_tag="C5L36_0B01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464535.1"
                     /db_xref="GeneID:40382682"
     CDS             355051..355659
                     /locus_tag="C5L36_0B01810"
                     /inference="similar to AA sequence:RefSeq:NP_015085.1"
                     /note="PKUD0B01810; similar to Saccharomyces cerevisiae
                     YPL239W (YAR1); ancestral locus Anc_6.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320394.1"
                     /db_xref="GeneID:40382682"
                     /translation="MGKLTSLTQEEMDNVIYDARFGDLESLTEIFTKEVEPSVIKTIK
                     DEYSLSTPFHMAAANGHIEVLKFLLSLIPDEDERKNILNLKNDSGNTALHWAAYNGHL
                     EIVQMLCDSGSDPFIRNNYNHDVFFEASNNEQEEVDDYLLQKYGNIVEKGIDEDDTNG
                     NHEAVEEKDQIKFSEGTEISKVTEEDKKAVAQMTEQTQKLSV"
     gene            <356356..>357174
                     /locus_tag="C5L36_0B01820"
                     /db_xref="GeneID:40382683"
     mRNA            <356356..>357174
                     /locus_tag="C5L36_0B01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464536.1"
                     /db_xref="GeneID:40382683"
     CDS             356356..357174
                     /locus_tag="C5L36_0B01820"
                     /inference="similar to AA sequence:RefSeq:NP_015087.1"
                     /note="PKUD0B01820; similar to Saccharomyces cerevisiae
                     YPL237W (SUI3); ancestral locus Anc_6.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320395.1"
                     /db_xref="GeneID:40382683"
                     /translation="MSAEELGFDPTLLKKKKKSKAAAPTEVEGASAAAEDDLFAGLKK
                     KKKKSKDKEATESTNAEDDLTESFEGLKLKKKKKKKSTKDAEIDDFEKQLAEAGIDES
                     ETNEATTTKTDLIPYSQLLDRFYDILKVNNPELAGGQQQRLKIPPPEVLRDGSKKTIF
                     ANVQQIAQVLQRNPSHLIQYLFAELGTSGSIDGEQRLIVKGRFQAKNIEGVLRRYIQE
                     YVICRTCKSMNTELKREAANRLHFIVCKACGSTKSVTSIRTGFTANVGAMKKKK"
     gene            complement(<357235..>358476)
                     /locus_tag="C5L36_0B01830"
                     /db_xref="GeneID:40382684"
     mRNA            complement(<357235..>358476)
                     /locus_tag="C5L36_0B01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464537.1"
                     /db_xref="GeneID:40382684"
     CDS             complement(357235..358476)
                     /locus_tag="C5L36_0B01830"
                     /note="PKUD0B01830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320396.1"
                     /db_xref="GeneID:40382684"
                     /translation="MLNLTSNHLIQQRAVLLSTGTIHPEKINTPWYLEGGTSLHLSGF
                     PPIEVPFSWNIKATRYLDFIKKGGICLEINPLAEETITEIGLVRNLSNSETLLMDVCP
                     QCKGPILYSSISHDSWRFISYLGVTIQDCINVGVELLVQASTLIESFTKVCFEFNLMD
                     TGFIGGFISSQLTWAVLTRNFWGVDPNVDTFEKFVATERFNLTEILLLNDASRPYFSA
                     IVGIFISIVSYTGTPLSILKMMGFSMKLARQILYRLSFNLGYMRLVCDYFPDNGHEHK
                     AFKDYPLTEMLKASFTEDYKKYLAAYPNTPLVDSIQPFDIYSSPGIAGYSILGMFTIG
                     KLLEKCKPFIRTLYMLFKRFKLTPIHVEFLIEYSGLEVTFFLKECLEFFYYWYDFQIA
                     KSYVPIKYKTEKASEDEGLYN"
     gene            <358970..>360187
                     /locus_tag="C5L36_0B01840"
                     /db_xref="GeneID:40382685"
     mRNA            <358970..>360187
                     /locus_tag="C5L36_0B01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464538.1"
                     /db_xref="GeneID:40382685"
     CDS             358970..360187
                     /locus_tag="C5L36_0B01840"
                     /note="PKUD0B01840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320397.1"
                     /db_xref="GeneID:40382685"
                     /translation="MESDTESEVSLSIETCVSCYRAEETPDNRFIHPCSSCSAAYHQR
                     CFVMECKAGLIQEQFIRKRGLSTNFIRPKSLRLTFLGNLLLSNLRYVNTITLSCSNCY
                     NIILVYGKPPTLLEKMQDIKNCFFKWCSRAATYIVLGIKLLTMNTILSGGLVGQLFWD
                     FGPRGKLLLLDASLFPHMVYSLTSPNVGIANVLLASGYTLFDFGTGRSRLRSTVRKLL
                     QVKLCAGLFYNAIINRYFLGSFRATIPAIYGARIECVDAWSIQHYRNSYEEDEVYESF
                     TFTEKVMRFFYDTWWSFKEDFGKLYKIQPTDFIMSHIGGLVCYGSGLLLRTVATPYFS
                     NIYYTDGENLAYTTLVGIAGAQAMYYLVSNFDAIMISVSYKCLKPKDPSQLGFSFKDL
                     MSYCIALFLNANK"
     gene            complement(<360205..>361416)
                     /locus_tag="C5L36_0B01850"
                     /db_xref="GeneID:40382686"
     mRNA            complement(<360205..>361416)
                     /locus_tag="C5L36_0B01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464539.1"
                     /db_xref="GeneID:40382686"
     CDS             complement(360205..361416)
                     /locus_tag="C5L36_0B01850"
                     /inference="similar to AA sequence:RefSeq:NP_116699.3"
                     /note="PKUD0B01850; similar to Saccharomyces cerevisiae
                     YFR041C (ERJ5); ancestral locus Anc_3.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320398.1"
                     /db_xref="GeneID:40382686"
                     /translation="MLRSKFISLLLLATLAFAYFSPKQLEILDLHYKIQPKKSNGEPT
                     RNFYSILNVPANVDEEQLEKAYKKLSRKWHPDKFVRAEMKERRKAERKFETLSLVMSI
                     LRDVERRKNYDYFLKRGFPVWDENKSRYVFKNRSKPTFKVVIVSLLVFATLAQIVIKK
                     LNTNQKNKRIEKILRDVRWKADNMSKQDNQTNKIMELPDDFEMGSTSIPSYSIDDKLV
                     TYCGRVFIVKPDRSVLLYNDESIDTENQQEMNDLVKKIIDSGHFNLYGFQKKPTNRKE
                     RRQQNRESKKGGASDEDDILDLLVQFRTEESSLKLSDLLVFKIPIKLWNIILGQLNTI
                     RNFENLSSGSCKSKTPHVGGVEKETREEGDDEQEKEAKKEGYEIVNKPRDSKDGKIVL
                     PNGKVLHSRRK"
     gene            complement(<361676..>362743)
                     /locus_tag="C5L36_0B01860"
                     /db_xref="GeneID:40382687"
     mRNA            complement(<361676..>362743)
                     /locus_tag="C5L36_0B01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464540.1"
                     /db_xref="GeneID:40382687"
     CDS             complement(361676..362743)
                     /locus_tag="C5L36_0B01860"
                     /inference="similar to AA sequence:RefSeq:NP_014418.3"
                     /note="PKUD0B01860; similar to Saccharomyces cerevisiae
                     YNR021W; ancestral locus Anc_6.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320399.1"
                     /db_xref="GeneID:40382687"
                     /translation="MASLNDYSPEEIVEMGIVQRLKLYSWKIELFAIAAISIYYLVYK
                     LGAGYNEKVALNFINSILPTLKENFYQVGVTETQLFAKDDDQNYTLYASGRTKIQSMT
                     AKIQLQTRQNLSMWAMEAVVGYFFQSVPAPHDIVTIEFKFDEETSDKFDNFIWAIVTK
                     DKMDKFRTENYFLSLTKTSESPKLPLQFVFMNEVPEMNDVLFTKKLSDALKDNLDTLK
                     FIAITDQPSEKPVKISELKPTKKVVLQFSISNNAKSIESIKNFFNYVLNDYLDLVANR
                     SVFRPELTRKVKKTRENEYNKLKRILDDIKREELNNKKIEEQRKLKESMTPEEQQKLA
                     KKQQERKQRKMLNRQKVRGSM"
     gene            complement(<363074..>363544)
                     /locus_tag="C5L36_0B01870"
                     /db_xref="GeneID:40382688"
     mRNA            complement(<363074..>363544)
                     /locus_tag="C5L36_0B01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464541.1"
                     /db_xref="GeneID:40382688"
     CDS             complement(363074..363544)
                     /locus_tag="C5L36_0B01870"
                     /inference="similar to AA sequence:RefSeq:NP_009975.1"
                     /note="PKUD0B01870; similar to Saccharomyces cerevisiae
                     YCR046C (IMG1); ancestral locus Anc_6.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320400.1"
                     /db_xref="GeneID:40382688"
                     /translation="MFKIFTRQISSSAVACGKKMQVYEPLPKLRNGVNLMEHIKAKQY
                     EKFDKTGLKRRAISLQNPERIRSDDVVTVVYKNQKPVTGQVIMVKRSGLNSTILLRNK
                     ITGLGVEINIPIFHPNIIRLDIVRRPATYKPRNRHYYIRNSRLDVGEISASGAK"
     gene            complement(<363788..>365065)
                     /locus_tag="C5L36_0B01880"
                     /db_xref="GeneID:40382689"
     mRNA            complement(<363788..>365065)
                     /locus_tag="C5L36_0B01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464542.1"
                     /db_xref="GeneID:40382689"
     CDS             complement(363788..365065)
                     /locus_tag="C5L36_0B01880"
                     /inference="similar to AA sequence:RefSeq:NP_010858.3"
                     /note="PKUD0B01880; similar to Saccharomyces cerevisiae
                     YEL056W (HAT2); ancestral locus Anc_6.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320401.1"
                     /db_xref="GeneID:40382689"
                     /translation="MEESAAMEAKLTETLLNMAVPQDGSENPDSDEESTETILQEYKL
                     WRKNCTYMYAFVCETALNWPSLSIQMVKSGTFINKTKDSKFAAVRNLLLTTYSSGEEE
                     KEYLKIGSIQLPKSLTESMNMTAEELETVDSRLKISKKYEQAVEINKTRLHPENHLIN
                     ATINANGDVHVYHLDEKMSLVKDYPLLHHKKNGFGLCWDPVNHNRLLSSSEDGSVALW
                     DYTESTSPLRVFTDHDGYVNDVRFAFEDGIFGSVGEDQRFVLRDLKNDKVLINQTFKE
                     TSFNSLTFSPFNKHLVAFGGDNSTIYIYDIRQMDTCLHVLTGHIKSITNIEWDPFHPH
                     IIASSSLDRRVILWDLTKIGEEQTAEEVEDGVPELVMMHGGHTGGVNDFCFSPEIEWC
                     IASCSDDNIVHIWQPKRDIVDPKDLVIDDSLVE"
     gene            complement(<365341..>366354)
                     /locus_tag="C5L36_0B01890"
                     /db_xref="GeneID:40382690"
     mRNA            complement(<365341..>366354)
                     /locus_tag="C5L36_0B01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464543.1"
                     /db_xref="GeneID:40382690"
     CDS             complement(365341..366354)
                     /locus_tag="C5L36_0B01890"
                     /inference="similar to AA sequence:RefSeq:NP_012772.1"
                     /note="PKUD0B01890; similar to Saccharomyces cerevisiae
                     YKL150W (MCR1); ancestral locus Anc_5.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320402.1"
                     /db_xref="GeneID:40382690"
                     /translation="MAQESNSGSNQMRKFFDAYKRQTVSVFAAKVVPHYQPISFLIIY
                     YSNKNMSRFLKFAIPAAAAAGGAYYYSTLTRAVAAPVFKGDNEWVNLTLTNIKPVSHD
                     SAIYTFAFPESNQPSGLIVASALLTKYVTPKGNNVIRPYTPISDVEELGKLNLLVKTY
                     PNGKMSKHIANLSVNDTLAFKGPILKWKWTPNQFNHVGLIGGGSGITPLYQIVHESLK
                     NDKDNTKITLLYGSKSEQDILLKPELDELAAKHPERFTVKYFVDELKDPKTTGLTKGF
                     ITKDVIKESLPGPSPESHVFVCGPPPLYKAISGNKVSPTDQGEVTGVLAELGYDKNTV
                     FKF"
     gene            <366537..>367403
                     /locus_tag="C5L36_0B01900"
                     /db_xref="GeneID:40382691"
     mRNA            <366537..>367403
                     /locus_tag="C5L36_0B01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464544.1"
                     /db_xref="GeneID:40382691"
     CDS             366537..367403
                     /locus_tag="C5L36_0B01900"
                     /inference="similar to AA sequence:RefSeq:NP_012771.1"
                     /note="PKUD0B01900; similar to Saccharomyces cerevisiae
                     YKL151C; ancestral locus Anc_5.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320403.1"
                     /db_xref="GeneID:40382691"
                     /translation="MNKMKQLKQLIPPLLPQLHKGQRGKLAVIGGSEDYTGAPYFAGY
                     SAMLAGVDLVHIITVESAASVIKTYSPDLMVHPYRVERRNQIVDLISKMDVVIIGPGL
                     GRERDAMAELMYLAIDQLVKNKTPLVLDADALYRLAVDKELQDLVLSNDTSHLVLTPN
                     VIELRRLADAFNVETEAQLAAKLGCTLLAKSQTDKIFNTVLLEEPLECKEPGSLKRVG
                     GQGDTLSGLVGAFLAWNSSVPEKIPLCCLAGSTAVRIAGHAAYEEHGRGMLASHLHKH
                     IEDAIRNIEDAE"
     gene            complement(<368026..>368646)
                     /locus_tag="C5L36_0B01910"
                     /db_xref="GeneID:40382692"
     mRNA            complement(<368026..>368646)
                     /locus_tag="C5L36_0B01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464545.1"
                     /db_xref="GeneID:40382692"
     CDS             complement(368026..368646)
                     /locus_tag="C5L36_0B01910"
                     /inference="similar to AA sequence:RefSeq:NP_012780.1"
                     /note="PKUD0B01910; similar to Saccharomyces cerevisiae
                     YKL142W (MRP8); ancestral locus Anc_5.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320404.1"
                     /db_xref="GeneID:40382692"
                     /translation="MSEDRLEALEKEIGALKAIVSKQKDLLAKTGQQVLSLQVKNTKQ
                     QLDAIPPPPSLTPAIDTSDFATNEDLVQLVGELQGQLDILEEKSVLRGINVRQDNDDD
                     LIVPLPNVDGDLPSSDVFTKTVAEFKAISDDTLIELCRFYQLLPQTAELEARIQAFVD
                     GEISKEELDRKDDFHPPAHDYTQEQLNGYFKDLAEFLGVSHLKREV"
     gene            <369870..>370376
                     /locus_tag="C5L36_0B01920"
                     /db_xref="GeneID:40382693"
     mRNA            <369870..>370376
                     /locus_tag="C5L36_0B01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464546.1"
                     /db_xref="GeneID:40382693"
     CDS             369870..370376
                     /locus_tag="C5L36_0B01920"
                     /inference="similar to AA sequence:RefSeq:NP_011505.1"
                     /note="PKUD0B01920; similar to Saccharomyces cerevisiae
                     YGL010W; ancestral locus Anc_4.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320405.1"
                     /db_xref="GeneID:40382693"
                     /translation="MLFDLSYQLAYYKAYHLHQKNVAIHLCCIPLILASAMTMLYATG
                     KPWILYSLATVYSGYYIILHRKVGAMASAFLVAIIILIQKLNTLFPPTVIFRSALTIH
                     ILSWAAQFYGHFHFEKRSPAVLDNLVQPLVLAPYFVLFELLFNAGYERKLHDRMLAQA
                     VQLRRDKQ"
     gene            <370511..>371404
                     /locus_tag="C5L36_0B01930"
                     /db_xref="GeneID:40382694"
     mRNA            <370511..>371404
                     /locus_tag="C5L36_0B01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464547.1"
                     /db_xref="GeneID:40382694"
     CDS             370511..371404
                     /locus_tag="C5L36_0B01930"
                     /inference="similar to AA sequence:RefSeq:NP_009824.2"
                     /note="PKUD0B01930; similar to Saccharomyces cerevisiae
                     YBR265W (TSC10); ancestral locus Anc_1.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320406.1"
                     /db_xref="GeneID:40382694"
                     /translation="MLDVEGKTVIVSGASQGLGRSLALKLHARGANVVLVARTASKLQ
                     ELADSLNENRMSSNHQAYAYPLDLSIKEDVLEFGKWLDDRVDNLVGVFCCAGSSIPKL
                     FTNLSLDEIDNGININYKTCIYLLHVTIPLLKRSKEKTNIVIFSSSVAFYSFIGYSQY
                     APLKSALQSLGDILRQELDPYNINVSTVFPGNFASEGFHEENLTKPAITSQIEGASVP
                     ISVDECADKVLSGITNSESYIHTDFIGWVLSCFSLGFGPRSWWLFQIPVAVIGVLFAR
                     LISKYHDYQVKQWVAANRHKQ"
     gene            <372010..>372648
                     /locus_tag="C5L36_0B01940"
                     /db_xref="GeneID:40382695"
     mRNA            <372010..>372648
                     /locus_tag="C5L36_0B01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464548.1"
                     /db_xref="GeneID:40382695"
     CDS             372010..372648
                     /locus_tag="C5L36_0B01940"
                     /inference="similar to AA sequence:RefSeq:NP_012472.1"
                     /note="PKUD0B01940; similar to Saccharomyces cerevisiae
                     YJL063C (MRPL8); ancestral locus Anc_1.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320407.1"
                     /db_xref="GeneID:40382695"
                     /translation="MTLGRNSKQLKHTIRNLVSSLVMHEHVTTTPAKAKIAANYIENL
                     ILKSKKHQSSEKASAQWRHLLYGKLYNQDITVDKVITEFVQRYQNRSSGFTRQLKLEP
                     RFGDNAPQVALEMVDNESREMAFWYLAKTVARLELQGLALDPLTKKNVDKLTVGKVNG
                     PEKFREVVQICKDNFFNDEDAKHELETSKPRFKSNTNGFNRQTTNFEFVPRE"
     gene            complement(<372753..>374048)
                     /locus_tag="C5L36_0B01950"
                     /db_xref="GeneID:40382696"
     mRNA            complement(<372753..>374048)
                     /locus_tag="C5L36_0B01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464549.1"
                     /db_xref="GeneID:40382696"
     CDS             complement(372753..374048)
                     /locus_tag="C5L36_0B01950"
                     /note="PKUD0B01950; Pfam Domains: eIF3_N(1.5e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320408.1"
                     /db_xref="GeneID:40382696"
                     /translation="MSQLTPQQVEVAKKYDVSGKLVEFLDRHLFCQVLDSLVKIYGEE
                     KIDQLEMQVLKDTYMFDVLKELHANLKGDAKELAEINEREQKVHERLIPLNESTKKTL
                     STLCSKEIQDNLKQDKASNRELIKGYGIDDSKIMELYEFGKLQYNRGDYVMSSDLLNN
                     FKLLSSDSEKILSATCGKFVSDILSGDIIEAKNEMNNLREVTDNRNYEGSPLEQVKLR
                     NWLIYNSLFLFFNSNKNSTQDQLANQLLQLNEIFISSSYLSTIEASCPWILRYIISSV
                     LYTRDYRRLKDLIKAVNIESYEFQDPFTQLIDTLFIKFNLDNISETVSNIEILLETDF
                     FLSKLDKALMMKNIYTLVVKNVLKIYGELDIEQLKVHFLPNLSQDIINEISGDFSNNN
                     GKLSLKGEKESKYFDIYERTKALSFKSTQLLNNAFGKDF"
     gene            <374368..>375882
                     /locus_tag="C5L36_0B01960"
                     /db_xref="GeneID:40382697"
     mRNA            <374368..>375882
                     /locus_tag="C5L36_0B01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464550.1"
                     /db_xref="GeneID:40382697"
     CDS             374368..375882
                     /locus_tag="C5L36_0B01960"
                     /inference="similar to AA sequence:RefSeq:NP_015121.1"
                     /note="PKUD0B01960; similar to Saccharomyces cerevisiae
                     YPL203W (TPK2); ancestral locus Anc_6.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320409.1"
                     /db_xref="GeneID:40382697"
                     /translation="MENQHHLLHNTRHSVSIDLDTLKSNTPSTIYTNTPSPVLSQPSP
                     YLPSSNIIDQSQATALAQAQAQAQAHLQAQAQAAAQAQAVAQAQAQAAAQMQAQMQAQ
                     LQAQAQAQAQAQLQAQVQYQQQQQQQQQQQQQPDSIQLTTEEQKQLEYLQRMPSYQAI
                     IQPNYHLLKLKYGNKSLLPQRDTISKGKYSLKDFQIMRTLGTGSFGRVHLVRSIHNHR
                     YYAIKVLKKQQVIKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDSKNLFMVMDYIEG
                     GELFSLLRKSQRFPNPVAKFYAAEVILSLEYLHSHNIIYRDLKPENILLDRNGHIKLT
                     DFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGILIFEMLAGFTPFYDQ
                     TPMKTYEKILACKVHYPSHFHPDVVDLLTKLITPDLTRRLGNLQNGPEDIRNHRWFSE
                     VIWEKLLLKDIETPYEPPITAGVGDTSLFDHYPEEQLDYGIVCDDPYAKYFNDF"
     gene            <376050..>376949
                     /locus_tag="C5L36_0B01970"
                     /db_xref="GeneID:40382698"
     mRNA            <376050..>376949
                     /locus_tag="C5L36_0B01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464551.1"
                     /db_xref="GeneID:40382698"
     CDS             376050..376949
                     /locus_tag="C5L36_0B01970"
                     /note="PKUD0B01970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320410.1"
                     /db_xref="GeneID:40382698"
                     /translation="MTIAHSSSTICRIRLCPQLERDHAADSEKLHQETIINNRKVNMK
                     CESPYSAKSTLDTESPTDDNEGLICKHSSPFSWLFCRPKNEKQKKSSSSDEEKSGSKF
                     VLLSPYFKNELLDKLDFCIDEVKAMDNIDPKYVTGSLVILCKSLRKIYIDSQKQHIIK
                     KNNNLKYAQNLENWEIAISSIQIFIDGLKESKTSLSTRGAIQKKEKGVAEKLASDTSI
                     ENEKTNPRISPSLRDKLLIHEGTYLSSKNNSGDLSSGVPYRTYQMPFHRSPYNYSKRT
                     ENEDSILMDINNRLQNASDLDWL"
     gene            complement(<377097..>377564)
                     /locus_tag="C5L36_0B01980"
                     /db_xref="GeneID:40382699"
     mRNA            complement(<377097..>377564)
                     /locus_tag="C5L36_0B01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464552.1"
                     /db_xref="GeneID:40382699"
     CDS             complement(377097..377564)
                     /locus_tag="C5L36_0B01980"
                     /inference="similar to AA sequence:RefSeq:NP_011447.1"
                     /note="PKUD0B01980; similar to Saccharomyces cerevisiae
                     YGL068W (MNP1); ancestral locus Anc_6.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320411.1"
                     /db_xref="GeneID:40382699"
                     /translation="MMVRFNSSEAAAEKASAPVDPKIQSIVDSISSLTLVETSALIKA
                     LKTQLDIPDMAFPVGGVAAPAAAPAAAEGEGEDAAPAPAEKTIFNIKLESFDAKTKAK
                     IIKEVKGLLGLSLVDSKKFVEAAPKVLKENVAKEDAEKIKKTLEDLGAKVSLE"
     gene            <377997..>378341
                     /locus_tag="C5L36_0B01990"
                     /db_xref="GeneID:40382700"
     mRNA            <377997..>378341
                     /locus_tag="C5L36_0B01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464553.1"
                     /db_xref="GeneID:40382700"
     CDS             377997..378341
                     /locus_tag="C5L36_0B01990"
                     /inference="similar to AA sequence:RefSeq:NP_011445.1"
                     /note="PKUD0B01990; similar to Saccharomyces cerevisiae
                     YGL070C (RPB9); ancestral locus Anc_6.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320412.1"
                     /db_xref="GeneID:40382700"
                     /translation="MSFKFCAECNNMLYPKEDKVNRRLLYQCRNCSYSELADSPRVYR
                     HELITSIGETAGVTDDIGSDPKLPRSDRICPRCHNNECVFFQSQQRRKDTSMVLFYVC
                     LECKNVFKSDES"
     gene            complement(<378608..>380113)
                     /locus_tag="C5L36_0B02000"
                     /db_xref="GeneID:40382701"
     mRNA            complement(<378608..>380113)
                     /locus_tag="C5L36_0B02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464554.1"
                     /db_xref="GeneID:40382701"
     CDS             complement(378608..380113)
                     /locus_tag="C5L36_0B02000"
                     /inference="similar to AA sequence:RefSeq:NP_011444.1"
                     /note="PKUD0B02000; similar to Saccharomyces cerevisiae
                     YGL071W (AFT1) and YPL202C (AFT2); ancestral locus
                     Anc_6.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320413.1"
                     /db_xref="GeneID:40382701"
                     /translation="MTHSDSGLHKNPSMRCEASPSNFGSEFEDGMSHGVQSCDAPDRG
                     MYTTSYCPIKDTIMMHKSSSQASSQVPSQVPSQVPSQVPSQASSQASSQVPSQASSSC
                     CSTNSAPCSPTSPLILSSEGRENKVHCSNSMTKLKLENRHFTNKADIKPWLQRNLASM
                     GIHIVIERSDDTKIVFKCKYSDKKPLEKNNCKSHERAARQRKKKVCPFRIRANYSIRS
                     KHWTLVIVNDSHNHPISSLDVNIADIKSKLSIIDQKKSNHRVTKPKSLKHKDHLPVPR
                     AFAIDPSNALSSTSLTCKPYHNSLIPSILNENTHVKVKLPPISLPDNSLNNQVRQIED
                     TLKTFQQVGNIPNVSKEKILKDVWCVLNKSINEITDSNSGSFPLPLPLPLPHQKMGRV
                     SQRQSFQLFNTNNNIENNVINGNLENSNTSSRSSSNSINDINDINDINDINLASNNMY
                     LNNYAKSNTFTSPHFKVPRYQFSNASLGPLIKSAHDRNISLPSIRNLDSGA"
     gene            complement(<381578..>384475)
                     /locus_tag="C5L36_0B02010"
                     /db_xref="GeneID:40382702"
     mRNA            complement(<381578..>384475)
                     /locus_tag="C5L36_0B02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464555.1"
                     /db_xref="GeneID:40382702"
     CDS             complement(381578..384475)
                     /locus_tag="C5L36_0B02010"
                     /inference="similar to AA sequence:RefSeq:NP_010253.2"
                     /note="PKUD0B02010; similar to Saccharomyces cerevisiae
                     YDL031W (DBP10); ancestral locus Anc_3.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320414.1"
                     /db_xref="GeneID:40382702"
                     /translation="MSSSDEEEIDILSSLVPNVEDPSSDDSDDEVENGEIQDEILSSE
                     SESEDEEESSRNKKKQKQQEKQKKQLLTKLDFPSLELDDNNKDKAEHEEDMFFIQQEL
                     SNANKAKNGSFASFGLSKLVLSNISKKGYRQPTPIQRKTIPLLMQNRDVVGMARTGSG
                     KTAAFLLPLIEKLKTHSAKIGIRAIILSPSRELATQTHKEFKEFSRGSDLRSLLLIGG
                     DSLEDQFGAMVNNPDVVIATPGRFLHLKVEMRLDLSSIEYMIYDEADRLFEMGFAEQL
                     NELLASLPEKRQSMLFSATLPRNLVDFAKAGLINPVLVRLDAETKVSDQLEMCFFSTK
                     KNEREANLLSILQDVIKMPTATKEQLDKLNHANNTFNDSDSDSENENRKKNQPQRKKK
                     KIRFPKANELPSEYSTIIFVPTRHHVEYITNILKAANYAVSYIYGSLDQHARRQQLQN
                     FRLGLSSVMVVTDVAARGIDIPVLAYVINYTLPSSSKVFIHRVGRTARAGNKGWAYSI
                     IGEGELPYLLDLEIFLGRKILLTKMQEKKNEILRNKWIETRGTDEGYVEPKVPYTKRI
                     VLGSIPRIQVETMEDLYETILRHNYDIKNLKGVCDKAEKLYMRSRQPASQESVRRSKE
                     LISVGWDDQNVIFGQNLELEKDKFLAKLQNRIHKETVFEIGKKDDNLVELMNKRRKQI
                     APVQERMRERRALLEKERLLGLSHNLEDELMKEEDEKEGEVGFGVNEEELIKEFEDGD
                     EVLNMSKSKKKTYKDPNFFLSYYAPRNVIQDQQMSINEGSNSGGNFISEANKAAFDID
                     AEDEKLAISKQAPKVVWEKNKFVRKQDDRKFIISESGQRIPASFRSGKFDEWKEKHKV
                     GNIKVGALEKSQGGIGNKFNSNLNGSRIGGKFKHHNEKAPKMPKKGRDDYEKQMEKVK
                     KAVERGVPVKGFIGKGSGRQELRDSEHIRKQREVKQKRREKNARPSKRRRK"
     gene            complement(<385152..>387044)
                     /locus_tag="C5L36_0B02020"
                     /db_xref="GeneID:40382703"
     mRNA            complement(<385152..>387044)
                     /locus_tag="C5L36_0B02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464556.1"
                     /db_xref="GeneID:40382703"
     CDS             complement(385152..387044)
                     /locus_tag="C5L36_0B02020"
                     /inference="similar to AA sequence:RefSeq:NP_014518.1"
                     /note="PKUD0B02020; similar to Saccharomyces cerevisiae
                     YOL123W (HRP1); ancestral locus Anc_3.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320415.1"
                     /db_xref="GeneID:40382703"
                     /translation="MSNFEDDEALFDDVYAEDTKVSTNAPTVTEQQQQQEQPQEVQTR
                     KETQESSHTVQDSVAPPTISSSSKNEEVSANAEGVNSALVGNPSSNSEAQTSESGTDH
                     QPSQVDANTTHMQMQPMMQMPVMQPGQNPMEYYQQMQQYQAMQAAVTQGQNAQGSPAS
                     MQAMMIPPMMGQFPQYPQYPGQVMPGVPGVPGVPGVPGVPGVPGVPIPTNSPPVPEAQ
                     TNQTQQEHIPDATEIEAPKDITDKVKADMSNKDLGKLFIGGLNWETDEERLKQYFSQY
                     GEVLELNVMRDNNTGKSRGFAFLTFASSSSVDAVMKEKHILDGKLIDPKRAIPKDEQE
                     KVGKVFVGGIAADVTPEEFRSFFEKFGTIIDSQLMINKDTGKSRGYGFVTYDSQEAVD
                     RVTKYNYVMFRGKKMEIKKAEPRTQHLKNQGRSVDNTSYNQNNQYGSPMGGPMGFNAG
                     APGGFNNMQYWQQMQQMQQMQQYWMQMQQQQQQQQHQPQQHMSPTSQDAQLNMYSSNN
                     GNQGQGGDDDNVPNPQEHGSYNDGNDDYRDDYRDDRRGGYNRRDDRRGGRRYDDDDDE
                     FDGEDDRTNLPSGPKKLRERRGSGSGGSRYNDRRSGGGGSGGGGSRRRGGRSGRRNNN
                     YHPYRR"
     gene            <387709..>389040
                     /locus_tag="C5L36_0B02030"
                     /db_xref="GeneID:40382704"
     mRNA            <387709..>389040
                     /locus_tag="C5L36_0B02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464557.1"
                     /db_xref="GeneID:40382704"
     CDS             387709..389040
                     /locus_tag="C5L36_0B02030"
                     /inference="similar to AA sequence:RefSeq:NP_014517.1"
                     /note="PKUD0B02030; similar to Saccharomyces cerevisiae
                     YOL124C (TRM11); ancestral locus Anc_3.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320416.1"
                     /db_xref="GeneID:40382704"
                     /translation="MVKEYLIFLAQTHTSFRKAELESLADLHNIEVDLSEHNEENPFV
                     IVKLKNDEEAFKLIDRAILAKSIYELWGHGESFDQLHRDVKKKMDFLRGPYMDNTAFK
                     FENLTFQGGKKTREQQIRLYEQFAYLEFKGKIKMKNPDQVFTILEQYSLGTDLYPLEY
                     PDHVYFGRLVNVSARTRGAVEKYEIKKRPYFGTTSFDAELSLFTCNMGQVKKNQLVYD
                     PFVGTGSFLVAASEFGGITIGSEIEFLTLKGKGPKRRLKDNFDYYKKPLHFCDALCMD
                     FTNNAFRDDLMFGSIICDPPYGVREGVKVCGSSDDKVGREKIVIDGQLAYLRKDYIQP
                     KKAYSLDLLLDDLLDFSAKRLETGSRLCFWMPVANDEDIPTMIPQHENLELIYELVQD
                     FHKWSRRLLVYVKRDGNYKGKTLKSEHREGTNNFRDRYFHKFSRDSKLTQN"
     gene            complement(<389187..>390093)
                     /locus_tag="C5L36_0B02040"
                     /db_xref="GeneID:40382705"
     mRNA            complement(join(<389187..389607,390074..>390093))
                     /locus_tag="C5L36_0B02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464558.1"
                     /db_xref="GeneID:40382705"
     CDS             complement(join(389187..389607,390074..390093))
                     /locus_tag="C5L36_0B02040"
                     /inference="similar to AA sequence:RefSeq:NP_014097.1"
                     /note="PKUD0B02040; similar to Saccharomyces cerevisiae
                     YNL302C (RPS19B) and YOL121C (RPS19A); ancestral locus
                     Anc_3.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320417.1"
                     /db_xref="GeneID:40382705"
                     /translation="MPGVTVRDVSAHEFINAYAQFLQRQGKLEVPSYVELVKTSAGNE
                     LPPQDAEGWFYKRAASVARHIYLRKHVGIGKLNKVYGGSKNRGPRPGKHVDASGSVNR
                     RVVQALEKIGVLELAANGGRKISENGQRDLDRIAAQTLEAEDDE"
     gene            complement(<390735..>391651)
                     /locus_tag="C5L36_0B02050"
                     /db_xref="GeneID:40382706"
     mRNA            complement(join(<390735..391183,391540..>391651))
                     /locus_tag="C5L36_0B02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464559.1"
                     /db_xref="GeneID:40382706"
     CDS             complement(join(390735..391183,391540..391651))
                     /locus_tag="C5L36_0B02050"
                     /inference="similar to AA sequence:RefSeq:NP_014521.1"
                     /note="PKUD0B02050; similar to Saccharomyces cerevisiae
                     YOL120C (RPL18A) and YNL301C (RPL18B); ancestral locus
                     Anc_3.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320418.1"
                     /db_xref="GeneID:40382706"
                     /translation="MGRDHFKKPHEKSSHRSAPKSDNVYLASLARLYSFLARRTDAAF
                     NKVVLRQLFLSKINKPPVSVSRIARALKPEVNANKIVVVVGTVTDDVRLHSFPKATVA
                     ALKFTKSAKATILKNGGEAITLDELALRAPTGKNTLILRGPRNSREAVRHFGFGPHKG
                     KAPKVQSKGRKFERARGRRRSRGFKV"
     gene            <392010..>392621
                     /locus_tag="C5L36_0B02060"
                     /db_xref="GeneID:40382707"
     mRNA            <392010..>392621
                     /locus_tag="C5L36_0B02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464560.1"
                     /db_xref="GeneID:40382707"
     CDS             392010..392621
                     /locus_tag="C5L36_0B02060"
                     /inference="similar to AA sequence:RefSeq:NP_011592.3"
                     /note="PKUD0B02060; similar to Saccharomyces cerevisiae
                     YGR078C (PAC10); ancestral locus Anc_3.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320419.1"
                     /db_xref="GeneID:40382707"
                     /translation="MSSTITDRLKTGETNPRGIPEAKFIENIEDFINPRTCTDADVSN
                     FLNELQMRLEQYKFMEESKRSSLANLDTKIPDITNTLNMCEFLKQRSTEIGRDELDNE
                     QKTISVDYQLNDTIYATANIEPESCKSVSLWLGANVMLEYPIDEAIDMLSERLTSTKH
                     SKEITLEDLEFLRANITTMEVNLARVYNWDVQRRKSAAQSEDK"
     gene            complement(<392730..>393590)
                     /locus_tag="C5L36_0B02070"
                     /db_xref="GeneID:40382708"
     mRNA            complement(<392730..>393590)
                     /locus_tag="C5L36_0B02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464561.1"
                     /db_xref="GeneID:40382708"
     CDS             complement(392730..393590)
                     /locus_tag="C5L36_0B02070"
                     /inference="similar to AA sequence:RefSeq:NP_014568.1"
                     /note="PKUD0B02070; similar to Saccharomyces cerevisiae
                     YOL073C; ancestral locus Anc_3.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320420.1"
                     /db_xref="GeneID:40382708"
                     /translation="MSSILPKGFKLQPVMSSLTISIIGLPLFFSVMGWKPFFLFAWDP
                     FISKWNQFWRLLILQLQFQNQSEITLASVLILLRLKGLERLYGSLKMFKILVLLYSYN
                     LLIVTFLSFFLFFTFDFDIFIPSGPFGILFGLYYPFSRFIPETYVAEFDFTNATSLRI
                     FGDGAILPLSDAFPVHFLFGILSLTEGVSSLIVSSIGYFIGILYFQNLLPLTDTSLGF
                     LDPIYFKITHEKSFAREGRNNTTYNGVDSNHNASALDLDEENERSPSVEDNDTPVRSI
                     GQEVLHTFTR"
     gene            <393790..>395751
                     /locus_tag="C5L36_0B02080"
                     /db_xref="GeneID:40382709"
     mRNA            <393790..>395751
                     /locus_tag="C5L36_0B02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464562.1"
                     /db_xref="GeneID:40382709"
     CDS             393790..395751
                     /locus_tag="C5L36_0B02080"
                     /inference="similar to AA sequence:RefSeq:NP_011591.1"
                     /note="PKUD0B02080; similar to Saccharomyces cerevisiae
                     YGR077C (PEX8); ancestral locus Anc_3.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320421.1"
                     /db_xref="GeneID:40382709"
                     /translation="MSSLDKKFGNQGRHLLQLEYDTINRKREFPIPTELDYLFHDIEH
                     CNSFETPPDKIISYLVNYYPKLKNKENVELLTKVFLKCPVFFQSFHSVTLNNSSKIVN
                     AFHFILYEKFKITNPTVSFIDFQSSIYTAMLATLQDDPTSYWKILPVLAGCISSVKSM
                     NMYNSTPEYNNVIKKLNHLFCHMFSDLYIHLNITPLPLEISYSYLIILCAAQENMSDA
                     FYRKLLNTNPTLLSVVTSLIFYSTEGLKEGSVLFSPNTYNSLVQKSPVIRNMNRLVFL
                     YGRLCRGMPQTTNSLYQIYMSLGCIVSFCLNISNEELENLLHDTKWDLAKYTFFSIVI
                     VFEHSTAAIISGKHGINKWSSDIATQVLFCFFQLSFILDQIGTGGFDSYNFAFSSATS
                     FLNENDHEAANSLAQSMLNNLPSTKTQLSGNGTSKLNFFLRTVEVLLPSLKESFKKMV
                     LFPLIDRVMFNGAPSSIEFCHSIMIKRLGMSSAEEISKLQDIIYPYFGQVLIQFPKVL
                     SLSQTTLIVETCGGVLPPGTSHFKAVLFDLVKFQISMSGYSPLPARSVQQNGKTITIP
                     EKLHTRKSGLVSFLIIMLRFVEVDELILRLNEVKKEIDMLVGERDIYKLYDILWETIL
                     VINKFDTQVGQMAISWWYETVNSGQVPKL"
     gene            complement(<395802..>398984)
                     /locus_tag="C5L36_0B02090"
                     /db_xref="GeneID:40382710"
     mRNA            complement(<395802..>398984)
                     /locus_tag="C5L36_0B02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464563.1"
                     /db_xref="GeneID:40382710"
     CDS             complement(395802..398984)
                     /locus_tag="C5L36_0B02090"
                     /inference="similar to AA sequence:RefSeq:NP_011314.2"
                     /note="PKUD0B02090; similar to Saccharomyces cerevisiae
                     YGL201C (MCM6); ancestral locus Anc_3.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320422.1"
                     /db_xref="GeneID:40382710"
                     /translation="MSQSGSVIKFILSSSFEVRNRKSRTPNFLAMRECMPKVQQNIRA
                     EHFHNCIFFGGTRRSEAQVLYSSMSNVNSSPLLSYGRPRENPLSSQLSDFNLDETSQH
                     QNTQSSFLGGNLTSSGLPHSTTGRDGNENPNLGHGAPEASETAQRIRVNRGVANVTKV
                     TDKISETVLESFEEFLESFKIPQDDPSYDENFDGKLYIGKIAKMVNDESTLLEVDFKH
                     LVSYQDGILADAILEQFYRFLPALQAALRKVVAQHQPEYLRRSTTITATEDASKSVER
                     DFQLSFFNLSTVHRIRELKAENIGMLMAISGTVTRTSEIRPELYKAAFTCDVCKALIT
                     NVEQTFKFTEPTSCINNTCVNQSEWTLNIAKSHFLDWQKVRIQENSNEIPNGSMPRTL
                     DIILRGELVDKAKPGDKCKFTGTEIVLPDITQYQLPGIKAATIRTRGSSAASDPLTSG
                     INMRSLGARDLTYKIAFLGCHVSSMSGKDLDEGEDDSSSSLEVFLSNLTSSEVDELRD
                     MVSDRNVYSKLVQSICPTVYGHEVVKKGVLLQLLGGVHKRTIEGINLRGDINVCIVGD
                     PSCAKSQFLKWVNGFSPRSVYTSGKASSAAGLTASVVKDEESGEFTIEAGALMLADNG
                     ICCIDEFDKMDIADQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYNTK
                     VGLRSNLSMTGPILSRFDLFFVILDECNEAVDTQLATHIVNLHLFRDDALHPPYSKEQ
                     VLRYIRYARNIKPRLTREARAYLIQRYKELRADDGKDGRASYRITVRQLESLIRLSEA
                     IARANCKDDVVPAFVAEAYDLLKQSIIRVEKEDLEIDDNDYDDNDYDDNTDAVGDRGN
                     NNHEDHGSDHGMQEDGDEDMRSAQDLQSQHASASTQKEKTHIPYQVFVNLRNLFLQRI
                     KERENEIDRTDADDGDEENIATTGYTQKELLDWYMNAIEDQLDSVQEYYKELKIAKKV
                     LNKLVKDNVLMRVNPDPTDFTQDQMPPDLIITPDMNEAEREATIAEQNNWRRRKNKEL
                     NKKLIYIIHPNCSLEDLLGEFEQEDEVQED"
     gene            complement(<399153..>400310)
                     /locus_tag="C5L36_0B02100"
                     /db_xref="GeneID:40382711"
     mRNA            complement(<399153..>400310)
                     /locus_tag="C5L36_0B02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464564.1"
                     /db_xref="GeneID:40382711"
     CDS             complement(399153..400310)
                     /locus_tag="C5L36_0B02100"
                     /note="PKUD0B02100; Pfam Domains: AA_permease(3.8e-105)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320423.1"
                     /db_xref="GeneID:40382711"
                     /translation="MVLINFSNVKYFGEIEFWIGLLKIFAIIGLIIVGIVIFFGGAPA
                     SHGVLGFHYWKTPGAFVEHLTDGNTGKFLAVWTSIIKSAFAFILSPELITACASEAEH
                     PRVNLPKATNRFIYRMIVFYVLGSLTIGVIVASNDPRLLGALSQGSSTAAASPFVIGI
                     QNAGIPVLNHIINAAILSSAYSCGNSQFFSATRTLHSMAIRGEVPRLFGRTNRWGVPY
                     YAVTLTALISLVSYLNVSNSSSVVFTWLTNISTVSGFISWIFIGIIYLRFRKAIDYHN
                     LNDRVTFRPKFQIPGAYFTIFFFTLISITNGYGVFFNFNGSDFVAAYITLPIVFILYV
                     GHMLWYRNWKLFTPSRQIDCFTGLEEVEKDEANYIEPVPKNWIMKVYYWLC"
     gene            <403906..>405048
                     /locus_tag="C5L36_0B02110"
                     /db_xref="GeneID:40382712"
     mRNA            <403906..>405048
                     /locus_tag="C5L36_0B02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464565.1"
                     /db_xref="GeneID:40382712"
     CDS             403906..405048
                     /locus_tag="C5L36_0B02110"
                     /inference="similar to AA sequence:RefSeq:NP_009341.2"
                     /note="PKUD0B02110; similar to Saccharomyces cerevisiae
                     YAL060W (BDH1); ancestral locus Anc_7.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320424.1"
                     /db_xref="GeneID:40382712"
                     /translation="MKGLLYYGREEIRYSEDIPEPQIKNPNDVKVKIAYCGICGTDLH
                     EFLDGPIFFPQPNGRSEISGKKLPLCPGHEFSGVIEEVGTGVTKFQRGDRVVVEATSH
                     CSDRERYKDEIEDKDLSFCAACKAEKPNCCKRLSFVGLGTDHGAFGQYVVYGEDHILK
                     IPDDLPLDLAALVEPLSVAWHAVSLANFKPGQTAVVLGGGPIGLCTILALKGHQAGKI
                     VCSEPAAIRRELAEKLGAETFNPMDHEDPIAELKNLLPETEGFTASFDCSGIQKTFDT
                     SIDVLGPGGSAVNVAIWPNVPIQYVPMCLTYQEKTATGSMCYVTKDFREVLDAIAAGL
                     IDQKSMRLLVTGKVEAKDGIEGGFMQLINHKETNVKILIAPNGLDM"
     gene            <405433..>406518
                     /locus_tag="C5L36_0B02120"
                     /db_xref="GeneID:40382713"
     mRNA            <405433..>406518
                     /locus_tag="C5L36_0B02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464566.1"
                     /db_xref="GeneID:40382713"
     CDS             405433..406518
                     /locus_tag="C5L36_0B02120"
                     /inference="similar to AA sequence:RefSeq:NP_009901.1"
                     /note="PKUD0B02120; similar to Saccharomyces cerevisiae
                     YCL029C (BIK1); ancestral locus Anc_1.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320425.1"
                     /db_xref="GeneID:40382713"
                     /translation="MARMQASTPVLPPIGSVISLPNSSDIAILKYVGSVDNHDGVFCG
                     LELCGALASSGKNDGIINGIEYFQVSVPKSGLFVPLRKILGWLSHTHTQPQPQPQSLP
                     QSQPLLQPQLLPQPNSVSIESTSSGSVAATKEIEELKRHIISLEKQLLLRENDLKELD
                     IQLDELDATLRSNDARLARKEERFNRYKVEKEEEISMLLTTIESLEKKIVELEERLSV
                     QPQVPDNSELVKRIEQLEKELKLEKDNFSSFKAQKSNEINELRKFEMKNYTLELEIEK
                     LREHQHNEDTDSLVNDLRKQIEERDERLKELEGLKTIKSSGELPIYKPQTEVDPSAGR
                     EDFCNYCDTSGHTTGDCPYEKDNLEIF"
     gene            complement(<406639..>407094)
                     /locus_tag="C5L36_0B02130"
                     /db_xref="GeneID:40382714"
     mRNA            complement(<406639..>407094)
                     /locus_tag="C5L36_0B02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464567.1"
                     /db_xref="GeneID:40382714"
     CDS             complement(406639..407094)
                     /locus_tag="C5L36_0B02130"
                     /inference="similar to AA sequence:RefSeq:NP_015425.1"
                     /note="PKUD0B02130; similar to Saccharomyces cerevisiae
                     YPR100W (MRPL51); ancestral locus Anc_3.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320426.1"
                     /db_xref="GeneID:40382714"
                     /translation="MVGIKVLQQVSRSRNGVGAFVLPCKRITLQYCNFGGSSEGMRDF
                     LRQRLPKFAARHPEIEFRVVEKPGKHPIVKGEYSTPNANVNNYENDTFKQICVRKWNI
                     DVIENKLKLLVNSSGKKLSKPKHTVVSSNPSVRGIWSPFYVDPKHRFRV"
     gene            <407436..>407966
                     /locus_tag="C5L36_0B02140"
                     /db_xref="GeneID:40382715"
     mRNA            <407436..>407966
                     /locus_tag="C5L36_0B02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464568.1"
                     /db_xref="GeneID:40382715"
     CDS             407436..407966
                     /locus_tag="C5L36_0B02140"
                     /note="PKUD0B02140; Pfam Domains: DUF498(8.7e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320427.1"
                     /db_xref="GeneID:40382715"
                     /translation="MHRRFFSTSSRVNRHYSSTFKASNLGQNLAKYDIYALAEKPENN
                     VEMISDDSIVFSNLKVIRSPNKQQEPIGALLLNNQIFEINLKDTEFHHNNVVVELTPK
                     LFDILSLAYPKPELIIAGLGKRTRMLGPKTRESLNKLGIRVETSDTKSSALSYDLLAT
                     ERSPALVASIMLPPNL"
     gene            complement(<408022..>408510)
                     /locus_tag="C5L36_0B02150"
                     /db_xref="GeneID:40382716"
     mRNA            complement(<408022..>408510)
                     /locus_tag="C5L36_0B02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464569.1"
                     /db_xref="GeneID:40382716"
     CDS             complement(408022..408510)
                     /locus_tag="C5L36_0B02150"
                     /inference="similar to AA sequence:RefSeq:NP_015423.2"
                     /note="PKUD0B02150; similar to Saccharomyces cerevisiae
                     YPR098C; ancestral locus Anc_3.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320428.1"
                     /db_xref="GeneID:40382716"
                     /translation="MSYLLPIHLMTYGYTFGSTTFHSFVASFKAIETLPRREFGEFQG
                     KVLPIQFVTQSVAPIIIGLTAPYTISTLGLGLLGVSALGGIANIAYLTPKCAHFKTKR
                     WEIVDTKYNGDNEAAVKSGEVSALDKQFGKFHGMSMGANLLSIVALTAYGFILSGHLK
                     VI"
     gene            complement(<408825..>411338)
                     /locus_tag="C5L36_0B02160"
                     /db_xref="GeneID:40382717"
     mRNA            complement(<408825..>411338)
                     /locus_tag="C5L36_0B02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464570.1"
                     /db_xref="GeneID:40382717"
     CDS             complement(408825..411338)
                     /locus_tag="C5L36_0B02160"
                     /inference="similar to AA sequence:RefSeq:NP_009900.2"
                     /note="PKUD0B02160; similar to Saccharomyces cerevisiae
                     YCL030C (HIS4); ancestral locus Anc_1.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320429.1"
                     /db_xref="GeneID:40382717"
                     /translation="MVFPVLPLYESTGKPLLSVVGQALYRFNGSNTDAIVQISKYTPN
                     LNVFVELAVNEISDAIVEQLLSLYNNGVCSVLATPEQGSVILEKIPNARITYKASENK
                     QYQSIAYVLGSSLPQTIDEKITAFVYVEDTLSLEELQKLVKSGYIPIIKSDLLTNEYE
                     DVKGQYPLVDFIIPKIVTDRADGLYTTLVVDSSNQSLGLVYSSVTSISESIRTGTGVY
                     QSRKHGLWYKGKTSGATQKLISFDLDCDSDCLKAIVEQSGSGFCHLSTNSCFGNFTGL
                     KALEATLFQRKTDAPEGSYTKRLFDDESLLNAKIKEEAEELADAKTKEEIAWEAADLF
                     YFALARCAKYNVTLADIEKNLDMKALKVSRRKGDAKPKFIEKKQSTEKSEINERHIGP
                     DDKIYLNRINAATASKEEVEACLERPIQKSADIMSLVTPIVENVKANGDKALLELTAK
                     FDRVQLDSPVLFAPYKPDMMQISEKLKKAIDVSFENIRIFHEAQNQKDILTVETSPGV
                     YCSRFARPIEKVGCYIPGGTAVLPSTSLMLSVPALVAGCKEIIFASPPGKDGKLTPEV
                     VYVAHKVGAKCIVMAGGAQAVAAMAYGTESVPKCDKIMGPGNQFVTAAKMLVSNDSNA
                     LCAIDMPAGPSEVLVIADKHADPDFVASDLLSQAEHGIDSQVILLAVDMTDAEVDSID
                     EAVHRQALALPRVDIVRKCIAHSTTIVVKTLDEAFEMSNKYAPEHLILQIENAEEWVP
                     KVDNAGSVFVGALSPESCGDYSSGTNHTLPTYGYARMYSGVNTATFQKFITSQVVTRE
                     GLKNIGPAVMDLAEVEGLDGHRNAVRVRMDKLGMLPEGY"
     gene            complement(<411601..>414189)
                     /locus_tag="C5L36_0B02170"
                     /db_xref="GeneID:40382718"
     mRNA            complement(<411601..>414189)
                     /locus_tag="C5L36_0B02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464571.1"
                     /db_xref="GeneID:40382718"
     CDS             complement(411601..414189)
                     /locus_tag="C5L36_0B02170"
                     /note="PKUD0B02170; Pfam Domains:
                     SNF2_N(2.2e-93)|Helicase_C(1.2e-15)|zf-C3HC4(9.7e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320430.1"
                     /db_xref="GeneID:40382718"
                     /translation="MGGSESDTEVQGGFLVSKGAKEISRERKRTRSGTRQLRHMNNQT
                     PSSSSTRNTRSRIRRSGLAVEEESYGEDQGEKEEEEEEEEEEEDDDGDEDYVEDDVVI
                     TGFNEKGEKGDPVELSDDSNDDVIITEGRDFKSDFREISELQDEINELQKESNGNSNN
                     EELVDGGLIKESNGSTKKKSSRKKPTKSPRKKKEPKPKLTPFERRTNRLYEAHPELRD
                     IFPSLEEQGPKKVILADQPPDLAVTLLNFQREGLSWMVRQEDESPYNGGILADEMGMG
                     KTIQMIALMMHDRSKGPNLVVAPTVALIQWKTEIETHTNNALKVAIFHGANRATSLEE
                     LEDIDVVLTSYAVVESSYRKEKYGFTKKHKKVREKSILHLKKFYRVILDEAHNIKDRT
                     SSTAKACDVLNCEKRWCLSGTPLQNRIGELYSLIRFLDIAPFCQYFCTKCPCKSKEWN
                     FPDYKVCAQCGHAPMVHSNFFNHFMLKNIQKYGLQFEGEESFHRIQLLLRQIMIRRTK
                     VERADDLGLPPKLVEIRRDYFNPEEKDLYQSLYTDSKRQFDDYVAEGVVLNNYANIFT
                     LITRMRQLADHPDLVLKRMKLPSSANGGNEGVVELPPGVIVCQICDDEAEEPIESKCH
                     HKFCRICVSEYVESFNGDTSKLKCPVCHIGLSIDLEAPAIEMDLDAVDKTSIVNRIDM
                     AGNWKSSTKVEALMEELYKSRSDRVTTKSIVFSQFTSMLDLVEWRLKRAGFSTVKLQG
                     SMTPSQRQSSIKYFLETPSVEVFLVSLKAGGVALNLVEANQVFILDSWWNPSLDTGQA
                     ADRIHRIGQHRPIRIVKLVIEDSIESRIIELQEKKANMVKATLDHDERAANKLSAEDM
                     QFLFNN"
     gene            complement(<414633..>418151)
                     /locus_tag="C5L36_0B02180"
                     /db_xref="GeneID:40382719"
     mRNA            complement(<414633..>418151)
                     /locus_tag="C5L36_0B02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464572.1"
                     /db_xref="GeneID:40382719"
     CDS             complement(414633..418151)
                     /locus_tag="C5L36_0B02180"
                     /inference="similar to AA sequence:RefSeq:NP_014591.1"
                     /note="PKUD0B02180; similar to Saccharomyces cerevisiae
                     YOL051W (GAL11); ancestral locus Anc_7.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320431.1"
                     /db_xref="GeneID:40382719"
                     /translation="MDGANQGFQPNQQQQQQQQQQQQQQQQQFRMQISQNDRIQFIKV
                     LITSLQKIQGPSFNIQKIKPVADEFEKYAFANSSSKGQYVEFLKNKITSLTQAKRNQS
                     QQVSQQMMQAQQAQQAQGQPQRMPQIQQPLQQPMQNPQQKFTMLQQQQQQQQQQQQQQ
                     QQQQAQAPSQQLDSKSISFQNIPIPRELLMKLPKVFPTHLNTWHQIMPYLRNNQLSQN
                     DLEIIRKVHMAHLNYFKQNFANQSQTPQQLQLQQKHQQQQQQQQQPQQLQPQPQSQPQ
                     SKSNVALNPQQILMMKQQSHQQQQQQQAAMAQAEAARNAQAAAQAHAQMKAQAQAQAA
                     AQAQIQAQMQAQLQAQNIQNQNKMNPNMQASQQQMSKMKQAQINAYKAQAVQVIRKLQ
                     SAGKLPVTLTPEQEANYVKKYLLHILQNSNKEQQKQAHQNLQQQQQQQQQQTQQQTHQ
                     NNQSNQQLQHPQISPNMGFNQTMDNMSPMNRRNVSMGMNSGNVDMTKMSSPVVPMSNL
                     NTSVLNNNQQMNNFSSPTIPNPQMIMNNQIANQQQPQLSQSVDSQFSLQQTAQQSSTK
                     RTGGIVNQQLPTNQNNFGNTINNQIGKPTSASSIGAKLLPGLKATPEDWESLKKIYME
                     TIQSPIVLKDVTNQLLDDEKARIIGLAKQSKQLMILCQTMIIPNFYFITKQRVPTEKI
                     IYNELMLRQFLEKLTSSRVFVANEELLIKIHDHIKKYLQFVRDQSNKIIKAQVLEQQS
                     RVNKLQQQQQLQQQYADNMNGPPKGTFNQMPANLTPTMMQVNMQQQMIKGNQESVVTG
                     QPIGFTPQQIPSSTVPTPTAGPNPSLKAASPPKQAKKPRKKATPKSTVSGNGKTSASN
                     TPNSTTPGSKPATENTSATNLQMKSSLSNKSQDSSASMTNEIQNILKTNNELIEKEEL
                     RLKNIDIARARRRALVPVPTTNAKSTPASASSPAKSAATATHSSITGAAAYFLATLND
                     TLGLESEEKAIVTNATSKSTLPKSKSSSLRDHPKVLTPSAVLATPVGLNVKTPVNKST
                     ITDEENKVTQWKGKISANLISNAFRPVIHINTSISPKMLQSGKFFTKSTPSMSGGKNL
                     SFLEVVKEKTANKRALELIIPTTEGSNWTGNSSNIWSFGNNENNRKDVSKIYPTPPED
                     ANEAKRRKLNNSSSVDCDIFWDFDRV"
     gene            complement(<418551..>419246)
                     /locus_tag="C5L36_0B02190"
                     /db_xref="GeneID:40382720"
     mRNA            complement(<418551..>419246)
                     /locus_tag="C5L36_0B02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464573.1"
                     /db_xref="GeneID:40382720"
     CDS             complement(418551..419246)
                     /locus_tag="C5L36_0B02190"
                     /inference="similar to AA sequence:RefSeq:NP_011683.3"
                     /note="PKUD0B02190; similar to Saccharomyces cerevisiae
                     YGR167W (CLC1); ancestral locus Anc_5.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320432.1"
                     /db_xref="GeneID:40382720"
                     /translation="MADKFPEIDVVAPEGDDISNSDFLSREKEALGDEFATPQDHEVN
                     TGDDQDDEFEDFKSQFPDVDSQEATIAAAPQGEDTMDDAHGEAEPQGEDVVTPVVNRF
                     ENLDLNESEHIKEWKKTRDLEISKRDEIAARKLEEIKKEAEKAIDDFYENYNNKKDDA
                     IAETKKEEKAFLEKREKFLEKGTTWDRVVELLKLTKNSDAIDAENYRDKTRFRDLLLA
                     LKGKENVPGASGV"
     gene            <419501..>420886
                     /locus_tag="C5L36_0B02200"
                     /db_xref="GeneID:40382721"
     mRNA            <419501..>420886
                     /locus_tag="C5L36_0B02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464574.1"
                     /db_xref="GeneID:40382721"
     CDS             419501..420886
                     /locus_tag="C5L36_0B02200"
                     /inference="similar to AA sequence:RefSeq:NP_010575.1"
                     /note="PKUD0B02200; similar to Saccharomyces cerevisiae
                     YDR289C (RTT103); ancestral locus Anc_5.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320433.1"
                     /db_xref="GeneID:40382721"
                     /translation="MSFSEEKAIAKLAVLDNTQQAIQSTSQWCLFHYRHCAEIVKLWM
                     SAFNSPPESVTQSLPNYRLSLFYLCNDLVQFSKKKEVKYKCFLDEFEKVIPHFLSIIS
                     SDPTSIHLKDKYVRVLNVWRDRSVYNTSQIVRWLAILNKKNNSHTNHLHNNSTNNNIS
                     NNSNLSGTNIEPIGNSIPSIVQSPYKIPDELSPVVNKYNRLNSLLKDYKANYNEFNKI
                     SDNILNDNEQTSNQLNTLLNSLSTLQNNAVTEQSDQNMKRFEKSEKLSLTLSEQSKEI
                     KETRLDIMKDLRRLADELNDWILLDQEKQVKIDEKLQQLEAKKNSIVEETEKVSVFNY
                     SDNNDEENIPTYDNDNEDSDSDKAPNSDSEESEDEDQEEDNLKHGNSDNDEQKTDTKE
                     ENVPVSSLRKRLLGDDQDSKGDVPKKMKKSVSFANENETHVFNEEETIQEEDSTSKGD
                     ADLQALLGKLV"
     gene            <421030..>422757
                     /locus_tag="C5L36_0B02210"
                     /db_xref="GeneID:40382722"
     mRNA            <421030..>422757
                     /locus_tag="C5L36_0B02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464575.1"
                     /db_xref="GeneID:40382722"
     CDS             421030..422757
                     /locus_tag="C5L36_0B02210"
                     /inference="similar to AA sequence:RefSeq:NP_014323.1"
                     /note="PKUD0B02210; similar to Saccharomyces cerevisiae
                     YNL076W (MKS1); ancestral locus Anc_2.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320434.1"
                     /db_xref="GeneID:40382722"
                     /translation="MHKKLVDINTINTIPIVQGDPLQIRLLLRMMDDRYRQQFLEISQ
                     STISYIQKTTTRSKNEDSLVEFDNVLTFWTTLAKSSDVIQHGKRLENLSWRLINRRIL
                     KQDELRSRDLNIVVDISKGTECRELQDSGNRRKMQKTLQNYSVQRLPFKKDQQQQKQV
                     QEHTGQINKRPQEFRKTKFFYDHSLSSPDSDTSVPQNSIDAITELKNGKVSTQNAGQQ
                     LGQVPSLFNPHMMVGRKKLNHSQLQMTSQRSHQNLQHYQQQQNQQLQQDHYKHHHHHQ
                     SYQNQQKQQSLQKQQNQQSHPNHHAHPAENTLKHEKFVESAQTSEQPSLFQKPEKETS
                     KIVYSSSSEFDQDSDSDWSSLSDAEEEEEEDKKPSLNFEKKAVVDDEIKRPQLKRSLL
                     SGMFLDEMGKSGNDKQTSSVKGKRYDSSHRSNAPPTASTLLPTALSTHMFLPTTNFQS
                     YQSTQRGNNPTSRRIRDAKTMGKLTSDNVSKMNRTDDFDSNNNNGRAYASSIHTQTSS
                     IDIPGIEDKIERDKRRLERKLEAGNDGAELPLHLVDSIQNENKLYETPEFIVDDGLGV
                     VEKQYGEEW"
     gene            complement(<422902..>423723)
                     /locus_tag="C5L36_0B02220"
                     /db_xref="GeneID:40382723"
     mRNA            complement(<422902..>423723)
                     /locus_tag="C5L36_0B02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464576.1"
                     /db_xref="GeneID:40382723"
     CDS             complement(422902..423723)
                     /locus_tag="C5L36_0B02220"
                     /inference="similar to AA sequence:RefSeq:NP_014115.1"
                     /note="PKUD0B02220; similar to Saccharomyces cerevisiae
                     YNL284C (MRPL10); ancestral locus Anc_3.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320435.1"
                     /db_xref="GeneID:40382723"
                     /translation="MLSRLATLHPTSPSFARPVSLLARLTPTQDSKNRVKRVGRGPGS
                     GLGKTSGRGQKGQKARSSVPDWFEGGQTPLWKLFPKRGFYRHQKLILNEVKLSTIQKF
                     YEQGKLENVKLLDMKTMKDLGMVTGSMNDGVAILKDTENYTCPIPVETTKATGPAIKV
                     IESAGATFTSVYYSRGVGFRAHHSPDWFLENKGYLPLRARPIARRDIQYYSNPEKRGY
                     LTGSDYIKNIHVGGKRIEKKVKKTPLDLEVESASKDNSNGSFVRSAIVSFADLKL"
     gene            complement(<424022..>425047)
                     /locus_tag="C5L36_0B02230"
                     /db_xref="GeneID:40382724"
     mRNA            complement(<424022..>425047)
                     /locus_tag="C5L36_0B02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464577.1"
                     /db_xref="GeneID:40382724"
     CDS             complement(424022..425047)
                     /locus_tag="C5L36_0B02230"
                     /inference="similar to AA sequence:RefSeq:NP_009598.1"
                     /note="PKUD0B02230; similar to Saccharomyces cerevisiae
                     YBR042C (CST26) and YDR018C (YDR018C); ancestral locus
                     Anc_3.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320436.1"
                     /db_xref="GeneID:40382724"
                     /translation="MPIISWRLLYWPIRQLLFGIVFFSGCVTIVSIQWLILTINGRHT
                     QEWLDDSKRWFIQLLTFCTCWFTSGTTLRLVFKDREAMARYYNAGQLQLPRRAIVIAN
                     HQMYTDWLYIWYLAYRNVGDMGAHIYIIMKESLKKLPILGYGMINYSFVFLARNWQRD
                     AEKMACQFNETSKRDSFWMLIFPEGTNMSHNNREKSHQWARKTNKPIWNGVLLPRVKG
                     LQLAVKEMGNQVITLTMGYKGCSLDRMAQDVFNVVQLYIWGNQPPLVSILIDVQTIDR
                     EVEPWIESHWQEKENEMLHYYSNGDFDGVYVDVPLVVGDKLVHILLLGALLSSLVAIY
                     YKYLVNV"
     gene            complement(<425259..>426128)
                     /locus_tag="C5L36_0B02240"
                     /db_xref="GeneID:40382725"
     mRNA            complement(<425259..>426128)
                     /locus_tag="C5L36_0B02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464578.1"
                     /db_xref="GeneID:40382725"
     CDS             complement(425259..426128)
                     /locus_tag="C5L36_0B02240"
                     /inference="similar to AA sequence:RefSeq:NP_014083.2"
                     /note="PKUD0B02240; similar to Saccharomyces cerevisiae
                     YNL316C (PHA2); ancestral locus Anc_3.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320437.1"
                     /db_xref="GeneID:40382725"
                     /translation="MRVGYLGPAGTYSYQAAVQHFPNANGEVEYLPQKSIGACFQSMN
                     DGSVDYAIVPFENSTNGQVIFTFDLIVDWFVGGKANFQVVGEEYVAIHHALVGYAASI
                     NGIKEVHSHPQVWGQCRNILAKLESPIQVDESSTAAAVLAVSKLRSLSVAALAPLSAA
                     HVHNVPIIQSPVEDDPSNTTRFLVLGRQHYSADRKIADRKIADKGMLLLAPHGDPSAP
                     AGVARAMAELAARGVGVAGVTSRPLGNGVGNGVGKVFVVDCFDEEARGEEFAGRIAEA
                     AQQIGIAIVAGVY"
     gene            complement(<426824..>427783)
                     /locus_tag="C5L36_0B02250"
                     /db_xref="GeneID:40382726"
     mRNA            complement(<426824..>427783)
                     /locus_tag="C5L36_0B02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464579.1"
                     /db_xref="GeneID:40382726"
     CDS             complement(426824..427783)
                     /locus_tag="C5L36_0B02250"
                     /inference="similar to AA sequence:RefSeq:NP_014084.1"
                     /note="PKUD0B02250; similar to Saccharomyces cerevisiae
                     YNL315C (ATP11); ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320438.1"
                     /db_xref="GeneID:40382726"
                     /translation="MIGVKSVSVFTSIRFLGRHSIRTASVTNVRFLQSKTVIDRQIKD
                     KYRAKLEAIARQKGIESPDELIEEMKDTIEERKKELNMIDPLKELEDYEAALAIKEAQ
                     QGKKMLDPISKDAPKGKFKTLEDYLILEKVRELGEKEIEFLWRAKFAKDERSVVGVAP
                     TESYFKMYLNARKFPTFVLPLPREDAQVEGNKEDGKTPMELHFVQWSFVGPNTTHCMI
                     TTLMEYKLHGEYARPHTTISFHQELSAEKGLVLMNGHVDENAALTMSDAQLLLLNVQR
                     FYGAFGTGSDVEKARLELVRQFNAGETDFDIEAVVKLSQTMEH"
     gene            <428430..>429311
                     /locus_tag="C5L36_0B02260"
                     /db_xref="GeneID:40382727"
     mRNA            <428430..>429311
                     /locus_tag="C5L36_0B02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464580.1"
                     /db_xref="GeneID:40382727"
     CDS             428430..429311
                     /locus_tag="C5L36_0B02260"
                     /note="PKUD0B02260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320439.1"
                     /db_xref="GeneID:40382727"
                     /translation="MAVTGSYIVNSKTVSSSRLLSSSKAVSYKDRAVEIPNSASNPFL
                     QSSRFKQGTLYVIIFPIIFAFILIYILGAIIQKYRANKQARKIEPFDKDYEGIDDIYS
                     VDDYNNDNELDPFNDRNEINPDFISQYRRSMDHLKGNLGKHTRNSSVGTILKIDLNSQ
                     PNLQPTHYQERSTQPPVYSIESNDQSYVSLPQGTADSASYFLAAEPSKQHPPPTSRSH
                     LHSRSLSTQALDDFLSTGELPVPNTSYDIPVSRHSRSRSTSPQRSPQPRRTTVYTQQT
                     SRNNSPSRSPVRSLRGV"
     gene            complement(<429430..>430074)
                     /locus_tag="C5L36_0B02270"
                     /db_xref="GeneID:40382728"
     mRNA            complement(<429430..>430074)
                     /locus_tag="C5L36_0B02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464581.1"
                     /db_xref="GeneID:40382728"
     CDS             complement(429430..430074)
                     /locus_tag="C5L36_0B02270"
                     /inference="similar to AA sequence:RefSeq:NP_012148.1"
                     /note="PKUD0B02270; similar to Saccharomyces cerevisiae
                     YIL118W (RHO3); ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320440.1"
                     /db_xref="GeneID:40382728"
                     /translation="MGTVQRKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIH
                     DIFIDGQQVQLSLWDTAGQEEFDKLRSLSYSDTHCIILCFSIDSHDSLDNVKNKWVGE
                     ILEHCEGVKLILVALKADLRQSNDHTDEDLNLGTSAYNNDGKLKRLVSYEEGVAVAKE
                     IGALRYLECSAMKNRGVKEVFTEAARIALTSTPSAVTNIGVSNEGSSSSSCAIM"
     gene            <430392..>431219
                     /locus_tag="C5L36_0B02275"
                     /db_xref="GeneID:40382729"
     mRNA            <430392..>431219
                     /locus_tag="C5L36_0B02275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464582.1"
                     /db_xref="GeneID:40382729"
     CDS             430392..431219
                     /locus_tag="C5L36_0B02275"
                     /note="PKUD0B02275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320441.1"
                     /db_xref="GeneID:40382729"
                     /translation="MAKGERRTARGGKSGKNLVGLQNNPLFRALNGKSTKGSNVSTNK
                     EIPAKLTDNPLLKRLDMYNKNLGKDNRNKNQVSKRLANNRLAMALNIVPTLGANNSIG
                     LKPPKFSKSNKKATISKSNRKSSIPKGPSGSGINVMDDNKPTTNRDVTFKNASLIPFM
                     RLQNLTPDASESDIRMVLSKILGPTLKIMKMGATYNGKPSVTAEVFFIHEEKLEEYVQ
                     RMDKIQADGRILRAHISYKSWIINSDRLWDSVLKEVAMLKQQQIKRQVLENDGLVLP"
     gene            complement(<431310..>432590)
                     /locus_tag="C5L36_0B02277"
                     /db_xref="GeneID:40382730"
     mRNA            complement(<431310..>432590)
                     /locus_tag="C5L36_0B02277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464583.1"
                     /db_xref="GeneID:40382730"
     CDS             complement(431310..432590)
                     /locus_tag="C5L36_0B02277"
                     /note="PKUD0B02277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320442.1"
                     /db_xref="GeneID:40382730"
                     /translation="MYRRLGSHPSSVDSASGISGLLKSSVSVILLNIKQLKLILLTAL
                     IAFGIFSFTLPGSSISAKLDALNHHPLYYAATSNNSTDPMYIRESPPKMNKKSFKSIH
                     NRLKFFFPYDGEQEVENNIWQLWKYRADNPNFPEECFKHMERWRLVNSEYNHNVITID
                     EAEQQVFNIFSYEMTEVIEAYNILPDIRLKFEFLKYLLIYTSGGVYADIDTLDATPVK
                     FWHHSSLKPNRVMVGVDVDYNDVNWDILYNRRLSFSTKIFQAKSHHPFFTKLIARIVY
                     TILNHKEDILSIDWNEAFKNVDSNNEPLTQLLSESIFTDTLFEYLNGLDNPIVHRVAR
                     TEKDLIPTEIFGPETDQVFSYKLFTLSKGPTQIDDILVMPQITFRGPSSGQHKGQINK
                     NSYENEYNDEKPEDYYYARPLHFLSWDSLLSHEQ"
     gene            complement(<432908..>435115)
                     /locus_tag="C5L36_0B02280"
                     /db_xref="GeneID:40382731"
     mRNA            complement(<432908..>435115)
                     /locus_tag="C5L36_0B02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464584.1"
                     /db_xref="GeneID:40382731"
     CDS             complement(432908..435115)
                     /locus_tag="C5L36_0B02280"
                     /note="PKUD0B02280; Pfam Domains: VPS9(1.6e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320443.1"
                     /db_xref="GeneID:40382731"
                     /translation="MFYTPPTKSDWKSETAITHSYDTNSGFTSNSNSDLESQDVTIDT
                     QDTKDAESEYSAIEYHDNLEAIDKHLGSTNKNCDNTSTIQDDSSSYIESFEIPTESDL
                     PVPLLKVYEKCLKELKEPKFERSLASFEIAELFQSFYRTFQLECKNYLTNDGKYEMKE
                     MNQDSEYQYYRLNLTFERLLCDKFYNQIVFPLKGIPVDEFEKDFNDEFSDKLGCLSYL
                     DIHFRNLDIELDPGLENKFLQLLEEKILPEFELFSAERSPTLKMKYLIKIHKKLSQIL
                     SDITEGKGNILNTDMYLPILIFSMIKLKELRAYFLVSQMITIKRFANEFIFDNSIEKL
                     QIEKGKLLYVFANFEAAISYISSVTLENLGIPVPSPHWDLLPGSLKSRGELLTLLSVP
                     LNLDSLEKKVLEFKEKNPLIIGASPTNENQNQSLFANPLNAWLEYPKVGITDQNIKSI
                     SDSIDAGLRNLVGRVSWLSSSNLDVTGREAPTVEEKSNQDKKTLLSETLLKQIQENDA
                     YIAKIDVKKNDAELITSQTNIKDAPKAKYNIGMGGIRVSAKPTGDSNSMLTATSSSSL
                     NKLNDFSKENTTSSQNLERSFSAGNITPLSPASNKPLNRANAIIRSRATSFINSTIFS
                     VNSASGDPSTNISNSPTKEHLSSIFSSLENALDNVRNRSRGNSSATTGMNSVYPNNSN
                     LNSIGGDANTANTIKSLENLLQPLKTPFEAMTIEDLQNMYATYQTAANVLHSS"
     gene            complement(<435424..>436023)
                     /locus_tag="C5L36_0B02290"
                     /db_xref="GeneID:40382732"
     mRNA            complement(<435424..>436023)
                     /locus_tag="C5L36_0B02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464585.1"
                     /db_xref="GeneID:40382732"
     CDS             complement(435424..436023)
                     /locus_tag="C5L36_0B02290"
                     /inference="similar to AA sequence:RefSeq:NP_012925.3"
                     /note="PKUD0B02290; similar to Saccharomyces cerevisiae
                     YKL001C (MET14); ancestral locus Anc_2.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320444.1"
                     /db_xref="GeneID:40382732"
                     /translation="MATNITWHHNLTHEERSKIIGQPGATLWFTGLSASGKSTIACAL
                     ERKLLEQKIQTYRLDGDNVRFGLNKDLGFSEADRNENIRRISEVAKLFADSCTIALTS
                     FISPYKKDRDSARKLHEDANLPFIEVYVNVPLEVAEQRDPKGLYKKAREGLIKNFTGI
                     DDPYEAPETPEIVLNTHEKSVEECADAIISYLKEKKIIA"
     gene            <437822..>439504
                     /locus_tag="C5L36_0B02300"
                     /db_xref="GeneID:40382733"
     mRNA            <437822..>439504
                     /locus_tag="C5L36_0B02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464586.1"
                     /db_xref="GeneID:40382733"
     CDS             437822..439504
                     /locus_tag="C5L36_0B02300"
                     /inference="similar to AA sequence:RefSeq:NP_015495.2"
                     /note="PKUD0B02300; similar to Saccharomyces cerevisiae
                     YPR169W (JIP5); ancestral locus Anc_7.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320445.1"
                     /db_xref="GeneID:40382733"
                     /translation="MAKTKTGKVVKEFKFTRRPIFNIHHQADPLFAAKCHPSEPVFVT
                     GTATGHVQAYRYDIDKLEEIYEDQDKFPYDVSCVKYDDFDDGSITCQWHTKRHKSSCR
                     DLCFDLPSGGEKVHTIGSEGVIKTADVKTGQVINKFISSKNNTFEDDGFEIGTYTKCV
                     STPRKEFLLVGDELGNLMCHDTRSKHLNLCYKPFKKLHLGEGINSINYCWPKSDYKII
                     TTGSTTVCEIDLRKPGEPLHTSEDQEDEVLCAAWLDQEKQETMICGMGDVVTTWKPAM
                     NAWNDQISRIRIAKGETVESLISAMDADSRYMYAGSSNGHIAKVDIIGGKVVERFLQH
                     DPEEDDKVDEVLGLDLDLNYRLISFGTDGFKIWEEEKGDLEIDSEIDSDNGEEDKNRD
                     PDDDGIYTDDLGSDSSDEEEIEEKVTLGDEIGEEVHDMEETEVDDSGLTNTEETVPRK
                     RSLAESLKNRIELASSCIDDALHEKEETGLEEDVGVEVSDSDDDTDIGSTNGKVVELQ
                     EIRDELIARIENPVLDEPKNARERKRQKKLNKKEKQKGQHHHNHGIRKFEGL"
     gene            <439909..>441258
                     /locus_tag="C5L36_0B02310"
                     /db_xref="GeneID:40382734"
     mRNA            <439909..>441258
                     /locus_tag="C5L36_0B02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464587.1"
                     /db_xref="GeneID:40382734"
     CDS             439909..441258
                     /locus_tag="C5L36_0B02310"
                     /inference="similar to AA sequence:RefSeq:NP_010282.3"
                     /note="PKUD0B02310; similar to Saccharomyces cerevisiae
                     YDL002C (NHP10); ancestral locus Anc_3.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320446.1"
                     /db_xref="GeneID:40382734"
                     /translation="MSTSTEEPAIPAVNNSPTPSTPRSAMESSAALKERDDESSSMVD
                     EDRPAKGTRSITPHETEALRLKQKCKDLKQKIVDIETQNQIRAIGVSRAKDSISRLRF
                     EYSLLLESLEKKNATLPFPDLKNFKPEDIDAETVSSLSLTDVTNLLSTTPLALANIKR
                     FLPNALGDLISERQQQYINQAASSDQQAPSTSRTRRKRGTPNGSSASSRKRIRDPREP
                     KRPTNAYLFFCDSERERVKSEWAEKNPNQHIDLSKAMTEVWRKMTDEDKKPYFEMYEK
                     DKQRYQKAVEEFANIKEQERLNAQELLSSRAQSETASAEPETPVNGGFELDAHPDPDI
                     SQLDDANQTNEDIDENEGVEGEGDEEEDVDEDEEEEEEEEEANGSRLSTTAEVNGEPD
                     GSEDLLLELDSEAHIEGEDGEDEDAAKDVTHESKDTEDEHLYDAAQLRSEPDTPLHE"
     gene            <442404..>444485
                     /locus_tag="C5L36_0B02320"
                     /db_xref="GeneID:40382735"
     mRNA            <442404..>444485
                     /locus_tag="C5L36_0B02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464588.1"
                     /db_xref="GeneID:40382735"
     CDS             442404..444485
                     /locus_tag="C5L36_0B02320"
                     /note="PKUD0B02320; Pfam Domains:
                     Ferric_reduct(7.9e-39)|FAD_binding_8(8.6e-
                     19)|NAD_binding_6(1.3e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320447.1"
                     /db_xref="GeneID:40382735"
                     /translation="MNIILLLIALTINICFAESKLLGTTLGQVNAGVAEFWGCEIGVR
                     SYVVDFKPPLTSAYSKYHDKPCGYPPLIGTMMVCFTNLTGNTSEKYIEKLSMLTAEKC
                     NEFSSFNYTAEFYKQQYYNATKHLVDYRDVKNLSQPIYSPLTTNVSKYYASFKYYKSY
                     YANVDNSTYFAVGICGYFLALIIIGAIHNFCRETSVAKSINGTRIVKLFQRYIVFPTL
                     LPGGKYYEAYGWKYFTILSPNRAQFLVDFVLMLLQIGFYGATYYHATHKNYLRFLADK
                     TGIMSFGKIPLLILFAGRNNFLLWITGWSYNTFLHFHKTLSYWMILDAVIHSISWTIL
                     ELGYYVESLKELYFACGVAATVIGCVMIGQSLHPLRCISYEVFLIGHIVLAIGFIAMC
                     WNHCNILGWMEWLVAACCVWFFDRLVRVIRMCCFGIRTAKISVVGKDLIKVEVNKPTW
                     VRHSPGHYYYVYFAGWNMWQNHPFTTVQEGDKLCTYIRVKKGLTQRVFETVSANGGKM
