GenomeNet

Database: RefSeq
Entry: NC_042508
LinkDB: NC_042508
Original site: NC_042508 
LOCUS       NC_042508            2541747 bp    DNA     linear   CON 16-JUN-2019
DEFINITION  Pichia kudriavzevii chromosome 3, complete sequence.
ACCESSION   NC_042508
VERSION     NC_042508.1
DBLINK      BioProject: PRJNA545694
            BioSample: SAMN08558011
            Assembly: GCF_003054445.1
KEYWORDS    RefSeq.
SOURCE      Pichia kudriavzevii (Candida krusei)
  ORGANISM  Pichia kudriavzevii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
REFERENCE   1  (bases 1 to 2541747)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Population genomics shows no distinction between pathogenic Candida
            krusei and environmental Pichia kudriavzevii: One species, four
            names
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2541747)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2541747)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 2541747)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP028775.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 01-DEC-2017
            Assembly Method        :: HGAP v. 3
            Assembly Name          :: UCD_Pkud_6
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 93.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2541747
                     /organism="Pichia kudriavzevii"
                     /mol_type="genomic DNA"
                     /strain="CBS573"
                     /isolation_source="lab strain"
                     /type_material="type material of Candida krusei"
                     /db_xref="taxon:4909"
                     /chromosome="3"
     telomere        1..100
     gene            <3066..>4478
                     /locus_tag="C5L36_0C00100"
                     /db_xref="GeneID:40383860"
     mRNA            <3066..>4478
                     /locus_tag="C5L36_0C00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465682.1"
                     /db_xref="GeneID:40383860"
     CDS             3066..4478
                     /locus_tag="C5L36_0C00100"
                     /note="PKUD0C00100; Pfam Domains: DAO(1.8e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321542.1"
                     /db_xref="GeneID:40383860"
                     /translation="MDKDKRIIVLGAGVMGLSTTLSLLENGYKDISLYDKRDYFAKRY
                     SYFDGCDSPSSDLNKIFRSSYGAEVHYQKMSFLSREKFQRWNREIAEQKWEGGEPIYL
                     NTGNVHLTDRGELPEFERLTLENMPEHSIHITDADAGERAVKQGLDPCSVDPFDMRRK
                     GKNLQGVLDTTGGMTLADKSCRWILEKCIAMGKDRLKTFFGDCGTFKELLLEFNSKTL
                     KRKCVGIKTLDNEAHKCDHLIVCVGPWTTEVIPEASEKLEATGGSVCLIKITDEKLKE
                     RFNQSKFPTWTYKVRDGAIGGLYGFPCTGGYLKIGYRGLKWINPQNGLNSKVKTKWSP
                     DETETNIPLFALKQIKNFVREHIPEIPKITMTRLCWYSDSEDNDYLISFCPYYEENSV
                     FVMGGDSGHAFMMLGSIGDVAVGIINGTGNKLFKDLFSWERERPKLNPINGGKEDPRC
                     LEDTVMATPKDWYIHEPPKL"
     gene            <4846..>5643
                     /locus_tag="C5L36_0C00105"
                     /db_xref="GeneID:40383861"
     mRNA            <4846..>5643
                     /locus_tag="C5L36_0C00105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465683.1"
                     /db_xref="GeneID:40383861"
     CDS             4846..5643
                     /locus_tag="C5L36_0C00105"
                     /note="PKUD0C00105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321543.1"
                     /db_xref="GeneID:40383861"
                     /translation="MCHHLKTGGSPPLGALCLDYTEDIHRPPGDVIVSETYTFPVIQE
                     KVIGATLWKVVDSQSFSDSYVQLFVDACRVLQKKGCIGIITSCGFLAQIQERLAEQIE
                     VPIATSSLLQVPYVLAIIGPRKKVGVITFDEARLSETHFNGVGINNEMLKRVIVTGCH
                     PKGALHRIITRGDPYIAEEVKQELVNLATELVQKNQDIGAIVLECTQMPPYSEAIQQA
                     TKLPVFDGVTMVKWFYSGLNSMAVPDDKNRQDALRRRLRSSKEEKPP"
     gene            <6058..>8217
                     /locus_tag="C5L36_0C00110"
                     /db_xref="GeneID:40383862"
     mRNA            <6058..>8217
                     /locus_tag="C5L36_0C00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465684.1"
                     /db_xref="GeneID:40383862"
     CDS             6058..8217
                     /locus_tag="C5L36_0C00110"
                     /note="PKUD0C00110; Pfam Domains:
                     Fungal_trans(4.1e-22)|Zn_clus(4.6e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321544.1"
                     /db_xref="GeneID:40383862"
                     /translation="MVILGIATTEHCVVENMEKQNSGMDKKKPTISINVFKPEKQNVQ
                     LKRPLRTRRSGGKHQMAACCACKKKRKKCDGKYPVCSTCERLGLECTMIYPPNGKEIK
                     RDYLETLEKSVKELTSKLDILQSKNTTGAETISNRVARTFETKFSTSQVKYPPTLNKD
                     NVLAEEVGFITLGAGGEPCYIGETSAYSIAKVISTSLTCPPFEEPHPWKDGGFSLNLE
                     LPFSHPDIKSGSELLSYYKESVHCQYPFLDWNYVEECFNLVLTEKSQEQVPNFFIYMI
                     FAISSQLHDVSNKIQTSQYTRAYYSKAFQYSNRTIESPTIYAVQAFLLIAVFSQKMPD
                     SSSGWQAIGLAIRTAVILGLHRKPYTRNNEELTAHQLQVQDLKSRIFWSAYGIERING
                     LVLGRPFSISDIDIDAPFSIESCETRVACHVIKLRRIQSNIYTFIYKPLHLTDQLENM
                     ETTRVQILLELNDWILTFPFKNDASSTFETNNWSLISYHNSILLLLKPIFLEVSKRKK
                     GSSKEHLEWFKVFTESASAICINYKNMYLKEKMSFTWLAMHCCFVSGISFLYCIWLDT
                     ELKVLKWKRKSLIYETISACQTVLYVLAERWNSALRFRDTFERLSSIVKAAIESSCEV
                     RGLSSPRTNDISSSRVFIEGSISIDSYLSCEKYRDMVKHIHSFSDENKTGIKPNVGGT
                     INEEDSLENLLNIFDHSGDQYLRDLFDELEDNVLMIS"
     gene            complement(<8320..>9420)
                     /locus_tag="C5L36_0C00120"
                     /db_xref="GeneID:40383863"
     mRNA            complement(<8320..>9420)
                     /locus_tag="C5L36_0C00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465685.1"
                     /db_xref="GeneID:40383863"
     CDS             complement(8320..9420)
                     /locus_tag="C5L36_0C00120"
                     /note="PKUD0C00120; possible pseudogene; frameshift at 5'
                     end"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321545.1"
                     /db_xref="GeneID:40383863"
                     /translation="MFTFATAISFNVSSLMTCRFFAGFFAGAPIVSAGGVLADLWDPS
                     FRGVAFAIYACFVANGASFGPVVSSLLTNSNSSVESWRITQWFCGLGQLVLFVLMYLF
                     TEETFENKTLQKLVTWYRIKEDKWLLHTKADTVYLDFKGMLLLHVVRPFEMLSIPVVF
                     TMALFASYVYGLFYLMITNISTAFELSRGWTGTITEVPNVSLFLGVVFGCIGNILWAL
                     KYLEIVRSNKGEAIPEQRFPIMMMLGWMMPVGIFVFGWTCDANIHWIVPCIGVSMIGA
                     GFITIFQGCINYLVDSYPIHAASAIAANTFMRSAFAAIFPLFAKQLFVNLGVHWGSSL
                     IGFVALGMIPIPFVLFVVGKKLRASHWDKLQG"
     gene            <10380..>11963
                     /locus_tag="C5L36_0C00140"
                     /db_xref="GeneID:40383864"
     mRNA            <10380..>11963
                     /locus_tag="C5L36_0C00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465686.1"
                     /db_xref="GeneID:40383864"
     CDS             10380..11963
                     /locus_tag="C5L36_0C00140"
                     /note="PKUD0C00140; Pfam Domains: MFS_1(3.3e-32)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321546.1"
                     /db_xref="GeneID:40383864"
                     /translation="MPEKLQNNEKGGLYTVEVSSLDDCDPVISTVVALNGKKIEVHQQ
                     DADVAMQYIDDIADLEMDPDFERKVLRKIDYAILPVIIALMSCQLMDKTTNSYASIMG
                     LQESLNMSLREYSWVGSSFYFGYLIFQYPANLLLQKLPLSKTLSIAVICWGVVLMCHA
                     ACTDAAGFLVCRVFLGVFEGFMNPAYILLTSQWWRKEEQFIRTCVWWGMQGFGTILGS
                     GIAYGLQVHRAGYQTFPSWKCVYVITGCITLCLGFVSYLHIPDVPTKAWFLSEKEKLY
                     VVERAKENQQGFGNQKFKWKQGKEAIFDPCTYIFFVYGISYAIPNGGFNNFGSILLKD
                     DFGFSTADALLMNMPGGGIDIIFPLCVALFNYYLLKNQRLVSCAIVNTTVVVGMCLLN
                     FTDSRGSRLAGYLSFYMATAVSAGICSTIASNIAGSTKKVVVNTFFLVGYCAGNIIGP
                     QTFNAKQAPGYSGAKAAMLASFAIGTCLIIALYVIYTCRNKKKDEIIQSLGEKYSIPD
                     NIAFADLTDFENPGFRYSL"
     gene            complement(<12283..>13299)
                     /locus_tag="C5L36_0C00150"
                     /db_xref="GeneID:40383865"
     mRNA            complement(<12283..>13299)
                     /locus_tag="C5L36_0C00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465687.1"
                     /db_xref="GeneID:40383865"
     CDS             complement(12283..13299)
                     /locus_tag="C5L36_0C00150"
                     /inference="similar to AA sequence:RefSeq:NP_010137.2"
                     /note="PKUD0C00150; similar to Saccharomyces cerevisiae
                     YDL144C; ancestral locus Anc_7.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321547.1"
                     /db_xref="GeneID:40383865"
                     /translation="MQLPRTLLIGTGGVGTIVAYGLKYTGKTTVSVVVKSDYPRVKEA
                     GWEINSCDYGKVENWKPDHIYPTVEAASANGDYDYVVITTKNLPDIVKPEEVAAPVIT
                     PGKTTIVLIQNGFDLGRPFIAKYPNNFCLSGVSHIGSHNHNGVISQTQNDKCLISYFS
                     NPTFSKEEQEEKAKEFVSLYSNDRNTISYFPDVKWYRYRKLVYNATLNTACALTRVDT
                     GRLEYSGALEAVSVPAMREVIKVAKADGVELPADVINSVVHSDDGDYFKPSMLVDVEK
                     GNPIELEVILGNLLIVANELNVETPTLTVLYNLLKATQLKLKENRGLVSLPQKRPITD
                     KFFS"
     gene            complement(<14132..>15148)
                     /locus_tag="C5L36_0C00160"
                     /db_xref="GeneID:40383866"
     mRNA            complement(<14132..>15148)
                     /locus_tag="C5L36_0C00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465688.1"
                     /db_xref="GeneID:40383866"
     CDS             complement(14132..15148)
                     /locus_tag="C5L36_0C00160"
                     /inference="similar to AA sequence:RefSeq:NP_010037.1"
                     /note="PKUD0C00160; similar to Saccharomyces cerevisiae
                     YDL244W (THI13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321548.1"
                     /db_xref="GeneID:40383866"
                     /translation="MSTNKITFSLNWQPAPYHIPIYYAQIKGYFKDEGLDIAILEPSN
                     PSDVTELIGSGKIDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGILYLKSSGITND
                     FSTIKGKKIGYVGEFGKIQLDELCKYHGLKESDYTAVRCGMNVAKYIIEGKIDGGIGI
                     ECIQQVELEEYCKQKGLDEQEVQMMRIDRVACLGCCCFCSICYIANDEFLKNNTEKVR
                     SFLKAIKKATTEILAAPQDCWETYVDFKPQLNNSLSYKQFERCYAYFSASLFNVDRDW
                     QKVTNYGKRLEILPPDYKANYTNALVPGEEPAETVDPTEAQRLMAVHQEEVRKNGGFH
                     RLAI"
     gene            <16385..>17428
                     /locus_tag="C5L36_0C00170"
                     /db_xref="GeneID:40383867"
     mRNA            join(<16385..16386,16468..>17428)
                     /locus_tag="C5L36_0C00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465689.1"
                     /db_xref="GeneID:40383867"
     CDS             join(16385..16386,16468..17428)
                     /locus_tag="C5L36_0C00170"
                     /inference="similar to AA sequence:RefSeq:NP_011660.1"
                     /note="PKUD0C00170; similar to Saccharomyces cerevisiae
                     YGR144W (THI4); ancestral locus Anc_5.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321549.1"
                     /db_xref="GeneID:40383867"
                     /translation="MASATTTTIAQESVPISLKTTNVANKDSKVAKATEAVYDWDTFK
                     FAPIRESQVSRAMTSRYFKDLDKYAESDIVIVGAGSSGLTAAYILGKSRPDLKIAIIE
                     ANVAVGGGCFLGGQLFSSMVLRKPADVFIKELGLEYEDEGNYIVVKHAALFITKLCSK
                     VLELPNVKLFNATCVEDLITRPTETGVRVAGVVTNWTLVSMHHDDQSCMDPNTINAKV
                     IISCTGHDGPMGAFCVKRLVSQGLIKRNLMGCLDMNKAEDAIVTKTREVFPGLVVAGM
                     ELSECDSSNRMGPTFGAMVLSGIKAAEEALNVFDLRAKQDAESY"
     gene            complement(<17642..>22189)
                     /locus_tag="C5L36_0C00180"
                     /db_xref="GeneID:40383868"
     mRNA            complement(<17642..>22189)
                     /locus_tag="C5L36_0C00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465690.1"
                     /db_xref="GeneID:40383868"
     CDS             complement(17642..22189)
                     /locus_tag="C5L36_0C00180"
                     /inference="similar to AA sequence:RefSeq:NP_014796.3"
                     /note="PKUD0C00180; similar to Saccharomyces cerevisiae
                     YOR153W (PDR5) and YDR406W (PDR15); ancestral locus
                     Anc_5.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321550.1"
                     /db_xref="GeneID:40383868"
                     /translation="MSTSSASSNGKYETFSMAETGKENKTEFENNADEDELSENISNI
                     YRAITHETEFNASNGKDSDPILKRLSTLSKTLSTMNAESMKSFKINENDFDLKAILEF
                     MARGNLRNGIQKKNCEVVFKDLTITGKNTSASVVKDVSDVFFPFYSLIRNRRERKKNS
                     FDFKKLPKSRNIVKGASGYLEAGSMTLVLGRPGAGCSSLLKILSGETKTYTGYEGEIF
                     YGGIPSEEMFKKHTDQLIYNPELDVHFPFLTVEQTLNFAIGCKTPVVRLNNISRKEYI
                     NVIKDLYLTVFGLKHVEKTLVGNDFVRGISGGQRKRVSIAEAMVTRGTVFCYDNATRG
                     LDASTALEFVEALRTSTNITENTSVVTIYQASENIYQLFDYVTVLYLGRQIYFGPIGE
                     AVGYFNRMGYHKPERQTSSEFLTAVTDPLARHIKPGFDISRVPQTADEFEEYWKNSPE
                     YAKLLKTVDEKIKIADSKETEMVFNSVRETEKQRWTSSTSPYTINFPQQLKLCCQRRF
                     QNIVNNKAYTLTLMFAATFQSLIIGSLFYNTPQTTIGAFSRGGVLFFSCLYFCIMALA
                     EIAALFMDKPILNKQISYTMYRPSAELLAKQMVSYPVRLIAITSFSLILYFLTNMKRQ
                     PGAYFIYFLFINLVVPTITSLFTLLASLMPNVAAANGISGLTMMSMVVYSSYMIQRPN
                     MHWWFKWFSYCNPVLYAFEAMILNEFHGRVMPCAESQLIPHGPSYSNINQLTNQVCGF
                     VGAAESKELYGGKNDVDGMIYLKLAFQYVYPHLWRNLGIMFAFLCGYLTLNVILVEIY
                     NPISASADKLLFVHGARIPSSLLDAIGFSETNDNDLEAQTVLKEKGDIQIETDVVVSQ
                     SSHDGVNERLGSQDILMWKNVDYVVPYEGEARKLLENVQGYVLPGTLTALMGESGAGK
                     TTLLNVLSRRVDVGVVSGDMLINGKPIDSSFERRTGYVQQQDLHIAELTVRESLIFSA
                     RLRRPHSVPDKEKIDYVDEVIRILRMEEYSDSIVGAAGYGLNVEQRKKLSIATEMVAK
                     PSLLLFLDEPTSGLDSQSSWAIVQVLKDLARAGQAILCTIHQPSATLFEEFDRLLLLK
                     TGGQTVYFGEIGENSSTLLDYFEKQGARKCLPSENPAEYILEAIGAGSISTTENWYEK
                     WCQSEEYIKVTKDIEQLIEETSKLPSVDNSELHTKFAAPYYVQFREVLKRTFLQFYRG
                     LQYIMAKFILFLLAGLVVGFTFWNSKHNASGMQDVMFACLLAVIIASPMMNQIQAKAI
                     ASRQLYEVRESKSNTFHWSLLMISQFLTEIPFCVCFSTIYFICWYFPIQLDNSASRCG
                     MWWFTYCIFFQIYYISFSLTIVYAAPDLPSANVLTGLGWSFVIAFCGVLQNPHLLPGF
                     WKFMWRLSPLTYFVDNFLSLVLHERKVTCSATEYNYLQPPSGSTCGEYLQSYFLDNSG
                     YVDNPNATADCAVCQYASGDEYLKTVGMSYSHRWRNVGFFCVYICFNLCAMMSLHYFF
                     RIRKYSLKTPFVLLAKNFQRK"
     gene            complement(<22620..>23945)
                     /locus_tag="C5L36_0C00190"
                     /db_xref="GeneID:40383869"
     mRNA            complement(<22620..>23945)
                     /locus_tag="C5L36_0C00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465691.1"
                     /db_xref="GeneID:40383869"
     CDS             complement(22620..23945)
                     /locus_tag="C5L36_0C00190"
                     /note="PKUD0C00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321551.1"
                     /db_xref="GeneID:40383869"
                     /translation="MSGIKGIQIAKGLPLEILQRVINISLQRWFNISEILQFILDNYD
                     VLDTDPFMRLVSLKNIELTLFFDDSLRFGYKFCGFDTIKLNNERALKFEELLKNGRLS
                     ISRICVYKNVKHLLFLLKYSPLNHFPDYVEIPHIALKQPLHKDINIEEEYLRDIPQIL
                     KNTRGDNQFTFHIQKFDEPENISDLSELVLFLNSLSDTRAEYEITFGLISTSESLSPS
                     SVYGLTTMLKKYETPRVKFNLMLSNIPLENKFPEYITEFSCYGLSLRGRPIDLNWKMG
                     DQAIFRYDGDLLTISEYMQNLNLRGLLDYIQSVNIFINSDRMEELCCHKYLLPFNVNT
                     LTLIYDEKDETVVDLSFLDVDGKTYLNTLRIVKPSCPTVRVINIKHLQDRIKNLILAM
                     GEHPDRKWEFLDRDLGLDNIYSNVPMVGKALPHDSPLIQNRFISMIHLD"
     gene            complement(<24137..>27232)
                     /locus_tag="C5L36_0C00200"
                     /db_xref="GeneID:40383870"
     mRNA            complement(<24137..>27232)
                     /locus_tag="C5L36_0C00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465692.1"
                     /db_xref="GeneID:40383870"
     CDS             complement(24137..27232)
                     /locus_tag="C5L36_0C00200"
                     /inference="similar to AA sequence:RefSeq:NP_014803.1"
                     /note="PKUD0C00200; similar to Saccharomyces cerevisiae
                     YOR160W (MTR10); ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321552.1"
                     /db_xref="GeneID:40383870"
                     /translation="MKLFFLVFTCFFFFFFFFFFSNRDSSGIIIILYCRYPTFSSRVH
                     FTGESANLETMDIQQIQNTLQSLYGPTSPAEKKAASDALLQFQRSQQAWDVIFPILQE
                     PNAPFELKLFVCQTLRSKVQYDFGQLNNESSTIESLRLSILNVLNSMTEFKSQKLLII
                     QVSIALAYLIIQDFTWETPITDVMNALANTPVNLLEFLNVLPEEMSDFKKLPLTNEEF
                     ESQFEKLLTKNAENVYYVLVQSSANIGFNKDLETLVLCCIKSWINEIPISLILSEDSP
                     LWKLIVDGFKDDETFDTSVDCMITIVNQIDVFDNLDDNLPLIQIVYSELVALRPIIQQ
                     HWEDPMVIERLAELYASAGEAWHTLIVKDPSNFQVLIESILQLSNYSEDLDIVKYTFK
                     FWYEMKSMLALPTFKDSKLIFKPIYIKLTEILIEHLKYPLVSDSTNVSELFNHNKENE
                     DKFKEFRYEIGDVLKDCCLIVGQYDCLSIPFNKLQALIGSGSGVRWQEIECLLFAIRS
                     MAKEVSKNESKIIPQIMSYLVQLPENPKIRYAATLVLGRYTLWTSAHPEFLQTELNYI
                     IEGFKVVDSGYKEDEKMQIIIAASHALKYFCMDCSELLIDFLEPLYNLYSNIENFIDF
                     QSLYDIVEGLSYVLQQYIGKNIVSNPDQCLSVLQMFWSSTISKLEGFIANKNDVAAID
                     VQIGNTVELLTLYIENFKPTHGFMTTKNPDYAICTYVMNSVLPLIFQVIERYGSMIRV
                     SERSIKLIRKCIQTFGRFILPSLKSLENVLAQGFQNFGYGCYLWCSGALLKEFSNEED
                     EDLDEFIPLTTDIINEVWNFGLGQIHTFITIYEADKINVNKDLVEDFYRMLGDVLMFK
                     PLELFSQFDIVEIVFRMSLEIIDNVNEYELLNLVIQFVIDLLSWSLENPPISIYIDIP
                     NILKFQIFELMNKNSTEMVTKMLNYAILKFNEDLMYSSIELVIEIFKINRHYSKNAAT
                     LNSINMFLQSLPSELINDVEKMKFYNQIEVALSSKNYRKVRSSMLDFIHWYKRKIVNR
                     D"
     gene            <27402..>27653
                     /locus_tag="C5L36_0C00210"
                     /db_xref="GeneID:40383871"
     mRNA            <27402..>27653
                     /locus_tag="C5L36_0C00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465693.1"
                     /db_xref="GeneID:40383871"
     CDS             27402..27653
                     /locus_tag="C5L36_0C00210"
                     /inference="similar to AA sequence:RefSeq:NP_014802.3"
                     /note="PKUD0C00210; similar to Saccharomyces cerevisiae
                     YOR159C (SME1); ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321553.1"
                     /db_xref="GeneID:40383871"
                     /translation="MSGRTTNTPPINALFKYLQTQKPVSIWLYQQPQIRVTGTIRGFD
                     EFMNVVLENAAEVSVKDGKKRELGMMLLKGDTISLISAV"
     gene            <27853..>28719
                     /locus_tag="C5L36_0C00220"
                     /db_xref="GeneID:40383872"
     mRNA            <27853..>28719
                     /locus_tag="C5L36_0C00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465694.1"
                     /db_xref="GeneID:40383872"
     CDS             27853..28719
                     /locus_tag="C5L36_0C00220"
                     /note="PKUD0C00220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321554.1"
                     /db_xref="GeneID:40383872"
                     /translation="MIIPLLLILQLAIGHDEIIENEMNWVLESLEQKSDSCMLNVMAK
                     YYIPYQEIIPAHDVKERALVSKILAVELTKCLFDGPYMPELDERCNATEWNEENLQNC
                     VGSLAQNNVIWTTFNGYLGQMDSLVHERSEKIDNLRILKEYKLIISSLGEHMDNILTE
                     RIEREFEFADILNTWHLEHEQTHLDLVQNLKSQIEELRAFNKLQQEIQQEERIRLSKS
                     SRFRLPVLIVALLLLTMTALVQLVGGVDRTQVELALFLRMIAFGVGAGLATVLRHELS
                     KYFTKLDPENIT"
     gene            <29536..>32139
                     /locus_tag="C5L36_0C00230"
                     /db_xref="GeneID:40383873"
     mRNA            <29536..>32139
                     /locus_tag="C5L36_0C00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465695.1"
                     /db_xref="GeneID:40383873"
     CDS             29536..32139
                     /locus_tag="C5L36_0C00230"
                     /inference="similar to AA sequence:RefSeq:NP_013012.3"
                     /note="PKUD0C00230; similar to Saccharomyces cerevisiae
                     YKR086W (PRP16); ancestral locus Anc_5.683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321555.1"
                     /db_xref="GeneID:40383873"
                     /translation="MFKKRGNFKKGNSKISSKDEGGLEDDILSSTPILSIKRGKEHCV
                     EFKKKQKLENTQDLTAKPDDDAEESYFEQFDDYEVDPSKTTCTKQILSKNIDTTGVND
                     IFVHRLTPPFLDSHSVLTTRQNIAEIVRDKSGDLYKLSKNGSTILNEKRRLNEISKGR
                     EMDTKGKTLQLEKVSESLEMEDEEGETAILQDTEHLSAKSFNRESLPAYKVRDQLMNL
                     INENQVLIVIGETGSGKTTQLPQFLYEKGYTKNGMIGITQPRRMAAVSVAERVGEEMG
                     VAIGTKVGFTIRFNDKTSSDTQIKFMTDGILLRETLHDPLLSKYSCVIMDEAHERSLN
                     TDILFGIIKKVLMKRRDFKLIITSATMNSLKFSRFFNNAPQFQIPGKTFPVDIMFQSI
                     PSADYIDSAVKQALKIHLSNPHAKGEHGDILVFMTGQEDIEVTCQVMEDELQKLKKIN
                     PSINGLDVLPVYSSLSSQCQLKIFSESENRKCIVATNIAETSLTLHHVKFVIDSGLMK
                     LKVYNPKLNMDALQMVPISKAQAKQRSGRAGRVCPGQCFRLYTLTSYEEEMWDEPIPE
                     IQRSNLMNTILLLKNLNIKDLGKFPFVDSPSKEALETSQYDLWTIGALNNFGELTELG
                     KKITRYPIDPMLSKMLIISKEYSCSAEILRIVSMLSVPPVFNTPKRDSNLTQKATHAR
                     ENFQIEGSDHLTLLNIFNQFENARNKEKWCTKNFLNFKSLRQAYEIHSQLKQLTGDIR
                     SNNNWNAIRECICASYFPNAAEFFKHGQYKHCRLGLEMYIHPTSVFFGLGDVPRFVVF
                     HELVMTSQKQQIHYLTSVEADWLVKYGYLFYSPRVRGISSRENQKIKEQEYLNLIEHE
                     KGLRNNKSIKD"
     gene            complement(<32126..>33055)
                     /locus_tag="C5L36_0C00240"
                     /db_xref="GeneID:40383874"
     mRNA            complement(<32126..>33055)
                     /locus_tag="C5L36_0C00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465696.1"
                     /db_xref="GeneID:40383874"
     CDS             complement(32126..33055)
                     /locus_tag="C5L36_0C00240"
                     /inference="similar to AA sequence:RefSeq:NP_012121.2"
                     /note="PKUD0C00240; similar to Saccharomyces cerevisiae
                     YIL145C (PAN6); ancestral locus Anc_5.697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321556.1"
                     /db_xref="GeneID:40383874"
                     /translation="MMEIPIITTVSELRQLRAKFGEESVGFVPTMGYLHEGHMSLVGR
                     STKENQHTIISIFVNPSQFAPEEDLDTYPRDIGHDVAVIEAYLKKHGGKVDAIFKPEV
                     NEMYPSGFTMKREEQRGAFVEVLGVSDVLEGKTRPSFFRGVATVVTKLFNAVKPTVAY
                     FGQKDIQQTVVIKMMVRDLLMDLSVVVVPTVRNKSGLALSSRNKYLSDDILKQAECLN
                     QSMLLANESYQKGETDVAKLSESIKSLIEGTNPAFKIDYVAFNDPVTLEYINKIDISK
                     GCILSMAIYVPNTTSKDEKKFTRLIDNMVFNPL"
     gene            <33388..>34968
                     /locus_tag="C5L36_0C00250"
                     /db_xref="GeneID:40383875"
     mRNA            <33388..>34968
                     /locus_tag="C5L36_0C00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465697.1"
                     /db_xref="GeneID:40383875"
     CDS             33388..34968
                     /locus_tag="C5L36_0C00250"
                     /note="PKUD0C00250; Pfam Domains: COesterase(3.8e-46)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321557.1"
                     /db_xref="GeneID:40383875"
                     /translation="MGHAVSADHCPKHTVEIPRHGTLTGVTLKRPSGKPTVHRFAKVP
                     YALPPKARFGLPIPIPDDYDYTGEYERYGAKCPQPVYESKELVYAESPSDESIQYLNI
                     WVPASNKYRPQNGWPVLVYIHGGWLQYGDINNEFFNSVELMDDEHFKEKYIFVTPAYR
                     LNIFGFLTCNQLEHKNMGFWDQREALKWVHRFIVHFGGDPSKITLSGLSAGAYSTFFQ
                     LAYELYHPNEEQIIKQVIFHSNMILTQPKSITECKAQYSEIVDKLGIGELNPQQQLQR
                     LQSLDYKFLERFIPTLNLHTFRAVTDDDFVSSTTILDIMNGKFSELLVKKGVRIMHGE
                     VDNEGYLYSLLNPPVSVEEFQLQVENYYPREVTLELMEVYNVVSAPETKLSTLFGNVI
                     GDGQVYVSTRGFINNIVENGFPAKDYFRYRIAYRGKWLDKHLSPELKVTHAHDKPIWF
                     YALRAGFTEKEKARLDEFLIPYLEFLNFHDDIKGWETSNARKLRLFKSDGSIVYEDDV
                     DWERCTQIAKKLYEKQLD"
     gene            complement(<35077..>36066)
                     /locus_tag="C5L36_0C00260"
                     /db_xref="GeneID:40383876"
     mRNA            complement(<35077..>36066)
                     /locus_tag="C5L36_0C00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465698.1"
                     /db_xref="GeneID:40383876"
     CDS             complement(35077..36066)
                     /locus_tag="C5L36_0C00260"
                     /inference="similar to AA sequence:RefSeq:NP_013006.3"
                     /note="PKUD0C00260; similar to Saccharomyces cerevisiae
                     YKR080W (MTD1); ancestral locus Anc_5.673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321558.1"
                     /db_xref="GeneID:40383876"
                     /translation="MSAIQKACKVIPASKIAKSYIQEVTEKTAALSKKPKLVGLLAND
                     DPAAMMYATWTGKTANNLGFQYELIQVNKDQLEEEIYKCNNNDDINGMIVYFPVFGNH
                     QDQYLQQCVSIHKDVEGLNFKYISNMYHNIRYLDHNKTMKSILPCTPLAVVKILEYIG
                     AYNTVLEPGARLYGKTITVVNRSEIVGRPLAALLANDGAKVYSVDINDIQLYERGDGL
                     RYKQHKVHDCNKSLEECAKESDIIITGVPTKTYKFPSNYIKRGAICINFSSEKNFVDE
                     EVEKVASLYVPSIGKVTIAMLLRNLLRLMNNKKAVDAPNVEPPIEPTDKPQKI"
     gene            <37199..>37774
                     /locus_tag="C5L36_0C00270"
                     /db_xref="GeneID:40383877"
     mRNA            <37199..>37774
                     /locus_tag="C5L36_0C00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465699.1"
                     /db_xref="GeneID:40383877"
     CDS             37199..37774
                     /locus_tag="C5L36_0C00270"
                     /note="PKUD0C00270; Pfam Domains: GST_C(7.3e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321559.1"
                     /db_xref="GeneID:40383877"
                     /translation="MTLGTLYVNAQFPRNSHVLKLVRYLGLNIDIVDVREINNYAEIY
                     ALHKVPYFLGTDGFKLPEAYAVVCYLIDLSGDHGDLLGRSTKEKALNTAWYSLVNMEI
                     IQRYGVLLSGKTQQAKDKATAELHGLLEYIDDALATREFLIGNSFTVSDLFAHDAIKT
                     LHGLNNDFKSYTNINRYLGSCGCHPCIAPYI"
     gene            <38180..>39589
                     /locus_tag="C5L36_0C00280"
                     /db_xref="GeneID:40383878"
     mRNA            <38180..>39589
                     /locus_tag="C5L36_0C00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465700.1"
                     /db_xref="GeneID:40383878"
     CDS             38180..39589
                     /locus_tag="C5L36_0C00280"
                     /inference="similar to AA sequence:RefSeq:NP_009890.1"
                     /note="PKUD0C00280; similar to Saccharomyces cerevisiae
                     YCL040W (GLK1) and YDR516C (EMI2); ancestral locus
                     Anc_1.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321560.1"
                     /db_xref="GeneID:40383878"
                     /translation="MSQLDLKVKEIVESFEVEKELLQNLVTLFIRSAEYGLTHSSVGK
                     AAMPMIPTYVTQIPTGKEKGVLLAADLGGTNFRVCSVKLNGDHTFELKQSKNPIPVDL
                     MSSTTEELFSYLAGKIGQFVETHHNDIGDKMKLGFTFSFPVEQTSLNSGTLIRWTKGF
                     NIEDTVGKDIVAVLQDHLDRKNIPVHVAALANDTVGTLLARSYTGENKEGLTSIGCIY
                     GTGTNGAYNEKVENITKLPKEVVEELKSKGIDHMVINTEWGSFDNNLELLPTTKYDVE
                     VDKISANPGYHLFEKRVSGMFLGEILRHILVDLYEQGLMFTQYPTINELPHRLKTPWL
                     LHSEGLSIFEIDDSTNLIATEIELKNMLRLPTTPEERKAIQKLTRAISKRAAHLAGVP
                     IAALTMKIDAFKGHNVEVDVGVDGSVVEFYPGFRTMMRDAIADTQIGAKGERRLHVNL
                     SKDGSSVGAALCALSNNSL"
     gene            <40024..>40590
                     /locus_tag="C5L36_0C00285"
                     /db_xref="GeneID:40383879"
     mRNA            <40024..>40590
                     /locus_tag="C5L36_0C00285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465701.1"
                     /db_xref="GeneID:40383879"
     CDS             40024..40590
                     /locus_tag="C5L36_0C00285"
                     /note="PKUD0C00285; Pfam Domains:
                     GST_C(6.1e-14)|GST_N(5.5e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321561.1"
                     /db_xref="GeneID:40383879"
                     /translation="MTFGTLYILPPSPRSAWLPKLAKYLGLEINVKSMLEVEDFKSKF
                     PLGKAPAFEGSDGFRLTETLAIIKYFIDSSSKPEFAGSSLKEKALNEKWLSFANSDLC
                     GAMVGVWFCKDESKKPELVSKLNSLLQYIDNELNNSKFLVGDSVLVADILLYVTLQHI
                     VEIGVDISSFSHLKKYSEEVAKHELLAE"
     gene            complement(<41173..>42066)
                     /locus_tag="C5L36_0C00290"
                     /db_xref="GeneID:40383880"
     mRNA            complement(<41173..>42066)
                     /locus_tag="C5L36_0C00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465702.1"
                     /db_xref="GeneID:40383880"
     CDS             complement(41173..42066)
                     /locus_tag="C5L36_0C00290"
                     /note="PKUD0C00290; Pfam Domains: DnaJ(4.2e-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321562.1"
                     /db_xref="GeneID:40383880"
                     /translation="MNRFGQYTYRCFHSRCPLGARDSHYDVMRLPHDATLSDIKSKFK
                     KLSLKLHPDMLKSQGLSDEEMSTKSEEYLKVKRSYEVLSDEQKRDEYDLHMGIKRRDT
                     SSPNSYFNRPGNTFHFHEKPRNFNDVPHFDFKKHAERMERTERRYKYSQKLNQSVDTF
                     GRDLYARNLGANGPRKGIYKNYSYQPNVRDDEKEGKKIAIKIVGSIVGIFSIWYILCG
                     SFTTKKDDKAIISSKDNDDRDSPDAKREESQLQEKVNSVSKSGTSMNLNNNYGLMLIK
                     KDLPKRDDMEIFEEQVSETAE"
     gene            complement(<42279..>42980)
                     /locus_tag="C5L36_0C00300"
                     /db_xref="GeneID:40383881"
     mRNA            complement(<42279..>42980)
                     /locus_tag="C5L36_0C00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465703.1"
                     /db_xref="GeneID:40383881"
     CDS             complement(42279..42980)
                     /locus_tag="C5L36_0C00300"
                     /inference="similar to AA sequence:RefSeq:NP_013813.1"
                     /note="PKUD0C00300; similar to Saccharomyces cerevisiae
                     YMR095C (SNO1); ancestral locus Anc_2.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321563.1"
                     /db_xref="GeneID:40383881"
                     /translation="MNRVYTVGVLSIQGSFREHMSHLDLLFQDLNEETTRFLSKKVGK
                     LEDLDKLDGLIIPGGESTTMTILLQRTQMFDRLQYMIQVEKLPVWGTCAGLILLSNHV
                     SNTKTQLGDLSFKPLGGLDVQVERNSFGRQLDSFKKVYRLSGFDGELRDADYECVFIR
                     APTICKHIENTVNAVKANTLAINDAPVEVLLDIGDKVVAVRQGNVLGTSFHPELNPGD
                     YRMHKWFVDQFIVNR"
     gene            <43416..>44297
                     /locus_tag="C5L36_0C00310"
                     /db_xref="GeneID:40383882"
     mRNA            <43416..>44297
                     /locus_tag="C5L36_0C00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465704.1"
                     /db_xref="GeneID:40383882"
     CDS             43416..44297
                     /locus_tag="C5L36_0C00310"
                     /inference="similar to AA sequence:RefSeq:NP_116596.1"
                     /note="PKUD0C00310; similar to Saccharomyces cerevisiae
                     YFL059W (SNZ3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321564.1"
                     /db_xref="GeneID:40383882"
                     /translation="MTEFELKAGLAQMLKGGVIMDVTTPEEAIIAEKAGAVAVMALER
                     VPSDIRKEGGVARMSDPKMIKKIMESVSIPVMAKVRIGHFVEAQILEELGVDYIDESE
                     VLTVADRVKHIKKSEFKVPFVCGSKDLGEALRRISEGAAMIRTKGEAGTGDISEAVFH
                     ISKIQTQIEELLTDANDETISKYAAEFRVDESIIKKLVDNNGKLPVVNFAAGGIATPA
                     DAALCMQMGCDGVFVGSGIFKSSNPEAVAKGIVNAVNHYNDKKVLLEASTGLGKLMFG
                     VNATTLKDSDKLATRGW"
     gene            complement(<44449..>46098)
                     /locus_tag="C5L36_0C00320"
                     /db_xref="GeneID:40383883"
     mRNA            complement(<44449..>46098)
                     /locus_tag="C5L36_0C00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465705.1"
                     /db_xref="GeneID:40383883"
     CDS             complement(44449..46098)
                     /locus_tag="C5L36_0C00320"
                     /inference="similar to AA sequence:RefSeq:NP_014634.1"
                     /note="PKUD0C00320; similar to Saccharomyces cerevisiae
                     YOL009C (MDM12); ancestral locus Anc_6.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321565.1"
                     /db_xref="GeneID:40383883"
                     /translation="MSFNINWDTICNDESLALSFREFLNSKLETVSLPQFLANLHVVD
                     FKFGNTAPSITIRDIDIPFPEFYASEKTEEEKEQNEEEGKGDSEGEDGKRLRNKNGNL
                     VNGKAADNTQEIPQSIPMGSRPISPFLNNNVGLDGSPTRTPSPSPFLNNTNSFLMPRT
                     SSGFTPTLGHLGVGLGAFGIAGVNSLANVNQYEVNLNNGSSGSNFEDESEYFQPMQKD
                     NTTDFNNILKGISGLRVDEEESHSYQNMMFMDEKESHSGDDLNFDIQLSIDFDWNSDL
                     YIEITCDLLVNYPAPEFIRLPVRLKLTDLKIHSLIVVAYINKKVFVSFLCDIEDSPDN
                     TTSNNNGNSELSEPREGLRRSPTPTRETFNGRNKGKDRIDILQDMKIEGEIGNLVDEI
                     NYNLPFNIHNNGLSPTDDGNGLVLRNIGKIEKFLIGTLRSLMIDEMAWPGWIELDFNE
                     VVVEEEEEEEEEEEGPPNEGEEEDGDDKYDKEKQHEVVSEGILSSSEFGTNKGSETVG
                     LTRPVSRTRRLSQRDSYRSSSQFDESSLYSSDSYFSSDDGL"
     gene            <46306..>47451
                     /locus_tag="C5L36_0C00330"
                     /db_xref="GeneID:40383884"
     mRNA            <46306..>47451
                     /locus_tag="C5L36_0C00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465706.1"
                     /db_xref="GeneID:40383884"
     CDS             46306..47451
                     /locus_tag="C5L36_0C00330"
                     /inference="similar to AA sequence:RefSeq:NP_014819.3"
                     /note="PKUD0C00330; similar to Saccharomyces cerevisiae
                     YOR176W (HEM15); ancestral locus Anc_6.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321566.1"
                     /db_xref="GeneID:40383884"
                     /translation="MLKSYLRRLSTATKPKQNGTAVVFMNMGGPSTVPETRDFLMRLF
                     SDGDLIPLGPFQETIAKFITWRRTPMIEKYYQRIGGGSPIRKWSEFQVSKACERLDEI
                     SPETAPHRPYVAFRYANPLTEETLKKMLDDGITRAVAFSQYPQFSYSTTASSINDLYR
                     LSKIHDKEGQINWSIIDRWPQHPSLVNTFARHIEDALKKFPESDRDEVVIQFSAHSLP
                     MDIINRGDSYPAEVAATVYAVMQKLGFSNPYRLTWQSQVGPKPWLGAQTEKTCKRITD
                     YNSVPGVVIVPIAFTSDHIETLHEIDIELVEAMDHPEKVVRCESLNGDPEFHQGLADL
                     VKDHLHSGELYSKQLPLDYKLGSVTAKNVFEHPSEFFGNRRGKKWIK"
     gene            complement(<47628..>51308)
                     /locus_tag="C5L36_0C00340"
                     /db_xref="GeneID:40383885"
     mRNA            complement(<47628..>51308)
                     /locus_tag="C5L36_0C00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465707.1"
                     /db_xref="GeneID:40383885"
     CDS             complement(47628..51308)
                     /locus_tag="C5L36_0C00340"
                     /inference="similar to AA sequence:RefSeq:NP_013374.1"
                     /note="PKUD0C00340; similar to Saccharomyces cerevisiae
                     YLR272C (YCS4); ancestral locus Anc_6.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321567.1"
                     /db_xref="GeneID:40383885"
                     /translation="MDFDLAYEVSTFSTEKRPDDGFNLAPYLNRVSDKLASSPSNILN
                     DDIFEMARQLVYYIPECTDLNRSETIFLTFTKAFQCGIDSLETVEADADASDQKELLC
                     RYVYLLFGLSQHLVTMFGESDVNKKRKKNDVDKKRLTKLNLVLSSILATICDLLNLQL
                     SVIIQSSTSTNDFCDVILKLAYSIMMSTETLKEKNNRSIFVKLFCLIAKNHQQNNQVC
                     HRLTLALPFSEHLSDTIAEILSVSYSAYENQNLVQDVLTSLAEIQNVGPNLAKNIGSI
                     LVKLSELLGQECVTFLDYFQNFVTATPTVRAATMMCFGNSVNSLSTSQELVTENIEVI
                     ESLISTLEEHLLDNFQIVRQRCFQALELIHSNRQSKLNFKEYRYTWALRALNHLEDKS
                     SFVRKAALNLLKCIIVNHPYTVDQGKLSWKFHWEHYAEATKEIKNIDNGIIYNAIRAN
                     ELENNQLNELIKENEDDTQYKDVFKTVLGAIPPADHNPLDNLPSEVVELILRRKFLRD
                     ACIFIKILDKSFEFVADNFLNSKTKSDVIAAIEYFTIGDAYGIETAKIGVKRMLHLIW
                     TTGSNEDGNRVVEKLIDAYVTMFLTPFSGETERNKTIYVASSLIKLTFNCNMADLISL
                     EKMISELVKGKREKEKYDYNGAVEHYITPQVVSALWSSFVNYKHFKERRGAIIILSML
                     AASDYRIVHDKIDVLLKYGLDTKNLNYEVATYTCIALRRSLPRKIEDDFVYPNFAKAI
                     SKCKEILLTNTIDGEWYNLAEETLTTLYDIDIDADQTSSLILKQKAVDVFGSATDQTI
                     DKSVALSQFLFLLGHVGLKTIIYLEKCEADFKRKKQDHENKKNEQDIELEMIGGTNED
                     EFSDAIQNIKDKELLYGPNSILAKFVPLVVEIIQKPKVYSHTMLKRQATLCFAKFMCI
                     SPRFCEAHLGLYLNLMKKSTDPIVRSNLVLGLGDIAVCFTNIIDENRNALYSELHDKE
                     ISVQRTCLMTVTFLILAGQIKVKGQLSQLAKLLVHEDEGLRQMAKMFFQELATKDNAI
                     YNGFIEMLSGLNQYIDKPGMTDEEQPFPLAKFKEVIRFVLPFISKDRQRNLLIKKLDV
                     RLKTCTKMEYQRYAFCLRELIKREDGVNRKEKDSESEKAKYYKEILKKLDEFEESNSA
                     SGELLKPVTRGPKRVSVDDRKQHSEGEENDAKEVEDWLSGSEITDGANNGEVRGPLDG
                     QIREQSSPDVASDVEMIDQDLE"
     gene            <51527..>52375
                     /locus_tag="C5L36_0C00350"
                     /db_xref="GeneID:40383886"
     mRNA            <51527..>52375
                     /locus_tag="C5L36_0C00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465708.1"
                     /db_xref="GeneID:40383886"
     CDS             51527..52375
                     /locus_tag="C5L36_0C00350"
                     /inference="similar to AA sequence:RefSeq:NP_012828.1"
                     /note="PKUD0C00350; similar to Saccharomyces cerevisiae
                     YKL095W (YJU2); ancestral locus Anc_2.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321568.1"
                     /db_xref="GeneID:40383886"
                     /translation="MSERKGINRYYPPNVDPSKVKFSQKKAQKSKGQNVRLMMPFSIK
                     CLKCEEYIAKSRKFNARKEVTDRDYLGIKIKQFSIRCPRCFSELVFETDPKLGDYTCV
                     VGCKKNFERDNGPTSKETIDEMIARLEKEEKEEERMRELKRKGGNSLRNGKISEETGM
                     EQLEKRLAEQEKERERIEELEDLQKGMEDLEKRRAEVETAENNIAGDSEEDREMDKEA
                     KEAFKHKGKRWKSNPIQPDILNGYSDSEESSDSEDHSVGEELDSKREWSQIRGVLKRR
                     KINIIT"
     gene            complement(<52475..>53476)
                     /locus_tag="C5L36_0C00360"
                     /db_xref="GeneID:40383887"
     mRNA            complement(<52475..>53476)
                     /locus_tag="C5L36_0C00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465709.1"
                     /db_xref="GeneID:40383887"
     CDS             complement(52475..53476)
                     /locus_tag="C5L36_0C00360"
                     /inference="similar to AA sequence:RefSeq:NP_013718.1"
                     /note="PKUD0C00360; similar to Saccharomyces cerevisiae
                     YMR005W (TAF4); ancestral locus Anc_6.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321569.1"
                     /db_xref="GeneID:40383887"
                     /translation="MSSNEKAVTPLGDSASLSATGSSEKGTHNGQIAVNTAPATSSVG
                     NTSININANATTHSNNTNTPASTTSSIKKKSSSKPHQTENHEALSDAVAASGVNIRAE
                     EEAMIGGLSISKRQIEQNSFLKLGQLEWFMQKTLEEQGSKSIIVDNEVGNLISASCEF
                     YMREIVTDLIVMMRHRRHASDAAANKAKGNKSSKGSKHSSSLHSGINSKSEISKALRD
                     LAAKHKEREEKRIRRRVLLGLDEEKVEENLVQDHKQTNLTASLMMNGSKKSKYSWMQS
                     SSTTSNSSFNSHGDNGIRYREAREEQSVVLRDLIAALENRRIGASNALLKAYARLKD"
     gene            <53820..>54917
                     /locus_tag="C5L36_0C00370"
                     /db_xref="GeneID:40383888"
     mRNA            <53820..>54917
                     /locus_tag="C5L36_0C00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465710.1"
                     /db_xref="GeneID:40383888"
     CDS             53820..54917
                     /locus_tag="C5L36_0C00370"
                     /inference="similar to AA sequence:RefSeq:NP_014633.1"
                     /note="PKUD0C00370; similar to Saccharomyces cerevisiae
                     YOL010W (RCL1); ancestral locus Anc_6.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321570.1"
                     /db_xref="GeneID:40383888"
                     /translation="MSGSKELTHFTTHENFTTRLVLATLSGKSIKISNIRSDSLNPGL
                     VDSEISFLRLLESVTNGSIIEISYTGTSLIYRPGLITGGSFTHNCPDSKSVSYFIIPM
                     LMLAPFSKKKFSIVFKGLTSKKHEVGLDFIKWGFIPLMQKFGIREVELHTLKRGSYPN
                     GGGEVHLLVNSLIPQPITVHILDIQKISSIRGIAWCTRVSPSVVNRLVDASRSVLRQT
                     GCEVNITTDVWRGENSGKSPGFGLTLFTESKKTPLRYIIDDVAISGETPEDLADDLSY
                     RFLELIENSGCAPRYLLDMAFIFMTIGKEDIGRFIVNKEQIDSELIQLLRDIKLLFNT
                     EFYFQEDDDNDKALIATCKGIGFTNASKKIA"
     gene            complement(<54969..>56899)
                     /locus_tag="C5L36_0C00380"
                     /db_xref="GeneID:40383889"
     mRNA            complement(join(<54969..56110,56185..>56899))
                     /locus_tag="C5L36_0C00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465711.1"
                     /db_xref="GeneID:40383889"
     CDS             complement(join(54969..56110,56185..56899))
                     /locus_tag="C5L36_0C00380"
                     /inference="similar to AA sequence:RefSeq:NP_013717.1"
                     /note="PKUD0C00380; similar to Saccharomyces cerevisiae
                     YMR004W (MVP1); ancestral locus Anc_6.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321571.1"
                     /db_xref="GeneID:40383889"
                     /translation="MSINYFTDVDPWSEEGRKEESLPVALGNSIHTTADSAGNNGTSD
                     VSNNLNLFNELNTASSMMDSMLGSVEPIVDSGWGNYNSSSIIANNKLDLSTTTKDLNK
                     LKLTPNTNSEQIDEYESESNEEDLVKPAEVKVWSDEEIKSFNPLSLKNSLDGISITVK
                     EIPEKQGLVFKHINYLISHTLKFGSEYNIPESKKRPSNEDENITKVIRRYSDFAWLVE
                     VLWKKYPFRLIPELPPKKFTSSSNDVVFLQKRRRGLQRFLYQLCKHPILSKENLVVMF
                     LTVPNDFSNWKKFANIELNEEFDGVRLNLARRFKLDVSDIMKGLKDEESDFDDIDNED
                     NYEGRTDPLLKTRNELVINSINQLWNESPMNYKDKNFITNVAKMNDNLTRLAETWSKI
                     YVLVERIERRELALSVDHQRFSNLLESLSKVDGEVFNMEDILNTKSGRANNEIHNMSI
                     INSIMGQISKFFVNSKKLKEEEVQIINNDVFESFKRFQDYYISLHFLIERLMNFKLET
                     EKEIQSLLQRIIRAIEKIKQCRSRSDIKGSEFERHVDILTESMDKLNMFISKIILVKT
                     SFANELKLFQKVKYLLSEIFQDWFEQRSKYSEIQDGYVQRLMDDLRDMPLGT"
     gene            <57098..>57490
                     /locus_tag="C5L36_0C00390"
                     /db_xref="GeneID:40383890"
     mRNA            <57098..>57490
                     /locus_tag="C5L36_0C00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465712.1"
                     /db_xref="GeneID:40383890"
     CDS             57098..57490
                     /locus_tag="C5L36_0C00390"
                     /note="PKUD0C00390; Pfam Domains: Ribonuc_L-PSP(2e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321572.1"
                     /db_xref="GeneID:40383890"
                     /translation="MVQTVTWKDVEQQGNPLLSPAVKSNGHVFTSGCLGTDKNGKIPE
                     SLVEQTENAIRNLQKVLETSGSSLDKVLKVLLFISDASFVGEVNKVYGKYFKSKPSRS
                     CVVVGFPNKAVKVEIECVAEFLPLSAKL"
     gene            complement(<58371..>59684)
                     /locus_tag="C5L36_0C00400"
                     /db_xref="GeneID:40383891"
     mRNA            complement(<58371..>59684)
                     /locus_tag="C5L36_0C00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465713.1"
                     /db_xref="GeneID:40383891"
     CDS             complement(58371..59684)
                     /locus_tag="C5L36_0C00400"
                     /inference="similar to AA sequence:RefSeq:NP_011770.3"
                     /note="PKUD0C00400; similar to Saccharomyces cerevisiae
                     YGR254W (ENO1) and YHR174W (ENO2); ancestral locus
                     Anc_5.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321573.1"
                     /db_xref="GeneID:40383891"
                     /translation="MSTVTKVFARSVYDSRGNPTVEVELTTAEGVFRTIVPSGASTGV
                     HEALELRDGDKSKWLGKGVTKAVDNVNKIIAPALVEAKIPVTEQLKIDQFLINLDGTP
                     NKGKLGANAILGVSLAVAKAAAAYEKVPLYQYIHKISGSKDAYVLPVPFMNVVNGGSH
                     AGGSLAFQEFMIAPTGAESFSEALRMGSEVYHHLKSLTKKTYGQSAGNVGDEGGVAPD
                     IHTPQEALDLIMSAIKAAGYEGKIDIAMDSASSEFYKNGKYDLAYKDPNSDGSKAITG
                     SQLGDLYAELCKNYPIVSLEDPFAEDDWETWTNNFEKLPVQIVADDLTVTNPQRIKTA
                     IEKKAASALLLKVNQIGTLSESIQAANDSFAAGWGVMVSHRSGETEDTFIADLTVGLR
                     TGELKSGAPARSERMAKYNQLLRIEEELGDKAVYAGKKFRTAHEL"
     gene            <61558..>62013
                     /locus_tag="C5L36_0C00410"
                     /db_xref="GeneID:40383892"
     mRNA            <61558..>62013
                     /locus_tag="C5L36_0C00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465714.1"
                     /db_xref="GeneID:40383892"
     CDS             61558..62013
                     /locus_tag="C5L36_0C00410"
                     /inference="similar to AA sequence:RefSeq:NP_010237.1"
                     /note="PKUD0C00410; similar to Saccharomyces cerevisiae
                     YDL046W (NPC2); ancestral locus Anc_3.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321574.1"
                     /db_xref="GeneID:40383892"
                     /translation="MVSPYLPFLAALPITKPIPGDSPIENCDITTHQSLKLRSVDLSP
                     NPPERGANLTITATGWLDDDIVDGAYVDVVVNYGYIRLISQTYDLCEQLPNVDMTCPI
                     ERGDYKLTKEVEIPGEVPPGQYTVFARAYNANDEMITCLTGSVNFEALI"
     gene            complement(<62074..>63315)
                     /locus_tag="C5L36_0C00420"
                     /db_xref="GeneID:40383893"
     mRNA            complement(<62074..>63315)
                     /locus_tag="C5L36_0C00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465715.1"
                     /db_xref="GeneID:40383893"
     CDS             complement(62074..63315)
                     /locus_tag="C5L36_0C00420"
                     /inference="similar to AA sequence:RefSeq:NP_009766.4"
                     /note="PKUD0C00420; similar to Saccharomyces cerevisiae
                     YBR207W (FTH1); ancestral locus Anc_8.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321575.1"
                     /db_xref="GeneID:40383893"
                     /translation="MEIQFAFKFQDQVPPQKYTDRITMIDFEAIFSPQIFFIILRETI
                     EAAIIVSVLLSFIKQNSYSAGGELTIDRRQYDSMRMQVWTGAFSGVSICAIIGAIFIT
                     LFYFIGTDLWSYTERIWEGMFSILSSVIIAIMGVSLLRINAMKNKWKASLVSSMQQHH
                     HHHHHHHQGNEDEVVIADMQKQNLKDKYFLFFLPFITTLREGLEAVVFVGGIGVNQPV
                     SSFPLAIAAGAILGVTIGCILYSGGNRMSIQYFLIASTCFLYLVAAGLMSRGVWFFEL
                     ERFVQKVGQDTSETGSGPGSYDVANTIWHVNCCNGLTDGGWMIFNALLGWTNTATYGS
                     VISYIGFWLFIILLLKSRTVFEREGYVRFIPLKWQLKKIKKRIIVDEMLAQELEELEL
                     SQVPPIANTGTSDGDRAPLLQ"
     gene            <64668..>68474
                     /locus_tag="C5L36_0C00430"
                     /db_xref="GeneID:40383894"
     mRNA            <64668..>68474
                     /locus_tag="C5L36_0C00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465716.1"
                     /db_xref="GeneID:40383894"
     CDS             64668..68474
                     /locus_tag="C5L36_0C00430"
                     /inference="similar to AA sequence:RefSeq:NP_012713.1"
                     /note="PKUD0C00430; similar to Saccharomyces cerevisiae
                     YKL209C (STE6); ancestral locus Anc_1.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321576.1"
                     /db_xref="GeneID:40383894"
                     /translation="MMGFSKRSRQKTAAPARQSASANGGGIKKATYEHTKKKEVGVSD
                     LTLLSTISDESINDNLKKRFENGIIYTYIGHVLISVNPFRDLGIYTLETLLSYKNKNR
                     LEVPPHVYAIAENMYHNMMAYNDNQCVIISGESGAGKTEAAKRIMQYIAQVSGSLTNS
                     TQIQRINDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIQFNKSFEPVSANITNYLL
                     EKQRVVGQIQNERNFHIFYQLTKAADDNYRQIFGVQKPEQYVYTAQSGCTSVDSIDDV
                     HDYTETLKAMDTIGLSSEERDHVFRLLSAILWIGNVSFIEDEEGNSKIRDESVTNFVA
                     YLLQVDATLLCKSLTERTMETSHGMKRGSIYHVPLNTTQATAVKDALAMGIYNNLFDW
                     IVDRVNQSFSSNKSDIFKSIGILDIYGFEIFEHNSFEQLCINYVNEKLQQIFIQLTLK
                     SEQDEYVKEQIQWTPIKFFNNQIVCDLIESKRPPGIFAALNDACATAHADSSAADQSF
                     AQRLNMLSTNQHFDLRGSKFVVKHYAGDVTYDIAAMTDKNKDQLLKDLLELLQTSQDP
                     FIRELFPNSVDQSSKKRPPTAGDKIKTSANLLVDTLSQATPSYIRTIKPNQHRSPTEY
                     DTKAVLHQVKYLGLKENVRIRRAGFAYRQTFEKFVERFYLLSTKTSYAGEYIWTGDAR