                     EWKVCYEGPYGGNGSYMMKKYDDSLLIAGGSGVPGILDEASRTSEGKMVWIAQTLDSV
                     KAYEMMLRNVKLDLELYITREQGSEKTMRLKELWGEAESEDTSSTDDKSNSATELEIK
                     SCGQQVHAYYGKPNVAEIVDKYVRESPSSNVGIIACGPPKMMDELSHTMSLNVTKWDK
                     SVDYYSEFQIW"
     gene            complement(<444681..>452348)
                     /locus_tag="C5L36_0B02330"
                     /db_xref="GeneID:40382736"
     mRNA            complement(<444681..>452348)
                     /locus_tag="C5L36_0B02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464589.1"
                     /db_xref="GeneID:40382736"
     CDS             complement(444681..452348)
                     /locus_tag="C5L36_0B02330"
                     /inference="similar to AA sequence:RefSeq:NP_009551.2"
                     /note="PKUD0B02330; similar to Saccharomyces cerevisiae
                     YBL004W (UTP20); ancestral locus Anc_3.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320448.1"
                     /db_xref="GeneID:40382736"
                     /translation="MAKKVGKTASSRKWSYKSFRDHVDSIKIDPLKDIKRKAFHDAEI
                     SHFLSTLEHWREVNLSKNFQELVEVVEPITMSLPQLLYHKDTIFHALDKTLMYNDPLS
                     LQPTLELLSQFCHDLGPDFMEYYPRALEIIREISLNQQDPQSLEMIFNTLAYIFKYLS
                     KILSSDLRPTFKSLLPLLTVKNKDYVTRFASEALSFLIRKSNVSTLQALVSDVFSSPE
                     LLHDYSPSYHLALTIMFAESLKSASGVLHSKSGIILPILAKCAIENPKSAAVLSDIIM
                     DILDYTESKENSSQLYDILIIALKDILDKHDKLNFKILTCIAQILLTLSFAESGKRVA
                     EWGDILKFVEILYDASLSMRQQDVEMGADRENEFVEYQLDFQNSMASWCSVIIRNADM
                     LSLSKYHVIILKVMTKLNDGAAFLSFIDTSTEMNKARTLQLAKNSVTSFITQHWKDSF
                     KEIAYFIAKMDDKNLIDPSSGFNIIISNDFKAFILKSFKEIDGIKNKDSLINSYWRLL
                     ILQNCSIQFDASLLIHFLSLLNNCTVVTDFFILDVFGATIGALHKQKLTDEQVYQVLE
                     ICFSKIDILIDSTLFITNLEKLINSIATISNPNSLKFIDSAKVSIISSLSTVLKSSSH
                     EAREKALDLIICIFNKSGKEIPDAVLICRTIEQIPLTLQHARDVPLRFRNLAQDYSNQ
                     SPLINQIVTNFLFGQLSNKFSPSWQGVQEFVQKTVNQISDLVWKLSYEFISMNYKNMH
                     ENIYLDYEFDNFNEKSDITTWLPQDSRLHTMMTNFEENIFHKYEDANHSIIELSESKR
                     KHGLPTDFVRYQVIKLLNKIPSVAEENFKDLVPFLVNDDADDVGSAETGSLLDGWTMA
                     DRNGLVGLLARFNNLQKVYSFEKIVDLLLTLLMDRQTEVQKLALDCLLNTKNSVYNKY
                     SKHLKNLLDDTLFRDEIVLFLQGKEKSTIESNDIPELMPLVLRILFGRAQTLKTNSTK
                     AGRKIAAIKSLNNLKDEYITDFLRLTFWKFKIGSFEKTGTVGKDGINRKLLTHINGFI
                     NMNLEVCETLGKNHSECLSVIVKPLLYSLSIVEYAIENAQGFEDPLIEKSARNGRKSG
                     FKLLYHLFQYLGDDYKWTSYGDIIYENLLKSKMNKFGVENLSSPSFLMKIMTQLWCEP
                     TKLFFLYKDDYLPVKALMSILPNPNAKDPVLVLILQFILALINIPHKDDQLIELLTIV
                     ISECLDSLVKIFENSSSSEVNSFATQVLLSFVSNEYVTDNENRKVLLDSLTMALGKPT
                     SQIEMPVKVDIVRMIALLVEDYECSYNDILPIYTNISKLYSTCQQSEMRNVISTVFYG
                     VSNRFTELEKVCQLVIELNAYDSKRFREPDYDRRLQAFSKLNEKDYSVLNTTDWIPIL
                     YTCMFFLNDENDQSLRSSAGYTFTRYIDSITLKSESEAAEYIKQMKELIIPTIKTGLK
                     KKHELVRFENVRILSHIVKNVKYYTEFEDMKSVLLNYDEEDEEADFFDDIIHLQVFRR
                     QKGLRLINKLASKLSPNSISHYILPIIEHYAFWTEEKYRNLANETVASIKHLAQYVSW
                     NQFKAILARYVSIMNTAQAKQQHEKLRDSILLIVSMSGAMRQWNIEPSTKPADYPKIE
                     TIDSFITLEIIPKLQKILSVRNEDTVVIRVPISEAMISFIVCCSQSKINSELAGLLTN
                     ICQILRARSENLRDSVRKHLGRIAVFLGPHYLKFIIKELKSALTRGPQIHILSFTIHH
                     ILTIMSPYLVHGSLGDSVEMIMASIMNDIFGEASEEKEASGYSNKAKEIKHNKSFDTG
                     ELISANIFLKDFNYLLTPVKYLLNERLSLKSQTKLEQLMKRFSHGLNRNEEGSSTDIL
                     VLCNEIYIQANDIIESRKHKKETDVDEKTSRFLVQLDARPQKTQMEYSLYITTLKQFA
                     FDLLRTAISKHESLFKAAYLAPFVPQLQESLSSESEGVVISSLKVMTMLVRLEFSPDV
                     DSKFTDAANDVLKILQDMPSTNNDICQFCLKFLSNVIRFKNDLELRDTAISYILKKVE
                     PDLDSPERQATAFGFLKSILFKRIMIPEVYDCMDVVSKLMVTSTTSEIRQVARSVFYT
                     FLMEYDQSRGRLEKQFKLIINNLKYPAYAGRLSVMELILTIVKKASKELLGRLATSFF
                     ISLANVSITDDNPSCRESATEILGVLFKRLHESDMDMEFVKKYTSSWLNQNKKPLLVR
                     CGLNVYKVILSTLDFPFNEALDNQVAERIIKTLNAAKRSDDESESDDEAADSAVEVEW
                     QMVYSCLTVFETLSGKTNTFGNKYEKLWSDIINAMLYPHSWVRLSSSRLIFKLLKQVV
                     DKNNESFEFEVSDSTIQTIAYRTFRQLGAPDISENLALQATANLVYISKKWDREETKF
                     INIKKEQKQEGRDEDEDENESPDKQRKFKSAFDWALNRSAAILKNDSRDYNDMLVTKR
                     AIISYCEFLTTFLSEEKLKEALSETLLIPLLHISEADLVDGEDDEKALPNLATACLEK
                     LSKKIGISDYNILLSAAMKTIQHRRYERKTRRAQLALNNPEVYAKRKLKKHAHEREKR
                     RNNKDENGYYKAKRRRM"
     gene            <452708..>454039
                     /locus_tag="C5L36_0B02340"
                     /db_xref="GeneID:40382737"
     mRNA            <452708..>454039
                     /locus_tag="C5L36_0B02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464590.1"
                     /db_xref="GeneID:40382737"
     CDS             452708..454039
                     /locus_tag="C5L36_0B02340"
                     /inference="similar to AA sequence:RefSeq:NP_010283.3"
                     /note="PKUD0B02340; similar to Saccharomyces cerevisiae
                     YDL001W (RMD1); ancestral locus Anc_3.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320449.1"
                     /db_xref="GeneID:40382737"
                     /translation="MSADSTERTALLSDNPYGTPGVLESELQSQEGNNRSGPTNDVNL
                     KKNTSSNISKLGPNMAPQRTSRTIQKLKLLPESLDYETPSIEDAKAGSSKTSALKQYS
                     LQKIKDRNARKDAERLGKKHRSMMPRVTAYCTAGSYKMRDFIRWLKDKRRLHSTAPKL
                     FDECIYTPFMFKDWRRARSGSTSSTKSNEAATNSRKNRFQLDDEGGVIDVGRRSTDLF
                     IFEYGVIVMWGFTKREERMLLIELAKFENEKLSDEDVQKEEFNYYITQSYQPRIYNDF
                     ITLRDDSNHMLKLSISYAISQSVKISLFEELVDNTIEDTQDIPQQISQTGKVKMTREE
                     IMKSIGELFILRININLHGSILDSPELMWSEPELEPIYQATRGYLEINQRVALLNQRL
                     EIISDLLQMLKEQLGHNNDEQLELTVILLIGAEVLVSLINIIVDLYSQRNT"
     gene            complement(<454190..>454585)
                     /locus_tag="C5L36_0B02350"
                     /db_xref="GeneID:40382738"
     mRNA            complement(<454190..>454585)
                     /locus_tag="C5L36_0B02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464591.1"
                     /db_xref="GeneID:40382738"
     CDS             complement(454190..454585)
                     /locus_tag="C5L36_0B02350"
                     /inference="similar to AA sequence:RefSeq:NP_009552.1"
                     /note="PKUD0B02350; similar to Saccharomyces cerevisiae
                     YBL003C (HTA2); ancestral locus Anc_3.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320450.1"
                     /db_xref="GeneID:40382738"
                     /translation="MSGGKGGKAGSSEKVSTSRSAKAGLTFPVGRVHRLLRKGNYAQR
                     IGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHV
                     TIAQGGVLPNIHQSLLPKKSAKAKASQEL"
     gene            <455382..>456767
                     /locus_tag="C5L36_0B02360"
                     /db_xref="GeneID:40382739"
     mRNA            <455382..>456767
                     /locus_tag="C5L36_0B02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464592.1"
                     /db_xref="GeneID:40382739"
     CDS             455382..456767
                     /locus_tag="C5L36_0B02360"
                     /inference="similar to AA sequence:RefSeq:NP_012131.1"
                     /note="PKUD0B02360; similar to Saccharomyces cerevisiae
                     YIL135C (VHS2) and YNL074C (MLF3); ancestral locus
                     Anc_2.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320451.1"
                     /db_xref="GeneID:40382739"
                     /translation="MYSPTTTPHLDSFRFRRDSHNHASVDSRNARFTTGPTPSPSSSN
                     LHDQDPLASSSANNQLRKTATANSNTGDNYSITSSYSEASYNSRADNSLIFERLVQDP
                     LIEGQPIPSSLPRHHTSETFIPASLDTTTHMIRNNTIDIHDLNEPTEFGFNSRKSSLA
                     NLEAALGGSSSNLSSRRPSSANLPTLNSFRSANLSRVSTTSSFSNLTDAFQKSQYPNS
                     NTTTTTTTTPTAAANNTNNNNNNNHNNNANSSTCNLNQNSNINLLPPLSKSVTSTSVS
                     SYASQRAQNAPVSPLQKNKSFYSYADIIAQDDQDSKFAIRRPSISTSLSNQKMARTGS
                     FGSCNSPRSPSVCGSLCNPTNVNSPNSLRTNSFSANQRLRNTSPTFKVDSHSDNNNNT
                     SNNNNDDDSIFSMSGLNNTPKRSVGFSGRPISSSTMRGSISQNSVLTTSNIDHLLKST
                     TSNESAASDKS"
     gene            complement(<457221..>458090)
                     /locus_tag="C5L36_0B02370"
                     /db_xref="GeneID:40382740"
     mRNA            complement(<457221..>458090)
                     /locus_tag="C5L36_0B02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464593.1"
                     /db_xref="GeneID:40382740"
     CDS             complement(457221..458090)
                     /locus_tag="C5L36_0B02370"
                     /inference="similar to AA sequence:RefSeq:NP_014324.3"
                     /note="PKUD0B02370; similar to Saccharomyces cerevisiae
                     YNL075W (IMP4); ancestral locus Anc_2.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320452.1"
                     /db_xref="GeneID:40382740"
                     /translation="MLRKQARERREYLFRKAQQLREQNTISKRQQLAASLATGKPLPK
                     EIAEDNQLQKDFLYDESTQAANVELDDEYSALSGLVEPRIVITTSRNPSTRLSQFTKE
                     IKLLFPNAVRLNRGNYIMPTLVDTCKKQGVTDIIVIHEHRGVPTTLTITHLPHGPTVT
                     FTLHNVVLRHDLLNVTNQSEVYPHLIFENFNSNLGKRCSTILKHLFPPGVKVDSPRVI
                     SFINRDDFISVRQHVYAKTRDGVELSEVGPRFEMRMFEIRLGTMDDKDADVEWMLRRF
                     VRTGNRKNYLSAE"
     gene            <458279..>459169
                     /locus_tag="C5L36_0B02380"
                     /db_xref="GeneID:40382741"
     mRNA            <458279..>459169
                     /locus_tag="C5L36_0B02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464594.1"
                     /db_xref="GeneID:40382741"
     CDS             458279..459169
                     /locus_tag="C5L36_0B02380"
                     /note="PKUD0B02380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320453.1"
                     /db_xref="GeneID:40382741"
                     /translation="MSVGNFGYLFLTFFISMIQPVLYKRNGKIAIFYLRIDCSPHDNY
                     IKIQLTDVYNFASYFESNTREELIDYTFDLNKLTKFDKGAVPKIYENMYTLVEKLKPV
                     LSEDFKCTLNEDALLLINGSFKYLFPLQSMPDSDNLLYIKEIYTNLEKLSIYEHLLIE
                     NLTNHIHTKNQILEKIAREYHNKVSYSRNEKFDILKSKHIKDLFINKQIMKFLVSKPE
                     EIVEESSKISGIDSKCLFTTGTQSIWNKIESEPRKEPELIIPEFGKTDRKEDLNGPSN
                     PTSKRKLQGLLRRIKRSKIQ"
     gene            complement(<459170..>460402)
                     /locus_tag="C5L36_0B02390"
                     /db_xref="GeneID:40382742"
     mRNA            complement(<459170..>460402)
                     /locus_tag="C5L36_0B02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464595.1"
                     /db_xref="GeneID:40382742"
     CDS             complement(459170..460402)
                     /locus_tag="C5L36_0B02390"
                     /inference="similar to AA sequence:RefSeq:NP_014809.3"
                     /note="PKUD0B02390; similar to Saccharomyces cerevisiae
                     YOR166C (SWT1); ancestral locus Anc_6.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320454.1"
                     /db_xref="GeneID:40382742"
                     /translation="MNIQDEEHLSAISDCVLDLRENNVFVPTDKSLGTADSGKYHKFH
                     KSAYLVVDTNFILSHLAILEDLENLSHDKYAGCYQIVIPKQVIHELDGLKDSDKSVLT
                     SRHSISKLARSAIDWCYAHFHESVPTVTGQRLHERIDVDATKDDSILDCCLYFQNVEN
                     GGGNFVVLMSDDKNLCVKALVNNVLTVSYRTGMDAELIASNIVNELQLLNSVIANEPC
                     SDQHTGQGGDMIVDDVNMYTELYQQQQQQQQQQQQELDRQQPKKMADVDRESTSNSFS
                     DVSLQIFSQVTTLVLEAINYAINSTYGDDVYMIEYDESKMKTLRDAGKCILRLGFSTF
                     ADFFDRRNVYNPMQILKDRTEFRKFTNVPPSKKDLDEFVEFWKLFLEAIYKSRNVEQK
                     NALKAIEDYWARSMRGND"
     gene            complement(<460620..>461540)
                     /locus_tag="C5L36_0B02400"
                     /db_xref="GeneID:40382743"
     mRNA            complement(<460620..>461540)
                     /locus_tag="C5L36_0B02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464596.1"
                     /db_xref="GeneID:40382743"
     CDS             complement(460620..461540)
                     /locus_tag="C5L36_0B02400"
                     /note="PKUD0B02400; Pfam Domains: Aldolase_II(6.3e-68)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320455.1"
                     /db_xref="GeneID:40382743"
                     /translation="MSSATAVQSETTNVPAQVKPSSTKGYTVSSQGAHNISMGNPNPH
                     AVPQFDDPYKKREWVLEHMAGVFRVFGRYGYNEGSAGHISVRDPVDPNTFWINPLGIH
                     FSLLKASDMVRVDEDGNLVGGNTSAPINAAGFAIHSALHKARPDVNAACHTHSKFGKA
                     WSCFGEPLEMLNQDACTLYGVQCVYEDFGGVAMDRREGQDIAKAAGEKNKCIILQNHG
                     LLTVGQTVDEAGYLFTLMERTAECQLLADAASACGRKKKVIGDSEAAYTQYMAGDPET
                     LYMEFQNDLELEKKYDDSFMTFTNAQKQKS"
     gene            complement(<461859..>462962)
                     /locus_tag="C5L36_0B02410"
                     /db_xref="GeneID:40382744"
     mRNA            complement(<461859..>462962)
                     /locus_tag="C5L36_0B02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464597.1"
                     /db_xref="GeneID:40382744"
     CDS             complement(461859..462962)
                     /locus_tag="C5L36_0B02410"
                     /inference="similar to AA sequence:RefSeq:NP_010055.1"
                     /note="PKUD0B02410; similar to Saccharomyces cerevisiae
                     YDL226C (GCS1) and YNL204C (SPS18); ancestral locus
                     Anc_2.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320456.1"
                     /db_xref="GeneID:40382744"
                     /translation="MSNQWTVDPDMRRKLMTLQKQPCNKKCFDCKAPNPQWASPKFGI
                     FICLECAGIHRGLGVHISFVRSITMDQFKPDELLRMEMGGNEKCGEYFTSHGVDLTLP
                     AHEKYDNYVAQDYKSKLTAVINNEEWTEPDHTGEELFPKKSQAGTSIQTTSKSASPAA
                     NGMSSLSRGNQSNDSFANRPTKEQNEQYFAKLGSKNESRPADLPPSQGGKYQGFGSTP
                     LPKSANNAGGSLAGFTLDAFQSDPLGTFTKGWGLFSSTVAKSVKEVNETVIQPGVKQL
                     SEQEYTIQAKRAVEQFGQKVSETGAALQQQYYDANKEGADSKFGKLFDGLTLQDNQSQ
                     DTIDPAFGLPKPTKKTELPGKGWDADDDKWESF"
     gene            complement(<463528..>464742)
                     /locus_tag="C5L36_0B02420"
                     /db_xref="GeneID:40382745"
     mRNA            complement(<463528..>464742)
                     /locus_tag="C5L36_0B02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464598.1"
                     /db_xref="GeneID:40382745"
     CDS             complement(463528..464742)
                     /locus_tag="C5L36_0B02420"
                     /inference="similar to AA sequence:RefSeq:NP_012364.2"
                     /note="PKUD0B02420; similar to Saccharomyces cerevisiae
                     YJL171C; ancestral locus Anc_1.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320457.1"
                     /db_xref="GeneID:40382745"
                     /translation="MQTALLSLFSLLVVLPSVSASKWSSPADLLQFENLGYSGYYYPV
                     TKIEALDNGNCSCEKGHPFTFSGPLAPLNEELTVHFRGPMNLKKFAYYVTPSYGVNQT
                     TGTWERKAYYDASSGTANNVTFLANYGHENECLGNAADYVSSDGLKKSNESVVLDDVT
                     IPSAKEFAIASDIKCDGVEDCGAYRTDGQAYHGFYGVNKMFLFEFNAPSDTSEDHKKN
                     KTDGYDMPAIWLLNAQILRTSQYPLNGNCSSWNSGSGEFDIFEVMNVTERNHFYSTIH
                     TYQGTDDIGTGIQNFGFLERTPGSTMKGGVVFGEDSSATVFLSNDTSIDSSIDNSDLN
                     SWILPLAKEVDSDETLSSITISPPSLATSTSATGSSVSSISKTKKNDAADLAPTRVMA
                     SLGALLGLLSLW"
     gene            <465398..>465748
                     /locus_tag="C5L36_0B02425"
                     /db_xref="GeneID:40382746"
     mRNA            <465398..>465748
                     /locus_tag="C5L36_0B02425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464599.1"
                     /db_xref="GeneID:40382746"
     CDS             465398..465748
                     /locus_tag="C5L36_0B02425"
                     /note="PKUD0B02425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320458.1"
                     /db_xref="GeneID:40382746"
                     /translation="MTVIHRAIFTISKPPLEQQTVWRILAHVKKTLADVSQQQQETHV
                     RLVDFKVPYTTYYGVGSYMDQVQVSLRTETLEEEHLVTRFLQNGLPPLDGLSFHSKTV
                     TATADTTSCTVSGG"
     gene            <466118..>469030
                     /locus_tag="C5L36_0B02430"
                     /db_xref="GeneID:40382747"
     mRNA            <466118..>469030
                     /locus_tag="C5L36_0B02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464600.1"
                     /db_xref="GeneID:40382747"
     CDS             466118..469030
                     /locus_tag="C5L36_0B02430"
                     /note="PKUD0B02430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320459.1"
                     /db_xref="GeneID:40382747"
                     /translation="MSYKPSCCMCDPPSMEDDERTASLYSEVSGILAGHEIENTGDAG
                     LSRLKEYLYYAIPRDKTWKQTPRWTPELERLALLLYNNATSKNTHLWISLFEKLPAYA
                     SLGLLKLYLSTDETSKLHDPILKINGYILNTRTNDLDRSLELLVQRFSIQEKLCEKIL
                     LSSEACFSQIIVKLVAKVQFADRKSERNADKAINELKSICEYHHRLLNVDLLDYIVFQ
                     IHDRVINNEYASIQHRKNAYSLFIVLHRIAYYMDDLVTVSNIETLIQLAVKEGLVNLN
                     SCQLITMLKGKSENWIDNFLSSLELRLFPNLDSAHSSTPTGLIPWSEVVQYFQFVHFL
                     LSNDIHLDHEKFTALYDLIFRISKIVDVPWEFYESLRVSTCDVISDGYRVGEIPCESL
                     ELYDTVLSYLFFSPNETVRSYAMKALVSIFCYDGENMKNALNINEGCEFPHIFHKLIP
                     IPVEDRFSYLGFYRLYTDNISNIVRPPMFSELLYVLYEFPNLKVMQKYFEFLRSLPTQ
                     QRETMKDLFQNLDPCISWPKNPSNGLFVRFFTIQMTPNPPANAVEKVHELVTPLYPKP
                     SRKETRIYLFSLRRQKKIRISETENFIVFDMLKMEDNDIQDCLYKVFSTLKLSEYVIH
                     SLINLIREQDEDILDFITSIQNIMMALPKSVHKFDIIKACLVGDKTKFDRFLRFFLNL
                     MHIHTSDIRQAANAYSNLLMNVETAYIDWGFDERAVFWDTFFNYTLDQQENHILEYAL
                     RGVNDFFNNLRKREEMIFVDNKSAIVFTRDKIGSYNETELRDFLHREIKKSKDEKERA
                     KRLLSQITLEKNKDRKMHIGSDVEILKKKSVNTGANEMEVSITVYPNGKRNAEFKDVR
                     SNKNLDKGERKKLYREMAALDSSNIADYSSYMINLFRNDIFKSCIKGKTHVGKFVGLM
                     FNVDCNFATATNQELKVIFPKVKRCRNFILHESLYLRFNEYLKTRFSSKQSTRRNK"
     gene            complement(<469122..>470210)
                     /locus_tag="C5L36_0B02433"
                     /db_xref="GeneID:40382748"
     mRNA            complement(<469122..>470210)
                     /locus_tag="C5L36_0B02433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464601.1"
                     /db_xref="GeneID:40382748"
     CDS             complement(469122..470210)
                     /locus_tag="C5L36_0B02433"
                     /note="PKUD0B02433; Pfam Domains:
                     Methyltransf_12(1.3e-09)|Methyltransf_11(2.6e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320460.1"
                     /db_xref="GeneID:40382748"
                     /translation="MFRKVFLSKSFSRGYASSPGGSHDIKVFDRHVKLLQKERAAKHP
                     DSKFVEYLRDEINRRTIDRLAFVKTDFEKVMDFGAHSGNFERLLCDPSKDETNPQWKA
                     DRELIKSKIKKILLVESSESMLYKDMDSAFNKEMNIERIVADEEYCDIPQLSEANQYD
                     LIVSNLSMHWINDLPEVFKRLYNCLKPDGCFMGSMFGGDTLFELRTSLQLAEIERYGG
                     ISPRVSPFVESSDIGNLMQKAGFQMLTVDAEELIVDYPHVLALMEDLQLMGENNSVIM
                     NPPPLTKDLLIALEPIYKELHGDKKTGHLPATFRFVYMIGWKPGKYLAKPAKRGSGSV
                     SLQDALDGVTTATTTLTEDEEPPCKDKK"
     gene            <470460..>471908
                     /locus_tag="C5L36_0B02435"
                     /db_xref="GeneID:40382749"
     mRNA            <470460..>471908
                     /locus_tag="C5L36_0B02435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464602.1"
                     /db_xref="GeneID:40382749"
     CDS             470460..471908
                     /locus_tag="C5L36_0B02435"
                     /note="PKUD0B02435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320461.1"
                     /db_xref="GeneID:40382749"
                     /translation="MLPTKPLFNASINELRNTVKKKLYQIYKSGDETRYQDALEVLNK
                     IDRKEIFNMNITSLGNLIFAKCKNPLYHEKYRDILEKFGLNTGYFNVKVYLENGQYEQ
                     AALTGIEEFKNLGKTDNILKEKLSHDLHMRQILEESNRRNDTVITTTILDLLAEHDVL
                     FRSNLSHTIGIAQINHNYEIIVKNLQYITENAFSESLLKSCFQMCIENGDNPNAIQFL
                     YNMKSKDLKSLLCFKFIKSLDFPVFVELINSLVNEGTLEIPCMLDLPAETLAIADLDN
                     YEILGEKLDQIQHVSTLELKRLFIFMLLSSIDNTNTHLGSTIFLMNRILNDRSVLTNE
                     HKDIIFHQLSKYPFKLTALKFIKLFEDIGLEISSRNYYHALKSQFHGKEHDTAYYLLI
                     KMMKEGKPLDKNIKSLLTGFNLALDDKKLALILEQNKPVHELERLIGFEFIQNHLEHQ
                     RERTKINRKKLQNTSEYDYQWDIKLVDSLQFD"
     gene            complement(<472025..>473512)
                     /locus_tag="C5L36_0B02440"
                     /db_xref="GeneID:40382750"
     mRNA            complement(join(<472025..473291,473454..>473512))
                     /locus_tag="C5L36_0B02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464603.1"
                     /db_xref="GeneID:40382750"
     CDS             complement(join(472025..473291,473454..473512))
                     /locus_tag="C5L36_0B02440"
                     /inference="similar to AA sequence:RefSeq:NP_012060.1"
                     /note="PKUD0B02440; similar to Saccharomyces cerevisiae
                     YHR190W (ERG9); ancestral locus Anc_8.857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320462.1"
                     /db_xref="GeneID:40382750"
                     /translation="MSKIIELAFHPSELKAVVQFKFFKKTLYPLKPSCETEKLCYDLL
                     KKTSRSFSAVIMELNPELRNAIMIFYLVLRALDTVEDDMSIDPKIKIPLLRSFHEKLL
                     LKDWTFDGNAETEKDRIVLVKFDAILTEYAKLKPEYQDIIKEITEKMGNGMADYIVDE
                     EFNLNGVKTIKDYDLYCFYVAGLVGHGLTKLGVASQFSDPYLLDHMELSDSMGLFLQK
                     TNIIRDYKEDLDDGRSFWPEEIWGKYADKLSDFASVENEEKGLHCITDLVLNAMNHIK
                     DCLKYLTMVYDHSTFNFCAIPQVMAIATLAEVFQNKDVFKKNVKIRKGVAISLILKSR
                     TYDGVLEIFSQYLRIIHHKVPVSDPNYLAIGIKCGEIEQFIEELYPNPAHLPKGVKPM
                     QTEFYLRALKKLDSEKDIKKLIQTENKNTNVVLVLVGLQVLFYTLYFTS"
     gene            <473812..>475821
                     /locus_tag="C5L36_0B02450"
                     /db_xref="GeneID:40382751"
     mRNA            <473812..>475821
                     /locus_tag="C5L36_0B02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464604.1"
                     /db_xref="GeneID:40382751"
     CDS             473812..475821
                     /locus_tag="C5L36_0B02450"
                     /inference="similar to AA sequence:RefSeq:NP_014011.1"
                     /note="PKUD0B02450; similar to Saccharomyces cerevisiae
                     YMR284W (YKU70); ancestral locus Anc_8.849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320463.1"
                     /db_xref="GeneID:40382751"
                     /translation="MEDQKYRDESEDEDNVIYNFHEGIVLAIHLSPTMYKKLPALFST
                     FLLLLKTLIKSMPKTGLGIYFSNCSKENKDDDQIQSSEGIFKLIKLGDINQTTLKVID
                     RYIKNATRGEPLMGISSREKELWAELLPALEDDAELHFGESLYRILHEAMKDFNKPTP
                     KTDEYTSKKIFFFTDCLKPYNEDNFLKEKIQNKLRELNSNKITVYPFILRPHDDDDND
                     NGAPIKKEDDTESQVYQDRYVQLKEFRELFDYPAGAEGKKYLPVIDDLTLDALEEKLI
                     KHTTMRNYNFQCPLILRNGFQIPVKGLNLLTTAEWKRVKFYNSNNRLHYAFRKNIFAQ
                     DNLIIEDEDIVKACKVGDQFFPYNEETFSECLKFGEKDAPLLRVIGARKFTHVTKSHT
                     INKSVFVIADENTKEESSLERFAALYKSLCEKQMVLLCWGMTRKRSNPRIYYLVPTTI
                     AEEQFFFKKFPQSLAMIEIPFADEIRKAPEYIDQLESLDRVDGSGMLDSLIEDSTVPH
                     FKTFPNPALAWKFKVMEEHILQVELSEKEQTQNIGDRQLEVDDMYQQLLEMKQKIESN
                     PITSAIVQKLVNRYNCISNDNELKRISQESQTNANKKAKIVGSQLTLSDSKVALYYKE
                     YGLTNCTNDMLKKYISSKGGVIKGGRNKGEMISNIVEYLNKYNLL"
     gene            <475976..>477385
                     /locus_tag="C5L36_0B02460"
                     /db_xref="GeneID:40382752"
     mRNA            <475976..>477385
                     /locus_tag="C5L36_0B02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464605.1"
                     /db_xref="GeneID:40382752"
     CDS             475976..477385
                     /locus_tag="C5L36_0B02460"
                     /note="PKUD0B02460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320464.1"
                     /db_xref="GeneID:40382752"
                     /translation="MAGIWTTEKETYLLNLLCFYRPRSEVETIFSSIKDKLNEKFGEG
                     DFDLESVQKKVYEFYDLKQLEKMELNEVTSEQNILDKEQSNLENDLVSENGELAKTVE
                     EQSAKREKHVVIDEDKNKVFQEGEKVEQTTNLSGEDKERKKDKETLSAMKSEPENDKT
                     DLSGYNQEEKSPAVEKEAEAQEISKEEEKQKEEEDEPAHITRAQARKLHISVEDEIPI
                     SKKPAKEELKRKDKLESVIGEDSALSKMCETVEDNSNARNPRDAKVVKSGEVTPRRSS
                     RLRRKSDVGFDDNIEMSNIGKRTRSASATRQQSDAENEGDGPMGLSESSRKSHTSELA
                     ASSRGTRSRRKEANEPSEMEQDEIKDKSLKEEEEEKKKGNADSRDQVGETNDNVSEKV
                     EDSDEPESKLRRSSRKRKVEETLLNTKRQRSSSGTPNKRRSGRRGKTKSPTPPKDSDA
                     EEETGIATRRTRRRTNQQE"
     gene            complement(<477488..>480046)
                     /locus_tag="C5L36_0B02470"
                     /db_xref="GeneID:40382753"
     mRNA            complement(<477488..>480046)
                     /locus_tag="C5L36_0B02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464606.1"
                     /db_xref="GeneID:40382753"
     CDS             complement(477488..480046)
                     /locus_tag="C5L36_0B02470"
                     /note="PKUD0B02470; Pfam Domains: Sulfate_transp(1.6e-85)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320465.1"
                     /db_xref="GeneID:40382753"
                     /translation="MQYQADISYEEDKASFYENNQNMKVPEFHTREISSTTYVKNLFK
                     NPTSRSLSYLKNIFPVIDWFPHYPTNLNWMLSDFITGVTVAIVLVPQSMSYAKLATLS
                     PEFGLYSAFIGAMFYFLFATSREICIGPVAVLSQEVGKIVTRVQGKYPGLYSNEEIAT
                     TLALISGGIVLGIGLLKLGFIVELLSLPAILAFTTGSAFNIVAGQLAGLFGFSKKAGK
                     HKSTCETIIAFLKHLPDTEVDVAFGLTGLVILYIWQFTCEYYLKKYKSDAKKRIAITY
                     ILNLRTAFVIIISTCISFGVLRYRPHSKKAPYSIIGDIPSGLKHVGRFVPPPGLAKHI
                     ASELPISTIVLVLEHISISKSFARINGYRVNPNQEFIAIGVTNMVGTFFGAYPVTGSF
                     SRTALSAKCGVKTPLKALITGCSVLLSIYCFTNGFYYIPNATLCAIIIHCVAGLLASY
                     KLTTKLYMFSPVDFIIFITGVFITVFATIEDGIYFALCASAAQLLWRLCLPNGSFLGR
                     VKVATLENPILLPAGLKTSSENSTSENGSVTSINKTPFNESTKQALNPPTSYVYKWVP
                     LPKEPNNPSKVHTRFINGNINVEKPPSGVLVYRMSESFVYSNCSLQIDQIIAKVRADY
                     KPHNDNRERLWCEYTYAESNWKENWKHLKMGNFRKFFNKEIKDLEDANAGDDVSYDGN
                     ESDEYIQNRKRIEDSRPVFRILHLDFSQVVAVDATSVQALLDLQMTIDHFVGPQWEMH
                     FSGIINPWITRALINAGFGAKRVDVTKIENSYLKRNLQNGWFEKLSTPSFLNRYLKSS
                     TGSIDLEDTEFTDKADVFPGDLEVGFAEDNRSLPLYSTDYPNIHFDIPSYSGYD"
     gene            <480951..>482150
                     /locus_tag="C5L36_0B02480"
                     /db_xref="GeneID:40382754"
     mRNA            <480951..>482150
                     /locus_tag="C5L36_0B02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464607.1"
                     /db_xref="GeneID:40382754"
     CDS             480951..482150
                     /locus_tag="C5L36_0B02480"
                     /inference="similar to AA sequence:RefSeq:NP_015277.1"
                     /note="PKUD0B02480; similar to Saccharomyces cerevisiae
                     YPL048W (CAM1); ancestral locus Anc_8.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320466.1"
                     /db_xref="GeneID:40382754"
                     /translation="MSQGTLFGSTETRSILPVGLVKAFKLDIALEKREAPAQKAAFPN
                     TKVPAFIGPKGFKLQESIAVLFYLISLHDAESPLLGTDVESKAQVLKYLSWATAELMT
                     PVTVVIKILLNRVPFNKKALDTANAEVDQHVAQLEKRLLTHTFLVGERLTVADLFVAS
                     CFYRCFALTFGKKWRAEHPVFMRWFNTVIKTEYLSYFFDTFEFVDEPVKPQLPSKKET
                     KPKQEEPAPAPAPAQPKKAKHPLEELGKPTIPLDELKRNYSNMETREGALPYFWNTFY
                     NDKEWSLWRVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCAVVYGENNNNGIV
                     GAFLVRGQDYKPAFEVAPDFESYSFTKLDASKPEDREFVDNMWAWDKPVIVNGESKEI
                     ADGKVLK"
     gene            <482488..>484149
                     /locus_tag="C5L36_0B02490"
                     /db_xref="GeneID:40382755"
     mRNA            <482488..>484149
                     /locus_tag="C5L36_0B02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464608.1"
                     /db_xref="GeneID:40382755"
     CDS             482488..484149
                     /locus_tag="C5L36_0B02490"
                     /inference="similar to AA sequence:RefSeq:NP_012588.1"
                     /note="PKUD0B02490; similar to Saccharomyces cerevisiae
                     YJR054W (YJR054W) and YML047C (PRM6); ancestral locus
                     Anc_1.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320467.1"
                     /db_xref="GeneID:40382755"
                     /translation="MDHQLRHEPSLILFKEATRITFDNITGEYNYRKCSFFNFLSYLS
                     LLVSIFLQFLFLASDIYTLIQIYALNDWEEFHVITYIPVLTYRITFTVCIGISFIYLI
                     VTWVLGFFIQRRNRVVPSYLHTGARQIDSLKSYERFCIYEEVQSKKVHDWICLSIYTG
                     YHYELINWLLADSPRQILNGVTIAYSVSNKFTSGELGMILSDIAKTNKKEAVLLSFMF
                     FSFVVWLCFTFKNFIIILSSICIIPNIKRKKKTKFNKYCADLVAARVYKLYDSKAKMN
                     EEELSKRRKVPSFIKNTNVEDSSFITEDYNDGTEDFDIVDPLRADQTNELTNDSVVSL
                     EKLNPFDSYSQVSEFPLSHSRVNLVPKASLHRRSPSKNRVFTNNEYELHEITMSDPHN
                     DAPHSKTTNHYDNGVKPTTDYSHSTNSPFCISEAETQDCGIRESYVYIPSKVYEEVYH
                     QQSPLNGKPPRIVFETEGNPSSESSTLPQYTPTSSKNREHASHRKDPKYDGVDTDGEE
                     SEDDDDDEEEEDYIKIGQTSYGNPKRGNSRTLYGSRGLANHRTII"
     gene            complement(<484273..>484773)
                     /locus_tag="C5L36_0B02500"
                     /db_xref="GeneID:40382756"
     mRNA            complement(<484273..>484773)
                     /locus_tag="C5L36_0B02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464609.1"
                     /db_xref="GeneID:40382756"
     CDS             complement(484273..484773)
                     /locus_tag="C5L36_0B02500"
                     /note="PKUD0B02500; Pfam Domains: Mago_nashi(7.4e-54)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320468.1"
                     /db_xref="GeneID:40382756"
                     /translation="MSDSFDLNVGSTDTEFYLRFYSGGYKDNVHGHEFLEFDIRHNPG
                     DKFATLRYANQTNYRNEELIRKEVCISLLVLEEILCIVKESQILLESDVFWPKAERES
                     KQEIEIRCGNKKKVLKTVGRLSLVSIKGMNDAESLKIFYYLVQDLKTFIFSLISLHFK
                     VNPLFS"
     gene            <485507..>486709
                     /locus_tag="C5L36_0B02510"
                     /db_xref="GeneID:40382757"
     mRNA            <485507..>486709
                     /locus_tag="C5L36_0B02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464610.1"
                     /db_xref="GeneID:40382757"
     CDS             485507..486709
                     /locus_tag="C5L36_0B02510"
                     /inference="similar to AA sequence:RefSeq:NP_011701.3"
                     /note="PKUD0B02510; similar to Saccharomyces cerevisiae
                     YGR185C (TYS1); ancestral locus Anc_5.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320469.1"
                     /db_xref="GeneID:40382757"
                     /translation="MSDMTPDQQYELITRNLQEVLNPQIIKNVLENEDRPLRVYWGTA
                     PTGKPHCGYFVPMVKLAHLLKAGVEVTVLIADLHAFLDNMKAPLEVVQYRAKYYEFVV
                     KSILTSINVPIEKLKFVLGSSYQLTPEYTMDLFKLSNRVSQNDAKRAGADVVKQVANP
                     LLSGLIYPLMQVLDEEYLKVDVQLGGVDQRKIFVLAEENIQALGYKKRAHLMNRMVPG
                     LMQGGKMSASDPNSKIDLLEQPKIVKKKINQAFCAPGNIEDNGLLAFVKNVLGPIYEL
                     KHGDGKFQFFIDRPEKYGGPITYNTYKELEDAFKNEQLSPVDLKSGVADAINVLLAPI
                     IEEYSANKEFQEAETKGYPPPAPEPKKNKKVKNRGSKYPGAKEVKVEATKDTSTEVVA
                     EKLDQTKI"
     gene            <487010..>489850
                     /locus_tag="C5L36_0B02520"
                     /db_xref="GeneID:40382758"
     mRNA            <487010..>489850
                     /locus_tag="C5L36_0B02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464611.1"
                     /db_xref="GeneID:40382758"
     CDS             487010..489850
                     /locus_tag="C5L36_0B02520"
                     /inference="similar to AA sequence:RefSeq:NP_012910.1"
                     /note="PKUD0B02520; similar to Saccharomyces cerevisiae
                     YKL015W (PUT3); ancestral locus Anc_2.654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320470.1"
                     /db_xref="GeneID:40382758"
                     /translation="MEPQPSQHPRIKDLLSANSSPVVESPSAESIDAGDKNKKRTNLA
                     CTNCRQRHLKCDGGGNPCSRCIRLKSDCIYLEADKKIVISVKYLDKLQSMISKLKVEN
                     ANLRSLNRITDTKDENSNIQHLSNFKGEALNIGSEAISQSSEKSPNSNKRPYPEAEES
                     QKESDKRSTEIIPPYLESYGRLIHSRTGERFYVGSSSMTLFGLEINRLVAPIIEQKEA
                     SGSPESVTSHNGKNETILEKEGNAYRIMLGKTHSRPGMDVNFTLPSYSYAMLLVDSFI
                     SYNDGCFYFFNEGLVKENLRRIYHDDEKRGFKLDYGIESLNNAPDNDPTLETIWFCKL
                     LLIFAVGEMYLGTANYLNGYKINDKNKLKKQKMSRKSSSVNSSNEDTSKRKKQKYHHD
                     ATKLPGSGFFNQASDLFTGLFASGSIDNCTREGGVEVLLLYAFYLQVADCTAASYFYF
                     GIALRASLLMGLHVDVGKDTLNRFELEHRRRLWWTVYMYERMLASKAGLPLSLTDEDI
                     SSELPNDFDMSNPGPGCENYIFPEAEFISNCVKITKVNATILRKLYTRHPSSNILPIV
                     HELVVSLLKWKKSLPRDINCDFSKDNIEISRLIANMMTEYFQGINLAVRPLLLHFVLV
                     NLKSSNPKEGKYLDLSKYSSIILALLNASFQASINTIRSLWALVPENMVALFGYMDRE
                     YLFNATATLVLFNATFGVFEATNEHLDHALTLFTKMRNLGNHPATLRREQILRLLSIL
                     DFNGAMSTLIAKHDDNKRPPSSMLNSDTSFGHNVSRSTQSNMGNPESFLNTTNEPMRA
                     KTVSDILTAFQMPRSQFQKPQAQPEVQTPTPTQSQTQTQTHSDMNNEIIKRRIIQHQG
                     IHIPESANLEPHSLDNINPPNLAPFSPNLASLFNHIDDVMEIEQLSSNGNDLELWKDI
                     TTKAAWLQNDMVSEIDHIFDTNHDGLENNDNL"
     gene            <490474..>492315
                     /locus_tag="C5L36_0B02530"
                     /db_xref="GeneID:40382759"
     mRNA            <490474..>492315
                     /locus_tag="C5L36_0B02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464612.1"
                     /db_xref="GeneID:40382759"
     CDS             490474..492315
                     /locus_tag="C5L36_0B02530"
                     /inference="similar to AA sequence:RefSeq:NP_011092.1"
                     /note="PKUD0B02530; similar to Saccharomyces cerevisiae
                     YER165W (PAB1); ancestral locus Anc_8.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320471.1"
                     /db_xref="GeneID:40382759"
                     /translation="MSSAEINQLSDNVEKLSVTESTPVTTTEESPAPESQNSEVPSSL
                     YVGELDPTITESELYEVFSAIGPVSSIRVCRDAVSKQSLGYAYVNYQNRADGEKALEE
                     LNYTEIKGKPCRIMWSQRDPAARKNGSGNVFIKNLHKDIDNKTLHDTFSAFGNILSCK
                     IATDANGVSKGFGFVHYDNPDSANDAIESVNGMLLNDLEVYVGPHISKKDRESKWQEL
                     IENYTNVYVKNISLETKEEDLRKLFEAYGNITSMYLATDEAGNSKGFAFINFEKHEDA
                     VKAVEELNDKEFEGKTLYVGRAQKKRERVEQLKQQYEQAKQEKMSKYQGVNLFVKNLD
                     DSIDDERLKEEFSPYGTITSVIVMKDETGKSKGFGFVCFSTPEEATKAINEMHQRIVE
                     SKPLYVALAQRKDIRRNQLSQQMQARNQMRMQQAAVQGGMGQFVAPMFYGQNFIPPMV
                     NGVRGGPFPGQPPMMMQQGAPQNFRGPNGQPVPVYVQPVYGDYQGRMQQQPRHYANRP
                     NQMQQPRKEQSFAQFIASLPVEQQKNALGNKIYEKITESQKVQDQEAIGKITGMLLSM
                     DNQQIISSLENEEIFNHQLDEAIKAYQDFKNNSETAPAEAAQAPVEN"
     gene            complement(<492687..>496985)
                     /locus_tag="C5L36_0B02540"
                     /db_xref="GeneID:40382760"
     mRNA            complement(<492687..>496985)
                     /locus_tag="C5L36_0B02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464613.1"
                     /db_xref="GeneID:40382760"
     CDS             complement(492687..496985)
                     /locus_tag="C5L36_0B02540"
                     /inference="similar to AA sequence:RefSeq:NP_011091.1"
                     /note="PKUD0B02540; similar to Saccharomyces cerevisiae
                     YER164W (CHD1); ancestral locus Anc_8.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320472.1"
                     /db_xref="GeneID:40382760"
                     /translation="MSIRDEIEGNPELYGLRRSGRARTTTESYKFSDDEDVVQTPRKK
                     RQTKKIDSDDEDVDHIDYGGNEDEDNEDEDDDDDDDDDFYISGKPKKSKRKHKPKKSK
                     KTGSRSLTDKFSAQAVRFSSRNNSKSVNYNVDQGDDDDLLESDQDIEEEEGDEESYYY
                     EYNDDSSEPQMAIDIVVNHRVIGDENSSSDEEDDDLTSLPSIVKSENSESKDTKDTDL
                     VKKEKQEKKLRIKELYERGDPKTDFEYLIKWLDIAHIHNTWETYQSLKEKGLKGFKKL
                     DNYINQYIILDREYRRDPFVTREDIEQLDIEEETRRENFEEYKKVERIIDSERVRLDN
                     GESALKYFVKWKRLNYDECTWELASEIAPSAPKQVKNFQNRQNSKILPANSASYGSNR
                     PKFEKLTSQPAFIKGGQLRDFQLTGLNWMAFLWSRDENGILADEMGLGKTVQTVSFLS
                     WLIYARRQNGPHLVVVPLSTVPAWQETFEKWAPDVNVIYYMGNTQARKNIRDYEFYIG
                     GNKKKPKFNILLTTYEYILKDRSELGSFKWQYLAVDEAHRLKNAESSLYESLFEFKIA
                     NRLLITGTPLQNNLKELAALCNFLMPGKFSIEQEIDFDTPNDEAESYIKDLQEKIKPY
                     ILRRLKKDVETSLPGKTERILRVELSDIQTDYYKNILTRNYTALNKGVRGSQISLLNI
                     VAELKKASNHPYLFDGVEENVLSQFGSSRENILRGLIMSSGKMVLLDQLLNKLKRDGH
                     RVLIFSQMVRMLDIIGDYLQLKGLNFQRLDGTINSHRRRISIDHFNAPDSKDFVFLLS
                     TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVSIYRFVSKDTIEEQ
                     VLERARKKMILEYAIISLGITDKKVNNSKNDPSSGELSEILKFGASAMFQKTDNQKKL
                     ENFDLEAVLNHAEDHITTPELGESNLGSEEFLKQFEVTDYKADVDWDDIIPEDELKKI
                     KEEEEKRKEDAFLQEQIEMSSRKRKAAIKPEYQNDDEGEDDEDSEGRSRRRGRKLDMN
                     KLTESQVRSIYRAILKFGNITARIEELIEDGTLPNKNPEVMKKCYFDIHNKAKELIRE
                     AEEKRFTELKELEEAANKEKVSNSQLPPNADGSAYPTPKLQALNMKKKEKKAVLFDYG
                     GCRNLNAETILARPIELDILRKYIPSDDPYKFRFKTDPKPVHGWTCDWKFDDDRMLLI
                     GIYKFGYGSWIQIRDDPILNLQNKIFLENAPANASKEEKDRINKRIPGAVHLVRRSDY
                     LLGFLKDTLNLPVEHGKDANTPPVTKKTRKRGPSKKSQTPDMSDKNGNSSSHGSTGDG
                     SNSSATSADTSHLSSSSKVPTGPKRNGSIHPLLQPVASDLKIWLSKGKGLDKVTWANK
                     LKTSLINIGKCIEKLSHDQPALNQELWLEACKSWPKRGVKAEDIKRVYLKKVKS"
     gene            <498232..>500859
                     /locus_tag="C5L36_0B02550"
                     /db_xref="GeneID:40382761"
     mRNA            <498232..>500859
                     /locus_tag="C5L36_0B02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464614.1"
                     /db_xref="GeneID:40382761"
     CDS             498232..500859
                     /locus_tag="C5L36_0B02550"
                     /note="PKUD0B02550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320473.1"
                     /db_xref="GeneID:40382761"
                     /translation="MSRLTGSDLHLTFRNWSTSGSDDSANSESDLEPDLQDLGTQRNS
                     INLSTVSGLNGPNSLYEGAPGLNAEARAPPNWGSSLVSHINPNTRDRYSLRSTEGGII
                     GGIRRRGSIHVNPDLSVRTLDYNEDDETTEGFMDNWVYGHSFFQSHAEHEALANHSRL
                     IHQNGLSAMMNNVLRCRSAGEDKQDAQPKKRSYLQACLGGTSTPSQYISKSSLKDKFQ
                     PSMYLQNGSFFSVCDLINGNKIQLKFADVNYQDLKASGVIQIGDVTLSFSGEIVDYQH
                     NDLRLNCEKQFIDGNIFNNLLRNRLVFTKRFDRLFDETPRKHSSEKNYLPFSMNRLGY
                     ILSNSTSSKIQNLISCSTRITPSKPRKFPNGSIFSQVQSWHDSSVDVYKSLSRWFELP
                     PLNQYSSTPSPPTPPHSYSHHRCVNTPENLLTCIDCLNSMNSNFVFLKLEIDIQDLFE
                     QSHRELENLYILPDGIFKKRRKFKKLSKRYNSDRNRGSTKYSNSSMKNRTTSASYETL
                     KINGEHTIAVKHSRLENNKISARPNIQYNENSQIYRKDLLEHKHLCGVNVDFLNDYDL
                     FGDTDEDLTDTMDFTDNEDVSDNYMPSHNVPDDTLAAVWPLSTERLMEHHPLIDPEIA
                     SNDGDASDEYDNSYTLSFNGNRSRRLSRLLFSIGLNSDRPSYQDHPVPASQLYKNDAS
                     RLSLKLIATINRSTGDLNIIPANLDPNLWTTSEVDGELFDNVETFGKVFNLFMNSSKE
                     SIFDTESTRNLKNWLINERFEETNYVKTLLALQVLSNPGIVHAYKKRKNLFLKKLSSS
                     NKYLALTIPNTQPNKFKKFKVNSDKVELPHKIMHDELTNLAGAISKFDVDNDRVLTFK
                     SGKIPTGSNISSSFSFAYE"
     gene            complement(<500976..>501425)
                     /locus_tag="C5L36_0B02560"
                     /db_xref="GeneID:40382762"
     mRNA            complement(<500976..>501425)
                     /locus_tag="C5L36_0B02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464615.1"
                     /db_xref="GeneID:40382762"
     CDS             complement(500976..501425)
                     /locus_tag="C5L36_0B02560"
                     /inference="similar to AA sequence:RefSeq:NP_011984.1"
                     /note="PKUD0B02560; similar to Saccharomyces cerevisiae
                     YHR116W (COX23); ancestral locus Anc_2.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320474.1"
                     /db_xref="GeneID:40382762"
                     /translation="MPTDKPEESSTNQGNKKLILTEYLEKLAPSILKPEEAVYVDNKK
                     LRELERKEKDTNKEFVKKNNNQIEEVRFYPDRPTQRSIKDKFIVKEPSKYFDPCQESS
                     KMAIRCMENHDEDYKEVCGEYFRAYRECKKEWMEQRRKDNRSGTSMW"
     gene            <501630..>502916
                     /locus_tag="C5L36_0B02570"
                     /db_xref="GeneID:40382763"
     mRNA            <501630..>502916
                     /locus_tag="C5L36_0B02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464616.1"
                     /db_xref="GeneID:40382763"
     CDS             501630..502916
                     /locus_tag="C5L36_0B02570"
                     /inference="similar to AA sequence:RefSeq:NP_014280.3"
                     /note="PKUD0B02570; similar to Saccharomyces cerevisiae
                     YNL119W (NCS2); ancestral locus Anc_2.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320475.1"
                     /db_xref="GeneID:40382763"
                     /translation="MPAVGDLCKRCKKQKTTILSRKDTFCDPCFVRFIRGKQRKQMQS
                     EKFKVKFKKTDNGTRILMDMRNNHESYAMFDIVFSMLVEQLTQGPKAVRGFDLVVCVI
                     KDSQDQVNIEGIKEMYGESELERLGIQFLVIDPEAYIKMHHYEHLRLDLKKFETIKFS
                     DSSSGFSYENVIAQVSDKSTREDIVEILHEDMLVQASVDNKCTMIAKPFSMTKLAVDI
                     LSDTIRGRGSEIPRFSRNEYVGSFEMIYPLRDILSSEIKIYSSIQNLNSLSLELTKTQ
                     NISNISTKNKTVKDMVLEYFQTLEVEYPEVVSTVVKIGGKLTNPEPLGQNKKCEICKV
                     TIFHDPKTWLEQITVPGFVGPRNEEEEANFRRYLDSITEENVEEDKNVGFDEKVNLCY
                     GCMVTLGVSEVKDFQWPQRPTKEEVLAEYIISDGED"
     gene            <503092..>503904
                     /locus_tag="C5L36_0B02580"
                     /db_xref="GeneID:40382764"
     mRNA            <503092..>503904
                     /locus_tag="C5L36_0B02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464617.1"
                     /db_xref="GeneID:40382764"
     CDS             503092..503904
                     /locus_tag="C5L36_0B02580"
                     /inference="similar to AA sequence:RefSeq:NP_014153.1"
                     /note="PKUD0B02580; similar to Saccharomyces cerevisiae
                     YNL246W (VPS75); ancestral locus Anc_1.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320476.1"
                     /db_xref="GeneID:40382764"
                     /translation="MVKPEVSVDKDVEESMLALKNLEVVIQEAEAQVEKFKNNLFKPI
                     YDKRREYIKKIPKFWYVVLVENEDFQEYVRVEDMKYIESISDIYVEYWDKTPTTQKIN
                     IPKKGFRITVQFDSSHATDYKIKSQTITKDFEWILDQEDGVRKLISTAAEIEWPQELQ
                     SINPQIIKQFAKDEGRSLTADEKKRYRQGMRSFFAFWGWTGRKAGKEFRSGEELATLI
                     ADTIFPIALDFYTMASVNDVQDGDSEDQISGEELDLSETEDPSEPMYKKQKI"
     gene            complement(<503984..>506338)
                     /locus_tag="C5L36_0B02590"
                     /db_xref="GeneID:40382765"
     mRNA            complement(<503984..>506338)
                     /locus_tag="C5L36_0B02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464618.1"
                     /db_xref="GeneID:40382765"
     CDS             complement(503984..506338)
                     /locus_tag="C5L36_0B02590"
                     /inference="similar to AA sequence:RefSeq:NP_015328.1"
                     /note="PKUD0B02590; similar to Saccharomyces cerevisiae
                     YPR003C; ancestral locus Anc_8.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320477.1"
                     /db_xref="GeneID:40382765"
                     /translation="MYVNEMLGKSPSPRKNGKGLGSVPKPTERHRESGENTPLMKRLG
                     STDRYRTFRYDTDTEESSIHDDSRSESVSSSFNFLTSTPRTVPYQVSSDVSLKRKICY
                     YIPCYSWIKEYKLEYFGYDLLAGWTLASYQIPLSMSFATAVAHVPTSSGLLGLTIGPM
                     VYSLLGTVPQMIVGPEAAVSMIIGQCIERTTKHDPSIDPVDVLCNLTFLSGLILFTFG
                     ILRFGFLDNVLCGTLLKGFITAIGLSMILNSCIAILGLEEIMENLPPTVHVHSAIEKF
                     LFLVHYWREYHRITAIVGILSFLNLLFLGFLKKKLIKKKFKKVSYFPEILFTIILFTI
                     FSYALDFEGKEVSVIGEVSLDNLKLKNPFSSVNRAHWGELFPIAFACAILGFFETSTA
                     GKSLSSTLETPVSSNRELVSLGVVGSAVSLFGALPAFGGYSRSKLNAVLGAKSPVSGL
                     CMGLTTLFVTFKMLNSVYYLPICVLNSVIAVVGWKMIEETPSEIKFHIRTRGINELVT
                     FVVTLLASLYYSIEIGVALGCFYSLMRVLKHSTQSRVQILTRVAGTDTFVNPDARDTS
                     TESFPRKIDNYVVPGYKEFRRQSIIGYQSLANVVEGASSEQNAEYSLSNTELKNSDIF
                     PKLEDREGCIIVKIAEPLTFFNANDMRARLKRIELYGSTAQHPGAKSIRKELRHIVFD
                     LHGMTSIDSSATKTFYELIEGYHRRGINVFFTRLFKSNHLFKLLKDSGIQELLSEVDG
                     EEFGIHQTRRPYYDSILDALKAIDKIDATCDWETHSIYSTIGID"
     gene            <506621..>508513
                     /locus_tag="C5L36_0B02600"
                     /db_xref="GeneID:40382766"
     mRNA            <506621..>508513
                     /locus_tag="C5L36_0B02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464619.1"
                     /db_xref="GeneID:40382766"
     CDS             506621..508513
                     /locus_tag="C5L36_0B02600"
                     /inference="similar to AA sequence:RefSeq:NP_014255.1"
                     /note="PKUD0B02600; similar to Saccharomyces cerevisiae
                     YNL144C (YNL144C) and YHR131C (YHR131C); ancestral locus
                     Anc_2.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320478.1"
                     /db_xref="GeneID:40382766"
                     /translation="MEMEQTDPGLAMLLLLEPFPVEPPDYELTLPRVNRPTYTDFKPY
                     NEKLPSYSPTVYKLGVLYRKMEWTSPFEMAQQRTWKPYIFELNNTQLNIYRYPAEADD
                     SILTKFDPPSSFSSNNSYSLLHPYHYHHLMLKKLQHQVAPTALASNDDDVIYSYNEDN
                     FRSIMTTKTDLKALKYFKSINALESTNIVRSYSLQYGKIGLSIDYKKKPHVFRCRFES
                     EQFLIDFPNAEGMVEWYNAINLGIDNSLDLNRREMPTHRTVPRRRRRKVQQMNHPHFS
                     SARNIALGLGFATPGMLSDSNSSSGKSSTSSSGKSKKELKGLFKGKSIDSIFKLGKWQ
                     KFDSKSRPASSNSNNNQLITSHRNMNKIGSDHSHESSPSAHVNTGSFKAFPSSGRSNA
                     SGSPERYNREGLPIDDDGFEIVEEYDDEFIDDDEDEFVVDDGTNGRSNTQDDLDSSIE
                     DTDQEDNEELIDENFDGNIGFLINKFQEGKPSLSALDTPSFSLNSISSCTASGITSMN
                     TGSSKQLCKLRTYREYIAKPSPLSVRAQTYPAQRKIIRDSIRCMVPLTENERWIGKFL
                     LLDYDWKYKPQSKEDVDHHFQSIEVLTHVSDVGSKYKHKFRRPLQEWIVTPSGLLPYI
                     NPSAFH"
     gene            <508841..>509662
                     /locus_tag="C5L36_0B02610"
                     /db_xref="GeneID:40382767"
     mRNA            <508841..>509662
                     /locus_tag="C5L36_0B02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464620.1"
                     /db_xref="GeneID:40382767"
     CDS             508841..509662
                     /locus_tag="C5L36_0B02610"
                     /inference="similar to AA sequence:RefSeq:NP_012918.1"
                     /note="PKUD0B02610; similar to Saccharomyces cerevisiae
                     YKL007W (CAP1); ancestral locus Anc_2.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320479.1"
                     /db_xref="GeneID:40382767"
                     /translation="MSEVESIVRQIIQTSPAGDDTTIIKDIKTLLSNANSDRLISNVL
                     RDHYTQEVKNIQDCGDMKLVRINGDYSIISNYNQKGLKFFDLKKDILFDYDFIGNKVI
                     DIESGVPNELKDESVESLQEELEQYISEYYNESSYGMVIPHNDGIKVLIVGEKLNDAN
                     YYNGKWVSVYTLANDGRFSVVFKIKVHYYEDGNVVMNSVNEKEIGQSTKAQLINDVSK
                     FDNEYELDIMKKINSLNEEKFKNLRRLMPISRAKIQWGRAIGNYKLGQDVAGGRH"
     gene            complement(<509746..>510036)
                     /locus_tag="C5L36_0B02620"
                     /db_xref="GeneID:40382768"
     mRNA            complement(<509746..>510036)
                     /locus_tag="C5L36_0B02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464621.1"
                     /db_xref="GeneID:40382768"
     CDS             complement(509746..510036)
                     /locus_tag="C5L36_0B02620"
                     /inference="similar to AA sequence:RefSeq:NP_012919.3"
                     /note="PKUD0B02620; similar to Saccharomyces cerevisiae
                     YKL006C-A (SFT1); ancestral locus Anc_2.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320480.1"
                     /db_xref="GeneID:40382768"
                     /translation="MSRAAQYEQSNDDQFHALANKVSIFKNIANDINNYAQEDNSQLN
                     SLSNQFSALSDSIKATSAKLTHVIRTNPKVIKMVGIAFLIFLIIYYSLKYLF"
     gene            <510980..>511782
                     /locus_tag="C5L36_0B02630"
                     /db_xref="GeneID:40382769"
     mRNA            join(<510980..511093,511498..>511782)
                     /locus_tag="C5L36_0B02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464622.1"
                     /db_xref="GeneID:40382769"
     CDS             join(510980..511093,511498..511782)
                     /locus_tag="C5L36_0B02630"
                     /inference="similar to AA sequence:RefSeq:NP_011862.1"
                     /note="PKUD0B02630; similar to Saccharomyces cerevisiae
                     YHL001W (RPL14B) and YKL006W (RPL14A); ancestral locus
                     Anc_2.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320481.1"
                     /db_xref="GeneID:40382769"
                     /translation="MSAESKVVSTNWRLVQVGRVVLVQNKLAAIVEIIDQKRVLIDGP
                     SVARQAISLGRVVLTPLVLEGLPRGARTGVVSKKWAAAEIDAKWAKTSWAKKIAQRER
                     RAQLNDFERFQVLVLKKQRNFAVKKALAKA"
     gene            complement(<511950..>514352)
                     /locus_tag="C5L36_0B02640"
                     /db_xref="GeneID:40382770"
     mRNA            complement(<511950..>514352)
                     /locus_tag="C5L36_0B02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464623.1"
                     /db_xref="GeneID:40382770"
     CDS             complement(511950..514352)
                     /locus_tag="C5L36_0B02640"
                     /inference="similar to AA sequence:RefSeq:NP_012921.3"
                     /note="PKUD0B02640; similar to Saccharomyces cerevisiae
                     YKL005C (BYE1); ancestral locus Anc_2.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320482.1"
                     /db_xref="GeneID:40382770"
                     /translation="MSVRRSSRTTKGFHSSRLDDEPQDKLSKPKIIKKKSTTRKQPAY
                     VPIVGESVRCLVCASTDLNYDEDDDPFGPMVECENCKTWQHIKCYFKDAKEEDIPDDY
                     KCDVCDPDNPLYANKRRKMSYARYLSLRLPESHNQKNNEKTKDKEEDEEETKDQQKEE
                     IEGLSESEEEEEEEEVVDAGALEESDDEYEESKKRAHSDDEFSDNDTKPTKKLLLPSK
                     KRETKKQKQTIKSPSIESQQQKQLQQQQLQQPNLKDKNFTKTVNQPLKVTYTLDSLRK
                     NIVKSFETKLVEFIPKTNNEELLNGKTLGELAKSWAEILENGLYGLYPNDQASYKQQA
                     RTLLINFKNSHLIKRVIDGEFTIEQLPTLSNEDMLTASEKKKLEEAKQKAIENVVIKN
                     DTSNLPKIRYTLKGVEIVGDTDTQFDINDRRNKEVEKIQDLKKKEEGEEQNEEEGELR
                     GRYGKQHSHTTPPPNFMMNATHDEEDDYAGDLKNENNDNHDDEDSFVAMGEESTETHN
                     IMDDDIFDNILNDGNSQPKEKKDTKDKVKEKTSAKPKVDTESLLNPSNQPNTPNHSKS
                     KRGLCKGTLVVPDYSLDCEIDFVTSTIKDRRKMIDNAHHIINDFTVDSTQFATKGRLP
                     SSVADTYLDKIIASRDLYLFEIKGVNFDNATFMNIWSVYHSTSKYAVIDHKLRYVKDI
                     YLLCYSRSKIIDGEESPSLISIFSTDMYEHLLDDESSDCKMYILFVVQRDVDRLKPLV
                     SQQALQKEAPKDDAKAENDDDYDPTISTISKPNITELPNDSNQTPDINPLLADLVKNL
                     GS"
     gene            <514678..>516576
                     /locus_tag="C5L36_0B02650"
                     /db_xref="GeneID:40382771"
     mRNA            <514678..>516576
                     /locus_tag="C5L36_0B02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464624.1"
                     /db_xref="GeneID:40382771"
     CDS             514678..516576
                     /locus_tag="C5L36_0B02650"
                     /inference="similar to AA sequence:RefSeq:NP_009681.3"
                     /note="PKUD0B02650; similar to Saccharomyces cerevisiae
                     YBR123C (TFC1); ancestral locus Anc_3.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320483.1"
                     /db_xref="GeneID:40382771"
                     /translation="MENRNKVAPLLDLDVPSLISVEYPLRVKDTNKAIDLIGGTEKLK
                     KCFIEPDMKLELRLRPNDPFSHPIRSNVVKNSSNVLINFRLPKRVLAKCGGDVRKSIE
                     YCENEGIRYTIKPVGVLRQNYKFRELADFQRINKDSNFSKTFDESIRNGNFEKIAEFS
                     NELMSSMDALQKFEDGDLDIPPLVRYARTDVSHNYRYHGKLLLDEQGEWLNKSVKLYT
                     IIVKFGAQVPTEHDPALAKERERVEKEIEEMREDGTPERMIHDSPSYILLECIKILKK
                     LFDMKPVWIRRHIYWLLPKKYRPQLKFALPFVSFTYSKGPWRHSFVKFGYDPTKDPNS
                     YKYQIEAFRSSSKVNHDVEIEKVIENDEDIYILPPTLYDYIDEFANPDSEINKLRIGK
                     IPRQIFFDGKTACNSLSFQIGDILDDEVKKILENLKLEPVCNIETGWIDFTTLYRVKN
                     VIKYKLRCIRDGTVISEDRVHELMNRTKAGSKGGEASEESEGGDDVDDDDYDNDDGDD
                     DDPVSDPADDNGSEEIGDDENDNMIKQRDSNGGTRKDGLNNSASTNKRDKAIPKENGN
                     SNGNDDRESLRGVKFRENMLKSCGDDLLDRLQRLNPKSVNLITEIDELVKQENVMGDL
                     LQNPALKE"
     gene            complement(<516863..>517261)
                     /locus_tag="C5L36_0B02660"
                     /db_xref="GeneID:40382772"
     mRNA            complement(<516863..>517261)
                     /locus_tag="C5L36_0B02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464625.1"
                     /db_xref="GeneID:40382772"
     CDS             complement(516863..517261)
                     /locus_tag="C5L36_0B02660"
                     /inference="similar to AA sequence:RefSeq:NP_011759.1"
                     /note="PKUD0B02660; similar to Saccharomyces cerevisiae
                     YGR243W (FMP43) and YHR162W (MPC2); ancestral locus
                     Anc_5.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320484.1"
                     /db_xref="GeneID:40382772"
                     /translation="MATGAAGANMFKRFLNSETGPKTIHFWAPCMKWMLVLAGANEMT
                     RPVEKVSATQQLSLFATGAIWTRWSMVIIPKNYLLASVNFFLGGVSIVQLIRIANWRI
                     NDLGETPKQAIKYMFDIKDDEKKTIVPKPE"
     gene            <517959..>519836
                     /locus_tag="C5L36_0B02670"
                     /db_xref="GeneID:40382773"
     mRNA            <517959..>519836
                     /locus_tag="C5L36_0B02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464626.1"
                     /db_xref="GeneID:40382773"
     CDS             517959..519836
                     /locus_tag="C5L36_0B02670"
                     /inference="similar to AA sequence:RefSeq:NP_011982.1"
                     /note="PKUD0B02670; similar to Saccharomyces cerevisiae
                     YHR114W (BZZ1); ancestral locus Anc_2.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320485.1"
                     /db_xref="GeneID:40382773"
                     /translation="MDVSIGDEIKDGFKKTESWVKSNLAFVQEMESFYKQRSLIEREY
                     AEKLTKLAQESLQKTTKLGPTLSVGDEPTITPGSLECASVVAWKEVLIQCENIAREKM
                     KLSGKFDSYVAQGLSKLAIKYSGIKDRWKQFDDDLKSTRDKHYNDMTVKKKAYDSACE
                     AMESQRAKSLKSTNEKHQEKLTKREAEMNISKNAYLISISVCNGLKDKYYYQDTPEIL
                     DGLQELNEAKVSKVNSILLSSSELEKKSNERINTFIDSIDSVVKQNLPKLDTAMFVKH
                     NISNWSEPAHFQYIPSSIWHDDDQMIVNDSALYDLKLRLNNACATYEKLSEICNDEKQ
                     VVEEVLVERNKLVGDTFNEVQVKTPEEYQKFEELLIKSISTLQKFTNDDTKRVMAEVE
                     IQTIQSATGDIDMTITTPIHEKKKSKFGFLKLNKHQGNSAEEPEMEVQELSQDVNNIR
                     ITPSNTKSRLFNTLGKIVDAYNTPVGEPINFRSTTTSSLSKVAIAQYPYEAQGEDEIS
                     MNKGDQFDIVDEDDGSGWTFVKSSYDEGLVPTSYLKIEQVQLQQKKKIPPKVVPRKNT
                     KTIKRMEILYDYQSQGDDELSLQTGDIVTIIQDDDGSGWTEGEINGETGLFPTSYGTL
                     V"
     gene            complement(<519930..>521204)
                     /locus_tag="C5L36_0B02680"
                     /db_xref="GeneID:40382774"
     mRNA            complement(<519930..>521204)
                     /locus_tag="C5L36_0B02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464627.1"
                     /db_xref="GeneID:40382774"
     CDS             complement(519930..521204)
                     /locus_tag="C5L36_0B02680"
                     /inference="similar to AA sequence:RefSeq:NP_009558.2"
                     /note="PKUD0B02680; similar to Saccharomyces cerevisiae
                     YBR004C (GPI18); ancestral locus Anc_3.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320486.1"
                     /db_xref="GeneID:40382774"
                     /translation="MCNLGFGCYPPTQNSLMLKIESYQYRFLHVLIGLFVVRIIQAAV
                     VYFVPFQFDTSSAILIDKYKSEIPKYPGWLLQILNNLTAWDSVYFLKLSMDGITYEHE
                     WVFGPLWWRMMRIFKTSMSFYGIEMDIYDVLVSFIILNNVLIILISYILYHLCLLICE
                     GNLKLIGKLNNKKFAYYTSLIILIQPSGIFSTVSYSETMVQFLSYLGVYLYLSSRGRV
                     TLSNRVRYFLSGTLFTIAFGFRSNSLLYGIIYLTDLLQFRNIKDIFTILITGAQLFIG
                     LALSIYIPYSIYCPERGEWCNSFSKSLVLYAQSHYWDNGFLKYFTIANIPMFVIAAPQ
                     LLILGLSINFFKSWVTLKSLTIMSAIYLALQFTTMHVQIVNRVSTFIPLHIWYVSYLY
                     TVNPERGRWILKWWIFWVILQTALFAAFLPPA"
     gene            complement(<522438..>524471)
                     /locus_tag="C5L36_0B02690"
                     /db_xref="GeneID:40382775"
     mRNA            complement(<522438..>524471)
                     /locus_tag="C5L36_0B02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464628.1"
                     /db_xref="GeneID:40382775"
     CDS             complement(522438..524471)
                     /locus_tag="C5L36_0B02690"
                     /inference="similar to AA sequence:RefSeq:NP_012861.1"
                     /note="PKUD0B02690; similar to Saccharomyces cerevisiae
                     YKL062W (MSN4) and YMR037C (MSN2); ancestral locus
                     Anc_2.598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320487.1"
                     /db_xref="GeneID:40382775"
                     /translation="MKMAVKFTNTSSRDRQVTPTLDDGTNCLATQKLSDLAARAHQSQ
                     SKLCVNNVTQKDSDDSTSNLELFHNLSSPCITSVSNYQSRLHANEREDSYICHYNKGL
                     YDPRILKTVDPSQCILDGSKNNVFMTDKMSNFFKASNLNEKMSIVDRSFLFDSNLKNT
                     AEFYSKLDNIEITNSQYYQEYLYDDPIYANTLENNRSFESTSYELDSVISNSNSRIHT
                     MEEDNGTINPIFFHHTPSPNNTTSIRIITSSNRITKLRDRKLIQAIHKSLKQHNSNYL
                     DDNDEKINTNYNGFKTLNDNQTYKLRRLSGDLTSIHIEANEIPNQQQSIQPNYTSCKY
                     SDFPSTFSENIFRGKETQYKEATPRYNDFDSFQPEAKILREMEKERKSLETIACTQKL
                     IDNTKQNALHIEKVEDLGNSEEIKQNVMSKQGKAKEGVEEAEDEEAREELSEVDIHGI
                     NITADCNSSDQRDVIKPQMKKVKGLKSNSQECKSQLSQDTALPKRKIVLTFKRHNKKY
                     RQGNSIMKNKERENDCSMNNSFGKLNQIKQVSNIMEFEIDKPKLIKAEEQEQDTQEIE
                     KDNDIVLEIFRASLKRNKDNFAKTKSSDVLLATKIPRVRAQRSNKKNPNKAKDNIYKC
                     LQCPKEFKQRSQWKRHIDCIHLKIAKFACIKCGKAFKRSDHLKNHIRRIHGQP"
     gene            <525254..>528067
                     /locus_tag="C5L36_0B02700"
                     /db_xref="GeneID:40382776"
     mRNA            <525254..>528067
                     /locus_tag="C5L36_0B02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464629.1"
                     /db_xref="GeneID:40382776"
     CDS             525254..528067
                     /locus_tag="C5L36_0B02700"
                     /inference="similar to AA sequence:RefSeq:NP_012874.1"
                     /note="PKUD0B02700; similar to Saccharomyces cerevisiae
                     YKL050C (YKL050C) and YMR031C (EIS1); ancestral locus
                     Anc_2.590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320488.1"
                     /db_xref="GeneID:40382776"
                     /translation="MTTQYADSTHSLTSKSSKYNVYQTDGKPLSTEAIYRAKLKYGVY
                     TNPAKISLGVDPSASDTAAILAANTDLSIHPYARGLSSEAAHAALIAKPDEIVRWNRE
                     SVAPEAEYAAISVNSLKFPFDAEADKETIQSTDVSEDQNAAAAASSVLNKKYSAKQHL
                     KDLYAFDDVRSGKATLSDFSAKNLKSTKSLSTSKDYRSGIPTSNKAIEKSRKININGV
                     TQSATKRANTLLNTRMTPEKDFRSGIKTSSTNTISNRDASIYITNIHQQAVKAKDKEL
                     NRKTTRVMGIETASDRGISSDPNKFAAATLKWDPSKEDVKSTIKDNKLVTQSLYAVAS
                     AKVNKDLEKLNENLDNKVFTANAKAYESAYKVASENAAKRKAKSLQPGEVNLGGGLKM
                     KVNDINQIASSLVTPALTDLSSRISEMKVIDAEKKKLPAKIKQREAEFKEEQRQARIA
                     VERKRAEEAKARRDQLEVDKKALDDELEQFRLELQAKYNEREEEFNKQVEQQEEEKKV
                     IDEERASKLKVLQDAKAENDAERTLELEEMTKDKDDDLAPLLSELETEQSKLNELVTV
                     REGKEAEYNEEKKKTDAINAELEDTLKQIEEMQEHIAKLSTGLEEISEKEAFATSGAL
                     ESEARLEGEGKEKQAKLEPLEKEKEEHFAKRTELRSKVDQKADELKKLHQDHYNEEKD
                     INEIYPEHLRKEVNVPEEFNDDDLNDSKFPLDETGVEIPPEIEEEPEHVPDEVRPKHA
                     SLEPEVVPETNAEERTATKTDGAFATAPVGTKQVVRSMVGDVKVTDLPVKSERAKAKS
                     DEADKAAKPSTKSAEKTAPKSVVKSNKNKNSGGILGFFKNKDFKNLSATPKPKPRPVS
                     KPSTSSTKKSNTISATPKVTAKTTPAKVEKKPAPTAVSDETDAPKTATKPVKADGPNP
                     NETTTKVDDDVFSGFSQGSEVEA"
     gene            <528763..>529275
                     /locus_tag="C5L36_0B02710"
                     /db_xref="GeneID:40382777"
     mRNA            <528763..>529275
                     /locus_tag="C5L36_0B02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464630.1"
                     /db_xref="GeneID:40382777"
     CDS             528763..529275
                     /locus_tag="C5L36_0B02710"
                     /inference="similar to AA sequence:RefSeq:NP_012875.2"
                     /note="PKUD0B02710; similar to Saccharomyces cerevisiae
                     YKL049C (CSE4); ancestral locus Anc_2.592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320489.1"
                     /db_xref="GeneID:40382777"
                     /translation="MARYKTKSTAVSASKRTSKPSKALKGKATEEVVEVKRNIYSSDE
                     EAEWLSEKASISSGLLKNQPGDPVDVKKRRNRKGTVALREIKKYQKNTDLLIRKLPFA
                     RLVREIVQTEFGNDADYRWQSVAILALQEASEAYLVHLLEDTNLCAIHAKRVTIMQKD
                     IHLARRLRGE"
     gene            complement(<529533..>530984)
                     /locus_tag="C5L36_0B02720"
                     /db_xref="GeneID:40382778"
     mRNA            complement(<529533..>530984)
                     /locus_tag="C5L36_0B02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464631.1"
                     /db_xref="GeneID:40382778"
     CDS             complement(529533..530984)
                     /locus_tag="C5L36_0B02720"
                     /inference="similar to AA sequence:RefSeq:NP_013747.1"
                     /note="PKUD0B02720; similar to Saccharomyces cerevisiae
                     YMR033W (ARP9); ancestral locus Anc_2.593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320490.1"
                     /db_xref="GeneID:40382778"
                     /translation="MAPTYKEDSYLIFQPGSVNTLAKFGLEDPLGLPSHTFDTKVYKK
                     KNEMLDADGDQETLYTTENKQGDANEYEEILPIVQGQIVDITALQVFLKSVLHAVLKV
                     EKDETVEKENEENDNSEKEAKEELVMPLENVNLLIVQNSSRWNPFHVESLVKYGFEKL
                     GVHSVSVVPIELCVMFAYGSLANALVIDIGYEKTEILPIVDYQLFSPSKKVVFKGGDH
                     INKSLSKLLPSLSNDQIEELKRSSIFECLSEEDAKKSFFGMEGLIENIEDDEKEDDGV
                     LDIAAIVTSDKSTREILEDTDTKNKKKVETRPNSELETNQFQDTHGNIITVGKERFQG
                     CNELIDSLVFHIYHCLRKIPDLKKRQDCYDNIIFAGKTSKIKGLKEKVMFHLFERYVV
                     LSDNKLLQPQAQFRNDVRPVDDTSLGQVPRHLKIVPKVEYFSEWKKTGFEDCSFLGAQ
                     ILSKQVFTATNELCMTKDTYEESGPLAIWNICL"
     gene            complement(<531526..>533838)
                     /locus_tag="C5L36_0B02730"
                     /db_xref="GeneID:40382779"
     mRNA            complement(<531526..>533838)
                     /locus_tag="C5L36_0B02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464632.1"
                     /db_xref="GeneID:40382779"
     CDS             complement(531526..533838)
                     /locus_tag="C5L36_0B02730"
                     /note="PKUD0B02730; Pfam Domains:
                     Sec23_trunk(1.6e-56)|Sec23_helical(8e-23)|Gelsolin(1.5e-
                     16)|Sec23_BS(1.5e-13)|zf-Sec23_Sec24(1.9e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320491.1"
                     /db_xref="GeneID:40382779"
                     /translation="MQSQFEDYEDKTGLKFAFNIFPRSKSQEKKCVIPISCLYQPLRP
                     KDEPVVLQSYPIACFTCKAILNPYCILDSNLRSWTCSICNNRNQFHQDLNQLPIEMNP
                     SCIDIDYVIPENTNAGLAVRKPTIFAYVIDLAIDEDELSALKEGLLNSIAMLPANSLL
                     SIITYGKNVNVHEVGNFEYNSIYVFNGLKEYTREEVGKKIGLSQRNIKNLKNQTHDEI
                     VNRFVQKTSICEYSITNLIKSLKKDSFKCEKYHRNKRATGSAVNIAFHMMNTLYPKIG
                     TRVMLFTGGAATVGPGSIVDTSFKDAIRSHHSLLKDSKISRRYQENIKFYEKIAEKAS
                     INGHTFDVFIGCYDQTGLTEMECLVSKTGGVVVQSDSFSSAIFKQSLQKFLSINEYGE
                     SQFGLNATLEVKAKNMTVNGFIGHGTGIYLKDSANFKFYAEKSKNPVGITGTNIFKLG
                     SVSTHSSYAIYFDMADHLVGDYSIIQFITSYQHPDGSQHIHVTTSQKFINQEGESLNS
                     IIQNFDQEAATVLIAREAVLRTEKNSSNDALKFTNQILVDFMSSFCQYQTNNANSVLI
                     PPTVNLLPQFIYHLRRSNFIQIFNASPDETTFYRHCFLTEDCINTLIMIQPTLTAYEL
                     DKEPEPVLLDSTSITPDRILLLDTFFHILIFHGSTIADWRRQRYQDQPDYEYFKQFLE
                     LPRQEAADILVDRFPLPRFIDTEEGGSQARFLMSKLNPTTSYNSNQSAHSLGTYGLQD
                     QTGSGAVIMTDDISLQVFMKFVNEAIVKPT"
     gene            <534040..>534705
                     /locus_tag="C5L36_0B02740"
                     /db_xref="GeneID:40382780"
     mRNA            <534040..>534705
                     /locus_tag="C5L36_0B02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464633.1"
                     /db_xref="GeneID:40382780"
     CDS             534040..534705
                     /locus_tag="C5L36_0B02740"
                     /note="PKUD0B02740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320492.1"
                     /db_xref="GeneID:40382780"
                     /translation="MHVTAYDTLDDLVKSFSIHTHEETLPNIQLVIINHEGNEEYDDN
                     NKTESKYLPSIKLSIKDITPKLWSSIFSKTRLTFIHFNDLDLVYSVLCQTLLRLQLMD
                     KVNDMIVIDGLISCLSVLFLRFVELQQIDYEKLNFRKLYLVLDKIHEIDEISGYRVQL
                     NETKDIWDVVDKIYIPFSHESDYPKMMECLSSNSESVSDKEVQQFYCLHEMLLKFNIK
                     RAQ"
     gene            complement(<534708..>536129)
                     /locus_tag="C5L36_0B02750"
                     /db_xref="GeneID:40382781"
     mRNA            complement(<534708..>536129)
                     /locus_tag="C5L36_0B02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464634.1"
                     /db_xref="GeneID:40382781"
     CDS             complement(534708..536129)
                     /locus_tag="C5L36_0B02750"
                     /inference="similar to AA sequence:RefSeq:NP_011861.1"
                     /note="PKUD0B02750; similar to Saccharomyces cerevisiae
                     YHL002W (HSE1); ancestral locus Anc_2.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320493.1"
                     /db_xref="GeneID:40382781"
                     /translation="MSIETLIDQITSPNLQDDDYGLLLDLVELVNKTPTTNVIEAVRF
                     LKVKLQSSNANTLLRAITLLDFLAQNCGAMLKASISTPDFVNDNLLPIIADNLIHISV
                     KYALIKEIYKLQKTFANDESLSIYKDTFSNLKRKLPNLCQQAIDEIDSNNKNSYNPSG
                     GSVEEEELELRKAIELSLKESSLPSRASTQPQGVPQQIQPQGVPQQIQPQQQFQQQFQ
                     LGQQLQQQPQFQPQFQSQSQPQVQQQPITSPQQQFQQAAPTRIQEDPSRPDKVIALFD
                     LSTDDEDTLSFRKDDIITIVEEINKDWLRGCLNGRAGIIPTNYVKPIPKTLESDIQNL
                     IQVLNSSFDIETTLSKLMDLNKKVKNSSMTSQQFENALLSNSFPDKIQNIEKVKAQLK
                     QILELQKLKLLELQSIQSNIDHSLQLYQQLITESAPEPENPDISNFIQTYPDISSLSL
                     NSSPQSTEEYIPPSMTGSYPQRR"
     gene            <536829..>538502
                     /locus_tag="C5L36_0B02760"
                     /db_xref="GeneID:40382782"
     mRNA            <536829..>538502
                     /locus_tag="C5L36_0B02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464635.1"
                     /db_xref="GeneID:40382782"
     CDS             536829..538502
                     /locus_tag="C5L36_0B02760"
                     /note="PKUD0B02760; Pfam Domains: MFS_1(4.8e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320494.1"
                     /db_xref="GeneID:40382782"
                     /translation="MGGKPSQISIHTSEKSADFINSTKKETDITSYNESIISESEEAE
                     ESANNPFLNEKFKEKYIRLYEDTRYECRSSLDANFKWTKQEQRRITWKLDLTVTLMAC
                     FFFVSLNMDRGNLAQAVSDNMLKDLKMTTNNYNTGNTIFYVCFLAAELPSQLISKRLG
                     ADVWIPIQMTLWSIVTICQFKLGGRHSFYACRALLGLCEGGFIPDLILWLSYFYTSAE
                     LSIRLSFFWTAMYFTKIINYLIAYGILHMRGVRGHAGWQWLFLIEGLLTLVVGISAFF
                     LMVPSPVQTKKPWNPKGWFTEREEKIVVNKVLRDDPTKGDMHNRQGLNLKMLVEAISD
                     WHLWPIYFIGLIAYIPENTIESYMTLLLRDMGFSTFHTNLLCIPYNFLRIIMLLLTTW
                     LSERVTNIFGTALIQPLWTSVCIGVLRFWSGNFYEKWQTYALLTVFLSVPYIHAMMVS