                     TATEIILRDSNFDPSEWQLGVSKVFIKKPETLFALEDLRENYWANKAKVIQRACRKWL
                     RRREEAAKIVQRLWRIRNKGFQETNQYIELRDFSNQIVYGKKQRRRLSVLGSRQFVGD
                     YIGVNDKTGGFGKFIKNAINLKDKVKFSAKGDQLHSKFGRSSQRLPKIFLITKDDRFI
                     VVGQNVVNNKAQYSVEFNKPITSIPQVSVSNLADDWLAINLNSKTEPDLFINCLFKTE
                     ILGRFKKANPAITINIGSKIVYCKKPGKKHTVKFQLATSGNTDAYKSSTVSISRGSEP
                     NAKNRPLPQPKTKFTGDKIAAYKRAAQNRGAGKKLLSASAAAAAYSPSQTQAAQQQQQ
                     QQQQQQQQQQYHQPQQQQHHHQHQHQHVQQASVPAPPSANNKPRLSKPAAPQPRPKPA
                     APVSRNRQSMQPTSAQTSVAKPAPAPPAPPAPPAAVAKPKWPTYRAEYDYPGNNGSMA
                     LTKGDIMYILQSEPSGWSLAKTLDEATEGWVPTAYIVECEPPSLLGGNVQSAPTSTQA
                     PVLAQTTQTANAGNNANGLADGLASALLEKKQEETILATDLAAAIRQHARRESDEEDD
                     EDDDDW"
     gene            <68745..>71669
                     /locus_tag="C5L36_0C00440"
                     /db_xref="GeneID:40383895"
     mRNA            <68745..>71669
                     /locus_tag="C5L36_0C00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465717.1"
                     /db_xref="GeneID:40383895"
     CDS             68745..71669
                     /locus_tag="C5L36_0C00440"
                     /inference="similar to AA sequence:RefSeq:NP_011276.1"
                     /note="PKUD0C00440; similar to Saccharomyces cerevisiae
                     YGL238W (CSE1); ancestral locus Anc_3.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321577.1"
                     /db_xref="GeneID:40383895"
                     /translation="MSDINTVVQVLEKSVDPKFAKDAETMLKSMEAQPGFPITLLHVV
                     ANENVQHSSRLAAALYFKNLIKRKWINEAGEYQISMDDVKMIKSEIVGLMIMLPDSLQ
                     LQIGEAISLIAESEFPNMWTELIDELVSKLTLEDLVVNKGVLKVAHSIFKRWRPLFRS
                     DELFLEIKMVLDKFAVPFLAMLKNVDSLIDASLQDANKLKLLFENLLLLVKIYYDLNC
                     QDIPEFFEDNLNEGMSILLKYLTFHSTLLEDQDEDEDMDLVIQVKINICELIQLYTTR
                     YEEEFQKYIEGSIQIVWDLLNNISTQPKNDILVSKALQYMTCVVALSNYQQLFSNEEA
                     VKKITELIILPNITLRESDLEMFEDDPIEYTRRDLEGSDVDSRRRAATDFLRALKESN
                     ENLTTSIMMSYINHYLSLYNENPRENWKFKDISIYLFCSIASKGSITTSAGITSTNLL
                     VDVIKFFGDFIYPDLVGEVSSPILKVDSIKYIYIFRNQLTKEQLIETLPLLTSNFNDL
                     NYVVYTYTSITIEKILSLRNPMNHQELLFSKSDFTVEVLNNMLMNLFKLISKMGSTPE
                     KLSENEFLMKCIMRILLISEDSLKGSIVGILQELIKIEELISKNPSNPKFSHYTFESI
                     CIILKYNKENITDFFAFLKAPLFSILGQDIQEFIPYAFQILAYILESYPKEQEMPIEY
                     EQLIRPLCSPQVWEFKGNIPAIKRLLSAIIEYKPSAFQTSEDITPILGIFQKLIISKV
                     NDILGFEFLETILISIDINSLKPFLNQIFIIILTRLKTYRTDKFVKRFIVFLSKLSSL
                     ELNPELNKNQWNSSVVIGIFESIQAGLFEQILNNFILSSITKFNNLIDKKILVVGLTN
                     LIVENYPTINDSEIAKIFSELLKLLNSDSIENYKSINENAEIMLELEVDDLSFGSSFN
                     KLNIIQLKPLDPISGNIRDKSTLVEFFKMKIQSVDHQYLFQLIQSLDDECKSAVSALG
                     IA"
     gene            complement(<71870..>72820)
                     /locus_tag="C5L36_0C00450"
                     /db_xref="GeneID:40383896"
     mRNA            complement(<71870..>72820)
                     /locus_tag="C5L36_0C00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465718.1"
                     /db_xref="GeneID:40383896"
     CDS             complement(71870..72820)
                     /locus_tag="C5L36_0C00450"
                     /inference="similar to AA sequence:RefSeq:NP_011277.1"
                     /note="PKUD0C00450; similar to Saccharomyces cerevisiae
                     YGL237C (HAP2); ancestral locus Anc_3.560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321578.1"
                     /db_xref="GeneID:40383896"
                     /translation="MDDSLNIPVQHYYQQQDFMTDQTHLHGLGSTLESINNVMDPTNT
                     NGDAGMAQHQQAFHNSHLLQLHHQQMQQQQQQQQHQQQQHQQQHPFGHQDINTVNDQL
                     HQLPDDHVRDQQEGLVSEQSMEQQTSTDQPYYVNAKQYHRILKRRIARAKLEEHLKIQ
                     RVRKPYLHESRHKHAMRRPRGQGGRFLTAAEIAELEKKEREKENGKELEKDTELEKDK
                     ELEKDKEPEKDKENGVELEKVPGADAVKNINGTVDDTNTNDDIKGSGYVDNNTAVNSS
                     TENNNTETNNDNRSASNNELPHSAESKPNIKQETPLEYPK"
     gene            <73450..>74652
                     /locus_tag="C5L36_0C00460"
                     /db_xref="GeneID:40383897"
     mRNA            <73450..>74652
                     /locus_tag="C5L36_0C00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465719.1"
                     /db_xref="GeneID:40383897"
     CDS             73450..74652
                     /locus_tag="C5L36_0C00460"
                     /inference="similar to AA sequence:RefSeq:NP_012606.3"
                     /note="PKUD0C00460; similar to Saccharomyces cerevisiae
                     YJR072C (NPA3); ancestral locus Anc_1.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321579.1"
                     /db_xref="GeneID:40383897"
                     /translation="MPATIICVGMAGSGKTTFMQRLNSHLHQKKTPPYVVNLDPAVLK
                     VPFGCNIDIRDSINYKKVMENYNLGPNGAIVTSLNLFSTKIDQVLEIIKKRSGDFKHC
                     IVDTPGQIECFVWSASGSIITEAFATENPTVLAYIIDTPRSSSPTTFMSNMLYACSIL
                     YKTKLPMIVVFNKTDVRSADFAKEWMTDFEAFQDSLRTNAELNDETSNGSGYMGSLIN
                     SMSLMLEEFYSTLDVVSTSAYTGEGFDDFLDAVDKKVDEYNEFYQKERERVIAEKKEK
                     EKREKERQLSHLMKDLGIKDKQKKKQTDEKAEKGERENVDVLSDIEDEIEQDEKDGYE
                     HGLIDLESSEREYTFQEDRNGELRDDANASEVAKSIKDRYQQAFEATAKTASSDIAAD
                     IAKYINGQ"
     gene            complement(<74720..>75316)
                     /locus_tag="C5L36_0C00470"
                     /db_xref="GeneID:40383898"
     mRNA            complement(<74720..>75316)
                     /locus_tag="C5L36_0C00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465720.1"
                     /db_xref="GeneID:40383898"
     CDS             complement(74720..75316)
                     /locus_tag="C5L36_0C00470"
                     /note="PKUD0C00470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321580.1"
                     /db_xref="GeneID:40383898"
                     /translation="MNRTLQVLQRYNPTQLLRTGHDASKQSVFSLGKRLTDALELYPV
                     NLVLTNRTRAHGYNLNRIAQDIYTVNSSGCMGDVNDLPTLVDYNVIDGDSNALLLEAF
                     KEQYTCIDIEMGKLLVVSLSEREMTQSTSFLERLCRDYKDAYTMKACILNTHCYPFLK
                     EVSKDSKDTLSSNMYQIAKAGLVCVHRHPNGSLILTQK"
     gene            <75707..>77014
                     /locus_tag="C5L36_0C00480"
                     /db_xref="GeneID:40383899"
     mRNA            <75707..>77014
                     /locus_tag="C5L36_0C00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465721.1"
                     /db_xref="GeneID:40383899"
     CDS             75707..77014
                     /locus_tag="C5L36_0C00480"
                     /note="PKUD0C00480; Pfam Domains: DUF1688(2.2e-183)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321581.1"
                     /db_xref="GeneID:40383899"
                     /translation="MRDLIDRPLQEEKMTVPDQVKYLYSIRSVRETNADTAARIRENK
                     LSNFNVNLEKMDGVVDFVCGVIRETYPSNESLGEIPVHGRFQHFNSGDPCRLQNVLDG
                     MKESCDDYELCKRLVDLFVISVLLDAGAGNQWKFTEPNGRLTGRSEGIAIASLYMYTS
                     GVFSEKAGGPLVNGSKLATLTEEELLLGLQVTPENPMTGVQGRLHLLNKLGETLQAKR
                     GLFPDERPGDLVDHFKASAEDGVLDLEVIWDALMELLLPVWPTQGRVQLDGYVLGDAW
                     PLRSKDGGIVTFHKLTQWLAYSLLKPLQDYGGFRVKNVQLLTGLPEYRNGGLFVDLGV
                     LELKPEVYAAGMATALKNGLSVAAYRPEEDVIVEWRSCTICLLDMLLPAVNSQMGITG
                     TKYELTLPQLIEAGSWKSGRAAASARRAHGGPPIELLADGTVF"
     gene            <77748..>78095
                     /locus_tag="C5L36_0C00490"
                     /db_xref="GeneID:40383900"
     mRNA            <77748..>78095
                     /locus_tag="C5L36_0C00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465722.1"
                     /db_xref="GeneID:40383900"
     CDS             77748..78095
                     /locus_tag="C5L36_0C00490"
                     /inference="similar to AA sequence:RefSeq:NP_011848.1"
                     /note="PKUD0C00490; similar to Saccharomyces cerevisiae
                     YHL015W (RPS20); ancestral locus Anc_2.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321582.1"
                     /db_xref="GeneID:40383900"
                     /translation="MSAEKKDIEQPQDLNKIRITFTSTNVRALEKVSGLVIRNARREG
                     INKKGPVRMPTKALSIATRKTPNGEGSKTWEHYEMRIHKRYIDLEAPSTLIKKITSLT
                     IEPGVDVEVTVSV"
     gene            <78784..>79827
                     /locus_tag="C5L36_0C00500"
                     /db_xref="GeneID:40383901"
     mRNA            <78784..>79827
                     /locus_tag="C5L36_0C00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465723.1"
                     /db_xref="GeneID:40383901"
     CDS             78784..79827
                     /locus_tag="C5L36_0C00500"
                     /inference="similar to AA sequence:RefSeq:NP_010956.1"
                     /note="PKUD0C00500; similar to Saccharomyces cerevisiae
                     YER039C (HVG1) and YGL225W (VRG4); ancestral locus
                     Anc_3.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321583.1"
                     /db_xref="GeneID:40383901"
                     /translation="MSKEKQEAAVNVTPVQGAAPLAAPPSAVARLVNSGPVSILCYCL
                     SSILMTTTNKYVVSGRHFNLNFFLLAIQSIVCLAVIAVLKFFGVITYRSFNTNEAKKW
                     SPIAFLLVIMIYTSSKALKYLAIPVYTIFKNLTIILIAYGEVLWFGGEVTSMALGSFV
                     LMVLSSVIATYGDTDATTGASNLNVGYLWMALNCFSSASFVLFMRKRIKLTNFKDFDT
                     MYYNNLLSIPILLVASLLLEDWSSANIELNFPSNARAAVWTAMIVSGATSVGISYCSG
                     WCIRVTSSTTYSMVGALNKLPIALSGLIFFDAPINFFSISSIFVGFAAGLVYVVAKQK
                     QKEDQARQGQLPK"
     gene            complement(<80062..>81093)
                     /locus_tag="C5L36_0C00510"
                     /db_xref="GeneID:40383902"
     mRNA            complement(<80062..>81093)
                     /locus_tag="C5L36_0C00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465724.1"
                     /db_xref="GeneID:40383902"
     CDS             complement(80062..81093)
                     /locus_tag="C5L36_0C00510"
                     /inference="similar to AA sequence:RefSeq:NP_602317.3"
                     /note="PKUD0C00510; similar to Saccharomyces cerevisiae
                     YFR047C (BNA6); ancestral locus Anc_3.563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321584.1"
                     /db_xref="GeneID:40383902"
                     /translation="MYNKENIGAIFRYGMIVPLLIFFSNLMAPSPQGKDNLVCNIETT
                     PLTMTDYSHLLPVSARWKQQITDFLSEDIPSFDYGGFVVGNAQKTASLYMKSPGVICG
                     IPFLQEVYDQCHVTVEWQCKEGEYRDPSAESSNGKIIVAKLSGESKNLLQAERVALNL
                     MSRLSGIASESREITELAKDSGYGGIIAGTRKTTPGLRIMEKYAMLVGGADMHRFDLS
                     SMIMLKDNHIWSTGSITNAIKNAKRVGGFAIKVEIEVQSLEEAIEAIEAGGDIIMLDN
                     FQGEELTKVAKQLKDMFTGKRHFLLECSGGLTKMNIKEYLCNEIDIYSTSSIHQGTPA
                     VDFSMKIDK"
     gene            complement(<82008..>83825)
                     /locus_tag="C5L36_0C00520"
                     /db_xref="GeneID:40383903"
     mRNA            complement(<82008..>83825)
                     /locus_tag="C5L36_0C00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465725.1"
                     /db_xref="GeneID:40383903"
     CDS             complement(82008..83825)
                     /locus_tag="C5L36_0C00520"
                     /note="PKUD0C00520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321585.1"
                     /db_xref="GeneID:40383903"
                     /translation="MNLQLQYLKKINNINYFTVFSKPIFELLAQRMSLNATPQRKMEL
                     EQAPSRPMTPRSPRSPHSPYTSRSPHTPRKSLTPLTKHALQMSTTPTRNRLLLTPTKN
                     KQRQIYDPLTDLQILGKLFHAQTSIKKKQKPNPARETSPTAKVGLEQDQEIVSGNDRT
                     QSTFSSPSKPQTFAPFSSPTPQIPLNSTIPSFVNKDVRNFGRYFGETSSLHNTSSLQD
                     SVEHSSSMVVDDTLPITQSQSQSQQVQTPDRDVSRRNTTFESYADTSIAVPEAILRDG
                     SGILGMSDSEDDRQEGDVSIGQQVDGDIPALGEYPDFADLTNEEIEDYKANLSIIQAS
                     SDESDEDVEAGDLSLVRDYYEHKETQRKRRRSFNTTHTPQKPPLFTIRLVKKMFQTLQ
                     LPAPMNLNEDLFNELTNRFIEIELRKSMQMSKENGMNNRIVYTDLLGDDEDDESILLN
                     AMSECDLETVKIIEGVLYSNLALRKKRHENVRVPRLSRGSIDSQSEAKWYQPNDGVAS
                     FPQTPRRDTNRDDNGKAETTESISDLGNIDSSVIEMPEQKDEGSNPFDDDKVVDLDKY
                     SSYITLQIQQDASDSSDLEIPLAVEEEEEEEDEETDIEE"
     gene            <83843..>84916
                     /locus_tag="C5L36_0C00530"
                     /db_xref="GeneID:40383904"
     mRNA            <83843..>84916
                     /locus_tag="C5L36_0C00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465726.1"
                     /db_xref="GeneID:40383904"
     CDS             83843..84916
                     /locus_tag="C5L36_0C00530"
                     /inference="similar to AA sequence:RefSeq:NP_013103.1"
                     /note="PKUD0C00530; similar to Saccharomyces cerevisiae
                     YLR003C (CMS1); ancestral locus Anc_5.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321586.1"
                     /db_xref="GeneID:40383904"
                     /translation="MRSKKKNCFFLYFPIFFVSLDSCLLPILLKCATMTADKRREENV
                     EDLDDGLAIDYELSDNEEGIEIESEIKEPSAADKTDIEGAFDSEVEEEAKEGTDVVVS
                     VGKKRKGPSEEKKSKKKQKMEFEKESKKSLSVEKNDIIVEKLNSKVREVYPQLSPLEL
                     TEYYLQGKNVIDSSDFSMEKNLENLSKYIEMYMKDLIPSIKEFKRLRNKIKKFETKKK
                     FNKKFNKTVEIPKRKFILILSISAIRACDVHRATRDLEGGSIKLIAKNPIGNDLKMLK
                     TTWSRILNATPGRIEKLLDISKQDKEKNFESTLALAADEIDTVILDNYVDPKLRSVVD
                     DRETFDLLKILKEANPKLKVYVY"
     gene            <85764..>86900
                     /locus_tag="C5L36_0C00540"
                     /db_xref="GeneID:40383905"
     mRNA            <85764..>86900
                     /locus_tag="C5L36_0C00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465727.1"
                     /db_xref="GeneID:40383905"
     CDS             85764..86900
                     /locus_tag="C5L36_0C00540"
                     /inference="similar to AA sequence:RefSeq:NP_013737.1"
                     /note="PKUD0C00540; similar to Saccharomyces cerevisiae
                     YMR024W (MRPL3); ancestral locus Anc_2.574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321587.1"
                     /db_xref="GeneID:40383905"
                     /translation="MLSFMNRSRAVQLSNKRWSVVVARNISVSPAAPKVVESSINSKN
                     YRFSYETAKNKFVESSNVSTPENKFDFSEYTTKDKPTNVVSEEEAKLIPSIIALHARL
                     GLPESYQYSTLVKALTCPTSKHDVIASNQQLSILGAHILSFYVTEYLIANYPRLPLSV
                     LRAATDAFIGNYSLYDVAKNTWGISEDSSSKLERYLSNEPEIFKFGTLRYTRKVTEPE
                     TDIVKYAPDHSVFELSKSEAFANSVRSIVGGLHIHAGEETTKQFVHDHILSRQVDISS
                     FFSFKEPGKLLTRLLRTNNMQPPTIRLISETGRFSSTPVYVVGCFSGENLLATSEGNS
                     LREARIKSFGKALKAWYLYKPLDAKLPSDESFEGMFVDQGEKFF"
     gene            complement(<87018..>91019)
                     /locus_tag="C5L36_0C00550"
                     /db_xref="GeneID:40383906"
     mRNA            complement(<87018..>91019)
                     /locus_tag="C5L36_0C00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465728.1"
                     /db_xref="GeneID:40383906"
     CDS             complement(87018..91019)
                     /locus_tag="C5L36_0C00550"
                     /inference="similar to AA sequence:RefSeq:NP_009519.1"
                     /note="PKUD0C00550; similar to Saccharomyces cerevisiae
                     YBL034C (STU1); ancestral locus Anc_3.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321588.1"
                     /db_xref="GeneID:40383906"
                     /translation="MYIIVLRKKKLLGFTNFPFGREVIFHVLDASLFRVVVLAYRSLP
                     LAANVYSCLNSTSTIENTKWEMCASHVSDPGMLMVFSIRNSHDPQEMEYAITNFKQYI
                     KRNLVDLTHVEDYCTSLILVFNDCRDLCVLAFSTLCHLIKRVSIQDPKVLSGVYNSVI
                     PFLLERLVETKDSIRLTALKSIKTCIESAPNGEINQIIQFLVGDGMKDEYIQGPVLDL
                     LYQITESSANFKFSFKYILDNIIHILSSDNEDVVHKVNQLLVLYFTRINPTNNTARSD
                     LVNSLVEEKIDPNVVSILLNSIDATLFNKYLSQLDSSEPDIQAKAHLDEILDKIPMWN
                     ADDSNLKPLDFDRDSSKAAYENMLSNFQTHFEGKESERNWKQRQELIIKLREILRGGN
                     LLQDYSIENYLYLIKEVKECICKGMLSLRTSLSNNSCQLVKDLGLFIGAYLDFSLVET
                     FLNSLIKLTSARKIIQHQNANVAIIALLLYTSLNPKIFNMLIATSQDKNIQPRVYTGN
                     WVQLLILKNYDPQDKELLHYIVDSLESVIIRGLSDPLPLVKDAMRNSFWTLCELEPRY
                     ESKFMRKLDPQTVKGLERAKSMYSSTIKKLIAPVKPMRPLKNLHRQNALPNLSYEPVR
                     KLQRSESLHENRKTEPEKKQIRNHTIGSDVSKIEKLETIIGVERERERDEMEDFTGRL
                     KRENVIYEELTSDSKSLQKSGFEKLLKESDSSSITIKFHNALNSLTITNHELFDVIFQ
                     KDSYFKKISSYISTDNVLRLFCMYYASHPDTPIEFIIDGLSIEDLCLSSIKIIDYATD
                     TSKINNINLSIQFIKNKYRMINSILKLLEKLLTFKKDQIKSYLLASIFECLISSYSII
                     QADEAFKAQYIIIFELCLNEYPDLFLRALDETTDEINKVEISKELKILTNEDDGSTSM
                     FSNDDKLLSPIKVNGEELGENLDEMTRVVPRIRHDGPVPLIQTDMTMILPKSKGHGLF
                     DMKSDEIMGSDIFVDEGTDYENKENENPRDAMDYSKSDSFVDEKGLQQQQQQQQQQQQ
                     QQQQQQQQQQLIDESEIESTGTAQNDQTMHDVKGSEEEQEVPSVVDITDNDNVNQEES
                     PYPLDEIIEEGSNISIIMKEDKVMSDSTPDINMLTIEDFGDTKIDGHLGVVLAELLEA
                     SPAEFQGLDNLETYQDFVNLFHSIERLDKVDVYNQMVVNIEKETFIVESLSLIRYNGY
                     IEHGIIDALDKIVHIPEFVCFDEIISMFDVKTLVSFKFNKKSDRLQEMILKSILDKLE
                     QIDCEDVFMIGTFLKRYVEHADSFIRMYSTLIFERLYHFHSNHKVDKNGVELVDELLV
                     KDMGDHLIRYCNI"
     gene            complement(<91113..>91886)
                     /locus_tag="C5L36_0C00560"
                     /db_xref="GeneID:40383907"
     mRNA            complement(<91113..>91886)
                     /locus_tag="C5L36_0C00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465729.1"
                     /db_xref="GeneID:40383907"
     CDS             complement(91113..91886)
                     /locus_tag="C5L36_0C00560"
                     /inference="similar to AA sequence:RefSeq:NP_116683.1"
                     /note="PKUD0C00560; similar to Saccharomyces cerevisiae
                     YFR027W (ECO1); ancestral locus Anc_1.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321589.1"
                     /db_xref="GeneID:40383907"
                     /translation="MSDKKRTKISKSVKTKLRQSTLFEPEIKVTKCAQCGYEWIKTIK
                     KSVTLHNMHHDDFLNGLTLPKPNYNTLINHGNCVDTFKVGGSRLALYMCKSNNPVITK
                     IVDSMMKTLNKVWLNSMGASTSWRKRPDESPVFLLVEKSPTDKLSRVIGITTTDPPPK
                     QQAYIKGYCMELETANISSKEELKLSIGISRIYVCPKYRRHHLAMAMLDAVLCHSLYG
                     VKLNQWQIGFSQPSGAGTLLLKKWYNNSKHIPVYHEVDN"
     gene            <92106..>94076
                     /locus_tag="C5L36_0C00570"
                     /db_xref="GeneID:40383908"
     mRNA            <92106..>94076
                     /locus_tag="C5L36_0C00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465730.1"
                     /db_xref="GeneID:40383908"
     CDS             92106..94076
                     /locus_tag="C5L36_0C00570"
                     /inference="similar to AA sequence:RefSeq:NP_011278.2"
                     /note="PKUD0C00570; similar to Saccharomyces cerevisiae
                     YGL236C (MTO1); ancestral locus Anc_3.558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321590.1"
                     /db_xref="GeneID:40383908"
                     /translation="MPFPHIFKRLLHYDAEVARKLATSPYHPVIVVGGGHAGIEAATG
                     SARTGVKTTLVTPKWDNIGATSCNPAFGGIGKGTLLKEIDALDGVCPRIVDRAGIQFK
                     ILNRSRGAAVWGYRAQIDRDLYQKEMQNFVKKYENLDIIENKIEDLIIEFQDADPLGR
                     NSGIVRGAVLSNGELVKCDRVVITTGTFLGAEIHLGMKCWPAGRIDETSSLGLSETFK
                     KVGFMMGRLKTGTPPRISGKSINYDLVTKEYGDNPPEPMSFLNERPKIAAEEQVLCYG
                     TYTKPEVKDIVMNNLHKTFHIRETVKGPRYCPSLESKILRFGDKPQHRVWLEPESLNR
                     EENDIIYPNGISMTMPEDIQYEILRNITGLENVEMLQPAYGVEYDYVDPRELSRTLET
                     KLISGLYLAGQINGTTGYEEAAAQGIIAGINAGLHHQNAEKDLALDRSDGYIGVLIDD
                     LITKGVEEPYRMFTSRSEFRVSVRADNADLRLTELGRQVGCVSNTRWEVFTKDKQRFE
                     TAVSKLKDFKLSSSKWNDILSEINIGNDSKLKSAYEILKYKGSNINRILEVVNDSELI
                     KDMNERIKMKVSVEGNYSGYIRKEKEYIRAFKADENLRLPAGFDYRTIPSLSAEAIAK
                     LNENRPETIGQARRIQGITPAAIFELYRISRK"
     gene            <94826..>97900
                     /locus_tag="C5L36_0C00580"
                     /db_xref="GeneID:40383909"
     mRNA            <94826..>97900
                     /locus_tag="C5L36_0C00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465731.1"
                     /db_xref="GeneID:40383909"
     CDS             94826..97900
                     /locus_tag="C5L36_0C00580"
                     /inference="similar to AA sequence:RefSeq:NP_012666.2"
                     /note="PKUD0C00580; similar to Saccharomyces cerevisiae
                     YJR132W (NMD5); ancestral locus Anc_4.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321591.1"
                     /db_xref="GeneID:40383909"
                     /translation="MNVEQLHHCFFGSLQADPNVRRQAEAQLNELSHQVGFLAACLDI
                     LSTPDVQPIVKQSCSIYFKNVILKNWTVGTLIDNDERPIIRERLLVSIVKLDKILRNQ
                     LLPALSLIIKFDYPSTWPNLLDHILNLINNSNSDINSLYIGIYSFTELCRIYRWKHNS
                     DRQAVLDPIISNFFPSLISLGTHLLEDTTSRGSYEASEILKLIIKCYKFVTYLDFPEQ
                     LRNGQPLIDWITFHVKVITADFSGNAPEGWFKAQKWAYHNLYRLFQRYGTKTLTSKFQ
                     YDEFRANFKANVLPQLINVYMGNLEKWTSGNKIISDASLYHLIQLFEQALLKKDTFKL
                     VEPHFNFIIVTLSFRIFNPKDEELELFEDEPEEYIHRIFEIVEGNTGEDSLHSFLFTL
                     VEKRADYLVPMFQFIGEKFTELAQQDTVEAARAKEALMKFISPISYKLSQPNNPIFNE
                     VEPFLNNFIIPNFQSNHQFLKARVNNLVSKFDNLEIRDVKTVENLFNGIMSSFLDESS
                     QLPVQIQAALAIQAFIINDAFKNSLDNYVLKLMERLMELSNKFDSDILPAVMQELVES
                     FPDKLEPFADQLMEQLCIKLTSLLKSIGEMSNSLEDYDDFDNMANDKTSTALGILNTM
                     ITILLYFENSVDIISKLEVYYSQVIKLIFEDKIEDFYAEAGELIENTLFLTRKVSPLM
                     WSLLPQFVQCLLNDEDITLYLEDSLPALKNYLIFGASTIQENVHVQELYYRIILNVFE
                     MDFDEGDVGFSDLVHISDLATTFVLSLNSSIAGKYVPSLINYSSKFLIDINDTLKEKG
                     KPFRIAVLDNIIASLVIDPNSTLKSLIESNQIENFMANWFNSTDDLKRVFDIKLSILG
                     YISLLSIDLQSIDSMGLSRALNTCGMNLTKLFIIIPQAIKDLEKKRSEYTDKSWENEL
                     TYNINQVNDDDDDVTANAGQTPLGGVDGEDDEEQDYSNFFTGENKFSFESDEELQEDP
                     YSNTSLDNINIFSQFKSFILGVQNNEGDKYGHIFGQLTDSDKEMLTSILNSI"
     gene            <98734..>99165
                     /locus_tag="C5L36_0C00590"
                     /db_xref="GeneID:40383910"
     mRNA            <98734..>99165
                     /locus_tag="C5L36_0C00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465732.1"
                     /db_xref="GeneID:40383910"
     CDS             98734..99165
                     /locus_tag="C5L36_0C00590"
                     /inference="similar to AA sequence:RefSeq:NP_015014.3"
                     /note="PKUD0C00590; similar to Saccharomyces cerevisiae
                     YOR369C (RPS12); ancestral locus Anc_7.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321592.1"
                     /db_xref="GeneID:40383910"
                     /translation="MSDIEEQQIVVEEEVVVEEEASVTLEDCIKKVLRTALVHDGLAR
                     GLREATKALTRGEAQLCVLCDAVTEDAISKLVEALCNEGDNKIPLIKVSDAKQLGEWA
                     GLCQVDREGNARKVVGASCVVVTNWGADSEERNILLESLSQ"
     gene            complement(<99388..>101217)
                     /locus_tag="C5L36_0C00600"
                     /db_xref="GeneID:40383911"
     mRNA            complement(<99388..>101217)
                     /locus_tag="C5L36_0C00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465733.1"
                     /db_xref="GeneID:40383911"
     CDS             complement(99388..101217)
                     /locus_tag="C5L36_0C00600"
                     /inference="similar to AA sequence:RefSeq:NP_015015.1"
                     /note="PKUD0C00600; similar to Saccharomyces cerevisiae
                     YOR370C (MRS6); ancestral locus Anc_7.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321593.1"
                     /db_xref="GeneID:40383911"
                     /translation="MSVQDRRPSIAERRPSSVSNLSSRRPSVVIPPLEGIEKPMAQTK
                     VDNLECDVLICGTGLQESILAAALSWQGSKVLHIDTNPYYGDHSATLTIDQIKNWFIN
                     SKLNKTGFKTYKNIKLDINENDYKIVSRDFGIDLSPKILFAKSEFLNLLIKSRVYHYL
                     EFQSLSNFHTFENKSFGKLVSSKEDIFTSESLDLVMKRKLMKFLKFIIDDNSVKSLSR
                     DDLVLPLKEYLQKNFKIDGKFNNELMYSLGLINTPQINALDGLSRIRRYLLSMNIYGN
                     FPTLYSKYGGPGEISQGFCRSAAVAGTTYKLNTKLLNYDSKKKVANLSDGTHVKVNER
                     VVSSLNQTINKPKNAKLYEIQRMVLIVDKPCDEWFAEGESSSIVVFPPGSLSSNNKYP
                     VECLIMGSGTGCCPDGKCIWYIHTIAPIINNTAGNDLYCALKEMEESYIRESKFNIEN
                     CLDDDDIQVVDDKVTLTAQGSVKLSESLRNFENNLPNIKDKIGYILKLEFTQLTMVDQ
                     NDENNLWGFDDTVKISNDDVIVTDMPSSELSYDGIITEAKKIYKEIVGDDVDFFDVDF
                     EDDEEEREIAATFENDDVLSDDVAVEEGDSVGNSETGVMDFEL"
     gene            <102432..>105962
                     /locus_tag="C5L36_0C00610"
                     /db_xref="GeneID:40383912"
     mRNA            <102432..>105962
                     /locus_tag="C5L36_0C00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465734.1"
                     /db_xref="GeneID:40383912"
     CDS             102432..105962
                     /locus_tag="C5L36_0C00610"
                     /note="PKUD0C00610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321594.1"
                     /db_xref="GeneID:40383912"
                     /translation="MHIVFNIEWNRPFVPGVHRYHHKYSVRAVNPITNVLNTAYSIFG
                     TTQFVEAKNANYEGFVDSDLRFRAYTILQRQVYMIMRWSILRYALDNPLKINFLNARV
                     FNLTPDNFVPSLEDIDSYLKCPRFLWRFSWQNYTECIEAMECKETDFKYLDFRLSYQD
                     GSCINAFARGKHTKLTNSFKKRLHVDNINMSHYDLNKIDKMDKVYFNFQLTKFEKLEY
                     LYSDDYMMFEMDGKTTYEEFTHLILTGQCHRYNSKILEEKVKFDNEKHQIKKRIIKAQ
                     SNKPLIEALKNTIRTFHSERGYYNKDPSDELSFFYESGKQYKIVMKLIKMIDNQDTMN
                     RDLFEELFNQVDISIYNFYGSTDDDLSMLAKRTYFRVINKHKSKVIISNRLYSVSTWT
                     HQALMSDAIHPFSFYKFLNTYVSAKCCADFDKLFNHIDDAYRFGWSFPKKNISYKEAF
                     QFYAEHIPQKYLTECYSNRLNNKNWLLVIRSLQTESNIKFKIQNRVNTVRKCKVELIK
                     DEEVDIEFEKIIGKAMQDVVKSIYSECFVRYKGDQKDPARMRVFTSKILKDTMKKLVS
                     VTPSEVKINIGRFEGDSIVGRVTDIVPITNNRPTHGESERPADGVTIRKMEWLFKKFE
                     GHLEQLVQRHIVAVPESRIPDKYKLEGFEQASNLSSASLPSTITFFVAMAIETPDKIE
                     MLRIIRKCSCEVKSAYESITKRKFIEAPDNVKKEFSRYYNVILSCVFQGMKTDRYNKY
                     HRISKTRFGKLVIATLNQAKNWNVEETPLLIEGQIKIDQVNTIHKDRRNANVIVAAPG
                     NKVLSDIPLLLPPIDSTDKQILSDTPSQIVESSNHIWTSDLTVVNTSPPDVVPSTNNA
                     TSQINSPAILFDANAPSKNILVDSSSDGALQVRNSQPPLVLSPALQSLLFPKYLDYFA
                     TFTYSNLHEVTSADSKRLCQVRDLKLFRMETLCEGRYTGVATSKVIKDNHGTNYFDLI
                     LHLCDYASARRYLHGKISLKDVKVMPVDRTQRYFIKQWDDRFRAQYPIASSAIVESWE
                     TFTYPREVYHTILHDRKLWPFDKDIRIIPFEWHIFRPTNATNENISTYLEFYDLKYGN
                     GKCPCWRLYRSLVDKIQQESTIHAKFVHAWARDRHLRELCNAAIYSDLFNDAGYELGD
                     HPEDLTWPSSGEYDLLNGKVFDFFFKKTMT"
     gene            <106325..>106807
                     /locus_tag="C5L36_0C00620"
                     /db_xref="GeneID:40383913"
     mRNA            <106325..>106807
                     /locus_tag="C5L36_0C00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465735.1"
                     /db_xref="GeneID:40383913"
     CDS             106325..106807
                     /locus_tag="C5L36_0C00620"
                     /inference="similar to AA sequence:RefSeq:NP_010062.1"
                     /note="PKUD0C00620; similar to Saccharomyces cerevisiae
                     YDL219W (DTD1); ancestral locus Anc_2.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321595.1"
                     /db_xref="GeneID:40383913"
                     /translation="MRVVIQRVKQASVTVDNAVVSEIKKGLCLLVGITQEDTDEDVAK
                     LANKVLKLRLFEDTAQEAGTNTEWVGKPWMKSVTDIGGEVLSVSQFTLYGNIKKGTKP
                     DFHRAQKGQLAMDLYNSFLGELRKGLGEAKVKDGQFGAMMDVGIVNDGPVTIVYDTKE
                     "
     gene            complement(<107077..>108309)
                     /locus_tag="C5L36_0C00630"
                     /db_xref="GeneID:40383914"
     mRNA            complement(<107077..>108309)
                     /locus_tag="C5L36_0C00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465736.1"
                     /db_xref="GeneID:40383914"
     CDS             complement(107077..108309)
                     /locus_tag="C5L36_0C00630"
                     /note="PKUD0C00630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321596.1"
                     /db_xref="GeneID:40383914"
                     /translation="MSFELPHQTLLPSIGSVTGEMEIPLSPETVEEVQAEVTNENIGE
                     SIENILEASNEPLPKDVGEINVCGHLRFDEEMPPDEETQTNTIFNALMYDIVEFPSKG
                     VDGRRGGGEEEEEEEEEGHVLKKRNPPKSIVFDTCSTNLDISKFQTTLLSQHPDFRFS
                     CHSRTLMVAFNDDPASVNALNWTVQEMCNDNDIVIILHVVPLNTVIKNGVGKHRDYCN
                     KLLKRMRNLNTKNRHIKLVVEIRIGAVEFTIARGFRDFDPNFLIMGTKGLKKTKLTSF
                     LNDNTSLTKHFLDNGRMPVIVINPEYIPSTATYTNINEKTFVDKLKSYSPDIERPGSS
                     QRIKLERSSSSSSIGGGSRTPRFLRLTSRSSSRTSLNSLGIATPASSTDTSPERPSNT
                     RTSNRSRALSPFRFFHRH"
     gene            <108758..>109792
                     /locus_tag="C5L36_0C00640"
                     /db_xref="GeneID:40383915"
     mRNA            <108758..>109792
                     /locus_tag="C5L36_0C00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465737.1"
                     /db_xref="GeneID:40383915"
     CDS             108758..109792
                     /locus_tag="C5L36_0C00640"
                     /inference="similar to AA sequence:RefSeq:NP_014208.1"
                     /note="PKUD0C00640; similar to Saccharomyces cerevisiae
                     YNL191W (DUG3); ancestral locus Anc_2.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321597.1"
                     /db_xref="GeneID:40383915"
                     /translation="MCRFLIYKGKDPMTLSNLLTKPQHSIINQSYDSRLRIDAQPVNG
                     DGFGVGYYTLDGGRGDRAPCLYKAITPAWNNLNLQRISEKTRSKLIFAHVRASTYGVL
                     SETNCHPFTYENIMFMHNGGISNFDKIKLRLINFIDEKFFLQIKGSTDSECCFALLLH
                     CLKVNGFDPDSGELCDLKILRQSVVDTIQHIKNWVKEVSNDPSLLNFAVTDGENIVVS
                     RYVTSRTDEAASLYFSTGSNFVEFAPGRFKMERMNKSQNLVMVASEPLTFERNDWLSV
                     PTNSTISISKLNVLLHPILDEYYSPDPTQSRSFDYASSKGMIGSYPTEQDTYNEVPPL
                     EREGRAVPTH"
     gene            complement(<110009..>110575)
                     /locus_tag="C5L36_0C00650"
                     /db_xref="GeneID:40383916"
     mRNA            complement(<110009..>110575)
                     /locus_tag="C5L36_0C00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465738.1"
                     /db_xref="GeneID:40383916"
     CDS             complement(110009..110575)
                     /locus_tag="C5L36_0C00650"
                     /inference="similar to AA sequence:RefSeq:NP_010064.1"
                     /note="PKUD0C00650; similar to Saccharomyces cerevisiae
                     YDL217C (TIM22); ancestral locus Anc_2.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321598.1"
                     /db_xref="GeneID:40383916"
                     /translation="MNNPFLPPPEKPLSEMTPEEQGEAGARQIMAFVSSCPGKALLAG
                     GSGFVLGGAFGFFMASMQYDSPAGLGMTGSAAAIAQEQYLKLPLREQMKIQFRDVWSR
                     TKSSARNFGYIGLIFSGVECCIEGMRGKSDLYNGAAAGCITGGGLAIKSGPEAMLIGC
                     AGFAAFSTAIDMYMRSENGEPPKNDYND"
     gene            complement(<111188..>113369)
                     /locus_tag="C5L36_0C00660"
                     /db_xref="GeneID:40383917"
     mRNA            complement(join(<111188..113086,113337..>113369))
                     /locus_tag="C5L36_0C00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465739.1"
                     /db_xref="GeneID:40383917"
     CDS             complement(join(111188..113086,113337..113369))
                     /locus_tag="C5L36_0C00660"
                     /inference="similar to AA sequence:RefSeq:NP_013076.1"
                     /note="PKUD0C00660; similar to Saccharomyces cerevisiae
                     YLL024C (SSA2); ancestral locus Anc_4.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321599.1"
                     /db_xref="GeneID:40383917"
                     /translation="MLANVSKNIKATPKKFVRYNSNKVQGTVIGIDLGTTNSAVAVME
                     GKTPKIIENAEGSRTTPSVVAFTKDGERLVGIPAKRQAVVNPENTLFATKRLIGRRFE
                     DAEVQRDIKEVPYKIVKHTNGDAWVEARGERYSPAQVGGFVLNKMKETAEAYLGKPVK
                     DAVVTVPAYFNDSQRQATKDAGAIVGLNVARVVNEPTAAALAYGLEKDDSKVVAVFDL
                     GGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIALVRYIVEEFKKESNIDLNGDRM
                     AIQRIREASEKAKIELSSALSTEISLPFITADATGPKHINLKMTRSQLEKLVEPLIKK
                     TFEPCKKALKDANLNASEVGEVILVGGMSRMPKVIETVKEIFGKEPSKAVNPDEAVAI
                     GAAIQGAVLSGEVKDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQVFSTAAD
                     GQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSAK
                     DKASGKDSSITVAGSSGLTDSEIEKMVNDAEKFKDQDKARKEAIEQTNKADQLCNDTE
                     KSLTEFGDKLDKTDAEVVKKLISELRELVVKVNGGETVEVADIKTKYDELQQSSLKLF
                     EKMYKNQSSEDSSNTDSKN"
     gene            complement(<114641..>115228)
                     /locus_tag="C5L36_0C00670"
                     /db_xref="GeneID:40383918"
     mRNA            complement(<114641..>115228)
                     /locus_tag="C5L36_0C00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465740.1"
                     /db_xref="GeneID:40383918"
     CDS             complement(114641..115228)
                     /locus_tag="C5L36_0C00670"
                     /note="PKUD0C00670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321600.1"
                     /db_xref="GeneID:40383918"
                     /translation="MHRRLSIKDESVICGSRGFTVAKVGKRVDRRGGGGGCSSVLERV
                     RAKELQRKVEAGVRRGDEGHEGDGGCLSRRVDEVKGRVEAILREERARGSVLSERKLL
                     QRVVDSYDGGIEEELVKKAVDAVRWRGADGRRCAGIKDVKDTTNIKDINGSEDIKDGK
                     DVKDTTNIKDINGSEDIKDGKDVKDINGSTGSIGR"
     gene            complement(<115342..>116364)
                     /locus_tag="C5L36_0C00680"
                     /db_xref="GeneID:40383919"
     mRNA            complement(<115342..>116364)
                     /locus_tag="C5L36_0C00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465741.1"
                     /db_xref="GeneID:40383919"
     CDS             complement(115342..116364)
                     /locus_tag="C5L36_0C00680"
                     /inference="similar to AA sequence:RefSeq:NP_013074.1"
                     /note="PKUD0C00680; similar to Saccharomyces cerevisiae
                     YLL026W (HSP104); ancestral locus Anc_4.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321601.1"
                     /db_xref="GeneID:40383919"
                     /translation="MSFPLDLELPWVEKYRPVTLDEVVGNKETIRALKRMAIDGNLPH
                     LIISGMPGIGKTTAVLCLARELFDGDVKVMREAVLELNASDDRGIEVVRNMIKTFAQK
                     KVNLRHNRHKIVILDEADSITASAQQALRRTMEIYSNSTRFVFSCNQSSKIIEPLQSR
                     CSILRFNKLNDEDVLANLNRIIKGEKIETVTDDGLSALIFTSDGDMRQAVNNLQSVYY
                     GFHMVNSENVFKIVDTPNPLLVRRMLQQALLGDIDGALAVLQGLWGKGYSAVDIVNVC
                     FRVSKTLDIANNTNSSTNSNNKIDHESVLSVLRLVGECQLRLVEGVSTYLQLAALMAR
                     LSEISN"
     gene            complement(<116510..>117805)
                     /locus_tag="C5L36_0C00690"
                     /db_xref="GeneID:40383920"
     mRNA            complement(<116510..>117805)
                     /locus_tag="C5L36_0C00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465742.1"
                     /db_xref="GeneID:40383920"
     CDS             complement(116510..117805)
                     /locus_tag="C5L36_0C00690"
                     /inference="similar to AA sequence:RefSeq:NP_013078.1"
                     /note="PKUD0C00690; similar to Saccharomyces cerevisiae
                     YLL022C (HIF1); ancestral locus Anc_4.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321602.1"
                     /db_xref="GeneID:40383920"
                     /translation="MSVSLETLLRLGAEAMAHKEYANAVELYSEACQVSNLDTSKDDP
                     DLMFLYAKALFANGVATNDVFGSKAGEGSGVGAEEGARSGGTVEDGCGGENLEQEVEE
                     ESSGFQFNDSVAIEEEDEGEEEGDEDEKENEESKKLKEESKKLKEESKKLKEESKKLK
                     EESNKGTKETVKEEASMDCRDAPTGDDETGEGGEEESSDEEVEGSNDEEVEGSNGQDQ
                     GKEVAQGGEEEVSDFEIAWDILELTRVLYEKRMEELNGRAEGDETVAEEKKKVQERLA
                     DVHLLMGDIGLETENFTQAVEDFGNAVKVIMETHGPKGGMYREAQFKLSLAYEFVGDE
                     ESIEGAVDAIEKVLQALDRESCVDIELRKDVEERMKELREMQAQRREEKAMLKQVLFG
                     VTTSGHGGGDECNGRDGKRIAANDLTGLVKRKRKEKKNA"
     gene            <118298..>119707
                     /locus_tag="C5L36_0C00700"
                     /db_xref="GeneID:40383921"
     mRNA            <118298..>119707
                     /locus_tag="C5L36_0C00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465743.1"
                     /db_xref="GeneID:40383921"
     CDS             118298..119707
                     /locus_tag="C5L36_0C00700"
                     /inference="similar to AA sequence:RefSeq:NP_013418.2"
                     /note="PKUD0C00700; similar to Saccharomyces cerevisiae
                     YLR314C (CDC3); ancestral locus Anc_4.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321603.1"
                     /db_xref="GeneID:40383921"
                     /translation="MTDVAVTQHMGELSLDAHSNQSSVHNLPLHSVIEDNKSNSSKII
                     RRKLNGYVGFANLPKQWHRKSIRRGFNFNLMVVGEKGLGKSTLVNTLFNRDLYDLNNS
                     KAYQIDLDNTEDQIKIETLNTEIEENNVKLNLQVIDCTGFGDSIDHTNSVKPIIDEID
                     SRFDSYLEMETKINRSSLAIKDNRIHALLYFIEPTGHCLKPLDINFMKQVHEKVNLIP
                     IIAKSDILTDLEVEDFKQKIVQDLQNQNIKFFSPKIYENDDQETRLTNNEIISKIPYA
                     IVGSNQLIKLNDGRLVRGRSYPWGIVEVDNELHCDFVKLRQLLIRNSMEELKEITNKK
                     LYENYRLEKLSKMGIKQDDSVFKEFDPVLKQEEEKRLHEAKLLNLEKQMKEIFQQKVS
                     REEKKLQETEADLFSKHKEMRDKLLKQIKMLEDKKKELEASANFVDHSSQQHQIQQQI
                     QQQQQQQQPTKTKKGFLRG"
     gene            <120107..>120817
                     /locus_tag="C5L36_0C00710"
                     /db_xref="GeneID:40383922"
     mRNA            <120107..>120817
                     /locus_tag="C5L36_0C00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465744.1"
                     /db_xref="GeneID:40383922"
     CDS             120107..120817
                     /locus_tag="C5L36_0C00710"
                     /inference="similar to AA sequence:RefSeq:NP_013141.1"
                     /note="PKUD0C00710; similar to Saccharomyces cerevisiae
                     YLR040C; ancestral locus Anc_2.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321604.1"
                     /db_xref="GeneID:40383922"
                     /translation="MVIRVLLFAFLCAVSSTEIITTTLDSAGEKTAAVVEQEDFIKAI
                     MRDALASQDKYASVMTEKSMEVPPELLQFLLALDNVEITDFPTASFADHFPFDEFATF
                     VTNFPWYSSYLTENGLTSFKQPSDFSTIVITQGKDDYTSLSTDSFTPAASSTFPIVPH
                     KTTANQKISETTAVTGISSTNITPNSSSSSSSSSSSSTPFSATTITTIHLKTPNEAGH
                     TVPPLPSVLVLFLLALFC"
     gene            <121674..>123200
                     /locus_tag="C5L36_0C00720"
                     /db_xref="GeneID:40383923"
     mRNA            <121674..>123200
                     /locus_tag="C5L36_0C00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465745.1"
                     /db_xref="GeneID:40383923"
     CDS             121674..123200
                     /locus_tag="C5L36_0C00720"
                     /note="PKUD0C00720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321605.1"
                     /db_xref="GeneID:40383923"
                     /translation="MTHVTEEETPHGRHMGVTDVIMMIVQRIIGSGIFAVSSMIYRDV
                     GGSPALFFLVWLISGYSSYAGLMCFSELGSVIPRSGGLKVFLPIIYEKPYMMINVVFG
                     IFIVIFGSIIANVMIFGEYLLYALGYPDGEFMDTYYRPIGFAFLTLVSIMLLISTKFV
                     VRLQTITGILKIILLCAVSLMGLTVLILPSRVTHIPNNLHAKDFFSIKTQVTVGSFTS
                     AVMKGIFSFNGWHTIHNVLGEIKDPVKTMRIAAPLSIFLINLCYFLINITYLIVIPSD
                     ELLEIDEMVGLVLFEKFFGDSFGKIILSALIAFSVGGNIVTVLYHISRINQEIFREGF
                     LPFSKMGATNYPFKTPIGSLLVPFVITTSFLLIPTSSSIFNYTINMESYPTQIFFGLA
                     CFGIIILRKRSPDIIPSIKASYFDIGFMIIFSVAMFLGPLIKPDQSQFPGLPNYAYTS
                     IVILLLCMLYWLLMFKLVPRLLNYRLEKHEETLYDGLTITKWEKIKDVNSTYEPISDV
                     "
     gene            <123496..>125019
                     /locus_tag="C5L36_0C00730"
                     /db_xref="GeneID:40383924"
     mRNA            <123496..>125019
                     /locus_tag="C5L36_0C00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465746.1"
                     /db_xref="GeneID:40383924"
     CDS             123496..125019
                     /locus_tag="C5L36_0C00730"
                     /inference="similar to AA sequence:RefSeq:NP_011827.1"
                     /note="PKUD0C00730; similar to Saccharomyces cerevisiae
                     YHL036W (MUP3); ancestral locus Anc_4.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321606.1"
                     /db_xref="GeneID:40383924"
                     /translation="MTHVSREESPHGRHLGVTDVIMMIVQRIIGSGIFAVPSMIYKDV
                     GGSPALFFLVWIIAGYSSYAGLMCYAELGSIIPRSGGLKAFLPVIYHKPYMMINVVYG
                     TYILVFGSIVSNVIIFGEYFLSALGYSQGEFTKQHYKTVGIVFLGGLCLMLLIHTRFV
                     VKLQTIMGIVKITLISSVSLIGIFVLALPSNEPKFTNNIHTSDFFTIKTQITIASFIS
                     AVMKAIFSCNGWQSIYNVLDEIKDPVRTMKIAAPSSIFLIQLCFFLINLTYLIIIPSD
                     ELLETDKLVGLVLFEKLFGNSLGRVILSSLIAFSVAGNITTGIYHSSRVNQEIFKEGF
                     LPFSRTLVKNYPFKSSPGSLLLPLLITASFLFVPTTSSIFSYVINLDGYPSRFFFGLA
                     SYGILVLRRRKPDVVPGIKASNWEIGFIISLSTFMVLGPLLKPDNSRFPGLPNYTYVS
                     LCLLGVCTLYWFFMFKIGPKLFHYELSEKHETLNDGMVITTWEKLKDTIPGTSYGSV"
     gene            <125258..>126589
                     /locus_tag="C5L36_0C00740"
                     /db_xref="GeneID:40383925"
     mRNA            <125258..>126589
                     /locus_tag="C5L36_0C00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465747.1"
                     /db_xref="GeneID:40383925"
     CDS             125258..126589
                     /locus_tag="C5L36_0C00740"
                     /inference="similar to AA sequence:RefSeq:NP_013191.1"
                     /note="PKUD0C00740; similar to Saccharomyces cerevisiae
                     YLR090W (XDJ1); ancestral locus Anc_8.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321607.1"
                     /db_xref="GeneID:40383925"
                     /translation="MASLYEVLGVESSATEGEIRKAYRKLALKFHPDKVSPEERETSE
                     IKFKEITEAYEILCDEDKRRDYDLGGSRREAPGYSFNDFEEFGGFGGGGFGGDFDADD
                     FANFFGTNFNARRSGGNSSFNHPNVGELDIKFEINVTLKDLYFGKLIKKTYKRDTICI
                     KCNGKGLRKNAVEIDCPACRGLGVVEEYRRMGGMAFVERVKCRQCDGKGKYSRPDDKC
                     RKCKGSGTMKEECTCEFQIQRGSPNAGEVTINDMGHIKPNLPKGRAILKFTYTKDPKE
                     NELFHREGNDLYTKISVSLVDALCGFENEKLVQTLDHRWLNVKVPMGKVLKPGDCIVI
                     KGEGMPIPGSMFNSSGDLFIGIEIIFPKDGWMVERGDRNRLMDILGHVENKPDANDND
                     QTDDEKSTPTVFQIKEKDAVPKSFNTYVNNTEVKTFGTGNDKGWFGGWFGW"
     gene            complement(<127124..>128350)
                     /locus_tag="C5L36_0C00750"
                     /db_xref="GeneID:40383926"
     mRNA            complement(<127124..>128350)
                     /locus_tag="C5L36_0C00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465748.1"
                     /db_xref="GeneID:40383926"
     CDS             complement(127124..128350)
                     /locus_tag="C5L36_0C00750"
                     /note="PKUD0C00750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321608.1"
                     /db_xref="GeneID:40383926"
                     /translation="MPLHKQDNTHKIAAARAAKNQENAGDSSHAVRKIFSSETMKADG
                     VVTERKALNAKSSNTRSSYGGKDLNIVQKTHSSSVSGNTNKARKVIKKPFSIFPEAAS
                     TSNNSISAHDTTTLQRSYSQKEQSAGSNSSFNTLSRSSTFGSSSNYFADSGTYSKNSL
                     KPTRRIKSQLTIGAENDIVAFFKNSKLQEQKQLGITDTKNTENKPELPLDEVTFTEDA
                     DDITSMKKILMERDSPVYQRTHKVNLHTLLSSSVDEDDVQETTFEYKDKGGGKVQDLE
                     TLILSRPNSTGDQRTDDLELEIVGHDKTNDRYNDSIPDCVLDGLYQPMSKDVLTNLWN
                     DPTPASISAAAKFKDPLNLPKSWRETANEDILKINNEQTQEPVELELEFSDIDNDDDG
                     SDIDLNEIADFYARKV"
     gene            <128607..>129497
                     /locus_tag="C5L36_0C00755"
                     /db_xref="GeneID:40383927"
     mRNA            <128607..>129497
                     /locus_tag="C5L36_0C00755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465749.1"
                     /db_xref="GeneID:40383927"
     CDS             128607..129497
                     /locus_tag="C5L36_0C00755"
                     /note="PKUD0C00755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321609.1"
                     /db_xref="GeneID:40383927"
                     /translation="MGLVATLDKYTLEKLARLVRHNDSKALQVHELIQSGELTEKQNS
                     NKVLDILQYIYTHPSNENERYPGWLFGFLKQKSVFKKEKLQMFERYSAILKLHHIMMD
                     FKDENNGILLRTYTEQWNTATMGYLSQRKFCKWSEHEGKALPKLVDFEFPEPPAENLQ
                     DIKKLVKLRQQYISALDLKKSPPDLQIVIAPNMFGEPPAPQRVFNKMIRRLEALQDYY
                     KKNQPVSTVDMDELNKINLLEIDGYFREAYVDFLNAIFVIKNDSTIEKSAMIQRQVAT
                     SKRVESLYQKFYKDDNTPTN"
     gene            complement(<129518..>131485)
                     /locus_tag="C5L36_0C00760"
                     /db_xref="GeneID:40383928"
     mRNA            complement(<129518..>131485)
                     /locus_tag="C5L36_0C00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465750.1"
                     /db_xref="GeneID:40383928"
     CDS             complement(129518..131485)
                     /locus_tag="C5L36_0C00760"
                     /inference="similar to AA sequence:RefSeq:NP_010403.3"
                     /note="PKUD0C00760; similar to Saccharomyces cerevisiae
                     YDR118W (APC4); ancestral locus Anc_8.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321610.1"
                     /db_xref="GeneID:40383928"
                     /translation="MVATITNGELNEFQSPLQFSNCFTLCPAMDLVSFQLTKNVLLVY
                     RRGNEKVWDIEPFHSSGSMCIKGLEWKPDGKLFVLFSSDGSIELIDTMTGAVLRELDL
                     GLSNLTCVRWFHKDGESRATHGKGKNVKGILKSLDITTLLPRTGHTQLNTVQDKTNPS
                     RKMSDMDMLFLGTKEGKLSCIFAGIFIVDDIAQKSFVSSKIINIASNTSLTDQYVLVE
                     VGNKIKLFKVSLKCLENDNDFCELLLICTRLLNLSLHFKKSINSIENQYKPYIEYTIR
                     IVQLLGSEIKEDGGTDPDSGICHDAADEKLNIGDSSINPIYDLYDLLLTGSLSKATKK
                     WITDYLGDKGIKRWTKLGRSYFDTARNQIYTEIISSLHLLIVYLTDLSGICRLNPEKS
                     SIKPLDIEECIKMTENYLKYSYKFMIQLNDYQKYFEQTIAWLSSVLSEITTDEKRNTS
                     FATNDITNYLMFLSEKLSFSGDNNEEKVLNDSKLGDFSKITDTVLNKLFDKVKNDIRL
                     HAQADQSIELFCGNYPTARNLKLSICTDTIGHASILLENSKLVIREIHLKDLSGDEFV
                     FSLPCKEPVEYELISPTVLIILLNDSLEIYNISYKSRKLSLQAKYNFSSIDHQEDHVF
                     EGGSMTVNQKRSIICILDSSKRKYLWLNYSI"
     gene            <131788..>133560
                     /locus_tag="C5L36_0C00770"
                     /db_xref="GeneID:40383929"
     mRNA            <131788..>133560
                     /locus_tag="C5L36_0C00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465751.1"
                     /db_xref="GeneID:40383929"
     CDS             131788..133560
                     /locus_tag="C5L36_0C00770"
                     /inference="similar to AA sequence:RefSeq:NP_010402.3"
                     /note="PKUD0C00770; similar to Saccharomyces cerevisiae
                     YDR117C (TMA64); ancestral locus Anc_8.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321611.1"
                     /db_xref="GeneID:40383929"
                     /translation="MFKKELEVKPSANLKSSEKRKLQKAIETQYEGIRVPDKLSKAVF
                     NSIGIKKGTLYLDSATGDPSFFQSRDGDIVPTLHTLWASVAGVDKPLCMPYILTHEGV
                     IDRLIDGANLMIRGCHGPYVKGLKRNALVAVVDYKRPNIAVAIGRCLMDLEGKVDGDL
                     GIPQSGVAVEIWTVIGDMLTNLGRNMEDVMKDAGKDNVIRNEQEDDKESQHEEQSKDQ
                     PDLELLEVTKPGTLVDVSHNLCDETEIETTESRPEKYTMTTEDIDEMFRRSVLYTLSQ
                     DALEFPIPSTQFMSGHVLKNLPNVDTDIVNMKKTSWKKTTKFLKAMEKEDLVKLKGKE
                     DKLTIVSAAGRSDPRISAFVPYRIKKPAHHEPNTTYSHNDEQMAPVVVKRYYKPNNAS
                     RMFFNKLDEKYDSLYTEQDIKLLTQRYVKENPGVISKANAQLIEPDDVLKEFKIKTTI