                     ATSRNSKSIKTRTVGSSLYNMFVQTGSIISSNIYRTDDKPLYHKGNSVLFAFALLMFP
                     TLIATKYFYRRLNSKRDEIWNNMSDQERDEYIATTTDKYSSRLDFRYAH"
     gene            complement(<538857..>540062)
                     /locus_tag="C5L36_0B02770"
                     /db_xref="GeneID:40382783"
     mRNA            complement(<538857..>540062)
                     /locus_tag="C5L36_0B02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464636.1"
                     /db_xref="GeneID:40382783"
     CDS             complement(538857..540062)
                     /locus_tag="C5L36_0B02770"
                     /note="PKUD0B02770; Pfam Domains: TauD(7.2e-104)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320495.1"
                     /db_xref="GeneID:40382783"
                     /translation="MPVTISRRNGSSKLNMMRLQTIENKEYLPPSNEVLSEVKYPKWA
                     PTWEKDQDHQFDHIGVFKHVDRGFFGDFRFKSLKNSDVKFKHVSPKLGLEVDGIQLSN
                     LNNQQKDDLALLVETYGVVAFRNQDFKDQGFEEIKDWGRYFGPLHIHPTRGAPKNQPE
                     FHLVFAKGGLEVNKDLFKDRLHKVSWHSDVSYETQTPGITAFTMLQTGPSGGDTQFLD
                     MFEVYDRLSPLMKSRIKDLKALHSSKAQAEEASKSGSIERKNPIESIHPIVRYHPVLK
                     RKCLFVNRGFTRRILGLKTEESNKLLAFLLKHIESCLDAHIRLSWDENTVVVWDNRRV
                     QHTATHDWPDTNCIRHAFRVTTIAERPIGSQEEYEKWSPHLEKESIKHTEYIANLSPE
                     EYFEQFIQS"
     gene            <541258..>542607
                     /locus_tag="C5L36_0B02780"
                     /db_xref="GeneID:40382784"
     mRNA            <541258..>542607
                     /locus_tag="C5L36_0B02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464637.1"
                     /db_xref="GeneID:40382784"
     CDS             541258..542607
                     /locus_tag="C5L36_0B02780"
                     /note="PKUD0B02780; Pfam Domains: GATA(4.5e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320496.1"
                     /db_xref="GeneID:40382784"
                     /translation="MNVPENTSSIVPVKLLKQELLNEMANNSNTSLEIFKMFNSNNNL
                     LPRNERILNLSWRMNSINRISKPRRRSTGQHSRTISNSSSNYKNITLLNSFNNNDHLL
                     EVSKPMDSHSEKSDHVEFDYIEHIRRISKEEYGIDVDQGKDEDYEMNFLKEVHSPVTA
                     HSLSVSSTTNSVFSYNNQQQFPTSSNSTQKQNSSMKKLSTTSTPATSTESRNNHTTSV
                     LKEDFSIDNYLNLEENFTELISGTKQEDNLNSYLDSDLSNYINNLEFSINGSNGETDT
                     IKKGSVSSINTFSLSSNATPMTISTSPDFMQLQHLTSKAPPVAPQVTKIDSMSTLNSS
                     QPICENCFTTTTPLWRKTSDNRLLCNACGLFFKLHGVIRPPTNNPHYHQRNLQASPSK
                     NCDNNLKPFPLSNEVSPFTNPLLSTKRRSSNNSLNNHRVPAKTEALSADLDWLKFEL"
     gene            <542775..>543182
                     /locus_tag="C5L36_0B02785"
                     /db_xref="GeneID:40382785"
     mRNA            <542775..>543182
                     /locus_tag="C5L36_0B02785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464638.1"
                     /db_xref="GeneID:40382785"
     CDS             542775..543182
                     /locus_tag="C5L36_0B02785"
                     /note="PKUD0B02785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320497.1"
                     /db_xref="GeneID:40382785"
                     /translation="MRSLPQPRYSRRRTLQRIFRSVVNLFSTGYVSDSSAFTHHTVLD
                     RSSHKTRIRRSRVTGRPTPRHTVVSKLGNKLVSELIEDETIIANIVTNEFGSFATKIG
                     HGGITAANDVNRNAKKGWLSLWKRGKHVDLGIF"
     gene            <543454..>544629
                     /locus_tag="C5L36_0B02790"
                     /db_xref="GeneID:40382786"
     mRNA            <543454..>544629
                     /locus_tag="C5L36_0B02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464639.1"
                     /db_xref="GeneID:40382786"
     CDS             543454..544629
                     /locus_tag="C5L36_0B02790"
                     /inference="similar to AA sequence:RefSeq:NP_013941.2"
                     /note="PKUD0B02790; similar to Saccharomyces cerevisiae
                     YMR214W (SCJ1); ancestral locus Anc_8.730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320498.1"
                     /db_xref="GeneID:40382786"
                     /translation="MNINFLNHLSQIRLVIPSTMVHNPISILVLLLSLLTIVLAGEDY
                     YKILGVDRNADEKEIRNAYRQLSKKYHPDKNPGDENAQHKFMEISNAYDTLMDEEKRR
                     IYDQYGEEGLQGGAGNHRGGGGGGGGGFGGDPFAQFFGGGFRRGPQRAPDVTSEITFT
                     LRDFYNGKNVDIQINMVGKCEKCNGSGSSDKSRTQCTQCGGHGRLVQRMNLGNGMIQQ
                     FEVPCPKCNGEGHIIKNKCRTCHGQGVHNQVKTFNVHLNPGTPRNYVEVFSGQGQAQP
                     RMEPGDLRLQLKEDKTDNDGYRRVGSNLYRTEALTLKEALLGGWEIKIPFFDQYDPFL
                     TLSRKKGVMVQNGEVEVIKGKGMPIFHGNDEYGDLFIEYVVVFPTNSKKLKQLHDEL"
     gene            complement(<544683..>547043)
                     /locus_tag="C5L36_0B02800"
                     /db_xref="GeneID:40382787"
     mRNA            complement(<544683..>547043)
                     /locus_tag="C5L36_0B02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464640.1"
                     /db_xref="GeneID:40382787"
     CDS             complement(544683..547043)
                     /locus_tag="C5L36_0B02800"
                     /note="PKUD0B02800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320499.1"
                     /db_xref="GeneID:40382787"
                     /translation="MMEKHDIDISESLKTLNLKLKELDKKIQSYSSGSSRKGPSGVSK
                     GETLMTPNSHPKQFSRHDINETVEVCNQLWVVNGLIDDYKQSTNFTDKLKSFYRLQKK
                     IDQIKSGYMPQSEVSQVKIFGELDNLLISYQTELNDTSNHKFQEYFNIREYPDIKIFP
                     EVDGVLMNEFFKLTRGLLSVKINEHFNIAKIFNNLLNTAFDKFDDGFVVEMEKNVLHF
                     EKSEYSFFGLVNSVQQVICFIDYTASLICDIPEYSNFRYILGKTILRELRRRMFDRKN
                     VYLLIVEKLGYDDDDDNGNKYKVTMEQSSIAVLYKIASQLSTEGWSTDGICDLEFWID
                     DLITSWVDNLVDGTVDEFKILVLRLIHKEFEGELNENNLITVEIGDDYGKESAALNGQ
                     SITNEWNNDWGKHDVWEADGDKDGDGDCTDKKEVEGKLDQSDLGLELEDDGGWDVDEE
                     LDLDSISEASQKGKAKIDDDDWGAWEEEVDLELDDATSRNLNKTTFKYSPLVLHLLKV
                     IERYMMNYTSLKELGVSEDQVEDSKALFKQGLKKLCTSYFMMIESQLFTTYKNSVLFY
                     NDFNKLLEECGRVYDIDFTNCHKMNLSFINEYVNDKILLLVKVLDDYALTIWNDDELD
                     NGEKLEGYSKEFLIRFNSQFDEVFFELSKLSHLNKQLVVNTLITITFQVSNNICNRIT
                     CRKDISSFESNILSNIIDSITQQLEQKVNTMGIKAEGIQSWTKLQQIKLVLSANLKGI
                     LDDFYDAKFYELETHELVSLIKSLFVESPQRTRTITEIQSARETQT"
     gene            complement(<547244..>550372)
                     /locus_tag="C5L36_0B02810"
                     /db_xref="GeneID:40382788"
     mRNA            complement(<547244..>550372)
                     /locus_tag="C5L36_0B02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464641.1"
                     /db_xref="GeneID:40382788"
     CDS             complement(547244..550372)
                     /locus_tag="C5L36_0B02810"
                     /inference="similar to AA sequence:RefSeq:NP_011561.3"
                     /note="PKUD0B02810; similar to Saccharomyces cerevisiae
                     YGR047C (TFC4); ancestral locus Anc_1.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320500.1"
                     /db_xref="GeneID:40382788"
                     /translation="MTSPRSTSHNGADFDLDHFSKDQLRQLLDDDDYNEEALEFSDDN
                     DDSINDGYSLNGEEEEEEEEQDDEDIDLQGDALEDADDDSELSDFEDSAESKQKRYQT
                     LADLGFDNDDEAHDSNSDNDSDDEFTFRNALREARNFKVKRKRPKKRGGLAAMRRRMR
                     RTELDPEVKLLLSQANEAFAMNELDKAIKIYKQVIKLDKNNFSAYKTLGEIYRMQNDV
                     NRCSNIWLLAAHLNPGDVDFWKTVAELSVELGHFKQAIYCYRRAISASKGKDYDAIFS
                     RACLYREVGKYKRASSGLLKIRSVLPSDSKIVRELAKVYVEEGRVNDAISLYTKILDD
                     NVKYRKLVDKGESVTLENIIFDWSELNILSELYASKAAWVLGIKALRQVSRWIQEREE
                     QTFWDENPNNDIEFDERRLDHPRFQKLKARDGSLDYSLPIDIRVQLGIFRLNNKQEEE
                     SLKHFSVLLDQPVEETPDLFFKVGMELESFGLFKEALEFLIPLSYHEEYNTYELVTTI
                     ARCLRETEDFENAKDTYIRLLEFDKDNVELKVALAECYFYLDDIEQANRLYRDAKLER
                     LRERTKNEEHETRESILSEEEEEEDDLGFGQNDIGQTQAIIEDYPVKKKKKKRVKYTN
                     DELKTMSLKSEIRVKKLYTKCSSILKQIEDLQTGDLTEVEEESLKVRTRVWIELVSDL
                     ITIFTMYKMFFPQDKLVAFNTRLRLRTAKLNIDQKLLRMKYLQTEIILTQQYSNDEIP
                     EIGFKGLTYEQWYYVFVKYALLVAEFEKDTETATSVEEIIRHAIVFKEKELTTRLVGL
                     SVGILTQDSQIIMNQTRGLMNEYQFASDSFRLYLASFIPNSEMEQKYADAPSQKFLLR
                     QIKAFDYLKDPGNDAIVGKATITKTNVDLSKDHFTLNYIYASYLFMNKSYTSALVYLM
                     KLYYSYPNNPELLFLLSLANLHRSVQRKTLNSSFQVLQGLSYMMEYIKTKDQSDPYYR
                     MEALYNLGRYFNLLGLDHIAVVFYGRVLNIEVDDSAYDLKKEAAHNLYTIYNLNGNHA
                     QAEAIMDEYLVI"
     gene            <550779..>551774
                     /locus_tag="C5L36_0B02820"
                     /db_xref="GeneID:40382789"
     mRNA            <550779..>551774
                     /locus_tag="C5L36_0B02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464642.1"
                     /db_xref="GeneID:40382789"
     CDS             550779..551774
                     /locus_tag="C5L36_0B02820"
                     /inference="similar to AA sequence:RefSeq:NP_011562.1"
                     /note="PKUD0B02820; similar to Saccharomyces cerevisiae
                     YGR048W (UFD1); ancestral locus Anc_1.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320501.1"
                     /db_xref="GeneID:40382789"
                     /translation="MMKDGANKDVANYGGKIFLPQSALHKLSMLNIRYPLLFKLSNTN
                     TGKHTHSGVLEFTADEGRCYLPDWMMDTLGVSPGTVVKIETTDLAQGNFVKLEPQSVD
                     FLEISDPKAVLENALRNFTTLTVGDIIELKYNNNVYKIKILEVKPESPLGGICVIETD
                     LVTDFATPVGYVEPDYEKLKEENNKKKREQALSAPSLKGKGTMATKINYGKIIGSSKD
                     NENKSFQGQGVKLSGKKVSDVLEKKFETEDLDLTGPVKPLELPPGYLFFGFPYKPYVD
                     EFEAAEKERDSRETIVVFQGQGQSLRAKKRKDKNKGHIPSKNKVRSPEAIVIDSD"
     gene            complement(<551836..>552654)
                     /locus_tag="C5L36_0B02830"
                     /db_xref="GeneID:40382790"
     mRNA            complement(<551836..>552654)
                     /locus_tag="C5L36_0B02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464643.1"
                     /db_xref="GeneID:40382790"
     CDS             complement(551836..552654)
                     /locus_tag="C5L36_0B02830"
                     /inference="similar to AA sequence:RefSeq:NP_011387.2"
                     /note="PKUD0B02830; similar to Saccharomyces cerevisiae
                     YGL128C (CWC23); ancestral locus Anc_1.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320502.1"
                     /db_xref="GeneID:40382790"
                     /translation="MDRSLENTIRLLLDSGKDAYDILEIDRNASNEVIRSAYRKKALK
                     FHPDKNNGIDVNDRFKFVSLANIVLSNDIIRKEYDIEVEKRKISTENTNPSVHKFKSD
                     LRNRESRYKAEQQEQYVLRQQAVNLSDRFDDYLKHTSTYPSINHEKNRDRACKIVSVK
                     WKNKVVFDENLLSKLMGVFGPVENVTTNPGNKVEDNYHYAKVEFKSSVGASLAATHDY
                     SVTTDHWNHLNLRKVSSLLRSATLLEAYDNQLENENPSELSYLDYISYSILARA"
     gene            555025..555096
                     /locus_tag="C5L36_0Btrna3P"
                     /db_xref="GeneID:40383837"
     tRNA            555025..555096
                     /locus_tag="C5L36_0Btrna3P"
                     /product="tRNA-Pro"
                     /note="PKUD0Btrna3P; codon recognized: CCA"
                     /db_xref="GeneID:40383837"
     gene            <556439..>557728
                     /locus_tag="C5L36_0B02840"
                     /db_xref="GeneID:40382791"
     mRNA            <556439..>557728
                     /locus_tag="C5L36_0B02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464644.1"
                     /db_xref="GeneID:40382791"
     CDS             556439..557728
                     /locus_tag="C5L36_0B02840"
                     /inference="similar to AA sequence:RefSeq:NP_014179.1"
                     /note="PKUD0B02840; similar to Saccharomyces cerevisiae
                     YNL220W (ADE12); ancestral locus Anc_2.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320503.1"
                     /db_xref="GeneID:40382791"
                     /translation="MADVVLGSQWGDEGKGKLVDLLCDDIEVCARCQGGNNAGHTIVI
                     GKTKYDFHMLPSGLINKKCLNLVGSGVVVHLPSFFDELKKIEDQGLECRDRLFLSSRA
                     HLVFDFHQRVDKLREAELSGNKKSIGTTGKGIGPTYSTKASRSGIRVHHLVSDEEGAW
                     EEFETKLRRLYNTRVKRYGEFEYDIEGELNRYKVLKEQIKPFVVDSVEFMHDALLKKK
                     KILVEGANALMLDLDFGTYPYVTSSNTGIGGVLTGLGIPATAIRNVYGVVKAYTTRVG
                     EGPFPTEQLNEVGEKLQDIGREFGVTTGRKRRCGWLDLVVLKYSTWINGYTSLNITKL
                     DVLDSFKELKVATAYKYKGEVLKSFPECLKVLGKVEVVYETLPGWEEDITQVKSYKDL
                     PENAKKYLKFIEDYLNVPIQWVGTGPARESMLDKPVN"
     gene            <558286..>559479
                     /locus_tag="C5L36_0B02850"
                     /db_xref="GeneID:40382792"
     mRNA            <558286..>559479
                     /locus_tag="C5L36_0B02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464645.1"
                     /db_xref="GeneID:40382792"
     CDS             558286..559479
                     /locus_tag="C5L36_0B02850"
                     /inference="similar to AA sequence:RefSeq:NP_010539.1"
                     /note="PKUD0B02850; similar to Saccharomyces cerevisiae
                     YDR253C (MET32) and YPL038W (MET31); ancestral locus
                     Anc_8.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320504.1"
                     /db_xref="GeneID:40382792"
                     /translation="MEELNYGTSGSTNYHNQSEPAINEHSNSISNISSFTSIDKNNSI
                     NNVACANPSQKDLFRILNQPQHGASQLNHHPASVPMMGEEDVAFLQAAKEIVRMNENK
                     VDPTIRDILNRLQYSNSPHGGMPISMQYLRSIEGVNDESENESEKEFDQCEDGDHHHS
                     DNNFILGHRFNNGGANLNEGNGLLSPGRSDIYTKQYHIHSPQDSYHQNVGNPLIVPPF
                     TENPLRNPPNNLEFPQFSLDIFKTNQNLQGQGYIDHFVSNNRNTKGYEDEDAGNNSEE
                     KEDYYGEEVDDLNFEGRQSRKNSSSKNDRSTSQVNENEPRNYKCQDCGISFKRSSDLK
                     RHEKIHLKTPPNICPQCRKGFARRDALKRHIGTLTCNRNRKRLIEKLQEEGNFELVQQ
                     LQNPN"
     gene            <559764..>560231
                     /locus_tag="C5L36_0B02860"
                     /db_xref="GeneID:40382793"
     mRNA            <559764..>560231
                     /locus_tag="C5L36_0B02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464646.1"
                     /db_xref="GeneID:40382793"
     CDS             559764..560231
                     /locus_tag="C5L36_0B02860"
                     /inference="similar to AA sequence:RefSeq:NP_010538.1"
                     /note="PKUD0B02860; similar to Saccharomyces cerevisiae
                     YDR252W (BTT1) and YPL037C (EGD1); ancestral locus
                     Anc_8.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320505.1"
                     /db_xref="GeneID:40382793"
                     /translation="MVIDPEKLAKLQKSSAKKIGGKRVAAKKVNKSSEGDDSKLQATL
                     AKFNPTTLTDVAEANFFRDDGSVLHFNRVGVQACAANNTYAVTGFGQEKQITELLPGI
                     LTQLGAENLELLQQLAQTFQQNPEQLANLRKQAANEKEEDIPELVEGETFDVE"
     gene            complement(<560547..>561482)
                     /locus_tag="C5L36_0B02865"
                     /db_xref="GeneID:40382794"
     mRNA            complement(<560547..>561482)
                     /locus_tag="C5L36_0B02865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464647.1"
                     /db_xref="GeneID:40382794"
     CDS             complement(560547..561482)
                     /locus_tag="C5L36_0B02865"
                     /note="PKUD0B02865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320506.1"
                     /db_xref="GeneID:40382794"
                     /translation="MRFNSILLSAIISSTSLAIAEETVKYNTDIISTINTYWHRSTGS
                     HVESTVPAESTTSDCEESTKTTYVHPTFTSSEHTTITHTTTDEDDCNESTKTTFVPPN
                     TESDTTTTTYTTLTEPYEIEATVTPAKPYVNETTIISPKFYKNETTPTLPPIPRTTGP
                     GATTIIPILPHRNSTVPNIPEDTTVTSALLVPGVTTAIPGAPVPGVTTVIPGAPVPGV
                     TTVIPGAPVPGVTTVIPGAPVPGVTTVIPGAPVPGVTTAIDSPNLAITTAAPISSVSI
                     TPSPQVEFSTFAGEAIKPSGSGAIVLLAVAAYLLL"
     gene            complement(<562034..>564307)
                     /locus_tag="C5L36_0B02870"
                     /db_xref="GeneID:40382795"
     mRNA            complement(<562034..>564307)
                     /locus_tag="C5L36_0B02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464648.1"
                     /db_xref="GeneID:40382795"
     CDS             complement(562034..564307)
                     /locus_tag="C5L36_0B02870"
                     /note="PKUD0B02870; Pfam Domains: Zn_clus(1.4e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320507.1"
                     /db_xref="GeneID:40382795"
                     /translation="MSSDPNQPSGAFPIENSDTSATASSCENIATNPELSPQNPKQKR
                     KYNFQRASVACEQCRKAKTRCNYINNGASCFRCENLSLKCSLIDTNLEPTLSTFQKST
                     TIISRDSSESSSRNKRRRRTGSENDSSDPKLNSEHSHGLLNHNNSPSHFVADQHQAML
                     SIINEKIDSLGEAIKELSNEKNFLAQQYQHQHPHPHQHQHQHQHQFQLQKQIQQQPIR
                     TDQPQSKLPLLRSQQSFPSAPLTPIFPTSFIPSNVPSISSINFNAPLARPYLYPSNKL
                     LPSNNNSNTNNNVNGTVSTPALNNQFKSTTHENDEFFFLNAPYIDLLTLSQSTGLPFS
                     KEIGFDITKDLVLVSIQERYDLIKRELLDYNTCYRLIEVALVHYGKWITYYEVDYKAW
                     FDRVRSQSPLLFCTLVLFGLRHQQIENVNNNLELDILQSIHQLLSLSIYEVPQSKEFL
                     QAVILLTHFAPSLSYKHIYFDSWWVSSYGLIHFMTREMTMNLLVKSIKSPEKIHQYRI
                     WNHLTISHIINCILSGRPCVIDEIRLDQCRDILDLPEANAFDAVIVGELCITLSLYNS
                     LQFPEDIETSLKDLSTVYSDWKYLTQTVSLGSVITGYYYFAKLMILRRYILKNLNLKG
                     QEQFSKYCRDFFNCALEFSTLISTGFQMLDISDLLRQCCFLNYSMLLQFKQLNLFNES
                     NDDYLILQTVENFSKVLQMAKTKARCYNGYYDHYGEFLTRLKNITFSQPPQKGTQYSQ
                     HPPPSSKPREPSSSEQQ"
     gene            <566172..>568445
                     /locus_tag="C5L36_0B02880"
                     /db_xref="GeneID:40382796"
     mRNA            <566172..>568445
                     /locus_tag="C5L36_0B02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464649.1"
                     /db_xref="GeneID:40382796"
     CDS             566172..568445
                     /locus_tag="C5L36_0B02880"
                     /inference="similar to AA sequence:RefSeq:NP_011395.1"
                     /note="PKUD0B02880; similar to Saccharomyces cerevisiae
                     YGL120C (PRP43); ancestral locus Anc_6.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320508.1"
                     /db_xref="GeneID:40382796"
                     /translation="MSDSRPTKKSKISKSSISELEAEHAEAELKAHPHPRENAKLDFH
                     DGGEFNLEKRHKTTTEYISQLQTGTENPFTGGQFSQKYFDILKVRQELPIHQQRKEFL
                     EMFHSTQIMVLVGETGSGKTTQVPQFVLYDDMPHLIGKQVACTQPRRVAAMSVAARVA
                     DEMDVKLGEEVGYNIRFENMTSNKTILKYMTDGMLLREAMEDHNLDGYSCIILDEAHE
                     RTLATDILMGLLKQLSERRKDLKIIIMSATLDAEKFQDYFNEAPLLAVPGRTYPVEIY
                     YTRDFQRDYLDAAIRTVLQIHATEDEGDILVFLTGEEEIEDAVRKLSMEGDQLVRDEG
                     CGPLKVYPLYGSLPPHQQQKIFEPAPKAFNKNGRPGRKVIVSTNIAETSLTIDGIVYV
                     VDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFEKEL
                     IEQSYPEVLRSNLANTVLELKKLGVDDLVHFDFMDPPAPETMMRALEELNYLTCIDDE
                     GQLTALGRLASVFPLDPMLAVLLIGSPAFKCSEEILTIVSMLSVPNVFIRPSGEGAKR
                     AADECKKLFAHQDGDHLTLLNVYHSFESNEAYEIGQRKWCIQNFLNYRSLKSAQSVRK
                     QLRRMMENYDIELIEGDYEDLSYYDNIRKALANGFFMQVAKKKSTGKGYITVKDSQDV
                     LLHPSTVLAQQDEWVIYNEFVLTSKNYIRTVTSVRPEWLVEYAPEYFAVENFQSEDVK
                     MSLSRVHDRVNKMKKLN"
     gene            complement(<568767..>569882)
                     /locus_tag="C5L36_0B02890"
                     /db_xref="GeneID:40382797"
     mRNA            complement(<568767..>569882)
                     /locus_tag="C5L36_0B02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464650.1"
                     /db_xref="GeneID:40382797"
     CDS             complement(568767..569882)
                     /locus_tag="C5L36_0B02890"
                     /inference="similar to AA sequence:RefSeq:NP_009780.1"
                     /note="PKUD0B02890; similar to Saccharomyces cerevisiae
                     YBR221C (PDB1); ancestral locus Anc_6.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320509.1"
                     /db_xref="GeneID:40382797"
                     /translation="MFASTNRLSIVKNLISKRGIHNATTAKHELTRIENGVQVMTVRD
                     ALNLAMQEELDRDPDVFLMGEEVAQYNGAYKVSRGLLDKFGPKRVIDTPITEMGFTGL
                     CVGAAFSGLKPICEFMTFNFAMQSIDQIINSAAKTYYMSGGKMPVNITFRGPNGAAAG
                     VAAQHSQDYAPWYSAIPGLKVVSPFSSADAKGLLKAAIRDPNPVIVLENELLYGESFP
                     VNDEILSPDYVLPIGKAKIEKEGKDVTVISHSRNLIFCLEAAKVMKEKYGVDAEVINL
                     RSIKPLDVDTIVASIKKTNHAITVEAGFPQCGVGSEICAQVMESEAFDYLDAPMERVT
                     GCEVPTPYAKELEDFAFPDTPTVVRGMEKVLSLGEWA"
     gene            complement(<570346..>570822)
                     /locus_tag="C5L36_0B02900"
                     /db_xref="GeneID:40382798"
     mRNA            complement(<570346..>570822)
                     /locus_tag="C5L36_0B02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464651.1"
                     /db_xref="GeneID:40382798"
     CDS             complement(570346..570822)
                     /locus_tag="C5L36_0B02900"
                     /inference="similar to AA sequence:RefSeq:NP_014316.3"
                     /note="PKUD0B02900; similar to Saccharomyces cerevisiae
                     YNL083W (SAL1); ancestral locus Anc_2.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320510.1"
                     /db_xref="GeneID:40382798"
                     /translation="MSLSKGVRQVKSELLDDQKQEIREAFQLFDMNNDGFLDYHELKV
                     ALRALGFEVTKKEVLDIIDEYDTSGKRVISYADFYRHVAGAMLERDPIVEIKRAFSLF
                     DDDHTGKISIKNLRRVAKELGETMSDDELAAMIDEFDLDGDGEISLEEFINICMEQ"
     gene            <571118..>573244
                     /locus_tag="C5L36_0B02910"
                     /db_xref="GeneID:40382799"
     mRNA            <571118..>573244
                     /locus_tag="C5L36_0B02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464652.1"
                     /db_xref="GeneID:40382799"
     CDS             571118..573244
                     /locus_tag="C5L36_0B02910"
                     /inference="similar to AA sequence:RefSeq:NP_015151.1"
                     /note="PKUD0B02910; similar to Saccharomyces cerevisiae
                     YPL174C (NIP100); ancestral locus Anc_8.704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320511.1"
                     /db_xref="GeneID:40382799"
                     /translation="MENKIHLDSWVSLSLSPSISLVGTVKYLGETKFASGFWAGVLLV
                     PEYRKFAKNNGSVQGVVYFTNEESPSNNLAVNDGGEGDAGHNNHLFGLFVRPDRLSPL
                     QLHDILENKSLSMKTKEDLVSTSINNLYNQLLDTQSNLEVLHVEYEHIFSNYNVLTER
                     LNHLEIHENALESLKHDQDLTSDKLEMRQLELKLIDANKRFTEKEVFYLKTIDSLKKD
                     LSSLQLKISRNGLNESLISDLNKSERIIENLTFQNNDLIDNVSHLKTKAEELEEVVNQ
                     NKDLIRCYEQTEIELNQLVLDLNKKLEFKDQLILQLNSQLDDSAHLISKLSSKYTSGK
                     NSLCNSLYSSLLLSTEQIVQELVLTNPEYGDLLEFYCVLIQVKNFVKILSSHRNSTQW
                     LKLFAQLDLMLATIPHDKMKYALKYENQLKKIQNLVVDFLETEDKDEEFLLSYSINFS
                     LDINEYLTTEHFEAKLINRELLIYYYSTETSDIDTLNRLKELRPFFGLDVDVEEFTNS
                     PHLIDPVKLDDPIVWEIASTDGPNKVMFDNSQVEKLKLKINLLQSKLSDDRELQKIIL
                     KLEKSISEKEKHEAQLRLKFSDMVSIKDALQSKVEELTNRLMKFGLEDSSLSSIDEFN
                     VLNNLKLIKTIENQRKLIEKVSNPSPFKAQLPQISIPQPHKVTNPSDCLERINKLFEL
                     TLAPLSPSPDSISHQHEKLLEYLYLH"
     gene            complement(<573271..>574605)
                     /locus_tag="C5L36_0B02920"
                     /db_xref="GeneID:40382800"
     mRNA            complement(<573271..>574605)
                     /locus_tag="C5L36_0B02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464653.1"
                     /db_xref="GeneID:40382800"
     CDS             complement(573271..574605)
                     /locus_tag="C5L36_0B02920"
                     /inference="similar to AA sequence:RefSeq:NP_015150.2"
                     /note="PKUD0B02920; similar to Saccharomyces cerevisiae
                     YPL175W (SPT14); ancestral locus Anc_8.703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320512.1"
                     /db_xref="GeneID:40382800"
                     /translation="MPEKKQLSSSKSYNIALVSDFFYPQPGGVELHIYHLAQNLIARN
                     HSVVIITHAYGDRQGIRVLTNGLKVYYIPYLVVHRQSTFPSVFLAFPILRQIFIRESI
                     DIVHGHGSCSSLCHEAIIHGNTMGLKTVFTDHSLFGFADVASIIHNKLLKFTLTDIGH
                     VICVSHTCKENTVIRANLNPSFVSVIPNAVVHEDFEPAPVRPSLDRITIVVISRLFQN
                     KGADLLTAIIPRLCADRVDIRFLIAGDGPKFIDLEQMRERYQLQDRVELIGSIRHEQV
                     RDVMVQGQIYLHPSLTEAFGTVLVEAASCGLLVVTTNVGGIPEVLPRKMTVFADPDED
                     SLVESVNKAVMKLKENQVDTSTFHNEIKTMYGWEDVARRTEKVYDDVYKRENTSLINR
                     LIKYYNSGSWAGLLFVLCIVTDIFILGVLEMIYPAKNIRLAKKWPKRKLKSL"
     gene            <574998..>577538
                     /locus_tag="C5L36_0B02930"
                     /db_xref="GeneID:40382801"
     mRNA            <574998..>577538
                     /locus_tag="C5L36_0B02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464654.1"
                     /db_xref="GeneID:40382801"
     CDS             574998..577538
                     /locus_tag="C5L36_0B02930"
                     /inference="similar to AA sequence:RefSeq:NP_015149.1"
                     /note="PKUD0B02930; similar to Saccharomyces cerevisiae
                     YPL176C (TRE1) and YOR256C (TRE2); ancestral locus
                     Anc_8.702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320513.1"
                     /db_xref="GeneID:40382801"
                     /translation="MSSSKYTRLPVEDSGSYSPPSSSFSQSETQMGDNAILDSEEPLD
                     LPPAYEPPSFIEFEIENENTDENMGFRAKAGKFMESFNSRVVRPISKTLDPVYQLYCY
                     ANARFEYMISKMGNPLIAKRMIYIVFVSIILYTVSLSGLSSDGVVGSHSDFSDQSKLL
                     EFIELSVDPRRLEENLEYLSSMPHLSGTSGDMALARYFEELVLRSKLEINPDVAFDTY
                     TNYPLEPKVLLFSGNGDEVLVECDLVETLEDHLESSIHKLAFNPGSKDMNSRGKLIYA
                     NYGTLQDYKILQERSIAINGSVLIIKYGGMYPAYKKLEYAQERGAIGVLFISDPQMKE
                     YYNLESLQREPVAFTNKMPGNMLSPGIHSGSPVEHVGDLNSRLQEARVVPSIPSLPIK
                     WKDFITIMDKLSNQGARIEGWDIEIEGKPIQIWTGGDDEVLLQNSLIQRPYKESWNII
                     GKLKGMEQDTFSIVIGASRDTMCYGAVESSGSAILLELMNIFSAMSSSLSWSPLRTIY
                     FVSYGGSKYNLAGSTHFAMKNQDLFKRDVYTFIDLDDIIQGDNLEIIADPLFLNLVKD
                     AIDKMAEANSTTPHFNYNSLEVFPYQLNSLSNSYPNVEHHNVAGISMKLKNSGNLKNQ
                     NTVQKFNIPQYSKNSCLDTFDNFRNRRIDPDMSKHAFMTKLIALVAVKLVETPILPYD
                     LRAMWNNMKTNYLNVKEYSKSRGYDLSFDSIDKALNEILEIAQQNEAFVNTWNDICDD
                     GHGSEPNLLTVNRWDWNAKLLLMTKVMIYMDGSYEHPFNYNLIYGLEEEPELRYFNDG
                     EGFDDSIEMKNMFPGIWDAINKGAWDEAQFQINKVGEALNHCIKLFQY"
     gene            complement(<577840..>580020)
                     /locus_tag="C5L36_0B02940"
                     /db_xref="GeneID:40382802"
     mRNA            complement(<577840..>580020)
                     /locus_tag="C5L36_0B02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464655.1"
                     /db_xref="GeneID:40382802"
     CDS             complement(577840..580020)
                     /locus_tag="C5L36_0B02940"
                     /inference="similar to AA sequence:RefSeq:NP_014314.3"
                     /note="PKUD0B02940; similar to Saccharomyces cerevisiae
                     YNL085W (MKT1); ancestral locus Anc_2.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320514.1"
                     /db_xref="GeneID:40382802"
                     /translation="MPIRTLQYSAEISSLDDLKNAVIGIDIQHYINVLLPPGTDPTFE
                     AIGGFPISLKSRIIADAQHMESLDIKPVYVFPGIKPITQFSYLQQPELQYEKHLKASW
                     KTKVANPEADISFRDLSNPYLIRLLMDEIMIILHENELEYLVAPYTQHHQLLYMLEAG
                     VINAIYSSNDCLLLERLDNFIVDIDFTNKKFQFLSSKQIIGGFNLDFKRFRDIAMLLG
                     NVFQPFELKPPTTTFHELVHTTRQGFNALSSLSTSKDDSSKLTHFINGCTILDFCPVL
                     RINGKVESFCIALGDSVISSASNNDAGKNVKAKLPRGLNEVFGFHFPQELYFYQSIGM
                     NIFPLIESFITSDYIERLPLDMKTDPIYEKIILDHKSMEMKEVLFNLFTSTLHRFFQH
                     KKVNLKSYYTSTHRLNLIDFKSAQVSNVSNLIVRHSSAKSFDLALFLNSLNDEFIYES
                     TVANPKEVSQGLGNIFTNYELISSSLLGTLVHYGFIELREKNFRLSKWGTTLVKFIGK
                     HNVDIETILLLCVFFQRTPNLDMKSLSASNDLDSLNDVVDDLGTLNLIAQFATLYKIK
                     EFKVGNYKGPVSNSLLHFNSIMSALHNEIKNFVIVDTLNLLLRNKNDIDKFNRSHEDW
                     CSLVSELPFKMPLSNTVIGLIVEKSIESFVLSENFKVELDAELLPFTVIVQNPSKEAL
                     HALKFVISICDLVYLLFENGLASEAVKSKFESVRMVTDKLISKF"
     gene            <580493..>580897
                     /locus_tag="C5L36_0B02945"
                     /db_xref="GeneID:40382803"
     mRNA            <580493..>580897
                     /locus_tag="C5L36_0B02945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464656.1"
                     /db_xref="GeneID:40382803"
     CDS             580493..580897
                     /locus_tag="C5L36_0B02945"
                     /note="PKUD0B02945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320515.1"
                     /db_xref="GeneID:40382803"
                     /translation="MQFERKRIWDYFLIYTSFATFICSFFPRIGKDICLVCKYSTGIV
                     CFFFFAKDLVFLAFFLKSSSTLQINKVLSTIFAGLCSGITGYIITLIIIASYMAFEAQ
                     KLPLRIQISYSHYLNVKVSFCADSKSSYLGTM"
     gene            <581245..>582264
                     /locus_tag="C5L36_0B02950"
                     /db_xref="GeneID:40382804"
     mRNA            <581245..>582264
                     /locus_tag="C5L36_0B02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464657.1"
                     /db_xref="GeneID:40382804"
     CDS             581245..582264
                     /locus_tag="C5L36_0B02950"
                     /inference="similar to AA sequence:RefSeq:NP_014728.1"
                     /note="PKUD0B02950; similar to Saccharomyces cerevisiae
                     YOR085W (OST3); ancestral locus Anc_2.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320516.1"
                     /db_xref="GeneID:40382804"
                     /translation="MNMLNIWPFLLLFLQYTTALSYEEALRIASKKDGLLYVNGKSYE
                     KLIKNENYSFVIFLTAEDARVGCTLCHDFGPKYKAIAKQYFENLNDPQSGMYNPIDSD
                     NDKSRVIFGFSDYMSAQTYFEKLGMTSVPKLLYYEPGKAPQLADFTNEFSFLTVENTD
                     SYTRWLAQNIPGLDPKFLEVQIPVSKSKLYTSIAIGIASLALLFKFRSSIFKVVQQKT
                     VWEVFSLSLIILFISGYMFNQIRNSETSRKDKEGNVVYFAKGFNMQFGAETQIISIVY
                     TILSGCLFSLIKILPNLKKSTTKLVASVTVCFIMFIVYSYLVEVYHLKSSTYPFHLWN
                     AFKSS"
     gene            complement(<582353..>582805)
                     /locus_tag="C5L36_0B02960"
                     /db_xref="GeneID:40382805"
     mRNA            complement(<582353..>582805)
                     /locus_tag="C5L36_0B02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464658.1"
                     /db_xref="GeneID:40382805"
     CDS             complement(582353..582805)
                     /locus_tag="C5L36_0B02960"
                     /inference="similar to AA sequence:RefSeq:NP_014313.1"
                     /note="PKUD0B02960; similar to Saccharomyces cerevisiae
                     YNL086W (SNN1); ancestral locus Anc_2.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320517.1"
                     /db_xref="GeneID:40382805"
                     /translation="MSNDNDENYIHPMELAVQSILEGPLELLNLNLKSLYESQLILHT
                     ILHKMEKTLQETANNLRPGSFPLDEQIISDCSENIGTQSEDLESSSTAEDGVRIDHSD
                     VKPEFDCKDYLQRLVILKKKIKNVEKTLDRVETRIVKIETEIGNNWGE"
     gene            <583017..>584219
                     /locus_tag="C5L36_0B02970"
                     /db_xref="GeneID:40382806"
     mRNA            <583017..>584219
                     /locus_tag="C5L36_0B02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464659.1"
                     /db_xref="GeneID:40382806"
     CDS             583017..584219
                     /locus_tag="C5L36_0B02970"
                     /inference="similar to AA sequence:RefSeq:NP_010176.1"
                     /note="PKUD0B02970; similar to Saccharomyces cerevisiae
                     YDL107W (MSS2); ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320518.1"
                     /db_xref="GeneID:40382806"
                     /translation="MLSYIQTSRRLYSSIPNAKPLLLDILPSKKMISRLLFDYDARYN
                     FNKYLPVIESIYDNECSDYANIPEKFKGNDLLVFQRVLAQIRKQTHTINPLLLKLEND
                     LIEKAAERGSRDALSTLSFMALEGKGEGWSEEDKTTAKSYIKELMELEHPLTFKLAAD
                     RELKGYTDSLERKCAESNDTPNDDLIPTFDLSFSTITESPKQLGRAISLYEHFLSLDS
                     RSTIAAAAHRSLGMIYFRTQQLGKSKEHFEKAVELAPSTDNPQAHFFLGLLNETDPLV
                     ARYHFQMAASEGFRESFANLGYLELNVFNDLYKSREWFALGAELGVPECIVGLFDVAM
                     RKKDYRKARAIVEKAERQGVSNLLKEVRKDSVELAISEADRIIEVAEEPQARQQSNPR
                     RKSTRWDL"
     gene            complement(<584264..>585850)
                     /locus_tag="C5L36_0B02980"
                     /db_xref="GeneID:40382807"
     mRNA            complement(<584264..>585850)
                     /locus_tag="C5L36_0B02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464660.1"
                     /db_xref="GeneID:40382807"
     CDS             complement(584264..585850)
                     /locus_tag="C5L36_0B02980"
                     /inference="similar to AA sequence:RefSeq:NP_011373.1"
                     /note="PKUD0B02980; similar to Saccharomyces cerevisiae
                     YGL142C (GPI10); ancestral locus Anc_2.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320519.1"
                     /db_xref="GeneID:40382807"
                     /translation="MSERDLIHREDSGLLWLERKLEVLGRPSVWLIIAWRLVNAFTIN
                     TFFQADEYWQALEPAHAMVFGYGYLTWEWKLGLRSFLHPLLYVVPYKFVDYFNLDYTY
                     LLAAPKVVNALVAIIGDYYLYDLIRLKFRNEKLAVLVCYLSLFSAWNWFCWCRSFANS
                     LELTTTIVSLYYLYANNILIALITAALTCLIRPTSAIIWLIVLPRIFWKNPKHIITAL
                     VIGTLVCSLDFLVNYWFYRKAKFPLLSFFRFNVADSLSSFYGVSRLDFYFLQAIPVIT
                     LNYLPFFLYGIAKTSWSDTKFLLLCYILIFSLIPHKEFRFIYPLMPFILTYVAYGLFN
                     IAIKVRERTMKILILISVIISAHLAYYFTQYHEMGELKLPTVIRNKVLEAHCDEPLSV
                     GFLTPCHSTPFQSHIHLPSRVVNVWFLTCEPPLPHNIKPGITLESYMDESDYFYENPL
                     AFIKANFPSIVHPNISPPRSQWPHQWPHYIVMYSSLWESNDDVRNFLGQYYGINEALW
                     NAAGHWDPRREGHLLLLKLL"
     gene            <586117..>587556
                     /locus_tag="C5L36_0B02990"
                     /db_xref="GeneID:40382808"
     mRNA            <586117..>587556
                     /locus_tag="C5L36_0B02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464661.1"
                     /db_xref="GeneID:40382808"
     CDS             586117..587556
                     /locus_tag="C5L36_0B02990"
                     /inference="similar to AA sequence:RefSeq:NP_015431.1"
                     /note="PKUD0B02990; similar to Saccharomyces cerevisiae
                     YPR106W (ISR1); ancestral locus Anc_3.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320520.1"
                     /db_xref="GeneID:40382808"
                     /translation="MYRNETSLSSHTDNSLLDHHFSESDTSLAITSINNTYQNKCQDS
                     PSTTYNDSYMLMQNKNVPSLINRRSGDTKDKKKSLLVGVSFNESPSNRKPGDCSNHSD
                     KINVESPILDDLFNTPTLGSNFDYPNSPVTPVTPYLDQVPFSKSPHIYGDTKEITKYP
                     LNDDKLESFVLIPEVFDIKLVERLGKGGNAYVYACELSTTGSIDNVFSTAIKIPINKS
                     KVKYILQEAKMAIKLREFQNTWFQTECRFFPFIDCYGLYYIDRQKFDMIKPREAFPCL
                     VMKRMTYSLTEFVSTQSKEAEADKTKIHLTLWWKLCQTLLDALKVLKTLGLVHCDLKT
                     DNVMITEYNSTLPIESQISQVLFKVIDFSSTNEIQGMVKCPDMTLQFTAPELLDFSKH
                     PLPTPNSDSFSAGLILLEAATGSKPYSAAGYDHFYLLSVIKEGKVMEWLSPEDMCILN
                     ANPDVKRVLEMFLIDRLPVESISSFIQTL"
     gene            <587902..>591099
                     /locus_tag="C5L36_0B03000"
                     /db_xref="GeneID:40382809"
     mRNA            <587902..>591099
                     /locus_tag="C5L36_0B03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464662.1"
                     /db_xref="GeneID:40382809"
     CDS             587902..591099
                     /locus_tag="C5L36_0B03000"
                     /inference="similar to AA sequence:RefSeq:NP_015429.1"
                     /note="PKUD0B03000; similar to Saccharomyces cerevisiae
                     YPR104C (FHL1); ancestral locus Anc_3.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320521.1"
                     /db_xref="GeneID:40382809"
                     /translation="MSSVEPNIANEMQQSHEELQSLHASNSAVDRISSELEPLHKAKT
                     NDVVKQENVGEVGHSTTDAGMTSLPSLDNLVIDDPSNPTTITTIVKSTESSPEKQTTS
                     SNISNSLGEIYSARKENETVNITTLPAAETQSAPDNVEQKYKTSKLEEETETVHLHPS
                     PNDAMKIQNSLQKNTESIESPSVQQLGTELEQKIQAYAMLDFESFTFYVQTMQILLGR
                     MVEGDSLTESLDIHLGNQKAISRRHAKIFYNFGNQRFELSVLGRNGAFVDGNFVEKGL
                     TVPLGDGAKIQIGETEFAFVLPQREGEQSNNNNVASKLEDKLEGNIEVKPKVEYEKDI
                     HLENLDNLVANFDEIKKDIQDNDILLKDPNVLNIVFDPEYERKRELEIEREIGRVLAR
                     ENSVQPPDVPDPIDTNKNKSKKKSTPSSNSKSKPKSEAAPEAEKPKPKRQSKAKKKVY
                     TLEEIPEPYRTKPNIAYSIMITECLRKKGTERGMSLSEIYKGIQELYPYYFYCPDGWQ
                     SSVRHNLSLNKSFRKISKEGKGWLWGVNEEVVAEKDRIRQKQLENAKAKAKLSQKIIS
                     KNSSSSTKMSSQGMTTSFSAKPSNPSLSSSSLNKTSMSNAQNLQGSSKQSSAGKNTSS
                     PISKDSNMSANTKKALTYLQKELISLTKSRKMYDRATSTEILTKALAMTISQVDQAAK
                     NFAIKGFPLVTLIDKNPGHVTKILTAALNAATLQVCKQKGLTPHLPPKITNSQGTQAT
                     TGSASAPVSSTSTPNNSNGASNSKNTPTINSAIKIQAKPQQNKPVIAIKREEGSNPPR
                     PVKPDLGKPKFFKPDLSKDTKSSGPVIYQFPKTMTKPQFKATQPMKPSFKPSVKPINA
                     GLSTGSTGGINSMKPIKLGGNITNNTGLMKPQFYTKSKIHERNLNKIENNDLAIKKSI
                     AKFGKPTSMNSGNIDTKISASEGEQKSGNAETSTTTVAVQRNDSECGLSTVTGDIMSR
                     VSTSTSAIVGGNSDTSLDSETIKTSHSDSNSNNNIVVKDEIEEEGEDELDMMLADLEN
                     RNKDESDDNNTDDETSKKRIASETEEPENKKIRLD"
     gene            complement(<591193..>592050)
                     /locus_tag="C5L36_0B03010"
                     /db_xref="GeneID:40382810"
     mRNA            complement(<591193..>592050)
                     /locus_tag="C5L36_0B03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464663.1"
                     /db_xref="GeneID:40382810"
     CDS             complement(591193..592050)
                     /locus_tag="C5L36_0B03010"
                     /inference="similar to AA sequence:RefSeq:NP_015428.1"
                     /note="PKUD0B03010; similar to Saccharomyces cerevisiae
                     YPR103W (PRE2); ancestral locus Anc_3.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320522.1"
                     /db_xref="GeneID:40382810"
                     /translation="MLSINDVANRYKFQSSLDAELSQYNSSLSRTPASVDSLSPSITI
                     PPISQPTEFLRAHTDDETNPDCSIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWIASQ
                     TVKKVIEINPMLLGTMAGGAADCQYWETWLGSQCRLHELRNKERITVAAASKILSNLV
                     YNYKGMGLSMGTMVCGCTPKEGPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYK
                     WDLTVEEALYLGKRSILAAAHRDAYSGGSINLYHITEEGWKYHGNYDVGPLFWEIKEK
                     EGSFNNVNA"
     gene            <592515..>593039
                     /locus_tag="C5L36_0B03020"
                     /db_xref="GeneID:40382811"
     mRNA            <592515..>593039
                     /locus_tag="C5L36_0B03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464664.1"
                     /db_xref="GeneID:40382811"
     CDS             592515..593039
                     /locus_tag="C5L36_0B03020"
                     /inference="similar to AA sequence:RefSeq:NP_011599.1"
                     /note="PKUD0B03020; similar to Saccharomyces cerevisiae
                     YGR085C (RPL11B) and YPR102C (RPL11A); ancestral locus
                     Anc_3.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320523.1"
                     /db_xref="GeneID:40382811"
                     /translation="MSDKSSNVMRELKIEKLVLNICVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTIRSFGIRRNEKISVHVTVRGPKAEEILERGLKVKEYQLRASNFSTSGNF
                     GFGIQEHIDLGIKYDPNIGIYGMDFFVVMGRAGFRVARRKRCRGTVGKYHKVSQTDAI
                     NWFKAKYDADVIGA"
     gene            complement(<593107..>593604)
                     /locus_tag="C5L36_0B03025"
                     /db_xref="GeneID:40382812"
     mRNA            complement(<593107..>593604)
                     /locus_tag="C5L36_0B03025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464665.1"
                     /db_xref="GeneID:40382812"
     CDS             complement(593107..593604)
                     /locus_tag="C5L36_0B03025"
                     /note="PKUD0B03025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320524.1"
                     /db_xref="GeneID:40382812"
                     /translation="MNHTDYEREIQLAVAAAVETMDTDRLHPQVQETCRHNDKLLPLS
                     EKGLDMSPLSEKYTGGSQGDVNLLLLASHSALRLQRNALIHSVITENPLLVDKHRYLQ
                     RRELESIYEELEKRASARKGELTVLENDRKQQLGEFAPINNFLTNRWNEKLNEKIQQE
                     IAKIK"
     gene            <593990..>595606
                     /locus_tag="C5L36_0B03030"
                     /db_xref="GeneID:40382813"
     mRNA            <593990..>595606
                     /locus_tag="C5L36_0B03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464666.1"
                     /db_xref="GeneID:40382813"
     CDS             593990..595606
                     /locus_tag="C5L36_0B03030"
                     /note="PKUD0B03030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320525.1"
                     /db_xref="GeneID:40382813"
                     /translation="MLSSSFRRRVSFDHYDPNPHEKHPPSNCKEQLSPTIKPILKNDL
                     PAQPRSTKDSTLSINTIGNFSLPGSPQAQKSSFSSNNAADHNSLQSSEPSRVHKSPYG
                     GLSDSELLELDSQFNNRTIDFQKSYGFSPTSRLQTNSISNRNKNLIDTHFRNLSPNAI
                     LKEYPTKPILTKNSFCFNYTHSKLANNDFSDRFYIVLLSNKSASLSSIDYFLNHIASK
                     GDTLVICCSLSTSILGNDKTEQLESFIEDFTDLILSHIGANDKIGEKPISVTFEFFKS
                     FSYMDEVLNLYQPSVVIVGTANEQTKSTSMTTPERKFISVVLVGEDYRNNRLREWNVP
                     QNTGLNCSQPPVSSISFKLPIEKKGSNSSSYAPSILVNDISYSSQDSMSSTTNLSKMK
                     TNDTTASSLFDNLNETPFLELAKTNSNSSSLQVPPDQQQQQRRRSMLAVLDNDTLSTL
                     NNKHSEQEFAIDDTPEYTTLSAKKQLPLGQTREQQELFSKYERRLSGLNVNIQRKPVD
                     SSSTSKDQVDVKEKSKNKRPKQKGLFGWFK"
     gene            complement(<595786..>597483)
                     /locus_tag="C5L36_0B03040"
                     /db_xref="GeneID:40382814"
     mRNA            complement(<595786..>597483)
                     /locus_tag="C5L36_0B03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464667.1"
                     /db_xref="GeneID:40382814"
     CDS             complement(595786..597483)
                     /locus_tag="C5L36_0B03040"
                     /note="PKUD0B03040; Pfam Domains: Aldedh(1.9e-105)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320526.1"
                     /db_xref="GeneID:40382814"
                     /translation="MLSKTLKSLRIPRYTRGIAQFAHFEAPKHITNEPTKLFTENDKQ
                     DWNKLENEIKSFIENPSTIPVVVNGEKINDRQTKRVVNPAKISQNLGVYAQATKDDVQ
                     KAIDSAMKAKSKWANMPFADRAAIFLKASELISTKYRYKMLAATMLGQGKNVFQGEID
                     CIGELVDFFRFNVKYAEELYKKQPIESTIGVWNRTEYRPLEGFVYAVTPFNFTAIAGG
                     LIGAPALMGNTVVWKPSDSSILSNYLLLDILKEAGLPDGVINFVPGNPVEVSEIVVNN
                     ENFSALHFTGSTDVFSSFWSQIAKNVALSKYKDFPRIIGETGGKNFHLVDSTANVDNA
                     VFNTIRGAFEFQGQKCSATSRAYVSASIWPEFKEKIIANTKKIKPTNCTEELQGFMGP
                     VIHERSFDKVTNAIKSTEKDSELTLLAGGKFDKSVGYFIEPTIVETSNIDHAFMKTEF
                     FGPLLTVYVFEDSQIDHILEKIDSATRYGLTGSVFSTSRENIRKYEERLRYSCGNFYI
                     NDKSTGAVVGQQSFGGSRMSGTNDKAGSAALISRFVTTRSIKENFGEITTYLNPSNF"
     gene            complement(<597707..>598681)
                     /locus_tag="C5L36_0B03050"
                     /db_xref="GeneID:40382815"
     mRNA            complement(<597707..>598681)
                     /locus_tag="C5L36_0B03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464668.1"
                     /db_xref="GeneID:40382815"
     CDS             complement(597707..598681)
                     /locus_tag="C5L36_0B03050"
                     /inference="similar to AA sequence:RefSeq:NP_013385.1"
                     /note="PKUD0B03050; similar to Saccharomyces cerevisiae
                     YLR283W; ancestral locus Anc_6.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320527.1"
                     /db_xref="GeneID:40382815"
                     /translation="MSRVMMRPVRAFWNVRLFSRRACLRNSTTKSPQQPLETNPINFT
                     MGKMPIGLPMGGEDVFISDTSSSKRKEEWIKEKQKQKEKEKQKQNAEIVEDVRIDDYV
                     IQVESFFDTYRVVQEFKRSGFTEAESKILTRYMYDVLKEKMNWINKTYAPKVDLENET
                     YLFEAAHSELLFEVTNSREISIMNLTNDSIILKRWFNGLNDETIAEIKLNDDLIKLEL
                     NQFKHENNLQQRELNLKNSDLNSRIISDMVSGLKSDIETYRWQLTRAGIVTILTMAVC
                     ILSVWNVAKRVNEEHSNEKWPRLVPVHEQTDEESHDYEADWDESVPLA"
     gene            <598901..>599173
                     /locus_tag="C5L36_0B03055"
                     /db_xref="GeneID:40382816"
     mRNA            <598901..>599173
                     /locus_tag="C5L36_0B03055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464669.1"
                     /db_xref="GeneID:40382816"
     CDS             598901..599173
                     /locus_tag="C5L36_0B03055"
                     /inference="similar to AA sequence:RefSeq:NP_013377.1"
                     /note="PKUD0B03055; similar to Saccharomyces cerevisiae
                     YLR275W (SMD2); ancestral locus Anc_6.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320528.1"
                     /db_xref="GeneID:40382816"
                     /translation="MDAPDYEFSQGPLRLLATAVQQDKKVLVSLRNTHKLVASVKAFD
                     KHCNMVLENVKEFWYDGEDGNKALRERYTAKMFLRGDSVVLVLHHE"
     gene            <599502..>601496
                     /locus_tag="C5L36_0B03060"
                     /db_xref="GeneID:40382817"
     mRNA            <599502..>601496
                     /locus_tag="C5L36_0B03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464670.1"
                     /db_xref="GeneID:40382817"
     CDS             599502..601496
                     /locus_tag="C5L36_0B03060"
                     /inference="similar to AA sequence:RefSeq:NP_013392.1"
                     /note="PKUD0B03060; similar to Saccharomyces cerevisiae
                     YLR289W (GUF1); ancestral locus Anc_6.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320529.1"
                     /db_xref="GeneID:40382817"
                     /translation="MFIRLLRNRQSLLVSFRRYVTTTPGTDTYKGYLKYPIDKVKNPT
                     PIVSDDDLYKRISSIPLENYRNFIIVAHVDHGKSTLSDRLLELTGVVNPTIDNKQVLD
                     KLEVERERGITVKAQTVSMIYHYKGEDYMIHLVDSPGHVDFRLEVIRSYASCQGALLL
                     VDASEGIKAQTVANFYIAYSMDLKLLPVINKIDLDTADIQKAEEQIEETFELDRDDIV
                     HVSAKTGLNVNYILPKIIESIPPPPPEKYNRDAPLRSQIVDCWYDPYVGVIMLVNVVD
                     GELKKGDKIEFISTGEKHEVKEVGVMYPDRRALPKLVSGQVAYVIPGFKDANKVFVGD
                     TIKLVGTDVETLEGFEEPKPMVFVGAFPAEGTEFKKMEESLQHLFLNDRSVVFQRTTS
                     NALGQGWKLGFLGSLHASIFKERLEKEHGKNLIIIAPTVPYKVTFKGGREEIINNPSD
                     FPDGNKKSGVVDIAEPIVEALMTFPGEYTGPVMKLCEINRGIQKDLQFLSNGQTLMRC
                     ILPTAQLIDDFVGKLKGATRGYASLDYEDGGYMSSDVCKLELLVNGGNVDALATIVHK
                     SQVNKMGREMAERLVKFLSVQQYDVIVQAAANGKIVARETIRARRKDVLAKLHAADQS
                     RRKKLLAKQKAGKKNLQAGSQGIAHTRVAAEACQSFLRRD"
     gene            <601710..>602714
                     /locus_tag="C5L36_0B03070"
                     /db_xref="GeneID:40382818"
     mRNA            <601710..>602714
                     /locus_tag="C5L36_0B03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464671.1"
                     /db_xref="GeneID:40382818"
     CDS             601710..602714
                     /locus_tag="C5L36_0B03070"
                     /inference="similar to AA sequence:RefSeq:NP_012553.3"
                     /note="PKUD0B03070; similar to Saccharomyces cerevisiae
                     YJR019C (TES1); ancestral locus Anc_5.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320530.1"
                     /db_xref="GeneID:40382818"
                     /translation="MIRGTKRSIPFPLRPQDMSRGRRLMSSTWSSNPPSSLEKLLALN
                     KISTETFVNASELFVPYRGRGLFGGTMVAQSLLASLLHSNMPEKKWKPVSIHCHFLQA
                     VQPTPQLQYKVTTLKPGKNYLTKEVNLHQNNKLVFKAIVTLQAYKLQGSASNLKGQLN
                     HHRKAPVVGVDIAPPEKMFSQSELIPNSTAVKCYEREPCDWRLPKDLFDLSIVKEEEK
                     AAPVEDRVLRYWVKNKEPLQDPSVYNWVSLAYVSDYFYLSANMRLNMREMFTTKFSVS
                     LDHTIYFNTELNTSEFFNYNVRNIKAGENRSIMMGEIFNREGKLGATTFQEGLSVINP
                     "
     gene            complement(<602881..>604380)
                     /locus_tag="C5L36_0B03080"
                     /db_xref="GeneID:40382819"
     mRNA            complement(<602881..>604380)
                     /locus_tag="C5L36_0B03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464672.1"
                     /db_xref="GeneID:40382819"
     CDS             complement(602881..604380)
                     /locus_tag="C5L36_0B03080"
                     /note="PKUD0B03080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320531.1"
                     /db_xref="GeneID:40382819"
                     /translation="MADSDSDYYPGKRNRTNYRRKKKNAVLSAAEGMNLKDALKINGI
                     HTKPLYLKTTAAQRKAKQKEGYDNDYISDDELNLPPPKYKNAEFIIDTNGNNKLVRSH
                     KQFSPKLDLPKPNANSQYEIDTKKPPKFIPGKNVVVTSDKKNKKDDLKTEPLTSPSVT
                     PQYTETAEICAMKALLRIKAIKNLRSKTGKKEAIAITDNMSITQLMKLALFSDDEDET
                     DLDLDKTRVKRKNLKKGKKKKSSKKSSKYISSSETGTDSYGNSEVEKERRRRKKELKA
                     RTKAKSRRSKKYYYPSDGSESDSDSDSDSDSDSDSDSDSDSESESESESDVGYSKGRK
                     SRRAKKYFSGSKREEINKKIKKKQKKKQERRYDHSVPGTGSESEIESEGRLELLTIGN
                     TRTNPLDSLSEDDSEVEGRRKNKTKNRKKSSGKIKHKGIEKYNTLDSVSKSTFKLQSN
                     SRKAKNKSDSTSFDSESSGYNFRRRKNLVESDSDSSDESDFYSKKKGRG"
     gene            complement(<604552..>606294)
                     /locus_tag="C5L36_0B03090"
                     /db_xref="GeneID:40382820"
     mRNA            complement(<604552..>606294)
                     /locus_tag="C5L36_0B03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464673.1"
                     /db_xref="GeneID:40382820"
     CDS             complement(604552..606294)
                     /locus_tag="C5L36_0B03090"
                     /inference="similar to AA sequence:RefSeq:NP_009401.1"
                     /note="PKUD0B03090; similar to Saccharomyces cerevisiae
                     YAR002W (NUP60); ancestral locus Anc_4.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320532.1"
                     /db_xref="GeneID:40382820"
                     /translation="MPRYNYSFGGERPDSPFKKTVKQGISPYYVPSKSNSQSQSQPEG
                     LFTRIKAFFQNKLKQQQKPKRNTKQPTAFENVSIGNIDLSMNSNMSFTSKNPNDTLSE
                     FFQKKGDTPLNEIEIEGVMSLIRKSQSNLPSRNGSMINHSLFTNNSQMGSKVGGLASF
                     NDANNSTILRAPSADLKKPVTIKTPTYKSKLVQSNTNTSLNRSFNLNGIRKRRIVSYT
                     SPLNKVETKSISPLCAFLEKKKTLSKKKNDSKDYKGGIIDLSKFSDDDDDDDDAHGEG
                     FIGDEAGKNIGVSRKGTTEEISKSSISKTASKVLDILDGEQNVIITINDELKENNHDD
                     KQIVHDKTQLLSESKTNNKKDKNQTVLESRSDKKSSATPVFPFKPMRELPLFKDDAES
                     AKTEIHKEGTKEYEPYFASTSSSTKSKLLQTKQIPEVPVTTSEKVDNSRVEPSTMKSQ
                     IRVPNVHEENENLDLSVTKPSFDFSIPKSDASKSPFSFSFSGDTISNSLSSEKTQNVQ
                     LEKKPAESGDIEVIDSFVFPEIPNKEPTKVASKLPPSQHTCDFIFPVVSSVDPSLLTK
                     IMNASNEYDEVFTF"
     gene            <606539..>607804
                     /locus_tag="C5L36_0B03100"
                     /db_xref="GeneID:40382821"
     mRNA            <606539..>607804
                     /locus_tag="C5L36_0B03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464674.1"
                     /db_xref="GeneID:40382821"
     CDS             606539..607804
                     /locus_tag="C5L36_0B03100"
                     /inference="similar to AA sequence:RefSeq:NP_014358.3"
                     /note="PKUD0B03100; similar to Saccharomyces cerevisiae
                     YNL040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320533.1"
                     /db_xref="GeneID:40382821"
                     /translation="MEMTMPVRTLIGALACQKDSYLKQLTTVVVSCSPLKEEAPKKAG
                     KKLSVTDSKEKRSLYEIELEDTILFPEGGGQPSDLGLIKVEDTKVRVLDVQRKGLYAV
                     HITEEPIESGTSVSLEVDWKRRLDHMQQHTGQHLLSAILDKYDLPTLSWNMGEMVNYI
                     EVPRKITPEEIVEVTEKVNHEIFNNTPINVDTPKSESEGVNSEKGVMRVVKIGDIDNN
                     PCCGTHLAQVGQVKMVVILGQMNGKNGTSKLNFLCGDRVYKYTSQLYDINKRLMNIFS
                     SNMEELPEKAEMVIKEGKKSRARERNLSKEIAIQFANRIIEAFQDKQSPKSVHYVYRE
                     EGDLEFINKINAELKIILSEHPDKSIVLISGDGAIIVVGPAMDSIVQELRKRLPTLRG
                     GGKNGRFQGKVASYKEHEMQAVIEYLKEL"
     gene            <608475..>610238
                     /locus_tag="C5L36_0B03110"
                     /db_xref="GeneID:40382822"
     mRNA            <608475..>610238
                     /locus_tag="C5L36_0B03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464675.1"
                     /db_xref="GeneID:40382822"
     CDS             608475..610238
                     /locus_tag="C5L36_0B03110"
                     /note="PKUD0B03110; Pfam Domains: Aa_trans(5e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320534.1"
                     /db_xref="GeneID:40382822"
                     /translation="MSDLKPITSAESVLANVISNNANALNNFPNSANLDELDEFYDVP
                     LEEFLYHAQLQRELEKSPDYGEAAPTVPLWEVIRVKLLNKEPRNNEQVKTVTEKVSSS
                     DCDEKGLPVCEINDTLITEKENANRMLRVASWGSVFYLITTDILGPTSAPYAISELGY
                     VPGALLYFLFGVCAAYCGALLWKQYLMLDSIKYPLRNYGDVVGRIFNKQTRYAIDFFQ
                     AVQLFCNVAVIILGNGQGLSQIAKGKGCYTILIFVWAVAGAIVGQIRSLAKFGFLANA
                     AIWMNVFVIIATMACASAFPPNYTAAAGTNNVSMGAVVTKVVISGAGDMFQSQLNACM
                     NIVYSYGGALVFVEFMAEMKRPWDFWKGMAAAQMFIFTVYLVFAMVVYHYQGQFVINP
                     ANQGISNYGWQTATNVINLVSALIAAGLYGNVGIKVLYSSVFQRFFKFPSLDSRFGVW
                     IWAGFVCVYWAIAFVFAAAIPNFSSLVSLIGAVCILQFSYTFPFIMQFVFDLQLGAMQ
                     GDGEYDHVNKVTHRVDSWRNFSRWWRGYKAFWFRNTCHLILFLASAATAGLGIYASAM
                     SLKEAFDSGSTTSFTCKSPVA"
     gene            <611782..>613542
                     /locus_tag="C5L36_0B03120"
                     /db_xref="GeneID:40382823"
     mRNA            <611782..>613542
                     /locus_tag="C5L36_0B03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464676.1"
                     /db_xref="GeneID:40382823"
     CDS             611782..613542
                     /locus_tag="C5L36_0B03120"
                     /note="PKUD0B03120; Pfam Domains: Aa_trans(5.4e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320535.1"
                     /db_xref="GeneID:40382823"
                     /translation="MSDLKPVTSAESVLANVISNNANALNNFPNSANLDELDEFYDVP
                     LEEFLYHAQLQRELEKSPDYGEAAPTIPLWEVIRVKLLNKEPRNVDGVKYVQDSNSSH
                     TDEKDLVPSEINDTLITEKENANRMLRVASWGSVFYLITTDILGPTSAPYAISELGYV
                     PGALLYFLFGVCAAYCGALLWKQYLMLDSIKYPLRNYGDVVGRIFNKQTRYAIDFFQA
                     VQLFCNVAVIILGNGQGLSQIAKGKGCYTILIFVWAVAGAIVGQIRSLAKFGFLANAA
                     IWMNVFVIIATMACASAFPPNYTAAAGTNNVSMGAVVTKVVISGAGDMFQSQLNACMN
                     IVYSYGGALVFVEFMAEMKRPWDFWKGMAAAQMFIFTVYLVFAMVVYHYQGQFVINPA
                     NQGISNYGWQTATNVINLVSALIAAGLYGNVGIKVLYSSVFQRFFKFPSLDSRFGVWI
                     WAGFVCVYWAIAFVFAAAIPNFSSLVSLIGAVCILQFSYTFPFIMQFVFDLQLGAMQG
                     DGEYDHVNKVTHRVDSWRNFSRWWRGYKAFWFRNTCHLILFLASAATAGLGIYASAMS
                     LKEAFDSGSTTSFTCKSPVA"
     gene            complement(<613765..>614877)
                     /locus_tag="C5L36_0B03125"
                     /db_xref="GeneID:40382824"
     mRNA            complement(<613765..>614877)
                     /locus_tag="C5L36_0B03125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464677.1"
                     /db_xref="GeneID:40382824"
     CDS             complement(613765..614877)
                     /locus_tag="C5L36_0B03125"
                     /note="PKUD0B03125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320536.1"
                     /db_xref="GeneID:40382824"
                     /translation="MVLSKGKFKWSNNDKSTEPAILHQRQSKLDLLDTTTFTSFPAPE
                     LIKEINKPSEDMLRIRSNVRQRSVERINSRSTRSKSRSTLGDSKTIIEAKDIPNQNPK
                     SETNFNFMTSLGSAEYTANHISKNETPPSSCDHESPFYDYRLLLEEKDASIWKIETVK
                     EDSSTADTKVKPQQNEGGSQLKPIISSDMYIQSIYDELYKSEEVSIEIKCSSCFKPVF
                     ENHEYINKILDLKAIICEDCMNIRYQPNESFNKSVSQFSTFEIEDFTELNSTNNTVQI
                     YLESTANENEDEITDNGRPQEIRFFSNNDSNITEFVNQGLNSVIKRLKEIERKDLKIR
                     HSIADFRQVQQMQRHRNGSLSLWGTIKHMFLKSNYV"
     gene            complement(<615305..>617485)
                     /locus_tag="C5L36_0B03130"
                     /db_xref="GeneID:40382825"
     mRNA            complement(<615305..>617485)
                     /locus_tag="C5L36_0B03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464678.1"
                     /db_xref="GeneID:40382825"
     CDS             complement(615305..617485)
                     /locus_tag="C5L36_0B03130"
                     /note="PKUD0B03130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320537.1"
                     /db_xref="GeneID:40382825"
                     /translation="MLVSKLQNLALLVFTAVGYAADSNIRITVTSDNRVQIDIPASNA
                     PYDEIDISQDSMQINYLWEASGSQFLQCSSDTDCTPFDSSAVITGNKDTVFQAGGTLN
                     ATPNPGNFVRYLSPPLEYPKVGIFQAAFDVFIQSDTPLLERLTATIYKLAEESLADYT
                     YIPTTICQYNECVTTSLPEQKVLSTTTVGGIEKVITSYSPISYNPITIQSYLTSTQVT
                     SDGIAIWVTTYCPLTDTHTSFATSSSTSSLTPPSIPSFTPSSIPSSTPSSTPSFIPSS
                     TPSFIPSSTPSFIPSSTPSSVSSSSTPSSTPSSTPSSIPPSTPSSIPSSTPSSSTPSS
                     STPSSSTSQSSTPSTSTPSSIPSSTPFSTPPSTPSSSTSQSSTPSTSTPSSTPPSTPS
                     SIPSSTPSSTSPSSTAYFTSPTSISSSSTSSFVSTTSFTTFITDCGSSSVTVNCASGV
                     TIVPVGFTDVSIVTYSCAPPAGNTIPGSFVNTKSVITYSNDVTTTVITVSNRIVPSFS
                     CPVPSSAIVSSTLSSTPLSTPLFTLSSSFSSPLVPQVSSMLPSSIPFSSSVSSAFLTS
                     KSRLTNTIIHCSDNECTESYPINSSAILSSVSSADFERSITIQPSPSIFFNATTVHSS
                     MPASTFTTSDIVSSNNRQYTVEKTTFSSTNDETTNSQLNSFSTSFNVTETPIPTTNVT
                     TQFIGSTSFTQPVLAQPTYYGAANVVSHSDFLLTLFFGFIGLLS"
     gene            complement(<618855..>620273)
                     /locus_tag="C5L36_0B03140"
                     /db_xref="GeneID:40382826"
     mRNA            complement(<618855..>620273)
                     /locus_tag="C5L36_0B03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464679.1"
                     /db_xref="GeneID:40382826"
     CDS             complement(618855..620273)
                     /locus_tag="C5L36_0B03140"
                     /note="PKUD0B03140; Pfam Domains:
                     Glyco_transf_15(1.7e-149)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320538.1"
                     /db_xref="GeneID:40382826"
                     /translation="MLLESRRSLRRAVVVFAIIFVIYLVSVSNGNISNTLDANYLFSS
                     TDDYTIKYNTKLMNQPQISEDGTSDEVQEPKGPMTWEEVEKALTFDKDVFKNIENNIV
                     ENNMNFFREVYSKRITEPKFAELTYSQYVDKKGNKKFLTQDEYPRANATLLTLVRNEE
                     LEDIIYTLRQLETKWNHKFHYPYTFINDQPFTEEFKETVKRHTVSDCYFEVIPPEMWN
                     KPDNIDPDIEAEKIGKLKAKGVQYIDKVSYHNMCRFNSGYFYQMDRLKQFRWYWRFEP
                     ATDYYCSVDYDLFKFMEDNNKTYGFTISLYDNPLTVETLWPVTLNFLKKHPEYVHPNG
                     AFKWLTENVQHPDYVEITGGYSTCHFWSNFEIGDMDFYRGEAYSAWMDALEEAGGFYY
                     ERWGDAPVHSVGLGLFEDRSKIHWFRDIGYHHSPYKNIPNSDKCEAPEDSGYFAPEDV
                     YDQNCLSNWIRLEMTNKELQSY"
     gene            <620534..>622639
                     /locus_tag="C5L36_0B03150"
                     /db_xref="GeneID:40382827"
     mRNA            <620534..>622639
                     /locus_tag="C5L36_0B03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464680.1"
                     /db_xref="GeneID:40382827"
     CDS             620534..622639
                     /locus_tag="C5L36_0B03150"
                     /inference="similar to AA sequence:RefSeq:NP_012709.1"
                     /note="PKUD0B03150; similar to Saccharomyces cerevisiae
                     YKL213C (DOA1); ancestral locus Anc_1.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320539.1"
                     /db_xref="GeneID:40382827"
                     /translation="MYKLSSTLYGHDDDVKALSNLGEDTIISGSRDSTVRIWNRLDKE
                     NTKDFSSSIINLKTEGFVNSLAIYNYQSELLIVSGGNDNMVHLTSPNSVFTDSEEYCF
                     IGHTANICTLDTYENLVLSGSWDCTAKVWNKETGAVLYDLRGHENSVWGARFLNENEY
                     LTCGADRTVRKWSKDKQVKCFIAHDDVVRDLLLLPSGDFVTCSNDTTIKIWDGVTFDL
                     KATLVGHQSFIYSIGLTSTGDIVSCGEDRSIRIWRNYQCIQVIVLPCISVWKVMVLPN
                     DDIVTASSDRLIRIFTNNARRYAKENEVLAFRKQLEESSISESVLANVNKQALPPLES
                     LDTDLPTIEGETRMVKSGFDILIYQWSVGKWLKIGQVVNGASSNQKQLYNGKYYDYLF
                     NIDVEDGQPPLKLPVNISDNPYEVADKFLATNDLPQSYQQQIVEFILQNTEGMNMDTK
                     PTDLRYGSTPKSEGLIPQTQYLAFEKMDIPKLISAFNKLNGKQSEGNILSGFETLINC
                     EDYTELHHLALEIIKRWDQDSKLLGFDILRCIITKIQPSEELFPIIRSGLEMENPKVQ
                     MMAVRILVNTFKCKGWGEQVMLDEDILSIIFTEGLFDNLANKIALLPTTIATLILNYS
                     VLTNKYQLINFHKKLLIIISKLLKYPAILDNDESSYRLLAAIGTLDHMKSIENKAEYL
                     LAFANKDEERFSILRNEIS"
     gene            complement(<622741..>623586)
                     /locus_tag="C5L36_0B03160"
                     /db_xref="GeneID:40382828"
     mRNA            complement(<622741..>623586)
                     /locus_tag="C5L36_0B03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464681.1"
                     /db_xref="GeneID:40382828"
     CDS             complement(622741..623586)
                     /locus_tag="C5L36_0B03160"
                     /note="PKUD0B03160; Pfam Domains: ADK(1.3e-62)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320540.1"
                     /db_xref="GeneID:40382828"
                     /translation="MYTRSFLRARPALKSFHRSKQLLRTYATSSGGGRSKTNHFIPLT
                     LLGLTALGLTFYNAGNNVKPPTAAIDPTTSTVQGSALFPSEKFKDPINVVFVLGGPGS
                     GKGTQCGKLVKDYKFVHLSAGDLLRLEKNTPGSEFGELIDHYIKEGLIVPQEITINLL
                     KNAIVKEYNNGSRNFLIDGFPRKMDQAISFENTVSEGKLVLYFECPEEIMLKRLLNRG
                     KTSGRSDDNLESIKKRFTTFIETSMPVVEYFEDQNKVIKVNCNEPVDEVYSHVVKELK
                     DKKII"
     gene            complement(<624743..>625588)
                     /locus_tag="C5L36_0B03170"
                     /db_xref="GeneID:40382829"
     mRNA            complement(<624743..>625588)
                     /locus_tag="C5L36_0B03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464682.1"
                     /db_xref="GeneID:40382829"
     CDS             complement(624743..625588)
                     /locus_tag="C5L36_0B03170"
                     /inference="similar to AA sequence:RefSeq:NP_012901.3"
                     /note="PKUD0B03170; similar to Saccharomyces cerevisiae
                     YKL024C (URA6); ancestral locus Anc_2.667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320541.1"
                     /db_xref="GeneID:40382829"
                     /translation="MYTRSFLRARPALKSFHRSKQLLRTYATSSGGGRSKTNHFIPLT
                     LLGLTALGLTFYNAGNNVKPPTAAIDPTTSTVQGSALFPSEKFKDPINVVFVLGGPGS
                     GKGTQCGKLVKDYKFVHLSAGDLLRLEKNTPGSEFGELIDHYIKEGLIVPQEITINLL
                     KNAIVKEYNNGSRNFLIDGFPRKMDQAISFENTVSEGKLVLYFECPEEIMLKRLLNRG
                     KTSGRSDDNLESIKKRFTTFIETSMPVVEYFEDQNKVIKVNCNEPVDEVYSHVVKELK
                     DKKII"
     gene            complement(<626158..>627498)
                     /locus_tag="C5L36_0B03180"
                     /db_xref="GeneID:40382830"
     mRNA            complement(<626158..>627498)
                     /locus_tag="C5L36_0B03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464683.1"
                     /db_xref="GeneID:40382830"
     CDS             complement(626158..627498)
                     /locus_tag="C5L36_0B03180"
                     /inference="similar to AA sequence:RefSeq:NP_009508.1"
                     /note="PKUD0B03180; similar to Saccharomyces cerevisiae
                     YBL045C (COR1); ancestral locus Anc_7.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320542.1"
                     /db_xref="GeneID:40382830"
                     /translation="MLSKRLFSTSSRQLTKVAVSKLGNGITVITKPSSGKQAVGVYLN
                     SGSRAENAYNSGISTLLGNLVTSSKSSKDALVNEGVKYYSSNAKEVTGLLSATYPRGN
                     SKGALSAIKNTLESLESIVSDEVVLGEQKEKSIALTEAFENSPKDMVIEHMIGTAFQG
                     TTLGLPKYGKAETIEVLQSLDLKNYLSKNLVSSNIAIVSVGDEINHESLAKFASQLPS
                     INSGAKADFPETSFLGSDIRLRDDTLPQAHAAISVLTPGLHDTHAYYTGLVAAQINGS
                     YEGVASPFSPFVGSTLAQLLEENHLIDSFDHFQLAYSDVGLWGGYFASHNVGCYDETI
                     HFALKNWNRFSTGTVNEIEFAKAKAELKLRLLKAPACPVQHSESLATKAFALGYVPSE
                     EEISSNVDSVTSSAISKWAQKYLYDQDIAIAGNGQIEALFDYNRIRNDMSTLRW"
     gene            <627625..>628128
                     /locus_tag="C5L36_0B03190"
                     /db_xref="GeneID:40382831"
     mRNA            <627625..>628128
                     /locus_tag="C5L36_0B03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464684.1"
                     /db_xref="GeneID:40382831"
     CDS             627625..628128
                     /locus_tag="C5L36_0B03190"
                     /note="PKUD0B03190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320543.1"
                     /db_xref="GeneID:40382831"
                     /translation="MFLFFVPLWCSSVQEKRVDNKGLEISVRDNDTSQQSEERTRECT
                     PLLHIPKRQRVYVMELQGECSTGTRDGADGEAPQNTRIGRGGESILWALWDSLPWSSG
                     QSRPLPPQKAISLVSKSHWPMRGRANSQWKVANVKLKENGQLSLKVETGNLCGFNMEK
                     SLCKFNN"
     gene            <628682..>629074
                     /locus_tag="C5L36_0B03200"
                     /db_xref="GeneID:40382832"
     mRNA            <628682..>629074
                     /locus_tag="C5L36_0B03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464685.1"
                     /db_xref="GeneID:40382832"
     CDS             628682..629074
                     /locus_tag="C5L36_0B03200"
                     /inference="similar to AA sequence:RefSeq:NP_015492.1"
                     /note="PKUD0B03200; similar to Saccharomyces cerevisiae
                     YPR166C (MRP2); ancestral locus Anc_7.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320544.1"
                     /db_xref="GeneID:40382832"
                     /translation="MSTIKEGAKALLSRSKPMKRFPQPVSLPSTFVNTRVMRDHFKRQ
                     MFEQHEVTSRALKFIARNSALPQKVRLEAQLQLNALPNYTRANQLRGRCVDSGRGKGV
                     IRDFRLCRYQFRMQALQGLLPGVRKGVW"
     gene            complement(<629881..>630228)
                     /locus_tag="C5L36_0B03205"
                     /db_xref="GeneID:40382833"
     mRNA            complement(<629881..>630228)
                     /locus_tag="C5L36_0B03205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464686.1"
                     /db_xref="GeneID:40382833"
     CDS             complement(629881..630228)
                     /locus_tag="C5L36_0B03205"
                     /note="PKUD0B03205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320545.1"
                     /db_xref="GeneID:40382833"
                     /translation="MQAQLTRQVIMQAPVLARASTITAAAATAMAVRRFSSDSTRNNN
                     IQHLLKNSGIDSKHGSFATFAEYRKFIIQKDPETMQARFRIMIKDGNAQKLPETEAEQ
                     SHFAENVKKVAYR"
     gene            <631052..>632596
                     /locus_tag="C5L36_0B03210"
                     /db_xref="GeneID:40382834"
     mRNA            <631052..>632596
                     /locus_tag="C5L36_0B03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464687.1"
                     /db_xref="GeneID:40382834"
     CDS             631052..632596
                     /locus_tag="C5L36_0B03210"
                     /inference="similar to AA sequence:RefSeq:NP_015322.1"
                     /note="PKUD0B03210; similar to Saccharomyces cerevisiae
                     YPL003W (ULA1); ancestral locus Anc_8.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320546.1"
                     /db_xref="GeneID:40382834"
                     /translation="MSNDKYDRQVRLWNTAGQRALHESSVALVNISTLAAEALKNIVL
                     PGVGTVTILDAGVVDETDVAANFFYTRGDLAKSRAAVLASVLQDLNPDVSIHYRDSIP
                     PAEDVHFWSQFHCVLYTAVPYPLVDASALFNTCWDMDVPVCKVGSLGFYAYLKIQLRE
                     HAVVESHGNNLHDLRLDFPWPELQAYLDSVDIDPITNSEYYKIPFSVILTKLNQEYVK
                     RHGTSPTTKQLRNSILDTYKTMDDPNVHEAYKKAYLIMKQSPPISDNIKEIFSYLSHS
                     QSHATTHSSTNSLYIFQILAKSLKCFYEEFGVLPISGVLPDMESDTNAYLTLKKIYLD
                     KFNSDKSYIRNKAITLIDQQDGDSSLLSDDTLVTFVRNARYLKIITGTKIDKDSQILQ
                     FFRSLGDESLKLKALIYLAFLIVEQFARLHGDWPTWNNRSELRALSISILCNDNNIDS
                     YPENLDKILDELCRAFGNELHNISAIFGGVVAQEVIKLLTNQYVPVDNCVVLDGILGK
                     TSTFKL"
     gene            <633145..>635316
                     /locus_tag="C5L36_0B03220"
                     /db_xref="GeneID:40382835"
     mRNA            <633145..>635316
                     /locus_tag="C5L36_0B03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464688.1"
                     /db_xref="GeneID:40382835"
     CDS             633145..635316
                     /locus_tag="C5L36_0B03220"
                     /inference="similar to AA sequence:RefSeq:NP_011939.2"
                     /note="PKUD0B03220; similar to Saccharomyces cerevisiae
                     YHR072W (ERG7); ancestral locus Anc_5.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320547.1"
                     /db_xref="GeneID:40382835"
                     /translation="MLYSDEIGIPRSDFSKWRLRTTKLGGQKWEYLDNPSDSDRQDNL
                     TKYLLNEPGFQPPITEKPKSILDATFNAANFFTSIQDENSGTWPVQYKGPMFMTIGYV
                     AVCYFTKTPIPEYERRELIRYIINTSHPVDGGWGLHEVDKSTCFGTTINYVILRLLGL
                     DASHPVCLKARRTLHKLGGAIGNPHWGKAWLAILNLYSWEGVNPAPTELFALPYWVPI
                     HPMKWWVHTRAIYIPLGYLSTAKVQCELDPLLEKIRSEIFTKPWSKIDFSSNRNRVCG
                     IDLYYPHTSLLNGLNNIMVLYEKYIRPTWLLDHCNKKAYDLILKELENTKHLGIAPVS
                     AAFETIVLYKEQGPQGSDYLKSLERMKEVLFLSDLGLTVMGTNGSQVWDCAFFIQYFF
                     NAGLAELPQYHDAIVRTFEFLIRSQFDEECVSGSYRDKRKGAWPFSTKDQGYTVSDCT
                     AESIKAIIMVMNSEAFSDVHHIYDLTKLHDAIDVLLSLQNVGSFEFGSFSTYEKIKAT
                     PMLELINPAEVFGNIMVEYPYVECTDSSVLGLSYFHRYSSYRNADISLAIKRATDYII
                     QSQQVDGSWYGCWGICFTYAGMFALEALAEINLDYSNSEVVRKGCNFLVTRQLPDGGW
                     GESMKSSETHTYVSTRKSLVVQTSWALIGLLLARYPDKEVLRKAVDLIISRQGEYGEW
                     EFEQVEGVFNHSCAIEYPNYKFLFPIKALGLYVKRFGNERL"
     gene            complement(<635357..>636199)
                     /locus_tag="C5L36_0B03230"
                     /db_xref="GeneID:40382836"
     mRNA            complement(<635357..>636199)
                     /locus_tag="C5L36_0B03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464689.1"
                     /db_xref="GeneID:40382836"
     CDS             complement(635357..636199)
                     /locus_tag="C5L36_0B03230"
                     /note="PKUD0B03230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320548.1"
                     /db_xref="GeneID:40382836"
                     /translation="MSELVAEPAGQSEQLDKQLDTFSAESDDDFGDFEEVDQGDSGVY
                     SNDLSANKEGRIRSYSGNFATIAADISQNLDKIFNESKGNSENEYKDIFLFDERADQI
                     FNRLISEEDDHLSPFIWKQSMIYKQVLLNLEIEPRAHVTYAKRQLPSANGSRKEFKNL
                     YDFLKSSSTNAELDKLLLQVPDFSQLGIDKDGEEYNQIINNTTSTISEAKKLLRSGSV
                     SELINLKERLLKLVSVWDVKSHDINEDNELFSSYVENLIGNTLKKRREKRQAKASKSK
                     KRLK"
     gene            complement(<636415..>640029)
                     /locus_tag="C5L36_0B03240"
                     /db_xref="GeneID:40382837"
     mRNA            complement(<636415..>640029)
                     /locus_tag="C5L36_0B03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464690.1"
                     /db_xref="GeneID:40382837"
     CDS             complement(636415..640029)
                     /locus_tag="C5L36_0B03240"
                     /inference="similar to AA sequence:RefSeq:NP_014729.1"
                     /note="PKUD0B03240; similar to Saccharomyces cerevisiae
                     YOR086C (TCB1) and YNL087W (TCB2); ancestral locus
                     Anc_2.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320549.1"
                     /db_xref="GeneID:40382837"
                     /translation="MSLEDPHIQPPEQTAARDSSASISSIDHLIEDNKLDSSSETSLE
                     EDHTVEHEEERANSAQPAKLNIGAPVSRSIGSKLRKAREEKEAAKRSPHAAAFRGWKE
                     VTGYDDSFALSPVDEIMDLLTRSTSLEEILPENLYGEWFHGVGALLTACLLSSIVGYF
                     RLSLGPVFFITIIFGLYYRSSIRKYRLNLRLQAQREFSVHAIEDDFESLDWLNVFLDK
                     YWVYLEPSISQQITEIVNPMVAELDAIPAFVREIWIQSLTLGTKPPRVDRVRTLDRTA
                     DDVTVMDWTFSLIPNAQADTTVKQMRNHANFEIIVKAKIFGVTVPVLVSNISMRADAR
                     IRLRMMSNFPHIQTVNVSLSDTPDFDFIFKIIGSNSIFGFELFNIPGLYMMVKEMVKK
                     YLGPMLFQPLSFELNLEQLLAGNGASGALGILELNVKSAEGLVAADTFNNTIDPYFTF
                     GFQKNVKAKTKIVYDTMNPIYNETIRVILNSSSDPLAIKLYDENISDGRKDKFMGAAL
                     YDLDELISKTELKNLKIPILRNNYPAGSINLDIKYMKSLQGSKLPDGSFSPPPDYNTG
                     VAKIVLSGARSFTSKDDEKKSVYAQLYLSGEKRLETPVAKNSNEASWSCDFEEIIYDR
                     SKARVRVILRESLKENKILGSATLRLVDIIDASYVGNSWFPLSNNQGEIEISCNWNSV
                     RIPGVKGALGYSEPFGVLRVYIEKASDLVRINKVGSIDPYFRVLVNGLQKGKTLTMDS
                     TYDPKYYQSMYIPVSSVNQRITIEGMDVARHGQDRTLGSFQIRLNEFIDYNNEGKPIE
                     TSGELKEAKLFHRRKGAKGSVTYSIAFYPIKQVVTPEEAETEKKEAAELQAKIDAEEK
                     KASNDKKDRSTEELSEQNNLALDTLHKDILPIEDIAKFDTGVLVFTLLGSKFSNSGYF
                     QVFFDKNGYPEYETSISGNTNLQRTFDYLVKEMQKYSLMTFRIVEKKNTPLTKNALKE
                     ITVPTIKVLEHSYGKQTSLNIGDSSNTILFTTKFLPAMISSLPPADSIGNSGTLNIEF
                     VGARELLSKDSNGKSDPFVKAYLNGDEFYKSKTIKKTLEPTWNESTSISIDSRVQSVI
                     RFKVNDWDFGLEQDDKIGEYTYALKQLDPFDTEMKDYNFELIGEEGQYAGTLEVRMSF
                     KPEYHTLLSAEKSLPNPGNIAIDGAGKILNTPGKVLGTASKIGSKAFGVFKKKHHDEE
                     "
     gene            <640288..>640701
                     /locus_tag="C5L36_0B03245"
                     /db_xref="GeneID:40382838"
     mRNA            <640288..>640701
                     /locus_tag="C5L36_0B03245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464691.1"
                     /db_xref="GeneID:40382838"
     CDS             640288..640701
                     /locus_tag="C5L36_0B03245"
                     /inference="similar to AA sequence:RefSeq:NP_010487.3"
                     /note="PKUD0B03245; similar to Saccharomyces cerevisiae
                     YDR201W (SPC19); ancestral locus Anc_8.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320550.1"
                     /db_xref="GeneID:40382838"
                     /translation="MRSGTHNGSGPDSEPTKGLNTTITMLESMIETLHHSVQIIKKQT
                     QDVPELARVLQTKALFDVLPERLVLQRPLKIRKMVKPILEKDNKTLDAFISKYKVKKQ
                     ILQQQSRISKLKLDSLAKQSGMYLNKKTMINSKEE"
     gene            complement(<640755..>641840)
                     /locus_tag="C5L36_0B03250"
                     /db_xref="GeneID:40382839"
     mRNA            complement(<640755..>641840)
                     /locus_tag="C5L36_0B03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464692.1"
                     /db_xref="GeneID:40382839"
     CDS             complement(640755..641840)
                     /locus_tag="C5L36_0B03250"
                     /inference="similar to AA sequence:RefSeq:NP_010488.1"
                     /note="PKUD0B03250; similar to Saccharomyces cerevisiae
                     YDR202C (RAV2); ancestral locus Anc_8.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320551.1"
                     /db_xref="GeneID:40382839"
                     /translation="MTTQFHTSRKLNPQDISVLVSQQSKNEIGWYISEIIANQLDPIK
                     DVLVYCKRNLEESNDTQYKLPLSSHQSEVVKGTLTRENFKITELHMVIHSPHFNSGKK
                     FEFVMKSQEYIIIRQLLDCHDAIENAIHYMNKIMENEENEHTTELFMRYIDQICTQLK
                     LARESLAHPQPVYEFPQLRNPGTIFEPVFPKTGALDFIINEGELSVEFKSLKIVEKRP
                     WNVIIDQKNRLSFADVVRKQISKMRDMPMNRIISDEYMKYIEWRKQHTNEGNHEENGI
                     SGTIKNMFSFNGDPSLSTLIKHANAYLETSITYIDDDNVPFVVQVADRCQVVTSDPIL
                     LSISVKLESIDKTMTRISKNLSSISQI"
     gene            <642065..>646828
                     /locus_tag="C5L36_0B03260"
                     /db_xref="GeneID:40382840"
     mRNA            <642065..>646828
                     /locus_tag="C5L36_0B03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464693.1"
                     /db_xref="GeneID:40382840"
     CDS             642065..646828
                     /locus_tag="C5L36_0B03260"
                     /inference="similar to AA sequence:RefSeq:NP_010466.3"
                     /note="PKUD0B03260; similar to Saccharomyces cerevisiae
                     YDR180W (SCC2); ancestral locus Anc_8.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320552.1"
                     /db_xref="GeneID:40382840"
                     /translation="MGKRNIEDFHPENKEREYSPSIITALPHHPFNFLIPNQSLLPLV
                     TPQFAQVKPDQILLSQDNVNDLKTEKAVCSYLLETEDPDLKYLKFKKPLSSSNRFNFT
                     LDYDPQLAGQPPDAPNISLVRKQDYLKVNYNTDNLDTYIKFNDDDHLVDEIVKLFGVD
                     TSNAMYKSENNKAMCKKSESSKFQAPQFVYEISTTQSSLLIHAKEELEGLVSRIITGV
                     NIDNMDEEVDSQLDFWNKFSLLFEKDTFYVREEILKIVESKLLLMIKYNSSISTDSDV
                     FAKLLESCVAILDNALTLDWVEYFSTENIDYSDEFRLFVCVVLQASSIVLLLSSSAYF
                     TSMFVKQDKGVVQVVDFISIFGSVLKSFLQSDPYIELPELFISPLQSFSHLLQQFAES
                     IYKMTLEESQVTRLEYIAFDLVFTDNFSSKQLSVLSSPMEQIRRQSANLIIELYSTYE
                     DQRQFLLNEIVENLRSLSPLKSRAKNLRLDSGITVQVVSYLIVSLIQCHHKFGNNFDY
                     SEWEYLYLDHKTKAKTVQFNELDSQYWSSINDEYSGMLKATNQFMDCFLIKINSLYNS
                     DLRKVIENIYADFFTLLKLPQFPACSVILYSTLSSALTLLHSAEKTYSNAQWMLFEII
                     ALIASKILEINSQKQVLLFDSGIQLDDYELLSKKCYNVVSYLRFSQSNSNIVAANFIT
                     MDFLYKSKGLEQSLEKVVNSHEQLLSSEKRISLEILLKEVKSTLMRFMELPFLSKSVN
                     NAENMSQIEIAECFRTILISHDLSTKYKDILSFIISSLNNPKVKFKIMALKTLTMLIS
                     NEDALLEDKQLRLLFKQRLSDDSATVIDVTLELILKILQNKPKYIEEYFEVVSSKILS
                     SSVAVKRKTVNLIDYMFANTSDITIKVKLCQALLTQLEDEDDKIIDLACIKLTELLFL
                     GLEGNQKEPVDFSVISFNSKAFESVKIMTGLFSQGAAVWDIFEKFFNERIIFTGHLTR
                     SSREELHKSIHRIVDLMLTLVTNLNVENDSATVLSNETILGVLSTFVKSKSNLVSQHQ
                     LIALQPYFINDYDSNQVCYYALQILNSSLVDQKIINTAFLNTCKQSIMKRLTRFNTKE
                     LDQAVQCLWKLYKLEGNTEPLARACVSSLRMLLRYITSLQNLGADFKIEPALPRLIYL
                     IGTFGQYCNLEQNRDIFLNAGLGLKEKEAISVFLLKYLLQFCGNNVVKPLRKVAIKNT
                     MNICIHHPKLFFSVPVSKLIDETFKKKDFAITNIVVGSLLVFLEKEELRMMQKNGFDV
                     KRSSSIQLDIAVFHGYSLEYVNDGICATLVQKYLTNILNICLNKNIDHAINAVKFLKL
                     VVKFGFSNPRTCFPVIVALECSKSRYIRHTMLELHKFLFDKYENLVESTYSESLRMAV
                     RYSNDIYNAEDLWQCSSFLKFFFQIVKQRKSRQCVDKFIHAIIRGLNITSMFKFSKMS
                     KVELLQAQNQIILLAININEIEFETQLELLEVVCSVERIILSEEAIFNDDFNMLLNIF
                     EEDVTDEKAKHVAMSKALLALKCLVKCLIANYSINPELIVRYQESVDKKEFKTSIQKV
                     NSNIFYKGEILDLLTKNLNNQLTLLRRKLLELSES"
     gene            complement(<646865..>649561)
                     /locus_tag="C5L36_0B03270"
                     /db_xref="GeneID:40382841"
     mRNA            complement(<646865..>649561)
                     /locus_tag="C5L36_0B03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464694.1"
                     /db_xref="GeneID:40382841"
     CDS             complement(646865..649561)
                     /locus_tag="C5L36_0B03270"
                     /inference="similar to AA sequence:RefSeq:NP_013267.1"
                     /note="PKUD0B03270; similar to Saccharomyces cerevisiae
                     YLR166C (SEC10); ancestral locus Anc_8.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320553.1"
                     /db_xref="GeneID:40382841"
                     /translation="MSFGFINTNQITLESFSGDVAPVNFINEMTSFSEDIPSDSFIHT
                     DNSDTKCIDPVPYISSLKMVQEKLATLMDECDKKKLECEKEAELKETKYHKSVMRHSK
                     TTSSLKGNYNDLYMSVEKLNSSKIEPLSEKLKKVTTLNDNASEIIFLLKSYNHFYKHN
                     EVPLEIMTSKKGSNTIETATTISQLLKLSSQLSQDSSLANGSKTHKLIEEVAHKFEKD
                     QLNSFNTLYSSQNFMRLQTISNTLFAFNDGINIIDNLIENQSIFSSLQSKVNKSVDAS
                     YWVALSDPKNSSYELDGDSFELLNSLRVTINDELDSLVTIFQHNSKKALSLLMIKLAE
                     KMLKPRLDSLLDVAKSKSKLAFLRTLHLFSNGVSQQLFLPLRTAFYESVTKLSIDTEN
                     IHYILFHRYLDENSYFKMEKENLQAYIDLLIQPFEVANRDSLRDKKLTTKIENMKLEG
                     EYSEDEHLSNLEDYEANPYKDSASIDAPEISVNKEGTQQNIYLPDSRVLRDKSKGARK
                     YIPSSQRLKKIAGSGFIKLNEKYSIFDRYKSPVQSDSIDPSFKESVPESNVTDSTKSV
                     LSLQVSQNIYRLTLESLTRSIELVPTQSNFYTIELFNLLIYKIGPSYIALGLESLYGN
                     FVDSQIKNKGVFSRGSNNTVDISFLQQLYNVLIQLYLLSTVIKKSFYPLVSTEDDSSH
                     MCDSFNNFLQDVEIGINIIMNDTVEIIKERITSILCKQPTNDYSVVSEAERTQTSELM
                     AMLLENILRGAMTELRFDSRLKLSFITKVSNFFLSSLIIHLSHMKVTMNGFTVLTHDL
                     AHYILIFNNLSVENTEENMYETYGSSPRETEYTVKWERDQIENIQTAFKILNEIPGLY
                     SCDPESLKDFCNEGKLNDLKPEIINSFISNREDFQSRFLSNS"
     gene            <650341..>651822
                     /locus_tag="C5L36_0B03280"
                     /db_xref="GeneID:40382842"
     mRNA            <650341..>651822
                     /locus_tag="C5L36_0B03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464695.1"
                     /db_xref="GeneID:40382842"
     CDS             650341..651822
                     /locus_tag="C5L36_0B03280"
                     /inference="similar to AA sequence:RefSeq:NP_011911.1"
                     /note="PKUD0B03280; similar to Saccharomyces cerevisiae
                     YHR045W; ancestral locus Anc_5.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320554.1"
                     /db_xref="GeneID:40382842"
                     /translation="MWAILVAVIVPLIYWGYHHIIRELREIDPVLLNHQSSISETRKP
                     SESAIYRSVDVPHGVSVTRGLNLSVGYKIRDGCLKDIWHLALRSAGKSHTTITLGKHR
                     YTIGQVNTLLHQIKETLDNLGNIEAVALFGDLMESPELLLVVWTCFFITDIRLIYYNS
                     KEDFQFQLEDEVNVLFTSERHVEDIPLSFKEIIGFNVKSPFTRSIDIDDVIESSFEFN
                     YNPQIDFEHVNNQPYSFIRNRQLIRFYQLNFLSAVASKVMSIPSSLSWSTNDNLLISY
                     TKNSCSVNNIIFETCCGLVSGLNKIDIINSREIPSMKSLAAHEPTIICIDSHILKQLC
                     NTTRKSFMQSFILQRSEYFNSLGYFNRFGRIEKSLNLKVAYVAQLTPMLSSFISNFCK
                     SVLGSRIIREIYTDFAIGPILKTNVYDYRVIRNKSLALSGVPANSVELKTINPKEGNS
                     HGKLLIRGMSVGKSESLQTDEEHWVDTGLEGTFAKDGCFYTTF"
     gene            <652094..>659797
                     /locus_tag="C5L36_0B03290"
                     /db_xref="GeneID:40382843"
     mRNA            <652094..>659797
                     /locus_tag="C5L36_0B03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464696.1"
                     /db_xref="GeneID:40382843"
     CDS             652094..659797
                     /locus_tag="C5L36_0B03290"
                     /inference="similar to AA sequence:RefSeq:NP_012137.3"
                     /note="PKUD0B03290; similar to Saccharomyces cerevisiae
                     YIL129C (TAO3); ancestral locus Anc_2.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320555.1"
                     /db_xref="GeneID:40382843"
                     /translation="MDHDYYAQSDYKFGDYQSSNIIEIPDISMSDAMESNTIRDQTTS
                     DAPAPSSLQHHVYNMDTENGVLDLDQIERFEAANAVSSATIVDHGIGLEWNSVPHKAS
                     ATNNFSTTYTNENRSDEKLNLHHEIDGLEDDNVDHADRTEFQTPTHSSTQQLSSNISV
                     NNSYNYKNGQTPSYTLNIVVRQFTKFAERKLNLCLNSSPLNQEPNIAEILSEGVDPMF
                     DRIISSLGYIARRTPKRVTDAVMNWRRGKSELRDMARKIFERDSTAYKEFFTRNKTQG
                     THRRTSSKAKNSSDMPRLSMQEKNRSELFDQYQKSELTYIQADRQFTISTFILWRVLI
                     EVIKQTPSSTLMEDTGLEEIMYNYLRSIDPYLVSTSLIHSANWNLLSELIGQMSEKSF
                     LSVSDRFIADLEKFPTGFTTGNSFSEASLNLLIHGMRYLQFSNSSLERFEEGADFIKS
                     IAKFFYRCENENIFLSYCDVLNQLLLSLAGTLTAEVNHPTWVDAIKVIYTKAMSISNS
                     NLTKYWGSSITLVVTALSVGPKEMFEEKWKSIVDVIIKRMKPKSSLSEKLVVMTCVSR
                     LLWAYLFRYQDTLNAKQRTMETLANLLFLNIQKKQQWLTEDALLIQSVVQIFRAMAYS
                     QLNFTLENIFIPFLKPSFNNATYEIVNHEKLILCIRAYCCILSDYYNHEKPPYPTDFV
                     IQNSLDPLEFSNTIVDKVFHNDLSNYQVHEEISSIFIKVLFLLESHCGCKILDFQSKN
                     TSAPQTPLSATSGSSLHQRIASLTNFHSGDDASYKNTELFTTAITCISWCANTSNSAE
                     YRKIIELLVKNSIYENETTAQFCIDALKILVCKKNPSVVLTTFASVAFCLDEKASNSF
                     DAAYLLSENYVKLLEVYLEVLQSWLDSLTEIEEHDTEEQANTMYNVNHGFIQEEIKET
                     KKFETLELKNMATLIDDVEGNALFFLFSHDFRIRFLGCQMLRIVTQFDEAIYYLSIED
                     DVQVAKGHCRLPSKFAAESGTRVIEVLGSLSFVDVAKNKVTQFSEAELKRYTKLAASD
                     KKNTIVKLAESSHGVDAALWFKIFEDILRTLVRNCPIQIAIARSHSCIRLVQFYDQIV
                     RINSNGGTGVDNAVIWDYMLYLKIVCSSLTTTNEQRLHIPDLKATSPSASSIYAPLVK
                     GHSRKKSQQLFTVQHQKITSARSIFKMTVPLLTTTNGRLRDALVEGLSCINVNIFKSF
                     IDCIAPSIERWEIFANGGFSSDMVLKQEICCILSKVIYRFSKSNENYFDEDILQKLTL
                     LLSNMLSVLSLDVSQVNFRYQRLRKYFSNMLETLQKDLLRLGEAGKWFSFPFRKKSFH
                     FLLEWTGYGDKSSILVERYNSMKKGISAENDRLNLQASLEMQKHQLQLSAISCIACLC
                     GSPVTEDGDSVDLSSMFGWFDSLFKTHNEKISSLARGALLDLLLVNGTVKDIFTIIIK
                     KCYTHDSALGNYFITLTEALVQGVEFEYEVYLPLALALFSSGSDNYNVRSSATVLLEF
                     IEMKFYNTSNVSSYVDGVCCRSRIIYKRTLFQLSTYFATAHPEEKFRMISELTMLFNL
                     VGSSPRRDLVAVLLPWVQTVDLDLNKGSNEIDNYLVVLSNFFDITMKYSHKIQNELEA
                     LWVALGTSNIGEGEGVQTIYDYIIANSLSLKNLAFIECSRQVIVSISTIPSKFSLIES
                     LISNMQPKSMIPFEPEVSKILISEIEKHEFKGLPYVAKLSKLIQKNSSTTIPAFSLGE
                     LSLIFLADLILIPNEKVSENLTLLLHLSISLLDHQLFLVQDQAATLVIHLIHEYGDAS
                     SDAGQKVINKLRKSDHSNNLWSYSDLASMKNKGRIPESMDSLVRDILKVFETKIPTIQ
                     KDWSIMAIKWATTCKVMHLASRSFQVFRCLISFLDQTMLKDMLSCLTNTISDGNSGIQ
                     GFSMQILMTLNAITSELYSEQLIAFPQLFWSSVASLTTVHEHEFIEVLSTLSKFISKI
                     DFNSPETVNCLSATFPSNWEGQFEGLQKMIMIGLRSSNAYEPTLKMMQKLNQLDNSQI
                     IGEGKHRVLLVLMANMPRFLHAYTTKRFPEDVVSAANSLSAMADKNEIIGLSRIIDSL
                     VKKRFRNKEDFVSQVTNILKRFYFPRFAPEVLIFLLGLLLNKTGWIKVEIMDFLKHIF
                     RIVDLTAPEFTGLGADLVSPLLRLIPTDYVNQALEVLDLATSITASPYDKQYLMVLTG
                     NPIKKYDHENLVTLFGVPEESGWSVPMPGVRTAITRNNIYSVYSTCVNNIEDDTKELL
                     NGEMNPLNISDNASAKNENDLVDENELNKGFDRSMQLSEAPRLSAESQYVQYNPLSPE
                     LQKQVNKHHQQQEHYNNDNMSVTEKDSLSNMLATLETLDSFFTKDGQEIKGGFEHQYA
                     SSVDTRSTSTTSNTERWGYDFELGSPKLEHTPVQFDSTASFRTLLADVKSPVSDSLSS
                     PRSSSLIGRGKKNSRGSIHAVVEPLKLARDITKDPIVNGALITESNNENEEQSDALFG
                     FDLLRQTNKTRRRSTRFTTSLGNESNGGNMLLKNSPISPRNPRSPRHTNINSRSKFRS
                     YAASYRRSSRAPYSPSESMRTDSPRSNIS"
     gene            <660331..>661248
                     /locus_tag="C5L36_0B03300"
                     /db_xref="GeneID:40382844"
     mRNA            <660331..>661248
                     /locus_tag="C5L36_0B03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464697.1"
                     /db_xref="GeneID:40382844"
     CDS             660331..661248
                     /locus_tag="C5L36_0B03300"
                     /note="PKUD0B03300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320556.1"
                     /db_xref="GeneID:40382844"
                     /translation="MVTQPDVSLVNKKREEEKEGSRFDFRQHLIYSTKIRHLVGIDLE
                     GFFLTVLSEKTYIKDHYVYGVSDWCVVVPQICGLIRRIIKDVFKVDMNYEFFQYWRDP
                     KNGKRGQTIEGLVQFIENKLSTTFRDSPPFTVVPFIQNLLLLNDLVEYQPVENDEPAL
                     YCGVKHYKKIVNDLVFGTKIEIDVTNPYYRESVDEPETPVDNDDTYLEINQKRETDEP
                     VTTLEQDFICKNSTNAVKYLLALISIISVESNLEQVQNDLKSYNSCNNIVPYTKDSKT
                     SDTLNDMTTHIKLEKISWFEPNMIQKRKP"
     gene            complement(<661369..>662018)
                     /locus_tag="C5L36_0B03310"
                     /db_xref="GeneID:40382845"
     mRNA            complement(join(<661369..661554,662016..>662018))
                     /locus_tag="C5L36_0B03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464698.1"
                     /db_xref="GeneID:40382845"
     CDS             complement(join(661369..661554,662016..662018))
                     /locus_tag="C5L36_0B03310"
                     /inference="similar to AA sequence:RefSeq:NP_013390.1"
                     /note="PKUD0B03310; similar to Saccharomyces cerevisiae
                     YLR287C-A (RPS30A) and YOR182C (RPS30B); ancestral locus
                     Anc_6.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320557.1"
                     /db_xref="GeneID:40382845"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKPKKPKGRAYKRLLYTKRF
                     VNAAITPGGKRKMNSNAK"
     gene            complement(<662245..>662826)
                     /locus_tag="C5L36_0B03320"
                     /db_xref="GeneID:40382846"
     mRNA            complement(<662245..>662826)
                     /locus_tag="C5L36_0B03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464699.1"
                     /db_xref="GeneID:40382846"
     CDS             complement(662245..662826)
                     /locus_tag="C5L36_0B03320"
                     /note="PKUD0B03320; Pfam Domains: DUF202(4.9e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320558.1"
                     /db_xref="GeneID:40382846"
                     /translation="MEPAINRRLRSGSTSAHKPAFSMTPEPIGNPKTHSGSCYIVDII
                     VKSSRITTAGNPSRDHMSNERTALAYIRTSLNLIILALLLLQLAKYVVIAPVTQIETI
                     QHLKDSYEKDIFNQLVSCRHTVEKFSRPISAFIFSISLSILATGTIRYIRIFQCLSNV
                     PDIFESGLPFQLLVFLGIVIISSLFIVYTIKLA"
     gene            complement(<663066..>663947)
                     /locus_tag="C5L36_0B03330"
                     /db_xref="GeneID:40382847"
     mRNA            complement(<663066..>663947)
                     /locus_tag="C5L36_0B03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464700.1"
                     /db_xref="GeneID:40382847"
     CDS             complement(663066..663947)
                     /locus_tag="C5L36_0B03330"
                     /inference="similar to AA sequence:RefSeq:NP_013393.1"
                     /note="PKUD0B03330; similar to Saccharomyces cerevisiae
                     YLR290C; ancestral locus Anc_6.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320559.1"
                     /db_xref="GeneID:40382847"
                     /translation="MSAANTANAVKKLVVFGGTGFLGKRIVENAVKRGFDVTSITGSG
                     RMPRPYPQEDNSWMEQVKWKQGNVFFPETYERDLQDCTAVVHSIGILLENDSYKKIVG
                     SEDGLINTVSSLFTTNPGTKTTNPMMKTPTDDVTGPNVVIDKTYKRYNTESALVLAET
                     LIDVNRGDKPPAFAYISADRGFPGLPSGYIQSKREAEYQLYQLQPRLRPILLRPGFMY
                     DPSEGTQGHMSMRSSLRTFLDGLNEVNSKLLFNALDGIVRPTISTKTVAQWCMDRIED
                     PDFHGPVMLDEMINIKK"
     gene            <664415..>665014
                     /locus_tag="C5L36_0B03340"
                     /db_xref="GeneID:40382848"
     mRNA            join(<664415..664417,664814..>665014)
                     /locus_tag="C5L36_0B03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464701.1"
                     /db_xref="GeneID:40382848"
     CDS             join(664415..664417,664814..665014)
                     /locus_tag="C5L36_0B03340"
                     /inference="similar to AA sequence:RefSeq:NP_013366.1"
                     /note="PKUD0B03340; similar to Saccharomyces cerevisiae
                     YLR264W (RPS28B) and YOR167C (RPS28A); ancestral locus
                     Anc_6.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320560.1"
                     /db_xref="GeneID:40382848"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDTSRTIVRNV
                     KGPVRENDILCLMESEREARRLR"
     gene            complement(<665588..>666580)
                     /locus_tag="C5L36_0B03350"
                     /db_xref="GeneID:40382849"
     mRNA            complement(<665588..>666580)
                     /locus_tag="C5L36_0B03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464702.1"
                     /db_xref="GeneID:40382849"
     CDS             complement(665588..666580)
                     /locus_tag="C5L36_0B03350"
                     /inference="similar to AA sequence:RefSeq:NP_014807.3"
                     /note="PKUD0B03350; similar to Saccharomyces cerevisiae
                     YOR164C (GET4); ancestral locus Anc_6.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320561.1"
                     /db_xref="GeneID:40382849"
                     /translation="MTSLVENKLKKSLARFRERINNGSYYEAQQTIRSITNRYVHAKN
                     YEAAVSLLYQSTMILLESKQYDEAADLYLYMLEVFQDENKEIDLFERDDVNKIMSLIT
                     LFPDTDANLGNLAKETSKFLTSKLGNSVGLPKLNFLLGSKLYNSGNVSLISQSEGYLF
                     LSEDAKALEMIIDLEYKTWKTSKVTNDFGLYLARTVLPYLAIKNVKFARMAINEFMER
                     FQKDQPDLQTEAIDGMFIFDGPEETNLNDKLLNCQKLVNFLQLLTTLLSRGKIEDANV
                     FQLLIKRYQDIIKTYDGLLERINEIAGIYYNISFIKKQSNLLQDMMGSFLGGGK"
     gene            <666873..>668231
                     /locus_tag="C5L36_0B03360"
                     /db_xref="GeneID:40382850"
     mRNA            <666873..>668231
                     /locus_tag="C5L36_0B03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464703.1"
                     /db_xref="GeneID:40382850"
     CDS             666873..668231
                     /locus_tag="C5L36_0B03360"
                     /inference="similar to AA sequence:RefSeq:NP_014145.1"
                     /note="PKUD0B03360; similar to Saccharomyces cerevisiae
                     YNL254C (RTC4); ancestral locus Anc_1.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320562.1"
                     /db_xref="GeneID:40382850"
                     /translation="MSFFKKNFSSLNSNNSLPHSSDMEDDQFSKVANPIQPPENTPPK
                     RTHTIESSFDELIPVKKQKSGKNKNIINRSVIADNLHSRQTPNLNKKDLPHTKRRSKS
                     HVYIASTNNAPDVDMLSQVLEHSHKGVSDDMKFMDVDGYKERAVQRESEFQKYLRARE
                     ERDRTSNGPKKSITKSYIDAKLDSSTFSTSDIGIYSKEKLALSSFSHGKDNQKKQSAG
                     ELSIGSLLLGTEKKESLKKEFEYRKPYITPKILAKKTDIVKLVNTYKDIVSGILNGEV
                     GSYFYNDVKRLQQGSKLMTIKDDEIINLPKNKYYGYIGAVRGFHIGKAIQENPDISLL
                     LRKKMKFNKVIKFLGIDNFTQYVLAPEIIAHLTMKIGKLPDLDSAYDEMEETNQYGMF
                     VTNTYELESDEQVETIDTSSQEEMVSTTLPSTLLVSSDDDHTLDDEDFMNTISEAILS
                     KK"
     gene            <668465..>668938
                     /locus_tag="C5L36_0B03370"
                     /db_xref="GeneID:40382851"
     mRNA            <668465..>668938
                     /locus_tag="C5L36_0B03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464704.1"
                     /db_xref="GeneID:40382851"
     CDS             668465..668938
                     /locus_tag="C5L36_0B03370"
                     /inference="similar to AA sequence:RefSeq:NP_014144.1"
                     /note="PKUD0B03370; similar to Saccharomyces cerevisiae
                     YNL255C (GIS2); ancestral locus Anc_1.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320563.1"
                     /db_xref="GeneID:40382851"
                     /translation="MAGFPRTCYKCGLAGHKAEDCDQAERLCYNCKQPNHETKDCPLP
                     KQNTEKQCYNCKEIGHVQSECPLPVRNNQKCFTCGKFGHVARDCRASTKVSCYRCGGA
                     NHFAKDCQASGPKCYTCGLTGHISKDCTAAPSASSAKTCYNCNQEGHISRECPSA"
     gene            complement(<669516..>671855)
                     /locus_tag="C5L36_0B03380"
                     /db_xref="GeneID:40382852"
     mRNA            complement(<669516..>671855)
                     /locus_tag="C5L36_0B03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464705.1"
                     /db_xref="GeneID:40382852"
     CDS             complement(669516..671855)
                     /locus_tag="C5L36_0B03380"
                     /inference="similar to AA sequence:RefSeq:NP_014143.2"
                     /note="PKUD0B03380; similar to Saccharomyces cerevisiae
                     YNL256W (FOL1); ancestral locus Anc_1.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320564.1"
                     /db_xref="GeneID:40382852"
                     /translation="MSDISDNGDTVLTKDLRFSALVNNTKKELFITTKFKTDFTKASS
                     TDDLRYSINYATVCQDFKDFEALNETKSFKSISSLGLSLLSKAAFKQVCSSITMTLKC
                     KEPKFDTHVELNRKLDNWGNIVPTEIDKIYLKNISLNTIIGLYTFERFQKQPIVLDIR
                     IDVDFSKTDPDIAGVGKSIYKYVEKSNFKTVEALVLNVNKLIYKLLPDASDCEVCVLK
                     TDIIEYSDVGVSTRKTREEIMKLDFELVEFDENDLTTEKFVIPNLNRETQIDLEVEDH
                     IAFLAFGSNEGHQLNNIMKAIAELNAHPKIKVLQTSSLYKSKPMYYLNQPDFINGCLK
                     ITTTLTPHALLKVLKQIEYGTLNRVKKFNNGPRTIDLDIILYDSAIINSPDLNIPHIR
                     MIERSFVLVPLCELLPPDFVHPVTAECVHDHMKQLLLSAPPPSEIQESSDLISLVPLP
                     TRSTDNATFRYLEYDLVHRKTPTQLMAILNVTPDSFSDGEEENLNLNRTMEKVDEMVA
                     NKIDIIDIGGCSTRPGSVQPPVEEELNRVLPVVRAVKEKYGDRITVSIDTYRAKVAEE
                     SIKLGADMINDISAGSFDKSMYDVIAKYNVPYIINHTRGDISTMASLTNYQQTEDGEG
                     IKIFNERRNQEDVITTEVSKELAKSLSEMYARGIRRWQIILDPGLGFAKSLHENLILI
                     RHLPFFSKYKQFNNKTGEFISFDYLPILLGPSRKKFIGTITSKGTAAERINGTSASIT
                     AGIGFGSDIVRVHDFKEMKDVCLMGDAIYKNILPKKKTD"
     gene            <672297..>673709
                     /locus_tag="C5L36_0B03390"
                     /db_xref="GeneID:40382853"
     mRNA            <672297..>673709
                     /locus_tag="C5L36_0B03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464706.1"
                     /db_xref="GeneID:40382853"
     CDS             672297..673709
                     /locus_tag="C5L36_0B03390"
                     /inference="similar to AA sequence:RefSeq:NP_011771.1"
                     /note="PKUD0B03390; similar to Saccharomyces cerevisiae
                     YGR255C (COQ6); ancestral locus Anc_1.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320565.1"
                     /db_xref="GeneID:40382853"
                     /translation="MFRRYFASAVKQAPKMDVADIVIIGGGPAGLSLASAIKSSPILN
                     DLKCTLVEGGKLAVSLEKFYQDPPEFIDKRVVSITPATMDYFKKIGSWEYVKEERIET
                     YDNIHTYDGVSGAKMEFDAPEIATMIENVNIQSMLFQRIKQLNEETPDNQLQLLDETK
                     VVDIKEDPNNEWPILNLSNGNTIKTRLLIGCDGYNSPVRHYAKIESRGWSYNRWGNVA
                     TCKYKDSEFRLSTGWQRFLPTGTLAFLPLPNNWCSLVWAVPPEISSILGKLNDEEFTL
                     MLNAAARLTPEELNYLYKVADDEQEKLVEEVKWRLDLFKKKTTPEQLQDFPLEIDYIV
                     AGSRAKFPLKLSHADSYVEERVALVGDAAHTTNPLAGQGLNMGQADVKCLVETLEKAR
                     MRGLDIGTKIAIEPYWSERFLANHVMLGVVDKIHKIYSTEFTPIVWARTVGVNVLNSL
                     PFVKDFMVDQISHYNGHGKK"
     gene            <673973..>675231
                     /locus_tag="C5L36_0B03400"
                     /db_xref="GeneID:40382854"
     mRNA            join(<673973..673990,674107..>675231)
                     /locus_tag="C5L36_0B03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464707.1"
                     /db_xref="GeneID:40382854"
     CDS             join(673973..673990,674107..675231)
                     /locus_tag="C5L36_0B03400"
                     /inference="similar to AA sequence:RefSeq:NP_010113.1"
                     /note="PKUD0B03400; similar to Saccharomyces cerevisiae
                     YDL168W (SFA1); ancestral locus Anc_7.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320566.1"
                     /db_xref="GeneID:40382854"
                     /translation="MSTEGKTITCKAAVAWAPKTDLAIETIEVAPPKAHEVRVKVDYT
                     GVCHTDAYTLSGQDSEGVFPVIFGHEGAGIVESVGEGVTNVKPGDHVVLLYTPECREC
                     KFCKSGKTNLCGKIRATQGKGLMPDGTTRFKCKGKELFHYMGCSSFAQYTVVADISVV
                     AVDSKAPMDRTCLLGCGITTGYGAATKTADIQEGDTVAVFGIGCIGLSVIQGAAERKA
                     SKIIAIDINDKKKEWAFKFGATDFINSMTDLKEGETIVSKLIDMTDGGLDYTFDCTGN
                     VNVMRNALEACHKGWGTSIVIGVAAAGKEISTRPFQLVTGRNWRGCAFGGVKGRTEMP
                     ALVQKYVDGKLKVDEFITHRHPLDKINQAFHDMHDGDCIRAVINMD"
     gene            <675864..>678752
                     /locus_tag="C5L36_0B03420"
                     /db_xref="GeneID:40382855"
     mRNA            <675864..>678752
                     /locus_tag="C5L36_0B03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464708.1"
                     /db_xref="GeneID:40382855"
     CDS             675864..678752
                     /locus_tag="C5L36_0B03420"
                     /inference="similar to AA sequence:RefSeq:NP_009635.1"
                     /note="PKUD0B03420; similar to Saccharomyces cerevisiae
                     YBR079C (RPG1); ancestral locus Anc_3.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320567.1"
                     /db_xref="GeneID:40382855"
                     /translation="MSYQAGRPENVLRRAEDLIAINEPTLALQSLYNFITAKRTKYIN
                     PTTPELVQNFKLFISIAIKNRLSKDIKDALYHYKRIVQTANTTEGYESLEQLAKFFLK
                     EANSKLDEAQTQANDAAEAAIEENVLSAAAAQKVLDTLEEEEEVAHDEEEDDVEAFHF
                     NVSPENILLSSVTTDDSTDRSNKEFFLPWLKFVWEAHRTVLELLKNNNKLETSYCQVI
                     LEAFQFCIKYERKAEFKRLCELLKNHLLAMSKPEFEDAVNLSNPDTLQKFLDTRFQQL
                     NTAVKLELWKESFKSIDDVHVLMKISKRTPKPIALVNYYKNLAKIFQVSNDYIYATTA
                     RQKLFELLIQSPIITAEELKEHSTLYLITALSIPVSESSSRSFSVQNGLVDSEFYKRK
                     NQKLTSLLNLKEVPTRESLLGSNTLKAVLKYADANIVALFNLLEKSFNPLTFNTSANK
                     ILNELASNDKYLSYTTPLKEVIVSKIISKVSTLYESIKFDFLYKISTFENSIFNYDQF
                     TFEDLLVNGSFSNLIKSDVEIDDEAGVVSFTDKLYASPASRVNSRLFDLEKALSSAIN
                     LINVEQYNASKKELQNRLLQAANEQFAAEKENILKTSELIAQREEELRASKLEEKLEN
                     EKARQEAAIKQRKAEEERIQQEAERRERERIEKTTKMIEMDNKKQIVANINASGIIHI
                     KFEDVKDMSEDDIRKLQIKKLEEESNKLEEKTQAIVKRADYIERAQRQYEIPLLEKEF
                     EHDVVKQREEYEVLKKKNEEQSKAAHEQALQIKERLSRFVPVFEEYCNKLAELSVDVR
                     KEKELKIKEKLEAAKKARIAEFIEEKKKEFLEAQQREKEAAKAKAMAEAQAAAEAKMY
                     EAQNRAREEALKARQAAMGQASSSGRYTPPTATPSRYTPPTAAPSRYTPPTAAPSRYT
                     PPTAVPSRASPSQGSGDPERADYEALKTKGSLSMSERLKLKRLAAKFE"
     gene            <679111..>679704
                     /locus_tag="C5L36_0B03430"
                     /db_xref="GeneID:40382856"
     mRNA            <679111..>679704
                     /locus_tag="C5L36_0B03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464709.1"
                     /db_xref="GeneID:40382856"
     CDS             679111..679704
                     /locus_tag="C5L36_0B03430"
                     /note="PKUD0B03430; Pfam Domains: GLTP(9.5e-64)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320568.1"
                     /db_xref="GeneID:40382856"
                     /translation="MTFFDDMKTSFKDVEIQDNEIPTLKFLEASESLVTLFDLLGSSA
                     FSVVQSDMTGNINKVSNKFLSDPEGCATLQKLILTEVKEGGKKTATQGLLWLTRGLQF
                     TAVAMRKCIDNPDWELSKAFEKSYSETLSKYHSMLVKPIFKLAMKACPYRKDFFAKLG
                     EDLAKVNEQLLQWVVALENIVQEVMKFFDSGNYGKGL"
     gene            complement(<680044..>681354)
                     /locus_tag="C5L36_0B03440"
                     /db_xref="GeneID:40382857"
     mRNA            complement(<680044..>681354)
                     /locus_tag="C5L36_0B03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464710.1"
                     /db_xref="GeneID:40382857"
     CDS             complement(680044..681354)
                     /locus_tag="C5L36_0B03440"
                     /inference="similar to AA sequence:RefSeq:NP_009634.2"
                     /note="PKUD0B03440; similar to Saccharomyces cerevisiae
                     YBR078W (ECM33) and YDR055W (PST1); ancestral locus
                     Anc_3.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320569.1"
                     /db_xref="GeneID:40382857"
                     /translation="MKLSSVFSSLALAATALAANDVKDTTSLETTLASTTSINVASGC
                     SFKSAFTATAQSDLDRLTGCEGIQGDVIITGDLGSASIANVKAIYGDLQIYNATNLQS
                     FAADSIGTITGSLKLHGLTVLSSLSFGSLNSVGAINWVTLPNLVETGLSQVTDCNSIL
                     ISDTQLSDLKGINPVNVEIFNVNNNLNLASISSNIETVSNALTVAFNGHDTEVEFNDL
                     QWANNLTFYSVASVSMEKINYVNKSAGFFESSVEELTFPLITGIGGDLTIENNQDLTH
                     IDFSNVTAIGGGFVIVNNTELASIENVDSIKSVQGAVVLKGDFDNCTMSSLRTVRGAF
                     DLETTGYADCDPFKKLSKNGGIQGSYKCKAKSKPVSSSSSSESSTKTKTGSDSKTTSS
                     DSDSTSTSSNADVSSISTTSKGAAASLQKASVFGTVAAVLLALL"
     gene            <683050..>692505
                     /locus_tag="C5L36_0B03450"
                     /db_xref="GeneID:40382858"
     mRNA            <683050..>692505
                     /locus_tag="C5L36_0B03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464711.1"
                     /db_xref="GeneID:40382858"
     CDS             683050..692505
                     /locus_tag="C5L36_0B03450"
                     /inference="similar to AA sequence:RefSeq:NP_013060.1"
                     /note="PKUD0B03450; similar to Saccharomyces cerevisiae
                     YLL040C (VPS13); ancestral locus Anc_4.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320570.1"
                     /db_xref="GeneID:40382858"
                     /translation="MLESLVANILNKTLGAYVENFDPNQLNIGIWSGDVTLSNLKLKP
                     ESLDKLDLPINLKCGHLANLTMQIPWSNLKSKPVKIQIEDCYILATAKLQNSKAYEDE
                     DDRLQRIKRQKLDNLELLSSQSNDSLDESDQLKNQSFTESLIAKVIDNLQVTIKNIHI
                     RYEDFDCYTKTPYAFGITLDELSASSTDENWIPNFIQQISTLSRKLLLLKSLTIYMDT
                     SLTKNTSICSDDQSQMLQNLKDYIRVASSDDSQMEYLLQPISGEGHLTLNKLGSTQEI
                     PHYQLDLFFDQFRINLNRSQYFNLLDTITEMNYYMKTLKFKKNAPTCTIDEDPYKWLK
                     YSFQTVFDEIHERNYKKTWSYMKKRRDQRKLYIPLWKKYLYDKNSLTPDERQKMLQLE
                     DECSYEDLKFYRSLAKLQYKKEYNSLPKSSKQENKGWFSSWWSGNNDSNVKAMDIKPS
                     DDTIEITNEQINEFYDAIEFDESKVLADSLDIPRDRIQLSVDCRLNTGSFVLRQSRSD
                     ANMAEFLSRGCHVDFLQRKDSYFVGFKLNAFSVVDGDPNTIFNQIINAKRKDFNINDP
                     TIEDVFKDEPFFQISYEQHPINEIADSELILKMGSVSIFHNRKFIESLMHFFCPPRAH
                     VDTIGSLMNAADCTLQDFTKQTKIGLQYAFEEHKTMNVVLDVQSPLIMLPADPTSWEA
                     PVVIIDAGHIDMVSDLISSEKYEEIRSERKDSYTEEDWKKMNTYMYDKYNVGLHDAHI
                     VVGPDIYTTTKILHDTDNDSGLILHDFSMNLIFEVSIIPSFYSLPKIKMSGEIPDLRA
                     QMSDYQYKILLDLTGNLMPDFSTPDDGSTNSSVDDYMDANSFFNERSDGETSIYLEDS
                     TLLKDLKETSLAEGNNPDSATNQSNSSLKDSPALQQHEIEFNFTMKHIVLSLKRCLDK
                     ETMESEILVDIVGDELKLHFYQTQRELHVDMSLADLYVRDYIQTSEIPEFKRLIGAKN
                     ENDSTENLFSLAYTRTLRYAHFKGEEIECFDQDINIDVSDLQFVITRKSLLTLINYSL
                     NTFTDVNAPEIPSDKLRHNNEEEINAPAHINIDLKLKSISLLLNDDGLKIATLVFADA
                     DASLFLLPDKMRINTKIGGLSLVDNDVHDGSKLINIQGDDLADIYYETFDPEINDLPY
                     DSQFKFESRSLVVTFIEDSFARIYNFLYQFQRMKYIYDSAREAALNQASNVEYPNKMK
                     FDVHVRAPIFVFPKPVDPVNEKFDTITINLGEIRTSNTFTEHKDHVLNLINADLFNTR
                     ITTSLNIADEGVQELDIIDRFDIHLNIDYSDKSTGERADVLVTGGLQGNDMKLTELQA
                     FTLIQLSQSLPTIFKHVKLDDEDLEDLEMDAHNANLLISNGASQEKVQENKPGMLKGK
                     FDAMEATDDTIQSSGSSVNFKFHIPVLSLTLFNNTCHTLNISDSELMRFSLNDMGIML
                     DIAKNGDYTSNLHIKSFTIRDVRQQCKNFFKDIIPEVDDKEYQFLTTINSNKGVTTVD
                     LNIDHPRILLAMDYIVALKSFIDYATYQPRNIVDHYMKQHPAIDETLSITRDENDRNT
                     INNNNNENSTTNYHIKINEPSIVLLADTEKEDSEAVVFKLNKLLVDVSETTNVDASGI
                     GMFLTRMSTDSSQDLRILDDFAFKFVMDSRGSCDTAFLTTIDATVEPLLLRLSLRDIY
                     LAIEIFNKASKMYNSIGQLSMNDNDVTSIAEEIGKTISKYAPSIISSLSRRSNEIYKK
                     LSDKKPDVIVKAEHMNIVFEGFRMVLIGDVHELPILDFDVESFEITAKNWSTDFEADT
                     RIETLINIFNYSLSQWEPMLEPWMFAIHIERNQDGKLHSNFVSKQTAEWTVTTRSIAT
                     ISHFANLLTETGELKPRGEDSPFRISNHTGYDINVWIDENKDEKRQLTVIRNEETIPW
                     SFEDWRKIRERLSIDSELNSIGIELVDSIYKPLRNVSLRCVGEEVFTLDPPVGNYHNR
                     IVTEITLAEDKVKEVILRSTISIENDTPTAIYIGIGSNYDGNFAIDRQVVIPGGARRA
                     LPIDYVYGGALVVRPDTSSEIFGWSKAFTKESHDITEFNWRNIRENDLFLECSATDPK
                     RNNSYFFKVHSESHNDVLNKYYPCMNVVISPPFVFENLLPYDIDWKVFQLKHEKWGSF
                     LKRGTKVPVHVLNINETSILKIDVLGSSFGPSQPAIINSAIAGVYPDNEIILRNHHTQ
                     LSLKLLYSTDARYGTKVSIYSPYLWVNKTGKDLRVVDNAHSILCPGRKGDVEGEEYPE
                     MFSFDSKNDVLGFLKGNLEANRIQLKIEDSRLSDSFSIDKIGQSFEVNVGLSDRYYED
                     NIGIHITEGTGIYKITKVIVASPRYIVKNDLKVPIIIGLVGSKENMTVQPEEICPLYK
                     TPAQNKKEMVIGFEEVPNSMSASFVITEIGEIFLRVKKKDSNAHQLLKVNISTDHATV
                     FVNILDAENKWPYMIKNYTNEEFFIFQQNPNISSDGSITSDVPFTPVLYRVPGKSVMP
                     YAWDFPSAENKELIVKCGDYQRYIRLEEIGEQVPILIKEKNMAFDLNVVAEGVVQSLN
                     ITDYDYSKSMYKLKSKKNSNSSSISTSTSNKDADFEAVVDNASDYYTSLIFNFEGVGI
                     SLVNTEGRIQELCYITIRGIEFRYNESGVYQTLSMKMKWLQIDNQLTRNVFPVVLYPT
                     VIPKSSFELNNHPVFSASIAKMKDDKHGVTYIKFATVLLQELSIKVDEDFLIALLDFS
                     KIPGASWNKVEEDELWAQNLDIPEPPSIRTTDDLYFEGLHLQPLQFNISFVRTENSNL
                     VSNVMSTQNILSVATDVLTMAIGNINNAPVRLAALLLENIRVPIPYLIKNICDHYTQA
                     FLYQLYKVLGSADVLGNPVGLFNNISSGVMDIFYEPYQGYIMTDRPEELGIGLAKGGL
                     SFLKKSVFGVSDSVSRFTSSMAKGLTVASMDKNFQEQRRLARQGIQNKNHPVNSLSLG
                     ATSFISGVSSGITGLATAPLEGVYKEGASGFFKGLGKGLLGLPTKTATGAFDLANNIS
                     ESIRNTTTAFDNDNIDKVRFPRYIPYDGSIIRYQNKESQGQYWLKNCDNGEFENDHYV
                     AHYVFPGGEYAVIISFQRIVLMNVYELKDQWMIPYDGIKDITLERGGIRIKESQSNSS
                     VVIPLRNPEDRKYLYRQISIAVNEFNKRSIVEL"
     gene            complement(<692588..>693571)
                     /locus_tag="C5L36_0B03460"
                     /db_xref="GeneID:40382859"
     mRNA            complement(<692588..>693571)
                     /locus_tag="C5L36_0B03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464712.1"
                     /db_xref="GeneID:40382859"
     CDS             complement(692588..693571)
                     /locus_tag="C5L36_0B03460"
                     /inference="similar to AA sequence:RefSeq:NP_009540.2"
                     /note="PKUD0B03460; similar to Saccharomyces cerevisiae
                     YBL013W (FMT1); ancestral locus Anc_4.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320571.1"
                     /db_xref="GeneID:40382859"
                     /translation="MKIAYFGTDFFSISTLKHIVNHPSISHLDIITRLPKPSGRGLKS
                     IKESPLATFAKSNDLNLLYAESKQDFEKLKHQYDLAVAVSFGQLIPALFLDTLKYPGL
                     NVHPSLLPKYSGPAPLQRALLNNDKITGVTLQNLHPTHFDKGDILLQETHPIQQNETL
                     LSLSESLANKGGEMLSYCLSNGLFDPSSPNYKTLKPQYPYSYAAKIKPAEREISWSSP
                     SDYVIRQFNTLGPLYTFKPALKKDGSTVHKRIVLDNIVKSNRILSVSDEILPNGTFIL
                     GENDQLDIKCHDSFASVGTIKTEGIGSESPTKFVNSLSKKFGNTENIFISI"
     gene            <693895..>694761
                     /locus_tag="C5L36_0B03470"
                     /db_xref="GeneID:40382860"
     mRNA            <693895..>694761
                     /locus_tag="C5L36_0B03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464713.1"
                     /db_xref="GeneID:40382860"
     CDS             693895..694761
                     /locus_tag="C5L36_0B03470"
                     /note="PKUD0B03470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320572.1"
                     /db_xref="GeneID:40382860"
                     /translation="MTMSEDEKRTRRLQRFQETAPSGPGLVSRGGDTLLRDSPEARWA
                     LLRRVEAFLFRGVVDGDGNNGYVGGVHEPYKVRVNTEISNREYHLGDEGLKSGSIDQT
                     WVLLQYRKLREGVISSRDTDQELCRRVFESGGRYFWTHGLISGYLPSLEKILNGESSN
                     GCFDYQWAVSCLCVHLALVEGDIEGAWVLLVRVEGAHCMGPLWVLRRVLDGAARGEWF
                     TVGRALRDLPRQVCASWVEARVRERQLAAIKRAYRCRGKPPSEEEIQNVCDDLEFGRK
                     KEERANEAVNII"
     gene            <694992..>695360
                     /locus_tag="C5L36_0B03475"
                     /db_xref="GeneID:40382861"
     mRNA            <694992..>695360
                     /locus_tag="C5L36_0B03475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464714.1"
                     /db_xref="GeneID:40382861"
     CDS             694992..695360
                     /locus_tag="C5L36_0B03475"
                     /note="PKUD0B03475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320573.1"
                     /db_xref="GeneID:40382861"
                     /translation="MATTTNNNNVKEEAPISIQALEAGEVDVGSVCRQLESLESLLGS
                     IRSKMVQLLETLATADATTALGAESLVAQQAQESVAQLIGERATFLAEYRRLMPLVRY
                     CKIKMGLSPDQQKVAQHHVV"
     gene            <695971..>698073
                     /locus_tag="C5L36_0B03480"
                     /db_xref="GeneID:40382862"
     mRNA            <695971..>698073
                     /locus_tag="C5L36_0B03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464715.1"
                     /db_xref="GeneID:40382862"
     CDS             695971..698073
                     /locus_tag="C5L36_0B03480"
                     /inference="similar to AA sequence:RefSeq:NP_011489.1"
                     /note="PKUD0B03480; similar to Saccharomyces cerevisiae
                     YGL026C (TRP5); ancestral locus Anc_4.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320574.1"
                     /db_xref="GeneID:40382862"
                     /translation="MSSHLRSAFVKAKEQGRNALVTFITAYYPTPQDTIDILKGLQNG
                     GADVIELGIPFSDPIADGPTIQVANTKAIENGCTVQTCIDLVRRAREEGVTIPIVLMG
                     YYNPILKYGEEKMVEASRNAGANGFIVVDLPPEEAVKFRNICSTHEMSYIPLVAPSTT
                     DDRLKLLAEIADSFIYVVSRMGSTGASITVTDSVGPLCDHIRKFTGNTPLAVGFGIST
                     RQHYLNVGKHSDGVVIGSKILSLISDAPAGARGKAAEDYVKSILNGDGENTFADSKIG
                     LSTNVVENPDFTESHKHNPNFGNFGGQYVPEALHACLRELEVAFEDAIADPVFWEEFH
                     SLYDYIGRPSTLHKAERLSEYAGGAQIWLKREDLNHTGSHKINNALAQILIAKRQGKT
                     NIIAETGAGQHGVATATACAKFGMTCTVYMGAEDVRRQALNVFRMRILGAKVVAVENG
                     TKTLRDATSEAFRSWVTNLKTTYYVVGSAIGPHPYPTLVRTFQSVIGNEIKKQFAEKN
                     NGKLPNLVVACVGGGSNSTGTFSPFENDTQVKLLGCEAGGSGVDTNHHSATLTVGEPG
                     VFHGVKTYVLQDEDGQVHDTHSVSAGLDYPGVGPELAAWKDSGRVEFIAVTDDQALEG
                     FRLLSQYEGIIPALESSHAIYGAVEAAKKMDKNQHVVITVSGRGDKDVQSVAEVLPVL
                     GPKIGWDLRFESGSDASK"
     gene            <698342..>700810
                     /locus_tag="C5L36_0B03490"
                     /db_xref="GeneID:40382863"
     mRNA            <698342..>700810
                     /locus_tag="C5L36_0B03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464716.1"
                     /db_xref="GeneID:40382863"
     CDS             698342..700810
                     /locus_tag="C5L36_0B03490"
                     /inference="similar to AA sequence:RefSeq:NP_009539.2"
                     /note="PKUD0B03490; similar to Saccharomyces cerevisiae
                     YBL014C (RRN6); ancestral locus Anc_4.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320575.1"
                     /db_xref="GeneID:40382863"
                     /translation="MLPYVPNIGISETYGTITRASLSVHPTLHWETSIAKAKTKKLTT
                     SSKQILFAPKLEEPLERDKSQEAKDRMQKKLEREQSKIDEMEKRRTLSSFESSGLYDP
                     TLSTLMPYIRDDNNDADGNSGNDDDEGEEEEEDGDEDVVTHDKSDTDDSSGDSSSEGE
                     QQGKNNESENTKKPKLKKTFRLKKTDFFDPNISTQVQFFYLRKKLHVLFVLEDKVLTF
                     GTMSKKFRFCKSIKLKSYIKCIQMVQINDGLALSLVRTNDDVYLLKCLYREKSLIVTK
                     VFSFTRDDTWAGLADVKIHVGDTLKLCIIDNIGKFQIWETTGIGKTDFKKLNNRWDSI
                     YQPQELSNFKRIVWVNENRLFFYSRSQVFNYELQTDELILKVNGGTWTRFLDLVKCNN
                     ELYFFLTTKEFIVVDVREGSFMKLLSWKHYWNDQDTSMFMNVLNGEDTKLCVVTSKHT
                     GINFVVEFNPKTFQFVNQPYHFFTTNQDPAISITFNFEASQLVALQKTAGNVVSFLKV
                     EYGNGNENVRIDDSNNTRFAKFKFPFFQENHYKILDGEPVQSKTEKPAEITARIYDNL
                     ETFLDTQSTAQISLIQLIEELRIPRNTKNVIKIVQHMIKNDNHNDTLIKINKSCYKKG
                     FNVTGEYANEDTLNNQLDQITEFINSNISDENSSEVIFYLFLSSIEIWKTKQSMKMEE
                     TKREYASYFNDLPHEYREMIDSFEEDFYAVGINESEDESTYSNPRSSNIFSVPSVSIS
                     QVVPTVSVSQPKQKIVPKKKSKIAPKGSIFSSPIRNSTQPSQPLESSQPSQQSQLLTQ
                     KFSQPQFGISQSKGPKKKRRRTGF"
     gene            <701001..>702410
                     /locus_tag="C5L36_0B03500"
                     /db_xref="GeneID:40382864"
     mRNA            <701001..>702410
                     /locus_tag="C5L36_0B03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464717.1"
                     /db_xref="GeneID:40382864"
     CDS             701001..702410
                     /locus_tag="C5L36_0B03500"
                     /note="PKUD0B03500; Pfam Domains: MFS_1(2.8e-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320576.1"
                     /db_xref="GeneID:40382864"
                     /translation="MTRLQDVDSPDNPHTLNTALSQTIAVQTTAESGISKSSSNSFEG
                     SHETEKEAIETIAKDDFPDGGLRAWFVVLASSFIMAMSFGMCNSYGVYQTYYEIKYPH
                     VRTNILSIIGALQTGLTMFLAVPSSVCMVYIGPQAVVAIGSLLACLSFMFLSITKSVA
                     EVFIVQGLMYGIGSGLMYVHSTGVTFQYFKRRKALAQGLITTGASLGGIYWPVAVKRL
                     INSVGFAWANRIIGFIYLPMGIVATVFLKPRIRVQKRKPGENILGINFAVMKDWKYLV
                     ISFAWVLYLVSMVPGFVFIDLYCLRAGVSPGFQKYTVTIMNSCGAVFRILCGFFGDKF
                     GRINITIPSLFFAGLFPLVLWLPSSLQSSPSSTLSIVFVVLWSCFASMPIALIPTVIG
                     QIFEGPYIYSYLSVFLVLGGIGDFLGPILGGLFLPQGNTHNVDGFDNLAIFCGVISLV
                     SSFLMICMKLIYGGVRGKI"
     gene            <702601..>705021
                     /locus_tag="C5L36_0B03510"
                     /db_xref="GeneID:40382865"
     mRNA            <702601..>705021
                     /locus_tag="C5L36_0B03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464718.1"
                     /db_xref="GeneID:40382865"
     CDS             702601..705021
                     /locus_tag="C5L36_0B03510"
                     /inference="similar to AA sequence:RefSeq:NP_011488.1"
                     /note="PKUD0B03510; similar to Saccharomyces cerevisiae
                     YGL027C (CWH41); ancestral locus Anc_4.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320577.1"
                     /db_xref="GeneID:40382865"
                     /translation="MVMNILLYISLFCGIAVSQGFVDIGQIAEQYEKLNQESLNWGPY
                     RSNLYLGLRPKIPESLIAGLLWFPTETFHGVSLAKHACDQSHNIKKFGWTKYDPRYGG
                     LERIIDGDSGLELSVKFVKTEDGLNWALRIEGTTNNPHSVHSVVFYTGLESDGDIERI
                     SDPVPGTDNLVDGDLIIKGKMDKIGGEFDIQIIDDVKNVMPKSNTLDYDPSFNPSLTH
                     HVSLTVPYEEVWKASDIFWTLLRLNVEEIEELEKRPYEFSPIELFQLRNPGGFQGNLH
                     FVEKTFIGNFQYDIIFNTKSSANKIQSEHLDQMITKTLNRIDEKFTRKFQLNAPFNTD
                     KYVDFAKEILSQLMGGIIYQYGDQLVDRKAIVDDVNFSHAQLNGEKEGPYELFTCVPS
                     RPFFPRGFYWDEGFHLLPVLDYDSDLTLEIVKSWFSLIDDNGWIAREQILGDEARTKV
                     PMEFTIQNPNIANPPTLMLIFTELLDMANKLNLERLTTQNDIESNLYSYSKMKDSLGD
                     LHLENPELMIDYAHSIYEKLQRHYEWFRRTQRGNTDDIERSYPHNEEVYRWKGRTKDH
                     CLPSGIDDYPRCIADIGELNVDLISWMGAMTRAMHQIAQLLGKQDDAKLYKQRYEFIV
                     ENIDSVHWSEEDQMYCDVSVDDDDLDVFECHEGYVTLMPFVHRLIPSGSTSKLLATLR
                     SLSDPAKLWSQFGIRSLSKQDANFHKGEDYWRGHIWININYLVLESLFDYGSRADVDP
                     AVRAEISDVYKKMRENVVSNIFEEYQRTGYAWEQYNEEDGHGQRTRHFLGWTSLVILM
                     MKMPTEIL"
     gene            <705150..>705541
                     /locus_tag="C5L36_0B03520"
                     /db_xref="GeneID:40382866"
     mRNA            join(<705150..705192,705261..>705541)
                     /locus_tag="C5L36_0B03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464719.1"
                     /db_xref="GeneID:40382866"
     CDS             join(705150..705192,705261..705541)
                     /locus_tag="C5L36_0B03520"
                     /inference="similar to AA sequence:RefSeq:NP_011482.3"
                     /note="PKUD0B03520; similar to Saccharomyces cerevisiae
                     YGL033W (HOP2); ancestral locus Anc_4.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320578.1"
                     /db_xref="GeneID:40382866"
                     /translation="MSLRKQGGRLDEETVKYMEKEYRPYAVTDLIGNLHNAITKALII
                     RLLDELVDKGTLIVKKYGKSSFYCYSELQVNEDMETTNLEKLQATKAEICSLEKEATK
                     LKSSM"
     gene            <706393..>707181
                     /locus_tag="C5L36_0B03530"
                     /db_xref="GeneID:40382867"
     mRNA            <706393..>707181
                     /locus_tag="C5L36_0B03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464720.1"
                     /db_xref="GeneID:40382867"
     CDS             706393..707181
                     /locus_tag="C5L36_0B03530"
                     /inference="similar to AA sequence:RefSeq:NP_011830.1"
                     /note="PKUD0B03530; similar to Saccharomyces cerevisiae
                     YHL033C (RPL8A) and YLL045C (RPL8B); ancestral locus
                     Anc_4.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320579.1"
                     /db_xref="GeneID:40382867"
                     /translation="MAPKGKKVAPAPLASKTTKSASAKNPLFESTPKNFGLGQAVQPK
                     RNLSRFVKWPEYVRLQRQKKILNLRLKVPPAIAQFSNVLDKNTAAATFKLLNKYRPET
                     TAEKKERLTKEAAAIAEGKKKEDVSEKPYVVKYGLNHVVGLIENKKAKLVLIANDVDP
                     IELVVFLPALCHKMGVPYAIVKGKARLGTLVHQKTATVAALVDVKSEDEAELAKLVST
                     INANYTEKYDESKRHWGGGIMGAKAQAKMAKRAKAAAASATAGK"
     gene            complement(<707626..>708205)
                     /locus_tag="C5L36_0B03540"
                     /db_xref="GeneID:40382868"
     mRNA            complement(join(<707626..707967,708146..>708205))
                     /locus_tag="C5L36_0B03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464721.1"
                     /db_xref="GeneID:40382868"
     CDS             complement(join(707626..707967,708146..708205))
                     /locus_tag="C5L36_0B03540"
                     /inference="similar to AA sequence:RefSeq:NP_116691.3"
                     /note="PKUD0B03540; similar to Saccharomyces cerevisiae
                     YFR033C (QCR6); ancestral locus Anc_7.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320580.1"
                     /db_xref="GeneID:40382868"
                     /translation="MSFVTDLINAIVPTVAYAEEPVEEVSAPVEVNEAAEKEQEQDDD
                     DEEEEEDDDDDDEEESEDQFDALKKECSQLPSVKPYLHHYEECVERVTKEQQEPGYED
                     KHYKEDCVEEFFHLQHALNDCAAPKLFSKLK"
     gene            <709142..>710788
                     /locus_tag="C5L36_0B03550"
                     /db_xref="GeneID:40382869"
     mRNA            <709142..>710788
                     /locus_tag="C5L36_0B03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464722.1"
                     /db_xref="GeneID:40382869"
     CDS             709142..710788
                     /locus_tag="C5L36_0B03550"
                     /inference="similar to AA sequence:RefSeq:NP_116689.1"
                     /note="PKUD0B03550; similar to Saccharomyces cerevisiae
                     YFR032C (RRT5); ancestral locus Anc_7.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320581.1"
                     /db_xref="GeneID:40382869"
                     /translation="MTIDIDTVQRSMAVSETDPNPDIGSATQDLKIQKGPVVSERNVS
                     GPEMLAEHESDVRGGAKASGEGEGEGEGEGEGEGEGEANGEANGEANGEGDGDENGEA
                     DREENGERDGEGKHPQHLQEQQQEIIPDRIFVGNLPYEVTEEDVRNLTPEFEVVSVEI
                     PRKTYLNRALNRTFLQSKGYGFITYTNADDAKMAIDSIVGKFISGREIYAKYALPQNK
                     EKFKQQQQQQQQHPHHHQHQHQQQQQLQQNGGFMPYQQYPRFARFQGTPRYHQGQRPI
                     HQMQFYAQPPPGVEYYYSQPPSHVPAPQGVYSPKQQQQQQQQPYQVPESHQQAPMQDQ
                     AEEHGETCDSVQPVDRKFFDSLPKETIKPFIPQPIAIFAPPYQTIPLYSQQQQQSRED
                     KQRRLENGVPSKTTIFVGNLERNLTVEDVGDFMKELNPINIKVPRKVLPPDVYRMLKL
                     QGIAIQNKGIAFVRFSNEESQKRAIDMFNGKVWKGKKLNVTIAINVNDDLQSTQQPGE
                     GVGADADADVVDNGDAVGVAIEEDKTDCEDVEIKLAENDG"
     gene            <711743..>712903
                     /locus_tag="C5L36_0B03560"
                     /db_xref="GeneID:40382870"
     mRNA            join(<711743..711746,712140..>712903)
                     /locus_tag="C5L36_0B03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464723.1"
                     /db_xref="GeneID:40382870"
     CDS             join(711743..711746,712140..712903)
                     /locus_tag="C5L36_0B03560"
                     /inference="similar to AA sequence:RefSeq:NP_116688.3"
                     /note="PKUD0B03560; similar to Saccharomyces cerevisiae
                     YFR031C-A (RPL2A) and YIL018W (RPL2B); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320582.1"
                     /db_xref="GeneID:40382870"
                     /translation="MGRVIRNQRKGAGSIFTAHTRLRKGAAKLRTLDYAERHGYIRGV
                     VKQIIHDPGRGAPLAKVAFRDPYRFKQREETFIANEGVYTGQFIYCGKSASLNIGNVL
                     PLGSLPEGTIVSNVEEKVGDRGALGRTSGNYVIIIGHNPEENKTRVKLPSGAKKIISS
                     DARGVIGVVAGGGRIDKPLLKAGRAFHKFKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSNNKNDD"
     gene            <713363..>718414
                     /locus_tag="C5L36_0B03570"
                     /db_xref="GeneID:40382871"
     mRNA            <713363..>718414
                     /locus_tag="C5L36_0B03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464724.1"
                     /db_xref="GeneID:40382871"
     CDS             713363..718414
                     /locus_tag="C5L36_0B03570"
                     /inference="similar to AA sequence:RefSeq:NP_011828.1"
                     /note="PKUD0B03570; similar to Saccharomyces cerevisiae
                     YHL035C (VMR1) and YLL048C (YBT1); ancestral locus
                     Anc_4.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320583.1"
                     /db_xref="GeneID:40382871"
                     /translation="MSNSTCDVVWQVDDFTRCSRHDILELKIPLVLTILSVISIGYYL
                     AKNNWLSSSNIKLDYKFSNNDSSLGPDLAQNYGSVENSNTENPDKKTNIIDAHFDMNY
                     LSGSSTQDMKVTTKTVFRSNFDRSMLALLEFLSLCQLVVAVSPFVMKDLAREWQDNTL
                     VPWANAFFWTYFFLLTTFRLKCSSTGLPEKYPDLWYHSFNLIFVYFFSALFLIRSALL
                     NHTLNKLSKDFYIVEFLLVSAMFLILGSDKFGDRPITVYVTQGLTPSPEPMASFFSVS
                     SYSWLEDMIYAAKKVTPTVKDVWSLKLEDNAYAVILKFHKVKFHSRFAVNLFYQFRKL
                     FLYQTICTSAEAVLTFFPSMLLKKILEYVESPDTESASLAWLFVILMAISSPITCALS
                     GRGLYLGRRICTRMRAVLIGEVYSKALRRQISSSSKITDNEKEESDSPPYTGASATSN
                     TLVSSNGSQKDTKSDEEEKSTRDLGSIINLIAVDSFKVSEICGYLHYFVNSFIMTVIA
                     IAVLYSLLGWAALAGALTIILMMPLNYKLSMTLGNFQKEMLKVTDSRIQKLNEAFQNI
                     RIIKYFAWENKFIEQIIDVRSKELNILFNRCLVWVVSSFVWFLTPTIVCLVAFYCYTI
                     IEGKQLTTPIAFTSLSLFSLLRAPLDQFADMLSFVVQSKVSLERIEEFLKEPETTKYE
                     QLVMERDENSPDVGFQNATFSWSTSSNAPNDFKLRSIDIAFKKNKLNVVIGSTGSGKT
                     SLLLALLGEMNLIEGKVFLPAWTPRDDLIVDSRTGLTESAAYCSQSAWLLNGTIRENI
                     LFAAPYDEKRYKQAIEACGLKRDFEILAAGDKTEIGEKGITLSGGQKQRVSLARALYS
                     NASYVLLDDCLSAVDSHTAVHIYENCITGPLMANRTCILVSHNIALTIKDAEHVVVMD
                     NGRVKTQGTVDELIKEGVFDEEATASVMQSRSASTANLNALVNEESDALHSHLLNSTI
                     AALASDHNADQIDSIPVEDENIDKSGKLIDEETKSDGSVSLEVYKAYINLFGGTYFWI
                     LLAIVLLSTQLVNIYQSYYLRIWSMAENERNGITVLTAIISEIPNKVYAKSDFAWDNV
                     LNVFKSIDWHKPIIKTRYNDFDVSKMSAIHSTMYYLVVYSLIGLVYSSIGSLRIIMVY
                     IGGLGVSRKIFKQLLQKVMRAEVRFFDSTPIGRIMNRFSKDMESIDQELAPYSEAFVV
                     DILSCLSTIVLITWITPAFLIFGVFVSILFGYVGILYLNLSRELKRFESITRSPINQH
                     FTETLTGVTTIRAYGDERRFLVQNMQKIDTNNRPFFFVWANNRWMSFRAQFTGSSIVA
                     ISAALAVLAARQIDSGLAGISLSFAASFSTSALWVLRCYADVEININSVERVQEYITD
                     IKEESATETPFDPPASWPEHGEISVEGLSLRYAPNLPLVIKDISFHVNSGEKVGVVGR
                     TGAGKSTIITSFFRFIEPAQGKIVIDGVDITKIGLNSLRRGLAIIPQEPTLFTGSLRS
                     NLDMFNESDDLSIYESLRRVGLISRDEYNSLRTVIESGQSLEEYNKSNENSEENVNKF
                     TNLEAEVTENGGNLSQGERQLICLARSLLKSPKILLLDEATASIDYETDAMIQNTIRE
                     EFSESTILTIAHRLKTIIDYDKILVLDHGNAKEYDHPYNLITKEGSQFRSMCQDTGEF
                     DELVRLAKEAYDAKK"
     gene            <718848..>721937
                     /locus_tag="C5L36_0B03580"
                     /db_xref="GeneID:40382872"
     mRNA            <718848..>721937
                     /locus_tag="C5L36_0B03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464725.1"
                     /db_xref="GeneID:40382872"
     CDS             718848..721937
                     /locus_tag="C5L36_0B03580"
                     /inference="similar to AA sequence:RefSeq:NP_009594.1"
                     /note="PKUD0B03580; similar to Saccharomyces cerevisiae
                     YBR038W (CHS2); ancestral locus Anc_3.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320584.1"
                     /db_xref="GeneID:40382872"
                     /translation="MSDPFRPNPFTVLQSPVKKPEEAYTPTGSPIRNSPVRNSPSKTA
                     IKYSPAVSFRRGDDNHEFINSSIGRNFIQRATESPFKPTARKLFTEHESPKKGGALAR
                     NLDPFSDVDEENDENDIISHYSIFNTDKTHEFKRSTNSNRTELESPKPVFSASTFAAA
                     GGDVNSLQSSLGEIPMLTPKSSRLGYIPPQQDLGVRVTSASSDSTAASSFGAELNEKK
                     TNHSSYFSSDQSTINAPIDNTEEFGSSQLTHSSNSTDYFDKNLMDGAPRIQVRRNNFH
                     KQQTVFRSRTGNLVLDTPIPRLLHDLLPRKGDDEYDFMKYSAVTSDPDDFVEDGFNLR
                     QIELERETEIVICITMYNEDEVALTRTLHAVMKNIEYLNKRTRSHTWGPDSWKKVVVC
                     IIADGRNKVSQGVLEVLSVMGVYQDGIAKSFVNQKEVKAHIFEYTTQVSVDENLKING
                     GKITPAQVVFCLKEKNAKKINSHRWLFNAICPTLDPNVTVLLDVGTVPNESAVYNLWK
                     AFDLDSNVAGAAGQIVAMKGKYWSKLVNPLVSSQNFEYKMSNILDKPCESAFGYISVL
                     PGALSAYRYSALKNHPDGTGPLQAYFHGETQDTAENADIFSANMYLAEDRVLAWELVA
                     KKNAQWVLKYCKDAKGETDVPETLSEFVLQRRRWLNGAFFAALYSLKQSGAIFSTDHS
                     SLRKFFFMVEFIYQGLTLLFSFFSIANFYITFYYLAGSLIVIGGTGGKVVFEIMNYIC
                     ICTLLAMLVISMGNKPTGAPMLFWVCVILLTLCGMYALISGFYFLSLMIQSHNAGNAG
                     GLSFASICVSLASTYGLYVLMSLLYLDPWHIISSSLQYFLMLPAYTCLLQIYAFCNTH
                     DVSWGTKGSVEAVQDLGKAIIQTDEKGQQIITTEVLAQQDIDSMYSETVLKLKDRRKK
                     PVNMRGKNSKSGGKKKNVIGKEDYYRDVRSRVVLVWVISNVILVMTITQIWAADSIRS
                     NKYLAFILWSVFGFSVFRFLGSSSYLIHLLLRKIIVSKNKWDLRKEEVPHMNELPNI"
     gene            complement(<722230..>725856)
                     /locus_tag="C5L36_0B03590"
                     /db_xref="GeneID:40382873"
     mRNA            complement(<722230..>725856)
                     /locus_tag="C5L36_0B03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464726.1"
                     /db_xref="GeneID:40382873"
     CDS             complement(722230..725856)
                     /locus_tag="C5L36_0B03590"
                     /inference="similar to AA sequence:RefSeq:NP_012446.1"
                     /note="PKUD0B03590; similar to Saccharomyces cerevisiae
                     YJL089W (SIP4); ancestral locus Anc_1.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320585.1"
                     /db_xref="GeneID:40382873"
                     /translation="MNDNTASMFGLKEVEHISDPNNLSQSSESAAEFSNDNACVSNTC
                     DGTHHHHDGETESCSSGTKNWNIIKNPSNGRTRISQACDRCRARKIKCSGKSDTNPRC
                     TNCEKDGFQCVVSDKLTRNSFPKGYTKNLEKKLLDVELNRNQLLLEIQKLKQKISQLE
                     NAGPKPTLAPTSNETPTPTPKSISPSVATAPTVPTAATITTTNTTNNKTTPSVAPHGV
                     LSTCNFMPKCVTDGDGDQLMSKDCGFDTPLPLLDKSIETSRKNAFYKEKVKIDSSGLL
                     VLDQNVMAPFESIFASLKANPFKGYRSLAFQKDNISDLTSTTSTGNSSSVSPEQLNPA
                     VSKQLANYHMNLNRYLNLILYKLIFPLFNSDSKSANGLVYSTNSGNESNKNLDHLIWL
                     FFNDYNKLIPILDFELFYNDYLTFVNTYTIKNSTYVENGIIKKKYYEFNQKDQDILVK
                     LVLILRYTLCQPKINENDYSSAFLPDKSAPDQLEESIKLINLRHLMLMFKNIGFLLSP
                     NRDKLEISLLMFYYLIKFENYNLPNYTDSLHSHKDFLLDIINLNIGLVRALNIDKPNE
                     LLETKQTTNKQLIEIQRLKLYWNFRILVKLSEIYFNIPLTDEEYDINPIVENENNSKS
                     HPSSLESIVLVNKDIKITLCLVRLLKIIPWNIMVFVNEQNQNVLMKIDAELSKWKKSV
                     EELYNEDDSVVFNKLKSYYLYFKVLVNINGTIDSSYFIDFINLVYDLTFNNPKSSYKP
                     HEISIEAAESLCLHSFNFHLVTLISITSLQNSKDKAVCEKIYKLIQLYHILVNFKDVD
                     PLITTFAIYIKENIMFSFSDATTIHDDTLKLFSAVDLDRSNNGSLFDKKVLKNSAPKI
                     LSTANQPQTNLQQPAPQTQMEFDLNAFSIPSDTSFFDKTSNKRRKSTASTSSVVSSNM
                     SLTSRESSVSMSRRLSGSSNDSMPTLFPSATSPYHNSSSSINSSDLLTSAKKRIIDYA
                     IQPMRTSMNRSRSLSSENRLRKTRVQDRRLSGSNYSGAAVTSRENSVDSIQSRRDTSD
                     IPATHTQATVDDSIISHFLNSQGDSELDPDVGAILNKPISKPSNFKHNSSLLPTIPSE
                     GNLMNIMTSLETSAIEPAEKINGNTGFSLNTIFPSNSNILDSFNAFNSSLTDSNSNKA
                     RKNDFSKAFKSNNAKGSISDAFSPNSSNSTSAKEAKNEKVFIDDDDIMRLRKHVMSMK
                     STPH"
     gene            complement(<726473..>728335)
                     /locus_tag="C5L36_0B03600"
                     /db_xref="GeneID:40382874"
     mRNA            complement(<726473..>728335)
                     /locus_tag="C5L36_0B03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464727.1"
                     /db_xref="GeneID:40382874"
     CDS             complement(726473..728335)
                     /locus_tag="C5L36_0B03600"
                     /note="PKUD0B03600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320586.1"
                     /db_xref="GeneID:40382874"
                     /translation="MASLKRLRFQIQRYVERRFSTLLLALMAVVFILYSFASMGTNTA
                     KVHKTEKDYFTEYIQSEANPQGKASGANGASGLDAVSTHNFNARLLKQYVKELYDLRP
                     DYELLAQDENQVEYVNIPQQNGIISKSYLENSVSIPPKWLEEVRGKHSLVTGLLREKV
                     KEINKEMAAKVKYSNNHPDETINMDSNLLFKSRGNGAVIVGGHANDETWLALISTRLF
                     RKAGGTLPIEVIIPTREDYKKDAEICDKYLPQLNAQCVILEDILGLTPVIKKFTDESE
                     SIEAYIWNRFNDIKKEVAILMSSFDNVLYITPENIMLKPMEHAVFTKQLFKDKGLFVW
                     TDFGLRKTLVDFYKIANVEIGKKKKSEFGLPLTPEVIENLENLSNEVLQDKTNFHDLE
                     GTLPFKQSESSEIIIDKRKHLSTLLLSMYYNFNGHGIYHPLLTGEKEGYWGSKETIIA
                     SAHVLGNPYYSINTNVDSNGYMYDDEYHGVSMLQYDPIVDSYSYEAYMKKFSKKGLSK
                     LTWKNYQRWLSASSERRSPLFLNMNNPALRPIELLRDGHVRKENGDRVRLVSSTSYFD
                     NKLETDIWRVMNDYMCYLSIDCAYVNKHFTASQASEKKAFCNQDMKEHLLWVSS"
     gene            <728947..>729663
                     /locus_tag="C5L36_0B03610"
                     /db_xref="GeneID:40382875"
     mRNA            <728947..>729663
                     /locus_tag="C5L36_0B03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464728.1"
                     /db_xref="GeneID:40382875"
     CDS             728947..729663
                     /locus_tag="C5L36_0B03610"
                     /inference="similar to AA sequence:RefSeq:NP_013125.1"
                     /note="PKUD0B03610; similar to Saccharomyces cerevisiae
                     YLR025W (SNF7); ancestral locus Anc_2.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320587.1"
                     /db_xref="GeneID:40382875"
                     /translation="MWNYLFGGAKQKKELPKKAIVDLREHINTLNKKSSYLESQIQDQ
                     EALARKYVTTNKNLARNALKKKKKLEGELLKIENQIESLEVQLGAIESANLNVETMKA
                     MKQGARAIKQMHSDFDIDKVDETMDEIREQVEASEEISEAISRPLGSEFVDEDELDEE
                     LAALQEEEINSHMVDTHNDVQNQNIQTPMRLESPTSQRINNLPSAPTKKVQPQQQQLP
                     VEDEDEDERALRELQAEMGM"
     gene            complement(<729938..>732799)
                     /locus_tag="C5L36_0B03620"
                     /db_xref="GeneID:40382876"
     mRNA            complement(<729938..>732799)
                     /locus_tag="C5L36_0B03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464729.1"
                     /db_xref="GeneID:40382876"
     CDS             complement(729938..732799)
                     /locus_tag="C5L36_0B03620"
                     /note="PKUD0B03620; Pfam Domains:
                     DUF2467(1.2e-145)|zf-C2H2(2.2e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320588.1"
                     /db_xref="GeneID:40382876"
                     /translation="MADSTESVSPQEKDNQEQNTHTDLSSNTTECSTPVQDPKKGKTR
                     GRKKTLVGPPYVCQYPNCGKSFQRSEHLSRHKLNHNPKTIFTCSHAGCGKTFVRHDLL
                     ARHLKRHEIKLEKQKQENKPSEFLSTVVSNNFKIQTTQPSSKRKKRNDSPNNDILSQS
                     NKTSNTNPVTVKDLVEQHSATPPLPPLSNMDLQVNSPQVATSNLNTDMTNAPSGAAPN
                     LFSWLFTDPSSNSNNLLPTQNTEHYFNSNNPMERALQAKIDNEGASNNNQSSQPNFNS
                     SYPTIGSNNDISNSNFLNELNEFHMNNNTHNFFIVQDDFSPASSSGYYSSTPDRMVSN
                     HPEISNSKKENVQSDKEKGLHSFQQSQGHQVSEPLAYQFDEGLLYTLTDEQMKEFEIL
                     IPALKNNHDFTKPKFEKALKTYWNFFHPRFPMLHRPTFNSTDSPILLLLAMIVIGSKL
                     FMCVDNITCPDNKRISQPKVLSDTIAEPLRWLLFASPFFQPPAEVWIIQSLLMLEFYE
                     KHCSNRRLHERSHLHHGTTIQLLRRSPTLGGASTKFNNESITEDTDNWYKWIEIESMK
                     RTTFMCFYMDAIDAICMGHQMFIYSHQIQMTMPVEDVVWESNFNQFSRNFKNSKRPQQ
                     FLIVLKNVMNGKPARTNSFGKKILLAGLSAILFQIQQRDLQLFFGLDKFTNTISENWR
                     DLLTAAFAIWRNDVGGSCCSSKTAIENLNALGNSSQFSTSDTRCKCISYHLAHIYMSI
                     SHYDIFIVCGAPWRMNVKPSSLLERQSIKNRVFEWSKTRHCEVSIVQCYLCLFEMFLS
                     PEDATFEYQYNYLPDADLFFRSYSLGYMVLVLWGYLYAKNRFDKIDVNHTNNKNGYLY
                     LKKMREQFSSKSGVSLHTWYNNQPGASFYGYLMKWANVVNQIEGMENMIGLLELVGNK
                     FVTADYAVVREIGKLLLFCKDRMIGATNKEILDDMYITD"
     gene            <734393..>734863
                     /locus_tag="C5L36_0B03630"
                     /db_xref="GeneID:40382877"
     mRNA            <734393..>734863
                     /locus_tag="C5L36_0B03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464730.1"
                     /db_xref="GeneID:40382877"
     CDS             734393..734863
                     /locus_tag="C5L36_0B03630"
                     /note="PKUD0B03630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320589.1"
                     /db_xref="GeneID:40382877"
                     /translation="MEHQEIVATYKKEGHFDERRKEWFELLANDGPKKEKLYSLIKEI
                     VQCKIERDPDLLTRNKGKVATLIQTEMVKAHVHRQRLRKGPRISTGTTSEDTTTSSST
                     TTSSSTTTSSSTRANTSIVKDRETELLELVDTLLDEVASDAQRTLPVEFKDINA"
     gene            <735349..>737412
                     /locus_tag="C5L36_0B03640"
                     /db_xref="GeneID:40382878"
     mRNA            <735349..>737412
                     /locus_tag="C5L36_0B03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464731.1"
                     /db_xref="GeneID:40382878"
     CDS             735349..737412