                     KRAELFARVMAAFSPYYAIYREGDEKSSDKLILKRLTPRKGELPIVKVAVNTLKTRKK
                     VVTSIVGSEQYYIDVEKLAGVLRVKCSGSTTILDSKEPKDGKVVTVQGEHDSAVCEIL
                     HKQFGVPAKVITVTNNTANKKKRR"
     gene            <135359..>137377
                     /locus_tag="C5L36_0C00780"
                     /db_xref="GeneID:40383930"
     mRNA            <135359..>137377
                     /locus_tag="C5L36_0C00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465752.1"
                     /db_xref="GeneID:40383930"
     CDS             135359..137377
                     /locus_tag="C5L36_0C00780"
                     /inference="similar to AA sequence:RefSeq:NP_014808.1"
                     /note="PKUD0C00780; similar to Saccharomyces cerevisiae
                     YOR165W (SEY1); ancestral locus Anc_6.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321612.1"
                     /db_xref="GeneID:40383930"
                     /translation="MSETQFLRVCRVSDRSFIRRSLAAWQITANFPAGRLHQGKKMDS
                     SPVLKKGDINTNSVQLIDEEKRFAKNLETYVDACYMNKSEDDSGLNYHIVSVFGSQST
                     GKSTLLNKLFGTQFDVMDEEKRQQTTKGIWFSHANYIASHDETNPKTENKKNVYVLDV
                     EGVDGREKADDKDFERKSALFALATSEVLIVNIFEHQVGLYQGANMELLKTVMEVNLS
                     LFHKQAERCLLLFVIRDFTGLTPLSNLGQSLEADMNRIWADLNKPEECKDSKLVDFFD
                     LKFASISHKHYQPEKFDSDIRKLGDDFSNETFFANNRYHKKIPIDAWALYSQQIWEQI
                     ENNKDLDLPTQQILVSRFKCNEISTALYDEIFDKEFNKLTLPEKDPLESCKVFKALRS
                     KCLELYDQQASRYKSAVYLETRKELELKMDLKLKDFQSRILGLLIEKLVTELDSAYAA
                     LKKSKTTSNFEETLKYVIDETLDKFETASSQYILVDDSEVSEIYAQNLKVHSELLMAK
                     LKDFSDRMRNKESTALVNKLGKKFQIKIKEYLIEEVTQPTDDLWDKVMSQFDQIVEKL
                     LRTYEYGQGYDFQLGLKEGNDLLHLKIMKMIWKKYDVLVHDFINEDTVSRILRNVFED
                     KFKFDDKGLPIVWKDFNQLDSRFNKSKEETLKLLPLLGTMRLSNGKTV"
     gene            complement(<138079..>145422)
                     /locus_tag="C5L36_0C00790"
                     /db_xref="GeneID:40383931"
     mRNA            complement(<138079..>145422)
                     /locus_tag="C5L36_0C00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465753.1"
                     /db_xref="GeneID:40383931"
     CDS             complement(138079..145422)
                     /locus_tag="C5L36_0C00790"
                     /inference="similar to AA sequence:RefSeq:NP_012035.1"
                     /note="PKUD0C00790; similar to Saccharomyces cerevisiae
                     YHR165C (PRP8); ancestral locus Anc_5.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321613.1"
                     /db_xref="GeneID:40383931"
                     /translation="MAPKKALPAKRPPPPPPPAVAASQTANIAEPPKKKVKLPPPPPP
                     PTSTSTSSSSSSLFASTGKHTEKSAPSRLPPPPPPPPPPSSKSQQGSNKGSKPNGIPQ
                     DILKARAKKWLLLQKNRFTEKKIQKGSHVHNVKYEMPPEHIRKIMNNQGDLSSKAFNS
                     EKRAMLGALRYMPHALLKLLENMPQPWETEKSVRVLYHTGGAISFVNEIPRVIEPVYK
                     AQWATAWIQMRREKRDRKNFRRMKFPPFDDEEPFMDFSKEIPAIDSLQGVSIELDPIE
                     DEAVADWLYEDKPLIEDRRFVNGASYRKWNLSVDILSNLHRLSTPLVGDDNLDTNSNY
                     LFDKESLFTAKALNIALPGGPKFEPLYKDENPDDEDFNEFNSLDRIIFRNPIKSEYKV
                     AFPYVYNNLVRSVSIPKYHSPPVLFVRSEDPELPSFHFNSDYNLIKPKNGLTNLHEIT
                     DFESETGEMLNDLGVVDDISFDLPDDFEPFFTEQPIEPTKNTYQSLELYWSSNSFSQR
                     AGNMKRAEDVPLIKNWYLQPSPPGERVKVKISHQKLLKSHVLNELKKERSPSNDSTPK
                     LLKALKNTKFFQETTLDWIEVGIQVCKQGHNMLNLLIHKRGLTYLHLDYNFNLKPTKT
                     LSTKERKKSRFGNAFHLIREMFRMIKMIVDAHIQFRLGNIDAYQLADGLYYAMNHMGQ
                     LTGIYRYKYKVMHQIRAIKDLKHVVYSRFNKIIGKGPGCGFWQPAWRVWIFFIRGIIP
                     ILERWLGNLLSRQFEGRQSKEVTKTITKQRVDSYYDLELRAAVMKDILDMIPEGMKQN
                     KSKTIMQHLSEAWRCWKANIPWKVPGLPEPIVHIIERYIKVKADGWISVAYYNREKIQ
                     RGASIEKTVVKKNLGRLTRLWIKNEQDRQLEYQKEGSFISPEEGVEIYMNMVNWLESR
                     NFVPIPFPPINYKHDSKILILALESLKEQYQGNSRLNSQERQELSIIEQAYDNPHEFL
                     ANIKRTILTQRNFKEVKLEMMDHYSHITPVYDIEPLEKIVDAYLDQYLWYEAEKRGLF
                     PNWVKPNDAEIPPLLTYKWCQGVNNLDDVWNVSQGQKDVILQTTLDKLGEKIDFTLLN
                     QLLRLVVDPNIADYITSKNNVSLNYKDMSYVNQFGLIKGLQFASFVYQYYALATDLMI
                     LGLDRASDLAGSPSNPNEFLEFESLEKQKQHPIRLYMRYIDKITIFFRFDKEESDELV
                     DDYLTENPDPNFEQIVGYNNRRCWPRDCRMKLTRRDVHLGRACFWEISRRLPRSIIDI
                     KWENTLASVYSLDNPNLLFTMCGFEVRILPTCRMSESKPSKEGVWDLIDENSKEVTAK
                     AFLQVTKEDIEKFQNSIRRILLSAGSSPFTKIASRWNTAVLALFVYYREAIVATEPLL
                     DILVKSETRIQNKVKLGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPSSDLRWS
                     RQTETGITHFRAGMTHDDERIIPTIYRYITTWENEFLDSQRVWSEFSNKRNEAEQLKK
                     RLTFEDLEDCWDRGLPRVSTLFQKDRQTLAVDKGYRIRKEFKEYSVTKNNFYWWLSDR
                     HDGRLWNLNAYRTDVIQALGGIETILEHTLFKGTGFESWEGLFWEKASGFEDTLKFKK
                     LTNAQRSGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPSLKISLIQ
                     IFRAHLWQKIHESLVVDICQVLDSHLEELMIDGVEKLPIHPRKSYKMNSSAADILMKG
                     ITQWSCSKPSLLYDSNDDYRTIKSDKFWIDIQLRYGDYDSHDISRYARAKYLDYTSDT
                     STVYPSATGLVIAVDLSYNMYNAYGNWFPGLKELVQKALKTIMKANPALYVLRERIRK
                     GLQLYQAQPQESFLSSSNYAELFNNDNKLVVDDSNVYRVVMHSTYEGNSAVKVLNGAL
                     FMINPRTGQLFLKVMHSSMYQGQKHRSKMSKWKSAEEVAALVRSLPTDEQPTQVIITS
                     KGIMDPLEVHMLDFPNISLRPTELRLPFDAALKIDKLGNLVNTAKEPTMVLFNIYDDW
                     LESCSSFTAFNRLIVLMRALQVNSDKAKLILRPNSNIVTKEHHLWPSFSVEQWRSVEA
                     QLADLILNDYSEKFNVNIDTLTDNEIRDIILGQNLNAPSVKNQKIAEIEGNKAVSLKN
                     DGNEEIEQQISNKVKTVNVHGEDIVTVTTSNLGQEKFESKSSWRKRAILSSLLDLEKS
                     KVFVTSGNFADEESFAFVIPKNILSTFLSCCDSRLQVGGFIYGKSPVDNDQVKEIRCI
                     VIAPQLGEHNQVNLPHVAPSSEYLEGLEPLGWIHSVPSGKETDLDGCYEIINHARMRN
                     EFKWSNKASIISVLLNNGSVTITSNRVTENGLNWGVKYAKYLGQADRLIHYSDDYRVH
                     TPLILTEKFKGYTMVPETDVWNYSFVSNTFDSEEEYKLKIDQPLGFFNELHRPIHFDA
                     FSKLEDHNIQGVDYSVEAEQEDVFI"
     gene            complement(<145849..>147807)
                     /locus_tag="C5L36_0C00800"
                     /db_xref="GeneID:40383932"
     mRNA            complement(<145849..>147807)
                     /locus_tag="C5L36_0C00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465754.1"
                     /db_xref="GeneID:40383932"
     CDS             complement(145849..147807)
                     /locus_tag="C5L36_0C00800"
                     /inference="similar to AA sequence:RefSeq:NP_012036.1"
                     /note="PKUD0C00800; similar to Saccharomyces cerevisiae
                     YHR166C (CDC23); ancestral locus Anc_5.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321614.1"
                     /db_xref="GeneID:40383932"
                     /translation="MDFDQKVLLRQVLLESSSVLSERHLNVSAKWSSEALNGMTPFTA
                     EQQYAEFQLLRRAMNQRYTGNSQLTSPLVSSGAFEPGNPTATGTGLGILPGSGCVSST
                     IPNIDSGISIATDGVQKSTTVENLSGNMDSENTSGINLVSDVDNEEYTQFTERGRITL
                     ANSYFNCKEFNRCHHVLKECKSAKAVFIRLYALYMSGEKKRNLDNGTLLGQNDSNTSN
                     PYISTIVKELEEYKTVRKLKHLNDPFLLYLQGIIHLRSKKYAHAQEMFYQSVSLYPVN
                     WSCWKELVSSLSTFSEALRIIDRIQRNNKFYDKREYRIMFLFFKINVYQEFFQISNEV
                     VANLNELSEIFPNFSFLKTQKALISYNELDYNSAENIFDDILKTDPMRLDEMDIYSNI
                     LYVMENKSKLSFLAHYASEVDPLRPETCCIIANYYSIKFDHQKAIMYYKRALSLSQDC
                     LSAWTLMGHEFVELKNSNAAIESYRRAVDTNNKDFRAWYGLGQAYEVLDMHLYSLYYY
                     QRACSLKPLDKRMWQAIGNCCEKLEEYEDAIKAYKKASSVSVDSDPTILYKLGVLFKE
                     LNDVKNAKLYMKLCLEEESHGDVTDETTKARLWLAQYEMNNKNWQTAYNYAIEVTQGT
                     SQEIEEARNIAREARMKLNIAKTSKQFL"
     gene            complement(<148046..>148909)
                     /locus_tag="C5L36_0C00810"
                     /db_xref="GeneID:40383933"
     mRNA            complement(<148046..>148909)
                     /locus_tag="C5L36_0C00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465755.1"
                     /db_xref="GeneID:40383933"
     CDS             complement(148046..148909)
                     /locus_tag="C5L36_0C00810"
                     /inference="similar to AA sequence:RefSeq:NP_014646.1"
                     /note="PKUD0C00810; similar to Saccharomyces cerevisiae
                     YOR004W (UTP23); ancestral locus Anc_6.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321615.1"
                     /db_xref="GeneID:40383933"
                     /translation="MRQKRAKQYRKQMQVLRTTFKFKTPIQCLVDDSTIIEAANTRYD
                     LIKGVNSVVQNETKFFVTQCCIQHLYDSNNQPAVDLAKKMEKRRCGHKDTLSSFECIK
                     SITNVDGENKYRYLVVTQNESLRTSLRNVAGVPLCFLHRSVMVMEPLSKVTKRVVDAV
                     ERMKLTQGLNNVNAGKRTLEEEEANTEDDKPKPKKRKAKGVNPLAMKKKQKKPIQGNH
                     KEKTQQKLEPEEGHNDSQSNNDNGEEKKKRRRRRHHTNSEPGGEGPVKETQPVESIPT
                     GEGFALVESTD"
     gene            <149212..>150063
                     /locus_tag="C5L36_0C00820"
                     /db_xref="GeneID:40383934"
     mRNA            <149212..>150063
                     /locus_tag="C5L36_0C00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465756.1"
                     /db_xref="GeneID:40383934"
     CDS             149212..150063
                     /locus_tag="C5L36_0C00820"
                     /inference="similar to AA sequence:RefSeq:NP_013165.1"
                     /note="PKUD0C00820; similar to Saccharomyces cerevisiae
                     YLR064W (PER33); ancestral locus Anc_8.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321616.1"
                     /db_xref="GeneID:40383934"
                     /translation="MTAITIPHVWYATQLASLFFSFLTFISSSIVPYKLAYLFVTASL
                     FISLYQSLTREQPKTTPGTVDSASGSANSESTSKSPSSSGNARVANKKHDVVSSIRLM
                     IKPARSHSTTPYALLALAYLLIFSKSKISLIPFDIFAFFHVINYTSSFIIDLLPVNAS
                     MQGQIKKGLEYTNTRYNPIGFRIAVWVQLLTFLISVLWTVLNLPLNLVGYGDGHSLLN
                     IATTVCWVFFIEKVQSQNLLMKAAINNVVAIIDGITADPRVPLQLRDLWTRVKHIAKF
                     KDFNHVQ"
     gene            complement(<150303..>150566)
                     /locus_tag="C5L36_0C00830"
                     /db_xref="GeneID:40383935"
     mRNA            complement(<150303..>150566)
                     /locus_tag="C5L36_0C00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465757.1"
                     /db_xref="GeneID:40383935"
     CDS             complement(150303..150566)
                     /locus_tag="C5L36_0C00830"
                     /inference="similar to AA sequence:RefSeq:NP_010666.2"
                     /note="PKUD0C00830; similar to Saccharomyces cerevisiae
                     YDR378C (LSM6); ancestral locus Anc_5.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321617.1"
                     /db_xref="GeneID:40383935"
                     /translation="MSNTETKVQSEESQTPDITASFLSSITNKPVNVKIYDDFIYTGT
                     LASIDGYMNIVLQNAEEIVRGKSTNTYEEIFIRGNNVLYISMA"
     gene            <150774..>151796
                     /locus_tag="C5L36_0C00840"
                     /db_xref="GeneID:40383936"
     mRNA            <150774..>151796
                     /locus_tag="C5L36_0C00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465758.1"
                     /db_xref="GeneID:40383936"
     CDS             150774..151796
                     /locus_tag="C5L36_0C00840"
                     /note="PKUD0C00840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321618.1"
                     /db_xref="GeneID:40383936"
                     /translation="MTGVQGVKKAVKYAKPSAKLLNSRLKQEQDIRTERNKLALASVK
                     DIFSIFNVNAGSDEDFDLTDFDCKVYFANPRAFEKLPFFKQQHVIDEMNEKLKKNWKG
                     IDKDIKRFSLWWAYGSHGPREGFVELHDYHTPYGVELEGVDSSKVGSNEKSVDNIKSV
                     HEHTKLDEIVEQISHDTAEVSSESSRSALRMTDNELDSAKLNKRPDVPPDLPFKLPSI
                     LKTFKPTKDTIVHRLPTLDPRSFGIRRLQQYRQDRRMNPINRIILVLLVFLTVLCFKK
                     DRRVNVTGVVPEYPWEIQEREEREEAERKLKQEEEEAAALLAREQKNGQTHSTGNKRW
                     YYLWLR"
     gene            complement(<151978..>152520)
                     /locus_tag="C5L36_0C00850"
                     /db_xref="GeneID:40383937"
     mRNA            complement(<151978..>152520)
                     /locus_tag="C5L36_0C00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465759.1"
                     /db_xref="GeneID:40383937"
     CDS             complement(151978..152520)
                     /locus_tag="C5L36_0C00850"
                     /inference="similar to AA sequence:RefSeq:NP_011457.1"
                     /note="PKUD0C00850; similar to Saccharomyces cerevisiae
                     YGL058W (RAD6); ancestral locus Anc_6.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321619.1"
                     /db_xref="GeneID:40383937"
                     /translation="MSTPARRRLMRDFKRIQQDTASASGGISASPLADNVMIWNAIII
                     GPEDTPFEDGTFRLRLTFDEQYPNKPPQVKFTSEIFHPNVYATGDLCLDILQNRWSPT
                     YDVASILTSIQSLLNDPNISSPANSEAAALYKDHRSQYIKRVRQTVEKSWAEDLEDMD
                     DEDEDDEDDDEDEDEEEDAA"
     gene            <152982..>154919
                     /locus_tag="C5L36_0C00860"
                     /db_xref="GeneID:40383938"
     mRNA            <152982..>154919
                     /locus_tag="C5L36_0C00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465760.1"
                     /db_xref="GeneID:40383938"
     CDS             152982..154919
                     /locus_tag="C5L36_0C00860"
                     /inference="similar to AA sequence:RefSeq:NP_009478.1"
                     /note="PKUD0C00860; similar to Saccharomyces cerevisiae
                     YBL075C (SSA3) and YER103W (SSA4); ancestral locus
                     Anc_7.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321620.1"
                     /db_xref="GeneID:40383938"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFVDPEVQTDMKHFPFKIVDDAGKPKIQ
                     VEYKGETKVFTPEEISSMVLGKMKEIAEAYLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     AIAGLNVLRIINEPTAAAIAYGLDKKNEEGEKNVLIFDLGGGTFDVSLLSIEEGIFEV
                     KATAGDTHLGGEDFDNRLVNHFANDFKRKHKKDLTGNPRAMRRLRTACERAKRTLSSS
                     AQTSIEIDSLFEGIDYYTSITRARFEELCQDLFRSTLDPVEKVLKDAKLDKSSVDEIV
                     LVGGSTRIPKVQKLVSDYFNGKEPNKSINPDEAVAYGAAVQAAILTGDQSSKTQDLLL
                     LDVTPLSLGIETAGGVMTKLIPRNSTIPCKKSETFSTYADNQPGVLIQVFEGERARTK
                     DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKTQKITITNDKGR
                     LSQEDIERMVSEAEKFKEEDEKEAGRIAAKNQLESYAYSVKNTSSEKAFEEKVEASER
                     EQLTKACEEVISWLDENQTATKEEFEDRQKELEQVVNPIMTKFYQAGGAPGAEGAAPG
                     GFPGAGPAAEEPAGPTVEEVD"
     gene            complement(155228..155300)
                     /locus_tag="C5L36_0Ctrna5T"
                     /db_xref="GeneID:40385075"
     tRNA            complement(155228..155300)
                     /locus_tag="C5L36_0Ctrna5T"
                     /product="tRNA-Thr"
                     /note="PKUD0Ctrna5T; codon recognized: ACU"
                     /db_xref="GeneID:40385075"
     gene            155942..156023
                     /locus_tag="C5L36_0Ctrna5S"
                     /db_xref="GeneID:40385074"
     tRNA            155942..156023
                     /locus_tag="C5L36_0Ctrna5S"
                     /product="tRNA-Ser"
                     /note="PKUD0Ctrna5S; codon recognized: UCU"
                     /db_xref="GeneID:40385074"
     gene            <156220..>157323
                     /locus_tag="C5L36_0C00870"
                     /db_xref="GeneID:40383939"
     mRNA            <156220..>157323
                     /locus_tag="C5L36_0C00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465761.1"
                     /db_xref="GeneID:40383939"
     CDS             156220..157323
                     /locus_tag="C5L36_0C00870"
                     /note="PKUD0C00870; Pfam Domains:
                     Beta_elim_lyase(2.3e-112)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321621.1"
                     /db_xref="GeneID:40383939"
                     /translation="MNTEILLPDNHNEFRSDTFTTPTQSMLESVKMASLGDSVYNEDK
                     DTIALETKVASMMGFDAGVFCVSGTLSNQIALRTHLTQPPHSVLCDYRGHVYVHEAGG
                     LATLSQAMVTAIIPSNGLYLTLEDIIERFIPDDGDVHAAPTKVVSLENTLHGLIYPIE
                     EIKRISHWCREKGIKIHLDGARIWDAHIATGIPLIEYSKFFDSISVCLSKGLGAPVGS
                     VLVGDKSFIQKATHFKKQNGGGIRQAGILTRMASIAIDENLSKMKHAHIKAKEVAQYC
                     EKLGLILEIPTQTNFVFLDTKKNYINPSTITAMGEKYDIKISGFRFAFSFQTSDIAVQ
                     NLKRALKDIKEHASSYPYYSRGPVGIYQGNKKA"
     gene            159661..159742
                     /locus_tag="C5L36_0Ctrna6S"
                     /db_xref="GeneID:40385083"
     tRNA            159661..159742
                     /locus_tag="C5L36_0Ctrna6S"
                     /product="tRNA-Ser"
                     /note="PKUD0Ctrna6S; codon recognized: UCG"
                     /db_xref="GeneID:40385083"
     gene            complement(159923..159994)
                     /locus_tag="C5L36_0Ctrna3D"
                     /db_xref="GeneID:40385066"
     tRNA            complement(159923..159994)
                     /locus_tag="C5L36_0Ctrna3D"
                     /product="tRNA-Asp"
                     /note="PKUD0Ctrna3D; codon recognized: GAC"
                     /db_xref="GeneID:40385066"
     gene            complement(159999..160069)
                     /locus_tag="C5L36_0Ctrna8G"
                     /db_xref="GeneID:40385093"
     tRNA            complement(159999..160069)
                     /locus_tag="C5L36_0Ctrna8G"
                     /product="tRNA-Gly"
                     /note="PKUD0Ctrna8G; codon recognized: GGC"
                     /db_xref="GeneID:40385093"
     gene            complement(<160341..>164179)
                     /locus_tag="C5L36_0C00880"
                     /db_xref="GeneID:40383940"
     mRNA            complement(join(<160341..164068,164068..>164179))
                     /locus_tag="C5L36_0C00880"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_029465762.1"
                     /db_xref="GeneID:40383940"
     CDS             complement(join(160341..164068,164068..164179))
                     /locus_tag="C5L36_0C00880"
                     /artificial_location="low-quality sequence region"
                     /note="PKUD0C00880; similar to Saccharomyces cerevisiae
                     YIL080W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321622.1"
                     /db_xref="GeneID:40383940"
                     /translation="MEIDSIKNKNYRGRNFDSYKRNKNYNRNYNGGYAGRKPRQRKFK
                     LVRNQKVVGSDIAINPPTIENANLQLKNEIQHSTKFDKYILDNKDIENLSVSNVYMDR
                     KELPLLKVKNELFKECVALVDSGASRNFLDYEFVKSHQLENYLEPTEFEDVVAANKKT
                     ISVKGELTLELQFKLRDEWQNENIRFLVLENINHKMILGFPFVKDHGNKVDWENIEKE
                     TETPEIPDIEEQIESSDENDLEETQENELIGINSMRAVRRNLKNVDNYPLLLFVQSVE
                     EKENNNVLEEPYDGVDGIRKKIHEEFRDVVTNDQPTSLPPQRDLTHRIILIEPTKSTY
                     RRQYKLSYSEKQELNKQVDELLKQGFIKPSSSPFNSPVLFVKKKDGSMRMCVDYRLLN
                     NNTVKDKFPIPRIDELITCFGGASVFSKLDLMSGYFQVRIAENDMEKTAFSTDYGHYE
                     WVVMPFGLTNAPSTFQRMMNRILAPYLNQFVQVYLDDIIIYSKTVEEHYSHIEKILEL
                     LRRNKLIAKKKKCSFYFKTLGFLGHLISSRGIQTDPAKIDKIKSWPIPKNAKDAQSFL
                     GLAGYYRRFIKDYSKIASPIMEFANKKCVWKEPQDKAFEELKGKLINAPILVHPIWED
                     GYTFVVHTDACGTALGYVLEQLDSDGKLRGVIAYGSRKLIGSELNYSIYDREFLAVVE
                     ALKNWRYYLLNRHFVLKTDHRSLVYLKRQNAIDSHRVARWLDYLADYDFTIQYVKGPT
                     NSVADALSRYPYEEKEVGINTIESVLTPNQELLERIIKSYDEDNEIKEIYDILKENLP
                     IPKSIHNHIKHYSIEDNLLYFSVVKGGNDRRIVVSPKSKLVQEIIGNAHDGNSAGHFG
                     YFKTYMRLHPMFYWPNMLKSVKRYCQRCTVCQKTKPETTGQRGLFSPLPIPEGRWTDI
                     SLDFVTGVPRCKNGHDMILVVVDRFTKMAHFIPTRKTATAEQCAKLMVDNCFKLHGIP
                     KRMVSDKDIRFMNKFWFTVYKIFGTSLLFSTTNHPQTDGQTERTNRILNQLLRNYASN
                     DLYSWDKWLSMAEFAYNSSHQVSIGSSPFEVCYGYLPDSPMFISSSRVSSRRYSNKAE
                     EFALEMKVIMENVKENMIEAQRSQETQHNKSRVYETFEVGDWILLHKDAYGSDRLYYK
                     IQPVYYGPYKVVKKISDNAYEVDLPKTNKKDRVINVRWLRRFLQTDKQFPKVPPRTIA
                     EARSRLTEIIGIAGIDETNDTLDVYWKDCDPCHSSSIPFSLFLEIPEDLQRTLWDNAK
                     AIDKDNKLRDEVSKAAE"
     gene            <166057..>169449
                     /locus_tag="C5L36_0C00890"
                     /db_xref="GeneID:40383941"
     mRNA            <166057..>169449
                     /locus_tag="C5L36_0C00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465763.1"
                     /db_xref="GeneID:40383941"
     CDS             166057..169449
                     /locus_tag="C5L36_0C00890"
                     /inference="similar to AA sequence:RefSeq:NP_012724.1"
                     /note="PKUD0C00890; similar to Saccharomyces cerevisiae
                     YKL197C (PEX1); ancestral locus Anc_1.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321623.1"
                     /db_xref="GeneID:40383941"
                     /translation="MSMDIEAKISCKQLNSCMVSLPSSFIYPILNTINLLVQQVIIHI
                     SDPKTRKHIASVGWNGNVTQDVETIEIDVDYARILKITEGSFVHIEIDMGVFKQTLNG
                     SSSVAETIEIEPLTTSDWELTEIHAQAIEMNFLSQVRCVRREQLLLIRANPTASGYSP
                     SEAVLFKVVKIKMKGREVDFSIIGNDSELHIIPKPYIVEKASNTSDSPPVGKRMPAPA
                     RGKPAKYSSIIRRSIVYNAGSGITIYSRGSALVPFKDEEFLQVSVIEGPGTPQRATKT
                     TTKELEMGLTSNSFGRPIIAKCIRLDNEDEEEEGELCCTHNLSVLLSPLLAVALGLEN
                     TTGEMVLLEPYIKKITRLDMDKCTFFVSKFSTTSDHIPSTSSNTKVINKSKVNELKRE
                     LGETLEQVLSITYGPGAPLTNGIKLPIIENILPEGGVLYIAQHNTKSRLNEQHYNARN
                     WTITENTVPNTLGQSKFSAKFKLKVIDDTLIPSSRIQQKHEEVSYIIHGQDDKLSRLR
                     EVLYNFVPTFLCGKSGSGKTLVCRILQQDFIGNGYFAKYIDFDHVTGYLNDEQAIEDS
                     GSLEEEDATNRENKENNQNKLIVKLFDKILKQASWHSPSLLILDNLDKILPKEVEHGD
                     NGASSQLSEILINKFEKYKGGTTVNILITAKSRDSINSVLFQNHLVDEEMILEAPNKY
                     QVSEILKGMMVRRFPNHVGPKILKRISDIASELEGYLPLDLENLLDRAFHNMISKDQI
                     VFEYENFLCAIEGYTPNSLRGVKLQKSATNWSDIGGLKEVKRILLETLEWPTKYAPIF
                     EKCSLRLRSGILLYGYPGCGKTMLASAIASQCGLNFISVKGPEVLNKYIGASEQSIRD
                     LFERAQSAKPCILFFDEFDSIAPKRGHDSTGVTDRIVNQLLTQMDGAEGLEGVYVLAA
                     TSRPDLIDSALLRPGRLDKSVICDLPDFENRLDILNTIVKTNGFHLQQGESALDQIAK
                     HTDGYTGADLQAVVYNAYLKSVHEVLEAKDSDIGESNLAGDDLSEVLSKTFTPRNQKF
                     KYNGELEKKIKTVICRSMATDDDIDNESTQGANRSIEKREIIYIKIGHLKESLEETKK
                     SISTNELKKLNRIYSQFESSKRPSEMKSGEGSTEVGVRTSLM"
     gene            complement(<169551..>171386)
                     /locus_tag="C5L36_0C00900"
                     /db_xref="GeneID:40383942"
     mRNA            complement(<169551..>171386)
                     /locus_tag="C5L36_0C00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465764.1"
                     /db_xref="GeneID:40383942"
     CDS             complement(169551..171386)
                     /locus_tag="C5L36_0C00900"
                     /note="PKUD0C00900; Pfam Domains:
                     Sugar_tr(3.1e-120)|MFS_1(6.7e-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321624.1"
                     /db_xref="GeneID:40383942"
                     /translation="MTVKTKTFSKEDKSFDVENGQLGQPSTSTESWSQDQKISTNTPL
                     LPQLEENHFSMTKYAMFSNIATLGLKGKILQHTITFACVVCFSLFGYDQGLMAGIITA
                     PQFVETFPAVGGVSHHTTVVQGAVTSCYELGCFFGALSAMYFGGKWGRKRMIMFGCVI
                     IIMGTFISIFPFKGHWALGHFIIARSFTGFGNGFNTATIPVYQSELSDATNRGFMVTF
                     EGCMVAVGTTTAYWIVFGLSYAKGSISWRLPLALQVVYAGLCFFLMIGLPESPRFLIT
                     KDKIEEARYVLAQLHDTSINDPDLLEEVILVRDANNRFSKRITLKEFFTPSKHQYLNR
                     VLIGSSSQFFQQFTGCNAAIYYSTVLFETTVGLSRRMALTLGGVFSSIYTCFTVLAFF
                     LIERVGRRKLFFTGAIGQGSSFIIAFGCLVHDTKENAKGAAVGLFLFICIFGFTILPL
                     PWLYPPEINSMRTRTMAASASTCTNWLSNFAVVMFTPIFINRTRWGCYLFFAAMNFIY
                     VPIIYMFYPETAGRSLEEIDIIFAKAFVEKKPAFIVAQQLPKLSNKEIEREGIELGLY
                     EDENDFSEWGYETDAITKRRPVHSRQNTQQTLRTVPASTTPAEKT"
     gene            complement(<172406..>174244)
                     /locus_tag="C5L36_0C00910"
                     /db_xref="GeneID:40383943"
     mRNA            complement(<172406..>174244)
                     /locus_tag="C5L36_0C00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465765.1"
                     /db_xref="GeneID:40383943"
     CDS             complement(172406..174244)
                     /locus_tag="C5L36_0C00910"
                     /inference="similar to AA sequence:RefSeq:NP_010825.3"
                     /note="PKUD0C00910; similar to Saccharomyces cerevisiae
                     YDR536W (STL1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321625.1"
                     /db_xref="GeneID:40383943"
                     /translation="MSNKSQSSSDEQGGSYFDDNKLDQQSNNQETPIPNEKNPDYVPL
                     LPDLEEDHFPMTKYGILSDYSTLGLRGNKLQYAITFCCVVGFSLFGYDQGLMSGIITA
                     PQFERTFPAVGGGTHHATVVQGAVTSCYELGCFFGALCAMYFGNKLGRKKLILFGCFV
                     IVIGTFISIFPFRGHWALGHFVIARSLTGFGNGFNTATIPMYQSEVSEAKNRGLLVNL
                     EGSMVAVGTFIAYWIDFGLSYANGSVSWRLPIALQIVFATVVFFFMIGLPESPRFLIT
                     KDKIEEARYVLAQLHDTSINDPDLLEEVILVRDANNRFSKGVSLKELFTPSKHQYLNR
                     LLIGSSGQFFQQFTGCNAAIYYSTVLFENTVGLSRRLSLVLGGIFATVYALFTIPSFF
                     LIERVGRRALFLTGAIGQGVSFIIAFACLVKDTKENAKGAAVGLFLFISFFAFTILPL
                     PWVYPPEINSMRTRTMATSVSTCTNWLSNFAVVMFTPIFINRTKWGCYLFFAAINLLY
                     VPIIFFFYPETAGRSLEEIDIIFAKAFVEKKPAFIVAQQLPKLSNKEIEREGIELGLY
                     EDENDFSEWGYETDAITKRRPVHSRQNTQQTLRTVPASTTTPAAEV"
     gene            <174615..>175196
                     /locus_tag="C5L36_0C00920"
                     /db_xref="GeneID:40383944"
     mRNA            <174615..>175196
                     /locus_tag="C5L36_0C00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465766.1"
                     /db_xref="GeneID:40383944"
     CDS             174615..175196
                     /locus_tag="C5L36_0C00920"
                     /note="PKUD0C00920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321626.1"
                     /db_xref="GeneID:40383944"
                     /translation="MRVGLREGSLQYCRLRNSAVTYAPRQKWEKKEKTKSRDRWSYVW
                     LTSCATAIGNSSTPGEGGGRRGREEGFFLGFPLSPISPLSPISPISPISPISPISLFY
                     FLRFSCFLGCVEDPARTIGRKSSDYYQRLVPSSIFSFSFPPRLPGFVPQVAHVSCHVF
                     PYYPRESPSSPHSCPFAMLLWGNRPAWLSPGLD"
     gene            <176379..>177503
                     /locus_tag="C5L36_0C00930"
                     /db_xref="GeneID:40383945"
     mRNA            <176379..>177503
                     /locus_tag="C5L36_0C00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465767.1"
                     /db_xref="GeneID:40383945"
     CDS             176379..177503
                     /locus_tag="C5L36_0C00930"
                     /inference="similar to AA sequence:RefSeq:NP_014051.3"
                     /note="PKUD0C00930; similar to Saccharomyces cerevisiae
                     YMR318C (ADH6)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321627.1"
                     /db_xref="GeneID:40383945"
                     /translation="MAKVNYPEEFAGFAIVDTNEWNKPKYITYKPKTFGDHDIDIEIE
                     CCGLCGSDIMTARGGEAGWGQITLPQVVGHEIIGKVIKVGPKVTLHRLGDRVGLGAQA
                     FACLDCNRCKQDNEQYCPHGVTTYDGKYPDGYVSQGGYASHVRAHEHLCFPIPEKLQS
                     IHAASLCCAGLTVFSPLKRYIPKDLPNGVKAKVAIVGLGGLGHLAVQLCKALGAEPWV
                     FSRGNSKKEQAFKLGASGFVATGEKDWEKPLFDQFDLILNCAIGLSGLNLDAFISILK
                     VDGRFCSVGLPSESEKYDVSPFTFFSNGSCLCSSALGSREEALELFELAAENNIVPWV
                     ETIPISEKGCEEALTRAWDGDVRYRFVFTEFDKAFGTGSS"
     gene            complement(<177619..>178974)
                     /locus_tag="C5L36_0C00940"
                     /db_xref="GeneID:40383946"
     mRNA            complement(<177619..>178974)
                     /locus_tag="C5L36_0C00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465768.1"
                     /db_xref="GeneID:40383946"
     CDS             complement(177619..178974)
                     /locus_tag="C5L36_0C00940"
                     /inference="similar to AA sequence:RefSeq:NP_012113.1"
                     /note="PKUD0C00940; similar to Saccharomyces cerevisiae
                     YIL153W (RRD1); ancestral locus Anc_5.709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321628.1"
                     /db_xref="GeneID:40383946"
                     /translation="MTETPMLPLFNPLDKDLSIKWKKPEKKIFSSVDIPFFQKSRAIA
                     NINGIVSLICTKVSATNVPDDALESKYVEFEKKNSHITNTNQQKNYSLPPKFVKELPL
                     GLVSQAIVQILDELKNIMSDTPPINGPKRYGNLAYSQWFKKVDLEIDRILDDTVGKLI
                     HTLNYTGFKDELRYYIMGSFGSYIRLDYGTGHELSYIAFLGCLTMIGIIDREKFTGSE
                     WLFVLAKYYDLIKALILRYTLEPAGSHGVWGLDDHFHLIYVFGACQLVNFKEIGNDKF
                     DMNEERAKILNFRMGVTPSSTTNPETLKNLRLKNLFFNAISFIKLVKTGPFNEHSPIL
                     YEISATRSWEKVARGTLRMYYGEVLSKHPVVQHFYFGGVFYPWEDLQGNELPSSGSDE
                     EDYEDGKSHIDKSDAIVATTKTGMTIRNDRKLDNNTRFHMNGHNQNRFPMGSSGASSK
                     R"
     gene            <179358..>184655
                     /locus_tag="C5L36_0C00950"
                     /db_xref="GeneID:40383947"
     mRNA            <179358..>184655
                     /locus_tag="C5L36_0C00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465769.1"
                     /db_xref="GeneID:40383947"
     CDS             179358..184655
                     /locus_tag="C5L36_0C00950"
                     /inference="similar to AA sequence:RefSeq:NP_012495.1"
                     /note="PKUD0C00950; similar to Saccharomyces cerevisiae
                     YJL039C (NUP192); ancestral locus Anc_5.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321629.1"
                     /db_xref="GeneID:40383947"
                     /translation="MGLQWSIKPFCALYDAISVDDSSLKQALINELSEDLVSLIVTKP
                     KNEVSRNKLQTGEVTFSDGSIYKLNKAFIDDSVQLSTELEIDELDAAELLYHASGGEL
                     DSLGTSYLDTAIAAFYNRRDYILQIMAFFLCSKESNNSMDEAYNSSLVSNSDGNKSIA
                     TEISNVQNFAITRILGSFKLIERELESIHEAVNRMKILGTYHENSPSMQKLTFRRNSL
                     FNEYQLLGEILLGYVNANLQKAFTMDHFIQLLDHVSLFDPQDIFALCFVPSLLCYISK
                     LDILDTATVEKLHLKLISYVDDLDKLSESPLKSFIILAFLTSFIEWCKKDQARTSRFE
                     FSTAVDKPMQLCISVGALEQLLSICADTSIIETSLYHRMKPFYDFRTFLQQHIPKYSP
                     TRIIDVDQDETSKQNGFHGQDNSTRPDVLETGKVSVCHTEAENRLGEHFINLLVLSLN
                     SFILSFISTAAFVMSQLRDAEEDFLLSSDTFDLEVLAENADLERLYMSVYYLYSERQH
                     LSSEIWADPTSATYGFLQWASRCNSPLVMATFSMLLAGLASTEDNAINVFTFLQSTNS
                     INSGLITSPKENSSLLTKYSSISWSTIYSTLLYYCDAFTKTSELTFDNLSSELGMEVK
                     DKKKIVLELGEDSIIYISGFFQVLSEVARKSSKARIELLESDNNQLFKILFKLLNLNT
                     SLDGPILSLLSSLAGDTKEERSKLWSMLDAWVFQNNRKNAFINFPVQKISQQLSSYQS
                     VCGFIDLASKLLEPLETSKDEFAPFTLPFALDFGSTLRRPGVKCYIDYFTNEVFASLD
                     STEVSCREKNQLKYSILSMMQLCLEQLDTNLVLNSSAAGIKDLDQVIEDKSVIRYFQA
                     HPASSVLLSLYNDRVYDAIFKICNVGFDRINSLHEDSAEIVIIEKSLTIIDIVLSSEK
                     FLSDELIPILRLPDNPYMDPSEVSMTGLRSFSEALLLNLPLVANFALYVGSNKLSIAL
                     KSLSIIRKLTASKAFSSNKVGSQNLMKRNSMLVMYETVDESIRIRSSFIEQMEAPISS
                     RDALDLKLSILDYIKENLVINGHEPTVSHFLLGFDTYKMGLGSTDQDTSVSSNRSLLK
                     SILNTLRDAVFLMSTSKVISFVPIRICALGMEIITTLCKSDKVGKNVLQFLRSNSSHL
                     SSKDSSNFIVFLLENFSKVHKNYVFDGKKFNGDFNVDNDFVSTGNSMCALNLFFAFRS
                     CVLELTAIELHVSMLSNLPSLCDKYVKLLTRARDLASGSFRLMDFLDVLDFSATNNIE
                     HVDALFNNLDFNYIFQKIKLSGLLSTSNEYPYDLSLVDELVSLLMKSSSRFITPLQKS
                     DSLKLFDSEKSKLKKIITCSISFDGFKSCVSNYLSSWSLLVKVIVSEIEIDVNSKLIF
                     ILDTFQHIVPKIDEFLEKETVFAKELIELCVHLLHVYNDERKNLYLDLGERSIGRLLD
                     FERLYPVFKVSLHGIISATSTSALRSDLYIMAQKVLEGTSGMTTVTGELSTLLRSLDT
                     RVFDVIRHDSLVGKGSNRLTSLLLLEEFVKAFLQSQTSYIQEEFISESFCIGNYLYSL
                     VKNLKVTDEIFCRTLDMTVDSGITLQTLVYELTAFKTSVSFLTRVAQTRIGAQKLLRS
                     DIFNVIRDCKFLQLDADLGFEIRLDDSTRFNKGSLKMKVMLDYPLGTDLSLNGTDTIN
                     MDTISYYEIFRPIFQLIVTIVITLGPQNSTCLLQATELHNHFEKLIAAILKRDIQYHE
                     YTESHGKIGKSVKGPFSERNIQNLEELTKIFTILDTLLG"
     gene            <184958..>186868
                     /locus_tag="C5L36_0C00960"
                     /db_xref="GeneID:40383948"
     mRNA            <184958..>186868
                     /locus_tag="C5L36_0C00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465770.1"
                     /db_xref="GeneID:40383948"
     CDS             184958..186868
                     /locus_tag="C5L36_0C00960"
                     /inference="similar to AA sequence:RefSeq:NP_013521.3"
                     /note="PKUD0C00960; similar to Saccharomyces cerevisiae
                     YLR417W (VPS36); ancestral locus Anc_4.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321630.1"
                     /db_xref="GeneID:40383948"
                     /translation="MSTNQLNLFRSIYFERVGVTPGGRPKLDCDEYVIRIAFSTGLYQ
                     DDFKIKGYQNGRLYLTNRRVIFIEETSESESVGINILHIDQLDYYSGFLKSSPKIVLK
                     LKHQPEVLSMKKSDRKMLSISWVCPICSFSNDFTTTLSNLDMMRSNGSSLPTCENCGI
                     SSTFELLKKSMAHKKQQETPGVVDLMTFNESECPKCTFINHPSMVQCEICGTDLPNLW
                     SNSFVDSENNPLVSKSPINLMTLEPYKSIDLNVVKISFRKGGHSEVYEDLKRIIENND
                     EHSNKIKNEANLLESKQIGNFSSFKGIHGLANKSEQQNQEASLLLSKSLQDLEQLLSK
                     AEELIDLSKKYQLLMKNMKPGGEKDINFTLLSESRKSVTKLQDIMQNDQIQKSINKTK
                     NINSLNSLKKGKSTTKVSGMPLEYIKELSRSIYDFLTDENILDKNNGLVTMFELYSLY
                     NNSRQVNLVTPEEFFGAVVKFEEIGDGLAVSKVSTVRKEYKNDADTIDGGAFIYVISK
                     KNGSKDVNRKVFLTVSSNPGIRIMEIQAHIQVNYLILKSILNALVNDGSLTIDESIEG
                     CTYWPNEILEANALNADVSTNNLSFPKCDSTMDKGEKADGLPKNSKITVTQNNNIGNS
                     EWYKELRNLDFS"
     gene            complement(<186928..>188013)
                     /locus_tag="C5L36_0C00970"
                     /db_xref="GeneID:40383949"
     mRNA            complement(<186928..>188013)
                     /locus_tag="C5L36_0C00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465771.1"
                     /db_xref="GeneID:40383949"
     CDS             complement(186928..188013)
                     /locus_tag="C5L36_0C00970"
                     /inference="similar to AA sequence:RefSeq:NP_012732.1"
                     /note="PKUD0C00970; similar to Saccharomyces cerevisiae
                     YKL189W (HYM1); ancestral locus Anc_4.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321631.1"
                     /db_xref="GeneID:40383949"
                     /translation="MAFLFKRNPKTPGDLLRLLNEQLTKLDTASVSERKKAQDDVTRH
                     LQTIKSMINGEDNILNESQSGSQTDILTQLSQEIYSTDTIYNLVANLECIEFDSRKIV
                     VLLFSYLLRRRIGNRSPTVDYLLSKPKIIVTLIKGPETPEISLNTGLMLREAIKHESI
                     AKFVLYDSLFWKYFVYIQSDSFEVSTDAFTTLRVLLTEHKSLVGSFFSNDQIVGNFIL
                     MINKLITQGNYITKRESTKLLADLIMIKLNYNLMTKYVNDVENLKIIMLLLGDRSKNI
                     QIEGFNVFKVFVANPKKEKTIIDILAKNRNKLLEFLEGFNKDRNDDLFIAEKEYISQQ
                     IQGLPKVLNSDKCNEKSNSSSFDIDHN"
     gene            complement(188228..188309)
                     /locus_tag="C5L36_0Ctrna7S"
                     /db_xref="GeneID:40385089"
     tRNA            complement(188228..188309)
                     /locus_tag="C5L36_0Ctrna7S"
                     /product="tRNA-Ser"
                     /note="PKUD0Ctrna7S; codon recognized: UCA"
                     /db_xref="GeneID:40385089"
     repeat_region   189590..203112
                     /note="IRL3"
                     /rpt_type=inverted
     gene            complement(202849..202921)
                     /locus_tag="C5L36_0Ctrna6T"
                     /db_xref="GeneID:40385084"
     tRNA            complement(202849..202921)
                     /locus_tag="C5L36_0Ctrna6T"
                     /product="tRNA-Thr"
                     /note="PKUD0Ctrna6T; codon recognized: ACU"
                     /db_xref="GeneID:40385084"
     repeat_region   complement(211181..224692)
                     /note="IRR3"
                     /rpt_type=inverted
     gene            211372..211444
                     /locus_tag="C5L36_0Ctrna7T"
                     /db_xref="GeneID:40385090"
     tRNA            211372..211444
                     /locus_tag="C5L36_0Ctrna7T"
                     /product="tRNA-Thr"
                     /note="PKUD0Ctrna7T; codon recognized: ACU"
                     /db_xref="GeneID:40385090"
     gene            complement(225659..225731)
                     /locus_tag="C5L36_0Ctrna8T"
                     /db_xref="GeneID:40385096"
     tRNA            complement(225659..225731)
                     /locus_tag="C5L36_0Ctrna8T"
                     /product="tRNA-Thr"
                     /note="PKUD0Ctrna8T; codon recognized: ACU"
                     /db_xref="GeneID:40385096"
     gene            226476..226549
                     /locus_tag="C5L36_0Ctrna4I"
                     /db_xref="GeneID:40385070"
     tRNA            226476..226549
                     /locus_tag="C5L36_0Ctrna4I"
                     /product="tRNA-Ile"
                     /note="PKUD0Ctrna4I; codon recognized: AUU"
                     /db_xref="GeneID:40385070"
     gene            226561..226633
                     /locus_tag="C5L36_0Ctrna5A"
                     /db_xref="GeneID:40385071"
     tRNA            226561..226633
                     /locus_tag="C5L36_0Ctrna5A"
                     /product="tRNA-Ala"
                     /note="PKUD0Ctrna5A; codon recognized: GCA"
                     /db_xref="GeneID:40385071"
     gene            complement(<226663..>228933)
                     /locus_tag="C5L36_0C01010"
                     /db_xref="GeneID:40383950"
     mRNA            complement(<226663..>228933)
                     /locus_tag="C5L36_0C01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465772.1"
                     /db_xref="GeneID:40383950"
     CDS             complement(226663..228933)
                     /locus_tag="C5L36_0C01010"
                     /inference="similar to AA sequence:RefSeq:NP_012403.1"
                     /note="PKUD0C01010; similar to Saccharomyces cerevisiae
                     YJL132W; ancestral locus Anc_1.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321632.1"
                     /db_xref="GeneID:40383950"
                     /translation="MWVSSQLLYALLLLVSVTFPAGVSIHSFIAVRTHLNTPSNLKNY
                     WPQYLAGSFHPDAFYNCFHSEAAEAAHWPPFIDEAIKYLQDLLPYNDHGQEYRHEYQQ
                     LEAFIYGIITHQVADISWHSLRGDQGLLKMIANVEFDGDIEKAHNYLDTAGDFIILHR
                     QFSNLSGESRNKLIKFLSTPWEYPSEHILNIYSRLGYNITPAELKFCMHRGYTALQSE
                     ISAVLSERTSKSRLSFIESPLTVSVLEGYYYGGIEQIIAVLEPCMFELKNWISNRDNN
                     DDPWNFCRPVFSRAETKDKVDLISLNGNTILLSSGIANTKFGGSIKFGHFLGEPSIAI
                     SAPYEESLGAVYLITLKEIIKEAKVSSNSLQAMKLSGDDSLSYPVRFGDKLFRWFLKE
                     YELLIVSQPGLSSFKVFLGNRIIANLQFLDAATELGSNGTKQINILSDLPHDINNDGY
                     PDIIIGSMYSDSVGFQSGKVYALDGQLLYKRIKTFIDYKGLGLPPTIDINSLLIIEYK
                     LPQFLEQLSAFEQFGTSFTATNDYAIIGINSIGGVVIFEKSTGKYVNILTYNDLFVDL
                     ESAITEFSYLPSRETSMFAYHKILSGSIDGKEWLLISAAGFNFETTLSGIAYLYEVKK
                     NRIKLITKLSPYDMNHSSFFDSQHIAEMFSSNMHKLSESLVVISSNGYKDGCGGLYLA
                     DISQFLRETKKTVVVEQLYEGHKDIGFTNFASTSMEFFSFEGKNYLALSLSDYFYAPA
                     NDETNLTSGSVLIIAI"
     gene            <229198..>230484
                     /locus_tag="C5L36_0C01020"
                     /db_xref="GeneID:40383951"
     mRNA            <229198..>230484
                     /locus_tag="C5L36_0C01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465773.1"
                     /db_xref="GeneID:40383951"
     CDS             229198..230484
                     /locus_tag="C5L36_0C01020"
                     /inference="similar to AA sequence:RefSeq:NP_012977.3"
                     /note="PKUD0C01020; similar to Saccharomyces cerevisiae
                     YKR051W; ancestral locus Anc_1.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321633.1"
                     /db_xref="GeneID:40383951"
                     /translation="MNWERWVYGVCGISTLISIAVSFVGIWLQLKNYRKPFEQRLIVR
                     ILALVPIFAISCYCMLTKPSIGHVIEPIREIYEAFVIYMFYKLLVLMLGGERRIILNT
                     VNKPAIKLGILEVNISDPRHFLMIKRCILQYVWMKPLLLCGIFIGTKLGIYDANDISV
                     HSLFLWIGIFYNLSVTVSLYSIALFWRCLYEELAVFDPWRKFLCVKLIIFASYWQGIF
                     IGIGNWLTGSNGEFGGRIQNALLCVEMLFFARLHWVSFPYTDYLKIPDAARMPTLMAM
                     KDWISIGDLVHDLKVSFGYGVHDTYTLRNFDARDESTDSGTFNQKVYQGLRVQGDGRR
                     YWLDDDPSHSVNTPLYVRDIEELGYGSLDESDDFGKDEKLYSYVKSHYISEAEINYPV
                     VYEYDMVDHSTRIRKLRNSLRDNQQRRGCEGEISIS"
     gene            <230524..>230856
                     /locus_tag="C5L36_0C01030"
                     /db_xref="GeneID:40383952"
     mRNA            <230524..>230856
                     /locus_tag="C5L36_0C01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465774.1"
                     /db_xref="GeneID:40383952"
     CDS             230524..230856
                     /locus_tag="C5L36_0C01030"
                     /inference="similar to AA sequence:RefSeq:NP_013205.1"
                     /note="PKUD0C01030; similar to Saccharomyces cerevisiae
                     YLR104W (LCL2); ancestral locus Anc_8.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321634.1"
                     /db_xref="GeneID:40383952"
                     /translation="MVFFFNKGCKHMRLFTILALLGTTEAFFEQFFQGGEGFGRQRQQ
                     PQQRESSHEERFLNKECKGYLCPDTQACVKKPMDCPCPFPNSQKKCIVGNSYLCISKG
                     SRDCSELI"
     gene            complement(<230963..>232051)
                     /locus_tag="C5L36_0C01040"
                     /db_xref="GeneID:40383953"
     mRNA            complement(<230963..>232051)
                     /locus_tag="C5L36_0C01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465775.1"
                     /db_xref="GeneID:40383953"
     CDS             complement(230963..232051)
                     /locus_tag="C5L36_0C01040"
                     /inference="similar to AA sequence:RefSeq:NP_013206.1"
                     /note="PKUD0C01040; similar to Saccharomyces cerevisiae
                     YLR105C (SEN2); ancestral locus Anc_8.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321635.1"
                     /db_xref="GeneID:40383953"
                     /translation="MSKSKREYNNTHYPRPLPVPIPLLHISNKYYTPWEVLQSVGDTL
                     SHLRHWWPSSTPVTVLYDKNDLSFKVYSPEQMKFIWANGFYGKGILSRSEPTWLHRME
                     NRLKSKHTNDVSYSEEVTSQRRQLRDAWKKQRQEYLSLEKSLKLNAVNGELSNSEKIL
                     LDKERDKLTQLKDSINKPVQKSGNLKPIWRMEDFELIDGNGIKDLEYLQLDPVEVLFL
                     LLLQTIEIPNYDFHSLFLELVEEYGDSIITNFVVYYHYKSLGWCVKPGLKFSCDWVLY
                     SRGPPFSHAEFSIKVVNDDEEDTLIDYSAISRVVSGVKKSLVLCFVDQVHNGWKEYRD
                     TKDIWKFLSNWRINEVVWKRWAPSRTRM"
     gene            complement(<233561..>234412)
                     /locus_tag="C5L36_0C01050"
                     /db_xref="GeneID:40383954"
     mRNA            complement(<233561..>234412)
                     /locus_tag="C5L36_0C01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465776.1"
                     /db_xref="GeneID:40383954"
     CDS             complement(233561..234412)
                     /locus_tag="C5L36_0C01050"
                     /note="PKUD0C01050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321636.1"
                     /db_xref="GeneID:40383954"
                     /translation="MQFPITHLFFFILLASSLPVQLLERRAVEYVTADPVTVTNQIEV
                     APEGYRTVTTVVSGSTGTFLQQVITSTRQTSTEATTTVNTSTSTGMTTSTTTAGSTSS
                     TETTPSSTSSTEVSTTPTTSTSTSTSTSATEVSTTPTTSSTSSSSTEATTESTSDSTQ
                     SPSTSSSETTLNTPTTTPSTTPQTTPTDATPSPATTATTPQTTSSSSSSSSATSSTST
                     TTSTSTTTPKPTYFPYTTAVAAGTCYVLEAEDTSVVDTPYTTITITSTVATVTVTDVS
                     GLKLATN"
     gene            <235225..>236016
                     /locus_tag="C5L36_0C01060"
                     /db_xref="GeneID:40383955"
     mRNA            <235225..>236016
                     /locus_tag="C5L36_0C01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465777.1"
                     /db_xref="GeneID:40383955"
     CDS             235225..236016
                     /locus_tag="C5L36_0C01060"
                     /inference="similar to AA sequence:RefSeq:NP_010915.1"
                     /note="PKUD0C01060; similar to Saccharomyces cerevisiae
                     YEL001C (IRC22); ancestral locus Anc_7.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321637.1"
                     /db_xref="GeneID:40383955"
                     /translation="MRLSLLAPLLALASAVFAEEPVANAADAVVDGVAEDVEIVTDPN
                     FVPTPEKPFNFRIDYNVAFKEDPNGNIEDFVNGETVELLFEFHSLEPAPVTIVGVGGQ
                     LLDPVTGEVKANITASQLGPIEVANNQNANFTQRVGINMEAADYLLVPAIYVVYQDQF
                     MMLGSKNKIVTVVEPSISIFNPQLIMSELILLVSFAGIVYALFNVFGAQYLNGILPES
                     LLPKDKKKKAKKAKKDSPVEASATSVESWLPEQHRKLTKKGKKKL"
     gene            <236306..>236635
                     /locus_tag="C5L36_0C01070"
                     /db_xref="GeneID:40383956"
     mRNA            <236306..>236635
                     /locus_tag="C5L36_0C01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465778.1"
                     /db_xref="GeneID:40383956"
     CDS             236306..236635
                     /locus_tag="C5L36_0C01070"
                     /inference="similar to AA sequence:RefSeq:NP_012259.3"
                     /note="PKUD0C01070; similar to Saccharomyces cerevisiae
                     YIL007C (NAS2); ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321638.1"
                     /db_xref="GeneID:40383956"
                     /translation="MSLTNSLPETTYTFEVTSRAQLNALPFEELSKHRSEIDADLAVL
                     FDHLQNKLHANMDTELLTLDGFPRADIDVVQIRLCRAKIIKLQNDYKWISETLLEKMQ
                     QQLQQNA"
     gene            complement(<236702..>237043)
                     /locus_tag="C5L36_0C01080"
                     /db_xref="GeneID:40383957"
     mRNA            complement(<236702..>237043)
                     /locus_tag="C5L36_0C01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465779.1"
                     /db_xref="GeneID:40383957"
     CDS             complement(236702..237043)
                     /locus_tag="C5L36_0C01080"
                     /inference="similar to AA sequence:RefSeq:NP_012258.3"
                     /note="PKUD0C01080; similar to Saccharomyces cerevisiae
                     YIL008W (URM1); ancestral locus Anc_7.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321639.1"
                     /db_xref="GeneID:40383957"
                     /translation="MPRAEQQACKGNMGTVSVKVELLGGMDQVFHSDKTLKLKVSSPS
                     NEVTVKDLIDHMAGLIDNPRDLDMFIQEETVRPGILVLINDTDWELEDKEEYILEDGD
                     LVSFTSTLHGG"
     gene            <237306..>239054
                     /locus_tag="C5L36_0C01090"
                     /db_xref="GeneID:40383958"
     mRNA            <237306..>239054
                     /locus_tag="C5L36_0C01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465780.1"
                     /db_xref="GeneID:40383958"
     CDS             237306..239054
                     /locus_tag="C5L36_0C01090"
                     /note="PKUD0C01090; Pfam Domains:
                     HMGL-like(2.3e-105)|LeuA_dimer(9.6e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321640.1"
                     /db_xref="GeneID:40383958"
                     /translation="MPMLKDPSIKYKPFDPKLTLNDRQWPSKTLTKPPRWLSTDLRDG
                     NQSLPDPMSIPEKKAYFTKLVEIGFKEIEVAFPSASQIDFDFTKWCVENAPSDVSIQV
                     LSPCRPDLIKRTIESLKGAKRATVHIYLATSDCFRTVVFNMTPDETLAKAVECTSLVR
                     SLTKDNHELENTDWDFEFSPETFSDTSPGFALKVCEVVKEAWGPTTEKPIIFNLPATV
                     EMSTPNVYADQIEYFSRNISNRETVCISLHPHNDRGCAVAAAELAQLAGADRVEGCLF
                     GNGERTGNVDLVTLALNLYTQGIHPNIDFSDLSSVIEIVEKCNKIPIHPRAPYGGQLV
                     VCAFSGSHQDAIKKGFKKYEEQVTQTGDITWKIPYLPLDPQDIGRTYEAIIRVNSQSG
                     KGGASWIILRNLELDLPRGLQIDFSKHVQLESEWRGRELKTKEIIDLFKDKYFVYDEN
                     DANDTETTAMLDYLKLTNYTVTNSEKTRDIIAHISSKSKELEIKGSGNGPISALANAF
                     SNYFGINIDVIHYNEHTLGKDSQSKAVGYIGIRAGDNESIIWGVGINEDVTEAGMIAI
                     VNTINVCIRDKIIKLK"
     gene            <239536..>243288
                     /locus_tag="C5L36_0C01100"
                     /db_xref="GeneID:40383959"
     mRNA            <239536..>243288
                     /locus_tag="C5L36_0C01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465781.1"
                     /db_xref="GeneID:40383959"
     CDS             239536..243288
                     /locus_tag="C5L36_0C01100"
                     /inference="similar to AA sequence:RefSeq:NP_012264.3"
                     /note="PKUD0C01100; similar to Saccharomyces cerevisiae
                     YIL002C (INP51); ancestral locus Anc_7.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321641.1"
                     /db_xref="GeneID:40383959"
                     /translation="MPWCSKENLSVVVNIFLQHYEVIKKNLLLIKLLFLALWFINAYI
                     KPSSFSDVRFLFSLENSSQHLGEVTQISMDVYFNDQSHTMVIVSNNYALVLIDNMNFE
                     NYPAISSSSQSSSNIPKCIIEFIPKEAVPLQSFRKIQSGVHGCLGLVCLKNVMYVGFI
                     SGRRKLGPIIPDVYVNQLISTVFINFQGEVSSLYSQSAHGQLTLYQSDEGYENTEASP
                     LTSRITSIMKLLQTGTFYYSNDTDLAVKAQDWGIVNKKGYTYTTINNLIDDYAGRFVW
                     NSNLINELSIFRRRLSNEEQIAFDEGRFCTTLIRGYVDRQNFGENGDKWMTIISRQDS
                     RKEGHIFGPSCMDDDGNVSNFAETEVMVYTGEYLVSFIILKGNVPLFWKLDSHLISTK
                     IEFPRSLDGTKHAFNRFFETLCLEYNMIYVLDALSTKGSQPELSSRFMSAITELQHER
                     KDLLVTYKKLEHIGSLSSRLKGKNEYLGLLLQDTHIHEALDDYSAFRFSLLDWNVTDT
                     QSGVFLISTLDSNERSNVIECKISEMILEKMFGSGFNAEILLKHNALWEANGNALRKL
                     SDSYNNSIKTKNKTGGIMGKMAEQGLKYAGHGKKYVSNAGNSHLSSSSGNKMGKQDQF
                     DKLLGRKSKEIQVELIDPIHDYVLHGLAERRKEFTSFKDLRIYALTYNINGVLYNGDL
                     TDLVFPEKETYDEYDLIAIALEEVIELSPKKTLTIDMRTRTFWEKRFKETLNSQKNGK
                     DYTLLRGEQLGGVLLLIYASTSTIDNIKNVETSVKKTGFKGISANKGGVAITFTFSTH
                     SRLCFVASHLAAGQSNSKERHHDYKTLANGLTFKKCRSIRDADILIWMGDLNYRVSLP
                     NSTVRKLLGYQAPSFPMKNRSSESISSYESYYSSLEEEEDDKEEEDESFIGDITAGLL
                     GHDKLVQSEETKMEAENEARLKDEIFERERDANMINKELENNSSSGCHIIVDNSENSS
                     LHNSTSNTIKESDTSQVHDVSTIDNNGILRPPARLPVAFSRSEEKVNMLTPQLTVTEA
                     NEEEEGKEGKAITQLLEFDQLNFQMANGQSFPFFDEMEIKFKPTYKYDKGTDTFDSSE
                     KQRVPSWTDRILSFTKNKRVTTLEQLRYNSIPQYVFSDHKPVYAIFSTRLEIVDEVIK
                     SKVEKELYDITKQKFYANDKNGSVLSPSFINSLYAESKYSTTKQGLPPPSTKALRWWI
                     NNSDSSNTAKVKINFSELDSGEYLINPNLPKNPFLITDEEWFIKAD"
     gene            complement(243400..243481)
                     /locus_tag="C5L36_0Ctrna8S"
                     /db_xref="GeneID:40385095"
     tRNA            complement(243400..243481)
                     /locus_tag="C5L36_0Ctrna8S"
                     /product="tRNA-Ser"
                     /note="PKUD0Ctrna8S; codon recognized: UCU"
                     /db_xref="GeneID:40385095"
     gene            complement(<251179..>252756)
                     /locus_tag="C5L36_0C01130"
                     /db_xref="GeneID:40383960"
     mRNA            complement(<251179..>252756)
                     /locus_tag="C5L36_0C01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465782.1"
                     /db_xref="GeneID:40383960"
     CDS             complement(251179..252756)
                     /locus_tag="C5L36_0C01130"
                     /inference="similar to AA sequence:RefSeq:NP_013045.1"
                     /note="PKUD0C01130; similar to Saccharomyces cerevisiae
                     YLL055W (YCT1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321642.1"
                     /db_xref="GeneID:40383960"
                     /translation="MSESGSVEKKKEEITIHHSAGSDPNVLRISSRDADVTLAFLEKY
                     DADVPEITPEEEKKLSRKVVAIILFLTAFTDLLLYADKATLSYSSIFGLWEDTHLDQN
                     KYNNSSTLFYVGYIIGQINLILVQKLPIGRLMTFTAFAWSMIIFLHCAAYNYQGIYAL
                     RFFLGFVESIALPILNTTMGQFLTAHEKAATAPMFYSTCVGVTIPVGFIAYGILHAQS
                     SVPTWKLFMIIIGGCTFLWTIVLLFIYPNNPTDAKFLSLKEKVWVIRRVQKTTGSSIE
                     QKIIKKYQVREALLDPISWLFFLFFLLQQLANNLPYQQNLLFEGIGRISNLDSTLVSV
                     ASGGFAAACCFVATTFLFYKPNYTAFSVFVWTMPSLAGSIAVASLPWDKKIALLAMLC
                     LASPLFGIPWILMFSWNTTSCSGYTKKITRNAMVMVAYAVANIISPQIWRAKDGPRYI
                     PAWIVQIVLSFSIAPSLALIIWFILNKRNKQRKLTLQEEGEKKGFVSDGSDGEIEVDI
                     AVLDLTDLENTNFIYPL"
     gene            <253769..>254320
                     /locus_tag="C5L36_0C01140"
                     /db_xref="GeneID:40383961"
     mRNA            <253769..>254320
                     /locus_tag="C5L36_0C01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465783.1"
                     /db_xref="GeneID:40383961"
     CDS             253769..254320
                     /locus_tag="C5L36_0C01140"
                     /inference="similar to AA sequence:RefSeq:NP_013210.1"
                     /note="PKUD0C01140; similar to Saccharomyces cerevisiae
                     YLR109W (AHP1); ancestral locus Anc_8.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321643.1"
                     /db_xref="GeneID:40383961"
                     /translation="MTVEKGSTLPSKPLYHLSPKAVGGSASAPEKVDVTKLEHPLLTL
                     VVPGAFTPACTEKHMPPYLTKEAIDSLKKSGIKQVVVISVDSPFITRAWSEDLTQDNP
                     EVKKFVEDGYIKFLSDAGAEWLNEAGLDMEANDPFVKDGIRGSRSAILTDGKGKVVYV
                     GVDSNPVNVDNSSFEAVLLELSN"
     gene            complement(<254708..>255388)
                     /locus_tag="C5L36_0C01150"
                     /db_xref="GeneID:40383962"
     mRNA            complement(<254708..>255388)
                     /locus_tag="C5L36_0C01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465784.1"
                     /db_xref="GeneID:40383962"
     CDS             complement(254708..255388)
                     /locus_tag="C5L36_0C01150"
                     /note="PKUD0C01150; Pfam Domains: Oxidored_FMN(4.3e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321644.1"
                     /db_xref="GeneID:40383962"
                     /translation="MLVLILLNFMLHICTLWNNSSIQPPIRELINVAVQLKNKARSVL
                     KIIDSFIQAIGAFKLALRQSPYATSEGAKDRSAEINPIVTTGYMLSKMERRARQGKRL
                     AYLSMTEPRVDGDKNADVVGTKTYFSWLTLIWNGTITKAGECFSGNRHETLQKIVNGD
                     DRTLIGISRYFTSNPDLVNRLKNSCPVTPCDRSTFFTNDNKRHLNFSKFGDGEDHSGD
                     YVQPTALV"
     gene            complement(<257259..>257864)
                     /locus_tag="C5L36_0C01160"
                     /db_xref="GeneID:40383963"
     mRNA            complement(<257259..>257864)
                     /locus_tag="C5L36_0C01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465785.1"
                     /db_xref="GeneID:40383963"
     CDS             complement(257259..257864)
                     /locus_tag="C5L36_0C01160"
                     /note="PKUD0C01160; Pfam Domains: Flavodoxin_1(7e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321645.1"
                     /db_xref="GeneID:40383963"
                     /translation="MPKQINIVIYSLYHHISKMAESAKIGIEAAGHKCEIYQVRETLP
                     EDLVKKLGSPGKLPYKEADISTLTTADGLMFGIPTRFGNMPAQLKSYIDSTGGLWANG
                     TLRNKPFGIFVSTGTGGGNESTAMNALSTFVHHSMIYVPLGFASAGHLLSNLNEVHGG
                     SPWGADTIAGADGSREPTPLELEVARIQGEEFAKIAAKIAT"
     gene            <258460..>259689
                     /locus_tag="C5L36_0C01170"
                     /db_xref="GeneID:40383964"
     mRNA            <258460..>259689
                     /locus_tag="C5L36_0C01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465786.1"
                     /db_xref="GeneID:40383964"
     CDS             258460..259689
                     /locus_tag="C5L36_0C01170"
                     /note="PKUD0C01170; Pfam Domains: HMGL-like(5.8e-108)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321646.1"
                     /db_xref="GeneID:40383964"
                     /translation="MSSTHNPYAPNPSDFISNVPRFEIIDSTLREGEQFANAFFTLEN
                     KIRIAKALDDFGVDYIEVTSPVASDQAREEVETLCKLGLKNSKILTHIRCHMHDAKVA
                     VETGVDGVNVFIGTSNFLRQHSHGKDMSFITKAAIEVIEFVKSKGLEIRFSTEDSFRS
                     DIVDLLNIYTTVDKIGVNRIGIADTVGGANPRQVYELIRTIKSSVKAEIETHFHNDTG
                     CAIANAYTALEAGAKYIDTCVLGIGERNGIVPLGGFMARMVVSAPDYVKSKYKLTKIR
                     ELENLVADIVSVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPQDFGLTRYI
                     HFANRLTGWNAIKARVEQLNLDLTDDQIKTVTAQIKQMGDIRPLGIEDVDSIIKEFHA
                     KENDTVEVPGAKRQRTD"
     gene            <260175..>261123
                     /locus_tag="C5L36_0C01180"
                     /db_xref="GeneID:40383965"
     mRNA            join(<260175..260181,260561..>261123)
                     /locus_tag="C5L36_0C01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465787.1"
                     /db_xref="GeneID:40383965"
     CDS             join(260175..260181,260561..261123)
                     /locus_tag="C5L36_0C01180"
                     /inference="similar to AA sequence:RefSeq:NP_009748.3"
                     /note="PKUD0C01180; similar to Saccharomyces cerevisiae
                     YBR189W (RPS9B) and YPL081W (RPS9A); ancestral locus
                     Anc_8.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321647.1"
                     /db_xref="GeneID:40383965"
                     /translation="MPRAPRNHSKTYSVPKRPFETARLDAELKLAGEYGLKNKREIYR
                     IGYQLSKLRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGILSEDKMKLDYVLSLKIE
                     DFLERRLQTQVFKLGLAKSVHHARVLITQRHIAVGKQIVSIPSFMVRLDSQKHIDFAP
                     TSPYGGGRPGRNKRKSQASAASGDAEDEE"
     gene            complement(<261389..>262468)
                     /locus_tag="C5L36_0C01190"
                     /db_xref="GeneID:40383966"
     mRNA            complement(<261389..>262468)
                     /locus_tag="C5L36_0C01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465788.1"
                     /db_xref="GeneID:40383966"
     CDS             complement(261389..262468)
                     /locus_tag="C5L36_0C01190"
                     /inference="similar to AA sequence:RefSeq:NP_009751.1"
                     /note="PKUD0C01190; similar to Saccharomyces cerevisiae
                     YBR192W (RIM2); ancestral locus Anc_8.552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321648.1"
                     /db_xref="GeneID:40383966"
                     /translation="MSKKPGIDKIISLENEIDKASPYLGSDEKSSTQREAYNVKTVKQ
                     EIAVKPWVHFVAGGLGGMCGAIFTCPFDVVKTRLQSSVYQELYKSKAIKPSVLTHFKE
                     TCNILGNIYRIEGPRALFKGLVPSLVGVIPARSINFFTYGYSKDLLREYYFNGQETSL
                     LHLLSGITAGFVTSTATNPIWLIKTRLQLDRATTKQYKGSIDCIRKVVKNEGFFSLYK
                     GLSASYLGSAESTLQWVLYEQMKAMINYRSQRLEKEGHVRTNLDVSIDWFARSGAAGF
                     AKLIASLLTYPHEVVRTRLRQAPLTENGKAKYTGLIQCFRLVIKEEGLASMYGGLTPH
                     LMRTVPNSMIMFGTWEIFTLLLSKF"
     gene            complement(<262711..>263518)
                     /locus_tag="C5L36_0C01200"
                     /db_xref="GeneID:40383967"
     mRNA            complement(join(<262711..263173,263508..>263518))
                     /locus_tag="C5L36_0C01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465789.1"
                     /db_xref="GeneID:40383967"
     CDS             complement(join(262711..263173,263508..263518))
                     /locus_tag="C5L36_0C01200"
                     /inference="similar to AA sequence:RefSeq:NP_009750.1"
                     /note="PKUD0C01200; similar to Saccharomyces cerevisiae
                     YBR191W (RPL21A) and YPL079W (RPL21B); ancestral locus
                     Anc_8.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321649.1"
                     /db_xref="GeneID:40383967"
                     /translation="MGKSHGLRSRTRYAFSRDFKKHGAPNMSTYLKTYKVGDIVDIKV
                     NGAIHDGMPFKFYHGKTGIVFNVTKSAVGVIVNKVVGHRYIEKRLNIKIEHVKHSKCR
                     QEFLNRVKENSAKRAAAKESGEKVQLKRQPAGPRSSRVVTGVPTTLAPVAYETYI"
     gene            complement(<263882..>264490)
                     /locus_tag="C5L36_0C01210"
                     /db_xref="GeneID:40383968"
     mRNA            complement(<263882..>264490)
                     /locus_tag="C5L36_0C01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465790.1"
                     /db_xref="GeneID:40383968"
     CDS             complement(263882..264490)
                     /locus_tag="C5L36_0C01210"
                     /inference="similar to AA sequence:RefSeq:NP_009752.3"
                     /note="PKUD0C01210; similar to Saccharomyces cerevisiae
                     YBR193C (MED8); ancestral locus Anc_8.551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321650.1"
                     /db_xref="GeneID:40383968"
                     /translation="MTSLPPLDHSATPADTLEQIRPRLLQLTQSLTKLEHHLQNPKVD
                     PTTLQNQYNVALQQLSSVTKTINQHQSILETTVVYPNREFNTLSPLLFTLLRKKLTPE
                     VEAWIADAQRQSDSPPNTATSTEAIAEPSLHAFDNFVSDLIDHANESIDHYLFGGYLT
                     KEEVESGINVKDVLPESIEDVKPMDENKILGFIYQGLDSKTV"
     gene            complement(<264848..>265522)
                     /locus_tag="C5L36_0C01220"
                     /db_xref="GeneID:40383969"
     mRNA            complement(<264848..>265522)
                     /locus_tag="C5L36_0C01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465791.1"
                     /db_xref="GeneID:40383969"
     CDS             complement(264848..265522)
                     /locus_tag="C5L36_0C01220"
                     /inference="similar to AA sequence:RefSeq:NP_015247.1"
                     /note="PKUD0C01220; similar to Saccharomyces cerevisiae
                     YPL078C (ATP4); ancestral locus Anc_8.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321651.1"
                     /db_xref="GeneID:40383969"
                     /translation="MLARSVRSVRPSHIRLATRAFSTPVEPKEKANSIIDALPGNSIL
                     SKTGILATSAAASVYAISSELYVVNDETILLATFLGFMGLVAKVVAPMYGEFARDRTA
                     HVTKLLNEARLGHVTAVKDRIDQVSNLKDVVSTTKALFEMSKETAALEAESFELKQRV
                     NVAAEAKSVLESWARYEAQVRQLEQQQLSSTVISKVQSELKDPKFQEKILAQAVADVE
                     KLFAKN"
     gene            complement(<266220..>266693)
                     /locus_tag="C5L36_0C01230"
                     /db_xref="GeneID:40383970"
     mRNA            complement(<266220..>266693)
                     /locus_tag="C5L36_0C01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465792.1"
                     /db_xref="GeneID:40383970"
     CDS             complement(266220..266693)
                     /locus_tag="C5L36_0C01230"
                     /inference="similar to AA sequence:RefSeq:NP_013271.1"
                     /note="PKUD0C01230; similar to Saccharomyces cerevisiae
                     YLR170C (APS1); ancestral locus Anc_1.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321652.1"
                     /db_xref="GeneID:40383970"
                     /translation="MIKYILLLSKQGKVRLVKWYLQVPEQVRQRTIREIGAVVPLRKS
                     KMCNVIEHGDGKVVYRRYASLYFVAGVDADENELSILDFMQRYVESLDALYGNVCELD
                     IVFNSALAYAALDECVIGGHISESGGHEVVSRVRSALRLEEMERDGSGQMKGLKV"
     gene            <266984..>267907
                     /locus_tag="C5L36_0C01240"
                     /db_xref="GeneID:40383971"
     mRNA            <266984..>267907
                     /locus_tag="C5L36_0C01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465793.1"
                     /db_xref="GeneID:40383971"
     CDS             266984..267907
                     /locus_tag="C5L36_0C01240"
                     /note="PKUD0C01240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321653.1"
                     /db_xref="GeneID:40383971"
                     /translation="MRRMDGKAKKLQRLKSQLYISDNSDLEDLETLEVDQGRHTRKRE
                     RIDYNENKRVRREERKSPSHHEDQFREKVRSGREKDRERTRETDGGIKGEDFKEPVIE
                     GNIDIGFVKRIVDYDLNKKMSVLGDEREHSIQQHSEGSGHTEKNTEAINDEIKKVYFE
                     LAQDVVDKKERDISRTVNRIDREVAKVKDAYEKGESVVPTLYPAVFNRSFKEMESEIQ
                     NEEMKRNYRLRMLEEQHQARKDIIKRRYENSVTENRSSIVRYLRHRIEELDDEIERKT
                     TGMDLETFLSLVEYGETKRRVSHVVDELRNE"
     gene            <268194..>269519
                     /locus_tag="C5L36_0C01250"
                     /db_xref="GeneID:40383972"
     mRNA            <268194..>269519
                     /locus_tag="C5L36_0C01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465794.1"
                     /db_xref="GeneID:40383972"
     CDS             268194..269519
                     /locus_tag="C5L36_0C01250"
                     /inference="similar to AA sequence:RefSeq:NP_010617.1"
                     /note="PKUD0C01250; similar to Saccharomyces cerevisiae
                     YDR330W (UBX5); ancestral locus Anc_5.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321654.1"
                     /db_xref="GeneID:40383972"
                     /translation="MDDHIALFMDITSATDANVAAQFLDMAGGNLDTAVGLYFEHGAG
                     SVAGAATTEATSNNEDEDGDAALASRLQQEMYEEPVRQPIEPTYDTLVPQDYGYGMGT
                     GTGIGMGPGYVPQGGMFGRQQSSVFNQTGRDVVVLDSDSEDEEMSGMSATQKRLASIF
                     RPPWDIIDKIDFQTAKDKGRQLKKWILINIQDVTDFRCQCLNRDFWSSQQIKQLVSAN
                     FVFLQYQHDSPSGEMYRNLYPFHDEYPHIAILDPITGERMMTWNANPPVHRFIEQVVD
                     FLDQYKLDGSAPFVAPTSQGLNKNHAVPISDEEDEDIQEHENDMDEKSYGNVEPSAEE
                     VSEQEGEISVASVIKSLPAKDIEDPSGESTRIQIRSGIDGKRVVKKLALDTTIRQLFQ
                     FVKFAFQESLNGQPFTLKMQRVDLSESLDITVSEAKLQNASILLELIDE"
     gene            <269919..>273611
                     /locus_tag="C5L36_0C01260"
                     /db_xref="GeneID:40383973"
     mRNA            <269919..>273611
                     /locus_tag="C5L36_0C01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465795.1"
                     /db_xref="GeneID:40383973"
     CDS             269919..273611
                     /locus_tag="C5L36_0C01260"
                     /inference="similar to AA sequence:RefSeq:NP_009506.1"
                     /note="PKUD0C01260; similar to Saccharomyces cerevisiae
                     YBL047C (EDE1); ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321655.1"
                     /db_xref="GeneID:40383973"
                     /translation="MISGGVAKPLLEASGLPLATLGEIWNIADADNTGFLNQYSFCVA
                     MRLIGHAQNGEVIDDHIANKVAPLAKFGTIQSNATGGSAQFQTQPQAQRIPSANSVTS
                     YASTASNSSAVVPLLSPIQAANFGAMFDKTASNGVLPGEQAKNIFLKARLPISVLEQI
                     WNLVDQNENGQLTRPQFIVAMHLIQCFMNKSLGVLPAVLSDQLWKVAEGTSGTPNSGV
                     GGIPVSGRVSLSPVQAQTSGSATPSATTNLNTWIMSSQQKKQYGAIFDTLDTKKDSFI
                     SSSTVANFLMTSKLPNQVLANIWELANLDQSDNFNKQEFSIAMYLVQKKLAGYELPDD
                     TPAELIQSSALEEPAPLAGPNQPVPPPQSFAAARDQAAPQRTASHMDDLLGIFNTAQV
                     VAPAPAPAPAPATSSHSHGPPPPLPASRLSTHLTGSNWAPTSDFGKNLQKQTLNEEES
                     SDDDDGPENLDLPRVRGAPPAIPGRSNKPHFDSPGPGTDVGGFSNSSNYDAIKSVSPT
                     ANNIFTNSALTQAASSSLAAASTVAAGALGSALGGFSNSTPIQKSAVPSYDNSGRAIT
                     EQITQASVDIANYSNQVNSLSKQTSVVNAKKEKAQQELNKILKSKEDLLNKLNQLKAL
                     HEKETEQVVEVQNLLIQSKEENDQLANQVSVAEAQYHAEQTKKEQLQEQYNEAQKANQ
                     AYKERLGTLNAESTDLKQQLVELENRAKQTSNMLAVSEQQVVAQEVQNEELRQRVADV
                     NSHIFQVESKHKLLLEKLESLENENAQLHDNHAEKSIESANKNIEYSNAFSDAISKGV
                     VVDDELTQVNNDEEVPTASLDEFDDGFTGLKPAKVEKSTTPTENNVEPSDTSSSVMSM
                     SKQTNTTSPTQMDSDLDDVDHQIEGQAEDISLPYPIAHSETSSTQNNPSQSVRDDAEV
                     EPENDSTSTIEETGPLSSQILPEGSNQEPSANEESPESFEMINHPYKHADSGEDNIIP
                     HSASPVTAQDERSIHTETETIEEPQQAKSTHQEKDEFPPIQELQPLDGSSSSSSSSSD
                     SAENFQDASFSNDSIQNSGAIEPPVANVEKSDGTTGPTKNPFSNQSLSASKPSQDSGV
                     SIFDDLGLETAAVEDNTDAFDNVQSGIDGAGFSFANNELTEATESQGGDDWEQVFAGF
                     GNDPNLQPATVEHSGSNEFTQSEMSGFSGVPSGVSYTEEKFTESQLLAIEELSDMGFD
                     KEDAVRALKLKNWVIDDASNYLLDKA"
     gene            complement(<273735..>274499)
                     /locus_tag="C5L36_0C01270"
                     /db_xref="GeneID:40383974"
     mRNA            complement(<273735..>274499)
                     /locus_tag="C5L36_0C01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465796.1"
                     /db_xref="GeneID:40383974"
     CDS             complement(273735..274499)
                     /locus_tag="C5L36_0C01270"
                     /inference="similar to AA sequence:RefSeq:NP_013220.1"
                     /note="PKUD0C01270; similar to Saccharomyces cerevisiae
                     YLR119W (SRN2); ancestral locus Anc_8.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321656.1"
                     /db_xref="GeneID:40383974"
                     /translation="MVKMDQLSYSDSKTIKQHIMLPQLPPKPETLSPLPAEKQGISAD
                     HCEIITNIPPDLPFPTLHPEYATDFFKNKYGGALPSVPMPDYIEWLPNPKIKEFLNNQ
                     RLLDGYIREIYRPEFQEIEEHINQIGVQQKEAAAKILEKYIEPETGILAVLRENESKI
                     CEYHDKLKEFDQAQIEMYESLQELSKSGILEIYQKRIHDNERECQNILKKIDKDEKLT
                     DSQLQELLSEYGHIREKWHLNNLYVSSIRSGKIKGL"
     gene            <275557..>276237
                     /locus_tag="C5L36_0C01280"
                     /db_xref="GeneID:40383975"
     mRNA            <275557..>276237
                     /locus_tag="C5L36_0C01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465797.1"
                     /db_xref="GeneID:40383975"
     CDS             275557..276237
                     /locus_tag="C5L36_0C01280"
                     /inference="similar to AA sequence:RefSeq:NP_013219.1"
                     /note="PKUD0C01280; similar to Saccharomyces cerevisiae
                     YLR118C; ancestral locus Anc_8.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321657.1"
                     /db_xref="GeneID:40383975"
                     /translation="MSLNVLRVNAPANATASIIILHGLGDSAHGWSFLSELLHHNPSF
                     QHVNLIFPNAPIKPLTCANGQRISQWFDIYEMGNPNAKMDEDGYWTNVSKVNNLIENE
                     VNNGIDASKIIVGGFSQGASLSLGVAASYEKKLAGILSLSGFFAMKHGIKTRLTDANK
                     STPIYHGHGDCDPVIGIEYARMTAKYFKEELGFTDYTLKEFPNMAHSTCNEEMQDIIE
                     FFKKNLDL"
     gene            complement(<276285..>276917)
                     /locus_tag="C5L36_0C01290"
                     /db_xref="GeneID:40383976"
     mRNA            complement(<276285..>276917)
                     /locus_tag="C5L36_0C01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465798.1"
                     /db_xref="GeneID:40383976"
     CDS             complement(276285..276917)
                     /locus_tag="C5L36_0C01290"
                     /inference="similar to AA sequence:RefSeq:NP_014595.2"
                     /note="PKUD0C01290; similar to Saccharomyces cerevisiae
                     YOL047C; ancestral locus Anc_7.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321658.1"
                     /db_xref="GeneID:40383976"
                     /translation="MIPMYFLTSLLTGGVFMTTLPTVFQTCHFIINFIYKSFIMPQHL
                     KRLFDHVINTNMALKYNKFPRGVLNNYLPGYYGETFFGKTFRNLQRMCSPILWLSNLM
                     VCFSINMIPFVGPVLVVFLRGPKSGFKKHQRYFYLKGLTNAQVYYIWLNMRTTYFMFG
                     VLTLFLEMTPIIGYLFVFTNTIGAACWAVDIEDKLYKQMLANVLVKEEGK"
     gene            <277378..>282594
                     /locus_tag="C5L36_0C01300"
                     /db_xref="GeneID:40383977"
     mRNA            <277378..>282594
                     /locus_tag="C5L36_0C01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465799.1"
                     /db_xref="GeneID:40383977"
     CDS             277378..282594
                     /locus_tag="C5L36_0C01300"
                     /inference="similar to AA sequence:RefSeq:NP_010425.1"
                     /note="PKUD0C01300; similar to Saccharomyces cerevisiae
                     YDR141C (DOP1); ancestral locus Anc_8.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321659.1"
                     /db_xref="GeneID:40383977"
                     /translation="MHRMMGPIPLFQGSRLANNRFTAFGQSATLTAKEKKYMSNVEKA
                     LQSFESVEEWADYIAFLAKLQKSLHTNPDKENTNWIPYDFQVSIMLSKCLAPSLPSGV
                     HKKTIELYSNIFDILKETNLSQSITLWLPGIFPLMSYASISIKQDLLNLFSNYICNVE
                     PIYLRSCFKSILLSLLPALDDTTSEFFNPTIDLIEKLKIQLDDVNHFWQCILLSIITS
                     PDKRTGSMEYLTRKFPLFKVLGGTENLNKDIVLGELSLDAKACLTPNSSLLVRAFCRA
                     ISDDNLFVQRGFFDILLSRLPLNSAVFQYLINDDDKELLLLHVTSTVMKKDMSLNRRL
                     WNWLLGPEPSVEENQSDSTPRTLSRSEYFKKYGYQPILKTLKQLLLNDTDKPKSSGEI
                     TQDFITVCSISISIMDRWEIGQMLLPQLFVSILERSKHIFEHQPSDFEKIIKVSNELF
                     DGVETNIIWANIFELIRNNQLDLVLFILRYYNVEDEEMLITHIPMVLLGSFAMFKLDI
                     KWICLVETLIKMIPERALLPFELTQEEIDLNDEYKKSIVDNLNEYYSLDDTKTQSSPK
                     RPYENLQLSSLYFTFITDIIIRCLDDKQSTVFLRSCKIFESFMQIVPSSKEISNLSMV
                     KDLVMKMGREMENDVELSFGASTLFKYIAKDMNKLEMMQLLKIIVQSLWSILGDTEGL
                     YQVEAVERLWNLEMIVGSSYLEGAICELLLESEFEKRVHDFNVIWTHLNNDRHESFSI
                     LKKPLYLILEELENDVYISNIAKWIKSTNNSGTLNKIFRIICMELFSNEILHETAELI
                     DFDKISYDLQIIHNLLKLDNDILNNFKFELCVIDNNKQLEFIRSNKWDFSTYKSFMII
                     VLNKFLDTKITSGDASELKYLKMSLKLLNLLIDGTEPNFNSIFISLIENCQKNCLSES
                     NLQKSAINSYYLETIVKMVKLSSKNKTQGDSIFENEKDNEASINLLQFIVTGIKSSKN
                     NLDFSNWVDLILSVAEYYPDLIFQIVGGLVECICGRIDDDFIPQIGQSSDAYNESLCE
                     LIIGLEKILMKCHKYLGYILSDTFGFNNVSLSHNNTVKDSGFFGSVIQGVFQVEGTEE
                     KNEGTKMKRYLLETFRRSVSTIYKAWIVLQNEKNTLREVTNPSDGKTKRYWFSKVKFR
                     CRKILEQEYLMEPLETIESLIENWKDSEWGQDDGFKLFQVLDDCQQKIILMYIIQGII
                     SRVNYSSLEEDKRSNLICNLSEIELSNFLVSYITNLRDDENIEKSWNELQGFFKDVLS
                     NVSYYKYIYPQLLEFVSIVSLKYLNTTVGSQKKASREIGDLFIRFLGNVLSIKLVPNS
                     THSFSRAILHGSLEVNDKEEKDKVETDGNLKEKIVFRQEVCSSLRNVIPSMKILINDD
                     DKLVSAFTNIITCVSTFMNKSGGINFKVPEYFIDLLLQLGADETCKDLKAWKNLCYEI
                     LNDGKLFINEEVLEREKWDSVLQTWIRNDDSRLRDLIVHKQTINMNKGNSGILFNWND
                     EVAVLNGNIEYIKKITYLLLINEKDTFLNLINDLLIRIDGYLRTFQNLSKHCEAEIWI
                     FILIRCIVVKFSENHLIESWTMINSSIFQILSEGYQKIVQVKDCGNVLVELEVEEEDE
                     NVGVFNQVFLEACKLLDILVVINYEEFQLSEWVFICDNMDGIYNNPGQQVGILEKLSK
                     NSVLISGSGELTIDNKGVPMLKNIVKIKSLIDMKRFFGMLKIEKFENDYEMRDIKYDA
                     ITQDILHDLLSI"
     gene            complement(<282628..>283308)
                     /locus_tag="C5L36_0C01310"
                     /db_xref="GeneID:40383978"
     mRNA            complement(<282628..>283308)
                     /locus_tag="C5L36_0C01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465800.1"
                     /db_xref="GeneID:40383978"
     CDS             complement(282628..283308)
                     /locus_tag="C5L36_0C01310"
                     /inference="similar to AA sequence:RefSeq:NP_010424.3"
                     /note="PKUD0C01310; similar to Saccharomyces cerevisiae
                     YDR140W (MTQ2); ancestral locus Anc_8.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321660.1"
                     /db_xref="GeneID:40383978"
                     /translation="MLATPLTKNLDIDHVYEPAEDTFLFLDLFESLHNSSFYKDKRNF
                     NNDCPLVVEIGSGSGLITTFISQHRIIPNAFHIATDINLIALENTTKTYKDNTSYPVF
                     DVLRSNLTDAIIPGSIDVLFFNPPYVPSEHVPPLPSIDDDSVWLDLALIGGDDGMLIT
                     RKVLSSLNRILAVSGHAYILFCARNNHPKVIEKFKEENLNFSVELTIQRKCGWEELAI
                     YRFTKTKE"
     gene            <283635..>283874
                     /locus_tag="C5L36_0C01320"
                     /db_xref="GeneID:40383979"
     mRNA            <283635..>283874
                     /locus_tag="C5L36_0C01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465801.1"
                     /db_xref="GeneID:40383979"
     CDS             283635..283874
                     /locus_tag="C5L36_0C01320"
                     /inference="similar to AA sequence:RefSeq:NP_010423.4"
                     /note="PKUD0C01320; similar to Saccharomyces cerevisiae
                     YDR139C (RUB1); ancestral locus Anc_8.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321661.1"
                     /db_xref="GeneID:40383979"
                     /translation="MVEITIRSLTGRSIPVEIDLQQRVSDLKEVVEVKEGIPPAQQRF
                     LFTGRQLDDDKTLAECGVANGSDLHLVLSLRGGML"
     gene            <285380..>286759
                     /locus_tag="C5L36_0C01330"
                     /db_xref="GeneID:40383980"
     mRNA            <285380..>286759
                     /locus_tag="C5L36_0C01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465802.1"
                     /db_xref="GeneID:40383980"
     CDS             285380..286759
                     /locus_tag="C5L36_0C01330"
                     /inference="similar to AA sequence:RefSeq:NP_011634.1"
                     /note="PKUD0C01330; similar to Saccharomyces cerevisiae
                     YGR119C (NUP57); ancestral locus Anc_3.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321662.1"
                     /db_xref="GeneID:40383980"
                     /translation="MFGSSNTTSGAGSAGTGTGFSFGGGATVSTSQPTKPAFSFGNAN
                     TNTNTSTGANTSNGGTSGGFSFGKPAATTNAATPGSSTTPGFSFGNSTTKPSASAGNG
                     GFSFGNSTSNTTASNTKTGLGTNTTMPSSLGSGNAGFSFGNQNSAQGTNVQPQGASKT
                     TSMFSSQPSFGWSKPGTLTTNTATTTTLPTTTAMTTGPNTSLGLQSAQQGTMNNTRSD
                     YTPTINDKLLKIKNSWDPSNPQCKMVTHVYNRVDPNFSYFNRPENETPEEWENAMANR
                     PKEYNTLPVKCAGFNQLFERNQIQDVHVKETRLLLNDIDNRITKMNEKHDLHSNTLLL
                     KCKMKQKNLNIKLLKIAINLSILKYKGYPLTNDEEILISKFNELLKKLDDPVGLNRVN
                     ELWARLASLKEKYPVPIGGDCEPDSVEEGSDSQVIQNMVKVLAKQQQGIQFLYELMEE
                     DENKLNKLL"
     gene            <287026..>287676
                     /locus_tag="C5L36_0C01340"
                     /db_xref="GeneID:40383981"
     mRNA            <287026..>287676
                     /locus_tag="C5L36_0C01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465803.1"
                     /db_xref="GeneID:40383981"
     CDS             287026..287676
                     /locus_tag="C5L36_0C01340"
                     /inference="similar to AA sequence:RefSeq:NP_013370.1"
                     /note="PKUD0C01340; similar to Saccharomyces cerevisiae
                     YLR268W (SEC22); ancestral locus Anc_6.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321663.1"
                     /db_xref="GeneID:40383981"
                     /translation="METTIVYQKSTGTPLAASSDDSKDAELIVSKKELKQVLHQLSGI
                     GNIKAFKKMIHYQVDETSDLAVVTITSEGFPAQLSLSYLNEIHDEFVHVYGMEMVNIL
                     KRGDILKPYQFMSFETFITKTKKIYADTRAKDGLSDINGQLRDVKKIMNQNINDLLNR
                     GEELNNLQDLSTSLREQSIKYQKYAKKINWDLMVKKYAPVLIVGILIILIFYRWLF"
     gene            complement(<287673..>290174)
                     /locus_tag="C5L36_0C01350"
                     /db_xref="GeneID:40383982"
     mRNA            complement(<287673..>290174)
                     /locus_tag="C5L36_0C01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465804.1"
                     /db_xref="GeneID:40383982"
     CDS             complement(287673..290174)
                     /locus_tag="C5L36_0C01350"
                     /inference="similar to AA sequence:RefSeq:NP_013216.1"
                     /note="PKUD0C01350; similar to Saccharomyces cerevisiae
                     YLR115W (CFT2); ancestral locus Anc_8.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321664.1"
                     /db_xref="GeneID:40383982"
                     /translation="MLEFQTVGTPTSQGKLITIDDTVTILADPGWSGIETDLDCYTPL
                     VSKIDIILLSQSTVDFIGALPYLYYRFPLLENVPIFSTLPTMKMGKTAVLEFYSTLKL
                     LGPVNNTFKLELSFINSIFNRIKSLNYSQTIRISIKSVNLSITSLNSGYSLGGSIWVV
                     ENNKKEKIIYAPMWNHSKDNYLNGCNIFSNQLILRPTTFITNSEVTSTKFSHNSRLNL
                     MLQNLNRIIHNNNNILIPITLTARFFEVILPILTKSNVNAPIYLVNYTKLENLKILGN
                     FIEWMNSNIIKFWETQSSKLLENNRIKCINLREVEDLMDSRPAIFFVDYLDHRDSNFW
                     QLVSRFENFKKNFTILMTEKPNPNSNMNNLYKSWKHNIDSTELNPKEGELTDISMEVD
                     ISSFVEVPLHGSDLSKYEKLVAESKEKEIQRLKEVEELAKQQKQEEQDENEDDEEDDE
                     DDDDDIVNGTGNGTVNGDRDGRLGRKDLVQDEAAEQANLENQTKYQFNESTILRMDQI
                     LSIPRDFDFRLFKERQRVFPNVNLKLSIDDYGVVIKHADFQTYENDRFPIIADRTNNE
                     NAGLGNGRLCDGNGDDDAGSEGGDYEGNRNVGNNRKKRKITESYSLDPLKDPVQRIYT
                     TRKLKITCGFTFIDMSGQHDLRSLKISIEKLKPRKLIILPEFKNGNVNNLIEELNKDI
                     MVNKNLNTEVLKSKLNKSLNLGDLITNYEILIDDDLAKSLNWNLLNDEYNVSSINGIV
                     EKIKDWDYKLVKDGGDGSNKEKSKIKIGDIKLTKLRNILSKNHSVELLGDGRLIIDDE
                     IIVSKEDDGDLKISSNLSPLFYTIKQTIENLLATI"
     gene            <290573..>291109
                     /locus_tag="C5L36_0C01360"
                     /db_xref="GeneID:40383983"
     mRNA            <290573..>291109
                     /locus_tag="C5L36_0C01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465805.1"
                     /db_xref="GeneID:40383983"
     CDS             290573..291109
                     /locus_tag="C5L36_0C01360"
                     /note="PKUD0C01360; Pfam Domains: CHCH(2.7e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321665.1"
                     /db_xref="GeneID:40383983"
                     /translation="MSTSNTYDGISNSNFTDKKRGTEIVFENDKLPAEIPHVKEIGAT
                     TGPLLSASYFIADRCQEFNDDFMMCQKENGTNGAVNCLKEGRKVTRCASSVLRDLNTH
                     CKDEFEMHFKCLNYSNMEFKNCRKAESMLNECVFKSLGLKKTIPGDGGREVWKNQIYK
                     PIHPHFPSEKAFERQQEQ"
     gene            complement(<291382..>292563)
                     /locus_tag="C5L36_0C01370"
                     /db_xref="GeneID:40383984"
     mRNA            complement(<291382..>292563)
                     /locus_tag="C5L36_0C01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465806.1"
                     /db_xref="GeneID:40383984"
     CDS             complement(291382..292563)
                     /locus_tag="C5L36_0C01370"
                     /inference="similar to AA sequence:RefSeq:NP_013089.1"
                     /note="PKUD0C01370; similar to Saccharomyces cerevisiae
                     YLL012W (YEH1) and YLR020C (YEH2); ancestral locus
                     Anc_5.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321666.1"
                     /db_xref="GeneID:40383984"
                     /translation="MITIAPLWGITLLIAIFIYSVLHFFLSPSRNTHIEPRPLPYAEK
                     PPHGVSLKRLCDILNISLVTCSLTTSDGYTVTLHRLNWPLSKSSLSSSYHPNDKIPVL
                     CIPGLLQSPMAFLSAGYDSLAYLLLKNGHTVYLGNNRGGSVDDHLTENSLSSFYWNFT
                     VTDMALDIVAMAQYIDSPLALMGHSQGTAQILHLLHNNWLDKDTFKRLILLAPALYGG
                     EILEKSIFFKLLHTLNCNGKIFTFFFGRSAFMPILMVLHRWTKSLPGYTTASYMVFHA
                     LFHWNDRLWNASCKRVHFQASPVYTSVRCIKWWLDEFKCNCSFIDERVPFPAEMPPIF
                     AVTGGKDTIVNNRLFMNRMQREGVLLENIHRDEYSHLDVLWSRDLLDVVGTRLLAFLE
                     E"
     gene            <292907..>293566
                     /locus_tag="C5L36_0C01380"
                     /db_xref="GeneID:40383985"
     mRNA            <292907..>293566
                     /locus_tag="C5L36_0C01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465807.1"
                     /db_xref="GeneID:40383985"
     CDS             292907..293566
                     /locus_tag="C5L36_0C01380"
                     /inference="similar to AA sequence:RefSeq:NP_116692.1"
                     /note="PKUD0C01380; similar to Saccharomyces cerevisiae
                     YFR034C (PHO4); ancestral locus Anc_7.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321667.1"
                     /db_xref="GeneID:40383985"
                     /translation="MVNTSRTKTPQQQQQQQQQVQSNTLPPLSPLVSPLLGPSLSSSA
                     SSVTNSPLLGTPALHARPSVYANPHRRSATSSPLILASSRPLATGILVGGTASPMGPV
                     GPAGPTGPTGVPAKRRKSDSHRLAEQGRRARLNSALRELESLLPAGVPETVVGGVGDG
                     NNNSAGNNNSNFNNCSNTSISNNNSSNNSKAATVERACLYIKTLQQELETLRNGQRCR
                     E"
     gene            complement(<295080..>297092)
                     /locus_tag="C5L36_0C01390"
                     /db_xref="GeneID:40383986"
     mRNA            complement(<295080..>297092)
                     /locus_tag="C5L36_0C01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465808.1"
                     /db_xref="GeneID:40383986"
     CDS             complement(295080..297092)
                     /locus_tag="C5L36_0C01390"
                     /inference="similar to AA sequence:RefSeq:NP_010405.3"
                     /note="PKUD0C01390; similar to Saccharomyces cerevisiae
                     YDR120C (TRM1); ancestral locus Anc_8.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321668.1"
                     /db_xref="GeneID:40383986"
                     /translation="MWWRTEWKGSTTCTKLAKSIKLMKLNQLIKLKLYRFCRENIQQF
                     ENFHSLRICTFFFFFHHNRNFLHFACFGGDACHCHPFPLYFFLMLRRLSRMSNLGKLA
                     TAAAKMSTAAESPENGASVTTGTSETTAESNTTTTKTTTKTTITTTTRAEASAAPNTT
                     KGADGCGEIDMDKYDLLKEGTTTILFPKNHVFYNPVQQYNRDLSSLAIRTFGKRLSAE
                     RTLKRSRKGEKATDDRPFMHLLEALSASGLRAIRYSKEVPLLEKVVANDLSKDAVRSI
                     QLNIDYNGAKNVVAQHSNAITHMATHGDEYHIIDLDPYGTVAPFVDSALNAVKNGGLL
                     LITCTDLGVLAGNGYPEKCYSLYGGVNVWGDATHESALRLVLGLVARSGGKYGIAIEP
                     LLSLSIDFYVRVFVRVWRKPVKVKELMSANTLVAKCSGCHSSVMQRMGKMESLDNGGK
                     SRTKYGLAKVEQEFTAQCVHCGFSNHICGPMWGGKLHNKEFVEEMLQELEQTSGGKEG
                     DVEYGTIERMRGMLTMAHQEIEAPLYFNVSTLSSVLKIPVPTMEEVVSALGNGGYDVS
                     LTHAAPSCIKTNAPWRFIWQIGRALAQRSGLDSSRLSTGTAGYRILNGAEDVRDVKDD
                     KDIQEVQDIDFTENAVTKRVRKLRSMKIRRHQVNPTKNWGPKARPS"
     gene            <297445..>298023
                     /locus_tag="C5L36_0C01400"
                     /db_xref="GeneID:40383987"
     mRNA            <297445..>298023
                     /locus_tag="C5L36_0C01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465809.1"
                     /db_xref="GeneID:40383987"
     CDS             297445..298023
                     /locus_tag="C5L36_0C01400"
                     /note="PKUD0C01400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321669.1"
                     /db_xref="GeneID:40383987"
                     /translation="MHTPFTTVPTTILSVLVSVPQRHSNLVPIVEQNLSCFLHPCYSL
                     LQRRPLLTVNVRELTHVHIEPRQRLHLKVPQQQLVQSLQHRQRVPATTGTRNMHTTDT
                     FFPMVAQVALLNVNVNKNIVSRYRYALQLREGRQRVSLRYPNNPLSTYLSRPCREHVN
                     DLRHCSSVHSQRWLHGGRTHQLLSLSNENLTS"
     gene            complement(<298393..>300405)
                     /locus_tag="C5L36_0C01410"
                     /db_xref="GeneID:40383988"
     mRNA            complement(<298393..>300405)
                     /locus_tag="C5L36_0C01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465810.1"
                     /db_xref="GeneID:40383988"
     CDS             complement(298393..300405)
                     /locus_tag="C5L36_0C01410"
                     /inference="similar to AA sequence:RefSeq:NP_012850.1"
                     /note="PKUD0C01410; similar to Saccharomyces cerevisiae
                     YKL073W (LHS1); ancestral locus Anc_2.618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321670.1"
                     /db_xref="GeneID:40383988"
                     /translation="MELPSTCLFSSGNLLFIRIPTHTHTYIHIHIGTKEITQEVTMKF
                     FKIVSFLVCTAYCVQCALLGIDFGTQNTKAVLIAPGVSLDVLLTPESKRKEVSGLAAT
                     FDKDGKIERHFGTHALASCVKSPQSCMLYMNTIIEGEEGEIQRYQEQFPGVAINKDNH
                     GLIRVTVKSRDGSKEETFHIEEVLGMVFNEIKKRAEQHWSESASSGMITKVDDVVISV
                     PYQLSAEGRLRIIDGAEIAGLNVVSLVEDGMSIAIDYLNRKNEIDSADEYHLIFDGGA
                     GQTKLTLTSVNNKDGKPAVNIISRASTKSINGEIFTSKIRDLIIEKFDERQGKGLLLR
                     KDARLMQKLWQIAERTKLILSANTETDVYIESLYDDNDFRCVVTREEFEELLKKERGL
                     LGELVDGIAGNLTLGSIVLSGGSSRIPWIQKLLVEKFGEESISKNVNADESVVFGTIM
                     RGAQLMGLKQRFQFTVNSERTLKYWSEELQVSESITVSGQEEEGTLEIPGLANTTFHD
                     FNVAYEKEYMFEVPESIDCNSTRYVFEYGADLNMYLICDMGEGKERRHVLIRHHRGMN
                     EIAKFSAKEKLRLLDHSDEEKRLLSDMKNKLETLIYELRGVEQNEAKLAELDELLDWL
                     DYESGDATFSDVSKRYEELHGEYRVILEGGPSAALDTEEQDVHDEL"
     gene            <300578..>301993
                     /locus_tag="C5L36_0C01420"
                     /db_xref="GeneID:40383989"
     mRNA            <300578..>301993
                     /locus_tag="C5L36_0C01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465811.1"
                     /db_xref="GeneID:40383989"
     CDS             300578..301993
                     /locus_tag="C5L36_0C01420"
                     /inference="similar to AA sequence:RefSeq:NP_012849.1"
                     /note="PKUD0C01420; similar to Saccharomyces cerevisiae
                     YKL074C (MUD2); ancestral locus Anc_2.619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321671.1"
                     /db_xref="GeneID:40383989"
                     /translation="MYNERRAANRNRALPSAPKGPPSYPRSRDRLPHRLPKRSYPLRR
                     DDHPREHHYSRHQQQTRYQETPVPSFESLKPRDTRWDVCIAKLQGMSARFAKASGVFP
                     SPSISRVDTLTAEEVKELIGKQQKYEQMRRERQVSQNISGISNSKASKTVHLQGIDFD
                     IISTQTVHTYLENFLASTVIPNVSYEDLKITTRVDGQSLIVECMSSLVATTLLSFQGK
                     QIEEFQCTLQVNRPPDYIASSKPLVRKEQDAQIVDEIIETSSLICVNGISKESLADDL
                     RKVFAEFGTLYSISILLDKLSYDSIGVAFINYMSLNENITYKDIFNNVKEKYQWNCHW
                     ACRNRDHRYFQSCDITTMNIKELVDFRTREISKHEHTSTIQILNVLPANQLIGDETDK
                     QFNVFRNEVSQLRGFKDIKVTKPPKDVKSITPEEFVPEYGRVYIKFEKPKDASSALTQ
                     ICGRFFNNRLLLGSYLDDSLF"
     gene            complement(<301994..>303070)
                     /locus_tag="C5L36_0C01430"
                     /db_xref="GeneID:40383990"
     mRNA            complement(<301994..>303070)
                     /locus_tag="C5L36_0C01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465812.1"
                     /db_xref="GeneID:40383990"
     CDS             complement(301994..303070)
                     /locus_tag="C5L36_0C01430"
                     /inference="similar to AA sequence:RefSeq:NP_013771.1"
                     /note="PKUD0C01430; similar to Saccharomyces cerevisiae
                     YMR055C (BUB2); ancestral locus Anc_2.620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321672.1"
                     /db_xref="GeneID:40383990"
                     /translation="MIRSTSYHRLNRKSSSTESSGSIRNKPSKPSISDSKQRGRKKDA
                     LEKFIESPQQLLKSSLSQLRHTILVEGLPVECPYRSYIWSILLSGAPIESEWYSGIVS
                     RGKVNSSNVVDTKFVHFGDKIENDVFRTFQNNKKFWSKIEEGELIRILNVFAWCVIED
                     EQVDFKVGSKISISPYVQGMNVLVAPLAYVCRSEPQAFALLYRLLMVEMPRYITPTLA
                     GVMDGVRLVDLVLKTVDRRLYEYLDQSMANAKIYALPSVLTLCACTPPLEEVLKLWDF
                     LFSFGIHMNVVLIVAQLLLIRGELMNTKNPMVLLRNFPQLESSKIIKLSLSIARNIPD
                     SLYDLIVRHTFDESVTLEIDDYKI"
     gene            complement(<303354..>306038)
                     /locus_tag="C5L36_0C01440"
                     /db_xref="GeneID:40383991"
     mRNA            complement(<303354..>306038)
                     /locus_tag="C5L36_0C01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465813.1"
                     /db_xref="GeneID:40383991"
     CDS             complement(303354..306038)
                     /locus_tag="C5L36_0C01440"
                     /inference="similar to AA sequence:RefSeq:NP_013770.1"
                     /note="PKUD0C01440; similar to Saccharomyces cerevisiae
                     YMR054W (STV1); ancestral locus Anc_2.617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321673.1"
                     /db_xref="GeneID:40383991"
                     /translation="MSLVQFYIPSEVARECVAVLGDMGNVQFRDMNQNVSSFQRAFVK
                     EIRSYDQVERQLKYLTGLIQKQEIKIRVNDHDELIMPPSTDYRQFYDSPSHLSASALE
                     ELLHEIASVESKVRELSFQKDEMSQRKADLTQHRLVLQNTRQFFESRLSLDLDDSDSL
                     FNQVRLSTESSDSFIISDDEGDGVLLESGLGNTNHGGNSISTGRNELNVFGSTMNFIS
                     GIIDTEKFLILEKICWRTLRGNVYTNHVPLPEPIIDIKTGEPSFKSVFLIFTHGESLI
                     SRCKRIVESLDGKLYNVDSDYEVYKQELRTVNNKIKDINEVLLYTNERLLIELKQVAL
                     DIEKWKIIIKREVSIYEVLNLFNYDSTRRCVIGEGWIPNDDLTYINMALRDVTNKFDA
                     GLSTIVNLMITNKTPPTYHKTNKFTGAFQSIIDAYGIATYQEVNPGLATIVTFPFMFA
                     IMFGDLGHGLILFIAALTLVLCENRISKIKNRDEIFDMAYTGRYILLLMGVFSMYTGI
                     IYNDLFSKSMSLFKSGWKWPNGFKEGTSIVGTQRGVYPLGLDPAWHGTENNLLFTNSY
                     KMKLSILMGFIHMSYSFYFALVNYRFFNSRVDIIGNFIPGLLFMQSIFGYLTITIVYK
                     WCVDWIAIGKPAPSLLNMLINMFLSPGTIEDKLYPGQGPLQVFLVLIALVCVPWLLLY
                     KPLTLKKMNSNKIQLGYADVNGPDNTNSRISVESVPYTEEAEDLFDRGSNTIQERLSI
                     DADVGLLEDENGEEEEPFSFGDAMVHQVIHTIEFCLNCVSHTASYLRLWALSLAHNQL
                     SAVLWEMTIQNSFKPYSETGWVGSIIVFFLFGMWFVLTVCILVVMEGTSAMLHSLRLH
                     WVEAMSKFFEGEGYAYQPFSFYRIILDMQAAEMEEERK"
     gene            <306495..>310001
                     /locus_tag="C5L36_0C01450"
                     /db_xref="GeneID:40383992"
     mRNA            <306495..>310001
                     /locus_tag="C5L36_0C01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465814.1"
                     /db_xref="GeneID:40383992"
     CDS             306495..310001
                     /locus_tag="C5L36_0C01450"
                     /inference="similar to AA sequence:RefSeq:NP_012851.1"
                     /note="PKUD0C01450; similar to Saccharomyces cerevisiae
                     YKL072W (STB6) and YMR053C (STB2); ancestral locus
                     Anc_2.616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321674.1"
                     /db_xref="GeneID:40383992"
                     /translation="MLKLDVSSGRGRSNSGVSLSHLQYAEFLNTSSFLIPDTIAFTKI
                     LPFFKAVPGYSTRYKIDRVQLIGYEAYFVEQWISSRSTSTLIVTYTGDKNDHVIAYHV
                     QSLDTPNGDEDLTKSNRWPPQFISYLVEQLECPFSVATQTSLGYAFITNLAQLSPFLS
                     LVDVKTGNIDEDYIIYKVNLNLRKLGCGSRSAANADEPSKTMEDKFKSTFKIDPKIPI
                     KYAVINLIYIVQIFLYYYDVIDPVYCDGLLCEKTENAIGEWWDIVSRIPLSHSIIRVM
                     PPSASMVQSIQAIVGFTVLCRYLLELSGSNFNTPKDPLDVKGMKHSIEKFQKHHKAEI
                     TSTFTLETLIKLFECGENSKASQNLAKDLSKMKKLVKNTVIDLTSGKNLHSIAQNATA
                     SPFCIHNQANYEHGKMINVQNIDHVRYMSLGKQLSYLHSGSGKPINMQTQALSVLTIK
                     KLAESLERGSSFFSGVKQLKNELKRGSSPSKKPSQVFHDFNFSGGSDDELNRSDDEEN
                     AELPNNIKTDVKNDYLRENTINLNLKQKYHKKSSSSLLDISHMSRKGSLTALGDDDLY
                     DDIEIYNPTIGGNKSRNNRLSSITSIATTSDQSNLVDCDESDGSELQQKKSNSKKDKG
                     SSFSSHFRRSKKHNEQEEVPDDIGPLDVNLSGRSLQSAKNARDKMPLKSVFASPHAIS
                     TGDFSSHFGGDQRNSFSSSSHKKKDSVSSAKKDSLRNMSNESDGVYEYENGFEYDYEM
                     ENNSNSNNGNNSSAHYRKASNAKRSDVSQIQEEATLYTACEDVNYSIFMKRIKRRHSI
                     PLVEPELNQYSIEMDVKMDKVKSLDMRRRHSRGSQWIWDGSSLNSYNNDDNEYLGFEL
                     KRKRSMFESQSINTSSSQDLLNTHINSAILYSKETGIDKLKRSASFSQIQDSLYYFSL
                     GTDGNGVEAIYQKIITPEILAIKYLKMKIKYEYEIVKNSFHLIEDMKRYSHYFTEDFS
                     QEKNLKYQSTRGEVNKAIGKYLEMEEKLKNTIKSNARLKYELRLLLQKTKEVENNVKS
                     LQDFKINTLQSKIDKLLGCYKVVDSDDDGETKIVRESSPIFEMICANDGKIDWTSVTW
                     KNIWGNPYIILYLFFHFWIFTVLKQSNIKFLEQQWSKIDRNQTVTRFIRNIYTTTEQE
                     LKEATADEPVKTDVSDTSKKNK"
     gene            complement(<310030..>310773)
                     /locus_tag="C5L36_0C01460"
                     /db_xref="GeneID:40383993"
     mRNA            complement(<310030..>310773)
                     /locus_tag="C5L36_0C01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465815.1"
                     /db_xref="GeneID:40383993"
     CDS             complement(310030..310773)
                     /locus_tag="C5L36_0C01460"
                     /note="PKUD0C01460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321675.1"
                     /db_xref="GeneID:40383993"
                     /translation="MSQTGSTSSNKDSVEIQPIHPRLNVKEFTQKEKHRLLNRLFQEL
                     DDENTSIETLKNNLSELSLKSGLDIDQWSKRTLSVSVDKMTVSWNEEEHKEEDLDLLQ
                     DLQDSGKGSMAGIEGVETPEKERNGKENERELLLNLLHREMKLSSQYESLIDSYQNLL
                     TYTKAHVKANREKIYGVDTDKPVDINQPKMQQLHSREIMHTVQNRVTSLRETSEFIKS
                     ATETKKIELELAKNNIKEEALKLSNILET"
     gene            complement(<311132..>312703)
                     /locus_tag="C5L36_0C01470"
                     /db_xref="GeneID:40383994"
     mRNA            complement(<311132..>312703)
                     /locus_tag="C5L36_0C01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465816.1"
                     /db_xref="GeneID:40383994"
     CDS             complement(311132..312703)
                     /locus_tag="C5L36_0C01470"
                     /inference="similar to AA sequence:RefSeq:NP_014955.1"
                     /note="PKUD0C01470; similar to Saccharomyces cerevisiae