                     /locus_tag="C5L36_0B03640"
                     /note="PKUD0B03640; Pfam Domains: zf-C2H2(1.6e-27)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320590.1"
                     /db_xref="GeneID:40382878"
                     /translation="MLLKNTETQQEKCEIDTEVFNQLLQCCFDPSHVASSGIDNSSTV
                     YPNTDTSNRSPSVKTETTNDNDLPPSCTNANSSIASSSIKSENSPYPPDMPATLLESC
                     TPIDLNPCCVTNCQDHHNQHQHQHHDHIHEKFTDDLTEMVMLNNFFTACCNDTGDLKF
                     QNDNNKSSLISPPISLNFNGICDESNQKLQTTTLQNTSNLRESLSNQDHQHIQEGSHK
                     ILTDPSGHHHHLLHLHHHNGKDKSQSHTHDIILHHHNSHVCSHGDPSTHHHHLLFENE
                     INGQKVKHDFILPDCDVPIKKEEKTGGLNENTYDQCTDFLTSSICSFEELFGEKEHHN
                     CSHHTHGSAYNNNNNNNNNNSQRHQQMRTFDSTPVKCGSASCLTKNIHHHDLKHETPV
                     HRAHFHSNIPGHSSFLKPDGSDSYICKWDHCNDRVDGSDLEKHIFENHLQYLPLSPNG
                     MDSGYQLQCEWDDCDFITEDSNEFLNHVPEHTKDVPKNPKNSSDSEEESAHICKWVDP
                     ESGVTCNEVFESTELLTNHLLKEHVKSGKSSYLCHWEGCSRCGKPFTQKQKITRHLNT
                     HTKHKPFQCEICNKRFSLELMLKQHMRIHTGEKPYKCDICGKTFKTSSSLTIHLRVHS
                     GDKPMECKICGKRFNESSNLNKHMKIHFREFKCVHCLKSFDSKLKFDRHQLLCKKKPK
                     TCAHF"
     gene            complement(<737552..>737914)
                     /locus_tag="C5L36_0B03650"
                     /db_xref="GeneID:40382879"
     mRNA            complement(<737552..>737914)
                     /locus_tag="C5L36_0B03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464732.1"
                     /db_xref="GeneID:40382879"
     CDS             complement(737552..737914)
                     /locus_tag="C5L36_0B03650"
                     /inference="similar to AA sequence:RefSeq:NP_012837.1"
                     /note="PKUD0B03650; similar to Saccharomyces cerevisiae
                     YKL086W (SRX1); ancestral locus Anc_2.642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320591.1"
                     /db_xref="GeneID:40382879"
                     /translation="MSLQTRNYGNIQDVPLADIIRPIMPVLDSAKIDTMVSTLKGDPT
                     PSATCTMENIIAGELPPIDVLMVSDKGVKKYFAFGGCHRFQAYEKAGVPMVRCKVLPS
                     TKGQLKVYLGSSVDNFFE"
     gene            <738344..>740734
                     /locus_tag="C5L36_0B03660"
                     /db_xref="GeneID:40382880"
     mRNA            <738344..>740734
                     /locus_tag="C5L36_0B03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464733.1"
                     /db_xref="GeneID:40382880"
     CDS             738344..740734
                     /locus_tag="C5L36_0B03660"
                     /inference="similar to AA sequence:RefSeq:NP_013146.1"
                     /note="PKUD0B03660; similar to Saccharomyces cerevisiae
                     YLR045C (STU2); ancestral locus Anc_5.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320592.1"
                     /db_xref="GeneID:40382880"
                     /translation="MSEEEFEKLPLDQLLAHKLWKARQLGYSKLRILAENNVNDPEIH
                     DLLENPERLRKIVADPNVLSQETAIHTLCEILKRTGKQAVKTREFIVPVLVEKGIISS
                     KIGAKNDSIECLLIYVEIDTPDPVIELMVPSLGVKNPKQVTATIKAINAIYAEFGCDV
                     VSPKLIMEHITKMFAHSDRNVRAEASSLSVTIRSYMGDSFDVFIFPKLKSIQQKDLTK
                     LFDKIEPGVKPKRLLFRDRERLESNVNLVQSKGDDDIVMQDAITANQEEEKFDPYELE
                     EPVDVLSKLPTDLSSRISDPIWKERVAVLEEISKLFKVMKIKNDDFSDFIGLMVKCLK
                     DVNLQVLSLSCSILVDLANGLKRNFERYVRTIINPLLERTKEKKRTILDSLNNVLDLC
                     FKYGRFEDILEPIVEHMSHIAPPVKVESMHYLVRCLKELEEVPKKHEVEIIMEPAIKL
                     LQDSQLPVRNAASEVIGVLLKMIGPDNSRYFIDKIDKRHVKKVLSICDSTTVKALRKS
                     IHRKSPISAKTEAIPDLRNKSTVSVNDESRKVQQQHNDTSMNTSSIPSKRMATSPLKK
                     DSIGSKSNLTSRSLKASNISNFGMASQQVKELETLRAEKLEWMSLKKNLTAELEDAKH
                     NNETLLKDIVTLNGKLDDYHNKFTTMSMTLKSKDTQIFRLKSDLQNFQTKNIQYQQKI
                     KMLENQLKNASTSSSSATSFSSTKPVDPVNSTDLATESNDINRRISILSIDSNNGDGS
                     FLAREESPSLQLNQSTLYNFDDNDDGWKRATAVTNDLKAKIQMMKARTRVLDHADD"
     gene            <741004..>741774
                     /locus_tag="C5L36_0B03670"
                     /db_xref="GeneID:40382881"
     mRNA            <741004..>741774
                     /locus_tag="C5L36_0B03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464734.1"
                     /db_xref="GeneID:40382881"
     CDS             741004..741774
                     /locus_tag="C5L36_0B03670"
                     /inference="similar to AA sequence:RefSeq:NP_011723.1"
                     /note="PKUD0B03670; similar to Saccharomyces cerevisiae
                     YGR207C (CIR1); ancestral locus Anc_5.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320593.1"
                     /db_xref="GeneID:40382881"
                     /translation="MSSKIKILVPVKRVIDAALKPRINATNNGVESTGVKYSINPFDD
                     IAVEEACKMKKNHKTLVESIHAVSIGPSKAKDVLRTALGRGADTSTLVDVGDAQVEPL
                     VVSKILKSIAEKEKANLIVLGKQAIDDDSNQVGQMLAGLLGWSQATNAAKVTIGEDGF
                     VEVEREIDGGVEVVKAPLPMIITTDLRLNEPKFVTLPKMMKAKKKPLEVISPSDLNVE
                     ITSRLETISLKEPEARKPGVIVNNVDELISKLKELKAI"
     gene            <742066..>742995
                     /locus_tag="C5L36_0B03680"
                     /db_xref="GeneID:40382882"
     mRNA            <742066..>742995
                     /locus_tag="C5L36_0B03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464735.1"
                     /db_xref="GeneID:40382882"
     CDS             742066..742995
                     /locus_tag="C5L36_0B03680"
                     /inference="similar to AA sequence:RefSeq:NP_011721.3"
                     /note="PKUD0B03680; similar to Saccharomyces cerevisiae
                     YGR205W (TDA10); ancestral locus Anc_5.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320594.1"
                     /db_xref="GeneID:40382882"
                     /translation="MSFLNISLASIKTKEMSNSSVVDEAIRFLAPFLEKKLYCQEKKP
                     LVIGIEGPQGSGKTTAATNIRVKLLEKINCNIVQFSMDDFYLTFEQQLNLNRENQDNK
                     LLQGRGLPGTHDVELLMKIFKDLIDIDHDKSPVKIPVYDKSLHNGKGDRLPLEKWNVV
                     EKRVDLIIFEGWFNGYTSINTEETLIRKWNSIKATHPRKFGDVEDRHIQKINCDLRRY
                     EQIWGLFDLFVCIKTENINNVYRWRLQQEHALIKKKGSGMTDMEVETFVDRYMPVYYL
                     YYDGLGKTEEKINSLELDIDEFRNLVNSNYIMQ"
     gene            complement(<742999..>743790)
                     /locus_tag="C5L36_0B03690"
                     /db_xref="GeneID:40382883"
     mRNA            complement(<742999..>743790)
                     /locus_tag="C5L36_0B03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464736.1"
                     /db_xref="GeneID:40382883"
     CDS             complement(742999..743790)
                     /locus_tag="C5L36_0B03690"
                     /inference="similar to AA sequence:RefSeq:NP_012555.1"
                     /note="PKUD0B03690; similar to Saccharomyces cerevisiae
                     YJR021C (REC107); ancestral locus Anc_5.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320595.1"
                     /db_xref="GeneID:40382883"
                     /translation="MINSDITELSSDFEITPNETEKFEKQELITWACKLELESIDYRN
                     TSMQLIEQLSKLSKTLTDNLKNTSLYLFQLKNEMGQRDVKIKNFIEVSIAEELDTAYN
                     NLAGISSKIKNVQQSIYKLEHHKIEEIISNIERSKYQQRSKDKQQDEKIRELEIQVKL
                     LLQRQEYINLLKTPESSSSGTSLPKREFSHESFQQNEENKGKLAEVSSVRLPLSQRGI
                     SSQPSLQLSSRKEKHAPLRRNKKAPSRSTKLPKQARGKTFTRKLL"
     gene            <743993..>744313
                     /locus_tag="C5L36_0B03700"
                     /db_xref="GeneID:40382884"
     mRNA            <743993..>744313
                     /locus_tag="C5L36_0B03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464737.1"
                     /db_xref="GeneID:40382884"
     CDS             743993..744313
                     /locus_tag="C5L36_0B03700"
                     /inference="similar to AA sequence:RefSeq:NP_012556.2"
                     /note="PKUD0B03700; similar to Saccharomyces cerevisiae
                     YJR022W (LSM8); ancestral locus Anc_5.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320596.1"
                     /db_xref="GeneID:40382884"
                     /translation="MSSLKDFVSQPVKVLTIDGHLVMGNLEGYDQNTNVVLTNAIERV
                     FSPNQIIKPKPSKGVIIRGDDIISVGTFDNEEESQVDYSRVFADKINDSKNCSLTPKS
                     VTRK"
     gene            complement(<744427..>745386)
                     /locus_tag="C5L36_0B03710"
                     /db_xref="GeneID:40382885"
     mRNA            complement(<744427..>745386)
                     /locus_tag="C5L36_0B03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464738.1"
                     /db_xref="GeneID:40382885"
     CDS             complement(744427..745386)
                     /locus_tag="C5L36_0B03710"
                     /inference="similar to AA sequence:RefSeq:NP_012558.3"
                     /note="PKUD0B03710; similar to Saccharomyces cerevisiae
                     YJR024C (MDE1); ancestral locus Anc_5.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320597.1"
                     /db_xref="GeneID:40382885"
                     /translation="MVNLKSIFSNTSPAPPLRVASPKKGCSCSSKKSKSDSCCKAEPK
                     SSGKSCCKTESTMASKPLMAETTGSSSSSTSLNSEVKLCCRGSSEANEDEVIQDTDAL
                     VLSKHPDHPANLICEFCRIFYNNGWVTGTGGGITIRDNDYVYLAPSGVQKERIQPLDI
                     FVMSLETQKYLRKPLHYKPSACTPLFMAAYTMRNAGACIHTHSQNAVMCTLLFDKVFE
                     ISSIEQIKALPKIVEQGNMWYSDKLVIPIIENTEKEEDLEASLRKAIAEYPAATAVLV
                     RRHGIYVWGETVWKAKIYNEAIDYLLELAVKMKQMGIPTVKLD"
     gene            747979..748050
                     /locus_tag="C5L36_0Btrna4Q"
                     /db_xref="GeneID:40383845"
     tRNA            747979..748050
                     /locus_tag="C5L36_0Btrna4Q"
                     /product="tRNA-Gln"
                     /note="PKUD0Btrna4Q; codon recognized: CAA"
                     /db_xref="GeneID:40383845"
     gene            complement(<750937..>755390)
                     /locus_tag="C5L36_0B03720"
                     /db_xref="GeneID:40382886"
     mRNA            complement(join(<750937..754664,754664..>755390))
                     /locus_tag="C5L36_0B03720"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_029464739.1"
                     /db_xref="GeneID:40382886"
     CDS             complement(join(750937..754664,754664..755390))
                     /locus_tag="C5L36_0B03720"
                     /artificial_location="low-quality sequence region"
                     /note="PKUD0B03720; Pfam Domains:
                     RVT_1(4.7e-52)|rve(8.9e-26)|Retrotrans_gag(1.7e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320598.1"
                     /db_xref="GeneID:40382886"
                     /translation="MNSEVNAMHAGSNPSQVNLNMVFKGNEKNSVRLAQQFLFKLDMA
                     FKLQESMGKDVSELFKVATAMLNLDGSALAWFTNRYGNSELPLWHQFVEEFTLEFCPT
                     DEFELRQVAAKYNGCHQGKNSVEQFIQEFEGYRTLLPGEYENEWATRDRFVQGLRAEI
                     RGRVFQHRPNSLAEAKFLARDFEKDSAPRARDFRFSHQDRWRGEPMEIDSIKNKNYRG
                     RNFDSYKRNKNYNRNYNGGYAGRKPRQRKFKLVRNQKVVGSDIAINPPTIENANLQLK
                     NEIQHSTKFDKYILDNKDIENLSVSNVYMDRKELPLLKVKNELFKECVALVDSGASRN
                     FLDYEFVKSHQLENYLEPTEFEDVVAANKKTISVKGELTLELQFKLRDEWQNENIRFL
                     VLENINHKMILGFPFVKDHGNKVDWENIEKETETPEIPDIEEQIESSDENDLEETQEN
                     ELIGINSMRAVRRNLKNVDNYPLLLFVQSVEEKENNNVLEEPYGGVVGIRKKIHEEFR
                     DVVTNDQPTSLPPQRDLTHRIILIEPTKSTYRRQYKLSYSEKQELNKQVDELLKQGFI
                     KPSSSPFNSPVLFVKKKDGSMRMCVDYRLLNNNTVKDKFPIPRIDELITCFGGASVFS
                     KLDLMSGYFQVRIAENDMEKTAFSTDYGHYEWVVMPFGLTNAPSTFQRMMNRILAPYL
                     NQFVQVYLDDIIIYSKTVEEHYSHIEKILELLRRNKLIAKKKKCSFYFKTLGFLGHLI
                     SSRGIQTDPAKIDKIKSWPIPKNAKDAQSFLGLAGYYRRFIKDYSKIASPIMEFANKK
                     CVWKEPQDKAFEELKGKLINAPILVHPIWEDGYTFVVHTDACGTALGYVLEQLDSDGK
                     LRGVIAYGSRKLIGSELNYSIYDREFLAVVEALKNWRYYLLNRHFVLKTDHRSLVYLK
                     RQNAIDSHRVARWLDYLADYDFTIQYVKGPTNSVADALSRYPYEEKEVGINTIESVLT
                     PNQELLERIIKSYDEDNEIKEIYDILKENLPIPKSIHNHIKHYSIEDNLLYFSVVKGG
                     NDRRIVVSPKSKLVQEIIGNAHDGNSAGHFGYFKTYMRLHPMFYWPNMLKSVKRYCQR
                     CTVCQKTKPETTGQRGLFSPLPIPEGRWTDISLDFVTGVPRCKNGHDMILVVVDRFTK
                     MAHFIPTRKTATAEQCAKLMVDNCFKLHGIPKRMVSDKDIRFMNKFWFTVYKIFGTSL
                     LFSTTNHPQTDGQTERTNRILNQLLRNYASNDLYSWDKWLSMAEFAYNSSHQVSIGSS
                     PFEVCYGYLPDSPMFISSSRVSSRRYSNKAEEFALEMKVIMENVKENMIEAQRSQETQ
                     HNKSRVYETFEVGDWILLHKDAYGSDRLYYKIQPVYYGPYKVVKKISDNAYEVDLPKT
                     NKKDRVINVRWLRRFLQTDKQFPKVPPRTIAEARSRLTEIIGIAGIDETNDTLDVYWK
                     DCDPCHSSSIPFSLFLEIPEDLQRTLWDNAKAIDKDNKLRDEVSKAAE"
     gene            755710..755781
                     /locus_tag="C5L36_0Btrna5Q"
                     /db_xref="GeneID:40383854"
     tRNA            755710..755781
                     /locus_tag="C5L36_0Btrna5Q"
                     /product="tRNA-Gln"
                     /note="PKUD0Btrna5Q; codon recognized: CAA"
                     /db_xref="GeneID:40383854"
     gene            <756111..>759362
                     /locus_tag="C5L36_0B03740"
                     /db_xref="GeneID:40382887"
     mRNA            <756111..>759362
                     /locus_tag="C5L36_0B03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464740.1"
                     /db_xref="GeneID:40382887"
     CDS             756111..759362
                     /locus_tag="C5L36_0B03740"
                     /inference="similar to AA sequence:RefSeq:NP_012717.1"
                     /note="PKUD0B03740; similar to Saccharomyces cerevisiae
                     YKL205W (LOS1); ancestral locus Anc_1.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320599.1"
                     /db_xref="GeneID:40382887"
                     /translation="MEEQIQQAVEIANSPSSDPVIKEQALSFVSQIKSSTNGWQPCLK
                     ILQLDTASTNSKFFALQVICERLPLLSDSEKISLKDMIFNYLSSLISQNKVEPIFLRN
                     ALSKTLGLLFVHCTLNCYATLVKDVLSLAYNGSTFNDIATDYYVRTLSVIHQEIGDQM
                     ITRDNRSQDQHNLLKDSIRANDMLDMTSVWKKILGHYTSDAVVNRSLADEIINNTIIC
                     IGSFVSWIEINLILDEQYMSFLYQFLGEGTNAKRRAITANTFNEILHKKMPPSKKLEL
                     INFLNLGGILNQLNINSNAIEFDVSMALAKLVNQIGEESITVLDKCSPAELGSADFRS
                     LACSKILEIFPLIFEFLSNEFDDISLEVFPFISNFLLLLKKNITNETIDLSAINNDEI
                     LTTLSKNIILKLKFDEDDDGDDDDTIEQFNEIRSKLSVFLDSIVLLNETLALEVIINC
                     INEFLFSKIGDAGSQPDWRTIELGLYVLTYYSDMLRNNVMNLPKTMINNSRPYFVFNE
                     MLCKVITSSTQILINHPLIQLSFFELLLKHYTFFNNNNIQVEGVNKEDILLKVLNIFI
                     SNFGVFSENDKVKYRSWYLFHRFVKMTRPKVGDFIIEELIKSLLPLLSFDFQIVSNKN
                     KLLSNDPSAALFDLDMTLIEESGSFESQLHVFESVGLLITLVSSDDGRINILENVLQP
                     MFTSLEAAITKLSSSQLEIVGLVQVHHYLIAMGNILKGFESLRGQQFDQSKILNVLNQ
                     VSQVILITLENFIDFNIIREAIQFCIVRLYIILNNNNHSEKELLQSILSKFISCIMLN
                     FEKLKVLEIISFINFVSQIFYQSSTDESSYILLSSLLAPLLSKIFMKVENDKNKVTDE
                     FSKQEVLDLQRSVMSMLIAISNDHLNSLWLANEDNKAMLINVINTMLSYSYNHQGTDL
                     SIVKLSILVLNMLCQGLGSGIVVDPQDNFRSDNNKFEQVNELLINNSILLVAELGLKV
                     PAANKNLLKDAQFRNNITLEVCRLLKGIAHIGFEYPDSNTLQKKKSENATDSNKFTPL
                     PVGFNEETCQQISNTLVGNFGFPSELAAQLVQTLVSTTDRNFMKYLIDLVEKF"
     gene            <759665..>763153
                     /locus_tag="C5L36_0B03750"
                     /db_xref="GeneID:40382888"
     mRNA            <759665..>763153
                     /locus_tag="C5L36_0B03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464741.1"
                     /db_xref="GeneID:40382888"
     CDS             759665..763153
                     /locus_tag="C5L36_0B03750"
                     /inference="similar to AA sequence:RefSeq:NP_009835.3"
                     /note="PKUD0B03750; similar to Saccharomyces cerevisiae
                     YBR276C (PPS1); ancestral locus Anc_1.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320600.1"
                     /db_xref="GeneID:40382888"
                     /translation="MSLPDSEGQNNLHIDTPAQTISSCGNQLKACDPAEEDTPRRLTD
                     MSSDEVHCGSEYNMIEKIAIYSSKNWDKDLSDTKRSSSNDETKIKNQQVLIPVDEIGN
                     SIRSYTPVCTLNHLDNQQSTIGSSSGYIQVSTSISSANSSYASINEDPPYSLDSYDMR
                     ESKVKSTSVSNVSRPVLLAPLNDRTANNIAIYDEDDDNQDLVQQERSRRSSKRAMSLS
                     LDEKGKSKARMSIDGLRSKISPGKFTDSIGLDTHKYGEFHVFDDQYHTFINHPFVPSL
                     RHVKLFSNDEAIFYLMNFQNTKLPEVETMFPWLHGIHRENFGQINFLSSSSNVIEGNN
                     NNRKVITFDKPTLINQIRQESIFIKRSEGEVQEEEEDPISRLTNTPDARFLMPIRSSN
                     LLGEVSSTYSNVIVESSGLIKGSVSIEDVLVNYSSVSNLECYLLKNLPKAIFKDYSLE
                     TIVLDCIITRVLPVFKKLDPELGINLRNFHIQVSKISHISDFIVYCFNKGDHQICMDR
                     KREDSFENNKCKCLSIARLLHVAQIVYQHEHPEILRGYNMGTLLNDKKYNTFILENPN
                     IEKLSEYDLISIEPLKVDASSKRDDELCSKYDLNVFNNWDSNYLYRERLEISKMSTAT
                     PLPDDVWLGNITDYECLKIQLNNNKDIKMSTKIDVNRILEEQRNNPLFCSPTNTITNL
                     RKIDFYEGLRNDEYDKLLITFPRTIWRFYIKCVENAKIPTLEQLRLIYNNFQDCDFIN
                     IEFPPSGSITMADMSDEEILSIINICKFLYYITNSEFPGLIYCSDGYTESSLLTLCYL
                     MYSLNICLDEAILKLHVRYGRPFFIFKTDYVLLSKLETIINKFSPLQTNMQETRDDFK
                     FEDDTRSIRVLLLLMPKKKRSVGTACSVGSVGSIGHESNSFVTNTGHHVVQLRGKPKR
                     HNITHANNFTKFGTKNPNVLKCKPSIDGSFEEVSGSLPSKILGHMYLGSLTHASSIPM
                     LSRLGIEYIVSVGETIPWNNEFKHEKIESSDPHLEKYIYEDSQYDEKSQYFFPIKKVM
                     VLHNINDDGMGTLISTLDETIKFIDECYQKGKKVLVHCQVGVSRSASVCIAEVMSRLK
                     LTLARAYMFVRVRRLNVIIQPNLKLMYELFKWEESNRLKNKDDAVITNSARSLREVEW
                     YVLCREIYNLNRAYIK"
     gene            complement(<763228..>765189)
                     /locus_tag="C5L36_0B03760"
                     /db_xref="GeneID:40382889"
     mRNA            complement(<763228..>765189)
                     /locus_tag="C5L36_0B03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464742.1"
                     /db_xref="GeneID:40382889"
     CDS             complement(763228..765189)
                     /locus_tag="C5L36_0B03760"
                     /inference="similar to AA sequence:RefSeq:NP_011038.3"
                     /note="PKUD0B03760; similar to Saccharomyces cerevisiae
                     YER113C (TMN3); ancestral locus Anc_7.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320601.1"
                     /db_xref="GeneID:40382889"
                     /translation="MNILHYVILVFISIHSSLALSSQFSPSNFLSLWHSKHLYKFGDD
                     IDLLVNTVSSSQSNIPYAYYKVPFVCPPSSSVKPVHLSLAEILNGDNLMQSDYQLVFG
                     NDSPCLRLCDRIMAKRNIIKSIDLIKQNYIVDWVIDGLPASTTFISDNLTERKKYYVP
                     GFPMGFVKGDDAYVNNHVLMVIRYHKEKDNQYSIVGFEVYPKSVNDFTCPGASKNFEH
                     TKLDASNDFQLIHFTYSVYWKEEPEIDYNNRMKLFIDPSLIDSNGKLLSKPSNNNKAI
                     HWVSLINSLVLATFVSLVAAFIILINFRSSIQSASQSSFAQISQNSFTKPRFLPLLSL
                     LTGSGVQLVFTLLASGILSSLFLRKSFANDSKILALTIFILIIGGFFAGFSSIQLLKL
                     FSTRGEQLSIWKTSLISSLSGSMLISLGLAIVVVVNTLIFSKDSPRSMKFSNFLQLFI
                     LYIFFQLPISLIGGLISRKFNLFTNLLSSSLDSAPYTYASNKVSVAKTPLYLRFPFSM
                     LIIGLFPCGIVFIESRFVYMTLLSERATTYLLGFLVLSAILLSIVMIEIGIISTYIRL
                     LKNTSQYNWQWWTFLNCSISIWLYLESTSLYQLLKKLKTEGSTSPFLFIAYSSILNTI
                     VALTCGTLALWSATIFIYSIVLISTKKKD"
     gene            <765782..>766672
                     /locus_tag="C5L36_0B03770"
                     /db_xref="GeneID:40382890"
     mRNA            <765782..>766672
                     /locus_tag="C5L36_0B03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464743.1"
                     /db_xref="GeneID:40382890"
     CDS             765782..766672
                     /locus_tag="C5L36_0B03770"
                     /note="PKUD0B03770; Pfam Domains: Y_phosphatase2(6.8e-38)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320602.1"
                     /db_xref="GeneID:40382890"
                     /translation="MVHFILNTIQNGVSSSPPSHLCLIFPKFQTHMSEHACFTIEDEL
                     VPEVADELLNSQLDGFEDLDARSVNYVEYGFNNDKDDKKDNSGNNRDICTYSHVHAHP
                     QRQRTYSSLRLREWTPRYYPPLNFGLVETGLYRSGHPQPVNFPFLESLNLKTIIYVGE
                     KTDNYDYYRWLRHNGIRLVHVPLSGTCRGAADEDERSCSLNDALSHVLSIVVRAENAP
                     ILIHSNKGKHRVGVAVAAVRARLQGWVLAAVYDEYARYAREHPTWEMEAVEFYQGPVF
                     VKRGDTAPFVRNITNTIISE"
     gene            <767537..>768940
                     /locus_tag="C5L36_0B03780"
                     /db_xref="GeneID:40382891"
     mRNA            <767537..>768940
                     /locus_tag="C5L36_0B03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464744.1"
                     /db_xref="GeneID:40382891"
     CDS             767537..768940
                     /locus_tag="C5L36_0B03780"
                     /inference="similar to AA sequence:RefSeq:NP_015464.1"
                     /note="PKUD0B03780; similar to Saccharomyces cerevisiae
                     YPR138C (MEP3) and YGR121C (MEP1); ancestral locus
                     Anc_3.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320603.1"
                     /db_xref="GeneID:40382891"
                     /translation="MATSSHVWTQAYDSTTVITLVLGTCLVLIMCFGLAYLYSGLARR
                     KSALHMVFSVFFILLISIFQWYFWGYSLAFSRTATNKFIGNLHNFGYQNLEDNYTAGA
                     NSNIPEMAFANFQGMFASITACIYIGAICERGRILPFIPFTFCWLTLVYCPVTCWIWN
                     SSGWAYKWGVLDYAGGGPVEILSGFSGFVISYFLGPRKEHLMINFRPHNVSLITIGTM
                     LLWFGWLGFNGLTCLTPSLKSVYAIMNTNLCAAFGGFTWCLLDFLRTNRWSTVGLCSG
                     IISGLVAATPTSGVIPLWASVVLGIVSGFICNCATYIKVWLKVDDALDVLAEHGIAGV
                     IGLFFNAIFAADYVLGYDGYTEHPGGWINHHWSQMYKQLAYIGATAGYSMMVTALICF
                     VLDKVPYCKLRVDEEAEEAGMDEDQIGEFAYDYVEVRRNFFDVNGFEESGNSEKAMPH
                     SSSSSSSTSSTANNQNV"
     gene            <769344..>771275
                     /locus_tag="C5L36_0B03790"
                     /db_xref="GeneID:40382892"
     mRNA            <769344..>771275
                     /locus_tag="C5L36_0B03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464745.1"
                     /db_xref="GeneID:40382892"
     CDS             769344..771275
                     /locus_tag="C5L36_0B03790"
                     /note="PKUD0B03790; Pfam Domains:
                     Creatinase_N(2.3e-11)|Peptidase_M24(9.2e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320604.1"
                     /db_xref="GeneID:40382892"
                     /translation="MRKLTDSPEVTSSCLTAIASIFKSKPLPEDSEIDPIDIFTQFNS
                     AKRLNSLRALMRENNISAYIIPSEDEHQSEYTALKDQRREYISGFSGSSGIAVVTLHS
                     AALSTDSRYFLQAEKQLDENWILLKQGVCGYPSWIDWLVDECVYGMDQLDEVGSVGVD
                     PRLITWKLGNELVSKCHDNNITFVNDLDHNLIDLIRGKQEANKGKLYKYELKYAGLHT
                     TKKIEKLRSQMAEHGYFVYVSSMLDSIAWLLNLRGNDISFNPVFFAYLVITMDNVVLY
                     VDKVKMNSEISAYLSELQIRTKPYTSIWDELPALKGDGCICLEKNASYSIFINVPQVY
                     EIVFRSIITELKGVKNEIEVANIQESQKIDSLAIVRFLSWFNLNKCNTSLNELDLVDK
                     LYEFRRKSEHFRGLSFATIIASGANASIVHYEPTEDSFSLVKHNDVLLIDSGGQYFQG
                     TTDITRTIYVNNGKPPSKELKRAYTLVLKGHLNVAMLKFHKGKSSYEIDRLAREPLLK
                     YGMNYGHGTGHGIDNFICVHAGPCGLSPSATSYNYKPLEKGNFISDEPGYYKDGHFGI
                     RIESDILVNEEQDMLKFEYFTLVPFCRELIETKYLSNAQVDWINAYHKRIYTELSTQL
                     ENVKDFGALDWLADETKAL"
     gene            <772019..>772843
                     /locus_tag="C5L36_0B03800"
                     /db_xref="GeneID:40382893"
     mRNA            <772019..>772843
                     /locus_tag="C5L36_0B03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464746.1"
                     /db_xref="GeneID:40382893"
     CDS             772019..772843
                     /locus_tag="C5L36_0B03800"
                     /inference="similar to AA sequence:RefSeq:NP_010406.3"
                     /note="PKUD0B03800; similar to Saccharomyces cerevisiae
                     YDR121W (DPB4); ancestral locus Anc_8.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320605.1"
                     /db_xref="GeneID:40382893"
                     /translation="MPVKGWRRDDQDTNFDTMLHSEGMSIDTFLFPKSTINKICKNAL
                     HESDPETNYLIAKDSQTVIQRSCVLFINFIYHHAKQLVKAQNRKVVNADDIMSALQQV
                     GYGEFTPILQNELQSFNKRKEAKKIAKAQQKLNDVEDADIDDSIGNHNKRLKLGTSIH
                     GNDVTMSDHGDTTEFNDPSVVVHDQDTEAEEEEEEDEDEEDDGEEDMEGKEADENDDS
                     TEETGEVIRHGPSQLELEQKELVGDKDEDEEKEEEEEEEDEDPVSAVADKIEEEID"
     gene            complement(<772908..>773708)
                     /locus_tag="C5L36_0B03810"
                     /db_xref="GeneID:40382894"
     mRNA            complement(<772908..>773708)
                     /locus_tag="C5L36_0B03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464747.1"
                     /db_xref="GeneID:40382894"
     CDS             complement(772908..773708)
                     /locus_tag="C5L36_0B03810"
                     /inference="similar to AA sequence:RefSeq:NP_013194.2"
                     /note="PKUD0B03810; similar to Saccharomyces cerevisiae
                     YLR093C (NYV1); ancestral locus Anc_8.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320606.1"
                     /db_xref="GeneID:40382894"
                     /translation="MSTDPLYGPLNRNFNPNVNIIHCNLSINSTTLYTYDNPFISHHT
                     SLNYLEIITQKLGEVNEVQENSIDSMNVSQSITTNNQETSLIIYYNKKVMVNDSNDLI
                     TVVILCGTQLLESFVQNLLKKILDCYVEEYFNINKKYEFKLKMREIIEDEERKLVTLV
                     QNYGATEEDVSLVRDLMNENINKILKRGDNLQSLINKTSNLNTNASSFRKKAVHAKRK
                     IFWSNFKFAGMVIVTLAILGYIFLGMECGLPFYEKCLHPKKPSQPDPN"
     gene            complement(<773954..>779911)
                     /locus_tag="C5L36_0B03820"
                     /db_xref="GeneID:40382895"
     mRNA            complement(<773954..>779911)
                     /locus_tag="C5L36_0B03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464748.1"
                     /db_xref="GeneID:40382895"
     CDS             complement(773954..779911)
                     /locus_tag="C5L36_0B03820"
                     /inference="similar to AA sequence:RefSeq:NP_011787.4"
                     /note="PKUD0B03820; similar to Saccharomyces cerevisiae
                     YGR271W (SLH1); ancestral locus Anc_5.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320607.1"
                     /db_xref="GeneID:40382895"
                     /translation="MSSYNVASTGSYMQAMNPMREKLAELVLPGEAEALKIPANLLNE
                     KIVSDARDEATKQVNDLLKNFENIEDDILLDYEMMDSEQTHLQDDDYSHYSDDESAKF
                     FLIEEIKQECRRIHRKHSDEENDDHVQLFESIVSLLKSQESEVGLQSELFDTLGFEEL
                     DLITKIVSSKLEIIREYDQQKEALKRKSTGSNLLNNGLMTTEQIKAKVAENARRAREM
                     PLSKDQTVTRYPHVFRSHDPGNMVSFTGKFYSLPMGSTREAYEKYEEVIIPKSEKRNS
                     SAPNIFIPIRELDFLCQGTFRGYETLNRMQSLIYDVGYNTNENMLVCAPTGAGKTDVA
                     LLTVLHTIKQFISENENPGEEAVNIDIDFDEFKIVYVAPLKALASEIVEKFTKKLAWL
                     GIKVRELTGDMQLTKAEILATQIIVTTPEKWDVVTRKSNGDTELVEKVKLLIIDEVHL
                     LHEDRGSVIETLVARTLRQVESSQSMIRIVGLSATLPNFVDVADFLGVNRNVGMFYFD
                     QSFRPVPLEQQLVGVRGKAGSKQARENLDEVSFEKLMQMIREGHQVMVFVHSRKDTVK
                     TARSYIKLIRDHSYESYFDCSTEEKYPYFEREMSKNKNKDLRELFIGGFGCHHAGMSR
                     ADRNLTEKLFLSGSIKVLVCTATLAWGVNLPAAAVIVKGTQVYDSKAGGFVDLGISDV
                     IQIFGRAGRPQFEAHGIGILCTTADSLDHYISLLLQQHPIESKLSAKLVDNLNAEISL
                     GTVTNVEEGVQWLGYTYLYVRMKQNPFAYGIDWKELANDPLLVQRRRDLIIEAARKLH
                     KLQMIVFDERSSGFIPKDIGRISSDFYLLNESVEIFNQMINPQASEADVLSIISMSSE
                     FDNVKFREEEAKELEELQNEKVVCEIGPKLENSQKKTNVLLQAYISKAFVKDSALCSD
                     MAYIAQNAARICRSLFFMGLNRRWGVFTRHMLEICKAVDKQLWPFQHPMNQFNLQSQI
                     IKMIEAKKPTMDHLRDLNPAELGDLVHNHGMGPKLHKLIGRFPYLLLDVECFPITTNV
                     MRIHLTIEADFVWNFEYHGNIQFFWILIEDSHASNILHFEKFILNKKSFGLSHELDFM
                     IPLSDPPPPQIMVRAISDTWIGSQTDVAVSFKHLIKPHNDTVKTKLLKLHPLPITAFH
                     NKEIEKIYNAKFKYFNPMQTMVFHNLYNLNSSVFVGSPTGSGKTVVAEMAIWNAFNRF
                     PDSKVVYIAPMKALVRERVDDWKVKICGNTSHRIVELTGDSLPGVQEVRQADIIITTP
                     EKFDGISRNWQSRKFVQQVSLVIMDEIHLLASDRGPILEMIVSRMNYISSFTKKPIRL
                     LGLSTAVSNAMDMASWLGVKEGLFNFPQSVRPVPLKMYIDGFPDNLAFCPLMKTMNKP
                     AFMAIKQHSPTKPVLIFVASRRQTRLTALDIIHLCGMEDNPRRFLKMREDELTPYVEK
                     VKDDTLKLSLQFGIGLHHAGLVESDRQISHKLFEQNKIQILIATSTLAWGVNLPAHLV
                     IIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAFDTSGIAMVFTKESKKTFYKHFIN
                     VGFPVESSLHKVMDNHIGAEISSGTIKSRQEAMDFLTWTFLYRRAHHNPTYYGIEDLS
                     QEGISSYLSGLVDKVIDNLVESKCLITTGEKIEPTPFLHISSYYYLSHRTIRNLLNKI
                     KPNASFRECLRWLCEATEYDELPTRHGEELINMEMSQEMRYSADDLEDYEFIWDPHIK
                     AFLLLQAYMSRIELPIADYAQDTVSTLDQSLRILQAYIDASSEMRYLSTTLNFIKLMQ
                     CIKQACWFDDDFVWTLPGLKVRKIDKYDERYDHDGSDWVSTLEDPPVTLKSIGALRGN
                     KNKIDRLMDELRVNKRKRDEFLRVAGTLPTGDFKICKQNELRELEIKLVHHNKMYRKD
                     YNIYAPKYPKPQRETWFVLLCDLNEDELYVIKRESPKKIGNVDMIASKLIVSPDLYGK
                     KVDVVVISDFTDIYYRGKVTLKSSDSV"
     gene            complement(<780447..>782732)
                     /locus_tag="C5L36_0B03830"
                     /db_xref="GeneID:40382896"
     mRNA            complement(<780447..>782732)
                     /locus_tag="C5L36_0B03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464749.1"
                     /db_xref="GeneID:40382896"
     CDS             complement(780447..782732)
                     /locus_tag="C5L36_0B03830"
                     /inference="similar to AA sequence:RefSeq:NP_013197.1"
                     /note="PKUD0B03830; similar to Saccharomyces cerevisiae
                     YLR096W (KIN2) and YDR122W (KIN1); ancestral locus
                     Anc_8.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320608.1"
                     /db_xref="GeneID:40382896"
                     /translation="MSDFAKNLFGFGKQKTQSPDATANMNSSNGAINNQFKSNEHHNT
                     NAVRRVVSNSGFPAEILPHATPTIGLNEKSYAMGTTIKDPTALNRSITQFDQSQDKYT
                     QSQSSNLTAQLSNNNSQSLNNENTDLNNHTNEQILHNKQEHNHNMNNNNLNLNLNHSN
                     NDNQQPPQINVSEDSQQSHGQHKYYSSLNKIQGYSIANASDAYDSVQRGKLRIVIEEA
                     VGLNVKSPHSQPYVVCTFESSEIVTQRPESYDPRSHDFSHKANHRTNSNSSKTSLSGE
                     YNPANPSWQHTAIFDVIGAKSQLQVSVYDTALDGNFLGHVSIFPKTIDDSRVERWYDL
                     QPRLPDEPVAGKIRIKLEYSNIRKRHYGPNDFEILRLLGKGTFGQVFQVKKKDSKRIY
                     AMKVLSKQVIVKKKEIAHTIGERNILVRTATTESPFIVGLKFSFQTPTDLYLVTDFMS
                     GGELFWHLQKEGRFSEERAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGHIAL
                     CDFGLSKANLSNDGTTNTFCGTTEYLAPEVLLDESGYTKMVDFWSLGVLIFEMCCGWS
                     PFYAENTQQMYKNIAFGKVRFPKEVLSQEGRSFVKGLLNRNPKHRLGAINDARELRAH
                     PFFHDINWGNLREKKIAPPFVPYIANELDTSNFDPEFTNASTSAINKQLFMGTTPLSQ
                     AVQENFKGFTYVDESTMFDHFNPSMGRRGSYKPQYGSFIPGNPNLPPDEEVVDEVSEI
                     EEENQDDMDLDDEFVNGQFDL"
     gene            complement(<783253..>785820)
                     /locus_tag="C5L36_0B03840"
                     /db_xref="GeneID:40382897"
     mRNA            complement(<783253..>785820)
                     /locus_tag="C5L36_0B03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464750.1"
                     /db_xref="GeneID:40382897"
     CDS             complement(783253..785820)
                     /locus_tag="C5L36_0B03840"
                     /inference="similar to AA sequence:RefSeq:NP_012074.3"
                     /note="PKUD0B03840; similar to Saccharomyces cerevisiae
                     YHR204W (MNL1); ancestral locus Anc_4.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320609.1"
                     /db_xref="GeneID:40382897"
                     /translation="MSSGSYPLVWPILLLLPLLTSVYCADYNAEYFQKYTYKSKYNDS
                     AIFQSTYTKKHLSVLKNETRDLFEYAWDKYMEFGFPYDEVRPLDCKPNKRDSQNKFNT
                     VKNDAMGNYSATLFDSMDTFIIMGNKDKFAEILELIKETYKDFEIDSTIQVFETNIRI
                     LGSLLSAHLYAIDPRRGFTIDGYDGFLLKLAYDLGKRLIVTFQHENDEYYSGDEYLKY
                     FVFNYPRTNLKYGPKIDTKLKVEQCTAGATTLTLEFGLLSRLTNDTIFEDISRRTVLD
                     FWSRRTKLDLIPWGFDTSLRAFDDPTTGIGASIDSFYEYALKYSILFNDDLFYDIWLN
                     SYSALLTHSQNNDGIFANLNANNGLATSEWIDSLSAFFPGLQVLSGDLDNAQKLHKVY
                     FKLWNNYGAIPERWNFMPFRSETYFSHLTRGYKDGDLIPGLDDAMTNVVLLKNSIGLE
                     WYPLRPEFIESTYHLYRATKDPFYLRIGEDFLERLREHSIAPCGFTGSLDITTDKPHT
                     REESFVLSETLKYLYLLFDVENKVQQGNTVFTTEGHPFWYDKSLNLYNPLAASSLEEM
                     NKWDEKTVQANEGILNKFFHQETFNLNREFSRLREKFYANIDKVDPIIHRISDFYSTI
                     PTEDGGIERNYGKRLRVTEREYWSFKNHDQTRMESMLSNQLKGENLKIVKDYLGLNTC
                     QLPQVSPFIQSALLSEDKEFYRLDWVYAMTLRRPPYMPNGRELEVEEGFYQRFVDGYS
                     TCDVEEHSQVWELLISSDDTFNVSPIYRFNYSDDIYLPELEGLRIQLKQLQKQSDNNR
                     SVVHVTKLNGKNIPIGGNVWISPTAVLLSNRDNISLTEDSCIVMDGHVVDNMCLLYL"
     gene            <786035..>786781
                     /locus_tag="C5L36_0B03850"
                     /db_xref="GeneID:40382898"
     mRNA            <786035..>786781
                     /locus_tag="C5L36_0B03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464751.1"
                     /db_xref="GeneID:40382898"
     CDS             786035..786781
                     /locus_tag="C5L36_0B03850"
                     /inference="similar to AA sequence:RefSeq:NP_012255.3"
                     /note="PKUD0B03850; similar to Saccharomyces cerevisiae
                     YIL010W (DOT5); ancestral locus Anc_7.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320610.1"
                     /db_xref="GeneID:40382898"
                     /translation="MSVSRRRSERIAAIQQEFEIVKAQKAETPASKVTKPKKSRTKTQ
                     TIATKVTEPKKSTRETENLKQGSPTVKVDLPKTTKSRSAKKEDAIELGDDYELNVGDE
                     IPSDLEIKLQNGEEQNLLEFSKKAGVLVIFSYPKASTPGCTRQAKGFRDHYKELNEKY
                     GASVLGLSADNAKTQTNFKVKQELQYDLICDTKKELIALLGCKKFPSGIIRSHFIFVD
                     GVLRFKNVKVSPEESFTNALKQVKELSKSK"
     gene            complement(<787149..>787829)
                     /locus_tag="C5L36_0B03860"
                     /db_xref="GeneID:40382899"
     mRNA            complement(<787149..>787829)
                     /locus_tag="C5L36_0B03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464752.1"
                     /db_xref="GeneID:40382899"
     CDS             complement(787149..787829)
                     /locus_tag="C5L36_0B03860"
                     /inference="similar to AA sequence:RefSeq:NP_012657.1"
                     /note="PKUD0B03860; similar to Saccharomyces cerevisiae
                     YJR123W (RPS5); ancestral locus Anc_7.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320611.1"
                     /db_xref="GeneID:40382899"
                     /translation="MSDVEEQQQFEEEIISEPVEVQYVELATPIPKDVQQGAAEVKLF
                     NKWSFEDVVVKDISLTDYIQVRQPVFVSHTAGRYATKRFRKAQCPIIERLTNSLMMNG
                     RNNGKKLKAVRIIKHAMEIIHILTDLNPLQVIVDAIVNTGAREDTTRIGSAGAVRRQA
                     VDVSPLRRVNQAIALLTIGAREAAFRNIKTIAECLAEELVNAAKGSSTSYAIKKKDEL
                     ERVAKSNR"
     gene            <788816..>791065
                     /locus_tag="C5L36_0B03870"
                     /db_xref="GeneID:40382900"
     mRNA            <788816..>791065
                     /locus_tag="C5L36_0B03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464753.1"
                     /db_xref="GeneID:40382900"
     CDS             788816..791065
                     /locus_tag="C5L36_0B03870"
                     /inference="similar to AA sequence:RefSeq:NP_010941.1"
                     /note="PKUD0B03870; similar to Saccharomyces cerevisiae
                     YER024W (YAT2); ancestral locus Anc_7.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320612.1"
                     /db_xref="GeneID:40382900"
                     /translation="MPSTFDSENLLPKLPLPNVQSSIHQALEALKPMVPENDFEKLVH
                     NAEEFANSEICETLQSHLKKIADSTDNYLHSEGISTTTSNVYGDLRGQTLPRNPFFIL
                     EDDPMKNIVPSQEYRAAVLTCSTLRFIVALKFGYLKPDYDRSSNNPLSMTAYHNLFGT
                     TVIPMNNGVTMKKSEGSKHIIFMSNGQFYSLTVLSEDYQIWFSKHELSAIIKEIIHDS
                     IHRKNNFNVGTFTSEAKTTWKAARFALEKTNSQQMEVIDSALFIVCLDHETFDLNHVN
                     NESNKIQLVSHGTSRIDKNGHQFGTCINRYYDKLNIVVTKNATAACIYPASIIDGTSV
                     LRFISDIYTDSVLRLARMINGKNYTLWTEINTVPIDSKIVKPNYQYLKFNLTNEIANG
                     LHLAESRLADIINQHEYVAKKIEMGKSYIRDKMKIPTDAFVQICIQITYYALYGKCPS
                     TFEPVSTRRFRDSRTEPICVQNEYILELCQAFISQTTEEEKWKLILQAIEKHQKNVKN
                     ASSGLGFERHLSALRSAFIQRNTLNNLNPELPKINPTSLPPFLFDSLIENLYKPELIA
                     ANCGNPALDYFGITPSVPSGFGFGYIIKDDYITIVGSSQWRQTGRFLDTLERVFLNIK
                     QIWRNVVINQSNNRDTDLQEYIKSIPMSLVQSNNSSWLPNINSKSKSNTKADAYIMGG
                     YDYFDVGQLHVRSEMASRAQSQAVSRAISRAGSQVNLAKIPSFKNVDSAHSEKPPTVG
                     RLLSLQTDL"
     gene            complement(<791255..>792673)
                     /locus_tag="C5L36_0B03880"
                     /db_xref="GeneID:40382901"
     mRNA            complement(<791255..>792673)
                     /locus_tag="C5L36_0B03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464754.1"
                     /db_xref="GeneID:40382901"
     CDS             complement(791255..792673)
                     /locus_tag="C5L36_0B03880"
                     /inference="similar to AA sequence:RefSeq:NP_012658.3"
                     /note="PKUD0B03880; similar to Saccharomyces cerevisiae
                     YJR124C; ancestral locus Anc_7.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320613.1"
                     /db_xref="GeneID:40382901"
                     /translation="MSTHIWHSLKQSTTDIRLLWFSVFIRMISFGLTNQVLTLYLREL
                     NISEVNIGLFMSLTMVGDSVISYALTWNANKLGNRFIMLLGSFLMIVAGFIFSTGTGN
                     FHYLLFAAIVGVISPSGNEAGPFKTIEETVLANLTPPNHRPEIYAIHWILGSVGASLG
                     SVLAGLIVQTLILNHGFSTKDAYRCTFYVIVFTSVLKFASLLFISEKAEPSYIPPYKL
                     TLENQLDNEDNEESNRTIDSQASTSTMTSANGERQPLLRIQSTVEHPTITGLSPQTQS
                     ILFKLMVPFMLDSFGYGFMTNAWVVYYFKKRYQISAVILGVLFGFSGIAMSISAIPSA
                     WFAKRFGPIKSSVLTQIPCGLFFMAIPLLGYNFNVAAVFYLLNQVTTAFDVVPRQIIL
                     TSLIPPVELSKVMGSVNIGKQIARSISPCFTGFFARDGLLWLCFQLTGTFLIMANLFL
                     AVEFSCLDEKVRKLEQVNHDIV"
     gene            <793163..>796279
                     /locus_tag="C5L36_0B03890"
                     /db_xref="GeneID:40382902"
     mRNA            <793163..>796279
                     /locus_tag="C5L36_0B03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464755.1"
                     /db_xref="GeneID:40382902"
     CDS             793163..796279
                     /locus_tag="C5L36_0B03890"
                     /inference="similar to AA sequence:RefSeq:NP_013556.3"
                     /note="PKUD0B03890; similar to Saccharomyces cerevisiae
                     YLR451W (LEU3); ancestral locus Anc_7.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320614.1"
                     /db_xref="GeneID:40382902"
                     /translation="MSTTSNNLTQFKAESPEAIMNSFDTKGSQKRSKRSKKIACTECR
                     QQKAKCDASERQPHPCSRCEKRKIPCKLDSEFKRTFKRAKIDELVKEYEIIKSKLNSN
                     MLNDTKQIPVQIQQQPPPLQQQQQPQPQPQAQTQQSFLPPIQYVSNSRANISGGSSYP
                     IQASPSNGSPLNDTAGYGSAVPSNSYNNHATHVSSSGIPGSINRQMGPNISGSGNVKP
                     ATPLSTLNRQFSPFSMRPISPLGQDMSLISGMQLSSSYNQPIKSPVIVATPGIQYSTN
                     ISSPNITNKINSSLNLSTLISAANASDNLSKGFTNGSAITASNNVNKQAATVSQLEPG
                     KLSNLRVCRPVRKPKIDQSLLSCTPKSLGEVTLNEDQIVVLYSTFLTHYHPLLPVIDM
                     EKSIEKIYKLCPILFWTMMFTALRGHHSLEPAISPEECKELYFTLSPVIKSVLAEITI
                     SPITRYAPSEADESILNASSVYSVQAFLIYTFWPPLTSSLSADSSWNSIGIAFYQAIR
                     LGLHTPGLTSDRSKSSDLLNENIRTWIACNVVSQTIASVFGYPSFFQPYGSLTLALSK
                     EGNDVPHCLRQMLEIQTFEEQIEKTLNSNSFDSLRLNHTSEQLPMIHLLENELNQLEL
                     KLCSVPDSPMDDFRMLSLYAARLHLLCYYFLDNDQSNTFEYKRGVIKAYNAALAIIQH
                     CKMSNEREDSFIKNLPSSYILTLWQASVVISRLVNSSYKSLIDVEAGKLLYQNAISLA
                     LKASVVKHDLAYRSCGIMKATWNLFRTLDMNSSGPVKVTVRSRMSANIFFDTLWIVRE
                     KCDMIKLNYRKKSDSNSGGESDDDVEVIEDDQKVSDDHQNVVTNTLSGSVGSETRSSS
                     KRKTNYSAENAARKIISTIPLDPQPISIAETPNDSTSNSKGGSPFASYKSPNTYSDAS
                     KKIITPQSLALNSASNYHSSPDHRSNQNSKRTPNDTKSVSSTPLETGAAAVLARPAES
                     QNANTEPVKSDSTVGLTNSNVDALGPTPTTNTGFFIDNWDLNADFDSDMLFKDIASVM
                     DEFGFHAG"
     gene            <796680..>798248
                     /locus_tag="C5L36_0B03900"
                     /db_xref="GeneID:40382903"
     mRNA            <796680..>798248
                     /locus_tag="C5L36_0B03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464756.1"
                     /db_xref="GeneID:40382903"
     CDS             796680..798248
                     /locus_tag="C5L36_0B03900"
                     /inference="similar to AA sequence:RefSeq:NP_010942.1"
                     /note="PKUD0B03900; similar to Saccharomyces cerevisiae
                     YER025W (GCD11); ancestral locus Anc_7.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320615.1"
                     /db_xref="GeneID:40382903"
                     /translation="MPSELQDAVPDIVIGGDQPVEEAEYESENEEILDTKTEKKTVSF
                     ADLDENENGESEEDIRKREFEEGGGLPEQPVNPDVASLTPISPEIINRQATINIGTIG
                     HVAHGKSTVVRAISGVQTVRFKNELERNITIKLGYANAKIYRCNDKNCPEPDCYRSFK
                     SDKEIHPKCQRPGCNGRYNLIRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNEP
                     CPQPQTSEHLAAIEIMKLKHVVILQNKVDLMKKEAALEHEKSILKFIKGTIADGAPII
                     PISAQLKYNIDAVNMCMVKSIPVPIRDFTAVPRLMVIRSFDVNKPGAEIADLKGGVAG
                     GSILTGVFRIGDEIEIRPGIVTKDDNGKIQCKSIFSSIVSLFAENNDLKFAVPGGLIG
                     VGTKVDPTLCRADRLVGQVVGAKGNLPSVFTDIEVNYFLLRRLLGVKTDDQKKVKVRN
                     LEVDDVLMVNIGSTATGARVVAVKADMARLTLTSPACTEINEKIALSRRIDKHFRLIG
                     WATIKKGTTIDPIN"
     gene            complement(<798618..>800684)
                     /locus_tag="C5L36_0B03910"
                     /db_xref="GeneID:40382904"
     mRNA            complement(<798618..>800684)
                     /locus_tag="C5L36_0B03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464757.1"
                     /db_xref="GeneID:40382904"
     CDS             complement(798618..800684)
                     /locus_tag="C5L36_0B03910"
                     /inference="similar to AA sequence:RefSeq:NP_013557.1"
                     /note="PKUD0B03910; similar to Saccharomyces cerevisiae
                     YLR452C (SST2); ancestral locus Anc_7.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320616.1"
                     /db_xref="GeneID:40382904"
                     /translation="MVASTCKVSNQVSLTSLTRTPSGSIYHQDLKNIFSVLLYCLDLH
                     DCSKRQSILSKINLKKEYPYTFTLEQAIQTMKRLYIKLQYKSTLTIFSYEINKHLSME
                     LLQIFYFAKLLHCPADKTCKKIADKNTVLQPTPKGLAILHQFCLKMGIPDIEKQHVPK
                     ILTTEFNTMQLLEFDRHSRTDQIIHNYHSDKLIFIRIMGPIMNTWSSKNGPDSIKDLG
                     SILKLKSKFKESNLYSSENANTNPLQDGAAFLLYLRKRQTDGAPEDENDGLEANDKET
                     TRQNNLHVSSFHHRFFTNPDSDSHCQYYVSDKGIRFFKEKTVAVNGTNVTVTNCFSGK
                     ALVQYLMDCTDLMYPKDALKIATIFLSSGLIECKTYGQNIFFPKKNALYILTEKGNQI
                     VKWKNYINSIQYDIPCTPFSNEFHKDTTSFKLVLKDPGLKYLFRNFMIENMCVENLDV
                     YDDIVDFQKKNSVLKKMISLKTREKTRYLEEIQYDTVFNEFRSNAMKQKKLTIYTAIN
                     KLSEYNLSKVYSIFSMYISEDAPNEVNIDSKLRFEVQNYFQAKINFETTLVNILDLKM
                     SIDVSNEQESDFCLKEVKHEGEVIEPLATPPATPSSFFCEEAQLWKVIPQQPPTLALK
                     MCHIKKMSDSECSPTEILFTPKLKFLDDVSVYFEEIKRKIYRIMERDSFAKFLESDQF
                     RENKTL"
     gene            complement(<801163..>801660)
                     /locus_tag="C5L36_0B03920"
                     /db_xref="GeneID:40382905"
     mRNA            complement(join(<801163..801429,801580..>801660))
                     /locus_tag="C5L36_0B03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464758.1"
                     /db_xref="GeneID:40382905"
     CDS             complement(join(801163..801429,801580..801660))
                     /locus_tag="C5L36_0B03920"
                     /inference="similar to AA sequence:RefSeq:NP_015227.1"
                     /note="PKUD0B03920; similar to Saccharomyces cerevisiae
                     YPL098C (MGR2); ancestral locus Anc_8.578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320617.1"
                     /db_xref="GeneID:40382905"
                     /translation="MPPVQQVQVQYQEPTLFDKMKMGFLMGSTVGAVSGLVFGGYAIL
                     KGGAPNGVVNTLGQYILGSGAFFGMFMSVGSIIRSEDLQYSNVGRPGNLAELKARMMA
                     RHMINMENMRKNL"
     gene            complement(<801938..>804397)
                     /locus_tag="C5L36_0B03930"
                     /db_xref="GeneID:40382906"
     mRNA            complement(<801938..>804397)
                     /locus_tag="C5L36_0B03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464759.1"
                     /db_xref="GeneID:40382906"
     CDS             complement(801938..804397)
                     /locus_tag="C5L36_0B03930"
                     /inference="similar to AA sequence:RefSeq:NP_014974.3"
                     /note="PKUD0B03930; similar to Saccharomyces cerevisiae
                     YOR329C (SCD5); ancestral locus Anc_7.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320618.1"
                     /db_xref="GeneID:40382906"
                     /translation="MAANFDWNTIPGITDNPAASPVQTDHFDDFFNSQLKQNQNQNFS
                     SQSLTSTVHTAEQTLYTNLLHSNKQDSDISDALSQMKISPKNKSYSDDALDNLKAVTS
                     SSPSELKPSHLNNVMEHVKHSSSADTVIPENDSSVPLSLAITDMEPKELKTYLRWYED
                     IRTRKINSKDVTIEDVFSFLQNFKIPDSIKERLKSSFSKWAHSLNIGQFFALMRLLAH
                     SLHGEILTRSLVRRVAPIPSPVPILTKKRKVELTDDSDIFDEQNKGVKKKLDIDSFTE
                     FLLTGERPVLRTGKTKDKKVKFSDVLVYSSSEKDSALESNLVESATHSSTHSLDFSLP
                     MNQLLDKIKGVTNEVPHNTAEQAAQPLSQSVENEEDILRDVKTDTFKKVTERVVAQDE
                     NDGLTPLKPNLTGSASKSMREHFMQQFEKTFNYNSTNGSFNAPYTDISSLSAQSQDPP
                     AMSNTLAALTANQNSSNPTSLTQKNSPVQFPHTLNAASPNIQNLFSGQPNNPSPQIQY
                     TNPQNNTTLADFSQEKQQADYFGMISHNNHSVGLQFMGDINGNRGSISNANNNISSNN
                     DTNNNTKNDSNKNTNFVTLPQPPTITRSRASSTASPPPIPPPPPRSRKSSRASAAMSN
                     IPPPSAAATSPSLASNMNPALPPKPMLNDTQRKQYLSVTDEVSRPFNSTSPLGNCAHL
                     NQYGSTVALSSVNLMQDNSPSPLNGMGIQNLQINGLSDANTQNGTGNQQLQTARLNGS
                     NQGYPQYHGNVGSGVYQMNGAIPVRNASFNTQNIFMNQATGGGWAPSQYLTTTNPQQH
                     QQQQQQQQRPQNTGNWSGWQI"
     gene            complement(<804875..>808753)
                     /locus_tag="C5L36_0B03940"
                     /db_xref="GeneID:40382907"
     mRNA            complement(<804875..>808753)
                     /locus_tag="C5L36_0B03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464760.1"
                     /db_xref="GeneID:40382907"
     CDS             complement(804875..808753)
                     /locus_tag="C5L36_0B03940"
                     /inference="similar to AA sequence:RefSeq:NP_014975.2"
                     /note="PKUD0B03940; similar to Saccharomyces cerevisiae
                     YOR330C (MIP1); ancestral locus Anc_7.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320619.1"
                     /db_xref="GeneID:40382907"
                     /translation="MLIGIRGRGFAWPYTVCRSFATVSKDHNPKINTNACGIQQLSDE
                     LHKQIFPVKSLPGPLPRLTKLSLKYLEDNELLGKPCSVNPPININLPTLQGTNISQHF
                     ENLGLKSISSYEDHAENLIKIGLTPLEKPKRWVFESGWTRYAPFSEPQNVPYPLENEL
                     VYDCEVMYKCSPYPVMATCLSPKAWYSWCSPYLTGDSATNNHLIPFATDKRECTIVGH
                     NVSFDRARILEEYNMSTTKAFFLDTMSLHVAVSGMCTRQRNTWMKYKKNLKEKKDSSV
                     KTLDEYREMIRNEDLRLTMANMILDDESVEGDTGTTSALRDDPWMKNSSLNKLSDVAE
                     LHCGIKMDKQLRDHFATTSVAEIREQFQKLMTYCANDVVATYHVFYKVYPKFKEVVPH
                     PVSFAALRHITSSILPTSTDWEDYIRRCEEMYQKSKTEVEEKVHQICNEVVSLRKNAQ
                     DEIPPWEEDPWLSQLDWEIKPVRLTKSGVPYKNQKLPGYPEWYKKLVAKDKLNLTIKS
                     RTSILLLRLLWEGKPIFWTETKGWCFVVDQKESAKFQNSKYLEVNPLDILMQIHANTP
                     KRKVSPKKKSVSRESSSTKSKESSRTKKTSKSIDKPTQHMSTEDANLDLLAVDLPPRY
                     AESDHIVRENLKKLIANGKTLFKIPHENGQDARVTSLISKPFLRYYEEGILSSENSLA
                     REAFQTNVTNSYWISSRERIMNQYVVYESDLNKAKPFRQKGEKEVGFIIPQIVPMGTI
                     TRRAVEKTWLTASNAKKNRLGSELKSLIQAPPGYCFVGADVDSEELWIASLVGDSVFR
                     LHGGTALGWMTLEGTKNSGTDLHSKTANILGISRNEAKVFNYGRIYGAGVKFATSLLK
                     KFNPAISEIDADKVAKTLYAETKGKTSVVKFPESGEKIKVWYGGSESVVFNRLESIAE
                     QDNPKTPVLGAGITAALNRTNLNSNSFLPSRINWAIQSSGVDYLHLLLVSMEYLTKLY
                     NVDARLSITVHDEVRYLSKIEDRYKCAMLLQIANLWTRAMFCFQLGIENVPQSCAFFS
                     CVDIDHVLRKEVDFDCITPSNPSPISHGESLDIYSLLKKKEVQDMLNSLNDKPNCENL
                     LENKQKTSRPVEKLDIKFDTSTKLKWIELQISKTEKEFKEKKKAFFQAADTLVLENFA
                     KKLKNIDNSNDEVVLNGLFVPNCTAGELLDSGKIIEENWDALINERKADKKFKGSKNN
                     KVCKDEDHSTTDLLIERIATDILDKMERKPKSKCKAYGKARPSKKTCLVESDNKSLTL
                     SSNRKRGREGEYVTFSHTHLTENELREIMF"
     gene            complement(<808991..>812365)
                     /locus_tag="C5L36_0B03950"
                     /db_xref="GeneID:40382908"
     mRNA            complement(<808991..>812365)
                     /locus_tag="C5L36_0B03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464761.1"
                     /db_xref="GeneID:40382908"
     CDS             complement(808991..812365)
                     /locus_tag="C5L36_0B03950"
                     /note="PKUD0B03950; Pfam Domains: DEAD(7e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320620.1"
                     /db_xref="GeneID:40382908"
                     /translation="MGASSDVIGEVYVDCPVASIGLPCASDAGYVSLRDFTLKNIYPD
                     SKEEPPDLPKDTRYSTRKFCVKVSKLQINAHLVYSASLDKKGKVVIDETPSPNSVLDL
                     YSFNSVSKSNHISEGTEKILECVSFKGKEHKEFISKVRKEEKQISIVLVQDDRLCFVQ
                     NLLRDLSCYGIRVFLLVHRPPEGNTSDLKQLCKLLGSLINRMNSKFTKNNGKQIHMIS
                     YEQSDLVFAIFLSQRSLNTNLTTAIIISNDFDEQELLKSKHYLGLNFKKKSVNNDVPR
                     FRIRTPTLSISLNKTVPNYWNSDYLKLGPNPWICKANKYLGNEYFILETQNNWFSNDI
                     IKWIKSWKHINIQDVYDIDLDNVDINWVLAKSQRQISTPSRSAGVKSIPLVVNDTYLE
                     TQNEDGEQAPFLRNQFDEEIDEGKVDIFDKYGLRIMSKEDLSKEQLRIQTKFYKLDEI
                     QDKTLPKNPPTGYDNLVTYFQYMTYSLFLEELYHQDFCSETYIKKSSDNNLNIFVSTK
                     QAFELYVQEEIHHLRKHPFVKDQPLFIIRKSDESLCWKNRPQFWVVKVKKCEVCRFNN
                     ETGELIAVTIKKSNKRERENAISMCSVEMYNWNEFSFPKKDPPHNFTILPGSIVLGRI
                     FDSMSRISNPTFIDLILGKTKIKSVSPKKPITGLYSTLNDSQKTALNACLSNEVTVIQ
                     GPPGSGKTSTIHETVIQLLDHGVKPVMVVASSNLAVDNIAEKMIDKYKDRILRVCSTA
                     KEREYNRDHKVGSICLHNKLTKQFSKDLVDIENRFREDPRNIDGKELNKYIDQSSKAA
                     TTIVNSAEVIFTTTASILHKHLRSIEGVPVIIMDEATQSSEPLTMIALGVKGCRKLAL
                     VGDTEQLSVFTNVRTLKTSLYQRVIDHSILTKPHLLNTQYRMHPEICEYSNTEFYKGQ
                     LRNGITAEDRRLKKIKFPLFFYDHQGNHAKESRIFCSNGEEQTYSWINTAEVGYVVEM
                     VENLIRDRELQPSDIGVMTGYSAQRELLINAFKKSLVVNPERCDISFSLDNEDLSINQ
                     NSTVCDINGLIIASIDAFQGRERKIVVMSCVRSNSEGNIGFMADHRRMNVAITRAQYS
                     FVMVGNFRTFSKDVHWGQYLLSLSKKGYVRINIYDY"
     gene            <812724..>813498
                     /locus_tag="C5L36_0B03960"
                     /db_xref="GeneID:40382909"
     mRNA            join(<812724..812756,812839..>813498)
                     /locus_tag="C5L36_0B03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464762.1"
                     /db_xref="GeneID:40382909"
     CDS             join(812724..812756,812839..813498)
                     /locus_tag="C5L36_0B03960"
                     /inference="similar to AA sequence:RefSeq:NP_014977.3"
                     /note="PKUD0B03960; similar to Saccharomyces cerevisiae
                     YOR332W (VMA4); ancestral locus Anc_7.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320621.1"
                     /db_xref="GeneID:40382909"
                     /translation="MSSTRALTDDQVQGELKKMESFIRKEAEEKAREIQLKADEEYEI
                     EKASVVRAEINAIDAAYQDKFKKASLAQQITKSTIANKTRLKVLATREEALETIFSAT
                     HDGLKKLASNKNKYKTLLIGLIEECLYTMMEKAVTIQVREVDVAVAKEAAKVAAENFE
                     KKAGFPVDITVDESNFLNKDLAGGVVAINGTGKISVDNTLDERLKLLSETALPAIKLE
                     MFGPSKTRKFFD"
     gene            <813755..>815215
                     /locus_tag="C5L36_0B03970"
                     /db_xref="GeneID:40382910"
     mRNA            <813755..>815215
                     /locus_tag="C5L36_0B03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464763.1"
                     /db_xref="GeneID:40382910"
     CDS             813755..815215
                     /locus_tag="C5L36_0B03970"
                     /inference="similar to AA sequence:RefSeq:NP_014979.1"
                     /note="PKUD0B03970; similar to Saccharomyces cerevisiae
                     YOR334W (MRS2); ancestral locus Anc_7.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320622.1"
                     /db_xref="GeneID:40382910"
                     /translation="MLISSNNLPIPFPYHTIQLTSTTRYLGVMQIYIPLVRQQIRKIG
                     SASVISSTSKVLKPIKPDLSTISCTVVDQTGTVRAVSKKFPRATFLQQNKLFPRDLRK
                     IDSSNVDVAPSIAVRSNGILVNLLHIKALIKRNEVLVFDTASPQSASKLSLFMYDLES
                     KLQTKVVHSGMLGINNGNHQNILNQTYEFKTLECILVNVMAVLETELREHAAKVDKIL
                     KQLDSQIDRAVLKDLLVNSKDLTMFYQKSLLIRNTLDELLDNDEDLENMYLTENYEIK
                     RLIVDQESDGKSSVLKAAKQDGSSNVNTNSNHHSLIQEGSESKDTGEIEMLLESYYKQ
                     CDEIVQQAETMINNIKSTEDIVNIILDANRNSLMVFELRVAIFTLGITVATIIPAFYG
                     MNLKNYIEDSNIAFVGVTAVSVVLGGIMAIIYLRKLRDVRRMTMVSSKQLDQFDNDTK
                     RGIHEKVRRQRESKTLEQRRKLEKEIVWKWLLGDHK"
     gene            <815613..>818801
                     /locus_tag="C5L36_0B03980"
                     /db_xref="GeneID:40382911"
     mRNA            <815613..>818801
                     /locus_tag="C5L36_0B03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464764.1"
                     /db_xref="GeneID:40382911"
     CDS             815613..818801
                     /locus_tag="C5L36_0B03980"
                     /note="PKUD0B03980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320623.1"
                     /db_xref="GeneID:40382911"
                     /translation="MEQTKSDIVRKSSGDENNGNKPSGTGTPSRLAHEPPSVRQIETL
                     YPIDAKLLQYHFILDKVDVFLGKVQKLKLEIKQDTNFVIDPQTILLLSGTIFNINDNF
                     YRRSEILQMCQKFNPSQKINLSPIISPISFDSLENIGKNSPVGPFGISLDKCVPLPSR
                     KKMNDTLFLLENLLNSVYDITLQRFESLLINFNNQHGLKETKSSIKEKLVFLDFDEIK
                     SIDKFNFQDVPKIDLKKQEYIRKYYLTSQFQFLEVLIGDYIHIVDNIKQSIHNSIISL
                     TKQKTQNNRTNPLFAMYTNLLRLADLYVEIRKIGKTIYFQNINYFQPYTKQRTALKAT
                     LSQMNILFTQSKQNGMLLSLISKYARRTEIKNLRMDFNIFVSEFRKVSLEMVTLLDKM
                     IGVLKGIHGEFTLIVGEGKDNDFSTEYIRSKLRERANSERVKRLSMIHMQQEEMKVKL
                     EHQIAGASVANNMSHINKRLNLVQAGKQEVTPQPTIVRRVEHRNITPNTQLARRASIN
                     GVIPAQSSSRLSSLKGSSHSPFYRPNASGSASPSVNSSRSNSLTRTDGMRQIARKVSL
                     DSLTIGSISEDGAFVEPPKISEDGVVSSQSTSSQSSTPTSSKISSDTTKTPTTQKVTR
                     SSSRSNSLTSSPSSRAQLLQRRGSVNLSTPPGIASPASRSEYLRRRASVNLSSPSNST
                     NSLTRTNDQREVVQRKPNVNTSSPSTSNSNKLVSQPSTSSPGNLERRRSVIGVPNEVS
                     SYSKSAAIQANKNSTPVHLTAQQRLQQHIMKASRNGTMYAQQLQSPRKTPNSSTSPPS
                     GEETPTLIVSPPSPAAKPPIDDLPTSPLNSLKTGSMEAQKTIKMQLLNRSRSGSDANL
                     SNYSLQDKLSPSKPKGLTSSSPSPTKIRSRSNSASVARKLALTSDKASNSGSASVSRN
                     RSRANSASSRQTLSRNNSVLGGNTMVYKPEDTHLDESEEKRVRFTGVQEYTEDEDAPT
                     PQRMQKQIRQKWAAYKPLFRKLNSQEGLALKLHKGDVDDVVQLPSVLMSQFNGEAPPK
                     VKTTLRESTQISAAQSAASKLSTKFSLFRKRK"
     gene            <819017..>820165
                     /locus_tag="C5L36_0B03990"
                     /db_xref="GeneID:40382912"
     mRNA            <819017..>820165
                     /locus_tag="C5L36_0B03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464765.1"
                     /db_xref="GeneID:40382912"
     CDS             819017..820165
                     /locus_tag="C5L36_0B03990"
                     /inference="similar to AA sequence:RefSeq:NP_014985.1"
                     /note="PKUD0B03990; similar to Saccharomyces cerevisiae
                     YOR340C (RPA43); ancestral locus Anc_7.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320624.1"
                     /db_xref="GeneID:40382912"
                     /translation="MSEISHKRRFSDTVQNETSSSKKQNTGIVSTVSIADEETGLAKC
                     FHRIRAKMYLSLAPCHLEHPILGLRQQHLDPLIMTYNSTVGGIIISYNNIKLSQDNYN
                     NNEKNDTFKYVAQVSYENPFSFLWVYVDFVVWKPQVGDNLEGYSIMQSQSHIGLLIHD
                     VFNASIKKFYIPQDWYFVANQADEPNADDNAADNDEPKSSFKKLGHWCDADGTPVGGK
                     IKFTVRAIHVSGKGLAVEGTLLTPEMEKDSLPVVMEEQIKSNIKKHVKFDGEEVDDTV
                     TTDSKATDVVVNDEIEEKEMKDAVSSIEPLQPEDEIAPVYNDDNSDSGSNSSSSDESD
                     SDSGKDAGKNNANSSSSDSDGESGSDDDSSSGSDDKANDSSEEGDSSD"
     gene            <820435..>821352
                     /locus_tag="C5L36_0B04000"
                     /db_xref="GeneID:40382913"
     mRNA            <820435..>821352
                     /locus_tag="C5L36_0B04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464766.1"
                     /db_xref="GeneID:40382913"
     CDS             820435..821352
                     /locus_tag="C5L36_0B04000"
                     /inference="similar to AA sequence:RefSeq:NP_009367.1"
                     /note="PKUD0B04000; similar to Saccharomyces cerevisiae
                     YAL034W-A (MTW1); ancestral locus Anc_7.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320625.1"
                     /db_xref="GeneID:40382913"
                     /translation="MSNDAAIELKSMRLLTEHFGYPPIEVIDDIINAINDIMYRCTEQ
                     LEQILLTQKEQLDEEKRVRTREIRKKREEEDIIIDEGRLDDGSATEAFTIKDIQMGTA
                     TLESYFEHHINRNFDKFELYAFRNVFNLPYDLVKGGYIRMKHHESIKLDDVEDINETD
                     NQLTQEIFEKIQDIRFEMKLNKVLNESLEKCTKLSKVAKVIKLKLEPFLSERNKQVMA
                     KLSPLNDTLLYLIKQARTVMAKIDEIKDSITDERIMCKLREKSEEDEQLNHRIDMMID
                     NMNRYSRTVDSKAQHSTGKVEQQLANFFT"
     gene            complement(<821534..>821704)
                     /locus_tag="C5L36_0B04010"
                     /db_xref="GeneID:40382914"
     mRNA            complement(<821534..>821704)
                     /locus_tag="C5L36_0B04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464767.1"
                     /db_xref="GeneID:40382914"
     CDS             complement(821534..821704)
                     /locus_tag="C5L36_0B04010"
                     /inference="similar to AA sequence:RefSeq:NP_015459.1"
                     /note="PKUD0B04010; similar to Saccharomyces cerevisiae
                     YPR133W-A (TOM5); ancestral locus Anc_3.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320626.1"
                     /db_xref="GeneID:40382914"
                     /translation="MNGYSEEDIKNAMLYQEQMKKAQEEQTNLTLKLAGLLAIGLWAI
                     PTAIHFARKSLA"
     gene            <821933..>823210
                     /locus_tag="C5L36_0B04020"
                     /db_xref="GeneID:40382915"
     mRNA            <821933..>823210
                     /locus_tag="C5L36_0B04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464768.1"
                     /db_xref="GeneID:40382915"
     CDS             821933..823210
                     /locus_tag="C5L36_0B04020"
                     /inference="similar to AA sequence:RefSeq:NP_015458.1"
                     /note="PKUD0B04020; similar to Saccharomyces cerevisiae
                     YPR133C (SPN1); ancestral locus Anc_3.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320627.1"
                     /db_xref="GeneID:40382915"
                     /translation="MSEHSKETELSREIPVEKQETSSNVIDNVTSQSEENKDEIEAQE
                     VERETEEEQQERSGASNENITPSAPAIADLEEDIQKLNKFKKLQETKQTNEPTTATRT
                     KESIKDVRDDDTKDRFEEGDDVLEEDIEDEQTRKRREFEEKFNALIKKPTKRRKNNDV
                     DLEAMQDEAISQLKNMMKEAAYMDVDCVNNKKPATNKLKLLPQVKETLIRSNLYDSIL
                     DNNMLEAVRIWLEPLPDGSLPSFEIQKALLNELTKLPIKTIHLRESGLGKVMIFYQKS
                     KKVDSGLKRIAEKLIGDWTRPVMGRSDNYRARDIPTANFDIIQFQQRTKLQQKADDSK
                     NTRKSLYQESADRRKRAAAPEARTTVYTIAPQSNLTAIQASNHSVLNMGAASSLHRDE
                     RFKGLNRKLTKLSQKKKGTKKDGVSIEGRGLNY"
     gene            complement(<823573..>824010)
                     /locus_tag="C5L36_0B04030"
                     /db_xref="GeneID:40382916"
     mRNA            complement(<823573..>824010)
                     /locus_tag="C5L36_0B04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464769.1"
                     /db_xref="GeneID:40382916"
     CDS             complement(823573..824010)
                     /locus_tag="C5L36_0B04030"
                     /inference="similar to AA sequence:RefSeq:NP_011633.3"
                     /note="PKUD0B04030; similar to Saccharomyces cerevisiae
                     YGR118W (RPS23A) and YPR132W (RPS23B); ancestral locus
                     Anc_3.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320628.1"
                     /db_xref="GeneID:40382916"
                     /translation="MGKGKPRGLNSARKLRVHRRDNKWADQSYKARLLGTAFKFSPFG
                     GSSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKRVTAFVPNDGCLNYVDENDEV
                     LLAGFGRRGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            <824508..>826031
                     /locus_tag="C5L36_0B04040"
                     /db_xref="GeneID:40382917"
     mRNA            <824508..>826031
                     /locus_tag="C5L36_0B04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464770.1"
                     /db_xref="GeneID:40382917"
     CDS             824508..826031
                     /locus_tag="C5L36_0B04040"
                     /inference="similar to AA sequence:RefSeq:NP_011632.3"
                     /note="PKUD0B04040; similar to Saccharomyces cerevisiae
                     YGR117C; ancestral locus Anc_3.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320629.1"
                     /db_xref="GeneID:40382917"
                     /translation="MGLEKMDDSMYIESLVAQFLHSKGYYKTLSALEEETQTKFTPTT
                     LNNDESLQSIVEDRINFKTLQSHTENAHHLENGDVNTLDSLSQSDIVRRRNIILPNWE
                     VKYPDSVEVLNLGTLNSLIIDSSYFSSFIGGKIYNLGLFVTNTKYLLVYDIDANQLLL
                     SVHDPLNGQPIKLVYGIPYSNHLFLCDMNGNLRTMSLKRDGLQYDMELVTNSNDSVKL
                     HRRLITDFTFKSVKLESDSTLLGYFSSIGWDGRVTLGLVREANNELIIKQIGEYKLFT
                     NPTCILLTIDKETNLPLLLVGRLESSLLTIFSINKHPLGAEEVKLVELGKLSLNDSEF
                     SSHSFQAMSIGEISYNNKDLIITVATDHIPYMRLITVLVPSIEEILSYSKNIDPNYSV
                     FEKLDKLVVKDNNQQFTSSSPILRSYIISNFNSLSPQDKYSNAIILSRPNCSGLWIPG
                     DDGKLRGFDLRTGNVIETLDSNDGRAKSAFIGQCGMESEVVVVCGAVDKKIVIWRCS"
     gene            complement(<826056..>826628)
                     /locus_tag="C5L36_0B04050"
                     /db_xref="GeneID:40382918"
     mRNA            complement(<826056..>826628)
                     /locus_tag="C5L36_0B04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464771.1"
                     /db_xref="GeneID:40382918"
     CDS             complement(826056..826628)
                     /locus_tag="C5L36_0B04050"
                     /inference="similar to AA sequence:RefSeq:NP_015456.2"
                     /note="PKUD0B04050; similar to Saccharomyces cerevisiae
                     YPR131C (NAT3); ancestral locus Anc_3.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320630.1"
                     /db_xref="GeneID:40382918"
                     /translation="MTSIKPFQATDLFELTPINLDPLTENFYLYFYHQYLYTWPTLSY
                     KSVDDDNQPTGYMLAKTEGKNKEWHAHISAVTVDPNYRRVGLGSYLCDQLRIVVEPER
                     PIHAWFIDLFVKCSNKTAITLYEKLGYSVYRRVVGYYETGDMSNINKKKTNDEIDAFD
                     MRLSLARDVNNESIRENGRKFHVLPEEVVF"
     gene            complement(<826775..>827956)
                     /locus_tag="C5L36_0B04060"
                     /db_xref="GeneID:40382919"
     mRNA            complement(<826775..>827956)
                     /locus_tag="C5L36_0B04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464772.1"
                     /db_xref="GeneID:40382919"
     CDS             complement(826775..827956)
                     /locus_tag="C5L36_0B04060"
                     /inference="similar to AA sequence:RefSeq:NP_012670.3"
                     /note="PKUD0B04060; similar to Saccharomyces cerevisiae
                     YJR136C (TTI2); ancestral locus Anc_4.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320631.1"
                     /db_xref="GeneID:40382919"
                     /translation="MDEVLRRDWKWWKDDASLEDWKKQELVVSKCEDLLAECSKHEEP
                     RGMIKTASKFYFSDESLAPWASSKSRDIARDFIDKYEGDVLLHDTIVSELHTVLTEMK
                     KRNLSTSTTPSGYRKTSQIKINEKLIGASYTQTLDKMSEFKEMYVASIGYLNVLIHHF
                     NIKDNWRIILPLLLTFLDDTDLLVKREACLTLNLLCRRLSEEQSETNIIFQSQTLPLF
                     RRALQPLILAIPSMTSESKSVVILPIAYDTVLRLYKLAIPNELEYYTTLSSMLNDSIL
                     PSLGKCKDYVRLSTALCLVLEKFLDYCGEYAIVVAKPTVYTILTILMDPYVAHAPPIV
                     ELFIDLVQRCIGQVPSQRRTKYLYDIKGCMGTLRRRMSDDLMSDFIGEKMETLIDSVN
                     K"
     gene            <828444..>831671
                     /locus_tag="C5L36_0B04070"
                     /db_xref="GeneID:40382920"
     mRNA            <828444..>831671
                     /locus_tag="C5L36_0B04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464773.1"
                     /db_xref="GeneID:40382920"
     CDS             828444..831671
                     /locus_tag="C5L36_0B04070"
                     /note="PKUD0B04070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320632.1"
                     /db_xref="GeneID:40382920"
                     /translation="MKRVRSQCFDEEASVGSKFAKLKNTVVGAFKRQLSGVLRKHRLN
                     TQKNGDIYIDENGASTPMTRSRNSSFQRSTNSPITARQLQEYYNSLRLQNEQLFENLN
                     SNDQDHKTNGNSDSNNNLKSTELNRVGSEKTKENTAPLNDKNEIVLIDETASIISKGQ
                     TNSDSDDASQFGIPPIYLHPDPLERANLVQLKKLMELEKYRRYRLNYLREHSRHLKHG
                     DVKKASKMMKKGSSKFAKKLDLKSIPETRRNKSGTFGISLLDTVPDDEPETVKPIDTN
                     TVSKLKFNDTKNESANFDVPSKLRSFNPTSEATTEMPEDNTTKPVGGEEPTKNAFKSN
                     NVGDKSFEDQPSGAFTFKPLASQEKSGINQEAESLSFAKPSTAVTNEMTKSKPLSFGG
                     LGGVHSPVAVIEADTEPKAKSSLMEKDAGIDSTNPKEIKPFLSAQEHPFVKDLKNGSA
                     SIDNKPSLFGSKDENKPTAFSFNPPPSNALSSDIERKDEKPSFSFNASTKKSGLEEKP
                     SLFTPSSANDSTKTKVSSTPAFTFGSSSKVQDIKEPSSTSGFSFGQAVSVPKLNFGLQ
                     ASAEKKQPPNLSVALTSGSKLNFGAKPQPLTTEKEEISRGSLPLTNSSENDKKGDSKT
                     TFSFGTTSAINPEVPASKPQFNFSPGTSSDSTAPKLAFGAGSTSINTPKDAETKPATT
                     FNFGVASTSINTPKDAETKPATTFNFGSAQKPSPELNGDNPQSKGDRPAASSIPFKPK
                     LTSGTLFDANPESKPNSTFSFGENKNSSEFSVSDGKRKQLAPADPKSSFNFTSSTFST
                     NTTQPNSAVAVGDKPSASAASGFSFSSNANTSNAPITFGGPNASKTFDTKTPGGFGSW
                     GLNKNTSTPNGNPGFSFGTPGSNNNQSNNLAQNSTNSNQTPGKLFSFNSSKFPSINEL
                     SKPTGFATSQPAQSASLQNNSNGFNFAGNTNTTNNMLGAGVGGNGFGMNINNGLNSSS
                     TAFGTVMNPNNSVTGGFGMNNSNSNNNGGFGGVSNNSQNGFNFGGNSGPGSAATSRST
                     TPNINFAGPTSNMNPAAIFNNTNLTPDQQQQISNRRKIYPRSRRR"
     gene            <831977..>832684
                     /locus_tag="C5L36_0B04080"
                     /db_xref="GeneID:40382921"
     mRNA            join(<831977..831998,832089..>832684)
                     /locus_tag="C5L36_0B04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464774.1"
                     /db_xref="GeneID:40382921"
     CDS             join(831977..831998,832089..832684)
                     /locus_tag="C5L36_0B04080"
                     /inference="similar to AA sequence:RefSeq:NP_012805.1"
                     /note="PKUD0B04080; similar to Saccharomyces cerevisiae
                     YKL117W (SBA1); ancestral locus Anc_2.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320633.1"
                     /db_xref="GeneID:40382921"
                     /translation="MAPIAPEVLWAQRSSTSDPLHNIIYLTINLKDPEQSSVELDIKD
                     TSLDLNAKSTTSDEEYSLHIDFYKEIDSSSVREVITGSHIFLVLVKKELQEEYWPRLT
                     KEKLKYNNIRTDFDKWVDEDEQDGADDEKLDPMAGLGGMDDLSAFSENNMDFSELAKQ
                     FGGKGGLSAGDAGSDKFGDLANAEFSSSGDEDEDNDKESSHGHEE"
     gene            complement(<832864..>834762)
                     /locus_tag="C5L36_0B04090"
                     /db_xref="GeneID:40382922"
     mRNA            complement(<832864..>834762)
                     /locus_tag="C5L36_0B04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464775.1"
                     /db_xref="GeneID:40382922"
     CDS             complement(832864..834762)
                     /locus_tag="C5L36_0B04090"
                     /note="PKUD0B04090; Pfam Domains:
                     Cu-oxidase_3(3.3e-59)|Cu-oxidase_2(5.5e-48)|Cu-oxidase(4.
                     9e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320634.1"
                     /db_xref="GeneID:40382922"
                     /translation="MLVLWYLYLCFATAFASEVHEFYFNVEYVNANPDGVFERQVISF
                     NGSWPLPTIEVSRGDRVKVHLTNSLEDTTTSLHFHGLKMKGKVHMDGPVGVTQCPISP
                     GETMLYDFVVEQAGTYWYHSHSGAQYSDGMRGLLIVHDKELESLYEFDKELSWSISDW
                     YHDSSSVLVKKQLTKYNPTGGEPVPQNILFNDSRNVTISIDYDTAYLIRIVNVGIMVS
                     QYFSIPGYEFDIIEVDGVYTHPKTATMAYLAVGQRMSIILKTKSREDVSSNILIFTAM
                     DEDMLDIVPDDLELNSYNYMSYDGALPEPKIPNWVTDRESFNPIDDMDLVPMKKKPLF
                     EDPDHRIEVVLHMENLGDGISYAFFNNVTYVAPKVPTLLTALSAPENLVKDSRIYGSN
                     TNSFILNHDEIVEIVVNNEDDGKHPMHLHGHQFQVVARSPELEEPSHYNPENQTFPPF
                     PMMRDTVMVEGGGFLVLRFKANNPGVWFFHCHLDFHLEQGLALTLVEAPDLINITLPD
                     DQLNICKTAGIPTKGNAAGNAEDFLNLEGENVQPKPLPDGFTAKGYFALFLCTAIALF
                     GLKSIYDFGMHDILQTESEKIQIEKKVIEKYIDLLEQMKSNDTDEPFEVDQLLQKAIN
                     LNERFSKF"
     gene            complement(<835102..>836949)
                     /locus_tag="C5L36_0B04100"
                     /db_xref="GeneID:40382923"
     mRNA            complement(<835102..>836949)
                     /locus_tag="C5L36_0B04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464776.1"
                     /db_xref="GeneID:40382923"
     CDS             complement(835102..836949)
                     /locus_tag="C5L36_0B04100"
                     /inference="similar to AA sequence:RefSeq:NP_014190.1"
                     /note="PKUD0B04100; similar to Saccharomyces cerevisiae
                     YNL209W (SSB2) and YDL229W (SSB1); ancestral locus
                     Anc_2.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320635.1"
                     /db_xref="GeneID:40382923"
                     /translation="MSEGTFAGAIGIDLGTTYSCVAVYDNTTGVEIIANEQGNRVTPS
                     FVAFTPEERLIGDAAKNQAALNPTNTVFDAKRLIGRAFSDESVQKDIKTWPFKVVDDN
                     GNPKIEVSYLGETKTFSPQEISSMVLTKMKEIAEAKLGQAVDKAVVTVPAYFNDAQRQ
                     ATKDAGSIAGLDVLRIINEPTAAAIAYGLGAGKSEHEKHILIFDLGGGTFDVSLLHIA
                     GGVFTVKATSGDTHLGGQDFDTNLLEHFKKEFQKKTGLDISGDARALRRLRTACERAK
                     RTLSSVAQTTVEVDSLFEGEDFSANITRARFEDLNSALFKSTLTPVEQVLKDAGLDKS
                     KVDEVVLVGGSTRIPKVQKMLSDFFDGKQLEKSINPDEAVAFGAAVQGAILTGQSTSD
                     ETKDLLLLDVIPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQ
                     GERVNCSENTLLGEFDLKGIPPMPAGEPVLEAIFEIDANGILKVTAVEKSTGKTANIT
                     ISNSIGRLSSDDIQKMIDDADKFKKADEEFSKKHEQKQKLEAYVTSIEGTVTDPVLSA
                     KIKKGSKAKIEAALSDALAALEIEDSSADDLRKAELALKRVVTKAMATR"
     gene            complement(<837473..>837940)
                     /locus_tag="C5L36_0B04110"
                     /db_xref="GeneID:40382924"
     mRNA            complement(<837473..>837940)
                     /locus_tag="C5L36_0B04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464777.1"
                     /db_xref="GeneID:40382924"
     CDS             complement(837473..837940)
                     /locus_tag="C5L36_0B04110"
                     /note="PKUD0B04110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320636.1"
                     /db_xref="GeneID:40382924"
                     /translation="MVQENVPPDIVESLCKHIFNAIGSLMFAVPRVTTYCFEGISTIT
                     MKVNYHHILPGKLIEIHHCLTSSCVQTYFPHFNNCINNRESLSPIMESWEILHKREPL
                     VVARDIATAPLDLSLNTPSGPKVTSQKLLIYLEAISFVIGTKERERERERERE"
     gene            <838534..>840309
                     /locus_tag="C5L36_0B04120"
                     /db_xref="GeneID:40382925"
     mRNA            <838534..>840309
                     /locus_tag="C5L36_0B04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464778.1"
                     /db_xref="GeneID:40382925"
     CDS             838534..840309
                     /locus_tag="C5L36_0B04120"
                     /inference="similar to AA sequence:RefSeq:NP_014304.1"
                     /note="PKUD0B04120; similar to Saccharomyces cerevisiae
                     YNL095C (YNL095C) and YOR092W (ECM3); ancestral locus
                     Anc_2.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320637.1"
                     /db_xref="GeneID:40382925"
                     /translation="MAGAPMGEIIYSAVKPVIRMYMIIGTGFFLTRKGLFGVTAARAC
                     SDMVLMLFMPALVFDKIVSYISISDIKTIGVICFCAFVMYSINAVVAFLIVRFTPVPK
                     SREERWVGGGLLAGIMQNVSDLPISYIQAVSIFSTKQQNKGTAYVIIWLAMYVVTQFN
                     CGLFQLVNWDFEYMGQTSGDAEKGDQLSHSCSETVQSDQPEKFREENDDDDVHDQNNL
                     TSSTKTSLNSSDNEDLQQPVNNNQASMERPMSEVSSLNISIDSETGIGQPTHGSTSAA
                     HRIQSHPSVRTRASSKQFSENYDPRPLTAVNSRISHLARTLSKGSAIARIPSARSINT
                     NGPNDSDHEDMLSLNQELIREYSRVQPYNQKMSKTMKVVTETNLTSQDVKESGEEIPF
                     IKKYHLHYVVFFLENFKKPMSVSLILAIIIALIPWTKALFVNDGKVTLKNAPDKQPAL
                     SFILMYAEYLGAPCVPLGLLLIGSVLARLDVSVLPKGFWKSAVSHTVFRLGVLPIIGM
                     AFITRLKTIGWLTDPMAIFVCVMEFALPSATVQIYLTAGAMRPEDKTSTPLNCFGLYL
                     ILQYAVLVISMPIVVCYCIKHPMGL"
     gene            <840906..>842699
                     /locus_tag="C5L36_0B04130"
                     /db_xref="GeneID:40382926"
     mRNA            <840906..>842699
                     /locus_tag="C5L36_0B04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464779.1"
                     /db_xref="GeneID:40382926"
     CDS             840906..842699
                     /locus_tag="C5L36_0B04130"
                     /inference="similar to AA sequence:RefSeq:NP_014305.1"
                     /note="PKUD0B04130; similar to Saccharomyces cerevisiae
                     YNL094W (APP1); ancestral locus Anc_2.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320638.1"
                     /db_xref="GeneID:40382926"
                     /translation="MSNFNRSTNDGSIPSFLMGKIMGAYKNTKESSYVKSLYHDTTQA
                     FKSTDYAEGIANEKPTRLPPDTQIFIYPTFAKHDNGKYVTRVKGVVSASGSNSRKSRF
                     LLSMARRLIRSSDPSDVETTISEFRNTISNPEIYRTSSNDKREYDQCSTVSSNSNDIV
                     KQRMQGILAKDIADTPLNITIGSAVPVDNIVGVNLTSDSFGMFQISITSPYKPEYIAV
                     SSVIDPSIIQTMTVEIVESKGFSVITDIDDTIRLTGILGDKREIFRNLFYKDFTSCEI
                     KGVSEWFNQLHDEYKCSVHYVSNSPWQVFNIVNSFLSFFEFPVTSVHLRQYSGNLIAS
                     FTQPSAERKRPSLVALLDEFPERKFILVGDTGEQDLEAYLSLLSNYSPQIVAIYMRVV
                     PKSLSSLGNDDIALKEFNEMLQVRKKTCLANKVDHLLRNPTGIDSNDEKSCFDGTHPI
                     HVSVPDRMVNRRRSSIDAAKTTIATAVKMTRVRKLPPIVPRKPDSLRGEKVIKTLLDD
                     DSVRVVKPSHEPVLNLSEGENRDHTTQLNNYDYENELIKGDIDDKRFILWKQRVQRVI
                     DEVPEHIHFEFWKDASTAHASSIHLLVKELE"
     gene            complement(<842909..>843970)
                     /locus_tag="C5L36_0B04140"
                     /db_xref="GeneID:40382927"
     mRNA            complement(<842909..>843970)
                     /locus_tag="C5L36_0B04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464780.1"
                     /db_xref="GeneID:40382927"
     CDS             complement(842909..843970)
                     /locus_tag="C5L36_0B04140"
                     /inference="similar to AA sequence:RefSeq:NP_014734.2"
                     /note="PKUD0B04140; similar to Saccharomyces cerevisiae
                     YOR091W (TMA46); ancestral locus Anc_2.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320639.1"
                     /db_xref="GeneID:40382927"
                     /translation="MPPKKNAKNQQKEAEKRAKAKSKAKNADDKTFGLKNKNKSKKVQ
                     EYVSQVKAGVPADIKKQQELAKRRAAEKKAAEEAKKEALKLLQGSIGTQKVPFGVDPK
                     SILCEFFKLGTCTRGKNCKFSHDMNIARKAAKKDLYTDDKDDKADKEADTMDNWDEEK
                     LRKVILSKHGNPKTTTDKVCKYFIQAVEDQKYGWLWVCPNTDPKNKVECKYRHSLPPG
                     FVLKTKEQRRLEKMALENQPKITLEDFIETERDRLPKDKLTPINPETFAKWKKEHKQQ
                     RFNMNNKDKKQLTGREIVLKRFEDKFLREEELSADHGTEIDMSQFKNALDEIEDENEP
                     KVKDYGDGSNAFAEANKVE"
     gene            <844245..>845981
                     /locus_tag="C5L36_0B04150"
                     /db_xref="GeneID:40382928"
     mRNA            <844245..>845981
                     /locus_tag="C5L36_0B04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464781.1"
                     /db_xref="GeneID:40382928"
     CDS             844245..845981
                     /locus_tag="C5L36_0B04150"
                     /inference="similar to AA sequence:RefSeq:NP_014733.1"
                     /note="PKUD0B04150; similar to Saccharomyces cerevisiae
                     YOR090C (PTC5); ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320640.1"
                     /db_xref="GeneID:40382928"
                     /translation="MLATVTKKQLAVKQLKASASLVSGNSFRFLHSQHLRPKLLDLKM
                     RRRYYVPLVSAIVAGISYYALGNNGILLDTAGSSNITSIPSAPTTSAIGGGNGSQRPL
                     STTTTSSLSNGGAGSQQNKQGLTLFNDEQVNRILRRFEESYIVNRGKGVYRYDASQLP
                     SNNPIEDDRAEKIVQIPIQDVYNDNQRVETDWHFWSIFDGHAGWNTSAYLRDKLLDTV
                     IAELTGVYKISDKNLRLVPSNEVIDKAIKQAFLKLDDEIVNKNVQKLLDSPNKNSAAE
                     LLMPALSGSCALMTFYDTHSQMLKVAVTGDSRALLGSYNEENKKWTVEALSVDQTGSN
                     PTEVAKLLSEHPNEPNVVRNGRVLGSLEPSRAFGDARYKWAKDIQAKIYNQFFGRQSP
                     ANLKTPPYVTAEPIITTHEINPSKNDFMVMASDGLYEMLSNEEIVGLVVKWMENKKMV
                     KPTRNFFSNVWQRSSKNQLPEVLDVSDKSGKPKQRYRRSDNMTAYLLEDENVSTHLIR
                     NALSNGGNKEDVNLLVSIPNPLSRRYRDDLTVTVVFFDNSENRVENANGMLEINREAT
                     RGGLDNPVSPKL"
     gene            complement(<846221..>846874)
                     /locus_tag="C5L36_0B04160"
                     /db_xref="GeneID:40382929"
     mRNA            complement(<846221..>846874)
                     /locus_tag="C5L36_0B04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464782.1"
                     /db_xref="GeneID:40382929"
     CDS             complement(846221..846874)
                     /locus_tag="C5L36_0B04160"
                     /inference="similar to AA sequence:RefSeq:NP_014306.3"
                     /note="PKUD0B04160; similar to Saccharomyces cerevisiae
                     YNL093W (YPT53) and YOR089C (VPS21); ancestral locus
                     Anc_2.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320641.1"
                     /db_xref="GeneID:40382929"
                     /translation="MSGSTQTAVKLVLLGEAAVGKSSLVLRFVSDDFRENKEPTIGAA
                     FLTQRCTIDDRTIKFEIWDTAGQERFANLAHLYYRNAQAALVVYDITKPASFIKARHW
                     MKELKEQSTKDITVALVGNKFDLIMDEGTGEEIEGARKVSIEEGQTLAEDEGAIFFET
                     SAKTSYNVNEVFMYIAKKILEKIDSAPPQEQTPAASQNNRIDLNAPSSNDNGSTCAC"
     gene            <847314..>850853
                     /locus_tag="C5L36_0B04170"
                     /db_xref="GeneID:40382930"
     mRNA            <847314..>850853
                     /locus_tag="C5L36_0B04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464783.1"
                     /db_xref="GeneID:40382930"
     CDS             847314..850853
                     /locus_tag="C5L36_0B04170"
                     /inference="similar to AA sequence:RefSeq:NP_015447.1"
                     /note="PKUD0B04170; similar to Saccharomyces cerevisiae
                     YPR122W (AXL1); ancestral locus Anc_3.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320642.1"
                     /db_xref="GeneID:40382930"
                     /translation="MTFQNQPLIFQQNFAVPFSSEQRSYLIIRLPNGIQGLLITDPCE
                     DVASCCLTVATGHHANPKNICGLAHLCEHMISLSSKEYPEIDAYRNLVYQVGGTRNAV
                     TNNETTSFFFSVPITSSPKVSEFEKVLSIFTSNFRNPNFEITYSNREIYAIDNEHAVN
                     KTRSNRLLFQGFKLLANNEHPFSMFSTGNLDSLIERNKKVDIRERLLDFFKAEYTPDK
                     MSFVLRGPQSLNYLQRLATLNFSKIGILNNRESFTETTMKPKVVPGNAVSNKVKSSWK
                     EKYNVLPYLPADLQKGVLIKKDIGAVLRIAFPVTFDKTKFMSKKRFNFYINFWCELFG
                     SESQKTIASALFGRELVSAIVSKTSSVTYDTTLLELELSITDKGYQYISTILDVIFNF
                     ASLFNASESSKFIKHLAKSMSQFNGIGIYNFLFSEASSESIWEVQKLSRILLEGIQSY
                     GRFLLKGQNLMDETVEGFKGAYTENKAAKNWWLDEAKRFSHFIKNNISINRTLLSFVG
                     DIDKTELDWAVNIPAEYTSEPNFEFNYKVVRLNSQVIDISKINDYGLDISPPNIFADE
                     MVDDQTALLGLCDLTTEHALDASLGYSVKNTLSSSIPILYHCDFGCQLWLKKEVDVAF
                     KNKALLTLELINTKIGASPTHVAVLEILVQLVKFRVNEYLYPATVLNYVYDLFPSFKG
                     DTGVLLHVSGPKENFAKVLKVLVYEVKLISESFGTTVTDSEFTKAKAAVLLKYSLSEK
                     MSTFESATLGLMATIEENTWLLQLRIEACQNLTKKGIASVTSKIFESCYLTAFLQGDI
                     EIQTLSADILPIISKLVKNFEGENYRFPSSVFLPPRSNYYVNYTSNDATNGIECFFQT
                     CRRDDIKETSITKFVSYLLGTDLTRKLRTDYQLGYIVLVGLRTLRKTQGIHILIISST
                     YSSDELDSKLEDILAEWYEQSIKKLKNAQLSQYIDKFVTAESATGSSTNSNSGCPSLF
                     FGALGSSGGDKKITKQHNSYWEQIDNKTYSFSKTLNGEDGVDLDVVKNITTESLTQFI
                     KQKLLPISAERSKITIRIDSKLPKEEFEKNSKGMQLYFLLSSMGFPIKQEHLEDILEK
                     SNNSQIKLCKSLYRYYRENGKSISQVASVIAKLSKSVLLSGKTEAANNTAVIVPPKQV
                     DIENLSAWKKQTGYVQEQIQMKDRLNSFRDCVT"
     gene            complement(<850858..>852075)
                     /locus_tag="C5L36_0B04180"
                     /db_xref="GeneID:40382931"
     mRNA            complement(<850858..>852075)
                     /locus_tag="C5L36_0B04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464784.1"
                     /db_xref="GeneID:40382931"
     CDS             complement(850858..852075)
                     /locus_tag="C5L36_0B04180"
                     /inference="similar to AA sequence:RefSeq:NP_014307.1"
                     /note="PKUD0B04180; similar to Saccharomyces cerevisiae
                     YNL092W; ancestral locus Anc_2.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320643.1"
                     /db_xref="GeneID:40382931"
                     /translation="MVEMKEQDAEEFKVLSSVLHSHLAYEEWAVKTILSPKERKYSSL
                     EDGEKQLLHWFPSYIEQLKHSIEINKNYFESVAIIMADSWGAENPKTWFPCSTSDLEK
                     MKGLMTQYVREWSSEGADEREVSFGRILETVEKLYPDISQRQKIEVLVPGAGLARLVV
                     EFVKRGFTTQGNEISYHMLINSNYILNNTFCENNFMICPFIHKSSNVEKRNYQCRQIY
                     FPDFNPGDISLLNVEYPDIPVGELMSMVAGGFVDLYGPPDLNKISEIYSNEEMAVQFR
                     NENKGKFNVIATCYFLDTAANIIDYLKAIKYSLNDDGYWINFGPLLWHFEGNDLEIDV
                     DSLNDDGTTKKKIPMSGLEIPKDDLIQLIEDLGFDFIEHQTGIKASYGGDIRSLGHWH
                     YNCEFWVCRKTKK"
     gene            complement(<852275..>854236)
                     /locus_tag="C5L36_0B04190"
                     /db_xref="GeneID:40382932"
     mRNA            complement(<852275..>854236)
                     /locus_tag="C5L36_0B04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464785.1"
                     /db_xref="GeneID:40382932"
     CDS             complement(852275..854236)
                     /locus_tag="C5L36_0B04190"
                     /inference="similar to AA sequence:RefSeq:NP_014730.2"
                     /note="PKUD0B04190; similar to Saccharomyces cerevisiae
                     YOR087W (YVC1); ancestral locus Anc_2.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320644.1"
                     /db_xref="GeneID:40382932"
                     /translation="MLLLPTTNDEDCNEHRPVSPRQALRVALNLKKLVDTITPQAVAA
                     DKIKSFDLDIKKEETIQAVYDAAGGDINDNGYESKRRYQACLVFCLLKVSGWFDSLAE
                     SRLERSDLYTSRSLVAQTIACILIDREKEDKYLFLSMLCHRYSINLNNEDSDPENALE
                     LAVDTRSPIVATSGYQRCIKWLWNGWIVQSRHDPSEYVLYKGIANTSFWAHFKPDRIQ
                     TPLYQNALEIFVAIVFLIIYTIVTNRDAAANKLNIPEILLFFFTFGFLADEIQKLYHI
                     GSAYLQLGSTFNDILYTIIFISFGFRFAAVTTTVPGHDQLYDTTSHRFLAVAAPFMWI
                     RMLFFCDIYHFFGVMIVVVNTMMKESIIFFFMLSVVIIGFLQAFIGLDQADGKRDLTY
                     FIITNMLNTVLSGPDFSAIERFAYPYGSVLYYIYNFLVTVILLNILIALFSSAYSDVI
                     SNANNEYLFQYSSRVLKYIRAPDAKIFLPPFNLIEIFLLDIPFAWWMNERQFNSMCNN
                     ILFLIYSPVLLITSNYEVRESKRVSYNRSFNHADDANEEDQEWLLTDGYDETIDDADN
                     RHQIERNIDLQMEAENAEPGFVKGFPDWNRKLKTLAPPMKEAGDQGVSPEAFKILSYI
                     DVLSQKVDTLIENNKSLQRELDSHKSKAK"
     gene            <854504..>855832
                     /locus_tag="C5L36_0B04200"
                     /db_xref="GeneID:40382933"
     mRNA            <854504..>855832
                     /locus_tag="C5L36_0B04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464786.1"
                     /db_xref="GeneID:40382933"
     CDS             854504..855832
                     /locus_tag="C5L36_0B04200"
                     /inference="similar to AA sequence:RefSeq:NP_014193.1"
                     /note="PKUD0B04200; similar to Saccharomyces cerevisiae
                     YNL206C (RTT106); ancestral locus Anc_2.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320645.1"
                     /db_xref="GeneID:40382933"
                     /translation="MSHLEDLPQELKSRVEEIIAKYPPSEEVFVSLMNFLIQQKSNDD
                     PKRKKTQESLAKSTRALTPSNSLESLQGTNIMLQLPDLSIQSPFRRRLNLVFGAVKGE
                     KKAYLALSKSLESKPELILRDITPGNAKFACILNVPEKKALRYLLVCYNQNEGNVYKN
                     EPLLIQFNHDILQEQFGSLLGGKTFSQYLTSQLALVDFKVIDCALDDTFSVPAYKKTK
                     EGYLFFLPEYIIFGFKKPIDVFKSSDIVSITYDCITRMTFNVHLEVKVGSETQKHEYS
                     MIDQKEFENIDKYVKLKEVKDNSMSDEHKAQSHLKNNSGAPGDLAEAAKLVPGGEQLI
                     PNGNTANNDVDDEDDDDDDNYQVGDSDDNHSDVSAAADYEDEEVEREEEDGTYNEYVN
                     ENAPSSTFTPGTLGSLEQFGGFDENLQQELQDLQKDLDLDINELQKAGYI"
     gene            complement(<856188..>856531)
                     /locus_tag="C5L36_0B04205"
                     /db_xref="GeneID:40382934"
     mRNA            complement(join(<856188..856378,856507..>856531))
                     /locus_tag="C5L36_0B04205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464787.1"
                     /db_xref="GeneID:40382934"
     CDS             complement(join(856188..856378,856507..856531))
                     /locus_tag="C5L36_0B04205"
                     /note="PKUD0B04205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320646.1"
                     /db_xref="GeneID:40382934"
                     /translation="MLLAWTAFGVGVRALQMGIRQAPLLHAPMGFVYSAAFTTGVGYF
                     FDQWVENNNELLELRLAKLKKIREESA"
     gene            complement(<858114..>859625)
                     /locus_tag="C5L36_0B04210"
                     /db_xref="GeneID:40382935"
     mRNA            complement(<858114..>859625)
                     /locus_tag="C5L36_0B04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464788.1"
                     /db_xref="GeneID:40382935"
     CDS             complement(858114..859625)
                     /locus_tag="C5L36_0B04210"
                     /inference="similar to AA sequence:RefSeq:NP_013736.1"
                     /note="PKUD0B04210; similar to Saccharomyces cerevisiae
                     YMR023C (MSS1); ancestral locus Anc_2.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320647.1"
                     /db_xref="GeneID:40382935"
                     /translation="MFSSKLMRRFSTKNISKQQQYLSPTIYALSTAPARAAIGVIRIS
                     GPSCGKIFTQLTGSTKLPKHRLATVRKIYDDTISSVGKDQTGRLLLDEPLILYFQSPR
                     SYTGEDLLELHLHGGTAVINKVMETISKFHMANAPVRLAEPGEFSKRAFQNQRFDLTE
                     VEGINTLIHAETEMQRISALSSVKGETNVLFNEWRDRILKNIALLTTVIDFGEDHDIE
                     EINELFQSVGNDVSKLDDEIRKYVSKIKRSQVLLEGIKLTLIGPPNAGKSSLLNILAQ
                     EDKAIVSSIAGTTRDAMEVPLDISGYKVIVGDTAGIRRSSDVIENEGIRRAKKKSLTS
                     DINIVLLPADDDKIDPSFLSHASNVISDKKMLSYVIVNKVDLIDDATKQTLPERLSQK
                     LKIPRDRIKLISCTTQCGIEELIQDLTNRFKEITSTEIADPVTISKRAREILINDILY
                     GFSEFRKFKDADDIVMASEALRCSVDGIGKITGEAIGVEEILGVVFSKFCIGK"
     gene            complement(<860188..>860790)
                     /locus_tag="C5L36_0B04220"
                     /db_xref="GeneID:40382936"
     mRNA            complement(<860188..>860790)
                     /locus_tag="C5L36_0B04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464789.1"
                     /db_xref="GeneID:40382936"
     CDS             complement(860188..860790)
                     /locus_tag="C5L36_0B04220"
                     /inference="similar to AA sequence:RefSeq:NP_014309.3"
                     /note="PKUD0B04220; similar to Saccharomyces cerevisiae
                     YNL090W (RHO2); ancestral locus Anc_2.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320648.1"
                     /db_xref="GeneID:40382936"
                     /translation="MSSDSNNSVIKRKIVIVGDGACGKTSLLYVFTLGEFPTEYHPTV
                     FENYATDCRVDGKPVRLTLWDTAGQEEYERLRPLSYSKAHIILIGFSLNAPDSLENAA
                     VKWAQEVKQYCPNAPIILVGLKKDLRPVDDGTDPDYSSKYVKYQDAERVAHYIGAKKY
                     IECSSLTGEAVDDVFEVATRASLIARPVTREAKAGCCTIC"
     gene            complement(<861288..>864908)
                     /locus_tag="C5L36_0B04230"
                     /db_xref="GeneID:40382937"
     mRNA            complement(<861288..>864908)
                     /locus_tag="C5L36_0B04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464790.1"
                     /db_xref="GeneID:40382937"
     CDS             complement(861288..864908)
                     /locus_tag="C5L36_0B04230"
                     /inference="similar to AA sequence:RefSeq:NP_014308.1"
                     /note="PKUD0B04230; similar to Saccharomyces cerevisiae
                     YNL091W (NST1); ancestral locus Anc_2.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320649.1"
                     /db_xref="GeneID:40382937"
                     /translation="MYSQLFVFSLKKNITKCRYSNKKQQMSKNFTLGKDIHFEYARPQ
                     CAKRDSSRISHGDLSFEVEIDDFQGDYPLSRVIKQDQDGNVIVQEVQDESEFRVIFDS
                     DGNKRIIHPQYPPCSPNLHEQILEHQLGEEELNSHAFDRDTEQVHLPCSDCENEYCTH
                     TGLETNHQIKELCQRKRKTEYHDGNPCKSECWDHSSKELEGGNADLRYDNLIKQGEEP
                     EEEHAVEEDEEVYDESEEEYEAHNCSCHRHRNALNKKSRHIPSMLEKQKSIIFEQIQI
                     PVMGNFLWDFEHQNDIPDMVKFWISLSYERKREIADIDFLEILNLVQVDQKTNCLCQL
                     CGNRKIVIQNELLKLYNGYYNIRRLVASSLDEVDLNINTINAMLGIVEEELTMQPEEN
                     YDLEHKNPTSKETNYSFNGLLSVADDLVKNNGENFINLIEKLENRGDSSSVTLKDKVD
                     EESTFKESDIERPREEEFQEGEDYEEDYEEDYEEDNDEEEDYEDEYESDNVSINSDDD
                     FSSKRRLEETYRMLLIYSSKILRMRLYSAFQAKRAEDISKSLLEEEAREAKLREEREE
                     KEKAKKERAKEKKRLQKMAKEEERMRLQKEKEEKERLLREEQQRKMEEGRKRKEAERK
                     KRELELQKKQEERRKNKEAELERQKREKQEKEKKKLEAKRLREEELKLKSQEKEKREK
                     ERSTARQKDNEKKTLAQEAQNKKGGQDQDYENPDFELKHQNNPMEFKGVPSRASNYQI
                     SFQPSYSLKSVAESPISMKNVSFANQYDSNLIEIINPATKSMAMGSGSDVFQSMHNPV
                     TDLSDKLNTTEKNIENAGNISSNLNSFNSMLFDHSALRDMHGFSDSLWNGSDCIPNSS
                     TTLNPNLNGLNNVPRSGSIWSDDLNNRSGSNFRWNSEIADTTNVETQLRPISEIVQSE
                     VIKASITLPPISPNIYSVPLFYHYIRSLPNSSIPNFTMEEFMKILLVNNEETLFYQFE
                     LFKDMNGVDLVKIVNRSLTEPQPTMNTSLLNHIHGVPTTSMGLDSSSMQMSIQNLSVN
                     NPPSANTMNIGGTAINMNTMDMNNMKLNDGMMINGMGMGGINNSNMMNLHTLKNINDM
                     VNINSMNNMNNMNNMTNMSHMNVEGVKMNGINTSVLNDVNMLSGVSNVEGMSDPNYGF
                     SGNNTNVNTDMNVMMNSMNMNMSTMNLQGFDRPSTGSQHHGDAFAKEGVPTVPSPWRR
                     FN"
     gene            <866885..>870403
                     /locus_tag="C5L36_0B04240"
                     /db_xref="GeneID:40382938"
     mRNA            <866885..>870403
                     /locus_tag="C5L36_0B04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464791.1"
                     /db_xref="GeneID:40382938"
     CDS             866885..870403
                     /locus_tag="C5L36_0B04240"
                     /inference="similar to AA sequence:RefSeq:NP_010695.1"
                     /note="PKUD0B04240; similar to Saccharomyces cerevisiae
                     YDR407C (TRS120); ancestral locus Anc_5.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320650.1"
                     /db_xref="GeneID:40382938"
                     /translation="MEEITFLAPAMVRALLVPVAEFDQTKFRNVVEVLKRVKDVRALD
                     LVHSPGKFNPQAYPQGHVYYNFITRDDDADSLFLHDFEPFRKTAVVIGLLGWSKEVTE
                     EIIRLKKNQLQRKYPAPIANIIMIFGCPIAFESKISDVFCVDENLSNIETRICDATSR
                     FLCKFSVYASAYEHTTLRSPGNLTGVVLKQRKRLSSSFEMNPERSKQMVTRGRRLKLN
                     ANFYLMAGNLKASLNDFSEAIFNLKAANDYLWLASALDGLAVCIFLLSSLGVPYRLPQ
                     FLNSLINSGKNVKSMLRSPSTTPRPSFQLSDISTSFSSFNESDGELNVMPFDVVEETI
                     INCGHLSSYYYEYAKTEQTENVPAIVSSESLIRYALLMVLVDLNGKYDMSLVNEIVQG
                     KSLHEGRYISENFNMEFFNFICFHVLNTDFEKLPVNSQLRIYQTLAFLFSKAKMKMKK
                     ALMVYNFLDLINASEQQLFSSISGYERLDLMLRDFCETYDIFIDRPEDIIRPNYIQKD
                     LLLHILKLCERVGYRGGYVIYGLFILTNFKQILGSSQQVEIYDKIKRFSSFVKVGARC
                     WNDDFLVGIDFEAVSGKLVEGEESTVKIHIRNPYAFELDIKELSLSTKDNFSFKLLSP
                     DKKSINDFKDSYKIVLKPYSEILVSLSIIPENNGTFAVDGIIASIGICDKRKYSVRVE
                     DMSAFPPKLKKSVHCCETETKFREWRIQVVHKQPLLKIVEVKLRDKWLMLLDGERKQF
                     SVILKNTTTSDINHLVSMFRDSTTDILNAELNNKALRPNEIYEIEYQIYKKKPFKILN
                     KNDLVKIKGNQTFKLDLEIVGKLDVKEANLVLEYSYQKNTIAEYIRSLSIPVSLTVYP
                     SVELAGCDIIPLTSNTSIGDMESKTCWQFLKEVSEEHHNLADFCLIALDFVNMWSEEM
                     EIVIQYRMDGSSGAKEPRMFITSEQLQTRKNVRMFVPIKRMDLDEQLLEQKIPSLRNK
                     QFVVDKKTPLAEQHFIKHSFWYKEEILKHLSAIWKVSSSVSSSMYLGRSGEINMRGFR
                     FSSRMIENIRVEKVKLKLKLLNDQDIVQDLNNVYLNQFYTVRIEITNRNKYPIFGMLR
                     HIPVCKDPPYTYEKKVLINGVLQFSIGKPLDSNETMIFELGIVFIEKGDYEWGALFDE
                     MPDWKDGNLTIKKQHLQREQLKFKVQ"
     gene            <870713..>873685
                     /locus_tag="C5L36_0B04250"
                     /db_xref="GeneID:40382939"
     mRNA            <870713..>873685
                     /locus_tag="C5L36_0B04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464792.1"
                     /db_xref="GeneID:40382939"
     CDS             870713..873685
                     /locus_tag="C5L36_0B04250"
                     /inference="similar to AA sequence:RefSeq:NP_009446.2"
                     /note="PKUD0B04250; similar to Saccharomyces cerevisiae
                     YBL104C (SEA4); ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320651.1"
                     /db_xref="GeneID:40382939"
                     /translation="MSGSVIRASGWAVDNEDQYLAVSPSGEAVYLYQTSNKFNKEEDN
                     IVKLHEKADFENIQCINYSGLTPGLTAVGQLDGRCLLFDIRSPENKSFVLKPLQSRSC
                     NSVSFNERGLIAMGYDRGRQDHSIHVWDIGSLHRGDYGGKTAKIFNCINNESISSLSF
                     CPTEPRNFVAGSYKLLREFDIRSNQPVYQIATRCTLNITVNPFSPFMFASNSEDGSLA
                     IWDRRKLTESFQINSTYQSSSVSSEGPALLFSKLLSDYQRRTNGSPYRFSSVQTAEIG
                     ALFDGGYVRRWKIGYVPPLEHELAQYEHMVKANKVENPTFVPKVPKPSGSMFISKVHD
                     TKTKYERVISFDYAPSKDAEYGIDLVCMRQSGSIYRMKVIDSQNSLTFNSFNDITFCG
                     PDGVCSKIVNGGFGEGPHIVDQKTGNLTIRDDSGNFEEDNDHMGNKRASDTGEKKDID
                     IFVGDSDSACPIYESLLVNDICSTIRKRATKGYGVNANVNMEILDSMNTYETQLHLKN
                     AWKWIDISYNLISAGKMHYADFDFGYLGVLGIWNMNKDFMNFNRYSGFDNITEKDVTS
                     AARGIVERRARECSLLAKPVIGFTGKNHKEVQRRLAMYVIGWDFGVRELEDKYSNLIR
                     DGNYERAAGWAIFHGDIDRAIRILSDSNNENYKIMSTAIAAYTAFKDTNVNNTWKDRC
                     RQLASDLADPYLRIIFAYIADGNWWDVLDETALPLRERLGVALRFLPDSELDVYLNRL
                     ADTVIERGDIEGILLTGITMKGINLLQSFVDRTSDIQSACLIASFASPKYFVDKRVDM
                     WVESYRILLNSWSLFSARAKFDIARTKLSKRMNEPAKAVPRQLYLECVNCHNSITERN
                     PPAVDVNMNNSYGVSTKAGSSFRGGAINHSCQHCGYPLPRCAICLITQGVPVPKEVMN
                     LHQNGNEAKLDRTFDRHASQIEENERADLQHELQFKEWFSFCLSCNHCMHAGHAEEWF
                     SKHYVCPVPDCNCKCNSR"
     gene            <874086..>877397
                     /locus_tag="C5L36_0B04260"
                     /db_xref="GeneID:40382940"
     mRNA            <874086..>877397
                     /locus_tag="C5L36_0B04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464793.1"
                     /db_xref="GeneID:40382940"
     CDS             874086..877397
                     /locus_tag="C5L36_0B04260"
                     /inference="similar to AA sequence:RefSeq:NP_009445.2"
                     /note="PKUD0B04260; similar to Saccharomyces cerevisiae
                     YBL105C (PKC1); ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320652.1"
                     /db_xref="GeneID:40382940"
                     /translation="MSQPLDTEKVNDILRKIDRERKLAEGASHLRKKTNNPSVIQKCN
                     TQVREAQKNIEYLESILRKLQISSANERSASNSPTKNTGPLDSEKDKQNHPYNTARQR
                     PLFTALDLLKYDCPSLGHKIQYMMQLLEFKIQVETQYREANEKMYNLYQVDGDRSSIA
                     LAQRGRSESDRKLQLMKRALKEYQSMYIDLDDISRENAMINTLRKNPLSGILTIQINS
                     IRGVDHIQSPMFSRNPECFLSIKIDDSEKAKTRGSRNDKWSDFFEIKVERANELSITI
                     YDKVNDQNVPVGLFWLSLSDIAEEIRRQKVRKERVTSEQWISTGTVDDDIQSGAKSSN
                     ATLLDSVPDLSNQDPKYNPNVQSAYSDSSTTSIPIRSNGWFSLEPSGEIYLTLGFVKT
                     NESKTRTDHHNFASGLGRHGAIRQRKEETIDAQGHRFVQKNFYNIMSCAVCNEFLRYN
                     GYQCEDCLFLCHQKCIKNIIAKCISKSSSDINSVDTKLNHKIPHRFVPVTNRGAKWCC
                     HCGYILPFGKKNVRKCDECGIMCHANCVHYVPDLCGISPKTIELILEALRAGQQKSKK
                     KAAATKSSSSVPLAIQKTGASEKTLLHLGKTNTDLLLPSNDQNISAEVGRLAADIYPA
                     KAVNNKSIEEQREQSLSPQRVVSRQESLSPQRVGQTSQVQSPVRVQTKQTQINDDNNR
                     GLPKLPLEGKLEGTYHSEDLRVSTNDGTRDIPEEFEHTTIQIEYEQLHVKAQQHQQEH
                     QQEHHKPPHQAQHHAQHQHHGQRQKRRHRRRYGLDDFKFLSVLGKGNFGKVMLAEYVS
                     NNQLCAIKVLKKNFIVENDEVESTKSEKRVFLVANKYKHPFMLSLYQSFQTENRIYFV
                     MEYISGGDLMWHVQQKRFSLKRAQFYASEILLALKFLHDHGIIYRDLKLDNIMLTESG
                     HIKLADYGLCKENMWYGKTTRTFCGTPELMAPEIISGEQTYDKAVDWWAFGVLLYQMI
                     LTKTPFKGDDEEEVFNAILTDEPLYPINMSKESVDIIQKLLTRDPKLRLGSSERDALD
                     IMEHPYFADVNFDDVLALKIKPPYIPQIDDPREAHCFEEEFTSQAAKLTPVNTVLSPK
                     IQEMFRGFTYSIDDE"
     gene            <877815..>878855
                     /locus_tag="C5L36_0B04270"
                     /db_xref="GeneID:40382941"
     mRNA            <877815..>878855
                     /locus_tag="C5L36_0B04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464794.1"
                     /db_xref="GeneID:40382941"
     CDS             877815..878855
                     /locus_tag="C5L36_0B04270"
                     /inference="similar to AA sequence:RefSeq:NP_009880.2"
                     /note="PKUD0B04270; similar to Saccharomyces cerevisiae
                     YCL050C (APA1) and YDR530C (APA2); ancestral locus
                     Anc_1.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320653.1"
                     /db_xref="GeneID:40382941"
                     /translation="MVEVKSIEELSQIKLFDLIREVFDKAYANGDLVYKEPTNIEHFK
                     DPESQLQYEISILEGLDKRPNNRAREPGEEEDVTKEVIEKVQTKDPFATPEPELTVID
                     SLLDDYRLILNKYPNTKYHFLLVTKDFEKQDSLLKPIELQIIRTILENLNGSGDGVKY
                     FSFFNSGPESGYSQFHKHVQFLKLPEHFMPFQDNIISGVNYFLPKEIVQERRPLFAKK
                     ARFKHYILKLKEYNEGEVDREEELDSLAMLYMYLIKRSLNINKEFEIDKRDFSYNLMM
                     MNDWMMIVPRRSAKYEDIWQNSLGFMGLFFLKDEDLKGKVQQVGISKILEECGFPMEE
                     DEHQIVYNEYGY"
     gene            complement(<879053..>879430)
                     /locus_tag="C5L36_0B04280"
                     /db_xref="GeneID:40382942"
     mRNA            complement(<879053..>879430)
                     /locus_tag="C5L36_0B04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464795.1"
                     /db_xref="GeneID:40382942"
     CDS             complement(879053..879430)
                     /locus_tag="C5L36_0B04280"
                     /inference="similar to AA sequence:RefSeq:NP_010818.1"
                     /note="PKUD0B04280; similar to Saccharomyces cerevisiae
                     YDR529C (QCR7); ancestral locus Anc_1.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320654.1"
                     /db_xref="GeneID:40382942"
                     /translation="MSTVTLVKKQAEFVLKNPLLRQLMVPAAKVFTNLSGYRNLGLKL
                     DDLLIEETPAMQKAISRLPAEESYARNYRIIAAHQLAVSIDVLPDSKALQAKDDTPYL
                     TPYILEAEAEIAEKEALNNSTVA"
     gene            <880700..>882265
                     /locus_tag="C5L36_0B04290"
                     /db_xref="GeneID:40382943"
     mRNA            <880700..>882265
                     /locus_tag="C5L36_0B04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464796.1"
                     /db_xref="GeneID:40382943"
     CDS             880700..882265
                     /locus_tag="C5L36_0B04290"
                     /inference="similar to AA sequence:RefSeq:NP_010874.3"
                     /note="PKUD0B04290; similar to Saccharomyces cerevisiae
                     YEL040W (UTR2); ancestral locus Anc_1.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320655.1"
                     /db_xref="GeneID:40382943"
                     /translation="MKISQLLISLAPLAGLAVASDPPKCDADNKCPEEYPCCSNDGAC
                     GTGSYCLGPCDPRYSFNSTSCMPAPICKAGTFTPRKDNMILQTDYLGNITANDFQYYG
                     QVEDNDDSVMIKMPKKSTGGVISSNFYIWYGNVKMKFKTSHNAGVVSAAILFSQVEDE
                     IDFEWVGSELDTTETNFYYEGILDYHNGNKSSSANTYEDFHVYEIDWTQDEINWLIDG
                     SVVRTLKKDDTWNSTSNKYEYPQTPTRVQLSIWPGGAADSPEGTREWAGGYIDWDASD
                     FSDPGYLYVAVDTVEVTCYDPPSTAQTEGNKKVSYRYDGKGYDEENVIISDKGTVIKD
                     LGRTGFNTGEDQNDNSSSKSSIKSSSTSKSASSSSSSPSSSSSASKSSNSASSTESSS
                     SSKSSKSSSSASPSSSSSSSASLSSKSSSSASLSSSSSSETSVIESSSSSSSVESTSS
                     STPAISSTLTPAVESTASSSTAHGFIQDTNTLSASATASVSSIVSVTPSKGHLNNASL
                     LGLLIAFVSHFAF"
     gene            <882566..>883294
                     /locus_tag="C5L36_0B04300"
                     /db_xref="GeneID:40382944"
     mRNA            <882566..>883294
                     /locus_tag="C5L36_0B04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464797.1"
                     /db_xref="GeneID:40382944"
     CDS             882566..883294
                     /locus_tag="C5L36_0B04300"
                     /inference="similar to AA sequence:RefSeq:NP_010842.1"
                     /note="PKUD0B04300; similar to Saccharomyces cerevisiae
                     YEL072W (RMD6)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320656.1"
                     /db_xref="GeneID:40382944"
                     /translation="MSVSVQIYKFSSPQVVNNESLLTRVLNRGYDLPRFKYNVITTPR
                     IKNSLVEDLGVSPLQDSYVFFCIANDEPTEDKHIGCDEPLDDYEQTTEKLKLRYPHIA
                     VNDVQRCYDNSVDETRSDLPLPKPLEDRLLSMAALKPHHTESGQAFEVTGFVSFYKGA
                     GSLVIREAEQFAAKFLGASQIWVTAIKEHQLREMYEKWGYNFVEHIYVPLASNGEVDN
                     SGSSLENDIGATRPFYLEVMMKSV"
     gene            <883488..>885536
                     /locus_tag="C5L36_0B04310"
                     /db_xref="GeneID:40382945"
     mRNA            <883488..>885536
                     /locus_tag="C5L36_0B04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464798.1"
                     /db_xref="GeneID:40382945"
     CDS             883488..885536
                     /locus_tag="C5L36_0B04310"
                     /inference="similar to AA sequence:RefSeq:NP_009679.2"
                     /note="PKUD0B04310; similar to Saccharomyces cerevisiae
                     YBR121C (GRS1) and YPR081C (GRS2); ancestral locus
                     Anc_3.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320657.1"
                     /db_xref="GeneID:40382945"
                     /translation="MFSRQSLRLFSSSVQRSAKTKLKHKMSAAQATNAEFSREALESV
                     LKRRFFFAPSFEIYGGVSGLYDYGPPGCALQANIVDTWRKHFVLEEDMLEVDCTMLTP
                     HEVLKTSGHVDKFADWMCKDPKSGEIFRADHLVEEVIEARLKGDKEARGIKVEEVEEE
                     DDQKKKRKKKVKEIKAVKLDDETVAEFETILAKIDGFSGPELGQIMIKYNIGNPVTGD
                     PLEQPVEFNLMFETAIGPSGQLKGYLRPETAQGQFLNFNKLLDFNNERMPFASASIGK
                     SFRNEISPRSGLLRVREFLMAEIEHFVDPENKSHANFDSVKDLEVSLLSKEVQQAGKT
                     DILKITIGEAVKQGIIDNETLGYFVGRIYKFLVKIGINPEKMRFRQHMSNEMAHYAQD
                     CWDAELQTSYGWIECVGCADRSAYDLSVHAAKTKEKLAVREALKEPITVEEFECNIEK
                     KKFGPLFRKDAPKVEEWLSSRTQCDLENLAKELETKLKITTKIPGIDAENVEIPGELV
                     KIEKKRKTVHIREYTPNVIEPSFGIGRIIYSVFEHCFWTRPEDSARAVLSFPPLVAPT
                     KVLVVPLMNNKELQDATKEVKSVLRKAQIPFKVDDSGASIGKRYARNDELGTPFGITV
                     DYDTIEDGSVTLRDRDSTLQVRGALADVVAAVQNITYKGISWEEGTKNLTKFESKSDE
                     "
     gene            <885956..>889696
                     /locus_tag="C5L36_0B04320"
                     /db_xref="GeneID:40382946"
     mRNA            <885956..>889696
                     /locus_tag="C5L36_0B04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464799.1"
                     /db_xref="GeneID:40382946"
     CDS             885956..889696
                     /locus_tag="C5L36_0B04320"
                     /inference="similar to AA sequence:RefSeq:NP_011856.1"
                     /note="PKUD0B04320; similar to Saccharomyces cerevisiae
                     YHL007C (STE20); ancestral locus Anc_2.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320658.1"
                     /db_xref="GeneID:40382946"
                     /translation="MSSDGEEVNLPRYRGTLNVDALVAEGSNESLKKIQTTNNGESST
                     LSDGLGIDLNVPENKENVNPVNACDTSNTSFQSNNPFNNTNTHSNSSEIELITQKLSE
                     LKSGIKGWDTSEEEVEEENTASKEIPEGECMTESNTLNPFKLDKAVSKLAESKPPNAG
                     AIDTPQSLTSTQFQAIEEITNFHFSTPRLSELHSEAFDPVLKENQDFPISPMIGSYEG
                     LQSNMESDMQLLTLDRQLSFRKKEETIKDNGAVAKSLDPKKTSDSVKSPEDQSSFKIS
                     DLNVNPPIKELKPQYPKPLQSSTSSDHDFNSIIDTYVQETPTITNSATLASSNPKYGV
                     KPNAEHNSGSSSGVSLDKQKRPGGHQRTNSVPHEIKTRQLPTTINTVKQFSEKEKEKK
                     KSKLFNGLSKAFGLTSSSRSSSSINISAPKNVILKTHVSYDSETRTYKDLPEAWARVL
                     TAQGISVAEQQANPIEAEEVLKFYSEAYAGNEGDKFMDVHDRISSSSYFNDTTNDYAN
                     NTSNETDNSATFAQHHSSTSDSSSSNFNNTNNVNPGQNANSEQTFGLSQFISSGFSGD
                     AGKDVEYIPQRHAPPPPKSQSANTTLLSTPIAGESPTFSTPSSKSISISRKTSLKNAR
                     NMSSPGKNKQNITSPTNLGTRSSPSSPSTSIIGSFSRRFGRKKSITEGRPKIVHLTEG
                     INTPGAPIQISSPAQANFTGVLHKSGQVVPQALNSSQTLHESRELQQSPALGPESFFE
                     PRRPPPPLPKAGASIGVNTPEAIEKSNASTSTLKSPVALSAMEDVKNAIEEEEEEVND
                     FVLKPVSPLNDENLSSKVEQSLPPIPKTIPIAEFANSDEEALDENTQDQMEVPVVKEV
                     EVPTIEDKETDTNSRQHIDDEVVEGTLTSTKQAEQVTPVPIPEAPQVSAPKRSSSKKK
                     LSEEEQERRRELRRAKDLKYMKKLREICSDDDPNNRYHDLVKIGQGASGGVFTAFDEQ
                     TKQCVAIKQMELEKQPKKELIINEILVMKGSKHGNIVNFIESYLLKKDLWVVMEYMEG
                     GSLTDIVTHSIMNEGQMGAVCRETLKGLRFLHSKGIIHRDIKSDNILLSLNGDIKLTD
                     FGFCAQIKDHASKRNTMVGTPYWMAPEIVKKKAYGPKVDLWSLGIMTIEMIEGEPPYL
                     NETPLRALFLITTNGKPELKDRDALSEDLQDFLDACLEVNPEHRANSVQLLNSKFIQN
                     ASDNKSLAPLVELARAEKMKEQEKDELDYGDDGDSIVEFNRT"
     gene            <889857..>890252
                     /locus_tag="C5L36_0B04330"
                     /db_xref="GeneID:40382947"
     mRNA            <889857..>890252
                     /locus_tag="C5L36_0B04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464800.1"
                     /db_xref="GeneID:40382947"
     CDS             889857..890252
                     /locus_tag="C5L36_0B04330"
                     /note="PKUD0B04330; Pfam Domains: Zn_clus(4e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320659.1"
                     /db_xref="GeneID:40382947"
                     /translation="MENNDINVIMASKLSQGVKSVKRRSRKGCLSCKRSKVKCDEQHP
                     TCGRCFRRGTECEYPVSTRSTPTETTGDSSVGVVLNQKCRVTKDMEQEDAGFVPHVRS
                     KAAEFIRSLIDKKGCPEVKDFSQVIKSIH"
     gene            complement(<890433..>893123)
                     /locus_tag="C5L36_0B04340"
                     /db_xref="GeneID:40382948"
     mRNA            complement(<890433..>893123)
                     /locus_tag="C5L36_0B04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464801.1"
                     /db_xref="GeneID:40382948"
     CDS             complement(890433..893123)
                     /locus_tag="C5L36_0B04340"
                     /inference="similar to AA sequence:RefSeq:NP_012834.1"
                     /note="PKUD0B04340; similar to Saccharomyces cerevisiae
                     YKL089W (MIF2); ancestral locus Anc_2.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320660.1"
                     /db_xref="GeneID:40382948"
                     /translation="MENSNVVDQIHLHGKVGRKTGFQVTRTPKKGQNGLEDVNDFFLS
                     EDEFEPTPELGETSPAKRLTERFRLMNESFNIEKKTVKPLDDTEHLDFEPSVTPVNSK
                     QEEHVPILDENLGLSDDEIEETIKDAEDLGTPIRISKNRLTSLTGSPAAQSPQPNVSL
                     LNTRKVTNAGKLTKNIVLNRNTKTSRFQPQNIVSNEGSTSENEVKHKNEIHKSKDANI
                     LETDIPEDVSVNETNKEIGNKNESITSVEKISEKVSINSEQEKIKERPKSANKGATEP
                     PQSPSEGYSEERLDATNHTQTSQRQISVHPSESNYSAIELSKKTGLEADVFIKSDRLP
                     LVSESTGGKVDQEISQATSKTVDSAKSEGLIAPQEALEKMSTECATKGNENVEQDQGS
                     NGVQPLGETHSESPKAQKNTNRRKSITTNDIVERIIIKDTKTNMSSPIRKLRTPRRAT
                     LNKDYSLKPPSFTLTQGAEENTTNAARVTDKKSLLESKNVQPVKKSTIQSKIVQSLKT
                     SPLKSKGTQQVKDSPMKPNSNQSKTASKTAKVPNEPHFVRRSTRTRVAPLATWKNEKI
                     VYKTEKINGVIVKSVDNVLHKDQDVEMFSQGPAKAAKSTVIGTPNKGHSKRTPSKKTK
                     PATPVKVRKASKLNEKASKNNKKTTNVKEAIKAKSDSKPDVQASKTHTVPIEIKTTPR
                     GPKKNSELKRAYQDSDSNLKRKMKKVSSPVQRTHEVVINSDEDSIVNGSLKEERDPGT
                     SWQKNNKGALSLSVFEGPGTGKQVNRTVAYAPDSYKNVTVIKNKDEYFKVGTLFDQDC
                     EFCGGGVIELPFDARKAVKSNHDTYFIFYVICGKVEVILSRNTFVVTEGCSFEIPMGN
                     YYQFHNVGDVTAKMMFVQSKYIVIGDNITSESDSNDESDE"
     gene            <893863..>899397
                     /locus_tag="C5L36_0B04350"
                     /db_xref="GeneID:40382949"
     mRNA            <893863..>899397
                     /locus_tag="C5L36_0B04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464802.1"
                     /db_xref="GeneID:40382949"
     CDS             893863..899397
                     /locus_tag="C5L36_0B04350"
                     /inference="similar to AA sequence:RefSeq:NP_012915.3"
                     /note="PKUD0B04350; similar to Saccharomyces cerevisiae
                     YKL010C (UFD4); ancestral locus Anc_2.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320661.1"
                     /db_xref="GeneID:40382949"
                     /translation="MTFFFPRINLDPFQSLRISCKTGVLTSSRPNTKVYLYVSRASLI
                     SSKILSLFSLPLESVWAKVTNLDLFDLGMVFGVVFTGLLLNKKLSTIKVKTNFFFMKN
                     FKLRKKTAVKKKKDSKQKRKILRERKKKQKKGSAVSCRCVCVCFFFFFFGFLMDSCSS
                     RRRFRETTDLVVRNIFRKKPTDKSNRRSEEREIIEMVDRPKKSPRSNDSDIDLSDADD
                     GHGYDDEMNDSDEESVLQRLTGNYRRFSETQRFREREQNNASLDIDGLESNVPIHARN
                     LNESSFDDDIGLDDEDMDAFLGEESDDENRDVGSAEEGREDHEEEGEEQLQRGNEEDE
                     IDSFENSSFAHSAALAMLANALSSSGRTSDEVSELEHFINQTRGRSFPSNNQNSVEGR
                     NLSEGETRENSSNRHGNQSPNMFFMNSLLNHVIPHRSSRIAGLIDGLNTHDNAYLIME
                     TLNEISSSLLMMSSIQSERQVPTFKLAEALVRVINEYPDDLELQLVGCRCIYNLAEVN
                     FNCISEIVSAGVIETLNEKLLDLSYIDMAEQALQALEIISRRAGRQCLVKGSVPIVLA
                     YLDFFTIHAQRKALQICANASVNIPQTKASDVQTAFATIKSVATTYPDPQCVESAWIF
                     IANTIKSFQYTPSLLTNLLDLEFLQKICNIFPLALGNGNRSSGLVKFKTCIFLLNSFT
                     MLANNSSKFSNNLLTECDIVSMITKSFASYSNAIDSNDIDSQSSVSIDVLLKCPKDLL
                     IAFLKLISVLLPLKDSSTKFNNHNDVGNYTQSHQSANLEKIKLLESEHNNMNNFFSSI
                     FPLLLNIYDATVEYRVRRLVLIVVLRLIHLMAPEQLEKIVYHSKITLTLASSITHGKN
                     LFKNKVGKQKEKELTRNYSLLYGSLLITQSLINCNPEVFLSDFMKEGLISQMKDLSAI
                     FQSEFQNIVDHDIESSAGLYDFSTQEISDESSSDNIEIDYEEEEEEEESDSYGGDYEE
                     DESHVHQAEINDLDSATEGLSQRIPYKNGTENTSLFKQKAFSIMDDGLGDLSMRSILD
                     SLSALSISIHDDYDRLLASNKVVKSENFQFLESFKEKLDADLAQLNRSDWDQLWSSFA
                     NSLHPKANGSAISSFELISSGVVQKLVEVFETHKDHNLAMHKSFQHVFCSSFSPCVNE
                     QASPLAFIVKALEEALDRNESFGIVGSDSDINRTPKFRTASMTKQMRVKLQPCDSDTT
                     GQVRGFLLVVHAIATFETIQNFIKSSKSINIRNTTNLNSSSLDGDFHYDFYLNGEKVP
                     SDATIYGAIYKSLENKYAQLGSTRENIMKTTHVIQYKTVPGKLVLDDNSANEETLVDP
                     LEIIADKNILMILKLLKILHSFNSNIPNPSTSDNIFMNYKLTAKLNRQLDEPLIVASG
                     ILPEWSVILPREFPFLFPIETRIFFLKSTSFGYSRLIDYWLNRSKEENTNNNHSGRTA
                     MLGRSIRHKLRISRERIFSSTVKVMESYATNPGLLEIEFFDEVGSGLGPTLEFYSEVS
                     KSFSRVKLHMWRSDQYCKQQNTDVSKDKHEVHIHNAHGLFPRPLHKMDPHLNNTLLYF
                     KVLGKFLARSFIDSRLIDFHFNPLFFQLAMKYACFEPMRVSLEESIELIKLIDESLSS
                     SLRHLNLYLTEFRHTPEEERADFKIMGATVSDLMLTFVLPGYEEIKLIPGGDDVSVTA
                     ENLDLYISAIVEYTLYDGVSQQIKSFVDGFSEVFPFSSLKLFSPEELTRLSGNAVENW
                     SVETLLAVVRSDHGYTNHSQQIEWLIDIMSKFEKEERRKFLKFITGSPRLPFNGFKGL
                     SPPFTVVLKHTEDNLRPDDYLPSVMTCANYLKLPRYSSREVMLAKIKQAMNEGTNAFL
                     LS"
     gene            complement(<899559..>901622)
                     /locus_tag="C5L36_0B04360"
                     /db_xref="GeneID:40382950"
     mRNA            complement(<899559..>901622)
                     /locus_tag="C5L36_0B04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464803.1"
                     /db_xref="GeneID:40382950"
     CDS             complement(899559..901622)
                     /locus_tag="C5L36_0B04360"
                     /note="PKUD0B04360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320662.1"
                     /db_xref="GeneID:40382950"
                     /translation="MVKMAGNTAAKTLVIGLAGLYAVKVIADQQPPKTNVAHVQERIT
                     HAPGAGLNVGQHPLQEVHDTSDQSLSNLKKYIQLSGDEASQRAMSIYDEAYSKVLDAK
                     KKLDDASSSGSNKFWADGTNEEILKKNYDEASKRLADLKKYLNDYVDSANSGISENIK
                     KGANVAQGYASDAYSKLVGSKESAEDVYKGNAEYFSEKAREAKKEWDDTKSSWFKWRK
                     AQSKEVQDRAEAKYNFFKQRSDSAISQLTKYLEESGQDAKKIVDDFNKELQRKASQAA
                     DKASQVKEDAISKGYDLKDAAGKHVENAKDSVKENADTAKLYAEGYKDRAVQAGYDAK
                     EAAGKHVENAKDSVKENADTAKLYAEGYKDRAVQAGYDAKEAAGKHVENAKDSVKENA
                     DTAKLYAEGYRDRAVQAGYDAKEAIDEQGEYMKKKLYNAKDAVADTASDVKDIVDENG
                     KYIKNKAYDAKDAAAEGASNAKEYVGENVEYLRDQAAKAKEDAINAGSDARGYVDSKA
                     SDIKSFAHENIDYAKDKASEVSGDVKESVDENAKYAKNKYVDVKERVAQAGYDTNEKI
                     KDDAKYVKDSVQDGAETAKNWLGSVGSATKNFFVDKYNSLYNSLGIFRASTLEIAEEA
                     AKYYDEEVAKAKKEYDEARGGWFGLKRAKPQEIQDAAREHWEILKAKQSAAHQELQRW
                     KSNNK"
     gene            complement(<901917..>905147)
                     /locus_tag="C5L36_0B04370"
                     /db_xref="GeneID:40382951"
     mRNA            complement(<901917..>905147)
                     /locus_tag="C5L36_0B04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464804.1"
                     /db_xref="GeneID:40382951"
     CDS             complement(901917..905147)
                     /locus_tag="C5L36_0B04370"
                     /inference="similar to AA sequence:RefSeq:NP_014293.1"
                     /note="PKUD0B04370; similar to Saccharomyces cerevisiae
                     YNL106C (INP52) and YOR109W (INP53); ancestral locus
                     Anc_2.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320663.1"
                     /db_xref="GeneID:40382951"
                     /translation="MTMNILVRQGTKRTLALQSATHVLLFRYINETQKCAIELIDRES
                     FSSKSYKQLSRSKPQGFLGLIEMNNDIFLCVITFKLHVAQPLPHESIYKIVDVEFHSL
                     TNDTWDFLDMNSNGYPNIENEPNGASSSIHNDYTPRIPQHPCWELRKLLSDGSFFYST
                     DFDLTSTLQGRGVHDRQRLSMDLFHTDYMWNDFMMEGIINYRNNLSEKQKLILDDDHF
                     LTTVIRGFAETLNAQVDGKPCTITIISKQSWKRAGTRFNVRGVDDDGNVANFVETELI
                     FTNHHYIFAFTQIRGSIPVFWEQDTALIAPKVQITRSFEAAQPTFAKHFEMLNSKYGP
                     IHIVNLLSKTRSSEIELSETYKAHFKKLQSTTPDSVFFTDFDFHHETAKTYADATRLL
                     PFLHDSFRAFDYFLYDNKRHIVVNEQKGTFRTNCLDCLDRTNVIQQVISLNALMEFLH
                     SVHYHDFSNLKNRHSTLWADHGDRISQIYTGTNALKSSFSRSGKMGFAGALSDATKSI
                     SRIYINNFVDKGKQQVTDTLLGKISNQNQVMIYDPVNDFINSELQKFESKFTTHESIN
                     IFTGTFNLAGAHNNKNLTDWLFPYDNFNPDLFVIGFQEVIELNASNILKSDGSVGQYW
                     TKEVEKTIQKNANDNYILLRSEFMSSILLLLFVKEDKVPLVTEVEGKSKKTGLGGMTA
                     NKGTVAIRLNIASTSFCFVNSHFAAGLSYTEERNNDFISSWNGVRFSRNRYIKHHDNI
                     VWLGDLNYRITFPNEKARALIKENDLSTLFTRDQLSYQMMRIKEFKCFQESEIKFPPT
                     YKFDKFSDDYDTSEKQRVPAWTDRIIYRGKYLESVAYDSVPIVKFTDHRPVFSVFNSR
                     ITIIDEETKDSISNKLRESFLNNSNGKSEYIDLNDVASSAASSVMSTNSSRATTINLI
                     DMDTSTPSTTPPLPRRPVPPVYNAQETKKMLVPGLTPVNIQNAIHVPNIVKQTPRASP
                     ASSEPTNFGSISVMTPTISRSGSTPPPPPPRRKPAESASQPSSPMHGASSLQEKVAEP
                     LKTAPIVPSKPKALNGIYTGDLNKSSSSQAQASTTSWVPMTPTKKL"
     gene            complement(<905407..>906309)
                     /locus_tag="C5L36_0B04380"
                     /db_xref="GeneID:40382952"
     mRNA            complement(<905407..>906309)
                     /locus_tag="C5L36_0B04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464805.1"
                     /db_xref="GeneID:40382952"
     CDS             complement(905407..906309)
                     /locus_tag="C5L36_0B04380"
                     /note="PKUD0B04380; Pfam Domains: Mito_carr(9.1e-65)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320664.1"
                     /db_xref="GeneID:40382952"
                     /translation="MITPEITEGIAGLSAGFATTVITHPLDFFKLRLQLDTTSTSQWQ
                     AVHLIYKKLIKTSTNVNGGFSTSSFIAHLYRGIGPNLVGSTSAWAMYFYFYRRYKNSI
                     LALTRGSSDHHLKSYHYLCSAFLAGWTTSIITNPIWVIKTRMISTEKSQPGAYRSILH
                     GIKEIYKREGLLGYYRGLTPAMLNVAQGAVQVSIYDLLKRSLVDPDASSEKLTTLQYV
                     YASSLSKMVSTCLFYPLQVIRSRLQVVSGSNKLQSASKLCLAMYQTEGLLAYYKGLVP
                     NLIRVVPATCTTFLIYEKVKHLLV"
     gene            <906910..>908874
                     /locus_tag="C5L36_0B04390"
                     /db_xref="GeneID:40382953"
     mRNA            <906910..>908874
                     /locus_tag="C5L36_0B04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464806.1"
                     /db_xref="GeneID:40382953"
     CDS             906910..908874
                     /locus_tag="C5L36_0B04390"
                     /note="PKUD0B04390; Pfam Domains: FTHFS(0)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320665.1"
                     /db_xref="GeneID:40382953"
                     /translation="MSQFKRLKLDLVKPVPSDYEISRNQVPKHISDVATESGITSDEL
                     EPYGSYKAKVKLDVLDRLQDRKNGKYVLVAGITPTPLGEGKSTTTVGLAQAIGATLGK
                     TCFANVRQPSMGPTFGVKGGAAGGGYSQVIPMDEFNMHITGDIHAVGMANNLVAAALD
                     TRMFHEATQSDAGLFKRLCPVKKDGSRDIPIGLTYRIKKLGLDINKINDWTPEEVSKF
                     VRLDVDPKTITWKRVLDLNDRSLRGITINEAPTEKGLIRKTGFDITVASEIMAILALC
                     TSLKDMRERFGRIVVASSKAGEPITCEDLGVAGALTAIMKDAIKPNLMQTLEGTPVFV
                     HAGPFANISIGASSVLADKIALKLAGTPTSYTEEQVKQEEGYVITEAGFDFTMGGERF
                     LNIKCRTSGLKPDVIVIVATVRALKVHGGGAEVKPGVPLPFEYTSENVEMLTKGCANL
                     QKHIQNAKQYGVDVIVAINKMSSDTDAEHEAIKKASLEAGATDAIVSNHWEEGGEGAK
                     NLAEGVIKCAQREYESQKEMENEFNFLYSLDGTIEERIEKIAKEMYGAGSVSFSDVAK
                     EKIAEYTSQGFDKLPICIAKTQYSFSHDAKLKGVPTGFEFPIKDIKASIGAGYLYALA
                     DNIMTIPGLATKCGFMNVEVNEKGEIEGLF"
     gene            complement(<909026..>910192)
                     /locus_tag="C5L36_0B04400"
                     /db_xref="GeneID:40382954"
     mRNA            complement(<909026..>910192)
                     /locus_tag="C5L36_0B04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464807.1"
                     /db_xref="GeneID:40382954"
     CDS             complement(909026..910192)
                     /locus_tag="C5L36_0B04400"
                     /inference="similar to AA sequence:RefSeq:NP_009688.3"
                     /note="PKUD0B04400; similar to Saccharomyces cerevisiae
                     YBR130C (SHE3); ancestral locus Anc_3.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320666.1"
                     /db_xref="GeneID:40382954"
                     /translation="MSTSKVIDTLHSQIDALQAQLQETTVSLNECRKKNSILSKRNED
                     MVEQLSNANHQAEIAQSLLKRKERRVADLEEQLTQTASENDNYAFQLESLKSKLNNYD
                     NEKQRLMAENQRLSHSYNTLSSSFTEFKLQTAESISNLKSQIPAFIKNQTSTLEQNLS
                     TIKAAQPEIDSSYNLLLKNSKRLEQLYAYKYEKVNDSLLLLAESTKQHGQSTGIVMQE
                     CEEILKKLNRNEDVLLKIKNQTLGHMSDCEKMKQLNKLRDLSILNDLPSSQSPTPTQS
                     PQPQSPQPNIYLPDAQKRNISVPKKDRRKRNSYRKSLNESDFANLNNNNRDTSHSTLG
                     RSSSTRRNNNRNSRNFTSPSSGIGNGNGNANGNSNNPRKWSSHSTNSNNDQANC"
     gene            complement(<910310..>910822)
                     /locus_tag="C5L36_0B04410"
                     /db_xref="GeneID:40382955"
     mRNA            complement(<910310..>910822)
                     /locus_tag="C5L36_0B04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464808.1"
                     /db_xref="GeneID:40382955"
     CDS             complement(910310..910822)
                     /locus_tag="C5L36_0B04410"
                     /note="PKUD0B04410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320667.1"
                     /db_xref="GeneID:40382955"
                     /translation="MYYTYSRSNASLSSSLDSKRHCLHHGFQPNRYASPKKKDFFEVH
                     LENSCRLLLPCSSYLQYLLPSFAPIKHRIALDSLNFFFSLSSFIFVLESYAVTNNYNT
                     CSPQPHSPQPHCSSEISLQNRHSACAPRVVDFLTACFFLPLSSLGLWKLPFFISFHMR
                     SRRKNRFKYR"
     gene            complement(<911397..>912101)
                     /locus_tag="C5L36_0B04420"
                     /db_xref="GeneID:40382956"
     mRNA            complement(<911397..>912101)
                     /locus_tag="C5L36_0B04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464809.1"
                     /db_xref="GeneID:40382956"
     CDS             complement(911397..912101)
                     /locus_tag="C5L36_0B04420"
                     /note="PKUD0B04420; Pfam Domains: GST_C(5.6e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320668.1"
                     /db_xref="GeneID:40382956"
                     /translation="MFNVASCQRHSLIPFPFPFIWLLSNPNMSQGILYGTVHTRTILA
                     VGLIRSFHLDIEVLKKGFPGHIEHFPNGKVPALVAADGLLLQEVIAVLFYLVSLHDPS
                     SPLLGSDIRSKALVLKYLSWGTTEFMRPVTVAADNILGRSSCPYNKRLVDDAVAQINI
                     HVQELEERLIYKTFLVGERITLADLFVATCFYRPFGLLLDSQWRQDHPVLMRWFKTVV
                     ASPYLSYFFDSFEYAT"
     gene            <913224..>914516
                     /locus_tag="C5L36_0B04430"
                     /db_xref="GeneID:40382957"
     mRNA            <913224..>914516
                     /locus_tag="C5L36_0B04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464810.1"
                     /db_xref="GeneID:40382957"
     CDS             913224..914516
                     /locus_tag="C5L36_0B04430"
                     /note="PKUD0B04430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320669.1"
                     /db_xref="GeneID:40382957"
                     /translation="MTLSSTLKKYIHLNTSTASNTSASDALDTIGDTDTTHTDTTHTD
                     TTHTPINTLHLPLPNEIQRLQRANLPSMSSPIDIFERSVQPAAPSPDQARNAASSTQM
                     AASFTTSSFNTNTPSLVGSPITSPPSLASPSRSSSSHILSENFTAPVLDSTVELISNN
                     LWDDLDVVQVPHSHPKLNLFKASTDLPLSRCSSPNTNPNSKRRPSNAASIVPNINTAI
                     DGVSLGHIPTRSNTRSKSISSKDSTLHLGPNQSRKSISFYSYSDLCNYENLTKSLSNL
                     SDQETSFISQIPLTASLKHIPSSRRSTIHGSPEDSDAKIDQELGPDDGASQYSNHSNH
                     SNRSNRSHYTDNDTASVKSWVPENHQIHPPLSMSRSRRQSLVDELASIRSCTTNNSYF
                     EDEFQDLTELNDPLVNVCSASQYIDSRTQELRKCCSGN"
     gene            <914911..>917799
                     /locus_tag="C5L36_0B04440"
                     /db_xref="GeneID:40382958"
     mRNA            <914911..>917799
                     /locus_tag="C5L36_0B04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464811.1"
                     /db_xref="GeneID:40382958"
     CDS             914911..917799
                     /locus_tag="C5L36_0B04440"
                     /inference="similar to AA sequence:RefSeq:NP_013797.1"
                     /note="PKUD0B04440; similar to Saccharomyces cerevisiae
                     YMR080C (NAM7); ancestral locus Anc_2.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320670.1"
                     /db_xref="GeneID:40382958"
                     /translation="MCESYSHPLEVSTETANDPACSYCGIHNHSTLVKCDICQKWFCN
                     GKFGNKGSHIITHLVLSKHNRISLHPDAELGDSTLECYNCGSKNIFVLGFVSAKQENV
                     VVILCRLPCAQQKDSNWDTQQWQSLIEDRQLLSWIAHYPNDEDLINAQNINYDQIVKL
                     EMKWRLNKDATLDDLVETEQEVEIPPILMRYTDAYQYQRSFAPLVKIEADYDKALKES
                     KGLNYISVYWSLSLNNRQLASFYFSTVDSLDLKIAVGDEMVLRYEGPELDAPWEGRGY
                     IVRLPDARQEEYTLEMIPSNTPVPTHVTNRFTAEFVWKGISYERMQDALKTFAIDPKA
                     MSNHLYMKLLGIPNASSSSSNDAYIRNESGEAHTNDIDREDENGTATATATSPSTLPV
                     TGINDDEKINVVIPKKLSIPNMPNLNPSQICAVENALTSPLTLIQGPPGTGKTVTSAT
                     IVYHLSKMHKKEKILVCAPSNVAVDHLTEKLTSMGLNVVRITAKSREDVDSSVSKYCL
                     HELVKKRAKGEFKKLIKLREEGNELSNEDNQKYFSNLRRSENNIISNCDVICCTCVGA
                     KDKRLDRIKFKTVLIDESTQASEPESLIPIVKGCRQLILVGDHQQLGPVIVNKKASEA
                     GLKQSLFERMIVLGHTPIRLEVQYRMHPALSEFPSNMFYDGSLQNGITNEDRTILNSN
                     FPWPINDIPMMFWAIYGREEISVGGTSYLNRVEAMNVERIITRLFKDGVKPSQIGVIT
                     PYEGQRNYILQYMQMNSTLAKKELYSEIEVVSVDAFQGREKDYIILSCVRANSQQLIG
                     FLRDPRRLNVALTRAKYGMMILGNPKALNKDKLWNHLLTFYRSKGCLVEGQIDNLQLS
                     SVQLSRFTEPSMRKPPVHGSTQMSNFDTASLVSYEGSMFGNPGKAAFENDSVWPSLNC
                     SNRHGNSDDNETVVSYNEQFQDESGHESDELANNIKCLTEKFGGDLTF"
     gene            complement(<918120..>921533)
                     /locus_tag="C5L36_0B04450"
                     /db_xref="GeneID:40382959"
     mRNA            complement(<918120..>921533)
                     /locus_tag="C5L36_0B04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464812.1"
                     /db_xref="GeneID:40382959"
     CDS             complement(918120..921533)
                     /locus_tag="C5L36_0B04450"
                     /inference="similar to AA sequence:RefSeq:NP_116698.3"
                     /note="PKUD0B04450; similar to Saccharomyces cerevisiae
                     YFR040W (SAP155) and YGL229C (SAP4); ancestral locus
                     Anc_3.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320671.1"
                     /db_xref="GeneID:40382959"
                     /translation="MSTIWPFFNHSFSNANINKILTEIEQDATKRLAQQTQNQNASKK
                     NGDQQPCKQGNGTMTTTSSAVPITLPTSLLNNNNNNNNNNITTALNGQSVDINNSPIE
                     NNTPTASLSHHVAYSPNTTQFNITASQLLHSIQNSSPSPSPSPLANLTSTTTSTSKSL
                     LDDELPNPLHRTISHIPSSTPSSTDKVKTGEKLPFSPSSHGPNSPPASASCSSSSSSS
                     SSSFISSSATTNQIQNLHFTKSNINVSLFNQLLDQPNLVEEINAAKNQRLISYISQKD
                     VVSTMFDYILFSIKLSKFTSIDEVPTPYLSHDIFVSTEDPAKSINNSTDDFMDSTSNN
                     ETDNENDTMQNNKLDGDEENDHNKEVRKDENMGNNHHNVDILHVALQRATVISEIMIL
                     PSSNIHQTLLSNFDIFTKLWRGFMNNEPHSYFKETKLVLSKDINSVNEDADITLNDDD
                     DDSVFSENIDVKGTDAQKLAEMEESDNYSKLRDPHEVLMFNNFLKFVDDMALINMGSF
                     MNFIRFEQEYYSLTDQFIRFIPYSQTVCDLLVRLISTDKRFNSNGLIDILLDQNLIIK
                     LISTCKKYYLDHQVQDNVCNILNGIVGISSNIGFWEDNSGVNGDDQQDLNSNNPNIGP
                     NDLTRQLVSPECVDEMLDIIINYGNYGLVTIVSVIIEVIRKNNSDYDEFDWISSVNFD
                     DENKSLPNPRDPIYLGNLMKLFSINLDKIVKTYLTDDYYKRNETALRLESSIGQTIEP
                     LGYERFKIMELVAELLHCSNMILMNKSVELDKLIHRRDMLRGDKKKEQLVSDAINELI
                     IDDSHNVKNNRDATNKERGNNDSIPERENSIINSRYFETDSGLSIGNFFKFKLLQTHA
                     IPLIALKLVKFPWNNFMHNVVFDLIQQIFNGRLANWDEDRAINQEETIYDDNLSLNKI
                     LIWSLFGEYSNYSNPEDPDDLFYYREYQCSNADYPGFFNLALFIVYCYHLSNRMYEKT
                     NFRFGYMGHLTLIAEEIHKFQSYVENFGVTKNENAFGLRREEEDDIRPFYLKSSYYIF
                     NELYESIFENKGDFKPWLEFVNVELREISSMYNKVLGNPNEVNDEAVDDGQLGLSSEQ
                     VISNMDIQEPPKAEGAIILDNGDNEEFRKGSGNSVKDSDGVEGVDENTN"
     gene            <922505..>923467
                     /locus_tag="C5L36_0B04460"
                     /db_xref="GeneID:40382960"
     mRNA            <922505..>923467
                     /locus_tag="C5L36_0B04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464813.1"
                     /db_xref="GeneID:40382960"
     CDS             922505..923467
                     /locus_tag="C5L36_0B04460"
                     /note="PKUD0B04460; Pfam Domains: SNARE(5.2e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320672.1"
                     /db_xref="GeneID:40382960"
                     /translation="MYRVLDGEWDCLNTREFYTRDTAGQTMTGGKLEELADTLDELQD
                     AVEDLLTLHGYSDGAGLERAGAHRQSEELLALVNETFHQLGACKDVVGGRSERRKIDV
                     ERYNSLLDRYAHLLEKLDSVAIKLSPYRPTETLRIGLDDVRADIDRGTSQQGAAKQPS
                     KSVRFKNNIVESSPVVPFAPYRDAVHPNEELNRGSDVPYSDSLLDAVNEHLDLDSPTI
                     DMSNKGVFIHNQRMFDRQDSQLDQLHTSVKQQRQISMAINDEVSDQFVLMDDLEHGLD
                     ASNSRMVHSNNKLLQYRQALKKRGDWICIFLLIFILLFLLIVVK"
     gene            <925024..>926691
                     /locus_tag="C5L36_0B04470"
                     /db_xref="GeneID:40382961"
     mRNA            <925024..>926691
                     /locus_tag="C5L36_0B04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464814.1"
                     /db_xref="GeneID:40382961"
     CDS             925024..926691
                     /locus_tag="C5L36_0B04470"
                     /inference="similar to AA sequence:RefSeq:NP_014609.1"
                     /note="PKUD0B04470; similar to Saccharomyces cerevisiae
                     YOL033W (MSE1); ancestral locus Anc_7.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320673.1"
                     /db_xref="GeneID:40382961"
                     /translation="MIVRRTLHTSVARLGFNLRNLRKGKESEAEKTHLQHEHHDHEHS
                     HHKHSPLLIQPNYPVRTRFAPSPTGYLHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQ
                     NRLIQGAEQNIYDTLQWLNMCIDEGPTHPGPHSPYRQSERSHIYEKYSNELLSKGLAY
                     RCFCSKERLDGLRDSARLLKPPTTVSYDRHCFNEISREESDERAQNGEPFTVRFKAPE
                     TYPEFTDLLHGTINLQPQINPIDRRFEDPVLMKSDGLPTYHFANVVDDHLMEITHVIR
                     GEEWVASTPKHIALYDAFGWDKPNFIHIPLLTTVEGKKLSKRSGDIDIMSLKKKGYLP
                     ESLVNFSVLFGWNPKRKLGEKTSEIHSLSELEKIWSLSGLTKGSAKVDWKKLDYFNKH
                     YLTEKLKDAKFFQSSVIECHTRICRTLNLTDLDIENVGKVLKMTYPSLITLNDFDSSK
                     FHYFFIKPRYKREEVQKILKINDETLLKISNELVKRSNDLTHLNFNQVIKEILEELPM
                     LKKKILFQALRYALSGPESGINLPIILELLGPEEVQARLDAFNDFLH"
     gene            complement(<926768..>927490)
                     /locus_tag="C5L36_0B04480"
                     /db_xref="GeneID:40382962"
     mRNA            complement(<926768..>927490)
                     /locus_tag="C5L36_0B04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464815.1"
                     /db_xref="GeneID:40382962"
     CDS             complement(926768..927490)
                     /locus_tag="C5L36_0B04480"
                     /inference="similar to AA sequence:RefSeq:NP_014610.1"
                     /note="PKUD0B04480; similar to Saccharomyces cerevisiae
                     YOL032W (OPI10); ancestral locus Anc_7.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320674.1"
                     /db_xref="GeneID:40382962"
                     /translation="MFASTVSNRPVAISQPISPQKQLIEFKGVPFKQLYHLSIFMLPN
                     VQFNPEYTALIYYQVIPEGGVQNEITNDSGSVGSQVMNNDFKLLGFLNATKQSAIFKI
                     NPGNIEIASVYNIQDEGDIDMDSGISELEERETVTIVIGISIEPNQTAAQQLDCLKVT
                     REATNNNNGTPLLKAPASSMMPLQQSEILTISNKIIGNAYNYLSSFTDARNYVNISKF
                     NDWWDKFKTKMTNDPNYLQNLE"
     gene            complement(<927727..>929349)
                     /locus_tag="C5L36_0B04490"
                     /db_xref="GeneID:40382963"
     mRNA            complement(<927727..>929349)
                     /locus_tag="C5L36_0B04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464816.1"
                     /db_xref="GeneID:40382963"
     CDS             complement(927727..929349)
                     /locus_tag="C5L36_0B04490"
                     /inference="similar to AA sequence:RefSeq:NP_116684.3"
                     /note="PKUD0B04490; similar to Saccharomyces cerevisiae
                     YFR028C (CDC14); ancestral locus Anc_1.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320675.1"
                     /db_xref="GeneID:40382963"
                     /translation="MSEVPTIEFLKGKIYLVVSDEKPEDTDEFVYFTIEESLPYNNFN
                     LDFGPLHVGHLYRFAVALHKILNEPRNKNKCVGFYSSNDSRQRTNAACILCCYMVLVQ
                     NWAPHQVLLPIAQIDPPFMPFRDAGYSHADFEVTIQDVVYGVWRAKERNLLDMRSFDL
                     EEYEQYERVDQGDLNILANDFIPFASPKQSRPGAPLNTAFKSVLELFLEKNVQLVVRL
                     NSHLYDKREFTKRGIQHVDMIFEDGTCPTMDFVQKFIGASETVINKGGKVAVHCKAGL
                     GRTGCLIGAYLIYTHGFTASECIAYMRMIRPGMVVGPQQHWLYLHQNEFRDWRHTMVL
                     DTIPDDFIGGLFPLISYEEYKKREAENENAGSEDSSDDQMNFKNDQLIRTPVRRRKVS
                     SGLKIVHKAVPNASPGQPRKYRSLDNPVQPYANSDEEDAYTSTINQTCNQSAIEDKES
                     DARSNTSSPFYKKTTTTTTTTTIAATGVTPVSPSSSRVYADSGTLKIGKQRKSMVHVT
                     KPNARVVSSDKIIGGSGVRKSSSSSKKTLIQM"
     gene            <929829..>934445
                     /locus_tag="C5L36_0B04500"
                     /db_xref="GeneID:40382964"
     mRNA            <929829..>934445
                     /locus_tag="C5L36_0B04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464817.1"
                     /db_xref="GeneID:40382964"
     CDS             929829..934445
                     /locus_tag="C5L36_0B04500"
                     /inference="similar to AA sequence:RefSeq:NP_013975.1"
                     /note="PKUD0B04500; similar to Saccharomyces cerevisiae
                     YMR247C (RKR1); ancestral locus Anc_8.799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320676.1"
                     /db_xref="GeneID:40382964"
                     /translation="MSAFANTLHTGLGNNGIEVSLNYITGIPNPDHLLCSNTLKLAFK
                     SLLKRDVHTKQKSIISLLEYIKENSSELDNDLVIITWIQMYPKLAIDDSSKVRSCSHQ
                     IQSQFVLSLGKKYAKYLRDTIGIWLAGLFDTDRATARTCRESICDSFGNNEEKVTNLW
                     KIFITQIVQYSHEVIVCESKDTLSDDKFSTKEEIESKYIRVTQASISLLVNALSHSDN
                     IDINEKSISMITQIYNNDSFLDLFGYKDLNLKKAVFMASKALITSKHLPSIMDKALYK
                     KLCKALIKGIKLDSSVNALLYGPVLVNMLDTLVVVTSYNSEFWLNVRNAKSKLLDLLK
                     VGSLNSEPIYYDVVAKLLKILPNELVSITNSETIEPFILTLIQSVEKEKSTAFLEKGW
                     KVVINLVESLQSAGSLTDSIVDTFTAALVKLMDSPRIIARGIIALMHDINSLSSENKD
                     VLLDINSIIMDHLPDKQIEFNDSHYLVKHQSQFIESFVNLLLLNGSDLADVLLANAIE
                     SLGEYDPKSSNPTLAFITINVFIKNGREEFASAINEFIRTVSKYISKTFKDLPLETLK
                     LFTSSIYSEKDLNVSVVNSIFTRLKDLDAADELLPVIASLKNFSIHDSKQLNMYLLEN
                     SKCVSSNGGNSSDTLYTFLNSEILSNLFRNENFVSFADNCVKNYQNDVFLSFSIENSD
                     FVEKLLDTILQSDGTKETEYQCASSLLAKLEQNIDNIQFRKAYLECVINCIERYDGRP
                     EAVSTRLSNNLKLELLNANFDTQFEECLTTNPNKLLSISNSLNLGMYYFVDKYDSNSD
                     IDLEQAKLSLNKATFYASLIGTAEISAENLMVLLLISEYASDILFLEYSYTSQYQEKL
                     MDFQVAVKATFSKLFSSVSYTEVVSSLATGQSDITLLQCLLNLLQSTNRLKAYYTHRI
                     IKLLLEEKIESMGMKSFELLPINDLENKPTILYALLNSANHFLTVSCLDHVRNKTIAN
                     LISIRKSEEIVSDGLKDLILLNSFMDIDDDVDIPESFCMAPPQRFMILLGTFEYWMDS
                     DVAYEENFKPLRIALMQFVQNYIKSIYYVCDSKYPTNFITKVFKLGLRLVSENINLVN
                     SDDQVSIDVLFHSLHLLLLLSKYKQDIEDWEDEISDIETETIELFFKVSRVEQVNLPL
                     ISLCEQFSLVLLSFNNNSLNSHYGKLFDLMNSKNINIQRTAASLLHQIIPDNQDQLVV
                     EFLLSKKKANEEGVSDVHLPNSLLQHVRVPLIDYIEYEEPWKVYQYLWSWYLIMDHFK
                     NITQQMRQDYISELTESTLIEFLNFAFSELETNKFRLHEDEGNYVKNYSFDDNAELNY
                     QEEIQKLLVNLVYEIMNNIGGTFAQNWFQSIKDKQFQQRVEKFITRFISPQLIGDILS
                     TLANKNSVEDSEFKININKRFNEIKCLYHIDEQKMEISIVLPANYPLAQIAVNGISRI
                     GVDEKKWKSWIMSAQYVINFQNGSILDAIKHFKDNVSANFENYEDCAICYSILNAVDH
                     STPNKVCPTCKHNFHSACLYRWFKSSGASTCPLCRSKFNFKKHS"
     gene            complement(<934528..>936417)
                     /locus_tag="C5L36_0B04510"
                     /db_xref="GeneID:40382965"
     mRNA            complement(<934528..>936417)
                     /locus_tag="C5L36_0B04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464818.1"
                     /db_xref="GeneID:40382965"
     CDS             complement(934528..936417)
                     /locus_tag="C5L36_0B04510"
                     /inference="similar to AA sequence:RefSeq:NP_009616.1"
                     /note="PKUD0B04510; similar to Saccharomyces cerevisiae
                     YBR060C (ORC2); ancestral locus Anc_3.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320677.1"
                     /db_xref="GeneID:40382965"
                     /translation="MKQSPLKGSGYYKTKSPQKKDRIGALTFSTAKLRSPVKRSMSEL
                     NKMAYEHAARNRHLLIEEDTVTDNETSIIEKIIELSKIEGLKPISLEQEEEDKTINNP
                     EYVDQDVFLIKKRKVDKENLSVGKFQVLNEGFTSTSPSKSSSKSPFKVERSSEPQDNI
                     NECLAQTPLTPAKRETMSPFQSPLRRSSRKRTTVLEKLKREEDDSPRSPRSPRSPRTR
                     NLLSTFNSIKDLAPPQHDQIKLMRIPDIDLDDDELLLTDIKSKNKALYHDGFEAYFEQ
                     NQTRSRLSKSSMNLAPQLSYEEFNTYNDLLELIETEPIKSLNLYYEFQFSQWLFELQE
                     DFNLIFYGVGSKRQILFQFLSEFVLPLDKKAKCIVVNGYNLEFNMRILISEIWKIAFH
                     KSTPASRELREACNFIHLEFLKVPNRSKKLYILINNMDGESLRNDDLQYTLSLLARIP
                     QISFVCSIDNLNTPLFWDAAVLSRFNFVWHNLSTFKSYSTEISFKDPLSIGKNDEIVG
                     SRGAKYVLGSLTGNAKSLYKNLIFQQIERIDTLIGDDAKMVENRGNIKGSNRSAIPLK
                     EFYEICVSEFIISNDMSFRAILGEFVEHKMCVLTRDTTGLEILYIAFSVNELEKILDE
                     ELMDV"
     gene            complement(<937223..>938410)
                     /locus_tag="C5L36_0B04520"
                     /db_xref="GeneID:40382966"
     mRNA            complement(<937223..>938410)
                     /locus_tag="C5L36_0B04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464819.1"
                     /db_xref="GeneID:40382966"
     CDS             complement(937223..938410)
                     /locus_tag="C5L36_0B04520"
                     /inference="similar to AA sequence:RefSeq:NP_011675.1"
                     /note="PKUD0B04520; similar to Saccharomyces cerevisiae
                     YGR159C (NSR1); ancestral locus Anc_4.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320678.1"
                     /db_xref="GeneID:40382966"
                     /translation="MAKSEIKKSKKSSSKKQEEKATKAVQKKEETSSSESSSSSSDES
                     SSSSDSESESSSNEEEEKKEESSDSDSDSDSDSDSDSGSGSSSEKEDDDDEEKKKDES