                     YOR310C (NOP58); ancestral locus Anc_8.787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321676.1"
                     /db_xref="GeneID:40383994"
                     /translation="MSYVLTETAAGYALLKASDKKIYKSSTLATDLNSAEKVLSQFKI
                     KAFSKFANATNALEEANFINDGKVSDQLKKLLEGAKPDKKTTLIVDDTKLANSINKLG
                     LSYSVVSDAASLDIFRAVREYLPELLPGMSDKDLSTMSLGLAHSIGRFKLKFSPDKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVVDSVAFAKIIKKMGVRSNC
                     ESTDFSDILPEEVEQQVKAAAEVSMGTEITDDDLLNIRLLADQIIEFSQYREQLSNYL
                     SARMKAIAPNLTALVGELVGARLIAHAGSLTSLAKAPASTVQILGAEKALFRALKTKH
                     DTPKYGLIYHASLVGQATGKNKGKIARVLAAKAAVALRYDALAEERDDSGDYGLEVRA
                     KVENRLSALEGRDLRSTPRVQKDMKKVEITEARAYNVDADATAPSAEEKVEKKRKREE
                     DSDDEDSDDEEEEEKEVKKAKKEKKEKKEKKDKKEKKDKKEKKEKKEKKEKKDKKEKK
                     EKKEKKEKKEKKDKK"
     gene            complement(<313090..>315306)
                     /locus_tag="C5L36_0C01480"
                     /db_xref="GeneID:40383995"
     mRNA            complement(<313090..>315306)
                     /locus_tag="C5L36_0C01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465817.1"
                     /db_xref="GeneID:40383995"
     CDS             complement(313090..315306)
                     /locus_tag="C5L36_0C01480"
                     /inference="similar to AA sequence:RefSeq:NP_012326.1"
                     /note="PKUD0C01480; similar to Saccharomyces cerevisiae
                     YJL209W (CBP1); ancestral locus Anc_1.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321677.1"
                     /db_xref="GeneID:40383995"
                     /translation="MRLFIRKRMLCHVRRMSYTGDSMKSLPLAELNSCDTISQLHRHM
                     GTPLFIKNVASTLCHACEHKQKLDNLFFENLRQSLSEPAEYKQDFTERKPLQLEGIND
                     IEGWMKIIFQFSLSMNMGGVAYLILRCCAQQGIDSMLNAVNILLVIDLLSVHRSQSKN
                     VQDIDRILELSDMTNYLFSSEQVKMIIDKAYMTLRPDLSFQLQEPFEIVSSNFLYPNA
                     TIENLIRVFGSVLTSKVSDTLSYYTGNEQEDKDIDITELLNRQLLSKYLQFCYHVIQE
                     RCMNNDPVIVYKIWLIIKPFHNKIYNAVINSETNDLSNNFYYYQTLAKMITTFSKNRR
                     YRKLIDEIIYDLPLDSVKVCPELMTSIIYHCARTKNESLGTIVGSRYDSNSDLSKLFG
                     QGGDLSILATGDKFTPAQARAFLAYNLRLGRKQKSLEIIEYLKDKLIGITNLDFNEVI
                     RCMLYNGGNKTDQVKDKLDSVWKMIEHNNDLKNRKLNKYALITYLDYMINQMKRVSLD
                     FKRIDQIYQYAIQCSPFEDVIYWNYFYMSYFKYIIRKYPLNIAQEVYKNCKIFTTRRN
                     PSDVIYFCKVGDYGFRNNPFMQKFQDVRLKLNDNVRLLILRDIYQRNDSYLKRAKQLQ
                     SDDLPEAEKQYVEVTRWVYEELTEIRSSSMKSNRHLVQTSMLIDIIKTIHRQARSIGF
                     QLTPVRDAIDANERVYRLKMGEAVAIDNIKLEEEFEENTACGDNIWRRSNALKYRK"
     gene            <316148..>317134
                     /locus_tag="C5L36_0C01490"
                     /db_xref="GeneID:40383996"
     mRNA            <316148..>317134
                     /locus_tag="C5L36_0C01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465818.1"
                     /db_xref="GeneID:40383996"
     CDS             316148..317134
                     /locus_tag="C5L36_0C01490"
                     /inference="similar to AA sequence:RefSeq:NP_012327.1"
                     /note="PKUD0C01490; similar to Saccharomyces cerevisiae
                     YJL208C (NUC1); ancestral locus Anc_1.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321678.1"
                     /db_xref="GeneID:40383996"
                     /translation="MLKQSLTVPALGLSSAALFFWGSSSSTSTPAPSAPAPAGMPAGL
                     PVGTPNNGKGTDVNASNTSDINPAAFFKYGFPGPVHDMSTHAEFLTVYDRQTRNPYYV
                     VEHITPQSIAKNGSNGDRKNSVFKEDESIPEKFRARLRDYFRSGYDRGHQAPAANAKF
                     SQEAMDETFYLTNMAPQVGAGFNRDYWAHFEDFCRRLTNDYNSVRIVTGPLYLPKKCD
                     DGKYRVSYEVIGNPPNIAVPTHFFKLIVAEQSKKKSVGNEDLAVAAFVMPNDVISNET
                     PLTSFQVPIESLEKSSGLEFLKTVDNRKKKELCREVKCEIIVREFNNALPKK"
     gene            complement(<317178..>318953)
                     /locus_tag="C5L36_0C01500"
                     /db_xref="GeneID:40383997"
     mRNA            complement(<317178..>318953)
                     /locus_tag="C5L36_0C01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465819.1"
                     /db_xref="GeneID:40383997"
     CDS             complement(317178..318953)
                     /locus_tag="C5L36_0C01500"
                     /inference="similar to AA sequence:RefSeq:NP_012334.1"
                     /note="PKUD0C01500; similar to Saccharomyces cerevisiae
                     YJL201W (ECM25); ancestral locus Anc_1.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321679.1"
                     /db_xref="GeneID:40383997"
                     /translation="MSIDRSYYRTTVLDPESSLPLYVLDTTFFPQNDDPCFLDAVLNI
                     YPETPHTLIIFTNGVKQIDLLRFIKSPYLRKIYLVHGNWLIKGIADVLTKLTINPSSP
                     KPTIVNCENISSLAKFVDITKLPISLHTYLIDKIQYKNQRIIINRHFDPLYGQPLSMY
                     TSNKLPLTQFQRIYNNLVAYLSNPSLDIQLTASDWTTIIQCSALDNQTKISIDILSEC
                     LKRDQKVILSEYSFLEHYMIIIKFILKLSNSNNPLIPAQLLIDTNVNFKKCKSVNKFF
                     NDILTHTHQLLDKSQFQHMECYDNSYILVKIFKLFKFLLNKLQRETLILEPNAKNVSK
                     SKDRQSLRLILSFTKILYTDNEEDLTSQDDDDIGFDNLFKLIRYVMEEFDNLSILGTQ
                     YRLDDFNNHISMEDFLAFEIFKDKQLGRENESNLIHPPTIKEPGSPVKLSKTVKDISA
                     PPTPTPFPEATPPMPRNTKLSDSMESEIDKVAASVESLGLNDIDLYKTPKKSTNGDVM
                     NDLLTPLPATQTLASPMHGTSVVKNTNLRKYTEKDLAVQLQAEAARKAELLKREQAIE
                     VERGVRRGERKVSRLARLYEEKYMQ"
     gene            complement(<319960..>321429)
                     /locus_tag="C5L36_0C01510"
                     /db_xref="GeneID:40383998"
     mRNA            complement(<319960..>321429)
                     /locus_tag="C5L36_0C01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465820.1"
                     /db_xref="GeneID:40383998"
     CDS             complement(319960..321429)
                     /locus_tag="C5L36_0C01510"
                     /inference="similar to AA sequence:RefSeq:NP_011460.3"
                     /note="PKUD0C01510; similar to Saccharomyces cerevisiae
                     YGL055W (OLE1); ancestral locus Anc_6.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321680.1"
                     /db_xref="GeneID:40383998"
                     /translation="MDSVDITQANAVAAGTNKPVKRIVASGIGGRLMGTKAMTTVTAE
                     ELARDSVAEVLKRDSELRVKYEKEQHISEKDWSFDTFFQKINWLNLYLVVAFPLFAIA
                     GAIYFQIKPTIQTVTLGVILFSLSGLSITAGYHRLWSHRAYDAKDPLKIVFALFGAAA
                     IEGSIKWWGHSHRIHHRYTDTDRDPYDARKGFWYSHIGWMLLVPNPKYKARADISDLV
                     DDWIVRVQHRHYLSIMLIMGLVVPALLSHYLWNDFWGGLIYAGLLKSSAIQQATFCVN
                     SLAHWIGEQPFDDRRTPRDHFLTALVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKIL
                     IWCASKVGLAYNLKKFSQNAIDQGILQQKQKKLDEMRSKLNWGPQIADLPIWTKEEFK
                     EKAAQKKGYIIISGIVHDCSSFITEHPGGQALVRTSYGKDATVAFNGGVYAHSNAAHN
                     LLSTLRVAVIKDSGANGNTYSRQLEYLAKTEKEQMSKSN"
     gene            <322543..>324306
                     /locus_tag="C5L36_0C01520"
                     /db_xref="GeneID:40383999"
     mRNA            <322543..>324306
                     /locus_tag="C5L36_0C01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465821.1"
                     /db_xref="GeneID:40383999"
     CDS             322543..324306
                     /locus_tag="C5L36_0C01520"
                     /inference="similar to AA sequence:RefSeq:NP_009965.2"
                     /note="PKUD0C01520; similar to Saccharomyces cerevisiae
                     YCR036W (RBK1); ancestral locus Anc_1.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321681.1"
                     /db_xref="GeneID:40383999"
                     /translation="MPIIVCGSLNHDLVTHTSVFPQQGETVTGNSFQSHLGGKGLNEA
                     VACAKLKSPSDKFSVKLFGALGDDPVADEFVRYLTNVGVKTDLISKIKGQVTGTATII
                     VEDNVNAENRIIVVSGANGKFTPSREELDAVFKMSNMQELQSSIENVDIPSHVHSHST
                     KPPFNEPIAKTLDVSPHPPSNIHSHGSMSSLNRSNGSESGLNGLVLKNGQLIHEWSAS
                     GTNLAQQGQLQNQSGISLHSHATRPRNESVSSNSSLGSHKFNDIQVSKITGSVNHNDQ
                     MLPSNLHAHSSSAKMDTLTYPSPKPSAIDLQNAAIALASKQPVPNRSGSNLNLTAQAR
                     LANVSFSLGGSSAHPSNVSLSPSQTYLSNIRNPVPNSKPVVDDLKYYLVIQNEIPNPH
                     TIIDYVSKNYTNVQIMYNPSPLPNAKDGYNSSFLDSLLHSTFVVMNEHELANIVANFH
                     PNPASEPMTVLKNVSNYEPSSEFELDGFVKQLTKLKSFLTKPNVIVTLGEAGILYSIG
                     GQFTYAYVPSEEVDEDDIVDTTGAGDTFLGAVTTCLYRGESLESAIKFAARASAETIK
                     KSGAAEAMPRYGDVERRGWVL"
     gene            complement(<324841..>325782)
                     /locus_tag="C5L36_0C01530"
                     /db_xref="GeneID:40384000"
     mRNA            complement(<324841..>325782)
                     /locus_tag="C5L36_0C01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465822.1"
                     /db_xref="GeneID:40384000"
     CDS             complement(324841..325782)
                     /locus_tag="C5L36_0C01530"
                     /note="PKUD0C01530; Pfam Domains: zf-C2H2(3.1e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321682.1"
                     /db_xref="GeneID:40384000"
                     /translation="MPSTDRPYKCPLCEKRFHRLEHQTRHIRTHTGEKPHQCNFPGCF
                     KRFSRSDELTRHSRIHSNPLSRANTAHSKSTSNLAALKKSASSSRLKQSRHQKKLTAS
                     FTCTSNPASMSTINSATNSATNSATNSMLNPLSNSTSINMLASAATKELENINKLSQN
                     LPLPLSPILSRSNSNSNQTSTSSSASLAYVKSLPSLSTYFQPSQPHSLPSIDRISEMT
                     TLPPPLSLPSLPSFKSPSSVASLSFAVPPSLTFHQQTPLTTSIPNSPLHSPPQSPHSP
                     QLPQHTQHTQLSPQIHPLPAEKNTTALPPLSSILNNP"
     gene            <325807..>326280
                     /locus_tag="C5L36_0C01540"
                     /db_xref="GeneID:40384001"
     mRNA            <325807..>326280
                     /locus_tag="C5L36_0C01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465823.1"
                     /db_xref="GeneID:40384001"
     CDS             325807..326280
                     /locus_tag="C5L36_0C01540"
                     /note="PKUD0C01540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321683.1"
                     /db_xref="GeneID:40384001"
                     /translation="MISYSFLSWCFVLYSLVLYLCVSGSLLSVCTRPKTLCCSGMEGG
                     GGGGNYGEPEISQSHIQITQKLYFTQCNMHILYSSTRKQWGKSRGDGGLPRKIVQPTE
                     ISGKGEIGTVGDSLFLPRLIRLFLYNGLEEEATRKMRFFFFPVFKTEFRRPFRGC"
     gene            <326548..>328578
                     /locus_tag="C5L36_0C01550"
                     /db_xref="GeneID:40384002"
     mRNA            <326548..>328578
                     /locus_tag="C5L36_0C01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465824.1"
                     /db_xref="GeneID:40384002"
     CDS             326548..328578
                     /locus_tag="C5L36_0C01550"
                     /inference="similar to AA sequence:RefSeq:NP_009675.3"
                     /note="PKUD0C01550; similar to Saccharomyces cerevisiae
                     YBR117C (TKL2) and YPR074C (TKL1); ancestral locus
                     Anc_3.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321684.1"
                     /db_xref="GeneID:40384002"
                     /translation="MSDITTKAVNTIRVLAADVVAKANSGHPGAPMGMAPAAHVLFSQ
                     LKTNPKNPEWINRDRFVLSNGHAVALLYVMLHLSGYPISMEDLKQFRQLDSKTPGHPE
                     SETVGVDVTTGPLGQGISNAVGLAIAQANFGATYNKPGYTISNNYTYTFFGDGCMMEG
                     VASEAASLAGHLQLGNLIAFYDDNKISIDGSTNMAFTEDVSKRLESYGWEVIEVKDAD
                     TDFDALALAIEKAKSNKNQPSCIRMSTTIGYGSLKQGTAGVHGSPLKADDIAQLKEKW
                     GFDPAKSFNVEDDVYDYWKSVAARGEEENRKWDSLFEAYSKEYPKEAEEIKRRVSYKL
                     PQGWEKVLPTYTKDDKPLASRKLSEIVLGKIEESLPELIGGSADLTPSNLTRWGGAVD
                     FQPPQTGLGDYAGRYIRFGVREHGMGAIMNGIAAYGANYKPYGGTFLNFVSYAAGAVR
                     LSALSGHPVIWVATHDSIGLGEDGPTHQPIETLAHFRATPNLMVWRPADGNEVSAAYK
                     VALESLATPSIIALTRQNLPQLENSSIEKATKGGYILNDIDNAKLIIAATGSEVSLAV
                     EAADKLTSEGIPTKVVSVPDFYTFDKQSHEYKMSVFPHGIPVVSLEVMSSFGWSKYAH
                     AHISLDRFGASAPADKLFEKFGFTKDVVADKAKKVVSYYAGKEVLSQLETPF"
     gene            <328992..>329963
                     /locus_tag="C5L36_0C01560"
                     /db_xref="GeneID:40384003"
     mRNA            <328992..>329963
                     /locus_tag="C5L36_0C01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465825.1"
                     /db_xref="GeneID:40384003"
     CDS             328992..329963
                     /locus_tag="C5L36_0C01560"
                     /inference="similar to AA sequence:RefSeq:NP_012220.3"
                     /note="PKUD0C01560; similar to Saccharomyces cerevisiae
                     YIL044C (AGE2); ancestral locus Anc_7.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321685.1"
                     /db_xref="GeneID:40384003"
                     /translation="MSHMKSNAQTARNKARLMELLKDPSNKHCADCKVSKNPRWASWN
                     LGLFICIRCSGIHRSLGTHITRVKSVDLDSWTDEQTESMCNWGNSKANQYWEAKLNDG
                     RGDYVPVEGKVESFVRTKYVLGKWKADGERNPDRFSSNNGTAARTNITSSTNASTNIS
                     TSTTKSSSLGSPLDDSINSLLDIAPTPTAQSVESAHSNPVSLHSMSSLNTSTHSINRS
                     KTNPTISLLEQQPPLRSHSRNENKYNNNGNSNNRHELKKSILSLYSTPTPSQSNVSLT
                     NNSPVSVPSTATSSANVNTANSNIWNTPAIATSKTYVPEDPFKNVWN"
     gene            complement(<330069..>333797)
                     /locus_tag="C5L36_0C01570"
                     /db_xref="GeneID:40384004"
     mRNA            complement(<330069..>333797)
                     /locus_tag="C5L36_0C01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465826.1"
                     /db_xref="GeneID:40384004"
     CDS             complement(330069..333797)
                     /locus_tag="C5L36_0C01570"
                     /inference="similar to AA sequence:RefSeq:NP_013663.1"
                     /note="PKUD0C01570; similar to Saccharomyces cerevisiae
                     YML049C (RSE1); ancestral locus Anc_1.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321686.1"
                     /db_xref="GeneID:40384004"
                     /translation="MADINPDFSLYHLTLKQQSGSVGSIIGNFSGLQKSQEVVIATQT
                     SLQLWKFDKGTKAFKKALFQNAFANITNIAVYPTSSKDLILLVSDAGALTIVEYLANK
                     NKFHTLKNEIFYKTGVRRTSPIEYIASDLRGRAVMLGAIERTKLVFTILQNGESNLVH
                     VNSPIEMNRSDVLTFDMKAMDTGLENPIFATIETEYSSPTQKLLNYYEFDLGLNHVML
                     LESETIRHSSNHIIPVPGGVHGPSGIFLCSEGMIQYKCPFKPTHYVPIPTRAGNSNLR
                     SFIVASVVHKMKNGFFCLAQNQFGDIFKIIVDFLSPQERSFDIMDERESGPGMVTSIT
                     VKYFDTIPVCKSLLILKSGFLLADCEAGDRHVYQFEKLGDGDDNEWNSQDYPDELSVM
                     EEEVKNLVFETKSLENIVLVNSNTMLHPMVEMKLSDGDFINNLPELYSLTGSKANSAV
                     KILHNSIQLSEIVTQDLPSKILGAFTTRIHNSDDYDKFIILSFFDGSIILRIGDEVEE
                     AENSGFIDTITTLNIQQIGDSSIVQIHATGFKQVFYDTHDEPVKSLDWNPPPNVEVLS
                     SSCTNTQVVLGLSNGDVVYFQTLEDNTLCENKVHKEFNSSIIGVVIGDIPQGKKFAPF
                     IVVTCKDCTLHVLSTDPRHMLETTTVERLESVASSLLITTFCSRGSVDGTLTTFVHVG
                     LRNGNYMRYSVLEDGTLVSMKKKFILHAPLRLFPVKVTNKNREVTTLTLINSKISFIV
                     VPEDHGDIKLISLPMPEKFIEPEEEDENENDEVAEYAKIYGCIASLHSADVPQGLLLT
                     HAGRLTIASMPELNVVDTSGEGCQDAVINTLRSMENIESINLRYTPRACIEHEKTKMT
                     YIACTDTQIASSSNDRGDPGADEITLYHTEENDELLKFQQCGYPTSPDSSASCIHVFS
                     SEKGAIGQTIELTNNEGAYRAGIATMERNGDIGDYLFVTTIANFRSPSDYKNTFVRVY
                     QILEDGSLDFVYKQEFPKPVLAIHPFQGLVLFGFGDELGLYQLGKLQLLRKGGLKMDS
                     YEIKDIVDIKSSGFRVFVSDIRTSVYVFTYDSTRNKFSLTFDDMIYRHVTRSVVLDHD
                     TIMLGDKFGTITTLRNNVNPKLGLLSSFYIGDTITSLMKKQIGIGGEEVVVYGGINGT
                     IGSLHTLKTVKEINFFKELEKLIRNTLDENGDFLIERDVLKFRSYYVPRRACIDGDLV
                     ELFLDMPDEMREKISSMMERPTALIDKRIVEMRSRVGY"
     gene            <334266..>337787
                     /locus_tag="C5L36_0C01580"
                     /db_xref="GeneID:40384005"
     mRNA            <334266..>337787
                     /locus_tag="C5L36_0C01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465827.1"
                     /db_xref="GeneID:40384005"
     CDS             334266..337787
                     /locus_tag="C5L36_0C01580"
                     /inference="similar to AA sequence:RefSeq:NP_010612.2"
                     /note="PKUD0C01580; similar to Saccharomyces cerevisiae
                     YDR325W (YCG1); ancestral locus Anc_5.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321687.1"
                     /db_xref="GeneID:40384005"
                     /translation="MEDELEEDGDIDAAIKKADAKKKQSTVKQRREYLNLVSNITTPE
                     DLETLMRKTFMESQTTVAAHKRELVILKALMVRAYALELNDKFNMTFCKLLSKILPLK
                     RNIKPADKVVKFVSSFFENINPLKIRDGEELQVPIPASAFEEVHALFINKVVKYLMKG
                     LDAKDTTVRYRSCQLLYHIIGNSGAMDEDLYESISDELSTKVYDKDAAVRVKAIAALA
                     CFQNEDGGSLSVAGKKIRFIMQNDLNAEVRRACLKHIEKNRYTEPFIVERARDVDTVN
                     RRTLYTKILPTYSSVTEISSANRNKLLEWGLRDRDESVRNACANWLTNTWMSNANNNI
                     MEFLDQLNVTESEIADTAVRVLLNRNTEIVNTFEFSKEFYDNLTPSLALLLRVTYEYC
                     HDNQKEDVIDRLYPEAAEFAVLFEKFFVERTDNLQKISENREKLENDPNIVKELEIVD
                     PDDYDYIVKQLLMIAVDYDYSDEFGRNKMYSILRSTLANNTITEPLLPLLMECLRKLA
                     VNERDFCQMTVEIINDLKDNAYEKLMQEKKMEETQRRRESEEQRKRRKRRYGNEEEEE
                     GDKGEEDLDKGNHEVSDLNERVAKLLNDDGDISDEQDSDDDSDEYHSAVNEMSRQSII
                     EANKSRQEEIDQVSALPPQVLTDCLTITKCMLQLVFSPLRENMLLISLLDNFIVPCVN
                     ERSEVEVRELALICHGLCGLLDKEVAVSTMVVAGIFVTRSDYESFVVTGLKVIGDLLT
                     IHGISILQSESQISIDSMAVAKVFYRTLKDQSKPEAQTTVAITLFKLFLCGVITDDEL
                     FETTLLAYFNPKVNNNPSLKQCLTFCIPTYAFSHQDHQELIANIVYDTISRIYKDWPE
                     IQRLNQENEIKKPITANFIIESLLYWTDPYNLAMVDEEEMEKSSNHLDVGIQFMKLLR
                     NFDYNNKLHRTLYKPILRALSKLTFTSKADLTKLRKFSQCFDDETLCQGDLDEVLKGD
                     AICKTNFLKSHTYVQDCLRDAEARAEANADTDDIVDAENNEANTEVENEATKNNVNSH
                     EAVSGGHRPGKALSLHEDTSQIGSSHSTSNNTNAFNGEEKSDSSAVTVKRETKEEDNG
                     DRVAEVGQELGASDSPVEVVQVIRKGRKTKKKGKSTTREHGSISKKSRKSTKGRKKLD
                     DEYVVNLGRDSVKTHQDTSEIILLDSE"
     gene            <337993..>340360
                     /locus_tag="C5L36_0C01590"
                     /db_xref="GeneID:40384006"
     mRNA            join(<337993..338173,338796..>340360)
                     /locus_tag="C5L36_0C01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465828.1"
                     /db_xref="GeneID:40384006"
     CDS             join(337993..338173,338796..340360)
                     /locus_tag="C5L36_0C01590"
                     /note="PKUD0C01590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321688.1"
                     /db_xref="GeneID:40384006"
                     /translation="MAQLSFQASNAIIYLTYGAMLFSGIAVAWYQLTRTSKGKNFLSS
                     NGTSTGIPLALNFIASAMGCGILTSYTEIANIAGIQGLLVYVLAGGVPIAMFGLFGPI
                     IRRRCPDGFVLTEWCRQRFGPIMGYGLSAATVLTIFLFMVGELTAINGAIETMTGISA
                     IPCVVVECVVTTIYTSMGGFAVSFTTDTLQACFVLLVLIISCIGYGTQVHIDPALKHE
                     TYHQLMGSTRIGWMNFYILNVAILTNDALMSGFWLRTFAARTSKDLYIATGIASVVTT
                     IICCLVGIPGILTVWTGDCTIGDPNGAYSFYILIAKMDKWIIGIVLIFCVVISTCTFD
                     SLQSAVTSTISNDVFRNKFPIIYSRALVIVLMIPALMVAIFCSANVLQIYYIADLLSC
                     SIIPIMFLGLSKHFYFLRGLDVIVGCLGSLLAVFIFGTIYYGSAKQGGLLLLIWNGTY
                     DPNDWGAFGAFVITTFGCVVFGHLCAAVRIGITYLYCKYTGSEFRALDKPNNIAFGIG
                     LDNKDDTVVTEFHEVPETESDEVSSIHKSVDVETTYDVHHLISSPRAATRAHIQLVHD
                     VISEIEWKELLHLLV"
     gene            <340661..>341731
                     /locus_tag="C5L36_0C01600"
                     /db_xref="GeneID:40384007"
     mRNA            <340661..>341731
                     /locus_tag="C5L36_0C01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465829.1"
                     /db_xref="GeneID:40384007"
     CDS             340661..341731
                     /locus_tag="C5L36_0C01600"
                     /inference="similar to AA sequence:RefSeq:NP_012964.2"
                     /note="PKUD0C01600; similar to Saccharomyces cerevisiae
                     YKR038C (KAE1); ancestral locus Anc_1.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321689.1"
                     /db_xref="GeneID:40384007"
                     /translation="MHLNFDLRAKPGQEWFIGLGMEGSANKIAVGIVKQPLGDPSKSE
                     NRAVILSNVRDTYNAPPGQGFMPRDVARHHRNWVVRIVKRAIEEAQIEITDIDCICFT
                     QGPGMGAPLQSVVIAARTLSMLWKVPLVGVNHCVGHIEMGREVTGADNPVVLYVSGGN
                     TQVIAYSRQRYRIFGETLDIAVGNCLDRFARVLKIPNAPSPGYNIEQLAKRGSKFVEL
                     PYTVKGMDISMSGILEYIEEIARRGTEKVEDLCYSLQECLFAMLVEITERAMAHVNSN
                     QALIVGGVGCNERLQEMMAIMARDRGGAVFATDERFCIDNGVMIAQAGLLEYRMGGAT
                     LVEDSVCSQKFRTDDVFVRWRE"
     gene            <341995..>343980
                     /locus_tag="C5L36_0C01610"
                     /db_xref="GeneID:40384008"
     mRNA            <341995..>343980
                     /locus_tag="C5L36_0C01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465830.1"
                     /db_xref="GeneID:40384008"
     CDS             341995..343980
                     /locus_tag="C5L36_0C01610"
                     /inference="similar to AA sequence:RefSeq:NP_012423.1"
                     /note="PKUD0C01610; similar to Saccharomyces cerevisiae
                     YJL112W (MDV1) and YKR036C (CAF4); ancestral locus
                     Anc_1.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321690.1"
                     /db_xref="GeneID:40384008"
                     /translation="MDINNDLAKLATTASVLVNSATANANINDMLQRNRTYASTFDAR
                     KTEAGNQPGLINLLAIHGDNIRVAKSLKRSNFTGDGSKKKDFTVLTNDMLKDIPDSEL
                     ENDSQRSDNTDETPFSLFQGFSAVLPEVDETIKIIKENSGKMIEGSKGNKRNGKATTL
                     ASSKRHMIENITIDKIKMCQNQRVLLGYKSDINYYLDLLEIRKGLGKSEISEIDAKID
                     RLYMRRKELSENIGLYEKQEMELENHLLEIKDRLDFIKDIEISEEPVRITRNDLNEDD
                     EFAMNSDKNKTNANKDKIKTKTKNKNKNNSKIEEEEFVLLDEKETYSRKTSTTRSFKS
                     GDLIHKFEAHHDPINCIAFDEPYGRLITCSMDNTVRLWDMGRYKCIGLLEGHFASVDC
                     VSIQDDLAFTGSRDATLKMWNLNYFNSKNTEEETPLIHSFEGHVDTVTAVSYNNGELV
                     SGSDDKTIRQWDLSTGHLLQTIDIMWASSMANSTISFGKPSAQNSSGGNIISNQSAYP
                     YISSLQVFDAALASGGNDGVVRLWDLRSGEVIRQLIGHTGAITTLQFDKHFNLVTGSA
                     DRSVRVWDLRTGGLLDSFSYESPIKKIVFDDFKIASVVENQHGIHIYDRSEQRHWKVG
                     AEDSSLPVGVSDTNDIACQGNYLVEGSSDGVVRVWNV"
     gene            <344223..>345875
                     /locus_tag="C5L36_0C01620"
                     /db_xref="GeneID:40384009"
     mRNA            <344223..>345875
                     /locus_tag="C5L36_0C01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465831.1"
                     /db_xref="GeneID:40384009"
     CDS             344223..345875
                     /locus_tag="C5L36_0C01620"
                     /inference="similar to AA sequence:RefSeq:NP_012424.1"
                     /note="PKUD0C01620; similar to Saccharomyces cerevisiae
                     YJL111W (CCT7); ancestral locus Anc_1.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321691.1"
                     /db_xref="GeneID:40384009"
                     /translation="MSYRQTPTIVVLKEGTDASQGRGQIISNINACLAIQDTLKTTLG
                     PFGSDLLLVGGDGKTTITNDGATILKKLDVVHPAAKILVDISRSQDCEIGDGTTSVCL
                     LASEILKHCKPYIEEGMSSNSIVKGLRDSVHLAVQKIKELEINLDEKSVDDEYDMLIK
                     CALTAMNSKIIQQNGEFYSKLVVDSVLTLDRDDLDENLIGIKKLPGGAMEESLFIQGV
                     AFKKTFSYAGFEQQPKTFQNPKILNLNVELELKAEKDNAEVRINKVEDYQKIVDAEWE
                     IIMDKLNKIVESGCNVVLSKLPIGDLATQFFADRGIFCAGRVSSDDLERTHKAVGGSI
                     LTSVNDIKPEHDLGTCEKFEELQIGGERYNIFNGCPLTKTCTLILRGGSIKIIDEIER
                     SLHDAIMIVKRALKNKQIVAGGGAIEMELSKYLRDYSHQVKGKKQLIIQSYARALEII
                     PRQLCENAGLDSIELLNKLRSLHANGEIYAGLDLDSDNVANNLEKFVWEPSVVKINAL
                     QSATEAAILVLSVDETIQNKDSEQASAAPVPRGRGMPMPAGM"
     gene            complement(<346471..>347094)
                     /locus_tag="C5L36_0C01630"
                     /db_xref="GeneID:40384010"
     mRNA            complement(<346471..>347094)
                     /locus_tag="C5L36_0C01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465832.1"
                     /db_xref="GeneID:40384010"
     CDS             complement(346471..347094)
                     /locus_tag="C5L36_0C01630"
                     /inference="similar to AA sequence:RefSeq:NP_014530.1"
                     /note="PKUD0C01630; similar to Saccharomyces cerevisiae
                     YOL111C (MDY2); ancestral locus Anc_3.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321692.1"
                     /db_xref="GeneID:40384010"
                     /translation="MSTEVQFANQFVQLLQVTKPTPEEQDAFLNGFRIQSVNSIPATL
                     TFPPLKHPYIATSTKAESIENNEEEMQFSINVTFKSLKPPRFNISVSTDITTNTKFYH
                     LKHVLANALKDQHIGIVDLADVKLMIRAKTMQDSDAVSTFLDGDKLALNVLVSKVKPL
                     EEEVEHVEQVQKGVSDESWEKIRNVLLSDLEDVSKVDQLISSMKKLV"
     gene            <347299..>347862
                     /locus_tag="C5L36_0C01640"
                     /db_xref="GeneID:40384011"
     mRNA            <347299..>347862
                     /locus_tag="C5L36_0C01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465833.1"
                     /db_xref="GeneID:40384011"
     CDS             347299..347862
                     /locus_tag="C5L36_0C01640"
                     /inference="similar to AA sequence:RefSeq:NP_014531.1"
                     /note="PKUD0C01640; similar to Saccharomyces cerevisiae
                     YOL110W (SHR5); ancestral locus Anc_3.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321693.1"
                     /db_xref="GeneID:40384011"
                     /translation="MDEFYNYHEYACPENDNIIITHHPNPYTSDGTRVVRIPLLPEPS
                     YPQFSTQLPGNEPAAIPSDANHFRGIYTWKGQHFGMGSISPLSNYITRAEFESIVTKI
                     NSLLWERFGNTWFNFWWVIINMLMYDLPRGSVRIWTFLTGTKDKLESYINEVNKRFDR
                     EDRNIRIVSPEKNGFVSLDWIIPSQAA"
     gene            complement(<347988..>349625)
                     /locus_tag="C5L36_0C01650"
                     /db_xref="GeneID:40384012"
     mRNA            complement(<347988..>349625)
                     /locus_tag="C5L36_0C01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465834.1"
                     /db_xref="GeneID:40384012"
     CDS             complement(347988..349625)
                     /locus_tag="C5L36_0C01650"
                     /inference="similar to AA sequence:RefSeq:NP_014106.1"
                     /note="PKUD0C01650; similar to Saccharomyces cerevisiae
                     YNL293W (MSB3) and YOL112W (MSB4); ancestral locus
                     Anc_3.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321694.1"
                     /db_xref="GeneID:40384012"
                     /translation="MHSRTTSAATAATGTTYGFLDYYTNATDEEDIEETENQVANTQQ
                     MEHTHMASAYITKHETKESIVESRRDFASLKERINSGMSIKESPLPFRKSAMKQSIKN
                     STTDRYGFQKTNQYISTKDYNDWWNEYCPYLIRRKAKWIKFLERNGLYYEPNLVPSRF
                     PARSEEMARFVRKGIPAEWRGKAWFSFVGGVEKMKDNKGLYEALVNESTDLVNENTEA
                     IEKDLHRTFPDNVYFKEQNSSMLDTLRRVLKCFSMFKPSIGYCQSLNFIAGLLLLFMN
                     EEETFWMLVIVTEKFLPGVHESNLEGLSVNQGMLMLCLKQYLPDVWKIIMDNDDLGDI
                     PDDDTSYLFFLPTLTFCTTSWFMSLFIGVLPIETTLRIWDIIFYHNSKTIFQVSLGIF
                     KMLDPELRKFYCRAHGISTLFTHSDTDLTLKSTRLQENNRDVLGSDLFQLIQNTPKRV
                     INTNLFIDTYVQNTFTQEEIRRCREFVVQSRQRHANLIDRRKELGMTHEERKELLKQE
                     RGVISGVWEERRMRTGLWNVGLNRRIKKIYSKGPPPK"
     gene            <349873..>350907
                     /locus_tag="C5L36_0C01660"
                     /db_xref="GeneID:40384013"
     mRNA            <349873..>350907
                     /locus_tag="C5L36_0C01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465835.1"
                     /db_xref="GeneID:40384013"
     CDS             349873..350907
                     /locus_tag="C5L36_0C01660"
                     /note="PKUD0C01660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321695.1"
                     /db_xref="GeneID:40384013"
                     /translation="MYFPFPQFPPSSNQFNLVVDVEQQRSYGIYVLYEVNRNMNGKRI
                     VIVHCGAGGKLPSSVERRLVRVVKKAFEAGVGDGHNDRFANIARVLEDSPLTNTGYGS
                     NICSDGTVRCDSSVVQCTPRGMKMGSVVCNSSRYPMEDALSVMNESLRVSKEGIVSPM
                     VKVGDLVPDPQLVSKLQQNVYERAGDTIGVLLFEEVDKEWIITTGSSSGGNIMRDWRR
                     IGSAGIPGSGCWTETMDFDEGGTNVVSIMVSGQGEELIKRDFARYISKNMLKYINNEG
                     MFVSDALEMSLNDMGRETRQLQWGVAGLAVIDGRPIGFFRGNSRSFVVGGSNSRVRLV
                     QNSGYGEILL"
     gene            <351186..>352874
                     /locus_tag="C5L36_0C01670"
                     /db_xref="GeneID:40384014"
     mRNA            <351186..>352874
                     /locus_tag="C5L36_0C01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465836.1"
                     /db_xref="GeneID:40384014"
     CDS             351186..352874
                     /locus_tag="C5L36_0C01670"
                     /inference="similar to AA sequence:RefSeq:NP_010249.1"
                     /note="PKUD0C01670; similar to Saccharomyces cerevisiae
                     YDL035C (GPR1); ancestral locus Anc_3.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321696.1"
                     /db_xref="GeneID:40384014"
                     /translation="MFRKEFSTIISHNEVKDLRIVAISSSTTSILAWFFFLYLYGMIH
                     PSRRNFRHNLIFVLIFFDFIKAIVILLYSTITYHNGLDNNNVLSDVLGWFIVFSIEGA
                     DVIILSFALHMAFLVFDTQLKKACQRLKDLTGIEKCPTERLSEWLNKNPDNLEGGLYK
                     FRFVVYFVCLFFPIMMASLSFTLHDPYMGYIYMPFFRVYTVAWHFSWVVRHIILVSIL
                     AIYVTIYVYVMCQFRKVSQSFIREGKEHEDENMLRYTFGETVWFKLLKVCIRISSKFA
                     RRHDKRTENDNDPHTGNVNGAVSSSDETLGLPNSGAVQNNDVSGQIQSILYQEATDRF
                     NARKLQIMKQMKSIFIYPISFFLLWLLPLINHYQVIRTGHETLWSTAPSAFFQPFNCF
                     VDALVFMYREKPWLLTVSESFLDTTDVGWRRHVSFLPGYGSYGETVYVEELGLNEAVY
                     NEGSPMCGHQGSSDEATPRSKDDKDEDSLDLKDFLNASKPMRVSNSKRHYSKQRSSSS
                     SQTHRMSTMSLSSSSNKSPVELIPAPTRVRESINWNLDMFEDKTIDMRDFLNGK"
     gene            complement(<353015..>355309)
                     /locus_tag="C5L36_0C01680"
                     /db_xref="GeneID:40384015"
     mRNA            complement(<353015..>355309)
                     /locus_tag="C5L36_0C01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465837.1"
                     /db_xref="GeneID:40384015"
     CDS             complement(353015..355309)
                     /locus_tag="C5L36_0C01680"
                     /note="PKUD0C01680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321697.1"
                     /db_xref="GeneID:40384015"
                     /translation="MDPLPAYNVSRQNKSKLRLYRNPTDLGDAAPVTLPNPRNMPDES
                     MQRASTLPVTKSESPSASIYSDIQYFDSGDDSKLKKQAKQKKNKLLRFTKKAGKFASD
                     IAFGSAMEDDTGYITHPFIPHVGGHGFKSSKPTLKPQLEEEYQKKLHNIRSQTESHGM
                     MYYHDYLRFFLKYMDESEPNDPCNYAITRNSLWWDWLQSYLKEVLRTLQTRQRAIDAK
                     KLEDGNSETTATIESPDRNLKRSQTSSSSLSSSSHQVEIEELRKKLKSLPTIEEIEAE
                     IFQDRRIVLLLLWHNQILDKLSLRTSTLSKILKRYPKDSEICVITTNKLKSFRASPKA
                     KLRKLFKNHILPAYLELIDGWNIRHDFPDYRTNMVSLTDRFQSILDLKSTGYLPEKLV
                     GENPHFCDYSFLSEEFVNSKMDKRERTFLSKYSSFTAPSMERLPLKDESQSLIFAPDF
                     SRLVLTKSDVDAGLIEFDRVLKPGGSISLIMFDSLSYTHTPNVDNEVTLAQYIQIYIN
                     QCITKLSKLPKISEYILSSLQSHNFKNVKFVKLGIPAIGTFTDDFDKEKLDNSRITGQ
                     KQPSNSMKNRPHVLSSTSTLKPAGTSVSTNSTDLFDYHENYDPARVEDTLPNISDQPI
                     ASVYSMYSSFIEFLRVSQLVDLHSWMNDPVEGKVRSSTMNGVAAVSDITATILEMWLD
                     WKLNNFNGQFVKEIIVERLIDSVDKDGYDGELGVRILNTDGNFWCNPQNGEVSAWYDS
                     HHGEFNDGFVLGLDSVFLVTAEKL"
     gene            complement(<355583..>356503)
                     /locus_tag="C5L36_0C01690"
                     /db_xref="GeneID:40384016"
     mRNA            complement(<355583..>356503)
                     /locus_tag="C5L36_0C01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465838.1"
                     /db_xref="GeneID:40384016"
     CDS             complement(355583..356503)
                     /locus_tag="C5L36_0C01690"
                     /inference="similar to AA sequence:RefSeq:NP_011294.1"
                     /note="PKUD0C01690; similar to Saccharomyces cerevisiae
                     YGL221C (NIF3); ancestral locus Anc_3.531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321698.1"
                     /db_xref="GeneID:40384016"
                     /translation="MDCFLSLLGWQGQKCKEKFKHRHTHTYRMPLSRPSLKQVTSLLN
                     KLYPLKYADNSWDNTGLLIDASVATSNEKPRLLLAIDLTEAVAQEAIDQKCNVIVAYH
                     PFLFRKFNRISPETNPQQRTLVKLLQHEISVYSPHTAVDAAAGGVNDWLVEGVSKGSE
                     FTSEVIIRDESNVEGVGMGRLVTLKSPVSILEIVSRIKVSLDLDHVQLGTRNINQMVS
                     TIAICAGSGSSVFSGVDADCYYTGELSHHEQLAYVEQDKSLVICGHSNTERGFLSVMA
                     AKIAENVHELETGADSILVSKTDCSPFQTV"
     gene            <356724..>356990
                     /locus_tag="C5L36_0C01700"
                     /db_xref="GeneID:40384017"
     mRNA            <356724..>356990
                     /locus_tag="C5L36_0C01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465839.1"
                     /db_xref="GeneID:40384017"
     CDS             356724..356990
                     /locus_tag="C5L36_0C01700"
                     /inference="similar to AA sequence:RefSeq:NP_011295.1"
                     /note="PKUD0C01700; similar to Saccharomyces cerevisiae
                     YGL220W (FRA2); ancestral locus Anc_3.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321699.1"
                     /db_xref="GeneID:40384017"
                     /translation="MSLTAESLSDIIRSRLEATEVEVQDMSGGCGQAFAVIIVSDVFQ
                     GKNKLARHRLVNSALKDEISAIHAFTQKVFTVAEWEEQKKLFSQ"
     gene            complement(<357235..>358824)
                     /locus_tag="C5L36_0C01710"
                     /db_xref="GeneID:40384018"
     mRNA            complement(<357235..>358824)
                     /locus_tag="C5L36_0C01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465840.1"
                     /db_xref="GeneID:40384018"
     CDS             complement(357235..358824)
                     /locus_tag="C5L36_0C01710"
                     /inference="similar to AA sequence:RefSeq:NP_011296.1"
                     /note="PKUD0C01710; similar to Saccharomyces cerevisiae
                     YGL219C (MDM34); ancestral locus Anc_3.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321700.1"
                     /db_xref="GeneID:40384018"
                     /translation="MSFKLDWNAIEKDSFATYTTELLEEALNSGKRPPILSDDIKIVD
                     LNFGTIAPNFQILEIGDLGVDKFRGIFNFKYYGDASITVRTKISASLLKNYNNNIGEE
                     YDFIKPAFVVSDCDFDIPLNLTLSNFKMSSIMIIVFSKTKGLTLVFKNDPLENIDVSS
                     TFDRITPIANFLQKKIESKISDLFKEFLPSLLYKFSLKYTTQSFDQFHKDLLIEEQVD
                     DKRKNKVLLKDLDPENPFRISPGSLMRSTRLSSMRQTLSLGNGIDKLSCDRFNKDIIT
                     KAFMNILNKSNNYNSNRVELSEHDFEFGNVHDKLIFIKNFQSKASKNSTKPKRRIIKM
                     NVKKPQVNGEEKQQDQEEMQEEVTDKGVNTTPSPVSTTPVSGYATSVELNKSANTSVF
                     SESEVDTSPATTIRSNSRSTSVSRSTSTRPSFSSSGRPSLAPLSTPMSRKSTSNKTAD
                     LERRSSTSKSRRPSTNTSTHLQMSQARKYDPYMADEREIRRRLVKLDRLVRNTNSKSP
                     RLMLSTTCIGSDTDIPPPYTG"
     gene            complement(<359831..>362230)
                     /locus_tag="C5L36_0C01720"
                     /db_xref="GeneID:40384019"
     mRNA            complement(<359831..>362230)
                     /locus_tag="C5L36_0C01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465841.1"
                     /db_xref="GeneID:40384019"
     CDS             complement(359831..362230)
                     /locus_tag="C5L36_0C01720"
                     /note="PKUD0C01720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321701.1"
                     /db_xref="GeneID:40384019"
                     /translation="MLPEEANHDIHSVFNWISLITGKHVATLETISDGILLIHLINKL
                     CRTSIVPTFSLSEYEDIFPKAKAKKTLSKFQRVSNVNVLMDWLNNDRKSPYFGSSQSG
                     DNAILGVTCMDIVESNDGYMTKFLWSLFWDFSLFIREPAQKDMQVIKTEFLKTWLLQF
                     VSDINDFKASTWLTEKKLDELLNALELHGEEVQQDYGLSLFIDENSDEWSVYVYLCCL
                     YETQKDKHPFIESREDTESEKGGEFVDFFGPNILSKASAISEHNYNMPLKLKIETFTV
                     IVLDIIRLKKRYLRKVEKVLFELLEVFGEFVAYDNLEYSDDANIPQILSVNDIESAEK
                     LMVNSTHINGSLNKAIESISFVENYRRSTKRRVYEQYVELQILRSQLQDVLATYHLHE
                     FVDPPQKSIEKLTKFIELLKKSETNVYDNAQSFVNGTINKLTSNIVETSSLLNVKLDN
                     LEEQILQINQSCWETRVQQFQSIKMEKIYELHLKTVHYQHQLQLINTSLAKGFDLNSS
                     MIINNQRNRIQFLEDCINKSLTNMKYIETQKSDAVEVLKIAEAAEKYKSEINGLSEDD
                     EQLKVHLFVLKLIQKKFHFQNIDPIRVLFDSHDTATKGYLTKSEFRRAFLKAYPDTEK
                     LGGLEEIDTIFETSYEVVGKMRKSMEFPQFKAIISLGASMEDVNIKEVIECESEDDTI
                     SVSSRTSQFTRLIAEMENMPITTNLTSDYFLKEFNKLSSDKEVISKEDVNKINMNKHL
                     EKHLEAIFPNRRYTLWFRQIEESTLYQDEESDEKTIVEEREIPLKNVLYELEKVDLNK
                     L"
     gene            complement(<362559..>363605)
                     /locus_tag="C5L36_0C01725"
                     /db_xref="GeneID:40384020"
     mRNA            complement(<362559..>363605)
                     /locus_tag="C5L36_0C01725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465842.1"
                     /db_xref="GeneID:40384020"
     CDS             complement(362559..363605)
                     /locus_tag="C5L36_0C01725"
                     /inference="similar to AA sequence:RefSeq:NP_014704.1"
                     /note="PKUD0C01725; similar to Saccharomyces cerevisiae
                     YOR061W (CKA2); ancestral locus Anc_5.662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321702.1"
                     /db_xref="GeneID:40384020"
                     /translation="MKHLQKKWQNRIHLLTMDTNSAGNKIYSVARVYADANERRPKSY
                     WDYENTTLSWGDIGNYEIISKIGRGKYSEVFTGVNVNNDKPCVIKVLKPVKLKKIYRE
                     ITILKNLTGGPNIINLYDLIQDRDSKIPALIFEKVNNVDFRILYPKFQIPDLQYYFTQ
                     LLTALDYSHSMGIIHRDVKPQNIMIDPVNKQLKLIDWGLAEFYHRGMDFNVRVASRYH
                     KGPELLINLQQYDYSLDLWSVGAMFAAIVFKKEPFFKGDSNPDQLVKIAQVLGTDDLM
                     KYVNKYRIRLSSEYDDILGQYPRKPWSAFVNKDNKAMATAPHVIDLIDHLLVYDHQLR
                     LTAKEAMAHPFFSS"
     gene            complement(<363792..>364835)
                     /locus_tag="C5L36_0C01730"
                     /db_xref="GeneID:40384021"
     mRNA            complement(<363792..>364835)
                     /locus_tag="C5L36_0C01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465843.1"
                     /db_xref="GeneID:40384021"
     CDS             complement(363792..364835)
                     /locus_tag="C5L36_0C01730"
                     /inference="similar to AA sequence:RefSeq:NP_011626.1"
                     /note="PKUD0C01730; similar to Saccharomyces cerevisiae
                     YGR111W; ancestral locus Anc_3.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321703.1"
                     /db_xref="GeneID:40384021"
                     /translation="MCTFEETTDRPTIEACQAANYKTWGQPFTLKQYQYRDWLNYSTD
                     YDKLGVNDHYFILKNDKGAVVSACEVIMRDSVVKTKDGLQKARTGTIGSVYTPHEYRG
                     QGYASKLLTELSKHLDTKYLSNEWDCCLLYSEIGDYYSKWGWIDHSVKVRDLSCTNYI
                     YTGTYENVVEIKNDFREVVEDFQKLLVEDLSQTEEPAFVVVPTEGLYGWWTNRVRVSY
                     WATHEPDGKEPKDSLRKDSVLYPITMGFKFIDDTDKLNYIVVSPLFHKLECSILVLVS
                     YGKKQEETLLSLVSSKCKEWGIPKLHVWEGTLKYITPTEPLTKNGSLSYVRFRGGKHV
                     DAKWVGNGEWVWF"
     gene            <365666..>366907
                     /locus_tag="C5L36_0C01735"
                     /db_xref="GeneID:40384022"
     mRNA            <365666..>366907
                     /locus_tag="C5L36_0C01735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465844.1"
                     /db_xref="GeneID:40384022"
     CDS             365666..366907
                     /locus_tag="C5L36_0C01735"
                     /note="PKUD0C01735; Pfam Domains: SPX(2.1e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321704.1"
                     /db_xref="GeneID:40384022"
                     /translation="MKFAKLFQQVLNEEHVPEEWINRAIQYKQLKKRINKVVEELENV
                     GISKDDENVTYSLELIGDTVHPILKICLSPLLRTLILDKINSMGYEYEIKPLKIEELD
                     NTSVCTTINPFDDDNIHYELKISLLQDSKFFQVLYDEIEDLDKFKEERETEITKDVEN
                     LANNIGSVAAPKIKKSDMYIWREIFQFYIESEIFFSTVEREAGEINIEVSRERYFKFL
                     KHLHETKIVTKFQQKQSFLAFEKFKQMNFEVMKISNYQTFNNMAVRKILKKFDKQTHL
                     TSKEIFPELIKSHANILNGSIAKDICFIIANRLLTVVPQIDDYLCPICCSIAFKPIRL
                     RCGHLFCIRCLVKLRRKHEDKCPLCREECLLSLTVDDLDIAQMNYMKMFFPKEVREKE
                     VENDKEIIKETYGTTKPCVIM"
     gene            <367543..>369180
                     /locus_tag="C5L36_0C01740"
                     /db_xref="GeneID:40384023"
     mRNA            <367543..>369180
                     /locus_tag="C5L36_0C01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465845.1"
                     /db_xref="GeneID:40384023"
     CDS             367543..369180
                     /locus_tag="C5L36_0C01740"
                     /note="PKUD0C01740; Pfam Domains:
                     Sugar_tr(3.9e-142)|MFS_1(1.1e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321705.1"
                     /db_xref="GeneID:40384023"
                     /translation="MSIESTNSLQDLDSAEKVNSQLQSKYTERADAPLTWKTWIICGF
                     GSFGGIFFGYDSGYISGVMGMDYFITEFTGKVKGGPEPFVLDAWQKSLITSILSAGTF
                     FGALFAGDTADWYGRRLTIICSCIIFIIGVILQTASSTVALLAVGRVIAGFGVGGVSS
                     TIILYMSEITPKKVRGATVSGYQFCVTLGLLIASCVDYGTKNRTDSGSYRIPIALQML
                     WAIILMVGLFLLPETPRFFVKKGDIAKAAKVLSFLRQQPEESDYVQEELAEIIENHER
                     ESALIPTRSYIQSWTACFTGSLRDQSSNLRRTILGTSLQMMQQWTGINFIFYFGTTFF
                     QELGTIKNEFLISIITTLVNVCSTPLSFYTVEKLGRRTLLIYGAVGMVVCEFIVAIAG
                     TVDGKNHETVSAMIAFICIYIFFFASTWGPGAWVVIGEIFPLPIRSRGVGLSTASNWL
                     WNCIISVITPYMVGEDKGNLGAKVFFIWGSLCGCCLVYAIFLVPETKGLTLEEIDIML
                     SETNAFTSSKWTPHFVNDIDDYQKPKTEHMEDTTSVV"
     gene            <370735..>372372
                     /locus_tag="C5L36_0C01750"
                     /db_xref="GeneID:40384024"
     mRNA            <370735..>372372
                     /locus_tag="C5L36_0C01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465846.1"
                     /db_xref="GeneID:40384024"
     CDS             370735..372372
                     /locus_tag="C5L36_0C01750"
                     /note="PKUD0C01750; Pfam Domains:
                     Sugar_tr(8.4e-141)|MFS_1(5.1e-27)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321706.1"
                     /db_xref="GeneID:40384024"
                     /translation="MSLKSPASIQELDSAEKINSVTENEYIERMEAPLTWKTYVICGF
                     GSFAGIFYGYDSGYISGVMGMDYFITEFTGKVKGGPEPFVLDAWQKSLITSILSAGTF
                     FGALFAGDTCDWYGRRTTIIFACLIFIIGAILQTASSTVALLVVGRVVAGLGVGGVSS
                     SVVLYMSEITPKKIRGAIVSGYQFCITIGLLIASCVDYGTKNRTDSGSYRIPIALQML
                     WAMILMIGLFLLPETPRFFVRKGDVAKAASVLGFLRQQPEDSDYVQEELAEIIESHER
                     ESALIPTRSYIQSWTACFTGSLRDQSSNLRRTILGTSLQMMQQCTGINFIFYFGTTFF
                     QELGTIKNEFLISIITSLVNVCSTPISFYLVEKLGRRPLLIYGAAGMVVCEFIVAIAG
                     TVDGGNPQTVSAMIAFICFYISFFASTWGPGAWVVTGEIFPLPIRSRAVGLSTASNWL
                     WNCIISVITPYMVGEDKGNLGAKVFFIWGSLCACGFVYAIMLIPETKGLTLEQVDLML
                     QETNAFTSAKWKPHSVDNTDEYIKSNTEHLEETVSIA"
     gene            <373682..>375283
                     /locus_tag="C5L36_0C01760"
                     /db_xref="GeneID:40384025"
     mRNA            <373682..>375283
                     /locus_tag="C5L36_0C01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465847.1"
                     /db_xref="GeneID:40384025"
     CDS             373682..375283
                     /locus_tag="C5L36_0C01760"
                     /note="PKUD0C01760; Pfam Domains:
                     FAD-oxidase_C(6.7e-63)|FAD_binding_4(2.3e-47)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321707.1"
                     /db_xref="GeneID:40384025"
                     /translation="MSRLFKVLKATQFKYVSSFLLGSTISGGVVYYNYKKSLNFSFPP
                     TSTTPITAAPPLQYGDVSKAISEITSKLGSSKITFSESEILHHSDSSFSTDHAKPHER
                     PHAVVYPESTEDVSEVLKICHTLKVPVVPFTGGTSLEGHFISTRNGISVDLSRMNKVL
                     AIHPEDLDAVVQPAVGWEELRDTLSDYNLLFGPDPGPGACIGGMVATSCSGTNAARYG
                     TMRENVVSVKVVLPDGTIVKTKRRPRKSSAGYNLTNLFIGSEGTLGIVTEVTLKLNVK
                     PKYESVALVSFDKLKDAAGSVTSFVQEGLQLNAIELLDDKMVHFVNESGETDLKYDEL
                     PTLLLKIGGSSPESVNLLIKTVERIVNANNAKTFKFASNEEEKYQLWNARKTALWSTI
                     EYGRRNIDKDIQVWTTDVAVPMSKFVEAVEETQKEIEESDLLASIVGHAGDGNYHTVI
                     LFKEEQRALAAKLVSNMVDRALAFDGTVSGEHGIGVGKKEFLIDEVGQESVDLMRKIK
                     FSIDPHKILNPDKVFSIDPVNDRSI"
     gene            <375833..>377701
                     /locus_tag="C5L36_0C01770"
                     /db_xref="GeneID:40384026"
     mRNA            <375833..>377701
                     /locus_tag="C5L36_0C01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465848.1"
                     /db_xref="GeneID:40384026"
     CDS             375833..377701
                     /locus_tag="C5L36_0C01770"
                     /note="PKUD0C01770; Pfam Domains:
                     Ferric_reduct(1.3e-29)|FAD_binding_8(1.8e-
                     16)|NAD_binding_6(8.5e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321708.1"
                     /db_xref="GeneID:40384026"
                     /translation="MYTGKDNVWTGKDILREGVWCLRDINTPEYQRLKEISQSETGKE
                     TRQVYGLYVVYFYSAVVFLFLIKRSIYYLLDASSGLGIKRKYFGERYYFKLLALTRWI
                     GYRKIPLLFCNAFQLPSSLGSILLIMVTCVYMLCHAFIPNTWYRQCMGFGLPPLAVRG
                     ALESTALFPIIIILSGKTNIISQVTNISYDKLNAFHRWTSIMCFLFAWIHAIPYYYQS
                     YREGGLELVAFNQKTDKYFQNGIPPIIFLTLITVFSHSFFRTLFYEIWLKLHWIFALG
                     MYISLFIHICSTVNTWKYLVATVVFWLTQLFWQTIRKGMWKFNQIPFKPSKCQMRKFL
                     PTQDNDVFEIIVENNNNFTWSPGQHCFIKLLKLKALERHPFSIVSCYDSAGSKDIKLI
                     VKACGSAGFTRVLYNKIPETGYADFDIFIDGPYGGCPRPVEAFESIFLIATGTGISAI
                     LPFLTQACQTIKENKGALKFVRLYWVIRNLENVEWILPELSYVVNSYTYLLAAHIIEI
                     NIFAKEGIIDVERNILKTLKSEIVTSSSEAESKGNSSSSISFCSDFVNIHYFKPSGSE
                     LIKKAKEELCSKNIFLVSGSDSMKKQVSNSVADLQSQVFKSSEISEIYLHTESFGL"
     gene            complement(<377794..>379365)
                     /locus_tag="C5L36_0C01780"
                     /db_xref="GeneID:40384027"
     mRNA            complement(<377794..>379365)
                     /locus_tag="C5L36_0C01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465849.1"
                     /db_xref="GeneID:40384027"
     CDS             complement(377794..379365)
                     /locus_tag="C5L36_0C01780"
                     /note="PKUD0C01780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321709.1"
                     /db_xref="GeneID:40384027"
                     /translation="MTISERPQFNIKSVAIIGAGPSGIASLHELSRVTRTGKSLFGLK
                     DISEYEEKGNTAFPKLVAFERNASVGGVWSKSAFGYNNKDPDLPIIEDDKIDLTKPEQ
                     IYKKYEIDKELEEKLEFSTYEKPIQIPLNENLETITKHQWRSSAAYEGLFTNVTNRFM
                     QFSFHEKTGDELKKLDYRYKNLPGFQYARDVGAYLEEAVETYNLEKYIRFNSNVERVQ
                     KTPTGKWEVIVSFMSEAEGKKYLNWYKEYFDAVIIGNGKTVPIVPSFKGLKQFAETNK
                     NKVTIKLAKSVQETTFIKNAKKLLFIGSSVSSIDLIQYAFPRDLDNPSVYISRRSATA
                     HLDWINGCTYSKGIVNKPTIEEFLPESNSIKFTDGTVESGFDVIVICCGYHMYYPFLT
                     NVSQDSLKWYQYTFWVDDPTLALVGNTYAGFFFNRVEAQGAALAGVWTNKHKLPDRES
                     QLKIIANKPQLSVGLINQEFINPLINLSLEGRPHPFDVDQSKSDHVAQICHAQLTIPD
                     LFYKIRDGLVDPMNL"
     gene            <379845..>381161
                     /locus_tag="C5L36_0C01790"
                     /db_xref="GeneID:40384028"
     mRNA            <379845..>381161
                     /locus_tag="C5L36_0C01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465850.1"
                     /db_xref="GeneID:40384028"
     CDS             379845..381161
                     /locus_tag="C5L36_0C01790"
                     /note="PKUD0C01790; Pfam Domains: TauD(1.6e-103)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321710.1"
                     /db_xref="GeneID:40384028"
                     /translation="MATKTQTYQHNTDASLTVHDDVSIDKQIEKLIRSHKELSITRSN
                     EANINFEGGPDSEGLKLLPASSRKRIEADGLDISKGYPEIPPRTQIPIFVDEAHAIRA
                     EDAPYIERAKNADPEKKALLGAAKEVIHLTKNVGTEIVGLQLADLTDQQKDELALLVA
                     ERVVVFFRDQKLPPTKQHELGSYLGNIEYHAQVPHVTGLPGATVIWNDYINKKDSKLN
                     FANANLANWDTLRYPGYGNQGWHTDLVHEHQPAGYTHLHLDAIPSIGGDTIWSSGYGA
                     YDKLSDEFKKFLDGKKAVYVSSHAYLDREDPLGGPKKIERVHPLVRTHPATGWKSLYV
                     NRGLTKRIIGVSPVESDLILNYLFDIYEKNADIQVRFKWSPTKEGYGTSAIWDNRISQ
                     HRAVWDHEGEESRHGTRVTSLAEVPFFDPESKSQREALGKPIHKWD"
     gene            <381618..>382898
                     /locus_tag="C5L36_0C01800"
                     /db_xref="GeneID:40384029"
     mRNA            <381618..>382898
                     /locus_tag="C5L36_0C01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465851.1"
                     /db_xref="GeneID:40384029"
     CDS             381618..382898
                     /locus_tag="C5L36_0C01800"
                     /note="PKUD0C01800; Pfam Domains: TauD(1.5e-96)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321711.1"
                     /db_xref="GeneID:40384029"
                     /translation="MTTIDTFGNNLSKNFEIVNDLPVEQQLETIFRNRNSKTPTGPDP
                     VGLEILPESTKKRLEDDNIEISQGYPEIPPSENIPIYVDEVLKIRSFETPYDDRAKNA
                     DPEKKALFGAAKEVIHLTKNIGTEIVGLQLVDLTDEQKNELALLVSERVVVFFRNQKL
                     PPSQQKALGSYWGKVEVHPQATHVNGIPGTTVLWSDYSKKKGNKANFANNGLQNWDVL
                     RYQHQGPFAWHTDLVHELQPAGYTHLHLDAIPSLGGDTTWASGYAAYDKLSDEFKNFL
                     DGKQVELQSLHGYIDRNDPLGGPKQVSRVHPLVRTHPVTGWKSLFINRGHIKRIIGVS
                     PVESDLILSYLFDIFEKNADVQVRFNWQPTQEGYGTSAIWDNRVSQHKNIFDYEGDEP
                     RHGTRVTTLAEVPYFDPNSKSQREALGKPIYKWE"
     gene            <383358..>384674
                     /locus_tag="C5L36_0C01810"
                     /db_xref="GeneID:40384030"
     mRNA            <383358..>384674
                     /locus_tag="C5L36_0C01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465852.1"
                     /db_xref="GeneID:40384030"
     CDS             383358..384674
                     /locus_tag="C5L36_0C01810"
                     /note="PKUD0C01810; Pfam Domains: TauD(5.1e-98)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321712.1"
                     /db_xref="GeneID:40384030"
                     /translation="MTTGTETVSVKDNSSLSIVNDIPIDQQIENLIRAHNDLKITNNG
                     NLKLRINPGPDPEGLKILSKSTRERLEADNIDLSVGYPETPPRAEIPVYLDQAYAIRA
                     EDAPYIERAKNADPEKKALLGAAKEVIHLTKNVGTEIVGLQLADLTDQQKDELALLVA
                     ERVVVFFRDQKLLPSEQLELGKYLGNIEYHPQTTHVTGLPGNSVIWNDYFALKGVNIN
                     YENNNLGNWDSLRYPARGTQVWHTDLVHEHQPAGYTHLHIDSVPTTGDDTLWASGYGA
                     YDKLSDEFKKFLDGKKAVYVSAHAYLDREDPLGGPKRIERVHPLVRTHPATGWKSLFI
                     NRAMTRRIIGVSPVESDLILNYLFDIYEKNADIQVRFKWSPTKEGYGTSAIWDNRISQ
                     HRSVWDNEGAESRHGTRVTSLAEVPFFDPESKSQREALGKPIHQWE"
     gene            <385213..>386523
                     /locus_tag="C5L36_0C01820"
                     /db_xref="GeneID:40384031"
     mRNA            <385213..>386523
                     /locus_tag="C5L36_0C01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465853.1"
                     /db_xref="GeneID:40384031"
     CDS             385213..386523
                     /locus_tag="C5L36_0C01820"
                     /note="PKUD0C01820; Pfam Domains: TauD(4.3e-98)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321713.1"
                     /db_xref="GeneID:40384031"
                     /translation="MSFTSTTTETIRTSNTLSSNQKNAPIDQQIANIIRTEHSLNIGS
                     SIHFHDGADKEGVLMLPESSRKRLEDGGIDLSAGYPEIPDVLEIPIFVDEAHAIRAED
                     VPYIERGKNADPEKKALLGAAKEVIHLTKNVGTEIVGLQLADLTDQQKDELALLVAER
                     VVVFFRDQKLPPTKQHELGSYLGNVEVHPQTPHVTGLPGATVIWNDFKLKKGMVLNYA
                     NANLSNWDPIRNKSIGNQTWHTDLVHEHQPAGYTHLHLDAIPKSGGDTLWASGYGAYD
                     KLSDEFKRFLDGKKAVYISAHAYLDRNDPLGGPKKIERIHPLVRTHPATGWKFLAVNR
                     SMTRRIVGLSPVESDLILNYLFDVYEKNADLQIRFKWTSSEEGCGTSAIWDNRVSQHR
                     NIWDHEGEEPRHGTRVTSLAEVPFFDPDSKSQREALGRPIHQWD"
     gene            <387035..>388684
                     /locus_tag="C5L36_0C01830"
                     /db_xref="GeneID:40384032"
     mRNA            <387035..>388684
                     /locus_tag="C5L36_0C01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465854.1"
                     /db_xref="GeneID:40384032"
     CDS             387035..388684
                     /locus_tag="C5L36_0C01830"
                     /inference="similar to AA sequence:RefSeq:NP_009957.1"
                     /note="PKUD0C01830; similar to Saccharomyces cerevisiae
                     YCR028C (FEN2); ancestral locus Anc_1.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321714.1"
                     /db_xref="GeneID:40384032"
                     /translation="MTGIGEVVWQFFKIDKPSTFKRDYIDQSIDRDRKPEKLGKYSKY
                     NVLNAFNWYPSHYSAYERKFLMKVDVCVLLFLCFSFYTKYLDNANVGSAYVSGMKEDL
                     KLHGNELNFFNTCYTVGYAVFQIPITLLITKPQFARHLLLFCELAWGMMTLANAYVTN
                     ANQMYAIRFFIGVFEACSFPATYVILSSFLTDEELFKRAGFYGAFATAGNASAGALQT
                     RAREHLAGINGLKGWQWQFIIDAVLTFGIFLYGFLLFPGIPSACKKFGFFSEDDMIFA
                     RKRLQNKIAFPKKFTWMTLKETLFTWQVYFGSAIWVLHHQSWYSNGAKLYMKSKPEIY
                     TTSMVTNWDSYMYCVGIPCAIIVAPLCKYYGKLIPVNVVMLTAYFACIVFIIWSVPNS
                     VLIAAFFLQRPYRDGLAQVYYTWIATLCKDNVEKKALVLSWVQALSYAINAFAIPLQY
                     NVKDAPSFKKGYIINIVLIAASHVVFFIGLWLDKYDLKYFPGISGNRHVNEDDILIAP
                     SKSKEAEELDFDIDVEKEIYEIKESSSLETPLKKTHIYYTD"
     gene            <389406..>391043
                     /locus_tag="C5L36_0C01840"
                     /db_xref="GeneID:40384033"
     mRNA            <389406..>391043
                     /locus_tag="C5L36_0C01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465855.1"
                     /db_xref="GeneID:40384033"
     CDS             389406..391043
                     /locus_tag="C5L36_0C01840"
                     /note="PKUD0C01840; Pfam Domains: MFS_1(1.6e-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321715.1"
                     /db_xref="GeneID:40384033"
                     /translation="MFRKDNAKEFFWQFFKIDKKESFREDYIDQTIDRERKPIKVSKW
                     DNINFLKAFDWYPSHYSAYERKFLMKVDICVFFFLCASFYTKYLDNTNVGSAYVSGLK
                     NDLNLKGNELNYFNTCYTVGYAVFQIPISLLITKPQFSRHLLLVCELAWGMMTLANAY
                     VRSAKEMYVVRFFVGVFEACSFPATYVILSSFLTDEELFKRAGVYGAFATAGSASSGA
                     LQTRARENLNGVYGLKGWQWQFIIDAIMTFGIFLYGFLLFPGIPPACKKFGFFSEDDM
                     IFARNRLKNKVAIPDKFTLKTLKETLGTWQIYFGTLLWTLHHQCWYSNGALLYMKSRP
                     EYFTTSMVTNWNSYMYCVGIPAAIFISPLTRYYGKFFTVNFVFAIAYYCAIVLIVWDV
                     SQSMILSAFFMSMLYSSGLAQVFYSWIVTLCRDNVEKKAIVLGWVQAFSYAVNAWGYP
                     LQYNVAEAPRFKKGYIANLFLLFLSHVVFLFGMWMDKYDLKYFPKIAGNRHADTNGIM
                     IASGKVEALEESDTDLEKTKYYVSEEKAGSDSDISVR"
     gene            <392867..>393682
                     /locus_tag="C5L36_0C01850"
                     /db_xref="GeneID:40384034"
     mRNA            <392867..>393682
                     /locus_tag="C5L36_0C01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465856.1"
                     /db_xref="GeneID:40384034"
     CDS             392867..393682
                     /locus_tag="C5L36_0C01850"
                     /note="PKUD0C01850; Pfam Domains: Zn_clus(3e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321716.1"
                     /db_xref="GeneID:40384034"
                     /translation="MGYNIVSYPTYQMPKVVESTQRRFQQQPELQQCDYCHFDRFHHE
                     SEKQHPIQGQQYTIPLSLTSSINESSKQSQYHHPQMPRQDGLTTIQYNAPTSLNCGVN
                     TLSTTPESPLNYTTSTNMFRRNSQMSFLTPHSASSPLDTSNARPETRDELYFEVASST
                     YVYKSPTEGREGVLQGSLIKHVLESNSDNRTCKRSRTGCLTCRYRKKRCSEGKPSCEE
                     CTRLNMKCRWPLPGSEHKNRSKRSLKIGHDEMYHETYGVIKVLRGVVLYKIEE"
     gene            complement(<394349..>395095)
                     /locus_tag="C5L36_0C01860"
                     /db_xref="GeneID:40384035"
     mRNA            complement(<394349..>395095)
                     /locus_tag="C5L36_0C01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465857.1"
                     /db_xref="GeneID:40384035"
     CDS             complement(394349..395095)
                     /locus_tag="C5L36_0C01860"
                     /note="PKUD0C01860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321717.1"
                     /db_xref="GeneID:40384035"
                     /translation="MAQPLNLAHQFLDTNFIESKKYNDFNILPIISTNPYCESFIDTP
                     PPIAVDYFSYDLTFEQYHSCWKNISNNQFMKPYELSNVDNITRLRVVQQTDDLMMFLP
                     TTSQARLENACWRAWGKKLNHLDELNPREINWFKENDVTVLYGPLIQENRSYEDLRSR
                     KMEPSVSTPSSPSVDWSDNSIDSDSESLLQRRYSFESNSSIPTSVSTASSTPLKGILK
                     KRRNGYHPEKGKQKKKCSFSEELCSVCDIV"
     gene            complement(<395688..>396641)
                     /locus_tag="C5L36_0C01870"
                     /db_xref="GeneID:40384036"
     mRNA            complement(<395688..>396641)
                     /locus_tag="C5L36_0C01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465858.1"
                     /db_xref="GeneID:40384036"
     CDS             complement(395688..396641)
                     /locus_tag="C5L36_0C01870"
                     /note="PKUD0C01870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321718.1"
                     /db_xref="GeneID:40384036"
                     /translation="MGRRGRPLKENDKPFTGESTLSIHVGKSASTAQSQSAAIARQGF
                     RSTPHLKQRGKVLEDYNLQQRGKKIHQEMCQVLRKKELDSSPITELMSDPANYEPSSP
                     LTMNMSMDMNMMGTHTFPTSSPTKGYEKAEYLSLSNAFPLSPKKSNVCETALCRNNTF
                     DPLELSPRFKLNTSTSASSEANLYSNRVTKPKPRIKRQFHYIMFPFEYRITLHLDTNG
                     RANIHARVLERNIQHHELCYQNNHRRKDSPYYFLREDPFLPQYVNPHNVFFSSPLTLS
                     PNVQDNYTGENSSMLKIKPVNIEGNNALLDMEKLVTDMHSS"
     gene            <396860..>398572
                     /locus_tag="C5L36_0C01880"
                     /db_xref="GeneID:40384037"
     mRNA            <396860..>398572
                     /locus_tag="C5L36_0C01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465859.1"
                     /db_xref="GeneID:40384037"
     CDS             396860..398572
                     /locus_tag="C5L36_0C01880"
                     /inference="similar to AA sequence:RefSeq:NP_014005.1"
                     /note="PKUD0C01880; similar to Saccharomyces cerevisiae
                     YMR278W (PGM3); ancestral locus Anc_8.840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321719.1"
                     /db_xref="GeneID:40384037"
                     /translation="MDGQLQKLVEQWLSIDHNETTRREIETFMANKNTSKLKELLESR
                     IQFGTAGLRARMEAGFARMNDVTVVQASQGLAAYIKSGSAVVGHDHRHNSKRFAQLTA
                     LVFGSYGFEVYFVGQCATPMVPYSVDRYKASVGIMVTASHNPKDDNGYKVYWKNGCQI
                     IPPLDSDIQLSIMENLDPQIDWDVNKIYSNKNVIFCHDEVVYGYSKRVLDILQPQKLG
                     DFKYVYTAMHGVGFEFVKAITELFTDDGNLIPVKKQCSPDPDFPTVAFPNPEEKDALN
                     LALCTANANNVDLVLANDPDADRFSVAYRTPNGWRQLSGNEIGLLFADYVVQKQTNLD
                     KMYMINSTVSSQMLGSMADKLGFGFVDTLTGFKWIGNKAIELEKKGYNVPFAFEEAIG
                     FMFPVVHDKDGISALVVFLQLYNKLLKEGIKLGERLEQLYSKYGYFKQCNGYYITTPA
                     VQDEIFNCIRSTKPYPSHIGNYRVNSWRDLTMGYDSDTVDHLPTLHVDPSSHMITCKL
                     LTPNKDEFIRFTVRGSGTEPKLKVYIEAKAENENRAESLAEDVWITLRKTWFTVEGLT
                     EKRV"
     gene            <398801..>400201
                     /locus_tag="C5L36_0C01890"
                     /db_xref="GeneID:40384038"
     mRNA            <398801..>400201
                     /locus_tag="C5L36_0C01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465860.1"
                     /db_xref="GeneID:40384038"
     CDS             398801..400201
                     /locus_tag="C5L36_0C01890"
                     /inference="similar to AA sequence:RefSeq:NP_013592.1"
                     /note="PKUD0C01890; similar to Saccharomyces cerevisiae
                     YML115C (VAN1); ancestral locus Anc_8.842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321720.1"
                     /db_xref="GeneID:40384038"
                     /translation="MMRNHWGNNKTNLPLSISDDKFTPKSKKKSTDIYKVLLGVIFTI
                     GLFYKLFVHGPSPNETQRNLDASFNAESHVADTEVNPAEAMVTPPDQMNLAENVEFYD
                     LMQYQGTPEGKSNEEIVLLLVPLRNAEKVLPLMFRNMMNITYDHSLIDIAFLVSDCSK
                     SDKTLEKLYEYTSAMQEGKLVPILEDREREIKGKGVFGSSDLYLKYMPEGYIENVKKS
                     YAPPFHSEYEKPFRSIQIYQKDFGQVIGQGFSDRHDVKIQGIRRKLMGRARNWLLSTA
                     IKPYHSWVYWRDVDIELSPADILETMMNFGSEYDVIIPNVWRPLPVYLGGEQPYDLNS
                     WIESNEALKLAKTLDEDDVIVEGYEEYATWRAHLAYIRDKNGDPNEVVELDGVGGVSI
                     LAKASTFRHGANFPAFTFLNHAETEAFGKMTRKMGMKIAGLPHYTIWHIYEPSEDDLI
                     EISKLERRKRRFGKKH"
     gene            complement(<400351..>401781)
                     /locus_tag="C5L36_0C01900"
                     /db_xref="GeneID:40384039"
     mRNA            complement(<400351..>401781)
                     /locus_tag="C5L36_0C01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465861.1"
                     /db_xref="GeneID:40384039"
     CDS             complement(400351..401781)
                     /locus_tag="C5L36_0C01900"
                     /note="PKUD0C01900; Pfam Domains: Asp(7.6e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321721.1"
                     /db_xref="GeneID:40384039"
                     /translation="MIIFIFLALITIVHAFNEVHPTFIDNGSSYFVSMVEEIPKQFQA
                     MKKQQTIGLLPNTTISESPSSTASIQTETMTAGMTYLNPTSKDEAFSVNITINAKDYP
                     VLLDTGSPYLWLYASNCTDNSCLGKDNFDSSKAHELNGTFALSYDSGIASGHIYEDSI
                     IIGGFETHDYKFGVADHVPDLFEPYQFSGVLGLPADNSSSTGLVNAISFLFENGDIRQ
                     SKFTICIGEYESERDNSGLLFFGETKEQLHEGEIYTSPLIEEAVSHWEFKIDSVYVND
                     YQITFDSLKIDQENSTTSRIGLLDSGTTSLILSTSDATKIHSFFEDSITDGQNFAIYC
                     NSTLEFEIEISGKNWTLTPDMYISSAYPSNGDLSGYCVSSIQGIDFTEDGAWILGILF
                     MKDKYVEFDYENQWIGLAERNNNLKFVEAPKSTAPVPTASTTITTSSSIAATAISAIS
                     SVKNDAYSQKSQRQWIFPFILSLLAY"
     gene            complement(402287..402360)
                     /locus_tag="C5L36_0Ctrna5V"
                     /db_xref="GeneID:40385076"
     tRNA            complement(402287..402360)
                     /locus_tag="C5L36_0Ctrna5V"
                     /product="tRNA-Val"
                     /note="PKUD0Ctrna5V; codon recognized: GUU"
                     /db_xref="GeneID:40385076"
     gene            complement(<403352..>404602)
                     /locus_tag="C5L36_0C01910"
                     /db_xref="GeneID:40384040"
     mRNA            complement(<403352..>404602)
                     /locus_tag="C5L36_0C01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465862.1"
                     /db_xref="GeneID:40384040"
     CDS             complement(403352..404602)
                     /locus_tag="C5L36_0C01910"
                     /inference="similar to AA sequence:RefSeq:NP_011448.3"
                     /note="PKUD0C01910; similar to Saccharomyces cerevisiae
                     YGL067W (NPY1); ancestral locus Anc_6.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321722.1"
                     /db_xref="GeneID:40384040"
                     /translation="MKDIYFGCSKQISRLGYLRRNVEHMRKLQQTLPQSKLIVFNNRD
                     NQSKRREVLINSIANQKKLSYLDVHSHEIFQDILHKWLQFNIDIESHVVEKTVIPWSQ
                     IDEELKAVSIFWLGQDDSGITTSENVGTSVFSIDISNSDLLYNYITEHVKTAGHSFTN
                     GMPSVLQLSNEDASAYSYSKMFIDFISKNRYCPACGGHIVAVNLGSRLYCLNDSPWDD
                     PARCEANLTSNNLQFPRTDLVVIIALYDSSGRILLGNNKRHPGKIVEKNDETSGKLVK
                     WTSKMYSCFAGFMEPGETIEQACVREVYEETGLELQPQDVKIIESQPWPFPANIMIGC
                     MAILREEQTDDRKINVHLDDELEHVSWFDSENVSKVIKGADIGILSKSDTEVEEWFLP
                     SPESVAGRLIGRAVDACSDLRGKF"
     gene            complement(<405159..>406460)
                     /locus_tag="C5L36_0C01920"
                     /db_xref="GeneID:40384041"
     mRNA            complement(<405159..>406460)
                     /locus_tag="C5L36_0C01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465863.1"
                     /db_xref="GeneID:40384041"
     CDS             complement(405159..406460)
                     /locus_tag="C5L36_0C01920"
                     /inference="similar to AA sequence:RefSeq:NP_015115.1"
                     /note="PKUD0C01920; similar to Saccharomyces cerevisiae
                     YPL209C (IPL1); ancestral locus Anc_6.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321723.1"
                     /db_xref="GeneID:40384041"
                     /translation="MDPNQVNVDLRVGRKYRLSKKIGSGSFGDIYLGTNIISGEEVAI
                     KLESIRAKHPQLEYEAKVYKALCGGVGIPFIRWYGTECDFNAMVIDLLGPSLEDLFGY
                     CNRKFSLKTVLLLADQLICRIEFIHARSFIHRDIKPDNFLMGAGKKGSQVNVIDFGLA
                     KKFRDPRTHLHIPYRENKNLTGTARYASINTHMGIEQSRRDDLESLGYVLIYFCKGQL
                     PWQGLKAATKRQKYDRILEKKLAIPTEVLAKGLPIEFTHYLNYVRSLRFDDKPDYIYL
                     RRMFRDLFLREKFVYDYIFDWTIYKFTVQNQQQQQQQQQQQQQKAIEEKNENQQQTQQ
                     IGQPIGQAQQYQSTPHDQQIKPLLQQQQNQAVHVPDIEANNQLKQTYRIQQSQQQGAN
                     KSPYNQGQQSSQAQHGQSPSILKNNVQNSQVNVNNNNPAWL"
     gene            <408461..>408775
                     /locus_tag="C5L36_0C01925"
                     /db_xref="GeneID:40384042"
     mRNA            <408461..>408775
                     /locus_tag="C5L36_0C01925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465864.1"
                     /db_xref="GeneID:40384042"
     CDS             408461..408775
                     /locus_tag="C5L36_0C01925"
                     /note="PKUD0C01925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321724.1"
                     /db_xref="GeneID:40384042"
                     /translation="MSTEQVEQNVQQKVEDVKQDINQAEQKVDQAKQEVNQAEQSTEN
                     KNELASIKSAVNKVAEEVKEAGAEVQKVAGDVVNQTKDISDKVQKTGPFSKVKNFFKK
                     LF"
     gene            <409545..>410948
                     /locus_tag="C5L36_0C01930"
                     /db_xref="GeneID:40384043"
     mRNA            <409545..>410948
                     /locus_tag="C5L36_0C01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465865.1"
                     /db_xref="GeneID:40384043"
     CDS             409545..410948
                     /locus_tag="C5L36_0C01930"
                     /inference="similar to AA sequence:RefSeq:NP_011386.2"
                     /note="PKUD0C01930; similar to Saccharomyces cerevisiae
                     YGL129C (RSM23); ancestral locus Anc_6.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321725.1"
                     /db_xref="GeneID:40384043"
                     /translation="MLAFKSFSQTRGLTTTSASLAAAVTRKSFNKKSSYDKSKNKKGS
                     GNDKSFQNSLLSKNYKKAAGKFDKLLIKQLLTFEPKNKDLIHNSIVQYPRTSIAKLHI
                     AGSFKQHQYNELYSQPVTLFRSREDSKLLEIIAKNESSLSNRYIVNGASGIGKSTILA
                     HFQSFALSKNKKGNKKFENNSILFPISNAESLVDGSNDYKLNPETKKYDQPMYTKEFL
                     KKFRNLNEYALSQIPLSKEITPITSTYKTSVHKIQGTLLDFVNYVLKASATEANTTFA
                     FTTILDELSMQEKLPVYMTIDNFSAFIQHGMTKYRDVENRRIYFQNFTVADSLLKFVS
                     GEKVFKNGAVMVATHGNHRLHNNVTFDIITGDKLIEDYAYEKFRNLDYQLANRLLQNN
                     GLNKFEISEFSLEECKSLVKHLFKFNLIHNEYDLENQLLTKSEDEVFDKIAAQKYILS
                     GNGNPKLLMDSCILQYV"
     gene            complement(<411064..>412560)
                     /locus_tag="C5L36_0C01940"
                     /db_xref="GeneID:40384044"
     mRNA            complement(<411064..>412560)
                     /locus_tag="C5L36_0C01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465866.1"
                     /db_xref="GeneID:40384044"
     CDS             complement(411064..412560)
                     /locus_tag="C5L36_0C01940"
                     /inference="similar to AA sequence:RefSeq:NP_011385.3"
                     /note="PKUD0C01940; similar to Saccharomyces cerevisiae
                     YGL130W (CEG1); ancestral locus Anc_6.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321726.1"
                     /db_xref="GeneID:40384044"
                     /translation="MPDRSVPDIPGTRCLPDVEAYLKQQVAMILRTRPNHFPGSQPVS
                     FVREHLTNNLLNKDYLVCEKSDGLRCLLFVLVNPETNEEGTFLISRENEFYHIPDFHF
                     PRSKKDFQSSHNGTIVDGELVYSTNPITKVKEIRYLIFDCLSMDMTSVMHKNLWKRLY
                     HAQHEFHAPYLELRRKFPDACANWVFKLDFKNMTQPFKIHKIFSEMKNLTYVSDGLIL
                     TCCDTPYISGTDPTLLKWKPAEENTIDFKIGLEFPTFIDEDLPKHDPNREYTNYDVKP
                     KFKLYVWKGGDDPFKNETVEENIKRNGGEYRNTFYNYEAWNDLEVSDEQWERMKNSGE
                     SFNGRIGECRQTANGKWELLRFRDDKSNGNHINVVLKILKSIEDSVTKEEIVEMEPQI
                     KARWEERDAMKRKAQQQQQHFVQKAGHSNQPHAQPQHHHQQHQPHKQQPPAHLVPEKR
                     RAEEDHLNNAPYKKADSKPDVQKDVNTRSNDDNDDDEDEFYQSDGFET"
     gene            <412905..>418163
                     /locus_tag="C5L36_0C01950"
                     /db_xref="GeneID:40384045"
     mRNA            <412905..>418163
                     /locus_tag="C5L36_0C01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465867.1"
                     /db_xref="GeneID:40384045"
     CDS             412905..418163
                     /locus_tag="C5L36_0C01950"
                     /inference="similar to AA sequence:RefSeq:NP_011384.1"
                     /note="PKUD0C01950; similar to Saccharomyces cerevisiae
                     YGL131C (SNT2); ancestral locus Anc_6.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321727.1"
                     /db_xref="GeneID:40384045"
                     /translation="MMPQDHLVVPNSPQEQVLAASKKSDTVMDDQIFNKSEHSKTMDV
                     DDGDIQSEMYLIDNLPNNSDIEQGEIIGECPGRDALKNPTINDSLDTMTEVLNGEDNI
                     IGDNGYTSEIKIEAEEKIPETKHHENREGTNLEEGRDHGKERRNDEHGEEEEAEDLPD
                     SDIASLAGIDLEPDAFTRPKRRTTKAVNYKEKTENDIPKVKSHQPGYAGAKRGRRPKS
                     QTDSISPPPSASSQKAILTAANSAEYHSVDEVVPINYQPPIDKKNSFNQILDLKGATI
                     DEHEAKLVTKSGVTIKKGDCIFMICEPPTEPFYIALVLGFNKKDKSTEIKDVSNYTFS
                     VCWFYRPRDLNRRLTDTRLVYASLHRDECPITSFRGFATVKHRDVIEDLDAYRQQPDS
                     FFFDKLYDRYMIKMYDMIPTIKLLHLPPNYYEALHKRFEYIFVEVGKAEDLLSSPKNC
                     EKCLQWCSNSDSISCSSCQKSYHLLCLDPPILTKPKRGFAWYCAACNRKLEEKLAQNR
                     GRMLESAQPSQIIKAEERALFSSNHEGKEEEKEGKIKQAEPVDCQEIDSSSLRYEQMA
                     RKFLEADKGLSLEQRRAIEEWPYRYLGVHAKFEDALDLQDRPYARAASRLGSKYQCTS
                     VTEWYDHKVQYYDSKTSSVGHNNKRLKKYYNRSKRLTTPLLPEDTLLEDKKYPVPEEY
                     KDLKPKDYPGWLQPKPKGYIERGGDETSELLWVMPDEGMGDMVEQYIKDCAGVATRLK
                     LTSTTTPNFIDAILLILMRHDYKPEESMEDVSKLTRESLKEPTFSDEEIKRFEDSVRI
                     HGSELYPVFKDVKTQPSSMVVRFYYLWKKTKSGHEIWDNYPGRAKNRFKTTKKTGFDL
                     ENPDDDGTYLNSKINKTHVKMKCMFCEAYHSSQWFRAPGAVLDEQNKLCEAFCYRCAK
                     LWRKYAAKWENPIELIKNQEKKSGYANKKRIESALIEEANLVVKARENYKMSPIKITQ
                     KLKKLKTTDPDLDYNYLGSESAKKGRKVRSKNMSNKASKMTNRNSDTKNQNKKEKSTK
                     VSSLTGKKKRAAEDDDLSNVDVKSEGVDKIKKRKYTRRKPKEKGLKFVYNSGDESLSD
                     KRKAKRVYEELDLFPKISDLKKELEVAENQLEENNNGGLFNAFLDMKLRERIESLRKE
                     LDELVPRSYENIPVEVKTTSNSKKTTKDTDLSKKYVRRRVYLSKTAVPGSGVFETPPI
                     QLVENIEPPKGKFSFQNEDLPKALEQKVSLLPPKVEDYGASFQSQPMLPPDTLVKAQE
                     APESNSSNGTTDENVSLGSPHPLVIKEVDSNGRTMKPVKSVSNETSISPAKTKEPISA
                     ISSLVSKLVFPFIENKDTVSKNMIKRYLSKFDIFNPLLASETYVSPIYQMRSSSRELH
                     SMWKTYQSSRKSRGRANKQFIPLFDYDKRPCCVCREMADISTMLICSNCGLNVHATCY
                     GISLPDDIAKKAGEYNWHCDPCSNDLHPLASTQYLCLLCNSRESNMDQAIKGDPISIP
                     DALKRTVEGRWCHVTCSLLSDKIKYGSKSLQPVYGTPASGVQNIFQTCEVCMCNGGVI
                     ATCEVCSKKTHVTCALDYGWKLGFKIARCIDIDGGNIIELKDKKIIGKLVPSFYCDDH
                     IRLSESSEFPTLYSLNDLGRDIAKESVEFKTLIELYATDERKQVDFICNGKLRRHAFD
                     DMAAAFDELAKRTTADNTDTESKQCSRCSRTSSLAWYPNSDHNNTTPIVCHSCHFSSD
                     SDETRSGVPDLSNVNTKKFDYSVYGC"
     gene            complement(<418279..>418956)
                     /locus_tag="C5L36_0C01960"
                     /db_xref="GeneID:40384046"
     mRNA            complement(<418279..>418956)
                     /locus_tag="C5L36_0C01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465868.1"
                     /db_xref="GeneID:40384046"
     CDS             complement(418279..418956)
                     /locus_tag="C5L36_0C01960"
                     /inference="similar to AA sequence:RefSeq:NP_015111.1"
                     /note="PKUD0C01960; similar to Saccharomyces cerevisiae
                     YPL213W (LEA1); ancestral locus Anc_6.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321728.1"
                     /db_xref="GeneID:40384046"
                     /translation="MRLTQTILIEADSFISPLKKRTLSLRNLELTSLDAIGILESSDI
                     NSVIDISQNHLSNIPAFPRLLRLDTLILSGNHIRTISGLTTLVNLEVLSVTFNEILYL
                     SDLEELTEIKNLRALYLTGNPVTKNKHYRSWCIWRFPTLQVLDFERVKESERSHAKST
                     YDENSDLVNSVLSVRSHGKVTPKQESAEVAGLTEDDRKKLENDLEAADSLEEIQRIEE
                     ILLRGHF"
     gene            complement(<419197..>420261)
                     /locus_tag="C5L36_0C01970"
                     /db_xref="GeneID:40384047"
     mRNA            complement(<419197..>420261)
                     /locus_tag="C5L36_0C01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465869.1"
                     /db_xref="GeneID:40384047"
     CDS             complement(419197..420261)
                     /locus_tag="C5L36_0C01970"
                     /inference="similar to AA sequence:RefSeq:NP_015109.1"
                     /note="PKUD0C01970; similar to Saccharomyces cerevisiae
                     YPL215W (CBP3); ancestral locus Anc_6.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321729.1"
                     /db_xref="GeneID:40384047"
                     /translation="MHCGKLKSSKLFLFSTVDFHHNFLVTNKGKMLTSTARNSAYVSR
                     SVRARYGLAALRHYAEMVNKTPSPEDLAKESQLPKIENPELPNRDIKAKNKLEKPAYE
                     KEGFKVPQWKKAFGETFVSLFHIDMDNVRAGTIGGSKYYYMCKDQGLQFADEPLSESA
                     KFWYETLGLPRTFAMWFQITNLHVWLLYVRMRAMPFKVGKNYQQKLVDKLFKDIELRL
                     SEEMNVLSGQIRDTYMKDFHSQMLGMIFSLDEALAQKSDDVLAAAVWRNIFNGDKNID
                     IVKLEAVVRYIRMQLYVLDNISDRAFGFGDFEFVGPNETVDLLTPEDKEQLYKMTKMK
                     YEPGNGKILPSQKSKLSLEE"
     gene            complement(<420460..>424281)
                     /locus_tag="C5L36_0C01980"
                     /db_xref="GeneID:40384048"
     mRNA            complement(<420460..>424281)
                     /locus_tag="C5L36_0C01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465870.1"
                     /db_xref="GeneID:40384048"
     CDS             complement(420460..424281)
                     /locus_tag="C5L36_0C01980"
                     /inference="similar to AA sequence:RefSeq:NP_011382.1"
                     /note="PKUD0C01980; similar to Saccharomyces cerevisiae
                     YGL133W (ITC1) and YPL216W (YPL216W); ancestral locus
                     Anc_6.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321730.1"
                     /db_xref="GeneID:40384048"
                     /translation="MSFYNIKKFVCETSGNSNLTFFEALEVEQEELVSMQKHFPEPVK
                     EPILRHVSFSTVPRIDMLVDQVYTKFKDDFFPGDKVVVKQESGNRVQGIIKEKVVFNS
                     RMDSEGVIRSPFISYRIALGKDKGEIDIENPSKIYRERNKFTKAYVKTFLKVSLARSS
                     KLGSPWVIREDIAKKYKISLEWPRELKKFDTTGSINSNKKSSILNDSADGDHSEEALS
                     ESKNSSSIDTVMKSTRGFSHTIFENLKETPPAIDELYQKWCQHWYQILKRTTAYFEDL
                     KSDDPARDKVLRLFKFTGVTITDKFDPNNTHFIITTRQFSLKENYPESDPFHYVQIKR
                     IKVWHYEKCQRFFKSIKISNRRIYQIAKQEAIRKGINLIDSMAENGNNSASYISIAPA
                     PQSKSSTNSEVKGQSKSKASTPVGENSADKSQNEQQPEKKSHKPQIVDDLLLPLQENL
                     QRPSWKKLQDFETLPFNYDECPTSMSDVFEVWMFINMFHEAFIIDTFTFDDFLNALQW
                     KDSKKKCPLLLEIFCSLLSGIINKDGQLDVTLPVDIETEIKNKERELKQKKKTIEKER
                     EREKEKRVKRDQLVKLKDGRSGTVALNGVHDNGPEDSDSEMRNENDEEDYDEDDHEGN
                     NNDAEHDNDDSDESYAEDEDEEINHNAYAVLNYKKISWRERCQKRDFKNGNWLIVLLG
                     VFSITEFIPEFKPEIVKTYEILCPIDEMPTPDLLEKHFFEDLNPVRRVTILSILMNIL
                     LNGNIVRNHTDFVVEKAASLRREKFELQKEMKNKVESAHNANKDVLDTLRSIDVREIK
                     QRIEDHELEMLKTEDEKEKFIESRNKGGRPVQNTLPPEPSALEKAVAAGHPEFLAILN
                     TRTNLIKEVEDMKKQKNEIDKTLVELNSQRIRFLGKDRFWNRYWWFERNGLPNLGGGK
                     DDDDDEGEAENDHDEDDDAELGDIKTEAKGHESDSEYDSETYLMGRVWIQGSNSIDSK
                     RLIDGDGSNLKRKREEEGSDFLETELDWVYIDEVEDFDLLIASLNDRGIRERALKKEL
                     NDCKDRVISSFKARKRFLNGNELQVKLHQYIDDLKKGKGTSEKVETKPVKQEEQTLDA
                     DIDESEYKYVPSVNSEKDSDKDDEPATRSMRTRRSARRRREDDGEDIKEVTGGINTRS
                     KRLRIETVDGYDANGNINEGPNGEDGRELDVVTSMVDKFQFPVSGDDSKLREGLITKA
                     LGKLKDVQQTIREENMVYWVNSSAIEKLGHSHYQGPKLAETRKAGRGRTRGGRTGASK
                     FSRTNKKRGQH"
     gene            complement(<424945..>425859)
                     /locus_tag="C5L36_0C01990"
                     /db_xref="GeneID:40384049"
     mRNA            complement(<424945..>425859)
                     /locus_tag="C5L36_0C01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465871.1"
                     /db_xref="GeneID:40384049"
     CDS             complement(424945..425859)
                     /locus_tag="C5L36_0C01990"
                     /inference="similar to AA sequence:RefSeq:NP_009580.1"
                     /note="PKUD0C01990; similar to Saccharomyces cerevisiae
                     YBR024W (SCO2) and YBR037C (SCO1); ancestral locus
                     Anc_3.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321731.1"
                     /db_xref="GeneID:40384049"
                     /translation="MISIRNLRALGSVKPLFAPSARVFSTVSSRLNEANKTEPTPSNP
                     EVEKPKKQYSRRPLSSIPIGSENYSSQTMKKKNPIEYLSWKSFVLFIAVGAGMTYFFR
                     NEKEKMKLRKEAEANRGVGKPLIGGPFNLVTQDGEPFTEKNLIGKFSIIYFGFTHCPD
                     ICPDELDKLGLMLDELKKNGVELQPIFITCDPARDSPAVLKEYLSEFHSDIIGLTGDY
                     DEVKRCCKNYRVYFSTPRDLKPGQDYLVDHSIFFYLMDPEGEFIDVLGRNYDAEGAVQ
                     KIIKDVNAYEPKEVRERKKEGMLGWLYK"
     gene            complement(<426075..>427262)
                     /locus_tag="C5L36_0C02000"
                     /db_xref="GeneID:40384050"
     mRNA            complement(<426075..>427262)
                     /locus_tag="C5L36_0C02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465872.1"
                     /db_xref="GeneID:40384050"
     CDS             complement(426075..427262)
                     /locus_tag="C5L36_0C02000"
                     /inference="similar to AA sequence:RefSeq:NP_009581.1"
                     /note="PKUD0C02000; similar to Saccharomyces cerevisiae
                     YBR025C (OLA1); ancestral locus Anc_3.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321732.1"
                     /db_xref="GeneID:40384050"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKSGIVGLANVGKSTFFQAITRCP
                     LGNPANYPFATIEPEEARVIVPSPRLDTLMEMYGRPKKVPAFITIYDIAGLTRGASKG
                     EGLGNEFLANIRAVDAIYQVVRCFDDAEIIHIEGDVNPVRDLEIISEELRLKDIEFAE
                     KHLEGIEKITKRGGQSLEVKQKKEEAVLVQRIIDLLKDGQRVANQNWTAKEVEVINSM
                     YLLTAKPSIYLINLSERDFLRKKNKWLPKIKEWVDTYSPGDIIVPLSVSFEERLSQME
                     TDEERAEEEKNVGATSVLPKLITLMRSKLNLISFFTAGEKTEVREWTIREGTKAPQAA
                     GVIHTDLMKTFILANVMKYDDLVEAGSEAAVKAAGKLMQKGKDYVVEDGDVMYFRAGA
                     GKN"
     gene            complement(<427698..>429503)
                     /locus_tag="C5L36_0C02010"
                     /db_xref="GeneID:40384051"
     mRNA            complement(<427698..>429503)
                     /locus_tag="C5L36_0C02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465873.1"
                     /db_xref="GeneID:40384051"
     CDS             complement(427698..429503)
                     /locus_tag="C5L36_0C02010"
                     /inference="similar to AA sequence:RefSeq:NP_009577.1"
                     /note="PKUD0C02010; similar to Saccharomyces cerevisiae
                     YBR021W (FUR4); ancestral locus Anc_3.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321733.1"
                     /db_xref="GeneID:40384051"
                     /translation="MEKNNYTYDVHERHKGQTSSVKASEVSSEDGIYEEALIAKEEPK
                     TWFQRLYRSLEIDGTQGFTLQQLFLLNYDLRPVEAARRKWKWYHFVFFWIADSFNINT
                     WQIAATGVQAGLSWWVTWITVWIGYTLCALFVVASARVGNAYHISFPVSCRSSFGIWG
                     SLWPVINRVVMACVWFGVQSTIGGNCVELMLRAIFSNDMEKRIPDHIGGNITSFKLLS
                     FFLFWFFQLPFIYFPPHIVRHLFSVKAVVCPIAGITFLVWTLVKADGGGPVIHQGSTI
                     KGSEFGWAFVNSIMNSLANFATLIVNAPDFSRFGNKPGAAITPQLISLPISFAVTCLI
                     GILVSSASTVLYGETYWNPLDVLSRFLDHYSRGSRGGVFLISLGFAIAQLGTNISANS
                     LSAGTDMTALLPKFINIRRGGFICAAIGFAICPWNLMTSSSMFTTYLSAYSVFLSAIA
                     GVVFCDYYILKKGFISLPDLYVSNNSSPYYYSKGFNARAYAAYIAGILPNIVGFVGAT
                     KTHHVPMGATYVYYFSFFTGYAAATAVLVVATLIFPINGLPDAKLFERKFFEEWQEVE
                     DFDDVFRQKAANIHDNGSDVIDELNYVVSAEKSLP"
     gene            complement(<430216..>432051)
                     /locus_tag="C5L36_0C02020"
                     /db_xref="GeneID:40384052"
     mRNA            complement(<430216..>432051)
                     /locus_tag="C5L36_0C02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465874.1"
                     /db_xref="GeneID:40384052"
     CDS             complement(430216..432051)
                     /locus_tag="C5L36_0C02020"
                     /note="PKUD0C02020; Pfam Domains:
                     Transp_cyt_pur(1.6e-180)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321734.1"
                     /db_xref="GeneID:40384052"
                     /translation="MFEGKNDENNHYKSEKDSLAKEKNLDLDARDTSSSDLFEETVEE
                     TVDSSEYSNNLRGWFQRFIHFVEISGTKGYSIQQLFLMNYDLRPVEAARRKWKWYHFI
                     FFWLSESFNVNTWQIAATGVQAGLSWWVTWITVWIGYTFCALFVCASARVGNAYHISF
                     PVSCRSSFGIWGSLWPVINRVVMACVWFGVHTSIGGNCVELMLRSIFSNDMEKRIPNH
                     INGNITSFKLLCFFLYWFFQLPFIYFPPHKIRHLFTVKAVISPIAGITFLVWTLVKAD
                     GGGPFIRAPSTVSGSAFGWAFVNSTMNAISNFATLIVNAPDFSRFANAPDAAIYSQMI
                     SLPISFAITCLIGVLVSSAANSIYGVSYWNPLDVLSRFLDHYSRGSRGGVFLLSFSFA
                     IAQLGTNISANSLSAGTDMTAIMPKFINIRRGGFVCAAIGFAICPWNLMTSSSMFTTY
                     LSAYSVFLSSIAGVVFCDYYILRKGYLVLTDLYIANESSPYYYWKGFNLRAYTAYIAG
                     VLPNIVGFVGATKTHHVPIGATYVYYFSFFAGYASAACVLIIITYIYPITGTPEARLF
                     QCKFFEEWQDVEDFEEVYKKRIAMDSNERELFIKRLPSIDASEKA"
     gene            complement(<432871..>434613)
                     /locus_tag="C5L36_0C02030"
                     /db_xref="GeneID:40384053"
     mRNA            complement(<432871..>434613)
                     /locus_tag="C5L36_0C02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465875.1"
                     /db_xref="GeneID:40384053"
     CDS             complement(432871..434613)
                     /locus_tag="C5L36_0C02030"
                     /inference="similar to AA sequence:RefSeq:NP_012197.1"
                     /note="PKUD0C02030; similar to Saccharomyces cerevisiae
                     YIL067C; ancestral locus Anc_7.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321735.1"
                     /db_xref="GeneID:40384053"
                     /translation="MDMQLGMKHEIGKDRDEEVELQWMSRGSRVSRDEEEERYQECSD
                     KQDPLRGIWLRINRIPETIHNMSPYGVYIPPLYILFAMVLLIWVYSVILFERPMISHE
                     IPVMQLSCGRAEQIWEGFDTECGLHAEKCLLPFKRHKTLYVKCPAFCEGSGLVYNVLR
                     YKDVEIQYEPFIVTSPVEENGEIVYRGDSYPCMAAYREGLVGNMWGGTVKLELTDRYP
                     YDVNLQNDEKMVFNGWYPAGFVIKPLERDEKGNNLFDLISLVIWMGVFLSVGLGVFVV
                     RNDIFWFSSVMLVYLSIVLVVDPPIVVDYEDNITLGDNSSWQLLSVVIGRLLPLSGII
                     VLIWVVVCEYSFVGSGLIQRLTFLCGLWITGMDALTFEKLPIDRLVIEDVINMGASGI
                     LAFIFVMILIVFCCVLQLYRIWRDGWFLKCVSRYLIVIFTVVALGVLFGDRLVLRVHH
                     WVIGLFFIWGCKSRGSIAGGLQGLCVGLILAGVGRWGFASIFERGWVVDRDGDNGDRP
                     TAPSVPVFVYNAARHQLTIEPVDDDTEINVFGNDVWIYKGHGGEDIPIEDIQWLRGRA
                     CNDGGCSEWVWITK"
     gene            <435111..>436202
                     /locus_tag="C5L36_0C02040"
                     /db_xref="GeneID:40384054"
     mRNA            <435111..>436202
                     /locus_tag="C5L36_0C02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465876.1"
                     /db_xref="GeneID:40384054"
     CDS             435111..436202
                     /locus_tag="C5L36_0C02040"
                     /inference="similar to AA sequence:RefSeq:NP_009808.1"
                     /note="PKUD0C02040; similar to Saccharomyces cerevisiae
                     YBR249C (ARO4); ancestral locus Anc_6.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321736.1"
                     /db_xref="GeneID:40384054"
                     /translation="MSDSRSTSTAPQEEEYEDLRILANEPLISPELLIKEIPATKSSL
                     KTVIQSRKAATAVVKKQDDRLLVVVGPCSLHNEKVAMEYANLLKPLADELSGELVVVM
                     RAYLEKPRTTVGWKGLINDPDLNGSFNINKGLRLARNIFVKLTDLGLPIGSEMLDTTS
                     PQYLSDCLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVAVDAIQAAEGSH
                     HFMGVTKSGLAAIITTKGNDSCFVILRGGKKGTNYDEASVKEAKEKLPKGKTIMVDCS
                     HGNSNKDYRNQPKVCSEVARQVANGEDDIIGVMIESNINEGNQKIPQDLSQLKYGVSV
                     TDACVNWNTTESMLRELANAVKSRRSLKA"
     gene            <436563..>438230
                     /locus_tag="C5L36_0C02050"
                     /db_xref="GeneID:40384055"
     mRNA            <436563..>438230
                     /locus_tag="C5L36_0C02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465877.1"
                     /db_xref="GeneID:40384055"
     CDS             436563..438230
                     /locus_tag="C5L36_0C02050"
                     /inference="similar to AA sequence:RefSeq:NP_009807.3"
                     /note="PKUD0C02050; similar to Saccharomyces cerevisiae
                     YBR248C (HIS7); ancestral locus Anc_6.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321737.1"
                     /db_xref="GeneID:40384055"
                     /translation="MSTVHVIDVNSGNLQSLSNAITSLGFKVEFITQGSDPALETCSK
                     LILPGVGNFGHFVLQLHERGFVEPLKKYIASGKPIMGICVGLQTLFQGSEESEGVEGL
                     SLLPGYLVKFDVTHKSVPQIGWNSVSLKSHEESANALYGISEDKRYYFVHSFAAVRTP
                     DEITKLYETGWDLALCTYLDETFIAAVAKNNIFATQFHPEKSGKAGLKVIQSFLTTEK
                     YSHVELHSANAAKTDTGLTRRIVACLDVRTNDHGDLVVTKGDQYDVREKSGDGNNVRN
                     LGKPVEMAEKYYNQGADEVTFLNITSFRNSPVKDLPMLEVLRLAAKTCFVPLTVGGGI
                     RDVTDPDGTKHSALEVASSYFHAGADKVSIGSDAVRAAEEFYENGNRGSGNSPIETIS
                     KAYGVQAVVISVDPKRFYLSDPSTCKYKTIKTSIPGPNGEEYCYYKVTSQGGRQIHEL
                     GAVELVVACEALGAGEILLNCIDKDGSNSGFDFELINMVKSSVTIPVIASSGAGNPQH
                     FVDVFNNTKTDAALGAGMFHRGEYKVSDVKEFMTKHGLYVRNDNTDL"
     gene            complement(<438367..>439839)
                     /locus_tag="C5L36_0C02060"
                     /db_xref="GeneID:40384056"
     mRNA            complement(<438367..>439839)
                     /locus_tag="C5L36_0C02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465878.1"
                     /db_xref="GeneID:40384056"
     CDS             complement(438367..439839)
                     /locus_tag="C5L36_0C02060"
                     /inference="similar to AA sequence:RefSeq:NP_011418.1"
                     /note="PKUD0C02060; similar to Saccharomyces cerevisiae
                     YGL097W (SRM1); ancestral locus Anc_6.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321738.1"
                     /db_xref="GeneID:40384056"
                     /translation="MVKLERKRKATGLVSEGNAVPSPAKKPKTLELHSFESLRASRYK
                     TINERATANRTPLDVFVWGSGSMCELGLGPDAKTKEVKRPRLNPFLKKDEVGIVDFAV
                     GGMHVLALDKNGAVWSWGNNDSAVLGRDTSADADKNLRDMDAESDDEDGDLNEAESTP
                     GKVEGLPENDSVVKLAASDNLSVVLLESGQVWAWGTFRNNEGILGFSKDVKLQKFPVR
                     ITELENIVSIVAGKDHILALDIKGWVYAWGNGQQYQLGRKILERSLLLSLEPRSFGLK
                     NVKFIGSGEFHSFAISTKGKVYSWGLNQYGQCGVDMNIDDGAVVTKPTEIKELADKDI
                     VYITGGEHHSLAVSSSGEVYAFGRYDMKEIGIEKDKLPLDDCIKDDHGNVRSLPVPTK
                     LALPPIKTVACGSHHSLAVTKDGFVFSWGFADTYAVGLGNLDDDVEKPTRIDNTATKE
                     HDIQIVGCGGQFSVSAGVKIDNEERIEERLDAIEKFEEEN"
     gene            <440090..>441568
                     /locus_tag="C5L36_0C02070"
                     /db_xref="GeneID:40384057"
     mRNA            <440090..>441568
                     /locus_tag="C5L36_0C02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465879.1"
                     /db_xref="GeneID:40384057"
     CDS             440090..441568
                     /locus_tag="C5L36_0C02070"
                     /inference="similar to AA sequence:RefSeq:NP_009806.3"
                     /note="PKUD0C02070; similar to Saccharomyces cerevisiae
                     YBR247C (ENP1); ancestral locus Anc_6.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321739.1"
                     /db_xref="GeneID:40384057"
                     /translation="MGKVSTKDTKASGKHVPLYKDIAASGGKLKSSQIKAKVYKKAKE
                     NDDNDDGDDGRDEFEMDAATSRRVLKLAREQQQELEEEENYNEVATKPRFQLIQHESD
                     AEEEQDEEEYEEEYEEEMEYVDDEDLNPSEVAMFETFFKAKQGNNEPFQPINLADKIM
                     QKIAQSATPDESDGGKDPESTEGRPQDGVYLPPRVIEAYQKVGESLRAWKHGKLPKLF
                     KVLPTIKNWEDLIYVTAPEQWTPNAVYEATRLFVSNLTAAKAEKFVSLVLYPRFRQDI
                     EENEDHKLNYHIYRALKKSLYKPAAFFKGFLFQLVEDQCSVREAMIAASVLKKTSVPV
                     QHASVALSWLLEQEFSPAATVFIRVLIEKKYALPYQTIDDLVFYFMRFRVITDNKSSF
                     KIDNEADLMDDVDIDITQQRKLQDAPPLPLVWHKSLLAFAQRYKNDITDDQRDFLMEV
                     VRQRPHREISPEIRRELLAGKPKEFTQEPTKKFDDDDVMSYF"
     gene            complement(<441740..>444487)
                     /locus_tag="C5L36_0C02080"
                     /db_xref="GeneID:40384058"
     mRNA            complement(<441740..>444487)
                     /locus_tag="C5L36_0C02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465880.1"
                     /db_xref="GeneID:40384058"
     CDS             complement(441740..444487)
                     /locus_tag="C5L36_0C02080"
                     /inference="similar to AA sequence:RefSeq:NP_015055.1"
                     /note="PKUD0C02080; similar to Saccharomyces cerevisiae
                     YPL268W (PLC1); ancestral locus Anc_6.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321740.1"
                     /db_xref="GeneID:40384058"
                     /translation="MHISSITSDITKHLSTLRMNSTSFRRQSSSDKSITISTQTLKES
                     SDGLSNIQNQETLDTFVPLTLEAINSASSDPFDPSSYPAELIDPGLEMIRVTRRKHVH
                     RLFKLNLPSLTLTWNSKASSKIEMDNIQSIRVGSDAKSYREEFNIPSDYNDLWITVIY
                     RTKNLTAGSLSNDLKALHMIATSKRNLEIMINTLTVLSTWVKNQESLINCADVNGFSV
                     GKWNNRIKKVNRQHMSFDDLIKLTSELNVNMNQSYLRQYFDECDKEKKGVLSFGEFQE
                     FVTKLRNRKEVDEILAHCGAANGKLHLEQFKQFITKIQNEDFDERFIGYLFKKYSYKG
                     EGEFMNQANLINYLNSVFNGPLISEYRTHSDYYSHPLTDYYISTSHNTYLLGKQVHGN
                     SSIEGYIHALQRGCRCVEIDVWNNDDNHPIVTHGRTLTTSIDFELVIDTIRKYAFIAT
                     PFPLIISLEIRCSKEAQQRCVTVMKNTFGDMLLCEPLSEINILPSPQDLKHKILIKVK
                     KSKQTTIVETSSSAIHSSFSTSSTQSEDLTASAHSDDSTTIVLKKIVPKPTRPTIIPE
                     LSILAPYFVGIRFRNFSLPESKTFNHVLSFSDRSLLSLLKDQFKLNAIVKHNKRGMMR
                     IYPSVVRFKSDNFNPIRFWEVGCQMVATNWQIWDCGQEISESLFRPLSTSSGIGYSGY
                     RLKPEILRRPTAANNKELIKIENLKALQFTILKKLDILILSGQQLPKPKELILSLNGY
                     TPWVEIEVYNVKPVEGKILHHKSASRSFSLDDELSSDSPIAHVEEYDKDIGTIRTNHS
                     DDFSSLSEYSLCFKTRLAENKDNAFNPIWNVLCRLSYFANAIDLSFIRIVVKTNRVNK
                     TNVISKVGNAVVKNTSDYTVGSWCCKIGDMKEGYRQIRLVDNKGDELIHSSLLLKISK
                     D"
     gene            complement(<444776..>446020)
                     /locus_tag="C5L36_0C02090"
                     /db_xref="GeneID:40384059"
     mRNA            complement(<444776..>446020)
                     /locus_tag="C5L36_0C02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465881.1"
                     /db_xref="GeneID:40384059"
     CDS             complement(444776..446020)
                     /locus_tag="C5L36_0C02090"
                     /note="PKUD0C02090; Pfam Domains: Gly_transf_sug(6.6e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321741.1"
                     /db_xref="GeneID:40384059"
                     /translation="MNTLKSVLLTALVIFSILNILSANIFNPSIHDAKIRKAFKTSAE
                     IRAGAASKNEDESVDLVVKDHAGIVQEYLKPKNIYSFSTILDRLLFSFPYNPYDEVEK
                     NIFQIWKTSDMDDEEHFPKDCKTLVERWSDANPEYDHRLFSVSEAEDLVADILRPQVP
                     EVVEALRYLPNERLKFEFLKFLILYLNGGVYADVDTIAVKPIRFWYNLPSFKTKVWLG
                     IDSDPNSADWSDNYSRRLTFNNNILRAKSNHPLLARIIARITFIINTNKELIQTTDWN
                     KEYENCDASGAPIVQFTGTSLLTDTVFEYLNTIDQYLFFTTIKNELFIKERVQLHKEV
                     FGPDVDPEQRFSYKTFTLLGNPVQVQDIAILPKISFTGYDTAQIDFFDDSNEKKGYDK
                     FYYGRSKFLTEWSPKKLRLDSN"
     gene            <446303..>448483
                     /locus_tag="C5L36_0C02100"
                     /db_xref="GeneID:40384060"
     mRNA            <446303..>448483
                     /locus_tag="C5L36_0C02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465882.1"
                     /db_xref="GeneID:40384060"
     CDS             446303..448483
                     /locus_tag="C5L36_0C02100"
                     /note="PKUD0C02100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321742.1"
                     /db_xref="GeneID:40384060"
                     /translation="MGSAESLSSAPTRFSGRISRLTRRRTRIIVLIGVMLTIVSAFYY
                     FAPGNNFASLKLSKGTESEGGMFDKLFDIDAVNRYLSNANKETKKLEKENEVKGAQLQ
                     VKINEEQEALLNNAEELRKLYFNSDHNGIINFGSTGNMGKPELNILKNKDSKNKLQEL
                     LHDGKDGKTSNNKEEPGGDRSIPLTDEILPDEDAFAKIDTEQLIKGDLTFQNFFGQIL
                     KLISKNHLSFPLERRMKLKDGKPIIDEVFFFEQSYDRLSEHDLYGLFEFPQNFISDLK
                     LKHENVVRGIPDVVPHFYKGDGYVTVGGGIYSWYALLGIETLRKVGSKLPVEVFLPEL
                     KDYEFEFCEVILPKLNARCIEMYKIFGAQSLQDFDVQGYQYKAFALLASSFENAFLLD
                     SDSYPVTNPDPLFESELYKEYQMITWPDFWRRTVSPYFYEISNTEIGMVPVRHLNDFF
                     VNPKYLEYKQGDDIVVGATYHDRAGTIPDWTTESGEMLINKRKHFRTLILALYYNYDG
                     PYGYYPLLSQGGAGEGDKETFVAAANFYGLKWYQVNKKCERHFGWYNDEQNYEHSTIV
                     QYDPISDYDLLQKSREMYRKDVETAGDSYEYNYDKYFLDFFTPDALNPMFYHVHDPKM
                     NPFKIMEKKWTENLDGKKIRNVAEDFPRVHFDLELFLWGTINHYMCDTSTNFRAFDGQ
                     DKTELCNKFMPDQLAYLKFSSQKIFDAYKSENYQEQIKGGRDWT"
     gene            <448707..>450332
                     /locus_tag="C5L36_0C02110"
                     /db_xref="GeneID:40384061"
     mRNA            <448707..>450332
                     /locus_tag="C5L36_0C02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465883.1"
                     /db_xref="GeneID:40384061"
     CDS             448707..450332
                     /locus_tag="C5L36_0C02110"
                     /inference="similar to AA sequence:RefSeq:NP_012814.1"
                     /note="PKUD0C02110; similar to Saccharomyces cerevisiae
                     YKL108W (SLD2); ancestral locus Anc_2.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321743.1"
                     /db_xref="GeneID:40384061"
                     /translation="MSIDVKEKYYLLRKYSHYLKTELKAFTGKKVTKGSSVENKLRVY
                     RKLRKLIHYVDDELKGKVEQEKKIIKQVDNYYEYLESKISKSLNGQTELSTSTRGKTK
                     QVSHHEQPPGNKQVNQESIETDEDDEEITEVGPTPQLNGRVLTIFDIQTSPEKIEMSP
                     MKGVPKLNLGIQLEAPQEVEMFKTPTKPVKTLDLGFGSSSRKLTFDKIDIADDDLVKD
                     TVPAKSNMQPIHETPKYLKTQSTKLNHFDYVMIDDNWSEDEFDDGFTDTMAPLGRGND
                     DKHENDTPKKHFLELSFSDSELSTLSYIEPSPIIKRTSGRSLFELHKDVVNLKRNLTD
                     LQELAGLESDHNELNKQDEPVLQTVGYDEYKLDEKPKEADEADQNLVSGESTHVSSPT
                     KDNTLFRENIVNVFDPHYKLRNKIKTIKRSTRRAKLHSDKISIHDDLEEIDIHALAFG
                     KRKLNFDEGQSCDSAKDHSKSETPHKRSSDIYTSDEDDELYERKDIAQLEKELEVKNK
                     GKGFKGKHPLSNNFVRLKINRGRRGNSRFKRRR"
     gene            complement(<450384..>451886)
                     /locus_tag="C5L36_0C02120"
                     /db_xref="GeneID:40384062"
     mRNA            complement(<450384..>451886)
                     /locus_tag="C5L36_0C02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465884.1"
                     /db_xref="GeneID:40384062"
     CDS             complement(450384..451886)
                     /locus_tag="C5L36_0C02120"