                     SSDSDSDSSSSDEEEKEGESSKKRKAESSEEESTTASPEPESKKAKSEEPAGEPATLF
                     VGRLSWNIDDAWLKREFEAYPGVISARVITDRSSGRSKGFGYVDFESKSVAEKALEEM
                     QGKEIDGRPINVDLSNAKPKQQSGAERTNERAKQYGDSKSEPSDTLFIGNLSFDSTRD
                     SVTEFFAEYGPIMGVRLPTHPETEQLKGFGYVQFESVDAAQKALDALNGEYLNNRAVR
                     LDFSTPKPQNERGGFGGNRGGNRGRGGFGGNRGGRDRGGFSRPTGSNNTPVAFRGNKK
                     TFD"
     gene            <938739..>939470
                     /locus_tag="C5L36_0B04530"
                     /db_xref="GeneID:40382967"
     mRNA            <938739..>939470
                     /locus_tag="C5L36_0B04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464820.1"
                     /db_xref="GeneID:40382967"
     CDS             938739..939470
                     /locus_tag="C5L36_0B04530"
                     /inference="similar to AA sequence:RefSeq:NP_014167.1"
                     /note="PKUD0B04530; similar to Saccharomyces cerevisiae
                     YNL232W (CSL4); ancestral locus Anc_2.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320679.1"
                     /db_xref="GeneID:40382967"
                     /translation="MQYPEKVLPGQPILPIYEPTATTQSFKYLPGSNVRLETILFNND
                     RIPTLVSTTAGRVEIIDDKDNENTKIVKVFAYKDPQYKQGELHLDDIKCRSYKAVTPQ
                     VNDVVLARVTKITHLRVNVEILSVLPKGQEENVNNGKLQLLNLLPAESGEYFKALIRS
                     QDVRSTERDSVKTWECYQPGDIIRAVVLSLGDGASFYLSTARNDLGVVFARNEDGELL
                     YPLDWETMLAPGSGEIEKRKCAKPF"
     gene            complement(<939663..>941354)
                     /locus_tag="C5L36_0B04540"
                     /db_xref="GeneID:40382968"
     mRNA            complement(<939663..>941354)
                     /locus_tag="C5L36_0B04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464821.1"
                     /db_xref="GeneID:40382968"
     CDS             complement(939663..941354)
                     /locus_tag="C5L36_0B04540"
                     /inference="similar to AA sequence:RefSeq:NP_013865.1"
                     /note="PKUD0B04540; similar to Saccharomyces cerevisiae
                     YMR145C (NDE1) and YDL085W (NDE2); ancestral locus
                     Anc_2.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320680.1"
                     /db_xref="GeneID:40382968"
                     /translation="MIPRLNPLLNISHLRGGPKFIGKAIKPSQFEFRKNNFRFNSTST
                     KTGSARTIKSGFLSWSFRAATFTGIAGWLYLTYLVYKETNPGSQSPQTEFSEIGNKKK
                     NIVILGSGWGAVSVLKTLDTTKYNVTIVSPRNYFLFTPLLPSVPSGTIDIKSICDSIR
                     TIARQTPGEVTYLEAAATDIDPVKKTIKLEHKSQRFLIGDAFTSEGDVIENELSYDYL
                     VYAVGATVNTFGIPGIPEYASYLKEANDATAVRQKLFNQIEASRLLPKDSEDRKRLLS
                     FVVCGGGPTGVELAAEIKDYIDQDLCKFIPGIEKEMQVTLIEAQHNVLSMFHPKLIEY
                     TKEVFKQQNLHLQVDTMVKKVDDKNVYATYRHPDGKTEDMVIPYGTLVWAGGNAQRKL
                     TRDLSSKIIEQKTARRGLLVDEYLKLDGDDSIYAIGDCTFTPNPPTAQVAHQQGEYLG
                     EHFNKLAKIDELNYLITNSTDDSTKYSKRLERAEKAIKPFEYDHQGALAYVGSERAVA
                     DLHWGSWSTVALGGTMTFFFWRTAYVSMLLSIRNKILVVTDWVKVAIFGRDCSQE"
     gene            complement(<941726..>943570)
                     /locus_tag="C5L36_0B04550"
                     /db_xref="GeneID:40382969"
     mRNA            complement(<941726..>943570)
                     /locus_tag="C5L36_0B04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464822.1"
                     /db_xref="GeneID:40382969"
     CDS             complement(941726..943570)
                     /locus_tag="C5L36_0B04550"
                     /note="PKUD0B04550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320681.1"
                     /db_xref="GeneID:40382969"
                     /translation="MADEATFNIDTIAGIANISNMDNLNDLHLSQLNSQLRYELRNLN
                     KDAGVQVQLSDEEEEDNAETDENDEETSEFDDQEGENDVEENNRNEPFKNYIKSIVER
                     GDGLAFDNQYQQHSTQLPAQSSHSLLQSQQQHFHRHHQHPHNNHDPQYQDHQHHQQLS
                     LNLQQRQRKRQRNEKSDIDKDIKKCSRCRMKRVHENENELEKYQTCIQCRERRKVKEK
                     KPRGPMKLPELRDDWKGFLDKVAMNSIMDVQGHIYRAYTDERQFPRYSHDDLTTDIVQ
                     KIGDKIVEKYIHPLQELTGFKFAIRDHHNPPLYDKNRSKKITWMFICSQDKFRRRKSR
                     SENKRQVLNKLKTEECCSKISLSYDIINGIVQISYNHKHHKPYNLIDSSGAIKPSRIH
                     LENEQAEVDRAVMEAAAAAVAAVAASDEKKEAKGEEHEENKIVIARSHARNDNNNNND
                     NNNNSGTGTNGNDENISSGDERSKNNYDPNRVFGESTSFDDISLIGNVHVNNVDVDNV
                     GVDVDVDVDVDDINVEDVAEIAKLLKQVQQAQSRRLDDEVPEEEQDHDHNKEDNNDQD
                     NIEPVVEGENSTAAFDISPVLLAHVQRQLHNFQDLPKDQHHVNSSPDS"
     gene            <943799..>944758
                     /locus_tag="C5L36_0B04560"
                     /db_xref="GeneID:40382970"
     mRNA            <943799..>944758
                     /locus_tag="C5L36_0B04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464823.1"
                     /db_xref="GeneID:40382970"
     CDS             943799..944758
                     /locus_tag="C5L36_0B04560"
                     /inference="similar to AA sequence:RefSeq:NP_014184.1"
                     /note="PKUD0B04560; similar to Saccharomyces cerevisiae
                     YNL215W (IES2); ancestral locus Anc_2.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320682.1"
                     /db_xref="GeneID:40382970"
                     /translation="MVNYRCNTKQNTPKGTTMSDEDEDLLSLGYEHELGSDEEKEPEL
                     IKDMVSIKKDQSKNKSLTLKFQFTDKMKLKNMESESRASSNSSNSGGNISKSMGKKRG
                     RKPGKLKVVELKEENTVKKRGRGRPRTRPPEDEEEEEIEFDEDEEEEEYDGEEYNSSD
                     DEELMRMIEQGEVDEKNVDLSKLSDRQRAKYLGQSEEPEELNAEFYNGKKLPKSVLAL
                     MKGNEKKKVLTPEEIELRKADAARKRKTFNARKLEAEKKETLRKLLHRKIDKAEVKRQ
                     EMEDERKRENKLKRREIIKHKALFSYVSKKVGEEIQSFYSMQL"
     gene            complement(<944782..>945429)
                     /locus_tag="C5L36_0B04570"
                     /db_xref="GeneID:40382971"
     mRNA            complement(<944782..>945429)
                     /locus_tag="C5L36_0B04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464824.1"
                     /db_xref="GeneID:40382971"
     CDS             complement(944782..945429)
                     /locus_tag="C5L36_0B04570"
                     /note="PKUD0B04570; Pfam Domains: DUF2470(7.4e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320683.1"
                     /db_xref="GeneID:40382971"
                     /translation="MAESRETRIVKHMNKDHVHNLEDFLVIYGHVDQTMAQRNPRLET
                     ITLDAMTISFIDMGGSKENVKIFFQPSLDSLDDARIRLVEMSQNAAKKRGFSEHIVKK
                     IPILRNWYDVPIFITMGVLYYWAMNLNSLLALVANFSTPFQELIREYYISFFRVLVII
                     HVLESVLILYPLLRKYRVNIFQKLTALSITMVEGGFYINDFNRKIDEVSNPKKTN"
     gene            <945963..>946544
                     /locus_tag="C5L36_0B04580"
                     /db_xref="GeneID:40382972"
     mRNA            <945963..>946544
                     /locus_tag="C5L36_0B04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464825.1"
                     /db_xref="GeneID:40382972"
     CDS             945963..946544
                     /locus_tag="C5L36_0B04580"
                     /inference="similar to AA sequence:RefSeq:NP_011468.1"
                     /note="PKUD0B04580; similar to Saccharomyces cerevisiae
                     YGL047W (ALG13); ancestral locus Anc_4.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320684.1"
                     /db_xref="GeneID:40382972"
                     /translation="MKEAYVTTGATSPYERLVLAVLSTRFITALATAGFSKLTVQHGT
                     FKPNREFKEALVQGTAQGVQISFCEYDSSLAARMARSQLVFSHGGAGCILDAVRVGSH
                     PNGKDGRRVVVVPNNALKDAHQREIAHAFADMGLVECIDIEGGVDELVDALVQVVPTD
                     TTSLTTTITTTTDTKNCVAHGAIVESVVSQELY"
     gene            <947231..>948712
                     /locus_tag="C5L36_0B04590"
                     /db_xref="GeneID:40382973"
     mRNA            <947231..>948712
                     /locus_tag="C5L36_0B04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464826.1"
                     /db_xref="GeneID:40382973"
     CDS             947231..948712
                     /locus_tag="C5L36_0B04590"
                     /inference="similar to AA sequence:RefSeq:NP_012376.3"
                     /note="PKUD0B04590; similar to Saccharomyces cerevisiae
                     YJL159W (HSP150) and YKL163W (PIR3); ancestral locus
                     Anc_1.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320685.1"
                     /db_xref="GeneID:40382973"
                     /translation="MQYRNLGVAALAGQAIAAYVPSEPWTTLTPSATLSGALTEYTGS
                     FGIAVNPISTTASASATLDAKNVKQHKAAAATQIGDGQIQATTGTSNAIKTKTTTLAA
                     ITQIGDGQIQATTKTEAPKKTAAPVTQIGDGQIQATTATETTKTIIANVVTQIGDGQV
                     QATTLTKQVVNPITQIGDGQIQATTATAAALISQIGDGQIQATTKTTTPKETAAPVTQ
                     IGDGQIQATTKTTTPKETAAPVTQIGDGQIQATTKTTTPKETAAPVTQIGDGQIQATT
                     KTTTPKETAAPVTQIGDGQIQATTKTTTPKETAEAATQIGDGQVQATTKTTTPKETAE
                     AATQIGDGQVQQTTKTTESTSTKNTATPATQIGDGQIQQSTASQQGAAASASPQDEEI
                     QYQACATNGTLSMNLHNGILTDSKGRIGSIVANQQFQFDGPPPQAGAIYAAGWSIKDG
                     KLAIGNSTTFYQCLSGNFYNLYAEHIGSKCEPVELDIVELVDC"
     gene            <949191..>954179
                     /locus_tag="C5L36_0B04600"
                     /db_xref="GeneID:40382974"
     mRNA            <949191..>954179
                     /locus_tag="C5L36_0B04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464827.1"
                     /db_xref="GeneID:40382974"
     CDS             949191..954179
                     /locus_tag="C5L36_0B04600"
                     /inference="similar to AA sequence:RefSeq:NP_011309.1"
                     /note="PKUD0B04600; similar to Saccharomyces cerevisiae
                     YGL206C (CHC1); ancestral locus Anc_3.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320686.1"
                     /db_xref="GeneID:40382974"
                     /translation="MSDAPPIELVDVCQLASLGINPQSFNFLSTTLESDHYVCCRETS
                     DAGNAAVIVDLKNNNQVTKKSMSADSVIMHPNSMVISLRANDKTIQIFNMETKQRLKS
                     NEMNERIVFWKWLSDQVLGLVTLNSIYTWNVFDGTDAGPILLTSRHVSLNDCQITQFA
                     ANKSLNWFAIGGIAQENGRIVGHIQLFSKDRNISQPIEGHVANFTQLKLQGSSIETQL
                     FAFATRNENGGTLHINEIDHQEGAPVITKKNVDIFFPSEVPNDFPVAIQLSSKYGIAY
                     ILTKFGFIHLYDVETGKKIFLNRISSDPVFTGAPFDNNGGIITINRSGSVLAVEISTD
                     RIIPYILNNLGDVELALSLASRGNLPGAENLFSHQFNQSIATGDYTSAVRIAASSSQL
                     RTPDTIAKLKSLPTQQGQPAPFLQYLVFLLDRGTLNKFETLELVKPLVQQNRIETLEK
                     YLKENKLECSEELGDLIKPANITLALAVYYKSNVPNKVVQCLAELGQFDKILPFCEKV
                     SYTPNFTVLIQNILRVNPDKAAEFAVSLLQSQPDLNVQQIADIFFSQNYIQQATAFLL
                     DALKEDKPADGQLQTKLLEVNLLHAPQVADAILGNSMFTHYDRPTIAALCEKAGLYQR
                     ALELYDNIKDIKRVIVHANELPADWLVSYFGNLKVDQSVSCLREMLSNNLAQNLQVAI
                     QIATRYSELIGPVTLIKVFEDYKSTEGLYYYLSSIVNVTQEPEVVLKYIQCAAKLGQI
                     KEIERVVRDNNVYDGEKVKNFLKEAQLQDQLPLIVVCDRYDFVHDLILYLYKNKFFKF
                     IEVYVQQVNPSKTPQVVAALLDVDCDENIIKSLLKSVLGQVPIAELCEEVEKRNRLKI
                     LLPFLEDTLASGSQDKAVYDTLAKIYIDSNNNPEKFLKENDQYDTLVVGKYCEKRDPF
                     LAYIAYDKGLNDDELINITNENSMFKYQARYLLKRSDLSLWGKVLTPDNIYKKQLVDQ
                     VVGTAIPELEDPQPISIAVKAFMDNQLQSELIDLLEKIVLEPSPFNDNPSLQALLILT
                     AVKVDPSRISNYIEKMDAYNPDEVAPICIENQLYEEAFQIYDKFENHTAAMKVLVEDI
                     MSLDRGEEYAEKLEKPEIWSQLAEAQLNGLRIPESIDSYLKAEDPSNYANVIEVAEHA
                     GKEEELIPFLLMARKTLREPLIDGAIINAYATLNRLSDIEKFLKLSNVADLDSIGDKL
                     YQNGNYEAAKLVFESVSNYSKLASTLVYLKDYTAAVDCARKASNVSVWKQVNQACIEN
                     KEFKLAQMCGLHLIVHAEELEPLVIQYEYNGYFNELISLFENGLSLERAHMGMFTELA
                     NLYTKYQPDKTMEHLKLFWSRINIPKVIRACEEAHLWPELIFLYCHYDEWDNAALTMI
                     ERSESAFDHSSFKEIIVKVSNLEIYYRAINFYTNMHPTLLIDLLAVLTPRLDLPRVVK
                     IFQKSDNLPLIKPFLISVLEKNNSVVNSAYHDLLIEEEDYKSLRLAIESYDKFDHIGL
                     AERLEKHELIFFRQLAAIIYRKNKKYHKAISLLKSDGLWSDAIETAAMSKSTKIITEL
                     LTYFVETGNRECMVATLYRCYSYIDYDVVLELSWLNNLEDLTKPYQISVARENQKKIN
                     EVYSDLKLRQEKEKTEEEPSGLGQPLMITSGPSGSAPLNVNSTGMGFGNGGF"
     gene            complement(<954443..>955732)
                     /locus_tag="C5L36_0B04610"
                     /db_xref="GeneID:40382975"
     mRNA            complement(<954443..>955732)
                     /locus_tag="C5L36_0B04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464828.1"
                     /db_xref="GeneID:40382975"
     CDS             complement(954443..955732)
                     /locus_tag="C5L36_0B04610"
                     /inference="similar to AA sequence:RefSeq:NP_015443.1"
                     /note="PKUD0B04610; similar to Saccharomyces cerevisiae
                     YPR118W (MRI1); ancestral locus Anc_3.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320687.1"
                     /db_xref="GeneID:40382975"
                     /translation="MSLEAIRFRSSPKASLSILNQLQLPYQSTYLDIDSIAPIEKLTN
                     FSGYEAIKGMYTRGAPAIMLVGCFSIVVELDRVLHGNSRDDVASSFGYDLESVDNFKS
                     RLSERIDELILSRPTAVNLANGCNQVKEIIDDFPNGDSNLEELYRSILQFSENLYKQD
                     YQSNIEIGQNGLQYVIDVLTEENFKGPFSVMTICNTGTLATSGHGTALGIIRHLHKYL
                     RKEVSNYDFYFEHTYPCETRPYNQGSRLTSYELKYEKIPHTLVTDNMPSFLIDNLNRP
                     EYHANQYIRENLQSKAPVRFIFVGSDRIVKNGDLANKIGTFQLSLISKFYSEVKFVGA
                     APTTTIDYETESGDSIRIEERPKDELTMVLGAKMSGNEFSIDATTGDVLLERVRMAPL
                     DINVWNPSFDVTPHENIDCIVTENGYYIKDNSGDFKL"
     gene            <956002..>958626
                     /locus_tag="C5L36_0B04620"
                     /db_xref="GeneID:40382976"
     mRNA            <956002..>958626
                     /locus_tag="C5L36_0B04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464829.1"
                     /db_xref="GeneID:40382976"
     CDS             956002..958626
                     /locus_tag="C5L36_0B04620"
                     /inference="similar to AA sequence:RefSeq:NP_011603.1"
                     /note="PKUD0B04620; similar to Saccharomyces cerevisiae
                     YGR089W (NNF2); ancestral locus Anc_3.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320688.1"
                     /db_xref="GeneID:40382976"
                     /translation="MSAPPEKGNTAPHKRNFSSGNNSNSGTNNILTDNNQHDKSHIHP
                     NVSYESLARKMSKKTNRYIMSSLPSYPLLDTFSLLCILVIFPHWLSAIIMILYVFLGH
                     PDFLEIILAIFLKHRLNRNSPTHLAPRAQRAKTFSFLQLVIYLVFDASIMAMMFLFTP
                     YTVPYIILLAKSFLASNLISLRNRYILDAFISCSLLILLESTSLYIIRHFEIFRGDSL
                     LSLTSDYSSAEILYPLYYSSPASVTKTLIYYLSFNRFGQNSAFMFRMEYAVQFLHSTF
                     SLYIILHNLNPIFRKVQLVDKLICLIQDYIISAPNDDIDLSYSTNEKSHLFQSSSMSK
                     GQNVFIIPKEISCAPLPTLRSHIMTVDESEDENARTLDEVINSKLKQDIDEGIQSDAV
                     YGVNVGDNIENRESNTETGIPMHFPEDHQVLNLNDVSSPGYVVAQNFENFCRMIWSST
                     SNLLYISRTPSLKVNDFTTNSTNNATNSVGINKKTLSHKRSFGKLKNNTNIPPSSNVE
                     KRVKVNLLKYQQPLWTFFNAMRAMFSRYDIYSGDYYSQNAMVTTGNGAEDYARSINSS
                     SQCFIWFTGETTLVFELHNISLEQLLIKVNGIIWEHVSSCAFFGREMIIINGLSPLSQ
                     YDIDFVKITLKGELVHLTTTTVSTVFQNKIVTESTSSSPLSTLQRSVVTTQEAIEREK
                     ARLKKLKSDWKKKAAQLKADIENLNSRNKPSDESRNYKKLDSLRQAITKSDTEAALLS
                     KEGERVRLLQTELEENFMEAKRHHEVVLRLYNKAQNDAKVEVSKIESKISASRAEKNQ
                     LLIKKEKIISKKLRIHHDVELLNNELESLRKTEIALRVERRKIRSIQREEKYNLLVKD
                     IETVLNSLKMKALNDFGV"
     gene            complement(<958725..>959562)
                     /locus_tag="C5L36_0B04630"
                     /db_xref="GeneID:40382977"
     mRNA            complement(join(<958725..959326,959436..>959562))
                     /locus_tag="C5L36_0B04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464830.1"
                     /db_xref="GeneID:40382977"
     CDS             complement(join(958725..959326,959436..959562))
                     /locus_tag="C5L36_0B04630"
                     /note="PKUD0B04630; Pfam Domains: Flavin_Reduct(1.9e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320689.1"
                     /db_xref="GeneID:40382977"
                     /translation="MPHERVFRVFNSVKTFKRGFFTESYLPPVEEFKNAMSTVGSQAM
                     ILTASFSGDLDVTKMHGTTLSSVSSLTVYPEPVLQFNIQVPSATSSSIHQNKYLALHI
                     LSPSSDSVKLARNFSLGSRFINMQMNSDNTNAERKHTTPFERIDKQEWELFEDVIQND
                     RPDSFHLDPKLHLPVLTKNSERILICEKYKVFQIYNHEIWTCKVKDILINVHEDHKTG
                     GLLYFNRNFHFVGNPLVDPNTKKD"
     gene            <959802..>960656
                     /locus_tag="C5L36_0B04640"
                     /db_xref="GeneID:40382978"
     mRNA            <959802..>960656
                     /locus_tag="C5L36_0B04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464831.1"
                     /db_xref="GeneID:40382978"
     CDS             959802..960656
                     /locus_tag="C5L36_0B04640"
                     /note="PKUD0B04640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320690.1"
                     /db_xref="GeneID:40382978"
                     /translation="MLSCNSVSHRAIRIYRSYSISGRSYTLSADSSAESAQSSFLRPL
                     KDPPRRTSKWKMISDRERVQSYKCLEKTAIAHILSSPPRMLHVARIVIPRDFLVPLRV
                     MENPIRGEASVFPYIIAPYHPDDLKVPEDPVLYYANSISLFESYNNKETTGTHTVPLQ
                     KLTIYNNMYPNIKVHKHVGWNIDTHKVIEQIYVDLLKHELEKCEVFEELMPSSVSCLD
                     LVYIDSKEYLFMGEERMQLNLFTMLQHSPEIIELLKGKFKTNIIPINSSTDNLNRILI
                     RYSMFLNN"
     gene            complement(<960711..>965576)
                     /locus_tag="C5L36_0B04650"
                     /db_xref="GeneID:40382979"
     mRNA            complement(<960711..>965576)
                     /locus_tag="C5L36_0B04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464832.1"
                     /db_xref="GeneID:40382979"
     CDS             complement(960711..965576)
                     /locus_tag="C5L36_0B04650"
                     /inference="similar to AA sequence:RefSeq:NP_011612.3"
                     /note="PKUD0B04650; similar to Saccharomyces cerevisiae
                     YGR098C (ESP1); ancestral locus Anc_3.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320691.1"
                     /db_xref="GeneID:40382979"
                     /translation="MCSDVALTKFGTLVEKIKSSNHSDNLEDSLAIIIIDIIHQTGQV
                     SNEIIEQYNTIMEECNTDSEFKKNNETLDLNLQILDYLIANYNFQIDCKLKFFCITFQ
                     MFLRLQSIQPGILTVEEIIRYTATSTKINDVPTFIRLKTNLLQLLVQKNDEIQMYTKD
                     IVNSYNHESEIYLLLLKEKSNVFIYDLLAMVFIKLSVVTKTVYRLTFLVIATIYSILS
                     SEFKPQLLHKLAKDGSKMFDKSSGLVYRFTAKEFFHLCKMCQQRGITINDLKQLIAKF
                     SLEEDKQHMNIPWSTLTFVDKKNSTDILHSFENMNISEGLLSTVTERPASELLSSKSF
                     ISTLEHTINNIDFTNVSVYTSLSKLIVFVANNISYSKYILKLFDIVTLKFKNMKCTES
                     NFSFIQLNLKRMAHSVVALNDTKRVINFLRLFYNFGNNLLKQNSELALTFWELFVYTD
                     MHLAGSAESKLSTKRITTASNLTLTTNDAKTALLIQLMYIKNRLSRISKLLTCNLLLK
                     KEYDSCLKIVTQCLIHDNALLTQILQYTSKDILSVSIYLNVIELVEDSNAPMKEGFIS
                     SIVLLLKENLRDTGLFLYFLSHVSTIVHFPISFKSTTLAFSEDSAVFEYQDLVISHLY
                     ILQTFSNSIDASEIVLKSYHLLSRWVLQTDTCFSDYEFTVLQTLYEALNYNEIYKYSK
                     MIINIYLKKRRNSLDPDQKKLLQMYLIDAHIKGEFSAKMDIPQLEVIGLSSYNSLDLC
                     LSILEVKIRRDDKLTNDVINAIYLELSQNPVFKIQKQTDKYKAIHLLLMYAKFCKLVG
                     LSNKIDHLNAVVNINRAVAILQSLFKNFLLAGPDVPPLNTNFKSILKMKFSSEMLQCY
                     NSLLRRYSTLGLGKEFDSYLRELDIFIKLQPSINLQYSYNLVLTEFSLFKNAFEDAKK
                     YYSLASRYEKSIFSDCNLCVTIYALAVSENLARRTNDTENVKAISKKLDNFMFNYFNT
                     SNVDHQHSEVIKAWITALKRRYEYPHDGDLDDYKYEFDPMVREIVDYHNYMKEFKVNT
                     FYASSCYPMLNEIIIKTTFNPMTTKLKLCNKGLIENFKECSSNHSTEVTKYTLDMAFS
                     SFLALLKNDNCSKVDEELTQIININDHFKSISLRWDKQFSKLTNKTKCFLPEISTLSD
                     FGFTQMKKINLKSLMPKDWVAISIDYVLPTNSLMIIRFDPRFENPLFINICLDLVGTD
                     NSFGNVAEKLRQIIIKSDNTTMTDVTSKVKTHDEKIEWWNSRKLLDQQLEDTLSIIDS
                     EWFGGFNSIFQAIHVNEHDFRAIKGEVKTLLSEYLTKKNIKLDPCQLENVHDGIYRLF
                     LKINKVNAQKVADLLYFIIMHIYPRFDLGKNELIDLGKHLVRKIDSIKQNNVLSNEDD
                     VKHVVLVLGSRCVNIPWESIPSLRKKSVSRMPSLIQLQDYLIKYKNYIDSGIDACKGF
                     YVINPGGDLKRTEKTLAPKFKHLDGWDGVVGEPPEEMQILNCFNEANLFIYAGHGGGE
                     QYVRSKNIKSRDTIPPSLLLGCSSGTMKGDGYVQPYGTAYNYINGGCPMLLVNLWDVT
                     DKDIDMFTISVLTKWGFFVDYDSFDMFDLTAENRTLPECVAASRDVCKLKYLNGAAPI
                     VYGLPLKLQSM"
     gene            complement(<965946..>967530)
                     /locus_tag="C5L36_0B04660"
                     /db_xref="GeneID:40382980"
     mRNA            complement(join(<965946..967361,967474..>967530))
                     /locus_tag="C5L36_0B04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464833.1"
                     /db_xref="GeneID:40382980"
     CDS             complement(join(965946..967361,967474..967530))
                     /locus_tag="C5L36_0B04660"
                     /inference="similar to AA sequence:RefSeq:NP_009822.4"
                     /note="PKUD0B04660; similar to Saccharomyces cerevisiae
                     YBR263W (SHM1); ancestral locus Anc_1.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320692.1"
                     /db_xref="GeneID:40382980"
                     /translation="MFSKLSVNTVKRSFSSSFKRSYALTPSSQALISKGVKDVDPEMY
                     EILQLEKARQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGERYYGGNEFIDMA
                     ESLCQKRALEAFNLNPEEWGVNVQSLSGAPANLYAYSAILEVGDRIMGLDLPHGGHLS
                     HGYQTPTTKISYISKYFQTMPYRLDESTGLIDYDTLEKNALLFRPKVIVAGASAYSRI
                     IDYKRMKEISDKVGAYLLSDMAHISGLVSAGVTDSPFPYSDIVTTTTHKSLRGPRGAM
                     IFFRKGIRKVTKKGKQIPYELEKKINFSVFPAHQGGPHNHTISALSVALKQAQTPEYK
                     QYQADIVKNASIFADALKTKGFDLVSGGTDTHLILVDLRSKGIDGARVEAVLERVNIA
                     ANKNTVPGDKSALFPSGLRVGTPAMTTRGFLGEEFKLVADFMDKAVKIAIDLKSKEQG
                     SSPKEKLNNFKKLASEDPQVKSLDEEVVKFVSKYPVPGDL"
     gene            <968834..>971260
                     /locus_tag="C5L36_0B04670"
                     /db_xref="GeneID:40382981"
     mRNA            <968834..>971260
                     /locus_tag="C5L36_0B04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464834.1"
                     /db_xref="GeneID:40382981"
     CDS             968834..971260
                     /locus_tag="C5L36_0B04670"
                     /note="PKUD0B04670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320693.1"
                     /db_xref="GeneID:40382981"
                     /translation="MCVNQQSDLLGEDKKKILMKSRLSIQNDNKLSIVCKNHKTERTL
                     FIMSDWDEDMYDESEEEVLSFEDEDESYGSGNVERSSPPLNSEALYFKAKNLKEEENY
                     EEALCVFDDLIQNSESSEEYIFKSIKQKIKIYEHQRCFETICPMLKKLLLFKERVDSS
                     YFSSSLLKILTRLERSNIGIEAKLSILQVFDNYISTLKMTQMDFSTRKLKYKVVLALA
                     NQKLVENDYTKAVQILSGLENDIELEDETIKNSFFLDIIAGKLLVLLGNSAPIKELKT
                     YANKATLLISGIPQTRVLGIINEASGVVAMYSEDYINANKYFQDAFRHYNDSGDTRRV
                     NILVKFVISSILSKSEVNPFQSSDIQGFLKLGSIKLLMNMRNAIQENNVSKYNVIIES
                     TDFSTSFLGQKFLSDFIPVITHMVYSQFVISQIALFERVSFDYFIEKMNIKLSEFKKL
                     VLELFNVGLISKIKIDFRHGIIRKTDCTFLHEKSVNPVSYIRNCFAYYNLCDSATHMD
                     LEREMDNLARNQNKEIGDIEITEKRALNGCSNSDFDVSSKRKFFETFTTKYNVKIQPT
                     NTEDLEMSKFDLFYNNINLRVLAKELFKNHTVGLGLFDDTEIRNKLIKQIELYLRLLS
                     SSAPLPITDDLSFVNRVKDDKRSSEFKKLFSNDKEINVFTQYDPNIPEVTQETSMNPL
                     EPPENFDLIRDPDVSLSRNEKLLERLKTIAKTTEIITEKNAITLLNSGNVNGAADDYE
                     LSPRKQLDRGGSYTRLNPCEIFSSVDSPFKATEDQYDYNYAYEDNINNKNGKEDYNDN
                     DDDNLSFNEY"
     gene            <971516..>972133
                     /locus_tag="C5L36_0B04680"
                     /db_xref="GeneID:40382982"
     mRNA            <971516..>972133
                     /locus_tag="C5L36_0B04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464835.1"
                     /db_xref="GeneID:40382982"
     CDS             971516..972133
                     /locus_tag="C5L36_0B04680"
                     /inference="similar to AA sequence:RefSeq:NP_116656.1"
                     /note="PKUD0B04680; similar to Saccharomyces cerevisiae
                     YFR001W (LOC1); ancestral locus Anc_8.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320694.1"
                     /db_xref="GeneID:40382982"
                     /translation="MSINKQTKAYKRKATMNGKREVQPEIRGDSQARNQLANQPNLTP
                     KKEKKTLKGKSLKKHLRAAELYGKKKQPRTYTEKELDIPKLNKAINPGNIVKKGKKGK
                     KFISDTDSITLQRIVKQVNDERDLVNESKLEKSRRLEEIRELRRKEMEMREEEKKEKL
                     ESAKSSIKEKASLARSARRKSAKDAKKEINKQATSVVKKKSVSFA"
     gene            <972983..>973909
                     /locus_tag="C5L36_0B04690"
                     /db_xref="GeneID:40382983"
     mRNA            <972983..>973909
                     /locus_tag="C5L36_0B04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464836.1"
                     /db_xref="GeneID:40382983"
     CDS             972983..973909
                     /locus_tag="C5L36_0B04690"
                     /inference="similar to AA sequence:RefSeq:NP_011620.1"
                     /note="PKUD0B04690; similar to Saccharomyces cerevisiae
                     YGR106C (VOA1); ancestral locus Anc_3.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320695.1"
                     /db_xref="GeneID:40382983"
                     /translation="MKLSSQNIKSIAFSALVGIASALSFENTAPLLISNAAFYDTVKF
                     KSMDSIANVKDLLSTLSDEFCFKHPNERLFYLRVPGLGAGEIPSELINIANVATEHVV
                     YDIPSSELFIGKSCSQVQILNMKDIDGSYNLDEHTNVAVIDFVNAAELYKTIDQLTAQ
                     FTVENVIIQGLPSFETPGNSWFDKSQQQLQNLLKSNSKKREELDYGRIEQELNETFEE
                     VNELLNDELVEIYEKTNIESKSTLSHSNKKIVIGGSLFDKYSFFTNGIWMCTIVFLFL
                     TWLLSMALSWLSSLQVSYGAFDKPFDFEKKMQ"
     gene            complement(<974051..>975370)
                     /locus_tag="C5L36_0B04700"
                     /db_xref="GeneID:40382984"
     mRNA            complement(<974051..>975370)
                     /locus_tag="C5L36_0B04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464837.1"
                     /db_xref="GeneID:40382984"
     CDS             complement(974051..975370)
                     /locus_tag="C5L36_0B04700"
                     /inference="similar to AA sequence:RefSeq:NP_014119.1"
                     /note="PKUD0B04700; similar to Saccharomyces cerevisiae
                     YNL280C (ERG24); ancestral locus Anc_3.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320696.1"
                     /db_xref="GeneID:40382984"
                     /translation="MSTLNPTTKEKEFGGAIGASILIVFLPLITLFLYLACNENYVMQ
                     GFQLDADAIKGVFCNQILRNWQNVFFNSKCWAYYLAWFFSLAILDVYIPGTTKYGIEL
                     RDGTRLKYNINGLQLVGFLLVLFISRFYLYGFNLFELDFLYDNFLGMMATSWEFSILL
                     SFFVYFASFIPLRNKNGKGTKERILSVNGNSQNFIGDWFMGRELNPRIGEWDIKLFCE
                     LRPGLLLWLLLNVSCMQRQYQKLGYVTNSMFLINALQFIYIIDGVLNEEGCLTMIDIT
                     TDGFGFMLAFGDLCWVPFCYCLQARYLTLNIINLSALSCIIILSIMALGFYVFKASNN
                     QKNNFRQNKLPHLKSIQTDRGTKLLIEGWWGISQHINYFGDMLIALSWCLPTGFNTIL
                     TYFYVIYFSALLFHRQARDEEKCRSKYGKYWDEYEKQVQYKIIPYIY"
     gene            <975797..>976888
                     /locus_tag="C5L36_0B04710"
                     /db_xref="GeneID:40382985"
     mRNA            <975797..>976888
                     /locus_tag="C5L36_0B04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464838.1"
                     /db_xref="GeneID:40382985"
     CDS             975797..976888
                     /locus_tag="C5L36_0B04710"
                     /inference="similar to AA sequence:RefSeq:NP_014577.1"
                     /note="PKUD0B04710; similar to Saccharomyces cerevisiae
                     YOL064C (MET22); ancestral locus Anc_3.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320697.1"
                     /db_xref="GeneID:40382985"
                     /translation="MKIDLIVRNIMSGSIDYLREAYIAQLAVKRAALLTCKVSEEHLK
                     GISKEDSSPVTIGDFGAQAIVINAILKNFPQDEVVGEEDSTLIKEKKIEKLILNEVNS
                     VQLKDSANNNLLGRLESPEDLCDTIDKGNSKGGRYGRIWALDPIDGTKGFLRGDQYAV
                     CLGLIVDGDVKVGVIACPNLPHSLRDASSPKGGLFTAIKGQGSFFQDLYSNVTFPLNK
                     SNKMSVHNEYGLDQTRVLEGVEKGHSSHGLQGMIKEQLKISQPSVNLDSQAKYCALSK
                     GDAEIYLRLPKDPDYREKIWDHAAGYLLVKESGGLVTDIFGNDLDFGYGRTLNSQGVI
                     AATKAVHPAIISTVKNIVGENGEKLAEYC"
     gene            <977108..>978715
                     /locus_tag="C5L36_0B04720"
                     /db_xref="GeneID:40382986"
     mRNA            <977108..>978715
                     /locus_tag="C5L36_0B04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464839.1"
                     /db_xref="GeneID:40382986"
     CDS             977108..978715
                     /locus_tag="C5L36_0B04720"
                     /inference="similar to AA sequence:RefSeq:NP_014644.1"
                     /note="PKUD0B04720; similar to Saccharomyces cerevisiae
                     YOR002W (ALG6); ancestral locus Anc_6.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320698.1"
                     /db_xref="GeneID:40382986"
                     /translation="MQRFLPQRLKQTDFVFLFKGSPLTDFLYPFKKAANQWVARYMII
                     IFALIIRCAVGLGSYSGEKTPPMYGDFEAQRHWLEITTGLPITQWYFYDLQYWGLDYP
                     PLTAYHSWLMGKIGKLIDSSWFELDTSRGIETIDLKSYMRITALISELIFFIPGVIMY
                     TRWMGRNLNKAPSIDQTIITAAILFLPDLQIIDHGHFQYNSVMLGLSLLALVNLLHNN
                     LGLASIFYTLSIGYKQMALYYAPIFFFYLLSLCVIPKFNMLKLIYISVSVASSVCFLL
                     APFLYHGGLSQVKQILLRMFPFGRGIFEDKVGNFWCATNIIIKYKQIFSTTQLQRQSL
                     ILTLIGISPSCIAIFLKPDKRLLSWCLASCSMSFYLFSFQVHEKSILLPWMPIALLLN
                     EVDSDVISMVCWFFNVSLFSMTPLLIRDGLIMQCIVLCILSNWLMGNLSWVRKYTNIF
                     VPFVSKRDNAITVLPHSYFWKIAIIGFYLGAGVILTCQLFVAPPLNLPDLWVIGNVLL
                     SFASFFLFYLWTFYKIHVIFKSKVKID"
     gene            complement(<980831..>986056)
                     /locus_tag="C5L36_0B04730"
                     /db_xref="GeneID:40382987"
     mRNA            complement(<980831..>986056)
                     /locus_tag="C5L36_0B04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464840.1"
                     /db_xref="GeneID:40382987"
     CDS             complement(980831..986056)
                     /locus_tag="C5L36_0B04730"
                     /note="PKUD0B04730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320699.1"
                     /db_xref="GeneID:40382987"
                     /translation="MDLESIPDSQSDDAVGIVTWETVEQERRLSTRKAKQLHKLQKEL
                     TPLTKEFKEIPRVRTRSSNFQKNNQFTVVAAEFLNLSSKSELNRLFEEGYTKDQIEQL
                     LENKYQEKKQFYTELGIKNHKFKRKNFESWRSMSNSHAVTTNTFASEEELLNVMEKSQ
                     QLRLKRINNKPLSSFKGLAPTNNTENLKKHKNLRETGSTLGHDEMSLINLTSDRNNSI
                     TIQSSPIRLRNEQTLTQDDLHEDNGDSVNRSDRNSVALSFASGSTGENNKPKPEDDIP
                     LTFSQLDKIFAIQDENIPNNTLPMPYSDEVDTHRSEIRKITDKSPDTEINVRQFSGIQ
                     IPSIPSSPQSTHTSIPKTPVLFTRHLRHRNIINRNPYLVDRAEYLGLSTRYELISLEE
                     EGKDDSKIIEFLDERYQQKREDRKKKDVGYGPFLKKSFHEIMNEGRSELLPETKIENS
                     KSTNDVDSDFSIEDDIVEEEDEDEEEHDLFSFSGEVSIDSQPINEEIFERTELLTAQK
                     LKQKPLPKRTRKFSSATLLTKSVRSSSKGVKRSPSSIIGEAYNTENKDIKEFLQTGKT
                     TNSKEYGSMADCSNPVDSDPYSMKFLTLSDDDLDFPENVFGEQPSAVTEDISSARKNH
                     QSDLKKAATIVKTRDVKSYKNSLSVTNKKKRLLEHPQEQNTTEKHSGRKKKKRQTNIV
                     AASFPPKDNPNYLFVRRPLTENYQVEGLQAHVIQSDKTVNTAEFNIDYARGTHENPMN
                     KTTIETKEVENHYDRLVKTWNKFKTSKSKNERFLKYILNVRLDDYKTIPWPTKLVNSS
                     LVQQILGSSEFYYRNKSIKIELSNSSFTFEMPLKDGDSFSKIKSIFSLLFGYITNEKV
                     RKSGLKQVRKLLIHLLMVVSNVKVDIPHIIEYIVMEINSFCNLLKISKEVNPLVLITT
                     LPYFCLYLRVLQRDSTENCHSFAHTEDWLCKRIVLNICSVSFEEMFVHKKNIVLESIY
                     IFLKVVKNPWRFVGSYLPHKSCNILNVTNFLFLCNAFQKVEMDWEYYLNILGKYSDGQ
                     LTSNNDTYSMKCLFLSILKINKDLSWEFENQLIVKMFRLLAEHKFSNIGCVNSPKATI
                     YPTAFVSDSLTYDDGCLDVYLKTLGKFTQQYMGENTKKIVERLIPIRSTFGYDAIQLQ
                     NRAIVLLFMIRLFDQDLMPILESVVSDMIRNGTEYSIKSAISLLSVIVKQTSRKQYLT
                     VRKFLPHIIHKINKDKNDREMVGCLKDLILNVTELLNGHDISYLKRILDFFSIILKFK
                     NLSTENGMLITYLKTFSIMKRQFEFSYGIEITEKDQARIDKSLYDVIVSVKPIILNDR
                     MTIDIKKFYIKVWLFCSAMSKKPVMQIVFTEWNFLGTQEFRDKMESYFYTELIGNFQV
                     EPVKYEVLAFFFKHLPIRSADLSIVFDSLKNSGILPIKGDDNTSNAKYIFMNDRTRIT
                     IRCLECLFKRLDISVRKTLLEIFIKSLKSQSIDFSSRRYIKEVALFIHGMVDMKLELT
                     EWDHLVKEFNLENTPQKLSTRVQLYDTVEDICVLFEKSYTVAIASSSLDKLMTEFEAL
                     DFVHHSESLLVESFCSIILFHIKEVCLSKTKHLFHLSNWLEIFEKYLHNTNQQFDILP
                     VLNVLLFLGKPKKHFADIKKYDYYYMKILLSNFKILLWCLYCFAGFSDSCIIKAKMGD
                     FVYLDEPFLKCHASDRDITLPCDVEQRIKNLYKSSQGVLDSKIQMFGDEEGLLLMREQ
                     VQLHRETIHAIEKKM"
     gene            <986333..>988606
                     /locus_tag="C5L36_0B04740"
                     /db_xref="GeneID:40382988"
     mRNA            <986333..>988606
                     /locus_tag="C5L36_0B04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464841.1"
                     /db_xref="GeneID:40382988"
     CDS             986333..988606
                     /locus_tag="C5L36_0B04740"
                     /inference="similar to AA sequence:RefSeq:NP_013423.1"
                     /note="PKUD0B04740; similar to Saccharomyces cerevisiae
                     YLR319C (BUD6); ancestral locus Anc_4.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320700.1"
                     /db_xref="GeneID:40382988"
                     /translation="MSELSKSNSGHRSPTKRKGHVPSVATATSHLLTSTKALLQSLTS
                     WSKRSATVSEVSAKFVKFGDSFKTLKRSYNAFGIDITTLPDIPKQVRTILEASLILEP
                     SQQSLDMFLPQIGESVAELMKMLKDKQFEVSEAEKSKSNLSLSASLSTVSSLRYPGKS
                     FAATPGATTTTSEHGSNDTSRTPYKDPLTRLQNNRNLIRRASKRYSAYQTSSIISIQS
                     PMNSTSFDTSQLPKTPLYEDGTPNITSDDLENAKNDSSIFNNSTLEKNGNSTFPYSIK
                     EEQESGQTPESDETEKEENAKEVKEVLNDTTDKLKGGRNERNDSVTDVFGGTRENHIF
                     LKLKDQVKKVNIKLPTTVANVKVLFTQKFNYSSPGLTPYPKMYIQDGPASVAYELENM
                     ADVTDGSIISLQQPDLQSAIFKHVDLQIDGVKSDIMNMEDRLLKKIESMNLSVTSNTV
                     SNTVRQSVEIDYEKNMKEKLEKNEEYQKLVDELQNELNKVKQHQNRSIKRITNMINGA
                     IDYVDNFQESGIVLKDMTENSYISECKNRVSEGCESLVEKLDDLQDIIEFMKTDITKH
                     NIKPSDKQLEHLGKEMRKTDDTLRKLTNYTQSERKNIAAIWNKQMALIAADQRFFKAQ
                     EEIMGLLEQDYQSAQETFELIKSCAAQLEKSSLPKSKLPIPDPSVSPWDASRLVMAEV
                     DALNPNHEERVEAIAKAERVREMEKELRLKDEFQEELDEFVSNERLKKRPGGIEELER
                     NRQEKDLQHIKNTLGVM"
     gene            complement(<988599..>991160)
                     /locus_tag="C5L36_0B04750"
                     /db_xref="GeneID:40382989"
     mRNA            complement(<988599..>991160)
                     /locus_tag="C5L36_0B04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464842.1"
                     /db_xref="GeneID:40382989"
     CDS             complement(988599..991160)
                     /locus_tag="C5L36_0B04750"
                     /inference="similar to AA sequence:RefSeq:NP_013422.2"
                     /note="PKUD0B04750; similar to Saccharomyces cerevisiae
                     YLR318W (EST2); ancestral locus Anc_4.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320701.1"
                     /db_xref="GeneID:40382989"
                     /translation="MPALRQYIKEKYSCIETDVFLEYSSGAYLQDIELLLDHIHVEEN
                     THVSDAISPILVSKCTCCYYNEMIDLLIEYMILKKRNNSLLLGLTKYHYEVDNTVQMF
                     KGFNSSLALLKSKPMEIIMNILGITRFLSLILGTDALWRPNNFVIWGDIKEMPFSNKV
                     NPNIVSIKKMLHRSIGHIRNLNPIKLDEYEVLKEIFGGTLTETQILNKTIPKRLRKVR
                     KIIKLMIFNHNKHAYEYPYIVDQICKSSRKLKSDNLGYATDRANVISLIHTLIYMIIP
                     MEIFGSNHNRTVLMRYVPKLINGTASFTMKTQDMLLNVKINEVKWLKPRNNCKMTKCE
                     FIRAKELFSMFVTWLFNSFVCKLTASFFHVTEPSQETRLLYYRHHIWKKISQKFKSRY
                     FIKHLYQKRDSSNSFKSFKQNEDTIGSLSIHPKKTDFRLIAKPFKGTLEERILYLSYQ
                     KRKLRPINQILNHIRLRNSCSSVRDIVKHIYSFKSRITKPTGKLPRVYAFKFDVQNAY
                     DSLPHAMIDKVIKQRLDAFTKSDTVFVQLCRKSKADGMVRTRKSLIADSLEKLKFSKD
                     FGFSAQHRLVDTHETLEFSKKDIINFARSQYAKTCITINSKSYFRKIGVFQGFPLSAT
                     LFNIVYDSMVEKLKSIINFTGEMTVIRLMDDFLVLSTSDSDLRKIRKFVSRTVADYNM
                     NINRLKSNFTNDKLLFAGLTIDVKNLVCYKPLKQYNTGRVIASNFTKLYAKLTEYTDI
                     WVGNTLLFDSTNVMSGKHGCRKNVVYLLRALLFKFVNSFRETRRRSKFKVQTLFSFLN
                     KTLCRISEITDLVFIQFDFAKFWKFTIEILKHKNIVHSKACFQFDKHTGYCFQST"
     gene            <991319..>992305
                     /locus_tag="C5L36_0B04760"
                     /db_xref="GeneID:40382990"
     mRNA            <991319..>992305
                     /locus_tag="C5L36_0B04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464843.1"
                     /db_xref="GeneID:40382990"
     CDS             991319..992305
                     /locus_tag="C5L36_0B04760"
                     /inference="similar to AA sequence:RefSeq:NP_013420.2"
                     /note="PKUD0B04760; similar to Saccharomyces cerevisiae
                     YLR316C (TAD3); ancestral locus Anc_4.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320702.1"
                     /db_xref="GeneID:40382990"
                     /translation="MTFDIDYEKEIFYGKLQRMALRRDANEISLDEYWCCNFDPKLSP
                     IILRLIKSELQYTSEPLKHLKRMYKVERNGKTLLRALLCPVIRTGDESNDTNFAEVFA
                     LVKLVLPSNSFKIEKVEVPMNKPTSKELNEKVSKLYWPVIWKGDPRLQELKEIYKRMD
                     INKVEKYVGLLIEKLENPPFKTSLPIVTIFVDPLSDEIKSISYDSRTRNNPIKHPIMD
                     GIAHIAELELRRRQESCYNDNESNNYLCLNYHVYSTHEPCAMCAMALLHSRISQLIYI
                     KPSTKTGAIGMESGHQEMVHVSCSLNWKFESFQYTDTSIANSVVSVDQDVFV"
     gene            complement(<992307..>992804)
                     /locus_tag="C5L36_0B04765"
                     /db_xref="GeneID:40382991"
     mRNA            complement(<992307..>992804)
                     /locus_tag="C5L36_0B04765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464844.1"
                     /db_xref="GeneID:40382991"
     CDS             complement(992307..992804)
                     /locus_tag="C5L36_0B04765"
                     /note="PKUD0B04765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320703.1"
                     /db_xref="GeneID:40382991"
                     /translation="MSSREILENYLDRDLFEVVSEQSVSKIINVQTQKRLTDKELKIL
                     SNLIYNRHNNRSMDRVRENILQGELQSVVDYEPDSEQVQIAEESHYVAFLDRLKKLND
                     RLEKEAENIESIKKHKMKLLDKNIKELAEAQTSITSKISSLGKSKAKQMTQEICETMA
                     SISKS"
     gene            <993038..>994450
                     /locus_tag="C5L36_0B04770"
                     /db_xref="GeneID:40382992"
     mRNA            <993038..>994450
                     /locus_tag="C5L36_0B04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464845.1"
                     /db_xref="GeneID:40382992"
     CDS             993038..994450
                     /locus_tag="C5L36_0B04770"
                     /note="PKUD0B04770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320704.1"
                     /db_xref="GeneID:40382992"
                     /translation="MAVAPKKSKNRKAFRNVPYEPQGLERTGNKSTLEYNAALKKSPF
                     TNHDNIKQGKNPVFTFPVPMGDPLKGSLLNDEVDMHFPRKHFLNKFQLYNDLLENVIS
                     KPIPVDKIIPPNLFPIPYVEGIPYKNKRTELLKDVNDYNLSQEQIVSNEEIISNDEAP
                     SNKVTSVEKENPKKEDNLDGHKNTTKKETIPEGTATNEDASREIAENESLDKGNNESS
                     LKLEKEKNGTSIDNKPSVSDDNLSDYDPDFIDYQIPYPKESEHVGNILDDYLNMRLKC
                     RPATDFFFGDSRLMKLQERCFSEQVHLESEALKRKLYVSEKYKYKLESMKSMHEEYRT
                     FTANSLKSIEEKLELIEAELKSKFNVTFADAKLPVEFHNLNVEMNKQEISVEDYNFKY
                     KSERQPFNPTSGIVSTNDISEEKKEGDSEDQHREIVDDTNIDQNFDFDMYESGAYAND
                     GGNAEDGEFASLSNDVFLNI"
     gene            complement(<994540..>997590)
                     /locus_tag="C5L36_0B04780"
                     /db_xref="GeneID:40382993"
     mRNA            complement(<994540..>997590)
                     /locus_tag="C5L36_0B04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464846.1"
                     /db_xref="GeneID:40382993"
     CDS             complement(994540..997590)
                     /locus_tag="C5L36_0B04780"
                     /inference="similar to AA sequence:RefSeq:NP_013069.1"
                     /note="PKUD0B04780; similar to Saccharomyces cerevisiae
                     YLL031C (GPI13); ancestral locus Anc_4.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320705.1"
                     /db_xref="GeneID:40382993"
                     /translation="MDKAAADISISSQIQSSEFRNKSSYYSKKLSITNSSYVRVMFLL
                     GILQTIGLVFFTRGFLLSRSVLSDLSTCKSQNRLLEDSYNGTCFHPYHFEKAVILVID
                     ALRFDFTIPFDNVTEDSPDYYYHNNFNVFYDRFQNEPGNSLLLKFIADPPTTTLQRLK
                     GLTTGSLPTFIDAGSNFDGDTVFEDNLLSQLFYNNKTVAFAGDDTWTSMFSPFLNRSL
                     TFPYDSLNVWDLHSVDNGVVDHIFPLLENQNQQKWDVLIGHFLGVDHCGHRYGPDHYA
                     MKDKLEQLNLIVERVIQQLSDDTLLVVFGDHGMDSTGNHGGESTDEVEAALFMYSKRK
                     QFKLLEDKINYDISNGGEKYRKVNQIDLTPTLAMLLGIPIPFNSLGSPIAEAFMIDET
                     KYAMASMLASSQINNYRLSSSELKDDEDVNDLFKRLKELWAKRDLPLQNLEFIEKSVA
                     YQQLSLGKCKEKWARFNDFNIWIGIVLIFLSLVVLIVYSKLVPAVVVSQLNYQCFLAS
                     IILILVYCVLCSSFVLIFKPEGLELSWALILGVALGIANGILAPIMDRYSLFWCILQV
                     KENLVQNGWTYCGMLIILLHSLIFASNSFIIWEDKIVSFWLSSFGFLAFFKSLKNEER
                     RKRVIGAYHSFIFMLLTRLVSMINACREEQGDKCFSNFKMTWWSIGLLYVSAIVLPIL
                     VEQYYKISYSFQGPASIWISKGFRAVLLMIAVLWTLEYVENDEYMTKTFDIPFATIKT
                     LRLTLGRVILGISFFAANFGWNAGPLCVRVELEQKEVEVAISTKKSKRTAPKMEMQKT
                     AKIIGYGNVYGSSYFLFIINILCSVLVVAKPLGGVSLFILTNQLLTLFELVDILSIRT
                     NLISVVVLCLLGYLHFFTTGHQATLQSIQWEIGFMFTETISFPITHLAIILNTLGSFI
                     LVALAVPLLSLWKIPPTNKPVALVSKIAEGSMTMLIYQTCLTLVTLITTNNLRRHLMV
                     WKIFAPRFMLNALILFLMNIILTFVSVGYASVKVILRWYSVFGG"
     gene            complement(<998139..>1000940)
                     /locus_tag="C5L36_0B04790"
                     /db_xref="GeneID:40382994"
     mRNA            complement(<998139..>1000940)
                     /locus_tag="C5L36_0B04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464847.1"
                     /db_xref="GeneID:40382994"
     CDS             complement(998139..1000940)
                     /locus_tag="C5L36_0B04790"
                     /inference="similar to AA sequence:RefSeq:NP_011840.1"
                     /note="PKUD0B04790; similar to Saccharomyces cerevisiae
                     YHL023C (NPR3); ancestral locus Anc_4.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320706.1"
                     /db_xref="GeneID:40382994"
                     /translation="MSSSLLLPNPCLLGIIFTVATHDGNHMVFHYPPKPNGFGFQATP
                     LDINEVHNEVEGLLVSSDSDISYDDGDDNELDDGDFGDEEDEALESNSDESLYSSDVR
                     DDGFESSDMACSEGKSSRSLSGESYIQSGSAGTHNRASWSSNNRYQSGRDLLEMLYDL
                     DQRKKKRKQIARRRNRKKTREGSTKKEQEIQSLKSSLKTSKSYIESDTLKKKEYRIHK
                     LFSFDTEFLSDLATPPKALCNTRFELTVEDMVFLGLPIHINDDGNWRVSKKSTRSRSK
                     STSTNQKSRKHSIHDIKLSGHSPIMSKKSELDGKDQPKESATDLDVLVYDGEKTVEKN
                     HMYQFNMLFVLNPPVVEYNHRIDEMFHYIVSRVSLLLRYEQQKTNYVWIESQKILKLR
                     EELVNLPIKQQWKSIIEKSSLAKVIADTYKAVSKSEIVNIEINGKLNSFQIPIKKEFI
                     RLPPSYLELPENSSLSSISPFNQLNSFESSTSLDHSNDIMGYFALILLDDCERVIRDI
                     KAEKDSLIAGFIRMIKPNESLQRLSILSGLDAQEVRMFANHLVYWRRAIAILPLTSRN
                     TYICSPISPLKNIHRDSESFNQIFPNLPSLPSFLSMISEVSKNKPKPISNIIPSRDHR
                     DLYMDAIAWLLKKGYVIQLFTFLYLKISKGIKIQVAEEIEIEIKKKQEFKKKSLLLSN
                     SNDESLDHLEQNDITKKKQRSSVSNDDIDATLDDLVEGLNSSSLRIETEKDKEGSSVM
                     ELDNVSVQDMENKSGYESFGNRRTDNSTEIDGISETKNVSDNSSKMPGPDNNGSKART
                     SSLNYAADNYAGRMINYSGSKKESELDLDNANSSLESNGYYNMYGTQRKIQFEEEEEE
                     DTILLEPEVCSALERRWIAKLVEGQPTEIVNLFYKVLKHMNGRNAAEVFLMQENISRH
                     DFKKLLDALGESIVSVRHW"
     gene            <1001162..>1002148
                     /locus_tag="C5L36_0B04800"
                     /db_xref="GeneID:40382995"
     mRNA            <1001162..>1002148
                     /locus_tag="C5L36_0B04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464848.1"
                     /db_xref="GeneID:40382995"
     CDS             1001162..1002148
                     /locus_tag="C5L36_0B04800"
                     /note="PKUD0B04800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320707.1"
                     /db_xref="GeneID:40382995"
                     /translation="MIICSRCKRKRFLGITDKNDDDLSTYQTCQPCRDKLKEYRRTYT
                     NRKRQKLENLRNQHDDRSKVLLRSTHEHKRKVNKLYTDFEAVLNKVYNHVKIDDLDMN
                     FTLRIPEFCIPKPNKQIECGYEEQSNLLEQQVELDENFKSELTKSLETHYVDRIIHVL
                     GICGYNFKFYVSSWKNGKYYATYKCIADKLAMKRFGVSEPSLKIDIEGRNSTEGKEST
                     LKQQVLGWITPLEDSDSFDLNLNVRNEDVGLQLIQTYGYHCQSQLSFIADYTNLELTF
                     KFKHQFHRSELKKPVHENKPAREKKPFSEISKHIDPADFSEKLDILHSKLKH"
     gene            complement(<1002247..>1005072)
                     /locus_tag="C5L36_0B04810"
                     /db_xref="GeneID:40382996"
     mRNA            complement(<1002247..>1005072)
                     /locus_tag="C5L36_0B04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464849.1"
                     /db_xref="GeneID:40382996"
     CDS             complement(1002247..1005072)
                     /locus_tag="C5L36_0B04810"
                     /inference="similar to AA sequence:RefSeq:NP_013068.1"
                     /note="PKUD0B04810; similar to Saccharomyces cerevisiae
                     YLL032C; ancestral locus Anc_4.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320708.1"
                     /db_xref="GeneID:40382996"
                     /translation="MLYQKSKNQDDKMIISFTLPYECIVKPSHNIYHESLIHSDWRFK
                     QPSTTANENLFDPSGSSLSSSNNVHNSNSFNDKSLIFDNLVSLRSVVNQLNESYASYG
                     IIVILNEFRLSNMKLSISIIGKHSYRSEMNSIKLQIFQKYSKILKSTITIDPRTNRHC
                     FINNEIKVELINFINSVSQFNKTSIYIERSDTLASTFTISVVGYRDQVKVTENKINLF
                     IDDMNPNFFSDYLELSSISILPLICGTNMSTLKRIIKQTNCNIYLPNLLPELFYNNSL
                     EVESRNPKIFITGLRSQVLLAKKWLSDMIINYTNNPFIKQLPILPVKREILIISQLVE
                     QNCDLFDEMMFKTSCYLSLPPLGYQSIDNNEVNQYNTNKGSSSNRNNNKSSLIGDLIT
                     VQGNSIEEVEILIDELTNKASSFYSEKVEFTVQSNSDHPIDINKLLNFNDSLTFNSNC
                     FVTCSKVDNKYIFQLMGNSENIKIATNCLTQFETYSGSSFSNQFVQYQIELTNKEKDF
                     IAGKKNGKIIKIINMSAVSIKLLPFNDQNFIVEISGNELMDAVVGLGLFEDELPTIFH
                     FNVPESFHRQIIGVGGQTIQIIMRKFNVFVKFSNSFELSDKTLDSQHILQSTNFQQSF
                     IRKNNVIIKCPSKNKSEIPLAKLELEKLVDKVKRNSYSSTTVRLSLQQWKLLTSAEFN
                     ILFNINRKKPTNFITELEKKTNTFISYPPLDSISNNQESVIIEIYGVENNSKLCFSEL
                     KKIIPYSYRFKINKSSNIDSLIEIIKLDKAHLLQMDSVSNLQISFLNNIVVPMKILYN
                     VELEIKSEDQYDSFILYYYPHAFSFNFNISNAERLNDQTQSQIVMSQQFSQIVQSMVS
                     FLNDWHFDLVDSGIYSAELFTIESNSPSNTKSNTNTSTNTNTNTNTNSSVNQSHFSAL
                     KTKSINTNSNNPNHNNSTDNSSKNNIW"
     gene            <1005960..>1007936
                     /locus_tag="C5L36_0B04820"
                     /db_xref="GeneID:40382997"
     mRNA            <1005960..>1007936
                     /locus_tag="C5L36_0B04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464850.1"
                     /db_xref="GeneID:40382997"
     CDS             1005960..1007936
                     /locus_tag="C5L36_0B04820"
                     /inference="similar to AA sequence:RefSeq:NP_013234.1"
                     /note="PKUD0B04820; similar to Saccharomyces cerevisiae
                     YLR133W (CKI1) and YDR147W (EKI1); ancestral locus
                     Anc_8.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320709.1"
                     /db_xref="GeneID:40382997"
                     /translation="MSPLERPTCVRRHSSNTTSPHLRPRRSSITSYSQTSTIRSTSHT
                     RGHGTVTRQHSNTPSAISLSSLNNIGDHLVYNNHHRAQIPPKSPRLLTSSNPTITRNS
                     SHTRFSLNTAQHRSFQSNDINEDNIDSVILNVNLDNSLPTDYFKQDILSVIKSLKIPK
                     WRKIEKSNYKQIGIDRISGAMTNCVYKLTYSNYYPLLLRIYGDMEDIIDRNSELLTLV
                     RLSRKNIGPKLLGCFSNGRFEEFLNNSITLNKSQIRDQKISRMIARRMKEFHSGVELS
                     FDEINQGPKSWILIERWIEIVDQIIQKENADENTQKSVFMLNWESFKHCVFIYKDWLF
                     SKYDVQTLKDSLRFCHNDAQYGNLLFYNKSDALSMDDDDTNNNKNNDGNYDKNSTSYK
                     DTIVADSEITNLSLDQLSIGSHSTNQELPLITEKTFENDTKLTVIDFEYAGQNPAAYD
                     IANHFCEWMYDYHDPVENYKTNELKYPSVEDRINYLNSYVKYVPGSTTPNFKPVQLSE
                     LHHEISENPPKLIKSIKLSDLPSQVKQLYNDIIYWRSTSSIFWALWAVISRGSISSRP
                     VLPNNTENFEFGPNGETYKIVSEFDQLADCNSSEDEYLEQTLDDEFDRLKYALGKTGI
                     FIGDMIQLGLLEEKDVDTENKSKIKYLDVELLPI"
     gene            complement(<1008104..>1008832)
                     /locus_tag="C5L36_0B04830"
                     /db_xref="GeneID:40382998"
     mRNA            complement(<1008104..>1008832)
                     /locus_tag="C5L36_0B04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464851.1"
                     /db_xref="GeneID:40382998"
     CDS             complement(1008104..1008832)
                     /locus_tag="C5L36_0B04830"
                     /inference="similar to AA sequence:RefSeq:NP_076891.4"
                     /note="PKUD0B04830; similar to Saccharomyces cerevisiae
                     YGR271C-A (EFG1); ancestral locus Anc_5.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320710.1"
                     /db_xref="GeneID:40382998"
                     /translation="MAKRNENSTQASVDLTKALMHGSSGIKKKIRDISRLLTKDTLPA
                     DVRVANERALSTLKLELEKIQSEQKAKKVALRYHKVRFFEKKKAIRFYKKSKREVEEL
                     ETKLNEVTGESERKDTKKQYKKAKRVFEHCKIDLAYILNYPKDEKYISLYTKTVVENL
                     PKKAIDGINRANQRKEALKKMFAEQLANNELPISLEEGLSGQVAKDSNNKNNGTSKKT
                     TNTIQNVDDMKVDTKEKEEDNFFE"
     gene            complement(<1009091..>1010659)
                     /locus_tag="C5L36_0B04840"
                     /db_xref="GeneID:40382999"
     mRNA            complement(<1009091..>1010659)
                     /locus_tag="C5L36_0B04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464852.1"
                     /db_xref="GeneID:40382999"
     CDS             complement(1009091..1010659)
                     /locus_tag="C5L36_0B04840"
                     /inference="similar to AA sequence:RefSeq:NP_009983.1"
                     /note="PKUD0B04840; similar to Saccharomyces cerevisiae
                     YCR054C (CTR86); ancestral locus Anc_6.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320711.1"
                     /db_xref="GeneID:40382999"
                     /translation="MKTVKECTVLVAVDNYFQGEKCDVESLIESLGTIIWKTSMMMQN
                     KAMWEYTISLSKCEDIWVLTIEILKKIEHKEISFSENDLRLIKGITLLIRNLSISYRE
                     SNRHSHAINILQNEYLVKILHNMFCFIDVNTEVALQLRALDVMIVCFHCLFNCYKQAR
                     DSLSIELLTQSLKCLISKLQTVGTLCELKQILPQLEHLCSSSDTKKLLLKDNCEFFLN
                     IFRSISRILNVNPQIDIQNLREINPDHYQVFLTLAKSIVHLFDEGTLAVNMFKSAQTD
                     PEKNSNNLFTFLIVLQFAFSTEEQENDIDYAALGLMCLEFYEIFEKNCIELLENRKMD
                     QEDWNKLACYHRIIISLLDIVSNLLPYKLFLETLKSYNFVEKIVCFLQIIENNTERRR
                     LKDLESPMGDKKVFGNVKTILIEIITYLVHNDKESQDLVRENGGLILILNNCNLDVNE
                     PFIRERCILCLKYLLENNAENQAFVASLEPKKVEVTQENEKILEKSGYEVEIVDGKVK
                     LKKTNDLIGKIEGN"
     gene            complement(<1010932..>1013715)
                     /locus_tag="C5L36_0B04850"
                     /db_xref="GeneID:40383000"
     mRNA            complement(<1010932..>1013715)
                     /locus_tag="C5L36_0B04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464853.1"
                     /db_xref="GeneID:40383000"
     CDS             complement(1010932..1013715)
                     /locus_tag="C5L36_0B04850"
                     /inference="similar to AA sequence:RefSeq:NP_009984.1"
                     /note="PKUD0B04850; similar to Saccharomyces cerevisiae
                     YCR057C (PWP2); ancestral locus Anc_6.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320712.1"
                     /db_xref="GeneID:40383000"
                     /translation="MKSDFKFSNLLGTVYRQGNIVYTADGSTLLSPVGNRVSVFDLIH
                     NKSFTFSYEHRKNISVIALNPQNTLLISIDEDGRGILVNFKARTVLHHFNFKNKVRSI
                     EFSPDGTHFAIAAGRFVEVWKTPDMSEDRQFAPFVRYRVYAGHYEDVTAVSWSGDSRF
                     ILSASKDMTARIFSLHSEDKHVKMSLAGHRNYVVKAFFNQSQEIIYTVSKDGAIFRWE
                     YTERPGEEDLPEEEKTMSWRIMAKNFFFAETNVKCCTFHTKSNLFIVGFANGEFRLYE
                     MPSFTLIQQLSMGANSVTTVSVNGSGEWIAFGSKELGQLLVYEWQSESYILRQQGHFD
                     SMNCLAYSPDGSRIVTASDDGKIKIWDIVSGFCLATFDEHQSSVTGVVFAKRGQVMFS
                     SSLDGTVRAWDLIRFRNFRTFTSTRRIQFSSVAVDPSGEIVCAGSLDDFDIQVWSVQT
                     SQLLDQLSGHEGPISCLSFGTETNARLASASWDKTVRIWDIFGRSQTSEPFDLTSECL
                     SLAMRPDSKEVAVSTMDGHLTFFDIENGKMVREIDGRKDILQGRYREDEFTSKNSKRG
                     KHFDTIAYSFDGLTLIAAGNNNSICLYDLPNEVLLKRFKISLNMQLNGTLEQLNSKNI
                     VDGQAVDLVDRSGELSDAEESHKADIRLPGSHRGDIGLRSTKPEIRVMSVGFSPTANA
                     FAAASTEGLLIYSIDDSLIFDPIDLDIDVTPENTLSCLGEGEYLNAVAMAFRLNEVYL
                     IQKVYESIKKEDIKLVARDLPVIYVPKILEFIGNLSTESAHVEFNLLWIEQLITLHGK
                     FITQNKHLFARGIRSIQRFLTRTAKDVVSYGKKANNLSRFLLASTAINTSDCDYKELE
                     NDAVIEDVEEADSDIMDVNEEEEKSDDEDEEEKEEEEAEEEGGWFGPNENGKKYIDNF
                     AHSDSEEDHDDVE"
     gene            <1013995..>1014528
                     /locus_tag="C5L36_0B04860"
                     /db_xref="GeneID:40383001"
     mRNA            <1013995..>1014528
                     /locus_tag="C5L36_0B04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464854.1"
                     /db_xref="GeneID:40383001"
     CDS             1013995..1014528
                     /locus_tag="C5L36_0B04860"
                     /inference="similar to AA sequence:RefSeq:NP_014421.3"
                     /note="PKUD0B04860; similar to Saccharomyces cerevisiae
                     YNR024W (MPP6); ancestral locus Anc_6.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320713.1"
                     /db_xref="GeneID:40383001"
                     /translation="MSGSLSDRVSSMKFMQVAGDRHRTIAKEEADSQKKKKMQDFSEW
                     SLPMTSKTLKVLKSKSKRIPKVGYTNINTMLPRISKDINHQIIGRKTMDSSVEEIVKK
                     PTLNSEDVRNHENREVTTKGKTEEEEKPKKSKKGKKSKKSKPMSDFQLKSDDEFDPTE
                     VELSSKSLLDLWKAKKS"
     gene            complement(<1014586..>1015578)
                     /locus_tag="C5L36_0B04870"
                     /db_xref="GeneID:40383002"
     mRNA            complement(<1014586..>1015578)
                     /locus_tag="C5L36_0B04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464855.1"
                     /db_xref="GeneID:40383002"
     CDS             complement(1014586..1015578)
                     /locus_tag="C5L36_0B04870"
                     /inference="similar to AA sequence:RefSeq:NP_009985.1"
                     /note="PKUD0B04870; similar to Saccharomyces cerevisiae
                     YCR059C (YIH1); ancestral locus Anc_6.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320714.1"
                     /db_xref="GeneID:40383002"
                     /translation="MHESEELVQEAGAIEAIYPECIEKLFEGVYKLRIPQHEHILFQM
                     SFPEDYPESKPYILDVVSEKEGFDEKYLMELFQDVLDSIYHEGVVVIFDLFTELEAVL
                     HIEEDADEEIKNEEDHWGMDESNVRNLATNLEASKVIRETGEEEEKKKEEQEQEQPQS
                     HLEYVYAKNKEKRYAKTGKPDNYTKPNKMSDPLDGWIISEPISDRKSTFVAFAKEVHS
                     LDDAYMKLSRLMEDKKVSRANHAMRAWRIKDSEKGVQYQDCDDDGETAAGGRMLHLMS
                     IMDAWNVMVVCCRWFGGVHIGPDRFKHINSTTRDVLVKGNFVDIDSKKSKKKRK"
     gene            <1015781..>1016794
                     /locus_tag="C5L36_0B04880"
                     /db_xref="GeneID:40383003"
     mRNA            <1015781..>1016794
                     /locus_tag="C5L36_0B04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464856.1"
                     /db_xref="GeneID:40383003"
     CDS             1015781..1016794
                     /locus_tag="C5L36_0B04880"
                     /inference="similar to AA sequence:RefSeq:NP_009986.1"
                     /note="PKUD0B04880; similar to Saccharomyces cerevisiae
                     YCR060W (TAH1); ancestral locus Anc_6.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320715.1"
                     /db_xref="GeneID:40383003"
                     /translation="MFEDQSDTLKEEGNVYFRKNDYISALVKYTEALCSNSRNPVLYS
                     NRASTFLKLNSLENALNDCNKGLKLVTNKDKGSTYIKLLWRKSIALRRSGDLENALDT
                     IKTALNVKPTSKELQHELEAVDYQMQKRNSKLSHVETDTPNQGILQRNSDTLYIPIQE
                     VQKIPTNFYSPEAPEDNEYIEDNPPEMKNQIKNQNEINAKRNLTTSSFPSSSNFEFDE
                     VDFPLKPTVQFLLSLKDKPKEFNAKSYRYVIEIDPEHYCQIFGNSGIDPSFLNFMLDS
                     TIYVLEKNQLDLKQKILNLFSMCTKLPRFSLTSMFVDTKTVNRLHFLFQERLNESFDN
                     YWL"
     gene            complement(<1017558..>1017917)
                     /locus_tag="C5L36_0B04890"
                     /db_xref="GeneID:40383004"
     mRNA            complement(<1017558..>1017917)
                     /locus_tag="C5L36_0B04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464857.1"
                     /db_xref="GeneID:40383004"
     CDS             complement(1017558..1017917)
                     /locus_tag="C5L36_0B04890"
                     /note="PKUD0B04890; Pfam Domains:
                     Glucan_synthase(9.8e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320716.1"
                     /db_xref="GeneID:40383004"
                     /translation="MFTAGIKTKEANSDTTTFMGSNHRLHSLLSLIIAQIGPKMLSVL
                     LGGAYFFSNFQIITTVMILVNSVVRLLAFVFGPIIINAGILLEMFLGLIVTASMVTCS
                     SSRLPSVIANFAHMASV"
     gene            complement(<1018609..>1018986)
                     /locus_tag="C5L36_0B04895"
                     /db_xref="GeneID:40383005"
     mRNA            complement(<1018609..>1018986)
                     /locus_tag="C5L36_0B04895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464858.1"
                     /db_xref="GeneID:40383005"
     CDS             complement(1018609..1018986)
                     /locus_tag="C5L36_0B04895"
                     /note="PKUD0B04895; Pfam Domains:
                     Glucan_synthase(9.2e-23)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320717.1"
                     /db_xref="GeneID:40383005"
                     /translation="MGTLSLLIINPSTIVVLMILSIVGSIVSFLNLVALLLELDFVPR
                     DFAGVLPVTSRFQLVFFTCKRGGVLKFQRDLLLNEGIYAGMRALMLGGRIKYCEYFQC
                     GKGRDLSFLFYLKLYNKSRFRNE"
     gene            <1021317..>1021889
                     /locus_tag="C5L36_0B04900"
                     /db_xref="GeneID:40383006"
     mRNA            <1021317..>1021889
                     /locus_tag="C5L36_0B04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464859.1"
                     /db_xref="GeneID:40383006"
     CDS             1021317..1021889
                     /locus_tag="C5L36_0B04900"
                     /inference="similar to AA sequence:RefSeq:NP_015315.1"
                     /note="PKUD0B04900; similar to Saccharomyces cerevisiae
                     YPL010W (RET3); ancestral locus Anc_8.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320718.1"
                     /db_xref="GeneID:40383006"
                     /translation="MTDNTSLYSITAVLILDNQQNRIYTKYYKSPHVEPVSELVTNPK
                     KQKQFESDLFKKTSKQNSDIILFDHHTVVYREFSDFIIYTIGNLDQNEVLLYNVLQGI
                     AGSLEIILDSQMDKRSLLESFDMVAIAIDETIDDGIVLETDPNAIAARVTNPPTEDIT
                     NIKIDLSEKGLLSAFNFAKKNISERLQQGF"
     gene            complement(<1021973..>1024996)
                     /locus_tag="C5L36_0B04910"
                     /db_xref="GeneID:40383007"
     mRNA            complement(<1021973..>1024996)
                     /locus_tag="C5L36_0B04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464860.1"
                     /db_xref="GeneID:40383007"
     CDS             complement(1021973..1024996)
                     /locus_tag="C5L36_0B04910"
                     /inference="similar to AA sequence:RefSeq:NP_015316.1"
                     /note="PKUD0B04910; similar to Saccharomyces cerevisiae
                     YPL009C (TAE2); ancestral locus Anc_8.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320719.1"
                     /db_xref="GeneID:40383007"
                     /translation="MKQRVSSLDLKILIAELKKSIHNYRLQNIYDLVANNRSFLLKFS
                     IPDSKVNVVLESGFKVYMTDFQRPTQPEPSNFTSKLRKHLKTKRVTDIKQVGDDRIVV
                     FEFGDGLYYLVLEFFSAGNVILLDENLKIMAIYRFVDTDSNSIKGNYDVGSIYNMFDK
                     SLFEDSCVALHDELYDEDTLLKWIEDTNQTEREPKKVLSIEKLCFQNAAYLSSDLIHI
                     SLLANSVPPKTSCLKLLEDDQLLKFTSKSMKDSKAKYDQLIETPVGEVEGYILSRKNE
                     LFDTEKDASADNLEYVYHEFHPYEPSHKINDNVKIECFKGYNKTVDKFFTAIEMSKVS
                     LGRQQQKANISKRLQYVKDEHSKKLQVLDEVQALNNKKGTLITYYNEKIEECKRAVQE
                     LIDQKMDWKNIEKYIKVQKDRGNEIAKMIKSLNLIKNEITISLVDNEDEYDGDEDDME
                     ESGWSTDDSDSDSDSDSESKSDSVNGSSKIQATNVVDVVIDITLSAFANASRYFDAKK
                     TARDKQEKTAKNAALAIRSSEQKIQNDLKRMEKESKQNVEFKQLRPKFWFEKFFWFIS
                     SEGYLCVAGRDDNQVDSIYYKYFDNETDCLVSNDLENCLKVFIKNPYKNKDIPPTTYM
                     QAGIFSLSTTKAWDNKMVTSPWYVPGKGVSKKDFDGTILPTGLLNVNKERNYLPPCQM
                     VMGAGLLFLADKETFTRYREGKKQRDGELELISGSKSKGSASKILELKTMLAKLQDAE
                     KSDTGESVNEIETENDEQKSSENDEVIMAPLPAQQTQTTIRGKKNKLKKIKEKYGHQD
                     DEERRLRMAVLGTLKQVEDKQKFEDKKSNEDPRMSIAAKKRRKRQQQINQITKLIDEL
                     ENKGDETDVGESDEYMNLVNDVDNYHLNISGLLGAPKKTDVVSDCIPVFAPWSALNKY
                     TYKVKLQPGNLKKGKTVKDIVETFKRRTGELIKDESDWYDRDNKIELINEQEFMMALT
                     ASKFKIGSSGSSSGKNDSRGGNNRSKGGKAKSKKK"
     gene            <1025244..>1026251
                     /locus_tag="C5L36_0B04920"
                     /db_xref="GeneID:40383008"
     mRNA            <1025244..>1026251
                     /locus_tag="C5L36_0B04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464861.1"
                     /db_xref="GeneID:40383008"
     CDS             1025244..1026251
                     /locus_tag="C5L36_0B04920"
                     /inference="similar to AA sequence:RefSeq:NP_015310.1"
                     /note="PKUD0B04920; similar to Saccharomyces cerevisiae
                     YPL015C (HST2); ancestral locus Anc_8.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320720.1"
                     /db_xref="GeneID:40383008"
                     /translation="MPVPTKDIDKIVKLLQKENSKVVFFVGAGISTNCGIPDFRSPET
                     GLYANLRKLSLPYPEAVFDIEYFKNKPKAFYTLADELFPGKFAPSKFHYLIRLCQDKN
                     LLKRCYSQNIDTLERIAGVEDDKIVEAHGSFASNHCIECNTEMSKEKLREFMNRGEIP
                     SCLECQGYVKPDIVFFGEALPTKLWDLWEEDVDDMDIAIVAGTSLAVYPFANLPAEVT
                     KKATRVLINRELCGDFELSPRKTDIVLLEDCDSIAETICERLNWSKELEQLVAKGKSQ
                     IGGTRYKGDETAVELGELISEKVSKAILKEEGQEGDRKDGEKEEDICALVDAMENVKV
                     D"
     gene            <1028295..>1030082
                     /locus_tag="C5L36_0B04930"
                     /db_xref="GeneID:40383009"
     mRNA            <1028295..>1030082
                     /locus_tag="C5L36_0B04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464862.1"
                     /db_xref="GeneID:40383009"
     CDS             1028295..1030082
                     /locus_tag="C5L36_0B04930"
                     /inference="similar to AA sequence:RefSeq:NP_015305.1"
                     /note="PKUD0B04930; similar to Saccharomyces cerevisiae
                     YPL020C (ULP1); ancestral locus Anc_8.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320721.1"
                     /db_xref="GeneID:40383009"
                     /translation="MNIYEGRRMGSVSSVESNSRSSFFSQYDFNNLPTFASSQTNSTG
                     SKNSNVHHNTSFTTRNTPSSKVELPFLPNRDVPSYVLDEARFPDPTLNRIFSNKATNP
                     MFGKRVWSTNSERSSHGDREDLYNSGLSSSNELMELIQNFGSLIYLLICKGGIWGLWF
                     LNALSKMLLKKVRTIPEPDNSERDENYETVISAESTPIKKDGEDKNIETPLFYQKLRS
                     LNVYDRLREEQAQPLHKAEKVNYKKPKQQYGTQFFKNPSSRMNLETEYLRTALKPLNL
                     PSEDVYSKSQKIKENLCAIYSEVRQNPANPTFTRSTTRFRDLEWLVDDNEDYLNNLER
                     TRRFKEYQNILAERKKMQQIIHLSKLKETGFGVRKLTGDQVAEIEKIWEIQPKDTIID
                     KFRIKITSRDLLTLCDRHWLNDNIIDFYLQLVKEDVNSRKLNQIHIFSTYFYTTLKEK
                     GYIGVKKWGKRAKVDVSELDMVFVPVNLHQTHWALAVIDNKNERFFYVDSLFGDGTDI
                     LYLLMDYMTEETKKNHGSLNRRNYSNYSVIGKYECPTQQNGYDCGVFTCTAADYLSRN
                     RELDYSQADMPDLRRRMGWEILKGKLIEH"
     gene            <1030913..>1033366
                     /locus_tag="C5L36_0B04940"
                     /db_xref="GeneID:40383010"
     mRNA            <1030913..>1033366
                     /locus_tag="C5L36_0B04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464863.1"
                     /db_xref="GeneID:40383010"
     CDS             1030913..1033366
                     /locus_tag="C5L36_0B04940"
                     /note="PKUD0B04940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320722.1"
                     /db_xref="GeneID:40383010"
                     /translation="MTIDIPGTIATTLTLTPLQEKAIFGVDILKNINDEALISDSTMR
                     IWKKLQEGDEGLISGWISSKVVTNEFEYAILLSVLSLYQVRNSSEVADSFDATNQIVL
                     NRIVENGRNALPSFSNLISWDKLDDIIRVLIQTTFKDTNSFESFRDRFNVLVKSAKSN
                     FGTIIMYLIGFNKFKESKAELKNISESFKSVIDTYYAQFKFPDATRSNASEVNQLMDL
                     VIYIASDRSLSAYLNIHSSINKYIHVTYHNVKVMKLWCLEALINGSNLEAKSTFRTYI
                     NYIKDYKAKHNGGLYDIMDVIHTFLFTLEKISENLRDHEEYRELNSWAKEARHIIDAL
                     FTIIGTDKTTYHRSLRKKLAEIYYICAVIKENSLKLESEPASKIGIISEYLTRSVSYL
                     SNDLKLLPIYVASIYYKHSYYLHKLGLHKKAIKYCKESMRHHPDKIKYINYYVKLLTG
                     DEDNLEKALLISQQVIENLHAVADSKRSMSWKNDALESYLIFLTLLGDSAIEVLGPFF
                     GFINKIFENQEFREPKGTSKNSGEEKVLKNTTPAYSVVNGNSEDMDGCTSCALSVDSM
                     NKGSTFKSVLKIGSGKGNKKDLSVKAIRRSLHVHRKNSLSTSSCSPGSQHHPERGKTK
                     NAMHKEEEILLCHMWLVLSRLFQANGYEVEALQCVEEAEDLANTPIMEIGVYARKGCV
                     LATRETQEEVNQGCKYLEKSFTMLEEVSIENSLHMLNNEPRYTEWSCILESIVGVAQV
                     ARDLERAGDRNATIDVGVDRESSRARAAHAQKMARWCLQQVAQHDNATLRLLFCDNDN
                     VVAAQDTVHGWHGFGIYCM"
     gene            <1033683..>1035827
                     /locus_tag="C5L36_0B04945"
                     /db_xref="GeneID:40383011"
     mRNA            <1033683..>1035827
                     /locus_tag="C5L36_0B04945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464864.1"
                     /db_xref="GeneID:40383011"
     CDS             1033683..1035827
                     /locus_tag="C5L36_0B04945"
                     /inference="similar to AA sequence:RefSeq:NP_012718.1"
                     /note="PKUD0B04945; similar to Saccharomyces cerevisiae
                     YKL204W (EAP1); ancestral locus Anc_1.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320723.1"
                     /db_xref="GeneID:40383011"
                     /translation="MTDKLMSMLQQATLHAEKERTFGDSIQESPQMNQQEALLMSMLR
                     DTQSEQTKGEEKLDQSNEKSSQMVQEQDACDTESDLEAGAISRLRKIIYTPQFLLSLE
                     SSPLVPRASYWVSELPPIEFFRLSQSKGGDHLRQRRKSSNGSSSREDRKSQRARQKEN
                     KKKGQKHEQVIEEEHPDWMDSKDVKTGNSILDFEIWRLKMRIETAKRNGEPINPEDEL
                     ELQQLQKSSKIVVGADTKGAHQLIDRDNDGGSNKEDGSEKEKLNHKHHIISADDQFEL
                     LSDLPSKNNVNSIDDVFIRENNSSNSINRNNSTPKSTVNTLQSGFSSFFDSPVSKEQT
                     VPHADDKRSSRLMSILADTPSSDSPSRQQPNLSSPLPSVAANSSFAPKKESDKLFFQS
                     LMEKSSPQPPQLPDIASSITSMSQQLPQQAQQLPQQARNMGGMNQLGRGNDINNMHLG
                     MNPFMNPQFAQLPPQIQQQLIQQHKLQQLQFMQMQMQMRMQNQQQQQQQQQQQQQQQQ
                     QQQHPQQLQSTPSLQHLTQPSQSPGMSNSPLYNSPRFKSAQLNHSPHGLNAPSNYSPH
                     AQHTPLRNSPQMSSTTHHQQLQPQPEPLHPYQQQLTSPSQLAQLPSQQQQSVNNGNTP
                     VQSHLPYGAHHSMPGMTPNHPLMKLLSKNKRKSISDSKEASPSPPPQSNQAMQNQLPP
                     GMYGMPNVDMLNVSTVQNTPNFSSNTGRYVQR"
     gene            complement(<1035927..>1036916)
                     /locus_tag="C5L36_0B04950"
                     /db_xref="GeneID:40383012"
     mRNA            complement(<1035927..>1036916)
                     /locus_tag="C5L36_0B04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464865.1"
                     /db_xref="GeneID:40383012"
     CDS             complement(1035927..1036916)
                     /locus_tag="C5L36_0B04950"
                     /inference="similar to AA sequence:RefSeq:NP_012602.3"
                     /note="PKUD0B04950; similar to Saccharomyces cerevisiae
                     YJR068W (RFC2); ancestral locus Anc_1.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320724.1"
                     /db_xref="GeneID:40383012"
                     /translation="MSEQPWIEKYRPKSLKDVASQSNTTNILEKSLHTANLPHMLFYG
                     PPGTGKTSTILALAHELYGPNLISSRVLELNASDERGISIVRDRIKNFARLAVSNPTA
                     EDREKYPCPPYKLIILDEADSMTSDAQSALRRTMENYANVTRFCLICNYVTKIIDPLA
                     SRCSKFRFKSLNKELGLQRLRYIANQENLGIGDDELNEILDVSEGDLRRAVNLLQCVS
                     TVFNDSTNLKIKELFGELPDSLIKETITVLKSKNLSQVAKFTESSLIAQGYSASFVLL
                     GIHDELLIKDPTLSTLQKNQISQILWKADMRVSNGCNESVQILNCMYNLCNVL"
     gene            <1037230..>1037826
                     /locus_tag="C5L36_0B04960"
                     /db_xref="GeneID:40383013"
     mRNA            <1037230..>1037826
                     /locus_tag="C5L36_0B04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464866.1"
                     /db_xref="GeneID:40383013"
     CDS             1037230..1037826
                     /locus_tag="C5L36_0B04960"
                     /inference="similar to AA sequence:RefSeq:NP_009837.1"
                     /note="PKUD0B04960; similar to Saccharomyces cerevisiae
                     YBR278W (DPB3) and YJL065C (DLS1); ancestral locus
                     Anc_1.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320725.1"
                     /db_xref="GeneID:40383013"
                     /translation="MDNEHKEDGGMSLQMSKIKKIIKLDPEHVSSTESANYVLGAATE
                     LFIKQLVMDASTVTKSKGRKKVMYDDIQKVVSSVDIYTFMKDIVPKTAPIGELLRSRA