                     /inference="similar to AA sequence:RefSeq:NP_013811.1"
                     /note="PKUD0C02120; similar to Saccharomyces cerevisiae
                     YMR093W (UTP15); ancestral locus Anc_2.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321744.1"
                     /db_xref="GeneID:40384062"
                     /translation="MSANRERVVLARNPSVPTQISPEQKFWKGFTSSQLVKEHNAITH
                     IHFDPNSPHDFAVTSSTRIQVFSSKTRKVVKNFTRFKDTVYCGEFRNDGKLLVAGDAS
                     GLVQIFDAHHPRTLLVTITPSSHPTHITKFHPTINTQMLTCSDDRVARLYDISQSQKP
                     IITFNNHDDYIRAGVFIPSSPNLIATGCYDNYLRIFDTRVGGSDPIIKFNQQSPVEDL
                     LSTNSTNILSAGEGVVKHWDMVAGKLSKTLHNFNKTVTCLSSAGERGILVGSVDGHVK
                     AFDTSTPNWDVKFGWKFGSGVLSCGVSPDFKHLVVGLNSGLLTIRTRKNANENINSTN
                     NKQKNDKSHAFARMIRGAEFKGEGEHHIVDEKVKYKKLKPFEKDLNAFRWSDALNSAL
                     EEGIEREATVTCLEELKKKGKIRVALANRDETSLEPLLTWCLKSLDDPRNVNIITDYI
                     VCILEMYDDLISRKPVLEEIVLSLQKRVEVEIRKAQDAERIIGMLELLSA"
     gene            complement(<452052..>452900)
                     /locus_tag="C5L36_0C02130"
                     /db_xref="GeneID:40384063"
     mRNA            complement(<452052..>452900)
                     /locus_tag="C5L36_0C02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465885.1"
                     /db_xref="GeneID:40384063"
     CDS             complement(452052..452900)
                     /locus_tag="C5L36_0C02130"
                     /inference="similar to AA sequence:RefSeq:NP_013832.1"
                     /note="PKUD0C02130; similar to Saccharomyces cerevisiae
                     YMR114C; ancestral locus Anc_2.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321745.1"
                     /db_xref="GeneID:40384063"
                     /translation="MCGRYALPIAPTTLPEYFGRQNLHVDQVVYSEKRTAHQYNIGPT
                     AVVPVFILTSKTADKSGDINGYIEYMRWGLIPKWVKTRSDLRRKVGSTFNARVENLTS
                     LSTWKSNVNNRCAVPVLGYYEWTHDKIKKPYYIKREDGELMFLAGLFSHGKLDNDTEE
                     TGSFTVITDDAPDYLKWLHPRMPIVLQPQDESFQKWIDPAVDIETALELNKKNHSSRE
                     ALEWYAVDRNVGDSRSDDKSYVLPQRNLILNFFKTKAKTANSKKRSSNDGDGEKNKRP
                     KIPKAE"
     gene            <453107..>454744
                     /locus_tag="C5L36_0C02140"
                     /db_xref="GeneID:40384064"
     mRNA            <453107..>454744
                     /locus_tag="C5L36_0C02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465886.1"
                     /db_xref="GeneID:40384064"
     CDS             453107..454744
                     /locus_tag="C5L36_0C02140"
                     /inference="similar to AA sequence:RefSeq:NP_012789.2"
                     /note="PKUD0C02140; similar to Saccharomyces cerevisiae
                     YKL133C (YKL133C) and YMR115W (MGR3); ancestral locus
                     Anc_2.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321746.1"
                     /db_xref="GeneID:40384064"
                     /translation="MLSSTTSLSRLSLRRSGVLSLFRNLRHYSDATPEDVKKQASLNQ
                     FQKQTENEASKERANPPVFFQSDKPPPEVFKDKTLEQPKKEPVLAGYEDVKQSKAITV
                     IVYTLALLSVAFIFSDLIEAVTPANTDYISEEVLEIISKAIEAESDKNIAKAISYYIQ
                     ALKQLDEEESEHITPCYTSCCVRIAQLYEHEKKFEKAIAIYKEVADSYLNAFTHRDDF
                     KTLQEDKSFDFAILRSLTVAIRYAYLLNEKNNNDARELLMFNIIEAQKRVIEAYPPFM
                     SVLNDINNRNILDIITSELEQSILHLPKSEQEAIIKKNSETPIELPLFTTEQTPENKI
                     LGLNVKAWPVFTRVLINAKDLYVNLSVEANDLSSAISNLTNNSIIIQRCFDHPSRLAL
                     TLTKLGVALQMTYQTLNKDFPVGKEIEIVQDNSPVKVDLSDPQLKDYVLNTTRAESSR
                     IFTKVLSLCENMKKQEKLIKSNHLGQGVEQWEAMFKPALDRSEMVSSASLGLLNLQNG
                     NTSEALKLLRRAKVLATKLHDDDYITDINDWISKVEN"
     gene            complement(<454995..>456680)
                     /locus_tag="C5L36_0C02150"
                     /db_xref="GeneID:40384065"
     mRNA            complement(<454995..>456680)
                     /locus_tag="C5L36_0C02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465887.1"
                     /db_xref="GeneID:40384065"
     CDS             complement(454995..456680)
                     /locus_tag="C5L36_0C02150"
                     /inference="similar to AA sequence:RefSeq:NP_012176.1"
                     /note="PKUD0C02150; similar to Saccharomyces cerevisiae
                     YIL090W (ICE2); ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321747.1"
                     /db_xref="GeneID:40384065"
                     /translation="MSNRSSPSSEIQPAVATVERTPSAGSIRSTSSTNHTRKVKVNET
                     LIQLLRVLFSTIYLIYIVLTIPLSFEVGGVNCGLSYSLTILILYFCLATLRVLKYHRF
                     ISSFLYYLQHLLLPTLLSFFLTVFNDDPTVNYNQSIFHEVWWIYVINFWKFFLINSTP
                     LFTILEGFCSLLSIQAIGQLFKYFIKNKSDTWSIINLILSSCILSTSIYFAGKIYVSP
                     LLDLEHVGLISASLLGCVFTLTILITFYAIYFNRATTLESSLMVGYIVKCCYELFPDL
                     SETNINSLFKFVFNEFEKIDKQAKQSFTINGTDFFGHFKWMKVVDFFSRVWKHEDIAN
                     HPLTTKINAKLPYFSEKILNFLKIVKKNGNLLIKLILEHFPRSFEPLWDFVKISINNL
                     TFSILMQLAYRIGVFFAATKIIPILSPVNKVPNTSSQPSTSSRLIYLYSPCIIIAVYT
                     NLMIQYNYEIDKETHFFSWFHYKVMELLHSSSTITSASHAITKTATITTTGTTTGNIV
                     SSGINSSVSQNLFSSIHSWQFWNWVNIFAVLLLYFSELVSYDPEDSALTDHWN"
     gene            <456975..>459380
                     /locus_tag="C5L36_0C02160"
                     /db_xref="GeneID:40384066"
     mRNA            <456975..>459380
                     /locus_tag="C5L36_0C02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465888.1"
                     /db_xref="GeneID:40384066"
     CDS             456975..459380
                     /locus_tag="C5L36_0C02160"
                     /inference="similar to AA sequence:RefSeq:NP_012175.1"
                     /note="PKUD0C02160; similar to Saccharomyces cerevisiae
                     YIL091C (UTP25); ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321748.1"
                     /db_xref="GeneID:40384066"
                     /translation="MSGENAVGVKRQKTKFGRSQLRNVTRTTRRPNQEDPHVSSGNSD
                     NDEDMENYDNESEDDDEVKRKVTIATKRNNRNENAFAYSALVTLLKSEHEEGNDDDDD
                     GDDDGADAEEKRKATGIIEADDDADDNDDKENKGDFEEDLLDDEEKAQDDIDVLNKYD
                     SFNLHFNQEEEIAKVIDKYESLSSGKKSVKLIGKEEIANSEEKYFKYRYGYPSVNPEL
                     VASSKSGTTLSKKLKYHNVKKRVVEHFEKMDVESLDTSLIESMITYETINFQYLNNER
                     IKEKYQDYYLLHVMNHLTKTRDRVLNNNEKKALYEKKMREGADVGEEPEFRDQGYTRP
                     KILILLPSRNFAYTLVTKLINTLQMESVENKRKFKTQFYDDSKVSDRVFHSKPKDFEE
                     HFDGNTNDMFVLGIKYTRKTLKLYSPLEQSDIIIASPIGLLRLFDKINTKAPKKKLDK
                     VNKENDIGLKNNFLSSIEICILDKAEGMMMQNWGNVTDLLNKHLNATPKDFMNVDFSR
                     IRMWAINGQSEYLTQIMTFSKYSTPEMISLVKRSKNLMSGSTSFVPIEERSVIDSLNY
                     KMYQMGLINKYERLKQVFMRFEIDLKNLIDEPNKRFEFFKNVILPQIQNKSSYKYGTL
                     IYIPNYFDYLRIKKFLNDETSVSFVAIDEYLSTSKLTRNRALFHNKSPHARIMLYTER
                     LHFYKRFDIKGVRNVVFYQLPTDPDFYQQVLEFIGNEKLRVNAAKAKLPPKSSIENQN
                     DNDDEDDDDDDEDDSDEDVDLNMCMVRTIYSKLDAMRFSAIVGSSNASKLSNGESEIT
                     EFS"
     gene            complement(<459520..>459815)
                     /locus_tag="C5L36_0C02170"
                     /db_xref="GeneID:40384067"
     mRNA            complement(join(<459520..459732,459813..>459815))
                     /locus_tag="C5L36_0C02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465889.1"
                     /db_xref="GeneID:40384067"
     CDS             complement(join(459520..459732,459813..459815))
                     /locus_tag="C5L36_0C02170"
                     /inference="similar to AA sequence:RefSeq:NP_878158.3"
                     /note="PKUD0C02170; similar to Saccharomyces cerevisiae
                     YNL024C-A (KSH1); ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321749.1"
                     /db_xref="GeneID:40384067"
                     /translation="MSALFNFASLLQVIVLLICTSTYVHSIWPTVLDRNKTGIMGVFW
                     KCARIGERMSPYVCISCFVIAVNQLIS"
     gene            <460049..>460771
                     /locus_tag="C5L36_0C02180"
                     /db_xref="GeneID:40384068"
     mRNA            <460049..>460771
                     /locus_tag="C5L36_0C02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465890.1"
                     /db_xref="GeneID:40384068"
     CDS             460049..460771
                     /locus_tag="C5L36_0C02180"
                     /inference="similar to AA sequence:RefSeq:NP_010019.1"
                     /note="PKUD0C02180; similar to Saccharomyces cerevisiae
                     YCR095C (OCA4); ancestral locus Anc_6.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321750.1"
                     /db_xref="GeneID:40384068"
                     /translation="MNDGLFELDMEMNTSLGEEEKEPILETEEDIYDRYVPTDERIVK
                     EYMNRLETSEEKEQHIEVVGDNIRFLNTIEGIYTPPENFARVCEGVYRSSFPRIENFP
                     YLKTLNLKSIVCLIPEEYPVENTRFNEINGIKMYQIGLSGNKEPFVKIKPELVTEAIK
                     ILIDPSNQPVLIHCNRGKHRTGCIVGCVRKLQKWSYSMIFDEYRRFAYPKERPLDQQF
                     IEMYNDNEIQEYIKEKGLSIEW"
     gene            complement(<460792..>461220)
                     /locus_tag="C5L36_0C02190"
                     /db_xref="GeneID:40384069"
     mRNA            complement(<460792..>461220)
                     /locus_tag="C5L36_0C02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465891.1"
                     /db_xref="GeneID:40384069"
     CDS             complement(460792..461220)
                     /locus_tag="C5L36_0C02190"
                     /inference="similar to AA sequence:RefSeq:NP_012179.3"
                     /note="PKUD0C02190; similar to Saccharomyces cerevisiae
                     YIL087C (AIM19); ancestral locus Anc_2.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321751.1"
                     /db_xref="GeneID:40384069"
                     /translation="MSELPIDTSKAPSFVHQWGLSPAPAWAFATVLAASPAFRPVLEA
                     PQTVQSSSGLYKSAPKVVSPYPSTPQVALFTAFSALGGFMIYDNDPTNGSAVVGVWSL
                     LYFMANVKKSMWNLKLYPKALTSLALVNSVFYGGKFLNVI"
     gene            complement(<461418..>461828)
                     /locus_tag="C5L36_0C02200"
                     /db_xref="GeneID:40384070"
     mRNA            complement(<461418..>461828)
                     /locus_tag="C5L36_0C02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465892.1"
                     /db_xref="GeneID:40384070"
     CDS             complement(461418..461828)
                     /locus_tag="C5L36_0C02200"
                     /inference="similar to AA sequence:RefSeq:NP_014367.1"
                     /note="PKUD0C02200; similar to Saccharomyces cerevisiae
                     YNL031C (HHT2); ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321752.1"
                     /db_xref="GeneID:40384070"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPTSGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
     gene            <462403..>462714
                     /locus_tag="C5L36_0C02210"
                     /db_xref="GeneID:40384071"
     mRNA            <462403..>462714
                     /locus_tag="C5L36_0C02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465893.1"
                     /db_xref="GeneID:40384071"
     CDS             462403..462714
                     /locus_tag="C5L36_0C02210"
                     /inference="similar to AA sequence:RefSeq:NP_014368.1"
                     /note="PKUD0C02210; similar to Saccharomyces cerevisiae
                     YNL030W (HHF2); ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321753.1"
                     /db_xref="GeneID:40384071"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISALIYEEVRAVLKTFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<463000..>464235)
                     /locus_tag="C5L36_0C02220"
                     /db_xref="GeneID:40384072"
     mRNA            complement(<463000..>464235)
                     /locus_tag="C5L36_0C02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465894.1"
                     /db_xref="GeneID:40384072"
     CDS             complement(463000..464235)
                     /locus_tag="C5L36_0C02220"
                     /inference="similar to AA sequence:RefSeq:NP_013275.1"
                     /note="PKUD0C02220; similar to Saccharomyces cerevisiae
                     YLR174W (IDP2) and YNL009W (IDP3); ancestral locus
                     Anc_1.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321754.1"
                     /db_xref="GeneID:40384072"
                     /translation="MAFEKIKVKTPVVEMDGDEMTRIIWKMIKDQLILPFLDIDLDYY
                     DLGIEYRDKTNDQVTVDSANATKKYGVAVKCATITPDEARVEEFGLKKMWLSPNGTIR
                     NILGGTVFREPIIIENIPRIIQHWEKPIVIGRHAFGDQYKCQNIVTPECGGDLKLVFT
                     PKDGSDVIEVPVYEYKGKGAALAMYNTEESITGFARASFELAISRKLPLYMSTKNTIL
                     KQYDGLFKDTFENMYQSEYKDKFEELGIWYEHRLIDDMVAQMIKSKGGYIIAMKNYDG
                     DVESDIVAQGFGSLGLMTSVLVSADGKTFESEAAHGTVTRHYRQHQQGKETSTNSIAS
                     IFAWSRGLIKRGELDSTPDVVKFAQVLEKATIDTVRVDGIMTKDLALARGEIDRSAYV
                     TTGEFIESVAKRLTKELGA"
     gene            complement(<465384..>465779)
                     /locus_tag="C5L36_0C02225"
                     /db_xref="GeneID:40384073"
     mRNA            complement(<465384..>465779)
                     /locus_tag="C5L36_0C02225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465895.1"
                     /db_xref="GeneID:40384073"
     CDS             complement(465384..465779)
                     /locus_tag="C5L36_0C02225"
                     /note="PKUD0C02225; Pfam Domains: PP-binding(1.4e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321755.1"
                     /db_xref="GeneID:40384073"
                     /translation="MFRSIVNASRITLRNVSVVSSATRVTPGYINKQAPMKSAVRFYS
                     AAPELTREIIAERIVELLQAYSKTAEDITITDSTSFSKDLGYDSLDTAEVIMEIEHEF
                     SILIPDKEADEIKTVGQAIDYIQHQDDAC"
     gene            <466232..>466783
                     /locus_tag="C5L36_0C02230"
                     /db_xref="GeneID:40384074"
     mRNA            <466232..>466783
                     /locus_tag="C5L36_0C02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465896.1"
                     /db_xref="GeneID:40384074"
     CDS             466232..466783
                     /locus_tag="C5L36_0C02230"
                     /inference="similar to AA sequence:RefSeq:NP_014434.1"
                     /note="PKUD0C02230; similar to Saccharomyces cerevisiae
                     YNR036C (MRPS12); ancestral locus Anc_6.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321756.1"
                     /db_xref="GeneID:40384074"
                     /translation="MFRALNIHRAMASAFKTSASSLIAPRLAIANNFINLQSQTSLLK
                     PSSVLQLSQQRNATLNQIRKGRGLITRKKRPTKSPHLENCPIKKGVVLRVMILKPKKP
                     NSAQRKAARVRLTNGEVVSAYIPGIGHNCQEHSVVYVRGGRSQDLPGVKYHLVRGAMD
                     LSGVANRATSRSKYGAKKPQSKE"
     gene            complement(<466818..>468806)
                     /locus_tag="C5L36_0C02240"
                     /db_xref="GeneID:40384075"
     mRNA            complement(<466818..>468806)
                     /locus_tag="C5L36_0C02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465897.1"
                     /db_xref="GeneID:40384075"
     CDS             complement(466818..468806)
                     /locus_tag="C5L36_0C02240"
                     /inference="similar to AA sequence:RefSeq:NP_014436.1"
                     /note="PKUD0C02240; similar to Saccharomyces cerevisiae
                     YNR038W (DBP6); ancestral locus Anc_6.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321757.1"
                     /db_xref="GeneID:40384075"
                     /translation="MFSKRYDPNTKPGTSGELSGRRSELLKKIKARKLQGSAIAEIQP
                     DVEMRDSVAHVEDSMDVSEDEKVLKRKRESMGSEFEEESESEDESEPELNAEISQDET
                     VDKVAEGDVMERDDIQIDTPHASIISRFQQVMNKQPSLAVEEEVDEKDEPIEYKDVAP
                     LPQPKLPRDKQLYSQLHKNKSLDWLTKPAFYDSSLSKPFKDFDPALMDIILRNLYNEF
                     KIENAFSVQVTLIEELLKDIKRGRLDPTPRGDYLINAATGSGKTLSYLIPIVQYIMGY
                     TQKLRIKDSGIQAIIIVPTKPLVQQVYSDALKLTKGTDINVMALKSGGDLSIQGEKLR
                     IESNLTDILITTPGRLVEHLEVISMKSLRFLVVDEADRLLNQNFQDWCDLVMNKIERI
                     SNVENEGLDVTFKLRCIKIVLSATLTTNSEKLTHLRLFKPRLVIVNSTNNNELYQLPR
                     TLNEKLLNVSEKLSYFKPLILLRLFEWIDKEKFRYDNFGLIFTKSNESTIRLSKLLNL
                     LVMKLRLKLRIGNINSMMDNLERMKILKNFDENGGILICTDLLSRGINLTSIKFVINY
                     DLPGSTKEYIHRIGRTARAGNLGNAITMCFGEGEFKWFKRIVYSGQQINRNGKPITDI
                     KFNKEHDEELWGKDEVDEFVLTIGEMDKQIYQECLRDL"
     gene            complement(<469051..>470298)
                     /locus_tag="C5L36_0C02250"
                     /db_xref="GeneID:40384076"
     mRNA            complement(<469051..>470298)
                     /locus_tag="C5L36_0C02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465898.1"
                     /db_xref="GeneID:40384076"
     CDS             complement(469051..470298)
                     /locus_tag="C5L36_0C02250"
                     /inference="similar to AA sequence:RefSeq:NP_011665.1"
                     /note="PKUD0C02250; similar to Saccharomyces cerevisiae
                     YGR149W; ancestral locus Anc_4.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321758.1"
                     /db_xref="GeneID:40384076"
                     /translation="MDIDNMEKDNGCSCTPTSDESSSNAYADLSSSDAPFFEGVTLLD
                     LLQPTTLNLELRKKKDDTYKWVRKVYNDKKKSANINLSKEDLKEIKRFLHIKLDQVYL
                     KVNETEKASSTEKLFFSFSVYMIFFIGYLIGHSPEYIHILYSVMFAILMPIRLLTYYK
                     RDYGYFLADLCYYVNYLLLIYIWILPDSQSLYIACCSFSWGSLSFAVITWKNKLVLHS
                     IEKITSTFIHVLPSVTMYVITHQLSHEYKLERFSGSVKLQQWDIMYGILQTSLLYLIW
                     QLGYHYFITIRKADKIKKGKVTSFEYLRKSMNTHKFVRFINSLPDPLPLVAFTLIQYG
                     YQLITMSLCPLLYKHRHLCSAFVSFIFFYATYNGATYYIDYYGKKFQRQVSELQREIE
                     AMQQDIEERDKSGLSKVATGIES"
     gene            <470967..>471971
                     /locus_tag="C5L36_0C02260"
                     /db_xref="GeneID:40384077"
     mRNA            <470967..>471971
                     /locus_tag="C5L36_0C02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465899.1"
                     /db_xref="GeneID:40384077"
     CDS             470967..471971
                     /locus_tag="C5L36_0C02260"
                     /note="PKUD0C02260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321759.1"
                     /db_xref="GeneID:40384077"
                     /translation="MAVTRSQANPRKFKSIKVNNSAFEINDASKQKKSVKTTKSSNIK
                     AASKDDTNTSKSTPCKTSDNHRKNEKSDTKRKPNDVDNKDESKCGSEHKGKRIPAYKI
                     EQLQRLQKLVDMSSVAKPKGPITSRDSLKSSKMTQNLKLKLNQDNKSRISNVTNYDPV
                     RKKYLDGKLDHAELDKVRERYVKIRKFKDVKAPKLHQDKLLQRVLNEISEDNKRLKYW
                     TSHNPQLDLETFLGDEYVLNESKLGYLGVDASQRESLLEQKSAGQGIGASLDGGETNV
                     RYKRIDIKKEEESSDLKNLLNALDTMKDVEMVDENSVFDGLELEDFTVIKKYPFAKKV
                     "
     gene            complement(<472206..>472997)
                     /locus_tag="C5L36_0C02270"
                     /db_xref="GeneID:40384078"
     mRNA            complement(<472206..>472997)
                     /locus_tag="C5L36_0C02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465900.1"
                     /db_xref="GeneID:40384078"
     CDS             complement(472206..472997)
                     /locus_tag="C5L36_0C02270"
                     /inference="similar to AA sequence:RefSeq:NP_009760.1"
                     /note="PKUD0C02270; similar to Saccharomyces cerevisiae
                     YBR201W (DER1); ancestral locus Anc_8.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321760.1"
                     /db_xref="GeneID:40384078"
                     /translation="MEGMPLQWLHTVLPVTRIYVIGSVGLAIAEHLGYVKLSDITLNS
                     NAGFDKDQLWKIPLNILYNGTISLNFVTRLYFFARYANSLEQAAQSSKKFFWNLFILT
                     CFIVLYSTYVTNLKLYGPTFRDAMLYIWTKKNSDAEVFFAFFLVRHIWIPWISFALEV
                     AILGARDKKKWLIELSGICIGHLYWFLDEQIPLLQGTKTILRPIWEWNFLNNVQQPME
                     LRNNQEQEIRDQAQGDVDDDIQLEPINADNELDFERETEETLHQR"
     gene            <473214..>474137
                     /locus_tag="C5L36_0C02280"
                     /db_xref="GeneID:40384079"
     mRNA            <473214..>474137
                     /locus_tag="C5L36_0C02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465901.1"
                     /db_xref="GeneID:40384079"
     CDS             473214..474137
                     /locus_tag="C5L36_0C02280"
                     /inference="similar to AA sequence:RefSeq:NP_015256.1"
                     /note="PKUD0C02280; similar to Saccharomyces cerevisiae
                     YPL069C (BTS1); ancestral locus Anc_8.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321761.1"
                     /db_xref="GeneID:40384079"
                     /translation="MSISSTNESLYLKLVEPFTYLRENTKGKGFRNTLLSCFNLYFNL
                     GDDDLKLVQEVIDILHNSSLLIDDVEDDGVIRRGVPCAHRIFGIGNTINAGNMMYFKA
                     WESLLQLNIPRLSEVYVASMMKLHFGQGLELYWRDNKKCPTEEEYLEMVVCKTGELFK
                     LGVSIMECVSINRGMSLDVHITEGIKKFCDILGMFYQIKNDVDDLVDGDDGIEFAHDL
                     KEGKYSFPIQYCINMKNMKLGIGKKDMSVNERRVIVTQIADAGGIRYSQEYMFRLQGD
                     AQTLLHSMASLSSSAKCDEMVKKLVSIVSKD"
     gene            <474586..>475017
                     /locus_tag="C5L36_0C02290"
                     /db_xref="GeneID:40384080"
     mRNA            <474586..>475017
                     /locus_tag="C5L36_0C02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465902.1"
                     /db_xref="GeneID:40384080"
     CDS             474586..475017
                     /locus_tag="C5L36_0C02290"
                     /inference="similar to AA sequence:RefSeq:NP_011918.1"
                     /note="PKUD0C02290; similar to Saccharomyces cerevisiae
                     YHR051W (COX6); ancestral locus Anc_5.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321762.1"
                     /db_xref="GeneID:40384080"
                     /translation="MFANTIRAAIRQNTRFAVNPARQQLINKSLIASTIRNYSDHHEE
                     TFDEFSTRYEKEFEEAYDLFEVQRVLNNCFSYDLVPSPSVIEKALRACRRVNDYATAV
                     RVFEGLKFKVENKEQYEAYLEELKDVRAELGIDLKEELFQE"
     gene            <475781..>481390
                     /locus_tag="C5L36_0C02300"
                     /db_xref="GeneID:40384081"
     mRNA            <475781..>481390
                     /locus_tag="C5L36_0C02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465903.1"
                     /db_xref="GeneID:40384081"
     CDS             475781..481390
                     /locus_tag="C5L36_0C02300"
                     /inference="similar to AA sequence:RefSeq:NP_011888.1"
                     /note="PKUD0C02300; similar to Saccharomyces cerevisiae
                     YHR023W (MYO1); ancestral locus Anc_5.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321763.1"
                     /db_xref="GeneID:40384081"
                     /translation="MENYKGEIWVSQPDDKQDSIFRRGEIVEKVKDTENSTIYKVKLK
                     DNDELVDADLKNIHKANPIRFDGYDDMASLTYLNEPSILNNLKVRYQDDKIYTHSGLF
                     LVTVNPYKKINIYNSDFITLYSANEKKCNQPHIFGTAQKAFDSLIKNKKDQSILVTGE
                     SGAGKTENTKRVIQYILSVATNVENKQSAAVLENQILQANPILESFGNATTVRNLNSS
                     RFGKFVKIQIDSSNSQLVGAHVDYYLLEKSRVIFQDSNERNYHVFYQLLKGAPLDLLE
                     RLHLNNKSLNQYEYLKSGLTTPVGNIDDKKEFQNLINAFKIMSFNDEEVLNIFKILAI
                     ILHLGNIKFKNSLNDTKQAVLLDESNETIDKVALLLGVSSQEFRKSFLNSKIKIGREI
                     VNQQRTAAQAKFSIDALSKSLYEKLFQYLIDNINRSFNSSTNQNEFMDISDNYIGILD
                     IAGFEIFKKNSFEQLCINYTNEKLQQFFNHHMFELEQSEYMKEGISWNYIDFGNELKP
                     TIELIEGSQSNKRKTNIFSILDEECVVPKGTDKSFIDKLFSELESKDTTVDKNNLSFK
                     PNKIRDGFIIKHYAGSVDYSVDGWLDKNKDPLSSTMVELLSNSNDIFVNDFVNASITE
                     FNITDSPVKGSPRKKTGMFRTAAQRHKEQLNLLMDNLSQTFPHFVRCILPNSEKKPGV
                     FNDAIVLHQLRCNGVLEGIRIARSGYPNRIDFENFAKQYSILSNASFNKASGIKNSTA
                     DYKKICEIILGELKLDPEVYKVGVTKLFFRNSVLASLEKVREQTLSSILSDFNAIVRG
                     KLVRASFVRNIQRLRASKVLAKNFKHYSLVKDDPWFKLINTLKPRLDDVGVVEAQYTN
                     RIAKLENQVKEMSSQINDNLKERDEIKSKLGALNKEIVEDQKTISAKDFELGELKQAK
                     VLLEKELANLKITTDEKTSILKEKEQEIDKLSNTNSDLINKLENDNKALVDSKKSLEA
                     TIERNNKQISLLNDELKELKCTIDKNELEISSMKRDKKSKDTAASKKIDELQCKLSDA
                     ISESSVIKAELDMKSKTLAEKIALLDDLQIKEKALSQENNKLKDIAQKYESKRVALDQ
                     AERLKKEFKELKHKYKQLKSNHEQRIQEEVNFNSGRQHYLEELDRTKIVIDELKRDLE
                     MEKKNSVDLSLRLDHAKLETERELKNKKSLEMEVSQLKLRLRSTNPDQAELSQLEHNR
                     RSNLFTPDMHRLIEEARSARTRLAAESYENRTLKALLRKHGISDLNLSNYSSKNESEP
                     SEIKIFNDHDEVDELRERLRLEKESNKRWEERYVQLQKQSVINKTKNARESIDIEAYD
                     LLSTDSMEYKNKYQMAKIEIDDLKEQLKELRIEAKRKPVQKSNVLADTTNIENRTLAS
                     LDNNKSKGENLRLKSELMSLKTKLNRLESGNTSRFEQEEEIIQLKNHLKTLELSNSSL
                     QASKEIYKDRSEDYYAKLNQVENELHSSKILEAKLKEDISHLKSQANMYQSKYLESNS
                     EILKLNEKIGKLEKNLIDREFEINKLNDIISDLKDKLQCSEDLRKSVKSVSYDYHENE
                     IERLKKELVNSVNKESEMNGFIKSMNAQLETLRNKVNAEKSNSSQLNEEKNKLARSLK
                     DCALKNEELCKHVEENINKAQSLTQQVNALKVTTADLTRERDELFAAKRDLEDKIRDI
                     NSQFEDNLMKAKENAHTVVLNQQLTSELNEARQELSEMRNKLSTYENNLIDVTGKLEL
                     KTKEYLKAVEDNKKLVKFNSKLESDISIMRQRYDAELKAQDDHWSKRVSELDEKLRVF
                     RSSQLTENYKINELNGTIRELEAQNQNLEHSKKHLKDVIRHLEANVERLQISYENSNK
                     REAEAQTRSLHLSNQLDKLRESLGVNI"
     gene            complement(481574..481646)
                     /locus_tag="C5L36_0Ctrna6R"
                     /db_xref="GeneID:40385082"
     tRNA            complement(481574..481646)
                     /locus_tag="C5L36_0Ctrna6R"
                     /product="tRNA-Arg"
                     /note="PKUD0Ctrna6R; codon recognized: AGA"
                     /db_xref="GeneID:40385082"
     gene            complement(<483128..>485143)
                     /locus_tag="C5L36_0C02310"
                     /db_xref="GeneID:40384082"
     mRNA            complement(<483128..>485143)
                     /locus_tag="C5L36_0C02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465904.1"
                     /db_xref="GeneID:40384082"
     CDS             complement(483128..485143)
                     /locus_tag="C5L36_0C02310"
                     /inference="similar to AA sequence:RefSeq:NP_015013.1"
                     /note="PKUD0C02310; similar to Saccharomyces cerevisiae
                     YOR368W (RAD17); ancestral locus Anc_7.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321764.1"
                     /db_xref="GeneID:40384082"
                     /translation="MASGAGNISTVPDITSSEIAYSINRQKENLDDNSLENEPRLQSS
                     GMVEVSLHPKLTQNGSFKKLEIKPQFLAKTRNIHTLHKLISSVQLFGDFCLVDISAEG
                     ICFSINDGNVCKVRLNLNRKMFDIFEFNGVWGKSARFTDSQLYADDTDLSDEACIEPN
                     SPELQFHRNEMITINLNISSFLETVNIYVKDKKSSDASVECTLKYERDGDPFILIFED
                     DHIVERVELGTYFVEGGAQNSKRKRGTKNRVKKNGKISDPHKTNNEEQAVTVFDFEPT
                     TLDDSVFRTDPSKILFDIIIKPNILYDVMKDMLDLTTERFVLYCSKNETELEELNQNR
                     VSLKDNKNSKIIFISKSKSDTIGYSKLIIPQRKANIPEFKLLKPIVANDNLDGRENGY
                     QFIDCYNISLSSTYHFHYFAKLIRAIKLSRLIKIRKDMNGITSLLLLLGKNAIGSQQQ
                     PQPDILLGSSIEFTTLESVPIDELSSLNIDGETTTLLKKLGYNNHFIEQLIKDDQDIQ
                     TIRVGNDGKFVTLDDFFGNAAAEFENAEPHNVMNHISTNSRNQNVNNYSSNAFKNEEV
                     LKPKKSDILPEQNNNVLKLTEQLTMSLLGHGTPLKVGHSNNIQVEKSIAEDDERTDRR
                     RGKRKTNSVEKRSKQQNSGKKGRKKRDKDENDGIETVGGAIEIPLFI"
     gene            485994..486067
                     /locus_tag="C5L36_0Ctrna5I"
                     /db_xref="GeneID:40385073"
     tRNA            485994..486067
                     /locus_tag="C5L36_0Ctrna5I"
                     /product="tRNA-Ile"
                     /note="PKUD0Ctrna5I; codon recognized: AUU"
                     /db_xref="GeneID:40385073"
     gene            486080..486152
                     /locus_tag="C5L36_0Ctrna6A"
                     /db_xref="GeneID:40385077"
     tRNA            486080..486152
                     /locus_tag="C5L36_0Ctrna6A"
                     /product="tRNA-Ala"
                     /note="PKUD0Ctrna6A; codon recognized: GCA"
                     /db_xref="GeneID:40385077"
     gene            <486428..>487324
                     /locus_tag="C5L36_0C02320"
                     /db_xref="GeneID:40384083"
     mRNA            <486428..>487324
                     /locus_tag="C5L36_0C02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465905.1"
                     /db_xref="GeneID:40384083"
     CDS             486428..487324
                     /locus_tag="C5L36_0C02320"
                     /inference="similar to AA sequence:RefSeq:NP_009918.1"
                     /note="PKUD0C02320; similar to Saccharomyces cerevisiae
                     YCL009C (ILV6); ancestral locus Anc_1.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321765.1"
                     /db_xref="GeneID:40384083"
                     /translation="MLAKSTGLGYGARLGSVLRCRYSSSTAAMAYKNLHRNKKRPQLP
                     TFEQPTLSADSAVSSIIYETPIVSKSPKTQHVLNCLVQNEPGVLSLVSGTLAARGFNI
                     DSLVVCNTEVKDLSRMTIVLGGQDAVIEQARKQIEDLVPVYAVLDYSHSEIIKRELLL
                     ARVSLLGPEYFQELVAHHNDSDASVSDRLRSETYHPKNLPPSQALRQKFEHLDAISKL
                     TREFGGKIVDVSDRNCIVELSAKPSRISSFIALIQPFGILELARSGMMALPRTPIEGV
                     EDGTDPTKDAADVVDVSQLPPG"
     gene            complement(<487551..>488225)
                     /locus_tag="C5L36_0C02330"
                     /db_xref="GeneID:40384084"
     mRNA            complement(<487551..>488225)
                     /locus_tag="C5L36_0C02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465906.1"
                     /db_xref="GeneID:40384084"
     CDS             complement(487551..488225)
                     /locus_tag="C5L36_0C02330"
                     /note="PKUD0C02330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321766.1"
                     /db_xref="GeneID:40384084"
                     /translation="MVFDNTESAPLLGSTFTTDNSFKSKWNNFKRQAVRNKLHVYVPI
                     GIISVILFSLIAIFFTHVKPNLGVGVAEGTVFDTDNLRLLGLGDSGGIDLQISGTNTN
                     NYTNIDDSWIRNYFKAGGFTLRGLNLKIDDLDLIVHEGDEKLNLGKAAIKPFYVKIAN
                     NKSTPMDLFITLYPNGKGVKSILKRVLLEKDPKLRLTGDANVKVYILGGFLPVSSISV
                     PLDVEF"
     gene            <488498..>489409
                     /locus_tag="C5L36_0C02340"
                     /db_xref="GeneID:40384085"
     mRNA            <488498..>489409
                     /locus_tag="C5L36_0C02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465907.1"
                     /db_xref="GeneID:40384085"
     CDS             488498..489409
                     /locus_tag="C5L36_0C02340"
                     /inference="similar to AA sequence:RefSeq:NP_013273.1"
                     /note="PKUD0C02340; similar to Saccharomyces cerevisiae
                     YLR172C (DPH5); ancestral locus Anc_1.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321767.1"
                     /db_xref="GeneID:40384085"
                     /translation="MLYMIGLGLAHETDITVRGLEAAKKCKRVYLEHYTSVLMSANKE
                     SLEKFYGREVILADREMVESESDKILENAQEDDVAFLVVGDVFGATTHTDLVIRAREQ
                     NIPVESIHNASVMNAVGACGLQLYNFGQAVSIVFFTEDWRPDSFYNKIMENRRIGLHT
                     LLLLDIKVKEPNIKAMMQGRIEYDPPRYMSVATCCQQLLEIEEKRKEEAYTPQTPCIA
                     VSRLGSPNQSFKAGTLEELANYDAGEPLHSVVMLGRQVHDIELDYLLAFANDPDAYRK
                     AVAADQEYFKPPPPPPAPQDIISSDEE"
     gene            complement(<489573..>492557)
                     /locus_tag="C5L36_0C02350"
                     /db_xref="GeneID:40384086"
     mRNA            complement(<489573..>492557)
                     /locus_tag="C5L36_0C02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465908.1"
                     /db_xref="GeneID:40384086"
     CDS             complement(489573..492557)
                     /locus_tag="C5L36_0C02350"
                     /inference="similar to AA sequence:RefSeq:NP_009365.1"
                     /note="PKUD0C02350; similar to Saccharomyces cerevisiae
                     YAL035W (FUN12); ancestral locus Anc_7.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321768.1"
                     /db_xref="GeneID:40384086"
                     /translation="MAKKGKKNNKQDYWDEEFEADQPQAEELASPAPESETAEPQGPA
                     VANAEDEFGGDFLSNLKKAKNKKEKKVKQKEEEKKQQEQETQKGPIIKTKKEKERERK
                     EREKQRKKQLAERKGASAGAAGNSSKKDEESTTETSGEEKKVDEPTKATPSSSKKTKK
                     VPAAIAALKRQLELKKQAEEEAARLEEEERLREEEEEKQRVAEEKANEEEKRLKKEKE
                     KARIEQLKKEGKYLTKKQKQEKALQERRRAALLQSGNIQVAGLSSEGQPKKASAARYK
                     KKKKQSQSAEEKAAAEAKAAAEAKKTVNNGLDDDEDEALVDDWENMLDDDEGEEAASG
                     ELDEEEREEQEEQEFVAHDYDDTDIVEEAQPKVTTPKASPIPEAKSLLPKTTSITKDG
                     RELRSPICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIDSIQEKTKV
                     MEEFEKVSYDVPGLLMIDTPGHESFTNLRTRGSSLCNIAILVIDIMHGLEQQTIESIR
                     LLRDRKAPFVVALNKIDRLYDWKATPNNSFRNSLEAQKPSVRSEFETRFTQIKVALAE
                     QGLNSELYYKNQNMSKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLKYLTGVEA
                     TILEVKVIEGLGTTIDVILSNGVLHEGDRIVLCGMNGPIVTNIRALLTPPPARELRIK
                     SEYVHHKEVKAAIGVKIAANDLEKAVAGSRLLVVKEGDDEEEMMDDVMDDLTGLLDSV
                     DTSGRGVTVQASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKATAMLDKAKELA
                     VMLCFDVKVDKEAEQYANEQGVKIFNADIIYHLFDEFTAYQEKLLEEKRKANAGSAIF
                     PCVLKTLQIINKRNPMIIGVDVVEGMVKVGTPICAVKPDPSTGRKIPMLLGTVTSLEV
                     NHESKASVRKGETNAGVAMRLEAGSGQQPTWGRHVDEKDGLYSLITRKSIDTLKDPAF
                     RSTVPREDWLLIKKLKPLLDIE"
     gene            complement(<493034..>494284)
                     /locus_tag="C5L36_0C02360"
                     /db_xref="GeneID:40384087"
     mRNA            complement(<493034..>494284)
                     /locus_tag="C5L36_0C02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465909.1"
                     /db_xref="GeneID:40384087"
     CDS             complement(493034..494284)
                     /locus_tag="C5L36_0C02360"
                     /note="PKUD0C02360; Pfam Domains:
                     M20_dimer(8e-20)|Peptidase_M20(5.1e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321769.1"
                     /db_xref="GeneID:40384087"
                     /translation="MIAWVHTLGVAALTLTLAAQGAPAPVAEVSLEDIFTIPDLISGV
                     ADSISSVIDGGSKVPSIFKENPELFKLHADLVKIESISGNEYGVSRYLRKYLSDLNLG
                     FELNVDESRRNIYAFSGTENSSVLLTSHIDTVPPYIHYSIAQDENGETRIYGRGSCDA
                     KGSVAAQIIAAKELVEDGLVKPEELGLLYVFQEEVGGAGMLLANDYFNNNSITWDAVI
                     FGEPTENKLATGHKGIYLADIEVKGKASHSGYPEVGIDANKILIEIMHEIESYPWPTS
                     EILNTTTVNIGLFQGGTAGNVVSPHASCKVLMRTPVDSDLIAPVVAQIVEKHLPEALE
                     IQFNVEVTDDPTFLDYQVPGFDTYIASYATDIPKLDHKNFTRYLYGPGTILVAHGDDE
                     YVTAESLLQAVDDYKKLVLFSLGR"
     gene            complement(<494612..>496057)
                     /locus_tag="C5L36_0C02370"
                     /db_xref="GeneID:40384088"
     mRNA            complement(<494612..>496057)
                     /locus_tag="C5L36_0C02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465910.1"
                     /db_xref="GeneID:40384088"
     CDS             complement(494612..496057)
                     /locus_tag="C5L36_0C02370"
                     /inference="similar to AA sequence:RefSeq:NP_013017.2"
                     /note="PKUD0C02370; similar to Saccharomyces cerevisiae
                     YKR091W (SRL3) and YOR083W (WHI5); ancestral locus
                     Anc_5.692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321770.1"
                     /db_xref="GeneID:40384088"
                     /translation="MSSTSDNTRSNPSPNNNASINSKSIATTAKEHKRDTSMNIIARS
                     GTEIKEPSKEPTTPSLLKTEVFSSPAPLQIPETPERVRGHINDVEGTPLISPPRAGDL
                     TFTPHKDRTKQFPGTDFYTLLKSPEARLEDKKLKRTSTDLFSRSNEDQSPERKEGDYD
                     SEHLLKSPRRDYKEIRKLSENLRTRLNYANVKVQHGWSNKSIGELETSLEEIATNPQR
                     SSQLNGIRPGNSNLEDFWKLRSDRLPKSEDFNDRKLEMSQALLSSPGQFSHNRRRSSF
                     NTSMRLDDIARRGVKSPDLKHTSPLKNGKFKLTINSDCINSGEDLEKDAIFSLISLAS
                     PKRTSAPMLPSVSSSSSNGGLPLLSNIANSQTQRLPPISSMLPMQESSVSRRGSINSA
                     GNPRNSFGAQLFGTTPGLGVGFKASLRSDDETDDETTEEETLEEQQNETLEEENVFLE
                     RSNSGSRQKSQSTPPWIVSFDQQDTTKVQGK"
     gene            <496321..>499056
                     /locus_tag="C5L36_0C02380"
                     /db_xref="GeneID:40384089"
     mRNA            <496321..>499056
                     /locus_tag="C5L36_0C02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465911.1"
                     /db_xref="GeneID:40384089"
     CDS             496321..499056
                     /locus_tag="C5L36_0C02380"
                     /inference="similar to AA sequence:RefSeq:NP_009804.1"
                     /note="PKUD0C02380; similar to Saccharomyces cerevisiae
                     YBR245C (ISW1); ancestral locus Anc_6.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321771.1"
                     /db_xref="GeneID:40384089"
                     /translation="MNLNTSFATYKKASLRRSRSSSTDKSLLSVPNSFTNDKEAQHER
                     TCSASLSNFTQVGTAKVTKYSVLYRKFTAKKNKTWEGDGVLQFNRSTNMGIIKNEDGI
                     VIARLKDASKFISRNIEFRSSGYEFEIDDEITSSEFSGNSSPLISVTSNSNIPLDSSR
                     YKTKNFVSPLISRSKANNSVNAQEQPEQLPKRKLTVPLVSAQKPITTPLQGIKKRKVT
                     DAPLYDTSMVENPLFMPDLPRSIDESEIPRKVVIDPLLSEKLRPHQREGVTFMYSCVM
                     GISGNDIRGAILADEMGLGKTLQTITLIWTLLRQSHIAGTKPVADKVLICCPVSLVNN
                     WKNEFNKWLGLNRLGICTINNNKYSNEIQDIQLFARNRVHQVMIIGYEKMQSMSEHIK
                     QVKFDLLVCDEAHRLKNSDNKTIKTLESFNIRRRILLSGTPIQNDLTEFYTMANFTNP
                     GILGDLKTFQKEFIRPILDSRDSNCRSTKVIEKGRAKSLELMKITERFILRRSNAELT
                     SYLPKRSDYIVFVPPTPLQLQLFKTIIETKKFKLFIENETTQNSSSSFNLINTFRKIC
                     NSPSLLQSDGFFLEISERNTQSQDDVEFRRQLGKKVKSGKIMFLIKLLGLLHSQGDEK
                     VVIVSNFTSTLDIIETLFKSLNLKFCRLDGSTASNERMKIVDRFNKSKADDTFAILLS
                     AKAGGVGLNLVGASRLILFDNDWNPAVDLQAIARIHRDGQKRDVKIYRLLTNGCMDEK
                     IFQRQLMKMDLSDKFLDQRGGEKELFDRSDIKDIFNVQFEKIKSNSYCNTHELMCCDC
                     DGKGTNNEIDQEDSTGTNSDDENESNDLTDIDKRQFMSALSYADKYPNASSNPEDELL
                     RMKRKKLRRCMKGYKHINGLGSKERFISTDDDILNALINNQDPEKPLISYVFGKF"
     gene            complement(<499123..>500265)
                     /locus_tag="C5L36_0C02390"
                     /db_xref="GeneID:40384090"
     mRNA            complement(<499123..>500265)
                     /locus_tag="C5L36_0C02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465912.1"
                     /db_xref="GeneID:40384090"
     CDS             complement(499123..500265)
                     /locus_tag="C5L36_0C02390"
                     /inference="similar to AA sequence:RefSeq:NP_009805.1"
                     /note="PKUD0C02390; similar to Saccharomyces cerevisiae
                     YBR246W (RRT2); ancestral locus Anc_6.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321772.1"
                     /db_xref="GeneID:40384090"
                     /translation="MTHNLRRRAVFNTEAPPCCLRINPLDSTIVYFGTYTLIQGNDRK
                     GTIEIWKLRSKEGTTDVPDEQNINLDDLELQGIKLGSIPTHGAVLDIKIDSKSITSNG
                     DSILLSTAQSTGNITLWKIKKDDPLDIKEVSDVQLFPESTSNLGETLITSINFHPRKT
                     YLSFTTTTGIVGYYDYSEGSNSNEPVCFGKEHSLEAWYADWCHLEALDNIVFSGGDDA
                     RLIAHDTRVPFPVFETSRIHDAGIVSILTARSNWCENVTDPYIIWTGGYDDQLCVLDL
                     RAGANMNNGALFEGIPPMLREKHNLGGGVWRLIPSPKENDCRVFTCNMYDGGRMLAYD
                     SSNAKNVEVKNYYKGDHSSITYGGDWIGDVAISCSFYDNVVQVWEV"
     gene            <500328..>502304
                     /locus_tag="C5L36_0C02400"
                     /db_xref="GeneID:40384091"
     mRNA            <500328..>502304
                     /locus_tag="C5L36_0C02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465913.1"
                     /db_xref="GeneID:40384091"
     CDS             500328..502304
                     /locus_tag="C5L36_0C02400"
                     /inference="similar to AA sequence:RefSeq:NP_010334.1"
                     /note="PKUD0C02400; similar to Saccharomyces cerevisiae
                     YDR049W (VMS1); ancestral locus Anc_3.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321773.1"
                     /db_xref="GeneID:40384091"
                     /translation="MLRLSEKKKSRTFIEFTSLSFIMFFLLFPTKTDKTMSNTIPFNK
                     RYIYNLDPSILESLQTLYFDSITFEQKSYEEYISRRKDEIEDTTNVQRADLFTKPVIV
                     RPKARASISQALSNLSTSMTEKQQLEDSSSEGELNDSNTESESDMENEDESRGEELYR
                     ISENVDDDHQSTISFMSTKSPMILFKSPIIEDDNKCFGIYKVSINAIDSPNFDPISTL
                     RNITYNTENTIPKDPIQAGMSAIFMMSSGHFAGAIISHLPHSTKGNKGTATELHMQSV
                     RMLAHKTFHRYTTRRKQGGSQSAMDDAKGKANSAGSTLRRYNEQALGKDIEELMEEWK
                     PLLDQCTSIYIRGSGKGGKNARGTGLIVRDSKDPKAIIKTGDKRVKFIPFATKRPTTM
                     EIKRTWCELSYLHVVDVPAISKTEIEKKRKREELLQKSKEESHAVDNELADKIKLSND
                     LIQLLKKSKAPALIAFMKKNQSKIDVNFRLQPADHYETNPTLLHYASRKSLPFMVQTL
                     MVQLHADPTILNSLGQTAYEIAGDKDTRYAFRFSRHILGEHSGISWIDSGVGSAMTKD
                     EIELAKSKDKQQQEEIADEEKKELKKQHNAIVQDFREREQSKAKHTSTITGPGLLRVS
                     EEQKLSGLSEAQRMKVLREQRFRAIEARLKRAQS"
     gene            complement(<502365..>503096)
                     /locus_tag="C5L36_0C02410"
                     /db_xref="GeneID:40384092"
     mRNA            complement(<502365..>503096)
                     /locus_tag="C5L36_0C02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465914.1"
                     /db_xref="GeneID:40384092"
     CDS             complement(502365..503096)
                     /locus_tag="C5L36_0C02410"
                     /note="PKUD0C02410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321774.1"
                     /db_xref="GeneID:40384092"
                     /translation="MVGIGNPLKQLKKRLAMEFGADFGRHENHLYRFVTHLVPYKSKL
                     TNYWALLLSLRKAHCKQNKPMTTEQPPTQRNKLLGLGIFAAATVGLYLYTKARPGKAN
                     LPYVYPTEQALATGRVFQTVYTPQEFELLLSSPAALNGTMFVSFVRLGGGPSNSMATN
                     LWDIVSRVETPNTSTVAVELMGGRMEEIANRYVVNKVPSVVALKKTLPYDTYVDPAVR
                     NSNTEVNEIDREKLQEWVENVLTRR"
     gene            <503130..>504212
                     /locus_tag="C5L36_0C02420"
                     /db_xref="GeneID:40384093"
     mRNA            <503130..>504212
                     /locus_tag="C5L36_0C02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465915.1"
                     /db_xref="GeneID:40384093"
     CDS             503130..504212
                     /locus_tag="C5L36_0C02420"
                     /inference="similar to AA sequence:RefSeq:NP_009520.1"
                     /note="PKUD0C02420; similar to Saccharomyces cerevisiae
                     YBL033C (RIB1); ancestral locus Anc_3.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321775.1"
                     /db_xref="GeneID:40384093"
                     /translation="MEETTEDIFENMPLISPTVSRENRASLGDEVVGSHIQSEIQNDI
                     ISNLLEKKGPKHQCLKHHHHVEDFQRCDSPFHAVPKAEEKRRLLPDKLPNVQCIARAR
                     IPTTQGPEIFLHLYSNDEDDKEHLAIVFGEDIRSRSLYKKRQNETQSDRMIRGAYVGK
                     LYPGRRDADFDKSTGMKLEFTENGDLVVDGSTTWVNPTLVRIHSECYTGETAWSARCD
                     CGEQFDEAGRLMGLEGHGCIVYLRQEGRGIGLGEKLKAYNLQDLGADTVQANLLLRHP
                     ADKRSFGLATAILVDLGLLEINLLTNNPDKIIAVEGRERQVHVRERVPMVPLAWQGEN
                     GVKSKEVEGYLRTKVEKMGHLLSKPL"
     gene            complement(<504479..>505009)
                     /locus_tag="C5L36_0C02430"
                     /db_xref="GeneID:40384094"
     mRNA            complement(<504479..>505009)
                     /locus_tag="C5L36_0C02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465916.1"
                     /db_xref="GeneID:40384094"
     CDS             complement(504479..505009)
                     /locus_tag="C5L36_0C02430"
                     /inference="similar to AA sequence:RefSeq:NP_009803.3"
                     /note="PKUD0C02430; similar to Saccharomyces cerevisiae
                     YBR244W (GPX2); ancestral locus Anc_6.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321776.1"
                     /db_xref="GeneID:40384094"
                     /translation="MLRTASKHYLHTLTNMSKFYTFTATKNNGEPFPMEDLKGKVVLI
                     VNTASKCGFTPQYEGLEELYKKYKDQGFTIIGFPCNQFAGQEPGSPEEIAEFCKINYG
                     VSFPIMKKIDVNGSNADPLYEWLKAEKPGLLGFKGIKWNFEKFLVDKEGNVVNRYSSI
                     KTPAAIEGDIEKLLKQ"
     gene            complement(<505386..>508601)
                     /locus_tag="C5L36_0C02440"
                     /db_xref="GeneID:40384095"
     mRNA            complement(<505386..>508601)
                     /locus_tag="C5L36_0C02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465917.1"
                     /db_xref="GeneID:40384095"
     CDS             complement(505386..508601)
                     /locus_tag="C5L36_0C02440"
                     /inference="similar to AA sequence:RefSeq:NP_009629.6"
                     /note="PKUD0C02440; similar to Saccharomyces cerevisiae
                     YBR073W (RDH54); ancestral locus Anc_3.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321777.1"
                     /db_xref="GeneID:40384095"
                     /translation="MTQVENSGIEEVQDPLAQYRAGLQDYPGFKGSEIRDFQSLKEHY
                     FVEDDKKKFDVQATANRFKYLLSLTPLFKHFLKVKAAKDENFSKVLELIEKDDPDNKQ
                     SNGRGTDHRRRRTEKEEDAELMRSEETEIDPKVQVLELEGEFTDSGYEFSKSPKYING
                     SLRPYQIQGLNWLVSLNTNDLSGILADEMGLGKTLQTISFLGYLRYVKNIRGPHIVIV
                     PKSTLENWQREFAKWTPEVRTCVLTGDQEARNQIIKDNISNCQFDVLISSYEIVIREK
                     AVLRKINWQYIVVDEAHRLKNEDSLLSQIIRMFHSKNRLLITGTPLQNNLHELWALLN
                     FLLPDVFSDSSTFDEWFSNDETGSDSNESTNDQDKVVQQLHQVLKPFLLRRIKNEVEK
                     SLLPKQELNVYVGMTPMQRKWYQSILEKDIDAVNGANKKESKTRLLNIVMQLRKCCNH
                     PYLFDGAEPGPPYTTDEHLVYNSQKMLVLDKLLKRLGEQGSRVLIFSQMSRMLDILED
                     YCVFRNFGYCRIDGQTEHTERIVAIDEYNKPDSDKFVFLLTTRAGGLGINLTSADVVV
                     LYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTENAIEEKVLERASQKLRLDQLVIQ
                     QGRTGLNAGQEKKSVASNKDELLNMIQHGAADMLMSAQIKEEGNEKHEIDDDELEKIL
                     MKSQEKTGELKSKFSKLGLDDLQNFSSNNDSVYEWNGKNFQKKEVKGLAGVDGEAFNW
                     ISLAKRERKGNYSVDGYYREVLQTGGRQTNLNSNGSHQGTGDENELRQPKHMNLYDHQ
                     FYPEELHYLYELEWAYYKRVYKIKAKAEKNKSNEDLQLEQAFIDHARPLSEEEKQLKK
                     EYLAQGYGNFSRRDFFSFISANVKHGRYDIASIAKEMPEKTYEEVKKYAEKFWESFRD
                     IENYERYIGQIEAGEDKLRKMNVQREVLRWKVASYDYPMRDMEIKVPYTTIAKREWSE
                     VEDRWLVIQMLRLGIDREDIYEQIFNEIQYGNDPVIEMNFWLQSRSAQEIGRRCQTLL
                     GSIVREHEAGSKKRGRTTGTGKGKSSGGARGGTKSRKKRHV"
     gene            complement(<508822..>510459)
                     /locus_tag="C5L36_0C02450"
                     /db_xref="GeneID:40384096"
     mRNA            complement(<508822..>510459)
                     /locus_tag="C5L36_0C02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465918.1"
                     /db_xref="GeneID:40384096"
     CDS             complement(508822..510459)
                     /locus_tag="C5L36_0C02450"
                     /note="PKUD0C02450; Pfam Domains: Cation_efflux(8.4e-30)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321778.1"
                     /db_xref="GeneID:40384096"
                     /translation="MSSDKTPFFKQGDPLFRYITETQGDEVYPPESPAAYKPGARHLS
                     DVELAPMLHRSRTFCDYLKPNRDLVVPISVNNPMQANRRLSVVPGNDFDRLIERVGSL
                     KSLRPFKLIGKMGKRVDWGSYKVDTDSKLIKNSKVREFYKEQNELIECYEDIDLLLDT
                     GVQFDMVQSYADNTSSNTSEEDSDSGLENENPIEVDVKSERLTLPITSLKMMKKSSNG
                     TTNSSGRKHINISAVPGNIDIEGAKILGYGDHPSSNVVLYAIYFNFVLNVILLVGKIV
                     AVYLSDSMSLIASLVDSSLDFLSTMIIFISNKYAAKQSTKFPVGRKQLEPIGVLVFSV
                     LMILSFSQVLIESIKELVDLGSPHEVTRISMTAIIIMVSTITSKIVAYLLCKSVKNSS
                     VQALVEDAKTDIVFNIFSLLFPVLSLVLRVWWIDSLGASLLCIYVISQWAAITFEHID
                     HLSGSHASKKNYQQVLYMVARFSEEIEGIKNYRMYHVGDLVNVEVDIVLRNSKMSLKD
                     CHDLGESLQYAIETLPYVNRCFVHIDYKIRNYLGHIS"
     gene            <511049..>512047
                     /locus_tag="C5L36_0C02460"
                     /db_xref="GeneID:40384097"