                     IRLREEDAMRVSSKGDETGEGEGREGLAGDGAGAEHEDEGDGLVTGEREECAGLAEDG
                     DEAMEVDTVVDADAGSGERVHESGTTTDTGELTHRGAV"
     gene            complement(<1037937..>1038374)
                     /locus_tag="C5L36_0B04970"
                     /db_xref="GeneID:40383014"
     mRNA            complement(<1037937..>1038374)
                     /locus_tag="C5L36_0B04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464867.1"
                     /db_xref="GeneID:40383014"
     CDS             complement(1037937..1038374)
                     /locus_tag="C5L36_0B04970"
                     /inference="similar to AA sequence:RefSeq:NP_009841.1"
                     /note="PKUD0B04970; similar to Saccharomyces cerevisiae
                     YBR282W (MRPL27); ancestral locus Anc_1.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320726.1"
                     /db_xref="GeneID:40383014"
                     /translation="MYSFSAPTQRSFHSSASALLRRPWKTYKDGTLFYGQSKSGNKRV
                     PLSTKQGNKNFYKGTRSSGIGRLSDKGKYMIDYNRVRTFVPPADMATPLKPLVSASVP
                     VPKNTFRGYTGVTDGRLWLDKVKEYVETGDVKFVKTETYIEKY"
     gene            complement(<1038686..>1039414)
                     /locus_tag="C5L36_0B04980"
                     /db_xref="GeneID:40383015"
     mRNA            complement(<1038686..>1039414)
                     /locus_tag="C5L36_0B04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464868.1"
                     /db_xref="GeneID:40383015"
     CDS             complement(1038686..1039414)
                     /locus_tag="C5L36_0B04980"
                     /inference="similar to AA sequence:RefSeq:NP_012716.1"
                     /note="PKUD0B04980; similar to Saccharomyces cerevisiae
                     YKL206C (ADD66); ancestral locus Anc_1.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320727.1"
                     /db_xref="GeneID:40383015"
                     /translation="MDKTLALPLVAMGNVPQIAIQLAVDFRKDQLAKTTIYSTYQYPF
                     VGPDLSVGEASNRVIGKRKDLARPLHLYRGHGGTSEPRVDYLQLHSPIIPGCESLFIK
                     ELVKLIEHEQYTKIIVFDAKDRGLWHGENATLVEERVLHWGNQTLSGLHLDDDDDDDH
                     DVADTRRGKGGDSEELPSVNDTNPFVRFLVNMLPETEIDYYAVSVYDGWNMDAAYALL
                     DAARLPVERVAERDAFEPTPGVYV"
     gene            <1039869..>1040816
                     /locus_tag="C5L36_0B04990"
                     /db_xref="GeneID:40383016"
     mRNA            <1039869..>1040816
                     /locus_tag="C5L36_0B04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464869.1"
                     /db_xref="GeneID:40383016"
     CDS             1039869..1040816
                     /locus_tag="C5L36_0B04990"
                     /inference="similar to AA sequence:RefSeq:NP_012604.1"
                     /note="PKUD0B04990; similar to Saccharomyces cerevisiae
                     YJR070C (LIA1); ancestral locus Anc_1.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320728.1"
                     /db_xref="GeneID:40383016"
                     /translation="MSMDENTSLETLRDVLVNASGKTPLADRFRALFYLKSIGTEFKE
                     TPERARTAIKYIAEAFGDSSELLKHEVAYCLGQTHNLESAPILRDVLADKHQQCMVRH
                     EAAEALGALGDKDSLEILSRYFQDPQEMVEIKQTCELAIERIKWENSNLSKEEILQKS
                     LYESVDPAPPLPLDKSTDKVENLQRILNDTNEPLFQRYRAMFRLRDLGTDEACLALAS
                     GFSDDSALFKHEIAYIFGQMCNPVTVPSLVDVVQRQNEAPMVRHEAAEALGSIATSDT
                     LPVLKALLKDNDEVVRDSAVVALDMWEYENSGEIEYAKV"
     gene            complement(<1041119..>1041490)
                     /locus_tag="C5L36_0B05000"
                     /db_xref="GeneID:40383017"
     mRNA            complement(<1041119..>1041490)
                     /locus_tag="C5L36_0B05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464870.1"
                     /db_xref="GeneID:40383017"
     CDS             complement(1041119..1041490)
                     /locus_tag="C5L36_0B05000"
                     /inference="similar to AA sequence:RefSeq:NP_012597.1"
                     /note="PKUD0B05000; similar to Saccharomyces cerevisiae
                     YJR063W (RPA12); ancestral locus Anc_1.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320729.1"
                     /db_xref="GeneID:40383017"
                     /translation="MSAVGSLIFCTSCGNLLDSISHQQHLTCSVCRKQYPSNQFSKLK
                     VVTHTSPDAFPSALKSRKSLVKTTLKHDEIEDGATIKEKCPQCGHDEMQYHTLQLRSA
                     DEGATVFYTCTKCGYKFRTNN"
     gene            <1041775..>1043475
                     /locus_tag="C5L36_0B05010"
                     /db_xref="GeneID:40383018"
     mRNA            <1041775..>1043475
                     /locus_tag="C5L36_0B05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464871.1"
                     /db_xref="GeneID:40383018"
     CDS             1041775..1043475
                     /locus_tag="C5L36_0B05010"
                     /inference="similar to AA sequence:RefSeq:NP_012598.1"
                     /note="PKUD0B05010; similar to Saccharomyces cerevisiae
                     YJR064W (CCT5); ancestral locus Anc_1.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320730.1"
                     /db_xref="GeneID:40383018"
                     /translation="MAHPQQMSMPMPDMSNAIMAQDELGRPFIIVRDQSNKTKTSGLE
                     ALKSNIQAARQVSDILRTSLGPRGLDKILISPDGDINITNDGATILSEMQIDNEIAKL
                     LVELSKSQDDEIGDGTTGVVILAGALLDQALKLVEMGIHPIKVANGYEKASKIVSSHL
                     DEIADEIFIDTEHLENNLLESSDLFKAAKTSLGSKIVNKNHNQFAKMAVESVLKVADL
                     NRNDVDFELIKLQGKLGGPISNSKTINGVCIDKDFSHPQMPKVVNNAKIAILSCPFEP
                     PKPKTKHKLEISNVDEFKSLQKYESDKFTEMIESIKKCGANLVICQWGFDDEANSLLL
                     SNNLPAVRWVGGSDIESIAIATKGSIVSRFEDLTPEKLGYADKVYEVEFGTTRDKMII
                     IENEKLMKNNTQVNTVTNLIRGSNKMIVDEAIRSLHDSLCVVRNLIKDNKIVYGGGAV
                     ETSCSLKIMEEADKQKGIDQYAFRAFSQALDVIPMSLAENSGYNPIEELTKLKAAQVS
                     QKSSRLGIDCLGNNTNDMKDLFVIETYLGKKQQLLLATQLTRMILKINNVIVSGKDQY
                     "
     gene            <1044139..>1046568
                     /locus_tag="C5L36_0B05020"
                     /db_xref="GeneID:40383019"
     mRNA            <1044139..>1046568
                     /locus_tag="C5L36_0B05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464872.1"
                     /db_xref="GeneID:40383019"
     CDS             1044139..1046568
                     /locus_tag="C5L36_0B05020"
                     /inference="similar to AA sequence:RefSeq:NP_014031.1"
                     /note="PKUD0B05020; similar to Saccharomyces cerevisiae
                     YMR302C (YME2); ancestral locus Anc_5.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320731.1"
                     /db_xref="GeneID:40383019"
                     /translation="MLTVQSRALSSLSRSIAPVTLLMLKRGLATYSYTGRKPINEATI
                     IENSNLGEDTNISDTGFILKSNNKTTLYIDHICFPKESKWDIKQFISPLLYPSSAEAI
                     TKYVADLTSSYKNVEIIPIPRDGGAFATFELPAATTPQLYNKSIIYNLSEKIVKKHRF
                     FLRIGIFPVKGIPWVEDMGRYASKTLKVKFEGDELSQESLYAMFRRYGKISDIVLPKP
                     GDMERVALVTFWSNRSAICARHCLTGSDVGGTTIHIHYKKKVSDHWLPTFIRDHPRIA
                     IPLLLAFAAATAVLIFDPVRSWFIKEKIKGELEINRYFWLQEMWRGWITTRNKVKGLL
                     NYKQNEEAEWELWGEIDDLMEEREKKAKDLKIWLEENVNSMIVVQGPPGSGKRHLVNT
                     MVLEDRENVLYFDCENVIKSRKDYQLIQSFAHEIGYFPVFSFVSSVSSFIDLVVKSLT
                     GQNSGLTETKESQTQAMLTLSIGAIRDLSLRSYREMLSNNADFNMKEEDYLQQNPHCK
                     PVIVIDRYQSSRKKNQSNAFIYQQLAEWAANLVQLNIAHVIFITDDVGSVQDLIRALP
                     SAPIKRIVLSDASKTASSIYVKHALGEDFVNQNESYRAELEKYTDMLGGRMRDLQMFV
                     RRIRSGDSPKEAFEGLTQQSIEQLSQVFLAGTQDYGFNVSQAWQIIKLLSEKEEVPYD
                     DIFLLPMFKANTFKILQSMENVELVRLNRIDGVISSVLPGKPLYLRAFKEMMNDPEIY
                     KAVQKECLLGMIEFETNRIRKFIEELNKFKEVPEPKLFKERLQYLSGKIEGGSKVITE
                     CEKEMMKLKEK"
     gene            complement(<1046648..>1047697)
                     /locus_tag="C5L36_0B05030"
                     /db_xref="GeneID:40383020"
     mRNA            complement(<1046648..>1047697)
                     /locus_tag="C5L36_0B05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464873.1"
                     /db_xref="GeneID:40383020"
     CDS             complement(1046648..1047697)
                     /locus_tag="C5L36_0B05030"
                     /inference="similar to AA sequence:RefSeq:NP_012075.1"
                     /note="PKUD0B05030; similar to Saccharomyces cerevisiae
                     YHR205W (SCH9); ancestral locus Anc_4.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320732.1"
                     /db_xref="GeneID:40383020"
                     /translation="MDQLEGKQWKVVSRLSGGRFSDVFKIERVVEGKESELRMGEPVN
                     YSIFALKVVDPDECKPPHNIRNEIQILQKLEEHRRRSPTRRTNNVVTLVDVIYNNVEY
                     GLIFPYYDLSLTAYIKKNIKTRSKFNLDGSISPERINNVPIATTKSLLYGILNGLSWI
                     HDLGIIHRDINPNNILLANDKEISPVIIDFGISYEEPDNNGLESCNMKFTDIATGFYK
                     APELLLSKRDYSNKVDIWAVGILMTLLLSEDGREVFDPDATNSDLVLLSNIISVFGSP
                     PTDWSDCVGLSSFEAMNTTFFKKPAKPLEEIIPRLFKNPHLPEFGPLRKLFVGLTQYE
                     NKHRLSAADALKLLC"
     gene            <1048004..>1048465
                     /locus_tag="C5L36_0B05040"
                     /db_xref="GeneID:40383021"
     mRNA            <1048004..>1048465
                     /locus_tag="C5L36_0B05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464874.1"
                     /db_xref="GeneID:40383021"
     CDS             1048004..1048465
                     /locus_tag="C5L36_0B05040"
                     /note="PKUD0B05040; Pfam Domains: RnaseH(1.8e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320733.1"
                     /db_xref="GeneID:40383021"
                     /translation="MSVLDIYTDGSCRNNGHCDARAGYGVYFGPQDSRNTYGKLSKQY
                     LQNSINAELMAIYNALQLIQREIESIERRRSSPMRYNINIDCTEALRLITRRQKSRYS
                     STNEIVKDCLEMYHPLKNECLVQFSLVKGHSGIQGNEMADALAVMGSVLPE"
     gene            complement(<1048862..>1050406)
                     /locus_tag="C5L36_0B05050"
                     /db_xref="GeneID:40383022"
     mRNA            complement(<1048862..>1050406)
                     /locus_tag="C5L36_0B05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464875.1"
                     /db_xref="GeneID:40383022"
     CDS             complement(1048862..1050406)
                     /locus_tag="C5L36_0B05050"
                     /inference="similar to AA sequence:RefSeq:NP_012077.1"
                     /note="PKUD0B05050; similar to Saccharomyces cerevisiae
                     YHR207C (SET5); ancestral locus Anc_4.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320734.1"
                     /db_xref="GeneID:40383022"
                     /translation="MFFLFHWTLFLATVEPMHSETVPTTINYNVLGPILRKILSKNSS
                     NHVLRFDTSKNQIKLKNDKSIPGPICLESPFIALPNFDILKLLDKGHCCGYCGEVLKI
                     YDDGKMKDDGKKKNRLKQNSMEKHDRYINGLDCSDCNVKWCDSQCRRLDFRHQLLHHR
                     PTNKTFSHPFTDINGKEIDTFYFENWNALQTELIARGLYMLYNTILCIFQVYFDSSLK
                     ETYESLLCIDSKEAQELEAYIKSLLIMDASVDIKKIWEGFNKVFKNYGIDYVDFLRYS
                     IIYHLNNYNGSIYLIFATLTKSAEVDANAKVEYYNGAIQRDYEEFSMVPKTKSRDLHI
                     VKHHITDETKVSQIYTNQKSCRLDKKILEISTIKKTTAQDEIILSKQDYTNPLDLEDD
                     ELTFLPDHTSTIPKIVVPISGDTNQKRRPSRVSFTSSGASFGEGIIKYNRNQIREMLE
                     SMTETIEKDELEEVIDDDNVSSVGSTVTIVDKEKLVNMVKNLQIAPHATQRRKSVKFD
                     DNVSDI"
     gene            complement(<1050574..>1053828)
                     /locus_tag="C5L36_0B05060"
                     /db_xref="GeneID:40383023"
     mRNA            complement(<1050574..>1053828)
                     /locus_tag="C5L36_0B05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464876.1"
                     /db_xref="GeneID:40383023"
     CDS             complement(1050574..1053828)
                     /locus_tag="C5L36_0B05060"
                     /inference="similar to AA sequence:RefSeq:NP_013341.1"
                     /note="PKUD0B05060; similar to Saccharomyces cerevisiae
                     YLR240W (VPS34); ancestral locus Anc_8.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320735.1"
                     /db_xref="GeneID:40383023"
                     /translation="MTGQSSTVVNFALSKDFDEPVRVKLHLLKGVLSSALLEKHHGTL
                     SYHSKHKSYTDVLVKEKLKLLHSETELVVQIHVESGVGKQLCIPVTGGLRGHEEKSIC
                     HKVVKEGETTYIDDQLLVFETIDRELLQSDSEISVSSSYFQKQTGLDSQKSPFDEQWI
                     ELPIEYSKLPPEATLSFNIFSFNIQNGQRSIFYCGRLPLFESNFTLKSGVCEVTLSDP
                     YPEEELNKRSDQAAANSIPRFRDNKPDWLAKLTASKLEEREEKLSRLDSGFVQKQKLI
                     VELPYTDIPIVFSDIKYVPLNIPTHESSTSVVNYDPTFNRITYSNIGVDDLTKDEHKE
                     YIHRNELFDPDMIRGELMEDPIEKKFRRLERMQHLSPLDKELKPTLRMRETLSKVMKK
                     QFFQKMSAKERNIVWRYRWFILNSIIVGNPGQSNAVINFIKCVDWNNTIEVSEFKKIL
                     KSLQESKKLKLNTLGRTYESPIDVLIEKTQIIDCLELLSGNYRTPIVREMAVRRLQNA
                     NDTELAMFMVQLVQSIKNEMLVGDSEHAVSDANFGAPRMMPIAEEEMNRVEEEDNYLK
                     ITRNAGQNSGYTMGSSDYQFIEYDPVSHSDTSIVEFIDSILFKKNQKQENERSIKIKS
                     KFINFLVERSINNSTLTNYFYWCLKVELEEERLRNKSHLPGDADTSTSSGRNGNSAFS
                     NIYELTMKKFVISLFQSRQGKEKLYQLRRQIELVSKLHQMTLKIKIEHKKETTPRKLE
                     LLKEMLAEKHKKTIFGSAYDNRNSFIEESKYETMVDFPKLPLPLDPAIIVNGVYPEDS
                     AVFKSSLNPLKITFKTTTGRKYPIMYKIGDDLRQDQFVTQVITLMENILENENMDLKL
                     NPYKILATGQEEGFIQFIPNNSLSHILAKYNNSILQYLQTFNPDPTAHLGIVPQVMDN
                     YVRSCAGYCVVTYILGVGDRHLENLLLTKDGHFFHADFGYILGQDPKPFPPLMKLPIQ
                     IVDGMGGYDDINYKTFCQYCFITYITLRKNASLILNLVQLMINTSIPALRTGIENSES
                     EKMELLWKVEEKFMLDMDDESAVLHFQNLIDSSVNAVLPVVIDRLHNLAQYWRS"
     gene            complement(<1054206..>1056392)
                     /locus_tag="C5L36_0B05070"
                     /db_xref="GeneID:40383024"
     mRNA            complement(<1054206..>1056392)
                     /locus_tag="C5L36_0B05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464877.1"
                     /db_xref="GeneID:40383024"
     CDS             complement(1054206..1056392)
                     /locus_tag="C5L36_0B05070"
                     /inference="similar to AA sequence:RefSeq:NP_010619.3"
                     /note="PKUD0B05070; similar to Saccharomyces cerevisiae
                     YDR332W (IRC3); ancestral locus Anc_5.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320736.1"
                     /db_xref="GeneID:40383024"
                     /translation="MLLHLIRRRCTNSAFLSFRIQKRYAKIEFAFSGVDFNNGQKLRS
                     FSTGAVTKSYHEGTENFESYKDLEKDIDLNNSIALRSYQKECIDTICKTLSNGASKIA
                     VSIATGGGKTVIFCKTIPTLLKIRRYDGDISNGILVLVHRRELAKQTIDTILRMNIVD
                     KDRVFLDMGTSALDPKIFLDNRPFIVVGSVPTLARNDCKRLACYNKSKFKAVIVDECH
                     HAVSKSYLDIFNTMNCSKELHGKPSDHKDGEIGPFLLGFTATLARADKQPLKKAFDEI
                     VFQKGILSLIEENHLCDLEWLRVEIGLNLSKVEVQGGDFNTASLAQHVNTDEVNSIVL
                     KSYIQMKTRFPDNMNSLLAFCVNVKHMQDLSLLFQANGINAQYVSGETKISERDAIIH
                     DFKRGKVPVLFNCGVFTEGTDIPNIDSIFLVRPTKSKPLLIQMIGRGLRLHEGKKKLL
                     VTDFVDNKSLGLTITSTLGGKSEILSLLGGTTGTGFNHRNEMLGGDVDYIKFARFSGK
                     ELFDENPDKQNPAYVLMQKMRLLNSKSALGNWIQVKFNTWATPCGYKSYLKIESDQNG
                     KYKAHYCFSKLGFKDSIRLISTTIAEDPNFTDVIDSVKEYVVKHEFINDEMKAISLRE
                     SHMKHASITKSQRNFIANTVMDIVEKSQSYAMDMDKFKKVFNEKVESMSRLEASDFIF
                     GFTVGRKQSAMIWIKQNFLRNKNQRALITKETVLQEKQALMDGGWT"
     gene            <1056633..>1057796
                     /locus_tag="C5L36_0B05080"
                     /db_xref="GeneID:40383025"
     mRNA            <1056633..>1057796
                     /locus_tag="C5L36_0B05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464878.1"
                     /db_xref="GeneID:40383025"
     CDS             1056633..1057796
                     /locus_tag="C5L36_0B05080"
                     /inference="similar to AA sequence:RefSeq:NP_010618.1"
                     /note="PKUD0B05080; similar to Saccharomyces cerevisiae
                     YDR331W (GPI8); ancestral locus Anc_5.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320737.1"
                     /db_xref="GeneID:40383025"
                     /translation="MKVLRLFYLIITFLMCTFAHEEVLSNSDSTEREPQQPQHTNNWA
                     VIVSTSRFWFNYRHMANALSLYRTVKRLGIPDSQIILMLSDDIACNPRNAFQGEVFNN
                     ADRQLELYGDNVKVDYRGYEVTVENFIRLLTDRWPKEQPRSKRLMTDENSNIFIYLTG
                     HGGDEFLKFQDAEEISSYDIADAIAQMHEMKRYNEIFLMIDTCQANTMYSQIYSPGVI
                     ACGSSDLHESSYSHHSDMEIGVAVIDRFTYFTLEFLENVTTTSKATLQDLFDYYTFDK
                     IHSNVGVMTELFNRDPNEVLITDFFANVQKTVIDEPDEDYVYVYDGDINDYPNEGIDS
                     EFETFHHIKNTKQQNKSNNHIIKLNVPKEEHNIISYAITASVIGLFIYGYNSS"
     gene            complement(<1057913..>1060819)
                     /locus_tag="C5L36_0B05090"
                     /db_xref="GeneID:40383026"
     mRNA            complement(<1057913..>1060819)
                     /locus_tag="C5L36_0B05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464879.1"
                     /db_xref="GeneID:40383026"
     CDS             complement(1057913..1060819)
                     /locus_tag="C5L36_0B05090"
                     /note="PKUD0B05090; Pfam Domains: Zn_clus(1.8e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320738.1"
                     /db_xref="GeneID:40383026"
                     /translation="MSGAGPQENKPAKNRLHKSLPNVHPTNSMVLPDGKIFKVQKKRQ
                     RKIHSCIPCHQRKIRCSREKPTCNNCLKLAEKNPAEEDEIIEACKYFDNDKKKNLKIK
                     GVEIEELQRLPSESEGSQSVSAVGTAHERNIQHASPSRSYFNPINDYYGMDDQPLCRQ
                     EYQSKEDSFEMENGSEKIDSEISDRGNQNIHENEHEHTLKDVNPSEFPFDSTDFIYIP
                     RKDTLAFLPTEENYACQDLNSSNFQLNSMYYENQVCSQYAKQFASQFVPILNSLPTKD
                     RSDELLKTFQVNIHSLLPILDMDSFVEKYNEFWYCGMFLTDNIERLYEYNIYFKDKDD
                     TEIPEKINDFLYWHNKTNETLNPSNLSEFLILLFAMYYTSMASSVYEFLSKKYDNFNS
                     ILTYKNEVNKYYNVFKKMNNKGLNNPRVMSLAVLQINVLVQSIINLKSGNSLISITKI
                     LRISQFYQFNRDPVLYHGLKETNLVQTRRMVWWQIFFLDNLVSFFLHLPPSVKLSDFD
                     TSLLMENLDNHSSSHCTIMYLNCMYRFTLVVDELSSLTNGLSGQLRDEDVTKLKNSIK
                     NLFITCTMSKNRIKSIYLKQVALEIKVTSGNKEFNNLVSENTGDKGEHTIQHEEYGAN
                     ENGKFNPQLNSKTSDYHNSSKDTLEFFISFLDIICDKLLIMLQKKILINPYVSRVNTV
                     VDENLNLKLQKLRYNYTDLQSNLLPSLVNYLNVFLVLSKKDMQKYNWKLKNFIPIDEL
                     ILLMQILATNYKSGMSQVDTNELHDINLKIYLVDQTINSLKLNWHLKLSSVNKLIFLA
                     SKMWELMILKFNIDLAVAYSLSEKFVFPTAVNENTAHNNPIQKPISSDSVNCAEIAPR
                     SLGLASAMDTPLNTKKKSLFNPVSSTGEVSRKNYALNMNVNVKDRFLKVAREVEDELL
                     KEGGAGVIQDINEDEEGWYNLGTEEEYGLNSIDDFHFYKNLKSDVVRLFKLVVC"
     gene            <1061391..>1063127
                     /locus_tag="C5L36_0B05100"
                     /db_xref="GeneID:40383027"
     mRNA            <1061391..>1063127
                     /locus_tag="C5L36_0B05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464880.1"
                     /db_xref="GeneID:40383027"
     CDS             1061391..1063127
                     /locus_tag="C5L36_0B05100"
                     /inference="similar to AA sequence:RefSeq:NP_012363.1"
                     /note="PKUD0B05100; similar to Saccharomyces cerevisiae
                     YJL172W (CPS1); ancestral locus Anc_1.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320739.1"
                     /db_xref="GeneID:40383027"
                     /translation="MKEYTDKVGKLNLFRNLSLGAISFLLVLSFIFKYYPHVSGYGNE
                     GVYAIMDPKCPSVPKYKHKNSDIYKNVLDKIINDETFRNQSVAKMQQAVQIDTSSYDD
                     EPTNVSDNLDKFQRFNEFHDFLKAEFPNFHKHLKLHHVNHFGLVYIWEGSDESLKPLL
                     LMAHQDVVPINENTLGEWIHEPFSGYYDGKYLYGRGSGDCKNLLIGHMEAVEELIKLD
                     FKPRRTVIFSYGFDEEASGIRNENAKFIEGLYGPNSLYAVMDEGGVSLMDIGETKMAV
                     VGTGEKGYLDLSISIQKKGGHSSIPQDHTAIGIMGSLIVQLENHKMPTYFTELNPTFY
                     QYVCLAENSVDIDESLKQDILRSQIDKKANENVRHFINRDRYSSYAIKTTQALDIING
                     GVKANALPEFVELIINSRVALEENIEIAFEKFLQDTEIIAYRYDLGLEVELPYGNGTQ
                     ELIEPTENGVLTIKPIQMLEPSPITPIGDKQWEIFAGTIRHVYENLAYSDEYSNGEKQ
                     IIVTPGLGTGNTDTKLYWNLTDHIYRYRPGVLPSVNANSHGINEYIEFDSHLQIIAFI
                     FEYIQAVDQVSD"
     gene            complement(<1063211..>1063972)
                     /locus_tag="C5L36_0B05110"
                     /db_xref="GeneID:40383028"
     mRNA            complement(<1063211..>1063972)
                     /locus_tag="C5L36_0B05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464881.1"
                     /db_xref="GeneID:40383028"
     CDS             complement(1063211..1063972)
                     /locus_tag="C5L36_0B05110"
                     /inference="similar to AA sequence:RefSeq:NP_010000.1"
                     /note="PKUD0B05110; similar to Saccharomyces cerevisiae
                     YCR075C (ERS1); ancestral locus Anc_6.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320740.1"
                     /db_xref="GeneID:40383028"
                     /translation="MSLASFCGWAYAIIWGVAFYPTIFLNYKLKTSDSMSWDFIILNL
                     VGYSCYTLSLYLQLYNDTVRLQYKQLFGGRLPLLSLADITYSAHGLLLIYIILSQIIF
                     GNSLWKFNNQRISFRLQRTSRILLMVLFTYVFLSLSADKSGHAFLNFTINLAYCKIII
                     SLVKYLPQVQHNYRRKTMYGISRMQIQLDLLGALFCIAEIYLKNELPLMKAIEANRGK
                     LGITLVASVFSTIFLYQIHIYGTSPEANNKEKSMV"
     gene            <1064232..>1067684
                     /locus_tag="C5L36_0B05120"
                     /db_xref="GeneID:40383029"
     mRNA            <1064232..>1067684
                     /locus_tag="C5L36_0B05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464882.1"
                     /db_xref="GeneID:40383029"
     CDS             1064232..1067684
                     /locus_tag="C5L36_0B05120"
                     /inference="similar to AA sequence:RefSeq:NP_014163.1"
                     /note="PKUD0B05120; similar to Saccharomyces cerevisiae
                     YNL236W (SIN4); ancestral locus Anc_2.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320741.1"
                     /db_xref="GeneID:40383029"
                     /translation="MSAGDYDVLGTLVSRSISGAKQNHISWSRQGLIAYILDSQNDDG
                     FSQKEGNLRLTFLECVDGKHWQLAPPTFFNIGALLTGSNPSSIPVHQNTKQVSTNYVL
                     FSNTGWDLFTSDKHGNVTILVTGLKRVLSNKPNSELISAENINHNIVQMQYSRTSFNT
                     CEIFYTEHNKGATVLESLGNKVITAKWLNLQKTVISNIPAIRIQQNSENQVLNGCASK
                     MGAATEDAHGYYYRYNALQHKAYGPCHPLSSKQACLSVRANGEICLYHQEEHGVEYVR
                     VQGNLHNESDSTDLITKSSIGYERNGKIIIAAYYEKSMYLKFYEVVIHWNYLSNAAKL
                     LAENPNYRATPEEKNNPTMEVRKILQREMDNIVEGFTFTDIDIISPNFEQDSAMDVLV
                     RVKNKKLHLNDSFLTGIIRYQLYETPLNQFIHKSFKTIASKNSIDITQSLGTSYELKY
                     SQTISINDAIISLESQHLDMYISMVLASGEVKLFRRATFLEEVNRFKADTRNIKTEAG
                     LTPQPPQSQETSLPPTISTLLDAGYEFPPIEKQPVYACLSPNLCAYVSLPIDGSSLEV
                     GCVVTHNVDPGYLKGEKKGLLLAKAAAIALRHTTACYLGYFTDDLVATIRTDLARMSK
                     LASENYSYALMVSILQESHRAINLNIDITPEQSDKMTQNQPLQRLLTLQLSLSTFENW
                     NKTRSGKIALALLNLRYIASSIMYTIHTIYSNIHRFAKKGFPATDTLLNAKLREECII
                     SVVGVIRWCLDYIVLLSQEILELDSAFKSQNQERISKLMKDSIVIPLILGKIPRAFLV
                     FSIANIRRLFSFVQKFIEKIDPSVTAKVTAENPLGGFDVIESWFLNGDSSVLQKKLGG
                     PVKPGSPPNSKNGKAIVTSPIVEAYYRLGLTIKRLPVSLVAFEKFLSEADGPLRNMKL
                     DAPTSLAIEQQIICQGYISRNFTDAIRKLSDVFTKSVLTYSDTKISDLYFYDVSWLGF
                     NSPEDSEDDDYYDNDLSSEECHDNTAAAPQQISNEVAIDEFIKSDKSNLSRTVIIQKT
                     DIKKSEKMYRNLVCKILQNGGIIDSVRKEWFGPETIMKPVGEYITKKNIYSDTTVGES
                     SKTALTPTGDLRPNIRKCIRCGSISVVNDEVVFIPNSMTFVTNPVFQQYQRICICGGS
                     WVNI"
     gene            <1067862..>1069151
                     /locus_tag="C5L36_0B05130"
                     /db_xref="GeneID:40383030"
     mRNA            <1067862..>1069151
                     /locus_tag="C5L36_0B05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464883.1"
                     /db_xref="GeneID:40383030"
     CDS             1067862..1069151
                     /locus_tag="C5L36_0B05130"
                     /inference="similar to AA sequence:RefSeq:NP_014165.1"
                     /note="PKUD0B05130; similar to Saccharomyces cerevisiae
                     YNL234W; ancestral locus Anc_2.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320742.1"
                     /db_xref="GeneID:40383030"
                     /translation="MSRSLGLNQKTQFIMCKLGPLYFATSQYQATMFQKPQAPSNSSV
                     NSSTLESASIHSGHGSPSFQGAVTNESPSIISRTLTATSVNSHSTVNTTFETNWMPNS
                     FVVSRKKYSISLKLKPNEISLLRKSWTIVTSNDSRAANENLLERSISRQSSTSNLRLT
                     VTTTNNSMGSNMTTGTTGTKPGSVVGNSHGGPGFNTASFSSYLFCIQFYNNLIGMDPE
                     IERLIPSIRHQASAFAGVIQVAIDTLEDLSKMKESLLNLGHLHARILGIDSPYFKTMG
                     DALIKTFQDWFGNSPESFPLELEEAWIKLYCFLANSIIQGGIDPIIEYNIQPANNMVT
                     NTNTDNMNEEAEESEEEESEAEKYDSIAEMGTSFASSSSLGKKSTPKHTPSSYSKYEP
                     SLSPPASKPVYSASVSGSRLNRLKKTKNGTKEDCTIM"
     gene            complement(<1069272..>1070078)
                     /locus_tag="C5L36_0B05135"
                     /db_xref="GeneID:40383031"
     mRNA            complement(<1069272..>1070078)
                     /locus_tag="C5L36_0B05135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464884.1"
                     /db_xref="GeneID:40383031"
     CDS             complement(1069272..1070078)
                     /locus_tag="C5L36_0B05135"
                     /note="PKUD0B05135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320743.1"
                     /db_xref="GeneID:40383031"
                     /translation="MSKRRSDEDDFSDGVSITSLKSSRSKISLTQSADSLFSNVNQYV
                     DPNTLELCRVIQFIEFFKGNVVGDDEVRLRALKILEKTPDPSITKTLKYNNQTVELPI
                     LGEEFQLEYNSTFPFLREPMSISVQCSELLSNTNNYRCFKKIILKNSTLKPILPSIEF
                     YYDTYSQLRFRLQCLLCDSSENQVLCILTDSLLLASNILLRMPHIWYISYELLKSDNS
                     LNLSDKRELICRIWKNLEVLFRKAQNLEVVVKVDPTGAIQVTDLLHNYFT"
     gene            complement(<1070268..>1071149)
                     /locus_tag="C5L36_0B05140"
                     /db_xref="GeneID:40383032"
     mRNA            complement(<1070268..>1071149)
                     /locus_tag="C5L36_0B05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464885.1"
                     /db_xref="GeneID:40383032"
     CDS             complement(1070268..1071149)
                     /locus_tag="C5L36_0B05140"
                     /note="PKUD0B05140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320744.1"
                     /db_xref="GeneID:40383032"
                     /translation="MAEKTRFGRDISNTTANTLIHRNMKRSTYHSYPILKTKCPKPLT
                     NLLADLQLENEGKEDNGDRSTFCVKDSSTFQSDESVLDDADDEKETNSMASNNDTKGG
                     SVDNRIVDLLSSQVNTKGKNEENSKCSVQRFCSDFEKINDEEQGRKYTFAARSSDLEE
                     IIQYYNGQLQKINDLAAERLDQFNELEESFNKIQQTQSQVYQNHLQYLQKQLKFKEEE
                     MEDMKRNYTLVEQWVLTLFKELGDCIRANPSSLVKLSGKQIKKSLQPPVKKTELESIY
                     RYLVQYLYLDGENEAVT"
     gene            <1071883..>1076253
                     /locus_tag="C5L36_0B05150"
                     /db_xref="GeneID:40383033"
     mRNA            <1071883..>1076253
                     /locus_tag="C5L36_0B05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464886.1"
                     /db_xref="GeneID:40383033"
     CDS             1071883..1076253
                     /locus_tag="C5L36_0B05150"
                     /inference="similar to AA sequence:RefSeq:NP_014166.1"
                     /note="PKUD0B05150; similar to Saccharomyces cerevisiae
                     YNL233W (BNI4); ancestral locus Anc_2.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320745.1"
                     /db_xref="GeneID:40383033"
                     /translation="MSYLAGFNKIQNQTFSVNNNSLNQSPLTQDSSSMNSYSDDFDFR
                     NIETSSSAQTSTVTSNQNHNSNMQNYHKEPKLSSLSFYNGPAMNKAAERVHASKFRKS
                     LVISPSFNSITSNPASDTDFDESRFIGDSKIEEPTKNIGMVISPSIRALSDILTSKVN
                     SKTSLVNDNNNTIIEEAEGDENDNETIQFKSNLRRNSSLIDDIFSPDVQSTKTFKTNN
                     SNDTLQNHLPQDLIDLSSPVVDSFQIPSEPPRLPQQKSQIQNSQQRNLDPNYSDMFES
                     YSPVKKGSIIEEEHRLHDRHDRERSHNRFSMMSDNFNFNQLQSPSLNFNSHVESIDNI
                     NPSITHSISKLSINDESFHAIGYDDGDGDNSEFSFLPSRTNTLNQSEKNLENRNSAAF
                     KSPNTFTQRHNPRNSIRIVDDTDEEEEEEEDIGDKYRGKEDKMDHKDGKSSFSDNLSG
                     SANLHFSTGVTPVVIPSPQFEDDLTPIIPGTTTFGGDNTSKVPVSTKFESPRKETPTL
                     KDVPSLSGNHTNASPSKSLLNSSPIRNTSPTLEHIDKSPRQEVKKTYINLSPDTKFSK
                     QTRAEHVQTQQLHKVQQQSKPKNKLTFKSLFSKTTSTEHLIVGKRKSPILESVEKFGR
                     PKSMVSAKQETPPVAKGEKKEKSKSLLSGWKRKSFGFSKTNLHDDLEKKPTKTKEKSK
                     TSQGPFTKSHKSTSSMPIISSPKSKQQQKQQERATAVSPHRHTKSEDLFEKKLPVLPP
                     PETTKRDQDQHKSLLQTYGFNNTLSELKESPILHSSPSLHSFHDPVPLSPTWDRVPTV
                     KRSTSENTIETSNSPPDLLEPQKADISSSSPALFNVSHPEMTNKNNGFNDPKDNSELG
                     NTSSTYDESTENPTQSNHLEFFKPPQALGITTMEDSPVATTPRPLSGSSFSTFTSENN
                     LLKTPQSFASPAISVVESFVASPNRYHIGDDMYPKSLGINEIESIVSLERSRSMRSIR
                     SAANAQNPLNHKSSILSMIQGQDVDGFNEMRLPDGMVVIKSPMTDQHHAWSKPPSRTT
                     SILKKNNSIKSNNPTSLKQVTTVDNDTSFEDDDFNDLINLINFDDDDDDIDMNTDFNI
                     NTDINLELSPLKSHYMNEQSNISNGGDLHDYLGIDTTYNSMRFDDDFNFEDSPIRQAK
                     KVEYIPQRESIDLVSTEEGQNQLAPFGFDSPTKGLKGPSFNSTLSSSLKPETRSAILD
                     SLNKNLPVNDFVHSESENSISYIAGGQHYGGYFRDSPNIKQDSLLEYQYKNQSKKPSD
                     EESQKFDFKYNQSFAQHLPVTSSDVLSALSESPSPSRFALNNPFSDYTQSYDDDYSDS
                     VNVNTTDKVNKRKSLNFMGKFSNPANLSTSSLPVMKDYEKPKKLVRKRNKTSVSFGSM
                     FEALVPTREEEKPTLNVKFSSRILLYDTYGEDEYDRRPDAATCNSLTPQIAMEIRNEL
                     NQVKAEMPIHEESRCYTHFF"
     gene            <1076511..>1078613
                     /locus_tag="C5L36_0B05160"
                     /db_xref="GeneID:40383034"
     mRNA            <1076511..>1078613
                     /locus_tag="C5L36_0B05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464887.1"
                     /db_xref="GeneID:40383034"
     CDS             1076511..1078613
                     /locus_tag="C5L36_0B05160"
                     /inference="similar to AA sequence:RefSeq:NP_010448.1"
                     /note="PKUD0B05160; similar to Saccharomyces cerevisiae
                     YDR164C (SEC1); ancestral locus Anc_8.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320746.1"
                     /db_xref="GeneID:40383034"
                     /translation="MSLYQIQKDALISDLNRVSSSHRHLIADDTTYPIIDKLFKDDVL
                     NYVYTFKRIDSPDRSKNRDSALYILDPSRSFSLNCLAADFSKGQRYKDVVVMFIPGHW
                     EHFWENMQKNHYFKESLVLSKVPLILEYMSFVPLEPRLYVTGNYHSIPIYYKPEKYGM
                     NYFHYQLDTAVNSMLGMCVALNEYPTVRYYNSRLSKELATRFQQKLDNYWRDHPDNFP
                     IGSKTVFLITDRTMDMFGPLCHYQYYRSQIFDLLDTVEVDRGVDPTATYSYKVETGEG
                     LTRKKLVFNTDDKVYPQLRDLTIEKATDTVRKLYNNLKAEDAKFSNEMLQTANGLRHA
                     LVNKDVHLENKAVVTAHYLLTNEMWNGLKKEHVADIITFENLCAAGLGVLDHLKSPVT
                     DGLLHLLANPEINIYNKIRLLVTYAIYRKGIIENDLRKLLMFSMPDKIENVLKLFKNL
                     ETLGVFALKHDLKSKAREKNTYFGVKDTDDQMNLMIPTYTNLVSRLVLNKLPEYYDTR
                     TIDASGYIQDEDESLKTFPYVKAGPSPMENEGYQQTVRNQPKWKSTKNTNDAARQKVM
                     LFCAGGLTPSEISSMSSLEEELNRNIIIGTDEIYTVWDMLGDINLINEDEFEFPLTDK
                     IESKPVPQSIVENSMDPSLLQQQQQQQQQQQVPKKSHTHLPHLPLGHHHPENTQTAPE
                     KEKKKIKGVMKKFKKFSI"
     gene            <1079046..>1080161
                     /locus_tag="C5L36_0B05170"
                     /db_xref="GeneID:40383035"
     mRNA            <1079046..>1080161
                     /locus_tag="C5L36_0B05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464888.1"
                     /db_xref="GeneID:40383035"
     CDS             1079046..1080161
                     /locus_tag="C5L36_0B05170"
                     /inference="similar to AA sequence:RefSeq:NP_014168.1"
                     /note="PKUD0B05170; similar to Saccharomyces cerevisiae
                     YNL231C (PDR16); ancestral locus Anc_2.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320747.1"
                     /db_xref="GeneID:40383035"
                     /translation="MFGFGKKKEAKKEDKADSKNFIKVSTPFEHPVEGIVPPKEKKLT
                     DEQDTKYQEVLHYFQRPDLEVSVKEKESSKKEPLIDDEKAWLTRECILRYLRATKWVV
                     KDAIERIEGTIAWRREFGIQYQDPEKNSCNAKLVEPESLTGKQVVLGFDNDARPCLYL
                     KPGRQNTKTSHRQVQHLVFCLEKVIDFMPSGQDSLALLIDFKQHPEISANVETSKIPP
                     LSVGREVLHILQTHYPERLGKALLTNIPFLGRAFLKLIYPFIDPLTKEKLVFDAEFKK
                     FVHAEQLDKDFEGLVDFEYNHELYWPALLEITQKRRAAYFERFHKFGAVVGLSEIDLR
                     GSSEKLTVPIGKHPYNASESTENLVEEVSDATEKLNL"
     gene            complement(<1080228..>1082453)
                     /locus_tag="C5L36_0B05180"
                     /db_xref="GeneID:40383036"
     mRNA            complement(<1080228..>1082453)
                     /locus_tag="C5L36_0B05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464889.1"
                     /db_xref="GeneID:40383036"
     CDS             complement(1080228..1082453)
                     /locus_tag="C5L36_0B05180"
                     /inference="similar to AA sequence:RefSeq:NP_011794.3"
                     /note="PKUD0B05180; similar to Saccharomyces cerevisiae
                     YGR278W (CWC22); ancestral locus Anc_5.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320748.1"
                     /db_xref="GeneID:40383036"
                     /translation="MSEKLSKLLKLKSGGAYVPPAKLRELMAQVELEENSKEFQILQW
                     EALKKNINSSVNKVNKKNLKTIVVELFKNNLLQGRGLLCQCIMKSQQLSTSYTDVYAS
                     LVSIINSKIPEVGDLLVRRLIVKFKRLIRRNEAEQCRSVVVFLSELFNFHVINSELVQ
                     QIIDKLFENISDFRIEMIIEIMRHCGITLHDENGKWFDQKANLLRNVLNENIVNPKSQ
                     YLIQEFFDNFKGLVTNYNGIDESLDLVEEEDQITHNFTLSENVLGDDHLDVFKFDPNY
                     EDNREKYNIIRKGILGSDVETDSDQEVDNESSDYSSDYDNEEEEKQDVDDDDNRQYTD
                     DKERNKLTVQIKDLTEQELTTFQKNVYLTIMSSMSPEEATHKLLKLPAVDPKRKEYML
                     VDMVIKCCAQEKIYSKYYGLIGENLAVINKSWAEVFQALFKENYQNCHRYETALLRNI
                     GAFWGHMFASDKIGWECLSVIKLTEEDTTSSGRIFIKFIFQRMVDELGDKKLNERISE
                     DYIQPFIRGLFPVDNPDHLRFSINYFTAIGMGKLTDKMRSNLNILTEKDKLITSLVNN
                     GSDSDESDVSSPHRGRSRSRSPHIGRSQSYSRSRSTSRERYNRGTLVSAEDRIGMSSF
                     ERERSYSRSRTASPARQNHKNDRTDNIPKGPRINHNDNGRGKGHGRGRSGWRGRGRGR
                     GGYSANRSRYRTQENWNYAGRNGSNQFRDDLSYNKRHNDHQYDHPAANRDYYNRQREN
                     R"
     gene            <1082682..>1083593
                     /locus_tag="C5L36_0B05190"
                     /db_xref="GeneID:40383037"
     mRNA            <1082682..>1083593
                     /locus_tag="C5L36_0B05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464890.1"
                     /db_xref="GeneID:40383037"
     CDS             1082682..1083593
                     /locus_tag="C5L36_0B05190"
                     /inference="similar to AA sequence:RefSeq:NP_011793.3"
                     /note="PKUD0B05190; similar to Saccharomyces cerevisiae
                     YGR277C (CAB4); ancestral locus Anc_5.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320749.1"
                     /db_xref="GeneID:40383037"
                     /translation="MLLVITERDSYCYNAIEHIFEVVLTKNIDEIYVLVHPDHGSPLT
                     VSSLIDQLGNIYDSFFQLTSVSKEKLNINVLLYDEKYDPEIASQLWTSVLYTDSVDVF
                     SIPKAYIEHVDKNKIHSISTSTIECTIEKHRKYRLSNPESTYESIPVVAVGGTFDHLH
                     DGHKILLTVSAFLTGRRLIVGVTGPGLLGNKKYVEYMESFEIRVRNVNSFVKIIKPGL
                     FPDIYEINDVCGPTAQVESIDALVVSLESYKGAEFVNNKRRELGWKPLDVYTIGVLGG
                     NEETFNHKMSSTDYRKAEYLRDHADRV"
     gene            complement(<1083702..>1087520)
                     /locus_tag="C5L36_0B05200"
                     /db_xref="GeneID:40383038"
     mRNA            complement(<1083702..>1087520)
                     /locus_tag="C5L36_0B05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464891.1"
                     /db_xref="GeneID:40383038"
     CDS             complement(1083702..1087520)
                     /locus_tag="C5L36_0B05200"
                     /inference="similar to AA sequence:RefSeq:NP_014033.1"
                     /note="PKUD0B05200; similar to Saccharomyces cerevisiae
                     YMR304W (UBP15); ancestral locus Anc_5.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320750.1"
                     /db_xref="GeneID:40383038"
                     /translation="MSTIKPKEVANDSEPVDDGTRELRLHHPQNKSDMDVTYGNDNNE
                     DENVPDGHDPEEEENDEDDENDEDDEDDEDDEEEKNNGNGSDSSGDSIIETDPFDYDK
                     SKQIKLIELDEKLKAKLDEGVDTLVEACPKGLDSIVQHFTFQIANIESMLAQPDTYLS
                     EPVQIGGYRFNLMIVVRKGQDRILSAYLKGRPVDEKENEIWSFPVHFAFNVWDADDIT
                     CHKVNFSKFRFSQRVDDWGFVKFLDSKFPTDEKFFRKNKVNITVYVRVIDDYTNCLYS
                     NYVDYDSKKSTGFVGIENQGATCYLNSLLQSYYFTKVFRKKVYKIPTDDEIKLEMDSY
                     EDYKHQHKTVSLALQRIFYRLQTSNVAINSLELTHSFGWTTADAFTQHDVQELNRILM
                     DRLETKMKGTEIDGCLNDIFVGKMKSFIRCVNVDYESSRTEDFWDIQLNVKGLKDIKE
                     SFDNYVELELLDGENKYDASGFGLQDAEKGVIFESFPDVLHIQLKRYEYDFETDNMVK
                     IHDRYEFFDEIDLKPYLDKTSPGYEDENWNYKLHCVLVHQGDVSGGHYYAMIKPTEKD
                     EWYKFDDDIVTRVTPYTVFEDGFGCGPPKNIDRSMTREEYQNYIIKHHTSAYMLVYFR
                     ESKIPHVLADVEEADVPEHVKQQIKYENQEDAKIKKEREEMHLYINFKIFTDETFAKY
                     QGFDLGPDEDNLQHFNEDLFDDGSFPIKLKLLKTQAWESIYETICKFSNKDPKVFANK
                     LRLWSITKRSNNTYRPERPIESMVSDIDNQTIESIALLLENGTSRRKYAGSNVPVVLS
                     LYLEDACRDLKYLASQCGGIPKGLQDYEERLESLVIVANKKCDASLEPIGDDSNILIM
                     VKLFDQRKQTLKGVSHIVLPSDAKIDFIAKFLQLVFNVDDGEQISFIEEISFSQRVRV
                     RTDLSLYQNEISSGDIVCASFDDDQDKELQFQDAESYYAFLETRVHFYISPLKRIDED
                     EEDFVFVETDPSKVAASDSIIDIWISSNSSYLDICTFIGKEVGISPEYIKLSVLSNGN
                     KTDLKSDFNFSTALQGFTKNSALKLYYETLNIPLKSFESMQLYRIYWVGNGICKEEKH
                     DFYLPSSSTLEDVVSKLQSKLKSEIDLNAVFCWVPDRQHKIKRIVKLEDSIDNHDVLI
                     VGLFPQYKELFFNDSRDVILIAGFQCYSSIENTHGLPFVFDLVKGEKLPETYVRLHKL
                     LGLSGKEFNSARIGITNSSVVEFIDKNNPASNSIELFNYFENGKYMLVIDHLDRKGRR
                     SSHHSSIMIR"
     gene            complement(<1087929..>1089395)
                     /locus_tag="C5L36_0B05210"
                     /db_xref="GeneID:40383039"
     mRNA            complement(<1087929..>1089395)
                     /locus_tag="C5L36_0B05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464892.1"
                     /db_xref="GeneID:40383039"
     CDS             complement(1087929..1089395)
                     /locus_tag="C5L36_0B05210"
                     /inference="similar to AA sequence:RefSeq:NP_010873.1"
                     /note="PKUD0B05210; similar to Saccharomyces cerevisiae
                     YEL041W (YEF1) and YJR049C (UTR1); ancestral locus
                     Anc_1.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320751.1"
                     /db_xref="GeneID:40383039"
                     /translation="MSETNQRNKSLRRLSSSVFQKEPILHEALIKDNTMNQFSSEISS
                     NSSSSTSISLSANFPPQTHVNGILAHSILGRNMPVSRDENIKHCKDIDNEHNAVDSLQ
                     ESQGLNSVRSHVDLAKTAHSVRALAKRLNRTTIHLCMNTVCIVTKARDNSLIYLTKEL
                     TEWLLVTNPGLTVYVDKNLKASHRFDASGLVKDIPNSTHRLKFWDKQLIQEGRVLFDF
                     VITLGGDGTVLHASTLFQNAVPPIISFALGSLGFLTCFEFENFREILSSVFNQGVKTD
                     LRMRFTCRVHRANGDIVCEQQVLNELTIDRGPSPYVTMLELYGDDNLLTVAQADGLII
                     ATPTGSTAYSLSAGGSLVHPEVSCICITPICPHTLSFRPIMIPDTMKLKIKVPLRSRS
                     TAWAAFDGRKRVKLETGDYVVVYASCYPFPTVKGNYDQYFDTVSRVLNWNSRKEQKGF
                     KHLLSDKNKKICDEEEKDDLADETEHEEWDIDYSEEDS"
     gene            complement(<1089675..>1091528)
                     /locus_tag="C5L36_0B05220"
                     /db_xref="GeneID:40383040"
     mRNA            complement(<1089675..>1091528)
                     /locus_tag="C5L36_0B05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464893.1"
                     /db_xref="GeneID:40383040"
     CDS             complement(1089675..1091528)
                     /locus_tag="C5L36_0B05220"
                     /inference="similar to AA sequence:RefSeq:NP_010872.1"
                     /note="PKUD0B05220; similar to Saccharomyces cerevisiae
                     YEL042W (GDA1); ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320752.1"
                     /db_xref="GeneID:40383040"
                     /translation="MAMLSLGRRQKPLVLGAAIILLVLLVSVSFSSTKNASISPIVGS
                     SNSGSTSGSDSVHKAEFGVGEAVSPSNDDTLLSGATIEQDTVNQNVKAKPHVVGNEKV
                     DTIAGSDASLKSKEESIAKAKGSKEIESYSGSSESDGDTPLKDTKIPAKKPVKDTTKD
                     TTAKPLTDKSAASGSGNSGYEYVVMIDAGSTGSRVHVYSFDTSVSPPALMNEEFKMLK
                     PGLSSFDTDTVGAAKSLDPLLELALASIPTDKQGCSPVAVKATAGLRLLGKAKSDAIL
                     KQVRKHLEEDYPFPVVDGDGISIMDGSDEGVYAWITTNYLLGNIGTSKKLDTAAVFDL
                     GGGSTQIVFEPTDGDSLLEGEHKYNIEFGGRKFTLYQYSHLGYGLMQARNKVNAEVLK
                     SEMKTAGKSKFVPLKESQIKNAVADVTIENPCVPPGVTAEDVIVELENGDKYAVTFVP
                     PKKTSSDSLAGQCKFLTDSILNKDLDCESDSCSFNGVYQPSFKDQFPSTADMYVFSYF
                     YDRLQPIGMPDSFTLKEMNDIMESVCAGSHLWDKYFTQEAHIKELENEPLWCLDLNFM
                     TSLLHNGYDIPLKRELKTAKTIGGNELGWCLGASLPLLDKSNWTCRVTKEL"
     gene            <1091804..>1092442
                     /locus_tag="C5L36_0B05230"
                     /db_xref="GeneID:40383041"
     mRNA            <1091804..>1092442
                     /locus_tag="C5L36_0B05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464894.1"
                     /db_xref="GeneID:40383041"
     CDS             1091804..1092442
                     /locus_tag="C5L36_0B05230"
                     /inference="similar to AA sequence:RefSeq:NP_012584.3"
                     /note="PKUD0B05230; similar to Saccharomyces cerevisiae
                     YJR050W (ISY1); ancestral locus Anc_1.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320753.1"
                     /db_xref="GeneID:40383041"
                     /translation="MKQKQENFTESMTGKKYKLRPSDCTDVERANEERRRVISAISVN
                     LAKINDVNLTHHQIRDINDTINRQLRLRRAWEHRIKELGGPDYILTGNSHEDKSLSFV
                     VKGYRYFGRARELPDVVKLLEEATIEKSNKQNARDKEQSIVRFRNSQNWPADYPDLMV
                     NRESKLHFESTAPSPFTFEATTERPVTENVRFMEKFLLQKKKALLLKKIRSK"
     gene            complement(<1092519..>1095272)
                     /locus_tag="C5L36_0B05240"
                     /db_xref="GeneID:40383042"
     mRNA            complement(<1092519..>1095272)
                     /locus_tag="C5L36_0B05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464895.1"
                     /db_xref="GeneID:40383042"
     CDS             complement(1092519..1095272)
                     /locus_tag="C5L36_0B05240"
                     /inference="similar to AA sequence:RefSeq:NP_010444.1"
                     /note="PKUD0B05240; similar to Saccharomyces cerevisiae
                     YDR160W (SSY1); ancestral locus Anc_8.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320754.1"
                     /db_xref="GeneID:40383042"
                     /translation="MVHRSKSGSPLSSLFIRRENAADDMDVDLSDRQSLFPDFSPIQD
                     GTGMIDNGIEESCSGTTNEPAESQSCSGNSIRSSVLHNILDNEPSLLENHDKIKFTRL
                     YKKYDKNESDENDLRLEFTDFQQYNRLLHHEDKLRSKLEKIARLKGLHLRKDTSQGPQ
                     ENVLTTLNDDALNALYINAENPKDWDEMEKAQRKREGESKWMFGRLLHKFINSSESSK
                     DNKEKDNSDELDFISIGSSIPIDDDVQLEDLPIDSQPFRKVNKRTLDYLREFEEHQYN
                     NNNEIEMVVSKNEKVDYNLHRVDQYQNIDPIESPTDLGDHWISKTLNYFNLLRIMRIQ
                     RANKYQIQRKLNVRHLNQIALGGTLGVGLLLASGKAFTIAGPFGCLLGFIIAGALVIA
                     TMLSFCEIVTLIPLCGGVSGVAARFIDDGFGFALGVLYWVTYLFSFSTEVVAASIMLS
                     YYDNLHIPGPNTAGWITLFLGITVIINLLDIRVYGEFEYYSTIIKLVILLALMIYMIV
                     LNTGHSGPLHQRIGFKYWDSSLSDVANNITFGLFRPTFDVDDNGLGSLHGIGGNLGRF
                     LQVLVSCTLASFAYVGTEIVIITGSESVNPRRSIPSATKNIFLRIIVFYIIAIFLVGL
                     NIYSGDPRLLRFYPHDYISESQIAQQDAVVKIIGEDRCKSTVVDWAGFVNGSQSPWVI
                     AIQSAGLCSFASAVNAFLLYFALTSASSQLYVSSRTLYFLALQNKIPSCFSLCTKRGV
                     PYVSVLFTAFFGLLSYLSVKNDTAVIFERLMNVCSTSGLLVWCGMCLSFIRFYHALKL
                     RPDIISRDDDDYPYRSPFQPYLAYMGLFTGLVLVISSGFTVFLKGKWSTSFFFSSYGS
                     LILFFGCYIAYWIFRGSKVTRLDQVDLDSGRREIDRVIWEDEKNYASNFKERLRKGIR
                     MFV"
     gene            <1095481..>1096371
                     /locus_tag="C5L36_0B05250"
                     /db_xref="GeneID:40383043"
     mRNA            <1095481..>1096371
                     /locus_tag="C5L36_0B05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464896.1"
                     /db_xref="GeneID:40383043"
     CDS             1095481..1096371
                     /locus_tag="C5L36_0B05250"
                     /inference="similar to AA sequence:RefSeq:NP_015231.2"
                     /note="PKUD0B05250; similar to Saccharomyces cerevisiae
                     YPL094C (SEC62); ancestral locus Anc_8.572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320755.1"
                     /db_xref="GeneID:40383043"
                     /translation="MSTPPPQGQRVPLSKEKNPVALAVATAVRYNPLLKQRQGILSTN
                     KEKTDFFRYKRFVRSIKSPEFQKKHAANAAKIPAILDDINAINQVFILLIQNQLVIPV
                     NKLKTQDAKKQGYKVDKKTPALEVTGKAVIQPDAYYAWNYTPPNPYMMLYSILAVIGI
                     FTVILFPLWPFWMRKGVWYLSTGLLCLVGLFFVVAVIRLIIYLISLATMPRQFWLFPN
                     MFEDCGVIESFQPLYAWEEPKSKGQHRSKKGKKHQEPTQSLDTNKENVVESTADTKTT
                     SAKKSETTTVQRKATIEEVE"
     gene            complement(<1096512..>1097549)
                     /locus_tag="C5L36_0B05260"
                     /db_xref="GeneID:40383044"
     mRNA            complement(<1096512..>1097549)
                     /locus_tag="C5L36_0B05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464897.1"
                     /db_xref="GeneID:40383044"
     CDS             complement(1096512..1097549)
                     /locus_tag="C5L36_0B05260"
                     /inference="similar to AA sequence:RefSeq:NP_012639.1"
                     /note="PKUD0B05260; similar to Saccharomyces cerevisiae
                     YJR105W (ADO1); ancestral locus Anc_7.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320756.1"
                     /db_xref="GeneID:40383044"
                     /translation="MSYDLVCLGNPLLDIQVNVDKEYLDKYNLKENDAILAEESHMPI
                     FKEILEKKDVILVAGGAAQNTARGAQYVLPENSVVYFGSVGKDIYADKLIEANKSVGL
                     TTAYMVHDNIATGKCAALINGLNRSLVTDLAAANHFKPSHLEKEENWKLVEGAKVFYI
                     GGFHLTVSPDAIKLLGKHAAETGKDFIMNFSAPFIPEFFKDPLNECLPYADYIICNES
                     EAAAYAKAHGLETQDLTEIAKHVAQSPKVNTKKPRTVIFTQGTDATLAVAYNDTTKEF
                     NIQSFPVHALDVSKIVDTNGAGDAFAAGFTAGLVQGEDLSKSVDMGHWLAKLSIQEVG
                     PSFPFPKQSYA"
     gene            complement(<1097755..>1098819)
                     /locus_tag="C5L36_0B05270"
                     /db_xref="GeneID:40383045"
     mRNA            complement(<1097755..>1098819)
                     /locus_tag="C5L36_0B05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464898.1"
                     /db_xref="GeneID:40383045"
     CDS             complement(1097755..1098819)
                     /locus_tag="C5L36_0B05270"
                     /inference="similar to AA sequence:RefSeq:NP_013013.2"
                     /note="PKUD0B05270; similar to Saccharomyces cerevisiae
                     YKR087C (OMA1); ancestral locus Anc_5.684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320757.1"
                     /db_xref="GeneID:40383045"
                     /translation="MFQKNFILRTFRLNPQASMRGKGIAFLRQARYYRNRPRYVYFND
                     SRQYNQSSWWSRFFAYARENPRVTYGTVGVFTLFLVTHIDEAPVTHRYRLMMTAEWVE
                     NYFTQQSFRQVMAEYGNYILPSYHPISKQVSSIMVRLIAAAHDYKDPTTGERVNLFTV
                     LGKSDIPLDKWEFYVIDDVRMGRPSPNAFVIGGGKVFLFKSLLPICEDTNGLATVLSH
                     ELGHLLADHLGERLSLSPLLFTLNIIMFSIFGSSRPGDILVNMLLNRSFSREMETEAD
                     YIGLMVMSRACFDPTGAPKLWRNMLQFEQQQGGSVPELVSTHPSSERRLENINGWMSK
                     AKGIYEENGCYKDLRSFWYR"
     gene            <1099027..>1099710
                     /locus_tag="C5L36_0B05280"
                     /db_xref="GeneID:40383046"
     mRNA            <1099027..>1099710
                     /locus_tag="C5L36_0B05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464899.1"
                     /db_xref="GeneID:40383046"
     CDS             1099027..1099710
                     /locus_tag="C5L36_0B05280"
                     /inference="similar to AA sequence:RefSeq:NP_011430.1"
                     /note="PKUD0B05280; similar to Saccharomyces cerevisiae
                     YGL085W (LCL3); ancestral locus Anc_6.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320758.1"
                     /db_xref="GeneID:40383046"
                     /translation="MERHNTLIPVVASLAVGAVAALSLHRVYVCHLKQISRASDIPPS
                     SMRKRWLYGHVTSVGDGDNFHLYHLPGGLRAGWGWLREVPLKHSQVRGQTISVRLCGI
                     DAPERAHFGKPKQPYSEEALIWLRKYILHRYVYVKPLRLDQYGRVVGRVMVWTWLGWR
                     DVGEEMLKCGLATLYEAQSGVEFDGRERIYRKREQNARRKKLGLWKDFGKKIFETPRE
                     YKTKYSSGK"
     gene            complement(<1099774..>1101468)
                     /locus_tag="C5L36_0B05290"
                     /db_xref="GeneID:40383047"
     mRNA            complement(<1099774..>1101468)
                     /locus_tag="C5L36_0B05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464900.1"
                     /db_xref="GeneID:40383047"
     CDS             complement(1099774..1101468)
                     /locus_tag="C5L36_0B05290"
                     /inference="similar to AA sequence:RefSeq:NP_011431.1"
                     /note="PKUD0B05290; similar to Saccharomyces cerevisiae
                     YGL084C (GUP1) and YPL189W (GUP2); ancestral locus
                     Anc_6.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320759.1"
                     /db_xref="GeneID:40383047"
                     /translation="MSLLSFFAVESLDSRISSNRRKPTTTQPSHWKTPEFKFYMVCFL
                     IVVPIMFKTAMDASNETNPNYPVYEKMLSKGWIFGRKVDNSDSQYRFFRDNFLLLLLF
                     VAIHKALRTIANQWRMSRLDFDLIFGSIFLAIVHGFNVFRILVHVFISFSLTRILRKR
                     PLLAQSVLWVYSISTLFINDRYRQVKYGDLVSSLSWMDHYKGLVARWDVFFNFTLLRM
                     LSFNIDYLRKSPVEGDIPLSVLNGTKAKSSEETRDGIDGAVTCELSERERLDAPLSLE
                     EYSFKNYLAYLFYTPLYIVGPIITFNDFIYQSKHPLKSINLHRTFLYGLRLIFCFLVM
                     EVILHYIYVVSVSKAKAWHGDTPFQISMIGFFNLNIIWLKLLIPWRLFRFWSLCDGID
                     PPENMIRCMNNNFSTMQFWRSWHRSFNKWVLRYIYVPLGGSNHRLLGSLATFSFVAIW
                     HDIELRLLVWGWAIVLFLLPEMIITKVMHPYKNEWWFRHACALGAVINIWMMMLANLY
                     GFCLGHDGMVKLLRDMLTTFDGVIFSICSTVCLFIAAQVMFELRESEHHRGIDVKC"
     gene            <1101720..>1102472
                     /locus_tag="C5L36_0B05300"
                     /db_xref="GeneID:40383048"
     mRNA            <1101720..>1102472
                     /locus_tag="C5L36_0B05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464901.1"
                     /db_xref="GeneID:40383048"
     CDS             1101720..1102472
                     /locus_tag="C5L36_0B05300"
                     /inference="similar to AA sequence:RefSeq:NP_014718.1"
                     /note="PKUD0B05300; similar to Saccharomyces cerevisiae
                     YOR075W (UFE1); ancestral locus Anc_5.679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320760.1"
                     /db_xref="GeneID:40383048"
                     /translation="MDEKGVPDLERRPNPPGWVQPKAPYNPYDPTDVRPAEGYPSEFN
                     APSAMKKNTGKIARDLTDYQKIKVDMKKLQYYPRPPSELYPGRYKVLRRVNHKSGFNR
                     GADLTAKVSIYGFLIFGVFFYKWNDHENVFAPFRRLQLRIKELVMGDLSVDDYNDVYN
                     YDGNKAIPQRPLPSIMYEANVGKDLVGREETNKEHIKDRFGNKHMVYAEHIKQKEDEN
                     MIKALDVAQRELELRKLNGIEKENSKPFWKVW"
     gene            complement(<1102846..>1103250)
                     /locus_tag="C5L36_0B05310"
                     /db_xref="GeneID:40383049"
     mRNA            complement(<1102846..>1103250)
                     /locus_tag="C5L36_0B05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464902.1"
                     /db_xref="GeneID:40383049"
     CDS             complement(1102846..1103250)
                     /locus_tag="C5L36_0B05310"
                     /inference="similar to AA sequence:RefSeq:NP_013108.1"
                     /note="PKUD0B05310; similar to Saccharomyces cerevisiae
                     YLR008C (PAM18); ancestral locus Anc_5.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320761.1"
                     /db_xref="GeneID:40383049"
                     /translation="MSNTENATQPATAPRSVNDQIEAYLQQTKQYTSEHPWITFAGCF
                     ATAYVLAGMYKKFSGSSSGKFVKGGFDPKMNAREALRILDLKESNLNIKKLKDNHRRI
                     MLLNHPDKGGSPYLATKINEAKDFLIKRGGLK"
     gene            <1104153..>1106255
                     /locus_tag="C5L36_0B05320"
                     /db_xref="GeneID:40383050"
     mRNA            <1104153..>1106255
                     /locus_tag="C5L36_0B05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464903.1"
                     /db_xref="GeneID:40383050"
     CDS             1104153..1106255
                     /locus_tag="C5L36_0B05320"
                     /inference="similar to AA sequence:RefSeq:NP_009874.1"
                     /note="PKUD0B05320; similar to Saccharomyces cerevisiae
                     YCL057W (PRD1); ancestral locus Anc_1.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320762.1"
                     /db_xref="GeneID:40383050"
                     /translation="MFGQYCRQYCRQFCKHFYNKTPIFQSPRMASTLVPPQTPLEWTH
                     TPESILLQTEKLIAEARAMDDAIAAVPLEKATIDTVIKPYADLENRQAGLTNQLTFYQ
                     HVSANKDLRDASNEADAKFRKYGIEAGLREDVFRVINKVYETIKDDESLDKETKRFIE
                     KVNKQYIRSGLSLPLETREKVKELKQQLSTLALKFSSNLSEETGSILFSKEQLDGVPK
                     DVVDQFEKVEGKFKMTFKYPDLFPVLKYANDAQTRKAALIGDQSKCPENAGILIEAVK
                     IRAQLAHLLGYNNFSEYILEERMAKDPKTVMNFLEDLKAKLRPLGEVELSKLKALKDK
                     HTGKENESYNIWDQNYYNTKMLEQNYNVDELKISQYFPMNNTIAKMLSIYETIFNLKF
                     VEIEKGSKGYNTWHEDVKQFQVWKKDDPQTPVFVGYLYFDLHPRTGKYGHAANFGLVP
                     SYIDVQTGEKNYPSTSLVCNFTKDTPEKPSLLKHGEVVTFFHELGHGIHDLMGQTQYS
                     RFHGTSVSWDFVEMPSQLLEYFCWDESMLKKLSCHYETGESLPDDLIKSLVASKNVNG
                     ALFNLRQLHFGLFDMALHTSKDGNVDMDKLWNDMREEICLISNGGITFKGYGSFGHLM
                     GGYASGYYGYLWSNVFAADVFFTKFAKDPLNVQNGMDYRNKILARGGSRDEMDNLVDL
                     LGRQPSSTSFLNELGLSQ"
     gene            complement(<1106453..>1108153)
                     /locus_tag="C5L36_0B05330"
                     /db_xref="GeneID:40383051"
     mRNA            complement(<1106453..>1108153)
                     /locus_tag="C5L36_0B05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464904.1"
                     /db_xref="GeneID:40383051"
     CDS             complement(1106453..1108153)
                     /locus_tag="C5L36_0B05330"
                     /note="PKUD0B05330; Pfam Domains:
                     Sugar_tr(2.3e-172)|MFS_1(1.8e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320763.1"
                     /db_xref="GeneID:40383051"
                     /translation="MPVLRKCHPTVFDMESIVSSIYSKTSNGTPYIKKEAFAKNVDNI
                     VTTNSILVSEEENEDKNNKNSFCLLAQYKLVATLCLLVAFGGFIFGWDTGTISGFVQM
                     PSFKNLFGTYNEFTGVYEFTNSRVGLIISIFNLGCALGGVTLAKLGDKLGRKRGLMAV
                     IVVYIIGIVTQISAMHWLQFMSGRIVSGLAVGAVSVLSPMFIAETSPSKIRGILVSCY
                     QLLITLGILLGYITTFGTVHTFSDTRQWRIPLGLCFVWAIILFGGMVFLPESPRFLIE
                     KERMAEATESIARVNSLEVSDTRVIAELYEISVGIKKQREAGEASWSELVFGKPHILT
                     RLMIGVSLQSFQQLTGNNYFFYYGTTIFQSVGLEDSFLTSIILGAVNFGSTFVALYVV
                     GRIGRRTNLITGSLGMAICLLIFAVIGSTILYPNGYGMPINRLAGIGLVVLTCIFIFL
                     FAITWAPGAFIVVSETYPLRIRSRGMAIATAANWVWGFLIAFFTPAITSHIRFAYGFV
                     FFGATVVGGFFVYFMVPETENLSLEEVDVLYRYYQPFNARNARKTIQCFHGEEKHMGP
                     "
     gene            <1108527..>1109222
                     /locus_tag="C5L36_0B05340"
                     /db_xref="GeneID:40383052"
     mRNA            <1108527..>1109222
                     /locus_tag="C5L36_0B05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464905.1"
                     /db_xref="GeneID:40383052"
     CDS             1108527..1109222
                     /locus_tag="C5L36_0B05340"
                     /inference="similar to AA sequence:RefSeq:NP_009677.1"
                     /note="PKUD0B05340; similar to Saccharomyces cerevisiae
                     YBR119W (MUD1); ancestral locus Anc_3.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320764.1"
                     /db_xref="GeneID:40383052"
                     /translation="MNSAHTLYIRNLNEKVGLKNLRKEIAKIFLEHGYQTLAIYVCKN
                     LKLKGQAFVSMRDSVDLDQVIEKLQTKLLYGKPMILQHAKTDADLVFKQKLSEEEFDK
                     LVQERRRARQQRRKQKTEEISKKRPRDEGPGENEHVSAKHKKLVTNKEEPVVPNKMMI
                     LTKLPEDITKEEIVSIFDKFGGFFKVNHVKVRKLALVEFQNEQAALECYKRLGPKLEI
                     KEKPDCLLTFAKN"
     gene            complement(<1109294..>1109770)
                     /locus_tag="C5L36_0B05350"
                     /db_xref="GeneID:40383053"
     mRNA            complement(<1109294..>1109770)
                     /locus_tag="C5L36_0B05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464906.1"
                     /db_xref="GeneID:40383053"
     CDS             complement(1109294..1109770)
                     /locus_tag="C5L36_0B05350"
                     /inference="similar to AA sequence:RefSeq:NP_009678.3"
                     /note="PKUD0B05350; similar to Saccharomyces cerevisiae
                     YBR120C (CBP6); ancestral locus Anc_3.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320765.1"
                     /db_xref="GeneID:40383053"
                     /translation="MSSTNITKKIVQLLQQLPADKVKHYSSFKFTQIERFCNLGGFPI
                     PKEVKEEQAAEEKKKQVLVKLDPKKLKRMIFNEKEEPINYQKNLFNEDILKQQYKSIK
                     NLHQNKWGNYYAISNKLLEPKGNPNYYSRLMGDVNKGGQKKEGLITAFKTILTGRY"
     gene            complement(<1109966..>1111465)
                     /locus_tag="C5L36_0B05360"
                     /db_xref="GeneID:40383054"
     mRNA            complement(<1109966..>1111465)
                     /locus_tag="C5L36_0B05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464907.1"
                     /db_xref="GeneID:40383054"
     CDS             complement(1109966..1111465)
                     /locus_tag="C5L36_0B05360"
                     /note="PKUD0B05360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320766.1"
                     /db_xref="GeneID:40383054"
                     /translation="MSSTEETKSIAQKKQWFPVASVAVLILALLLSKIHSFSVSLFNV
                     YNAYRYIPDKVLDHYIQKPLSDVSMEIPVYFDSAFKFPDLGEAVDIQLNSRMLNEYFI
                     LPNVSIILKPGKKYMYDEGYYPKDEMFTYAMLSDGDAIQVDGARNYGEIYFTLQSVDA
                     NDLPFFMTQLLLDHCYSREINKYTPDMFYQLTGADNQSDYFFLHADYVDKRLIRDLIH
                     KPKGIPLLIHIHLYVVMANFLNLNIMEAAQQYLLPVFQKYSHVFDFDVKVHHINLFDP
                     NADIQREHIDEYFPDELTDIPVLKDIYKETKEKFKDGTHVHMVFYPFFQGGDKLREKK
                     VGDMPLFSEYENMFLNIDNWGAVYFTHIPSENGDDTNTFSMNQLQDCMWTFNQALLDN
                     IGVPNEVLAPPIRLRGFGRYLTIQYLTYYSFLLNKIKVWKSTKALLYRDPSEVNHRVE
                     TFVGSLKLRDIVVERLKQDDTISSLHYAEKCLQWSETLTNKWKSVYLTA"
     gene            <1111710..>1112501
                     /locus_tag="C5L36_0B05370"
                     /db_xref="GeneID:40383055"
     mRNA            <1111710..>1112501
                     /locus_tag="C5L36_0B05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464908.1"
                     /db_xref="GeneID:40383055"
     CDS             1111710..1112501
                     /locus_tag="C5L36_0B05370"
                     /inference="similar to AA sequence:RefSeq:NP_013698.1"
                     /note="PKUD0B05370; similar to Saccharomyces cerevisiae
                     YML014W (TRM9); ancestral locus Anc_5.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320767.1"
                     /db_xref="GeneID:40383055"
                     /translation="MSGKLQPTEEEIHQETLRFHSRPTPVVKESEFVHDVYNEIAQHF
                     SQTRYKPWPIVQEFLETRPSKSIGVDVGCGNGKYVAVNPDLFIIGSDYSTGLIDQAVQ
                     LHRGEKCNDLMVADGLNLPHNSNTFDFAISIAVIHHFADEERRISAIAEILRVLEKGG
                     QALIYCWALEQEKSRRGYKEGMEQDVLVPWVLVKKGKRSKKNGKKEQKEQDKGQEGDD
                     QSPVKMRYYHLYKRGELTENAIKAGGKVVRDGYERDNWWVVVEKV"
     gene            complement(<1112607..>1114985)
                     /locus_tag="C5L36_0B05380"
                     /db_xref="GeneID:40383056"
     mRNA            complement(<1112607..>1114985)
                     /locus_tag="C5L36_0B05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464909.1"
                     /db_xref="GeneID:40383056"
     CDS             complement(1112607..1114985)
                     /locus_tag="C5L36_0B05380"
                     /inference="similar to AA sequence:RefSeq:NP_010724.1"
                     /note="PKUD0B05380; similar to Saccharomyces cerevisiae
                     YDR436W (PPZ2) and YML016C (PPZ1); ancestral locus
                     Anc_5.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320768.1"
                     /db_xref="GeneID:40383056"
                     /translation="MGNEGSKPKSNGVIKKESTNSIKSVRAFRGKRKNKDTKSSMGDT
                     TQTHVHSRTIKNERLQPLPNHINGKETPDSHRANDLLVRRVSSQKPRIETTDYSENFR
                     NDGNHDGQSMMYSSPSVTTSQRGLLESNSNSNSNSKIPIQIPIPIPIQIPNSHARSRS
                     HSHQNLVDGGNVAGEEETNNQWSNHGAHRSSSNVNLNDANNINNHNHRLPPSMAVLKP
                     KSPILRMNSSTSINDNSIQHMNPIDRQRSNSENHSSHLNNLSRRNSSTTINSTNSKNS
                     RHSKNSRNSRSYLETHGIPTDAFTQMTLEPNMGHLEDNGDQRPNSPTHSKGTSRSNSR
                     SNSRSHSRSHSTSSRNRASLIDQLGNGNVLGDYSNAIEDSGDEGIQPSQMINTDFRGD
                     LQHPNNEQDLLAYEQGENFIYGNNKDQNSQNQNYQEYEHEQAGQLEQNQNHQLEENIP
                     TDHYINPNDYRRKYDLDIEEMIQRLLDAGYAYKRTKSVCLKNSEIAMICSVAREIFLS
                     QPSLLELSAPVKIVGDVHGQYTDLIRIFSKCGFPPASNYLFLGDYVDRGKQSLETILL
                     LLCYKIKFPENFFLLRGNHECAQITRQYGFYDECKRRTNLKTWKLFVDTFNTLPIAAI
                     VASKIFCVHGGLSPVLNSMDEIRNIRRPTDVPDFGLLNDLLWSDPADSPNQWEDNERG
                     VSYCFNKVAINNFLNKFQFDLVVRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWG
                     AVMGVSEELLCSFELLDPLDSVALKHLMKKGRIERRNAMLKYSNNSTNQPTK"
     gene            <1116389..>1118050
                     /locus_tag="C5L36_0B05390"
                     /db_xref="GeneID:40383057"
     mRNA            <1116389..>1118050
                     /locus_tag="C5L36_0B05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464910.1"
                     /db_xref="GeneID:40383057"
     CDS             1116389..1118050
                     /locus_tag="C5L36_0B05390"
                     /inference="similar to AA sequence:RefSeq:NP_014029.1"
                     /note="PKUD0B05390; similar to Saccharomyces cerevisiae
                     YMR300C (ADE4); ancestral locus Anc_5.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320769.1"
                     /db_xref="GeneID:40383057"
                     /translation="MCGILALISPDQNTNVASELFDGSLYLQHRGQDAAGIVTCGKGG
                     RLYQCKGNGMARDVFTQERMAKLVGNMGIAHLRYPTAGSSSTSEAQPFYVNAPYGISL
                     AHNGNLVNADELKTYMDEVVHRHINTDSDSELLLNLFAAELATYDKSRVNENDIFKAL
                     EGVYNKVRGGYACVVMLAGYGIIGFRDPNGIRPLLIGERLKEDGTRDYMLASESVVLK
                     AHGYQVYRDILPGEAVIINKTDLKPVFRQVVKMRSYTPDIFEYVYFARPDSVLDGISV
                     YRSRLLMGEKLAGNIKSYFQNEDKDVLKEIDVVIPVPDTSRHSALQCAITLNIPYREG
                     FVKNRYVGRTFIMPDQKQRQSSVRRKLNAMASEFYGKNVLLVDDSIVRGTTSKEIVNM
                     AREAGAKKVYFASCSPCIRYNHIYGIDLADNKQLVGFQRSESEVASKIGADYVFYQKL
                     QDLVECCKRDDLIKENELELALTPVVSRDDTIKSLIQRDDEIPQITGFEAGVFTGEYV
                     TGDESRYMKLAEAARARNELLKNNSAGLVDVKAPSEINIHNDGDY"
     gene            complement(<1118289..>1119824)
                     /locus_tag="C5L36_0B05400"
                     /db_xref="GeneID:40383058"
     mRNA            complement(<1118289..>1119824)
                     /locus_tag="C5L36_0B05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464911.1"
                     /db_xref="GeneID:40383058"
     CDS             complement(1118289..1119824)
                     /locus_tag="C5L36_0B05400"
                     /note="PKUD0B05400; Pfam Domains: dsrm(2.4e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320770.1"
                     /db_xref="GeneID:40383058"
                     /translation="MSGKVTMFNPTFPFAAETSTDKVKKAVVDLQKAFSVIVDEANYY
                     TKSVADWNDPLVQFGIGLCTKYKNDLEFHTTMTFPASLNGYYDKDSDYLHQRATPYVF
                     NSFPTNFPELPASAFSYDTVNDYLKFEQRCGIGEALFRYLIETAIYRNDNNYSSKMAT
                     LIISQILNEASLKMLCHAYNIEFNYKLYAFHEPHKLFLAYLGTYYECQLRGGSGPNEL
                     YQWCRQLLGYRDFAPSQHPLTSSSTPPLNTSPATVNTHSQHTMGTSGQAEENPAKQQP
                     ILTGEVEETEKAQHLDNLDGELQIQDYLQSVQQDLNTMVKGSTDVQYEVSEYPDLKTG
                     FFKCTLKINGAKISESLAHSKKLAKSGAALEASTDVNTKQYIRRAYYDQWFRKYIDHA
                     AAIRKKLTNDARFAGSDSIPEQKNEHGCVANDDGGLTLEGGEGTDKVQLPLLQARNKL
                     YAYYHSKHGVTPKYEINQMGEQSFRADLFIGDKLRATATGVSKKEASAKAAMQIIEAE
                     SIR"
     gene            <1120154..>1120876
                     /locus_tag="C5L36_0B05410"
                     /db_xref="GeneID:40383059"
     mRNA            <1120154..>1120876
                     /locus_tag="C5L36_0B05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464912.1"
                     /db_xref="GeneID:40383059"
     CDS             1120154..1120876
                     /locus_tag="C5L36_0B05410"
                     /inference="similar to AA sequence:RefSeq:NP_012387.1"
                     /note="PKUD0B05410; similar to Saccharomyces cerevisiae
                     YJL148W (RPA34); ancestral locus Anc_1.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320771.1"
                     /db_xref="GeneID:40383059"
                     /translation="MAKKVISDEVIIDSDAGLSTDSEAERELEEKAVEFQAPKKYSKQ
                     DGKKKPSGFEALGKRDKVWLIKVPKDVDVDAIKEIPAVGKEIEINGKLYGISQEEARS
                     DQFQLLLPEGTGYRTCGVGISKVVDLHEKIRIPEINYSQVVTPRENVEREEGLRMRHF
                     PTGYYIKDYEEAQEPVVPGPNAGSKKRRHSAGEGDDDANVDGDDAAKSKKSKKDKKSK
                     KDKKDKKDKKEKKDKKDKKAKH"
     gene            complement(<1121015..>1122055)
                     /locus_tag="C5L36_0B05420"
                     /db_xref="GeneID:40383060"
     mRNA            complement(<1121015..>1122055)
                     /locus_tag="C5L36_0B05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464913.1"
                     /db_xref="GeneID:40383060"
     CDS             complement(1121015..1122055)
                     /locus_tag="C5L36_0B05420"
                     /inference="similar to AA sequence:RefSeq:NP_012988.1"
                     /note="PKUD0B05420; similar to Saccharomyces cerevisiae
                     YKR062W (TFA2); ancestral locus Anc_1.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320772.1"
                     /db_xref="GeneID:40383060"
                     /translation="MSDAFSAQLSAFKKSLKSTSDLPQQRRVPLAATSAPAESPSKPS
                     QNTSGVTGIQPSLDTSSGPLVKKQKVGRDPSPLPGDGGKLSGIAERAQLSAAAQAART
                     ANEGNLTMKLMTSSDYIKSKDREVPIFELETSLGFKVDSALMKCLTNVDRIKYNPTTS
                     SFVYLSLHNIKTGEDLLNVLKNQPAFTGLSVKQLRDGWNKCIPTLEQLEKENLIIVHK
                     TKKDNSPRHIWLNPDHLPIRVYNGVSSLQNFEMFVNQSSNTQVKEQTKTKSLDVVFYE
                     MWNDVHIPPHEELVKLLIANGLTPTNANREDKKTKKVKNVQERKQKRSRRSKITNIHM
                     KGILKDYSSKTK"
     gene            <1123314..>1124759
                     /locus_tag="C5L36_0B05430"
                     /db_xref="GeneID:40383061"
     mRNA            <1123314..>1124759
                     /locus_tag="C5L36_0B05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464914.1"
                     /db_xref="GeneID:40383061"
     CDS             1123314..1124759
                     /locus_tag="C5L36_0B05430"
                     /inference="similar to AA sequence:RefSeq:NP_015262.1"
                     /note="PKUD0B05430; similar to Saccharomyces cerevisiae
                     YPL063W (TIM50); ancestral locus Anc_8.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320773.1"
                     /db_xref="GeneID:40383061"
                     /translation="MSALRSLLLVRAASGPLRALPLRAAGRQLRGPAMAPLRSYATEK
                     NPHMGKTSKGKSILDEDMLAKAGVETEEPQSTSKSKATLSSKERQQEEYEEEEKRDKD
                     EFESTKSRRNNTKSTIDKKKEFYSRVFWYSFLAANLGFLGYMARDYDPNEEPELYVEE
                     ENGYTPGLIFKRLRKRLLGVSDVFSEPAFTDLLPPRTPGQYAPPYTLVLELDDFLIHS
                     DWDYKKGWKTAKRPGLDYFLGYLSQYYEIVIFSRSSMAFAEPAVLKLDPYHAFISYSL
                     FKEVCRSKDGKLVKDLSLLNRDLSKVIIIDPDENCYSMQPENAIPVDKWEGQKDDGLI
                     KLVPFLEYLATSRTPDVRQTLNSFQDKKHIPEEFAVREHQMREEWQIQQEKKKGSDWL
                     MKALGIPPSMRGSKKHPLDQIRENGQRNYLHMHNYLKEHGDRLLQEEQEKTKELMADQ
                     KLTLGKIVNEGMPTAEDIAKAAAEKEAQQSK"
     gene            complement(<1124979..>1127330)
                     /locus_tag="C5L36_0B05440"
                     /db_xref="GeneID:40383062"
     mRNA            complement(<1124979..>1127330)
                     /locus_tag="C5L36_0B05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029464915.1"
                     /db_xref="GeneID:40383062"
     CDS             complement(1124979..1127330)
                     /locus_tag="C5L36_0B05440"
                     /inference="similar to AA sequence:RefSeq:NP_014578.1"
                     /note="PKUD0B05440; similar to Saccharomyces cerevisiae
                     YOL063C (CRT10); ancestral locus Anc_3.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029320774.1"
                     /db_xref="GeneID:40383062"
                     /translation="MNDIIERDKLHDTLFEQYIATCGWRCTRDLGQSRLPRSHAAEDD
                     EMIEDDDEYGEEVYERERNQNQDSQGLQGGEVAREEGGIRNVEEETRYIQEADPLIPS
                     ETSSTSGPNSEEMFEGDIAIGAVYEGSTAYDSDVDFDSDSSEHDDDFENDDGMFEFSG
                     ERPTSKLQTLSSENLVPPFRENKFIYEQRNQTPSPKNSWNTSNGKDTGVPINGQDTNV
                     NYDRSVSEEPARSLSNRPQPSSDPMFTLANQPMQRFAQEKILDVRFVDRFLLPSNNFI
                     SFMNNLTALYSRNNYNILFLATGSKLEVYNLAEGNE