     mRNA            <511049..>512047
                     /locus_tag="C5L36_0C02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465919.1"
                     /db_xref="GeneID:40384097"
     CDS             511049..512047
                     /locus_tag="C5L36_0C02460"
                     /inference="similar to AA sequence:RefSeq:NP_011424.3"
                     /note="PKUD0C02460; similar to Saccharomyces cerevisiae
                     YGL091C (NBP35); ancestral locus Anc_6.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321779.1"
                     /db_xref="GeneID:40384097"
                     /translation="MAEIQTPPPEDMANKGKLSDLNAPEPEHCPGPTSEKAGQGDACQ
                     TCDNKEICTSLPKGPDPDIPLISKRLSSIKHKILVLSGKGGVGKSTFTSMLCWALASD
                     DDLEIGAMDLDICGPSLPKMLGASLKESVHASNSGWSPVYIADNLGMMSIQFMLPSED
                     SAVIWRGSKKTSLIKQFLKDVDWGSLDYLVIDTPPGTTDEHLSVTNYMKEVGIDGALI
                     VTTPQEVALLDVRKEIDFCRKAGIKILGIVENMSGFVCPNCSGESQIFKPTTGGGEKL
                     AKDLNIKFLGSVPLDPRIGKSCDNGECFFDLYPNSPASDAILDVVESLRDEIEGPV"
     gene            complement(<512140..>515949)
                     /locus_tag="C5L36_0C02470"
                     /db_xref="GeneID:40384098"
     mRNA            complement(<512140..>515949)
                     /locus_tag="C5L36_0C02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465920.1"
                     /db_xref="GeneID:40384098"
     CDS             complement(512140..515949)
                     /locus_tag="C5L36_0C02470"
                     /inference="similar to AA sequence:RefSeq:NP_011423.1"
                     /note="PKUD0C02470; similar to Saccharomyces cerevisiae
                     YGL092W (NUP145); ancestral locus Anc_6.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321780.1"
                     /db_xref="GeneID:40384098"
                     /translation="MFGSAAQKSGPFSFGSANNNSSANSTSTPSLNFSTNNNASNPTK
                     PSGFTLGGNTGSIGSQSSLFGSNLSSNNVASNGFTSGNNNNATTPSSTGFGFGSKQTT
                     STVTAPTTASFSFGSKQNGTGTTPLSGVLGANTNKPSLFGNSVTNPSFGSTNIGFGAA
                     QQPQNTPMNQQTTNSSPYGFDINKFSQVEMPKPLTSAASVDENSKLKRKRSDSLETSK
                     ENHSLVGRIVDTFRVPTRQSIENVRGLFSSAKTNQDMQLNDHAIQAKSEYQYALSLRS
                     EYRKLTIKKPRSTYANYKEIDPNDVLLSRRKDLRSKFLQQTQNASKVVIDSLTPPSKR
                     MKTQNELANKSTDNDNLTFSKPLSEQMFSSKEGKPEKADDSYYWSNPSIEEISKLSSL
                     ELTRVENFCVGRKGFGNVMFKYPVDLTEFQGKWDTLLGKTIIFQNRTLQVYPDEANKP
                     QEGNGLNVPAVVTLEKVFPRKYDIQHPNHELLERHVQRLKSTHGMKFISFDPTSGNYV
                     FEVEHFSIWGIVDEEDDDPEIVAKWKRQQTQESLSEKRKNELQINALEKIAGYGQPGD
                     SWKKQKSDFGLVVPGELKTDEDEIHSENEEELILEEQNDDNDKIPDSLVPATLEKDDQ
                     NANNMALLNSNVTDIDQLVEVRAYEPEVDDIDADFLNPRTELATSDNWDEQLKLSNGF
                     FSAFNKNLNQKYNVNLDPKNVGDLIFGKENAADIPKAANVPPVSFENASQYKSCLQEE
                     MVVSAFDVRELDELPRVIVKDEISLKIPMASFENSSNFKIWELLSILYDRGFLESFLT
                     DNLRNTCLNKPSKLSYVLDLKKRELFCDFLQNLEFLDVDTEVEKTNTARNPSERVFNF
                     ICQGKISDAIQYAINTKNNHLAVLLTMLDSSDAGVSKLATSQLESWKMSGSLNLIPSG
                     VLKVFKILKGDILSKEYINHLDGLSWPIVLSLMVRYETGSSIKETIRKLVEFAENSGI
                     SENPLYQMYFSSLKMIDERKRVETFEVELAFLLMKHLKPLIKYDNAEFDDIVVKFAEK
                     LEKQEMVMEAAFVIEHLTDDRKAKDLLTKLLNGNVTKFGFLEDDSKLHEINQRLRIPL
                     RLLHQARSVEFKNQKQYYKSTVELLVAEDIREAHKLLLAEVAPSVIIGNITSEIKRLR
                     LLIEEFSTLSEFKIGAGVYGDYIDFVDLSNGINYEDEEYGEKQAELKKLYQSILSGMS
                     SLQNYTPKVKIAKTIMIRRLLRVVFKEDLGCDREQVLRLELPESEKNYLEAKFDENLD
                     NRMLTTD"
     gene            complement(<516236..>521116)
                     /locus_tag="C5L36_0C02480"
                     /db_xref="GeneID:40384099"
     mRNA            complement(<516236..>521116)
                     /locus_tag="C5L36_0C02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465921.1"
                     /db_xref="GeneID:40384099"
     CDS             complement(516236..521116)
                     /locus_tag="C5L36_0C02480"
                     /inference="similar to AA sequence:RefSeq:NP_014986.3"
                     /note="PKUD0C02480; similar to Saccharomyces cerevisiae
                     YOR341W (RPA190); ancestral locus Anc_7.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321781.1"
                     /db_xref="GeneID:40384099"
                     /translation="MDIARPVGSEITHVDFGILSADEIRKLSAKQITNPTVFDNLGHP
                     VSGGLYDPALGAFLKNICSTCGLGDIYCPGHQGHIELPVPVYNPLFFNQLYLFLRISC
                     LYCNHFKLHSNEVHKFECKLKLLQYGLILEASEIDKIRVDLGELDDNVEKNQNELDKE
                     ESENLSVSSSRYLREKRELFVFESIKNAIADGRTTKSGVFTATVGEARKELITNFYAK
                     ILTKKKCENCGLFSSSFRKDGFSKIFENALKDKEATNNRIKLGSMKNKKAFLHHPPKT
                     GSKYVLSTEVRTLMRALWNTESEMIKYLFHAKPLSAQKLTADMFFIHALVVPATRFRL
                     PSKLGDEIHENSQNELLTKVLNTCLLIRDLNDQFSNITKDITIEEKKIIFNRLMNSFV
                     TLQNDVNGFIDSSKNQNASTTNPTPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPD
                     PNLETNEIGVPPVFAVKLTYPEPVTAYNVSELRQAVINGPDKWPGATQVQNEDGTLIS
                     LIGMSLEQRKSIASQLMTPSSGYNVLNKKVYRHIKNNDVVLMNRQPTLHKASMMGHKV
                     RVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSG
                     SPVRGLIQDHISAGVWLTNKDTFFTREKFQELIYSCIRPEEGHSASAKIITLPPTIFK
                     PVPLWTGKQVISTILLNIKPLDTPGINLKSSNKIKNEYWGHGSKENEVIFKNGELLSG
                     ILDKSQYGASKYGIIHSLHEVYGPDVAGKALSVLGRLFTTYIMMIGFTCGMDDLRLTA
                     EGNKWRNEILADSVDTGRIAATEVTNLDHTTKVNDPEFKKRLEEILRDDNKLAILDAV
                     TMSKVNAITSKVVSTCVPGGTEKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALE
                     GRRVPVMVSGKTLPCFKPFETDARAGGYIKNRFYSGIRPQEYYFHCMAGREGLIDTAV
                     KTANSGYLQRCLTKQLEGATINYDNTVRNSDGTMIQFMYGGDAVDVTKESHLYEFKFF
                     ADNYNSLLQRYSPSKVDNLDAETAISYNKKAKKFAKKQGNVPHFAESDKYDPTISVYN
                     PARYLGSVSDKFEEKLENFIDQNPQLFVSSKEAKNTGGLTSKKFKALMQLKYMRSLIN
                     PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASASIKTPQM
                     TLPILDDVDDESADAFCKSITKIRFSEFIDDVTVVETTADVSAGINATRSYEIKIKFF
                     DCKDYQEEYDVTKEELENTVRRQFIYQLEAVISKEVRKQKLKVAVDMPDIGVAVAKTK
                     ATSNVTSDEGTDEQNRTKQAVSYDGPDEEELETMREAEKSDDDLIDGSASESSDDDSS
                     EDEEDEDNKMDVDEKEETMEKKSLSKLSKARQHEVIVGHTFVTEYDFDDENGSWCNFK
                     LELSAETQKLLMVNIVEDVCKKCVVREVPNIGRCLRPSSDDDNRHLVTEGVNFQAMWE
                     HDSFINVNNIRANDIAAVLKVYGVEAARNTIVNEIQRVFGTYAISVSSRHLDLIADYM
                     TREGTYLAFNRQGIDSCTSSFMKMSYETTCQFLTKAVLNSDREDLKSPSARIVMGKLN
                     FAGTGSFDLMAKMPDA"
     gene            <521607..>522293
                     /locus_tag="C5L36_0C02490"
                     /db_xref="GeneID:40384100"
     mRNA            <521607..>522293
                     /locus_tag="C5L36_0C02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465922.1"
                     /db_xref="GeneID:40384100"
     CDS             521607..522293
                     /locus_tag="C5L36_0C02490"
                     /inference="similar to AA sequence:RefSeq:NP_012480.1"
                     /note="PKUD0C02490; similar to Saccharomyces cerevisiae
                     YJL055W; ancestral locus Anc_1.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321782.1"
                     /db_xref="GeneID:40384100"
                     /translation="MTTETTIPVPSKTICVFCGSSFGNSSEFASEAANLGKLMAEKNY
                     GLVYGGGTTGLMGEIAKAVSSNGAYVHGVIPDALVAKERVSSEEIEKINEEIKNSVDN
                     HKGETPLDDAYGKTTIVPDMHTRKRLMGQEADAFVAMPGGFGTLEELFEITTWSQLGI
                     HKKPIILFNLNGFYDELIRFIDNCIKSGFISANNGKILQIATTPDEVIEKLDNYVVPE
                     GRFTLSWNNQ"
     gene            complement(<522506..>523462)
                     /locus_tag="C5L36_0C02500"
                     /db_xref="GeneID:40384101"
     mRNA            complement(<522506..>523462)
                     /locus_tag="C5L36_0C02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465923.1"
                     /db_xref="GeneID:40384101"
     CDS             complement(522506..523462)
                     /locus_tag="C5L36_0C02500"
                     /inference="similar to AA sequence:RefSeq:NP_013411.1"
                     /note="PKUD0C02500; similar to Saccharomyces cerevisiae
                     YLR308W (CDA2); ancestral locus Anc_4.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321783.1"
                     /db_xref="GeneID:40384101"
                     /translation="MYGSAGVVILSISLALATNAAVVPILQHQSAVDDVNSQKEVMAN
                     ASLESVEALKARQEFPGWLHDFTKMNEWPGLNPPYIPLDFIDFSKIPNIPLRKSGICP
                     SSRAQCSFDCFKCVGHDDVYTCPKLSQTFDDGPSKYTLHLLNRLESEATFFTLGINII
                     KYPEVYKETQRRGHLLGSHTWSHKFLPALTNEEIIAQFEWSIWAMNATGHHLPKWYRP
                     PYGGLDDRVRAIARMFGMQAVLWDHDSFDWQMEIVPQQRTRRQIYGDVYRWAEQGGGL
                     ILEHDVYGSTTNVGAEISRIIGPDQMTVAQCVDGLNYVKEFD"
     gene            complement(<523812..>524588)
                     /locus_tag="C5L36_0C02510"
                     /db_xref="GeneID:40384102"
     mRNA            complement(<523812..>524588)
                     /locus_tag="C5L36_0C02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465924.1"
                     /db_xref="GeneID:40384102"
     CDS             complement(523812..524588)
                     /locus_tag="C5L36_0C02510"
                     /note="PKUD0C02510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321784.1"
                     /db_xref="GeneID:40384102"
                     /translation="MSSQDRFSPPSNCQDKSDNSNMKRPHSRTNSIVSSVSPRTSRLF
                     PDQENPIEGLEKEQEGIVLKLLHEISALKEENKMLKSKMRSSTSLLSTNGSCDSTSSV
                     SPVFPTDYTFNWSGGRDSASSLSSNSSQLSYPPQSSFMNQRRATVTTMTSLKRVPNSL
                     SSQPSVFPQMGNRSRSGSLSIKSPVFPFFDADTTAVTAKRKSLSYPVTDQDPHIQGRL
                     DNHLTKGHKRTISDKIKYSEETLVNNEAPPSSGLLIQQRR"
     gene            <525319..>526068
                     /locus_tag="C5L36_0C02520"
                     /db_xref="GeneID:40384103"
     mRNA            <525319..>526068
                     /locus_tag="C5L36_0C02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465925.1"
                     /db_xref="GeneID:40384103"
     CDS             525319..526068
                     /locus_tag="C5L36_0C02520"
                     /inference="similar to AA sequence:RefSeq:NP_012438.1"
                     /note="PKUD0C02520; similar to Saccharomyces cerevisiae
                     YJL097W (PHS1); ancestral locus Anc_1.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321785.1"
                     /db_xref="GeneID:40384103"
                     /translation="MSEPVAPARSRHTKEEKVTQKTSTDPPTWLIGYNLLSGCLWSFV
                     FLNVFATYLTFGNLLQTFELTHYWTTAIQCCAIIEVINAATGVVKSPVITTAMQVASR
                     LLVVLGVWTVLPEASGNTSYAYLTVHFAWGVAEVVRYYYYANHLISQQRQAPGIAPPQ
                     VPKFLLWLRYNAFLVLYPMGISSECYMVYRAVGAALARGTSGFTAYALFLCIVLIAYV
                     PGTVVLFSHMLHQRAKQQKTLKTKKVDSKSE"
     gene            <526312..>526734
                     /locus_tag="C5L36_0C02530"
                     /db_xref="GeneID:40384104"
     mRNA            <526312..>526734
                     /locus_tag="C5L36_0C02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465926.1"
                     /db_xref="GeneID:40384104"
     CDS             526312..526734
                     /locus_tag="C5L36_0C02530"
                     /inference="similar to AA sequence:RefSeq:NP_012439.2"
                     /note="PKUD0C02530; similar to Saccharomyces cerevisiae
                     YJL096W (MRPL49); ancestral locus Anc_1.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321786.1"
                     /db_xref="GeneID:40384104"
                     /translation="MFRRYFTTAVSAASSTAKKPADLLPLKFEHNIYATLKVHDRSYL
                     VTKGDLVNLPFCMHEAQIGDIIEFNKVDVVGSRNFTYHVKDGIDTSKVTVTGVVVEKT
                     KKPMQVKEVTKRRNRHTKHILSKHDLTVVRISELKINE"
     gene            <527632..>529275
                     /locus_tag="C5L36_0C02540"
                     /db_xref="GeneID:40384105"
     mRNA            <527632..>529275
                     /locus_tag="C5L36_0C02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465927.1"
                     /db_xref="GeneID:40384105"
     CDS             527632..529275
                     /locus_tag="C5L36_0C02540"
                     /note="PKUD0C02540; Pfam Domains: MFS_1(3.1e-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321787.1"
                     /db_xref="GeneID:40384105"
                     /translation="MSWRSKAKKFAWQFFKIDDPVTLRDDYIDKTIDRERKPRQLSKW
                     DRVNFLNAFNWYPSHYSAYEKRFLLKVDICVFLFLGASFFTKFLDNVNVGTAYVSGLK
                     EDLDLHGNELNIFNTCYSVGYAVFQVPLTLLLTKHQFSRHLLLFCELAYGMMTLANAY
                     VKTARQMYAVRFFVGVFEACSTPAAFVIMSSFFTEEELYQRAGLYGAFGTSGSASSGA
                     LQSKAREKLDGVAGLRGWQWQFIIDAVITFGIFLYGFFLFPGTPNSCKKFSLFSEDDM
                     TFARNRLKHCVAIPQKFTWKTIKETLLTWQIYFATILWSLYSQCWYNNSPLLYMKSRP
                     EHFTTTMVTNWNSYIHAVGVPMDILLSPIVQYYGMFIPVNFVFGVGYYCAIILVIWNV
                     SQPLIMSAFFLTMMYKAALSQVLTAWFAVLCKDNVEKKAITIAWAQAFSYAVNAFGFP
                     LQYNMKDSPRFKKGYIANLILIIATHIVFLFGMWMDKYDLKYFPKISGNRHTEYNGDE
                     ISCNESKVVSITEIDVEKDDMSIDVPNNLGSMNDSKTSF"
     gene            <529719..>534794
                     /locus_tag="C5L36_0C02550"
                     /db_xref="GeneID:40384106"
     mRNA            <529719..>534794
                     /locus_tag="C5L36_0C02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465928.1"
                     /db_xref="GeneID:40384106"
     CDS             529719..534794
                     /locus_tag="C5L36_0C02550"
                     /note="PKUD0C02550; Pfam Domains:
                     Pkinase(2.4e-74)|Pkinase_Tyr(6.1e-34)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321788.1"
                     /db_xref="GeneID:40384106"
                     /translation="MDNHSLPSLPPPPVPPLKQKVSLTVNTEVQNFQEPQNVLCVPKA
                     NSNISPQVSSKSVQSSVSLSPLPADGSTKAPTTKKKNVKLSSSKSGLMNGSPLYGEVS
                     GKMNLLFQSAHDSHDSAFNSGSSSSQHRFSTYSYTSNKGLINSQDLGQLNVSPNYHVY
                     SQDDDKEEEEEEEDGNVEEGMFDDFAFENMVASRYSPIKPLSNNRIVSDPTNKTSEKS
                     PMNEFGIDEFGVKLEGMSRSLPIGQKPTENRSMEKIPPMTNILSKKLNRNSDVPLPLS
                     LPEINEKLENMDANTQQKSSPVPLRSTQSVKHASSNRSRSGSMNSRSSTNSAIIPKTN
                     ATTNMSKSHKKTSSKSSLHDLATTPKSFFKFFGSKKHSDTSLKSSSSSKKRHSYSLSQ
                     SSDSSNQNISPVFSKPRNSLEPYPLANTNRFLQPKKYSSVHEHSDTFTVDSLNKSSRT
                     LSPSDPNTPVSSEFRIISPGIAPLKSKPLSNSTSCEIESRSGSIHSAKSALSLNISAT
                     KPGHSSSSSSGFSHKHSKSIDSNNSGSNVNTLVPKKSSIALNSPANNTLSSARSSASL
                     STTYVPATNLAATSSSRKVISLVKLGSKSIKYQRDKSSVPFSKRNSSFNPLDDWDGHS
                     GSFEKIGPVGKKPNPPGQTISVTTTSNLHCQDAEKRKSSTSITGLKTPSDIKSQKSPS
                     FPYSPVNEYNFKSDFEDRPSLRPLSQTSLPKSLNTEKINVNKQFLPKTNKSSVKILIT
                     ANFIDYKFVDITSVSTLSKFMNLVATKLKIKGEPHFYITEIGSSKDKLGKKLDSKVLQ
                     TIWDSLQSTPENITLIFYVTQDEKLKDIATPTPKSSTSHHDKVEETSIYTNSSYTNSI
                     NSDSSYDRYLPTPQQMILKKDSPADYWSVKDNGIDRKPSLNRAHSITHSSLSAEGTTV
                     ISTPSLSSKTSKTSIGFVNQSSLTSNATRSTTKSGTSNTSSTVSVESSANGSFKVIQP
                     QKPHVDFDNKRPSPFNPTRNLVAQRQPPPPPASPTQLPKVHATEKPFSISSTIRSQRK
                     RKPLSNSIKSLQRTNTQGSIFSTKSSSSGVSIDPFAENRITFANFESDGSSVENNSDG
                     TRAEVEKKLRKRPADDEENNKSESENESDSSSGSDDDEFGLFSKKPKSVNSLSNNALN
                     ESGKEEGKEEGDHGDKGNVDETSNLCQKAPKTTNKRTLVMQEPPTENPHAGFAKALGN
                     VIEQEASGLHRFLDSSKLKQRAANAGNPIERSVSDSSIPESASSSSLTSSLDFRPPPE
                     VLYDNLEVFFPKADLDSLIIDEPPTNGSGIGRMKSIRIVAQEASRRNSVIAPLKKSPA
                     SKRLRKAPSNLNNSMKYNTNSGNLLRRTSTKMWGQKVVEVKPDSINKKLVPKRGKNGE
                     FLEFAWIKGEMIGIGKFGKVFVALNVTTGELIAVKQMTINSKFLNRKETNDLVDTFKS
                     EVDSLKDLDHINIVQYLGFEIKDPTYSIFLEYVSGGSIGHLLRKYGRFEETVVKFLTE
                     QALEGLNYIHSKNILHRDLKADNLLLEPDGTLKISDFGISRKSKDIYTSQSKLNFQGT
                     IFWMAPEIIDDNKGVGYNAKVDIWALGCVVIEMFTGERPWSKYEGEGVLYKIGKEKLP
                     PPIKKEIRSEMSLMSKTFLRRCFEVDASRRPTAQMLLEDPFCIVSPDFEFAVTNLGKR
                     IFAVEEQEKGTLNKRMQSMARKL"
     gene            <535048..>537393
                     /locus_tag="C5L36_0C02560"
                     /db_xref="GeneID:40384107"
     mRNA            <535048..>537393
                     /locus_tag="C5L36_0C02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465929.1"
                     /db_xref="GeneID:40384107"
     CDS             535048..537393
                     /locus_tag="C5L36_0C02560"
                     /inference="similar to AA sequence:RefSeq:NP_012501.1"
                     /note="PKUD0C02560; similar to Saccharomyces cerevisiae
                     YJL033W (HCA4); ancestral locus Anc_5.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321789.1"
                     /db_xref="GeneID:40384107"
                     /translation="MAPKSKTISRQDRKLKREKEEALLKELKEKIQSLTPDEYKTLSN
                     FNELPLSKELVKGLDKSGFVKLTEIQKLAIPECLKGKDILAAAKTGSGKTLSFLVPVV
                     QQLLFEKWSDMDGLGALIITPTRELAVQIYEVLLKIGKFTQLSAGLVIGGKDYSFEKE
                     RVGRVNILIGTPGRLLQHMDESATLQINNLQMLVLDEADRILDMGFKKTIDAILGQLP
                     ASRQTLLFSATQTKSVSDLARLSMVDPQYINANKGANGRSGDELSLPETLEQSYVIVP
                     LHEKISLLWSFIKSHLQSKLLVFMSSSKQVHFIYEILRKLQPGMPLMKLHGRQKQKAR
                     LETSVKFTQSKNCCLFATDVVARGLDFPAIDWVIQLDCPEDVATYVHRVGRCARFGRV
                     GKSMLMLAPSEEEGFVAQLESKKIAVKKMNIKGSKKKNIQPQIQSLCFNNAELKYLGQ
                     KAFISYCKSVIIQKNKSVFKIEELPLDLFAASLGLPGMPKLKIPKKASTELSDEARLK
                     LKEKKNENRKLKLLEKTNENGELEDDQKKVRTKYDKMFERKNQNVLSDHYMKLNAELN
                     ADDSGDEDDDFLKVKRTDADVKTEELPELDVNTSKRAMKKALSRKLTAMKSGKGSKLV
                     FDDDGEAHPVYELDDEGTFLKEGPEKVKEEFLSSEKQKMTVEDVVDKGIAKEKRTEKK
                     RKRKEQERLMNGEYDSEEDGQFIATLGTPASSDNENVPDLDEDLESSDEDNGERETKK
                     QRKWFESNNYKGKEDINNDVVEYEQPETIDDLEALTLKLME"
     gene            complement(<537525..>540347)
                     /locus_tag="C5L36_0C02570"
                     /db_xref="GeneID:40384108"
     mRNA            complement(<537525..>540347)
                     /locus_tag="C5L36_0C02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465930.1"
                     /db_xref="GeneID:40384108"
     CDS             complement(537525..540347)
                     /locus_tag="C5L36_0C02570"
                     /inference="similar to AA sequence:RefSeq:NP_011348.1"
                     /note="PKUD0C02570; similar to Saccharomyces cerevisiae
                     YGL167C (PMR1); ancestral locus Anc_8.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321790.1"
                     /db_xref="GeneID:40384108"
                     /translation="MSDNPYMSALNGGGPTMTEEFDGKASYLDQEKNILASASSTERM
                     RSSLSSKYCTMSVDEVVSQLDTDLKSGLSNLQDVSHRRSIHGLNELDSEDEESLLWKF
                     LETFYSDPMIMLLIGSAVISFLMGNIDDAVSITAAIVIVVTVGFVQEYRSEKSLEALN
                     KLVPEMAHLTRNHATETVLASHLVPGDLVHFSVGDRIPADVRLTEAVHLTIDESNLTG
                     ETKPSKKSADIVKSPNTSVNERSNIAFMGTLVREGHGSGIVIATAKDTAFGSVFDMME
                     AIEKPKTPLQKSMDKLGGQLSMFSFVVIGVIGLIGIFQGRSWLDVFQVSVSLAVAAIP
                     EGLPIIVTVTLALGVLRMAKQKAIVKRLPSVETLGSVNVICSDKTGTLTQNHMTVNKV
                     WTTDMKSNPITFENVQSAYSVHPKVITDVSNDVKILLNVGCLCNNSRFSVEKEKFQGN
                     PTDIAIIEALSNFGLYDIRDNVARVNELPFSSSRKYMAVSCGSGSAVETYAKGATEKI
                     LSLCKSYYNKNGEIVKLTPDVIKSINESVSSFSNEGLRVLAFAKSSKPFDGEPKDLIF
                     CGLMGMNDPPRPQIKTSIQSLTRGGVHVIMITGDSEQTALNIAQQTSIPTGPNCVLTG
                     DKLDSMNEIELADAIQNVTVFARTSPEHKLKIVKALQMRGDIVAMTGDGVNDAPALKL
                     ADIGIAMGLNGTDVAKEAADMVLTDDDFSTILHAIKEGKGIFNNIQSFLTFQLSTSVA
                     ALSLIALATLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDGEVMNKPPRKRNDNV
                     LTMKVIKRVLQSALFVIVGTMYVYVREMGDSITRRDTTMTFTCFVLFDMFNALSCRSA
                     NKSVFELGFSNKMFNYAVGGSLLGQLCAIYVPFFQEIFQTEALSLGDLIYLLTISSSV
                     WIADETRKYIVNKRGGLISPGYSSFV"
     gene            complement(<541329..>543506)
                     /locus_tag="C5L36_0C02580"
                     /db_xref="GeneID:40384109"
     mRNA            complement(<541329..>543506)
                     /locus_tag="C5L36_0C02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465931.1"
                     /db_xref="GeneID:40384109"
     CDS             complement(541329..543506)
                     /locus_tag="C5L36_0C02580"
                     /inference="similar to AA sequence:RefSeq:NP_015170.1"
                     /note="PKUD0C02580; similar to Saccharomyces cerevisiae
                     YPL155C (KIP2); ancestral locus Anc_8.678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321791.1"
                     /db_xref="GeneID:40384109"
                     /translation="MGTPILRNDLCQKQYMSTPIKKSDLGKGYNAGSVSRSSSLNNSR
                     GTSERVPSYNSETFHYISTSSPKASMLGPRSRNPSRAPSRQASRDIYPPPPRGSGLST
                     PQHKSFSRSTSRSSSRLSLSSISSTGTQIASATSSIDSPFSMHTVSESRVSRIKVSVR
                     PKPLSFSNNVSTPWVINCQQGQIVNDEIGCFQYDHVFSPSDSNSDVFDVVAAPVVEKC
                     LQGFNGTVFAYGMTGSGKTYSMKGVLHDSAKILFNNLDNSKVTLSPDRMDQDTHSWNN
                     DDGGSPDSNIFHDDTILANGRYKVKYMTCSILEIYNEKVKDLLTTNDEVANKSDLKII
                     DDSKFGIKVYGLKEVKVQSRDHFFELIDQGENVRSTDATDYNYTSSRSHFIVTLKLCL
                     LDHDGLDVISVLNFCDLAGSERATSHIDRRKEGGYINKSLLALGTVITKLSESNGSSN
                     AHVPYRDSKLTRLLQPSLSGDSMVSILCTIHLGANVIGETTNTLRFGSRAKNVLINVR
                     KNIGEIDTNKLIQENESLKLEIEELRFVLDGNVNSTSTSCTLVNNGNNGMDIHGDEVY
                     YELVAENNILNEQVEHLKRLNMEESLIRSNEMDEDLQNLNELLNGLILDTQTRRQGVA
                     ILERLNSKIQEERHRFDETESYVSHLENRIRSYEIEMARYRQDGEIGANKSASILASK
                     VTRPAYNTQQELIDELKEEIDELKLSMQRKDAVIRALQRAGRS"
     gene            complement(<543684..>546269)
                     /locus_tag="C5L36_0C02590"
                     /db_xref="GeneID:40384110"
     mRNA            complement(<543684..>546269)
                     /locus_tag="C5L36_0C02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465932.1"
                     /db_xref="GeneID:40384110"
     CDS             complement(543684..546269)
                     /locus_tag="C5L36_0C02590"
                     /inference="similar to AA sequence:RefSeq:NP_014178.1"
                     /note="PKUD0C02590; similar to Saccharomyces cerevisiae
                     YNL221C (POP1); ancestral locus Anc_2.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321792.1"
                     /db_xref="GeneID:40384110"
                     /translation="MDSLPPKPGAYNPTVKRTKLYNSRQIRTQLNDPAFTKQPKGSNV
                     AKQIRQSISSGGMIANKLNIPDYLAARDFEIKALDSAMVKSRTSGASRVFQSLPRTLR
                     RRTASHNVRRIPKRMRKKALREMGFQIKNGESVMLGTKGVTPSGKPLAKKLGRGRQRW
                     DILRKIKILKYAAKWKIKGKLPGSEYISYSDINLRKRLKLLKKELEKLETRENNENDY
                     TPSIKNKVGSHDNTGLNTFSKVSKIVNVKYAVRQRKFRWLPTHIWHAKRAKMIKRWEW
                     NIPNEPTQRCYRSTSRSSRIKGAVAFDTSYMNTFVINNDITNNEELEKYFKRITKGKL
                     NLKSLKAGLAWDGYVYDYEDSKDPLGKILVVQAGTKILGRVHPSIFTTVFSQLLNWYR
                     ETEGVSIHDCKYSLASIEITGPKALTALQSICFSEKECKSFRNFMNLHKLNDLNTIPN
                     GTVFTFDVQDPRFFTKPSLPSKPNITYDEQLNILVSLKRKPDISDSLLDIERRAMSYN
                     SQLSLTELGQRKAKYPGENIPYKSTDAYISVMVIKSEDKWIFMMPWYWMVPFWHSLMH
                     VPHVNFGGFKQLEQLRLEKGLLGWSDMVFTRDGFIQCEIEREETEKKWRKRPKSKRVE
                     YTKIKVDGRVGELLSPFGLDWRGLQTLRLVVQKLINDGNIDTLTTNRRKFDEKMNLVP
                     QSRNDVEFLVQAIQSAELQLKNKNMHSTLLKYKPITLERSEIEYSSIFFNIPQLPPLQ
                     VVAIKLSCVNSGNIKANARIFTVPKDNLSIWTEVSSGKVKTLSASNMRVCSMVDPEKY
                     TPQITDLVGLVTSGTFNLTQGKFAGIGYVDADAVKGQELGFFLVRNVSSTSYSLTKWA
                     KIPLH"
     gene            complement(<546492..>547244)
                     /locus_tag="C5L36_0C02595"
                     /db_xref="GeneID:40384111"
     mRNA            complement(<546492..>547244)
                     /locus_tag="C5L36_0C02595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465933.1"
                     /db_xref="GeneID:40384111"
     CDS             complement(546492..547244)
                     /locus_tag="C5L36_0C02595"
                     /note="PKUD0C02595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321793.1"
                     /db_xref="GeneID:40384111"
                     /translation="MELTTLTQQQLIARIKQLQSDFQDFYNHSAQVEDLLQQQLDSSQ
                     KQIIEKNSQIKALESQLANIESLHSKVTSLEIENDVLESTVRILTSQLEIQSEKYNES
                     LERVAFLENEMELFKSRIEQGKSDEEETWTMREKNWIQQIESLKMQIEQLTANNKRIE
                     KEFSTKLKDIVTKSKRESSDVKRELLVLEEKVRLLMTSLHYSEQDKAVLEAKLKKLSS
                     RYKKYHQLNNLIRLKKRGITKAFTTPALKPLT"
     gene            complement(<547627..>549549)
                     /locus_tag="C5L36_0C02600"
                     /db_xref="GeneID:40384112"
     mRNA            complement(<547627..>549549)
                     /locus_tag="C5L36_0C02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465934.1"
                     /db_xref="GeneID:40384112"
     CDS             complement(547627..549549)
                     /locus_tag="C5L36_0C02600"
                     /note="PKUD0C02600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321794.1"
                     /db_xref="GeneID:40384112"
                     /translation="MDPYSKIFKRSTGELLRSARRGILEETLVKKLDTCVSSLWTAKC
                     TDAADIPYDGALCSRGANTMFGCNVPLENCGIDNDTPKYQEDISATFVNANVIEEEFF
                     SSSLSEVEALLASRSIALESNAKKSRSPGSISPKVLNFVASKTTSCPLITENTFPLLL
                     SNEIHFEKTGVLDIISTPLEQPPQNFQGIDTACNFSLCGNSTYCRDPKQDPSIETVFK
                     PGEAWFSLYDGPADCEPVNITSFSKCSSEPSNEEMSFQMNGDGGFDIEDSFDEDNYFP
                     GVENNLNYFYKGSPRFEDLSAEVDLWFQVFAGTESFASSKVTSMQQKEIKGDKCEQEN
                     VTTLICPTRFEEILKDQNRSSKISKTNLSLDDKARSRLSNRCILYSQEKKSHKKQVPV
                     FKLTKESIERITHYWEQIITRSTMKAKDFFQNDCDVEAGAIANDQRLKGNLISFLLPN
                     YATAKDFEKFSNNEQGWIYKDTGKHKTQTFPLRWCKQKYNFYDPVVCRVKIIEGKECF
                     KEALCPYCPLQKGMNLDNVFYKVNSSLYLHHVCNNHGVYTTGHEMPHPIICNDGDGLY
                     FTCAQCSHSERFVLQDGDPVNNILLNYYKHMMSSHKRTKQNRSEAQKVKDEEFFNEQG
                     KIHLYENTIFTHPPTL"
     gene            <550948..>552264
                     /locus_tag="C5L36_0C02605"
                     /db_xref="GeneID:40384113"
     mRNA            <550948..>552264
                     /locus_tag="C5L36_0C02605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465935.1"
                     /db_xref="GeneID:40384113"
     CDS             550948..552264
                     /locus_tag="C5L36_0C02605"
                     /note="PKUD0C02605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321795.1"
                     /db_xref="GeneID:40384113"
                     /translation="MYKMTGANRIVQPTSPSPTNPTMSLENSPSPRNGGIDDDSGIQF
                     KNYTVNNPPVFPSSEHHDPLVTPSHYPTPNHTPIPQPNLSYPPSAVLSKSSSSLSPPT
                     GQTLNSSQPVQRDPPSRGSPPAPRRTSVTASNLAKQIGDLLPPNIQRDANGYPILSRE
                     FVVRRISEGETGRLKEELKCEACGKGYKHITSLAKHLWEHTAEWQTTKKLLISKHQQA
                     QLLEAASILCSVSERESVNSSSNVHSVPVSSAPSALTSNTTTNTTNPKAATTAATTTT
                     TTTTTLNAPVSRQHAFNDYSPFDKDHNKLVPVNEHGNSVVSLATRRKSKTEYTKAGKF
                     GGKRRSKSFVIQNQPVPLNQSQALSPLRKMSGMEIHDESDMGMSSRRNSTSANPPIDL
                     RRPSVHSMRPSFGVSVSRRGSLLGSLIKEEPKSESSGAIYDSEEED"
     gene            complement(<552426..>552764)
                     /locus_tag="C5L36_0C02610"
                     /db_xref="GeneID:40384114"
     mRNA            complement(<552426..>552764)
                     /locus_tag="C5L36_0C02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465936.1"
                     /db_xref="GeneID:40384114"
     CDS             complement(552426..552764)
                     /locus_tag="C5L36_0C02610"
                     /inference="similar to AA sequence:RefSeq:NP_010330.1"
                     /note="PKUD0C02610; similar to Saccharomyces cerevisiae
                     YDR045C (RPC11); ancestral locus Anc_3.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321796.1"
                     /db_xref="GeneID:40384114"
                     /translation="MLTFCPYCSNMLIISRSDETGSNAFTCPTCPYEFPIVGLQMFER
                     KYLPRKEIDDVLGGAGSWDNVDQTTAQCPREVCGNDRAYFFQLQIRSADEPMTTFYKC
                     TKCSHQWREN"
     gene            <553045..>556881
                     /locus_tag="C5L36_0C02620"
                     /db_xref="GeneID:40384115"
     mRNA            <553045..>556881
                     /locus_tag="C5L36_0C02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465937.1"
                     /db_xref="GeneID:40384115"
     CDS             553045..556881
                     /locus_tag="C5L36_0C02620"
                     /inference="similar to AA sequence:RefSeq:NP_012289.3"
                     /note="PKUD0C02620; similar to Saccharomyces cerevisiae
                     YIR023W (DAL81); ancestral locus Anc_2.651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321797.1"
                     /db_xref="GeneID:40384115"
                     /translation="MQEDNVTVPSTKSGTPNANNPGNRIVSQSNNEVNTNNSNSRAKS
                     FDNNPNVNSSDNKASMDTPSLFPFDMSSWEDTPDMNFMMDPHHASVDSPSIISSVVSP
                     MNNLNQLGGLNLQSMTNISGLNMNGIQGFNNMSNMGTMPVLSNVNSMNKMGSLNHLNN
                     LINLNIQQQQQQQQQHKNAQEQSKKLTEVSGPSIDYSAQLQHYQNLLLETQGLLNMKQ
                     QMQQKSPGSNADTPQPNTPQSVNTASYNNSQQNMIQQLLQLAQMQQNLQQSQPQIPLQ
                     QQINQNLASSISAAFQSGVPNLPQDVNALQSYITQFSNLQQHQLFPQQQLQLNAQSTQ
                     PPIKFSPNDGRLEAPSKLKKKAEVPQPRTKIRPCDHCRRRKIKCVMIPDLRSCKSCQQ
                     KGIKCTFNENTTVKRNIQPLEQDNKRMKFEDPTIEPPPNVLVRDVPPIKDYSKMQGDS
                     LLKKTLSLQFPRSSFYIGPTSIYDPLFLDKVSLDKIDQLQINKTRSIRKVSNNIQFML
                     RDDFSEMLYEQSEKDSDTVEKYVAPHGQILIDLYFKMVHPSFPVLHKKIFLEKYSRTH
                     REFGASLLAAVYLLAIQWWDYEPRLAKFPKPDVLSLHRFAIRTFADIIQRPKLSAVQA
                     GLLLLQCQSLASSNLLSMKDKQNKKTQIDQRTKEERDKHILETQLQLYNQNNWLLCTQ
                     VVGLAEELGLGLDCSHWRLPKWERGLRRRLAWAVYSQDKWSSLVESRPSHISDQTNWL
                     VKPLTDDDFPEKTNDMANNNSSEFPGVDVELGKESFKHGILLSVILSEILSSLYTPRA
                     IAECNSINTVLKIAKPLQLKLREWYHSLPKYLQMGASGSGKFNVNGNLQLSYFATEIL
                     LHRRIISTLYNQTRSSQAFSPASASNNSTPSAFSEPQSSSQSQQPSTIPPPPPQLIAV
                     CRNAAKTRLTASIGFVRELDSSHMQSFWHSSASRNFASIGVFAVLLYVTSLDADEASI
                     YREHIMDYRWILKANAETFGIAKEALRLIDGVIKNIPGLWNEYDDVSMDAVSKNVNFE
                     QSNLNLHKRTVSNNNYGANSGDSPQSMASPKQANSKTTNTIGRVSQNATPLNSPVPPS
                     PLSGRMNFENSKNVNKQRTKSPIMNRSLKPGKSSGDPKSATSPERTPIVRTPTPVLRS
                     QSMASTPNQNAQGRISKDSNNSVEKQGKEDMEKREASVKEKAQELFRVDNKDSIMNMK
                     EALDISGSSEHRSSVDRTTNNDGEKVAAAQHRSSGDGSQANEDNSSNTGKLNLAMLTQ
                     MQMQKLLGMGNENGTH"
     gene            <557115..>560099
                     /locus_tag="C5L36_0C02630"
                     /db_xref="GeneID:40384116"
     mRNA            <557115..>560099
                     /locus_tag="C5L36_0C02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465938.1"
                     /db_xref="GeneID:40384116"
     CDS             557115..560099
                     /locus_tag="C5L36_0C02630"
                     /note="PKUD0C02630; Pfam Domains:
                     Glyco_hydro_3(1.8e-08)|Acetyltransf_1(3.5e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321798.1"
                     /db_xref="GeneID:40384116"
                     /translation="MLQNSREIGKLLFAGLREKYFTSECDAATLMRNHHVRCFILQIH
                     NFVSIEQFMRLINDLQGYAYKMQFDSPLIIAINEETYNFLTRVVQIKELTLFPTYMAL
                     TATRDINKIFDVGKAMGIELKSIGINMVFGPSLDICSKVVMDVIGTNSFGVNPDEVIR
                     FGGAFLYGLKEGGLITNVGHFPGIGKSYVHRIGEVPVLLDSLSALESFNCLPFKKIIE
                     HNLVDSVLVSTVLIPNAVSKDANACLNPKIVDGMLRNDMNFDKLVIAENIEVQDLYVK
                     YGIGQAASIAIAYAHCDMVMVVSNFEYQLEALEYLSKAFSDGNYQSTLINAIRRIDEF
                     LGKVSWSDDNIKVNSIILDEHRELAITAFKKSITLVKNLENLIPLKHYNNPSNNIFGS
                     SEVLTFTPNLNETYRKVVKLLKSGNDKHGISASNIVYTTKRFTSDIKRKIAGSWMVIL
                     FADDLCSNHYILDLIKEINDCLTSSQHLVVVSADSPYYFFNDESLVPTFICTYGDSYE
                     ALKLVPELIFGNYEACGVIPGEINKEKDFQGVLSELSNSEYTNGNDRSKFEILLNKPS
                     RKEIDIDESYKMTLQAGELNTSTKMKIKSWVVEEFDGTRDSSLFNMLKSSIVSNSNRL
                     IDLDMFTRTWEFTEYFSDFYKTFVVRNPTLNLVYGMVVVIVDDISKIGHICYMMVSKG
                     KRRQGVGEALHQHAIKYMTIDRNCTTILLGCTFPMFSIFPPNIIDEIFTVLEYLRTKN
                     QFNLDVDDVSMQLIGFFKSFGWSYTRQNKGLCQLSRKILMILNYKDWTFPMKDNSYEF
                     LQNVIDLSIRFDIEDDATSGFNVTLKKLRNGEFDDYEEMLFPQMYSATKLVIEHELKE
                     VAQGFKRNTFCIYARINGVICGGCIVYTSHSRLSLFYPFIEHVKGSTDEVIAGITGFF
                     INYKTENGNKTGRGNINDNELIKLGILSACIEILHSLGIDKCLLHNIHKDDNELYRDC
                     GFQTFLEYCACYGSKQAFEWIV"
     gene            <561052..>561483
                     /locus_tag="C5L36_0C02635"
                     /db_xref="GeneID:40384117"
     mRNA            <561052..>561483
                     /locus_tag="C5L36_0C02635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465939.1"
                     /db_xref="GeneID:40384117"
     CDS             561052..561483
                     /locus_tag="C5L36_0C02635"
                     /note="PKUD0C02635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321799.1"
                     /db_xref="GeneID:40384117"
                     /translation="MFLVLLFVMAVMVLAVVMLPTMSGLVTYTRTSKHREELSSSQSH
                     KQTDFYETPDVEEEEEEEKELNSGKTSGLKAKLRITEADLPVKLELVGEGELKRRVRS
                     THKGPTSGDPTVYDYDIDELIAEENAREEMEKRAVYGSADV"
     gene            complement(<561515..>562735)
                     /locus_tag="C5L36_0C02640"
                     /db_xref="GeneID:40384118"
     mRNA            complement(<561515..>562735)
                     /locus_tag="C5L36_0C02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465940.1"
                     /db_xref="GeneID:40384118"
     CDS             complement(561515..562735)
                     /locus_tag="C5L36_0C02640"
                     /inference="similar to AA sequence:RefSeq:NP_010161.1"
                     /note="PKUD0C02640; similar to Saccharomyces cerevisiae
                     YDL122W (UBP1); ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321800.1"
                     /db_xref="GeneID:40384118"
                     /translation="MWIPILVSLLILVVSSIYMLFNREEGEEKEIKPGPFIGGLANDG
                     NTCFINSIIQSLASSTAFTDFLNQHDKTFIKTLNKLLSELNVHREKSKLFSTKPLLKV
                     MNDSPSRHLFFGYNQEDAQEFYQNLMKQIESEVKEKDEKEEEDEKERKKTPLNLVTPV
                     DGIQTEEIKCTNCGESSGKRNTVVSGLSLSIPKGTRHTFDLNELLDEFVKPELIDGVE
                     CNRCTLTYVKDSLESNLQNIDNEKLSLKIRERIDEISKVLRETTIPDDVFQKFSTTNM
                     VKHVTKAKSTFISKPPPLLCIHINRSVYDPARGMVRKNSSKINFPIKLDLSEYMAPDS
                     NEDSSYTLKSVVSHWGTHNYGHYTCHRWHNDNWYAISDDEVSLCTEENVLKSDGTYML
                     FYELANKSILHPNL"
     gene            complement(<562970..>564172)
                     /locus_tag="C5L36_0C02650"
                     /db_xref="GeneID:40384119"
     mRNA            complement(<562970..>564172)
                     /locus_tag="C5L36_0C02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465941.1"
                     /db_xref="GeneID:40384119"
     CDS             complement(562970..564172)
                     /locus_tag="C5L36_0C02650"
                     /inference="similar to AA sequence:RefSeq:NP_014371.1"
                     /note="PKUD0C02650; similar to Saccharomyces cerevisiae
                     YNL027W (CRZ1); ancestral locus Anc_2.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321801.1"
                     /db_xref="GeneID:40384119"
                     /translation="MADQEDIAHLFPEIHIEDTDLGYIESLDSLDELANFNTLDTITG
                     LDPLDGFNFNAEYTSNTDTNFDTNTGIDTNFNTNTNTGTNTNTNININTNNIHQQLLL
                     HDDHDILRQLAQQDNLHTLGHSIPPPRLILETSPSHSPSLPPNSPALSDASSLNGIHS
                     LHSPRDSPSFPHSQPLSPSPPPSPYQGSSHSPSPYQSLSPSPSSLLPPDFHSMRRGRQ
                     LSHSSRSRSASTSSQRSLDSTHSDSSNYSNYSNYSNYSDVSPPIGPSGTYDCPHCPKS
                     FSRPYNLKSHLKSHTNDRPYECPHCHKRFARQHDRKRHIDLHSGLKKFQCWGEIPNST
                     LTWGCKKRFARTDALRRHFHTDNGKRCIKPLCDALDSKLDSVEELEHSIKLAMDSALA
                     IVRKNESS"
     gene            complement(<564680..>565441)
                     /locus_tag="C5L36_0C02660"
                     /db_xref="GeneID:40384120"
     mRNA            complement(<564680..>565441)
                     /locus_tag="C5L36_0C02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465942.1"
                     /db_xref="GeneID:40384120"
     CDS             complement(564680..565441)
                     /locus_tag="C5L36_0C02660"
                     /inference="similar to AA sequence:RefSeq:NP_012456.1"
                     /note="PKUD0C02660; similar to Saccharomyces cerevisiae
                     YJL079C (PRY1) and YKR013W (PRY2); ancestral locus
                     Anc_1.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321802.1"
                     /db_xref="GeneID:40384120"
                     /translation="MHTALALALLLSPLVQGAPLIETITEVAVTTEVVVQTHTLGVDS
                     ETSSSSLLLEETTTPETISSTPTPTTTDIPTSTTPITTNTPALATTTSSIPTSTSSST
                     STSSSSTSTSSTTPSSSNAETLLNAHNAKRALHGVPDLVWDDTLYAYAAQYAANYDCS
                     GTLTHSGGPYGENLALGYTLEGAIDAWYAEGDNYDYGSCSVLNHFTAVVWKSSTHVGC
                     ATKQCNNAWGEYLICSYSPAGNVVGECSENVLPLV"
     gene            <566589..>567986
                     /locus_tag="C5L36_0C02670"
                     /db_xref="GeneID:40384121"
     mRNA            <566589..>567986
                     /locus_tag="C5L36_0C02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465943.1"
                     /db_xref="GeneID:40384121"
     CDS             566589..567986
                     /locus_tag="C5L36_0C02670"
                     /note="PKUD0C02670; Pfam Domains: zf-C2H2(1.6e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321803.1"
                     /db_xref="GeneID:40384121"
                     /translation="MSLHTAESQVLEALTSLRSSSLTPHSQQNASQNQGVSFGLGQGN
                     TPSPASPNRNGNSTPHSPSHSNSPAHHSVSAPELRRASSDDQSPPSSAYWGTVLVKGE
                     QQLQQLQQQLQQQVQQQVQQQVHQQVQQKVHQHQHQHQHQHQHQQQQQQQQQSSNQTA
                     QPLSSVSISDLVEAANHVEQKVELDTETGVGIGIGIGVGGRNLNISAKKSRKRRDDRN
                     GSEKLEQGLEEEEAYEDEDEDDDDDDDDDDSGKQLQQRLPDVGTGGTAISSGDKLNNV
                     DTPIMEKNFKTTKVSKSSRVSKLAKAPKAVKATKIAKAPKAPKPPKAPKKEFHCPNCP
                     KTFTRKSNLDSHLITHSNERPHLCSHCGKAFARLSDRTRHETTTHAQVKTFQCRGKAL
                     EGDAEWGCGHFYSRADGLRKHFKSYAGKQCLAAFRGLPADSITANSRNSTEGNEELDA
                     FVEAAVRNVRAHCGW"
     gene            <568478..>569758
                     /locus_tag="C5L36_0C02680"
                     /db_xref="GeneID:40384122"
     mRNA            <568478..>569758
                     /locus_tag="C5L36_0C02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465944.1"
                     /db_xref="GeneID:40384122"
     CDS             568478..569758
                     /locus_tag="C5L36_0C02680"
                     /inference="similar to AA sequence:RefSeq:NP_013748.1"
                     /note="PKUD0C02680; similar to Saccharomyces cerevisiae
                     YMR034C; ancestral locus Anc_2.594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321804.1"
                     /db_xref="GeneID:40384122"
                     /translation="MPDWANVTVATPVEWAFRQVDSLFVKILPSKIHHQLKKIFDFLV
                     SKWFFIGLACFIALAHSYPSATNGVHIDYWAVALIFFISGLSIHRNELLLNFSNIHAH
                     ISVLVMSFLITSSIVYGICCGIKAAGNEKIANWMLVGLIVTHTCPTTVSSNVVMTRLA
                     DGNVALCLCEVIIGNMLGAFITPALSQMYLTGTWSFANPANGSSVQSVYRHVMKQIGL
                     SVFVPMFVGQVVRYFFEKQCDWCMKKFILNKVGTFCLLLIMWSSFCTAFYQNSFTSVS
                     HASIIMICFFNFGIYLFFTVVCFFYARPLFIKRLFPRDIDNDSSLAYKILYKLFRPFY
                     YSKRDTVTILLCGPAKTAALGVSLVTSQYGNNNPHLGQLLVPLVLYQAEQVFTAGMLT
                     SLMKRWVHYNEATDSEEESNDKFDQTSIQSFSSV"
     gene            complement(<569775..>570797)
                     /locus_tag="C5L36_0C02690"
                     /db_xref="GeneID:40384123"
     mRNA            complement(<569775..>570797)
                     /locus_tag="C5L36_0C02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465945.1"
                     /db_xref="GeneID:40384123"
     CDS             complement(569775..570797)
                     /locus_tag="C5L36_0C02690"
                     /note="PKUD0C02690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321805.1"
                     /db_xref="GeneID:40384123"
                     /translation="MNMFQYEQEECQEAGCGRECECGYEYECECGYGYVYGEDEIYSK
                     EGGFHGAELCARVVTTQLWKPIEEDGVSFLSERVMGVPELEEDVGDVADLECSEDGMD
                     SLFEVYDMPDECRFVDYVGVREFTFDGYEYLNTENIVGVHNEGTKTVDVEAREEDREE
                     EGEEEGEEEGEEEGEEGEEGEEEEEEEEEANGTEQEEGVNGYVLETGSAKSCYEDGSR
                     SRSCAKGRVSGKGEFRCCECGKVFPRKSNHDSHIRMHLKVKPHVCSFCGKGFVRRSDK
                     NRHERSLHLKTSYKCLGVHDGTRWGCGHVYSRKDGLRKHWKSPQGRWCLRSVVTDTQD
                     IEKLLA"
     gene            complement(<571227..>573675)
                     /locus_tag="C5L36_0C02700"
                     /db_xref="GeneID:40384124"
     mRNA            complement(join(<571227..572333,573311..573324,
                     573663..>573675))
                     /locus_tag="C5L36_0C02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465946.1"
                     /db_xref="GeneID:40384124"
     CDS             complement(join(571227..572333,573311..573324,
                     573663..573675))
                     /locus_tag="C5L36_0C02700"
                     /inference="similar to AA sequence:RefSeq:NP_116614.1"
                     /note="PKUD0C02700; similar to Saccharomyces cerevisiae
                     YFL039C (ACT1); ancestral locus Anc_8.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321806.1"
                     /db_xref="GeneID:40384124"
                     /translation="MDSYDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG
                     IMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
                     HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDG
                     VTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTTAEREIVRDIKEKL
                     CYVALDYDQELQTASQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSALGLEAAGI
                     DQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP
                     PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHHKCF"
     gene            complement(<574692..>575252)
                     /locus_tag="C5L36_0C02710"
                     /db_xref="GeneID:40384125"
     mRNA            complement(<574692..>575252)
                     /locus_tag="C5L36_0C02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465947.1"
                     /db_xref="GeneID:40384125"
     CDS             complement(574692..575252)
                     /locus_tag="C5L36_0C02710"
                     /inference="similar to AA sequence:RefSeq:NP_013166.1"
                     /note="PKUD0C02710; similar to Saccharomyces cerevisiae
                     YLR065C (ENV10); ancestral locus Anc_8.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321807.1"
                     /db_xref="GeneID:40384125"
                     /translation="MAGASEKKRAIRNIETLSSVHKLSLIVNAVCILCLFLLKRPSFG
                     KKWYFIYSVPAWGCQYVVERTGRPTYEIDGEGRRVLVRAGEDLQQPGLTEYMFDVIYL
                     TLGIDVLMCVFGSMKVYYLLLLIPGYAAWRLRGVASMVLGMVLPRRGATAGAMEGVHD
                     GGNDGKSKRQLKMEKRAAKGQQVRYR"
     gene            complement(<575683..>576297)
                     /locus_tag="C5L36_0C02720"
                     /db_xref="GeneID:40384126"
     mRNA            complement(<575683..>576297)
                     /locus_tag="C5L36_0C02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465948.1"
                     /db_xref="GeneID:40384126"
     CDS             complement(575683..576297)
                     /locus_tag="C5L36_0C02720"
                     /inference="similar to AA sequence:RefSeq:NP_116615.1"
                     /note="PKUD0C02720; similar to Saccharomyces cerevisiae
                     YFL038C (YPT1); ancestral locus Anc_8.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321808.1"
                     /db_xref="GeneID:40384126"
                     /translation="MNNDYDYLFKLLLIGDSGVGKSCLLLRFAENTYTQDYVSTIGVD
                     FKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVNQW
                     LQEIDRYATSSVQKLLVGNKSDLTDRKVVDYAVAKEFADARGIQLLETSAAESTNVEQ
                     AFILMSKQIKDQMTSDAQTTANSSSKPHVSLAGTAVNTNQGGCC"
     gene            <577101..>578912
                     /locus_tag="C5L36_0C02730"
                     /db_xref="GeneID:40384127"
     mRNA            <577101..>578912
                     /locus_tag="C5L36_0C02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465949.1"
                     /db_xref="GeneID:40384127"
     CDS             577101..578912
                     /locus_tag="C5L36_0C02730"
                     /inference="similar to AA sequence:RefSeq:NP_009716.1"
                     /note="PKUD0C02730; similar to Saccharomyces cerevisiae
                     YBR158W (AMN1); ancestral locus Anc_8.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321809.1"
                     /db_xref="GeneID:40384127"
                     /translation="MDQLNNPKLRKTASSLSILSKTRKISQELQRPLKRATSLSYRVF
                     TPTNMVIPTSLSSNSLSAHNHSINEPNTATLGNFSTRASKATRRFRSLRKLKIKHAVE
                     TPSTSPIGNFTSSAFEVNLISPPSSPRHLQDENDDEEESTNESETSVFSNDYNNYTEI
                     SCETSPITKRDLRFKPILGDLSNSLFPDELDHHLWVFQESASLRRQSKNCHRIFQIPE
                     ILELILRHVSHDYTSNIPVEPKLKRRPPLSYNHSLILYGEEDGEKIWKRTKSGEIIPT
                     KQRAAKNPNVHNCLLVNKLWNFTMLSILNENLYFENTEKFKVFASSLDVIKKQHSLQP
                     FSIVLHKIKTSQSSIEHFSSAIDPYRLSWLEMYICQSILPSMKLITSALEKLILPGCT
                     YLTDDYLSNIIFKTPNLKTLDIRACDQITDTSLYYISQHCPQLEVLNCGRHRRGELIT
                     DISIGQIARNCPLKTIGIAGCGISDWSIWEIALNCSATLERLSVNYCWKLTDSGICKV
                     LKTGMLDGLKVLEIRGLNIENVEELVYWERRSANKGNRKVLIEACERIDRMIYDFQKQ
                     LHLEINRNILSDLGSWLEQSDSDIDHSAFLRRFADDL"
     gene            complement(<579018..>580334)
                     /locus_tag="C5L36_0C02740"
                     /db_xref="GeneID:40384128"
     mRNA            complement(<579018..>580334)
                     /locus_tag="C5L36_0C02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465950.1"
                     /db_xref="GeneID:40384128"
     CDS             complement(579018..580334)
                     /locus_tag="C5L36_0C02740"
                     /inference="similar to AA sequence:RefSeq:NP_010918.1"
                     /note="PKUD0C02740; similar to Saccharomyces cerevisiae
                     YER003C (PMI40); ancestral locus Anc_7.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321810.1"
                     /db_xref="GeneID:40384128"
                     /translation="MDCLFSLFSFVYIQLSFCLKEKNMSVFRVVGGPQNYAWGKLGSS
                     SAVARYAAANDPEHVKIDENTPYAELWMGTHPKVPTIVYETGKPLSELIAQNPSKYLG
                     DKVIAKFGSSKELPFLYKVLSIKKVLSIQAHPDKKLAQQLHASDPEHYPDDNHKPEMA
                     VAITDFEAFCGFKPLAAIKHELETIPEFAELVGEKATKDFIANPSKENLKNVFHRVMS
                     SDETFIAEVATKLVKRSVEEPSLFGNELADLIQRLNEQFPKDVGLFCGCLMLNHCNLK
                     SGEAMFLQAREPHAYISGDIMECMAASDNVIRAGFTPKFKDVEVLVSSLTYSTNPVEE
                     QKQPPAPFPRGSGDAKFALYDPPIDEFSVLQIKFDNAGKAQMKGIDGPSIVIVTEGTG
                     KLNQNDENISLDAFEGGVYFIAPGAEVELVNESSKPFILYRAFCEA"
     gene            complement(<580648..>582324)
                     /locus_tag="C5L36_0C02750"
                     /db_xref="GeneID:40384129"
     mRNA            complement(<580648..>582324)
                     /locus_tag="C5L36_0C02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465951.1"
                     /db_xref="GeneID:40384129"
     CDS             complement(580648..582324)
                     /locus_tag="C5L36_0C02750"
                     /note="PKUD0C02750; Pfam Domains:
                     Arrestin_C(9.3e-16)|Arrestin_N(6.8e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321811.1"
                     /db_xref="GeneID:40384129"
                     /translation="MHSIRVETPIRNTLVISGSPQDSSSGSLLEGHVVFALSKPTLIS
                     CVKLTLLGTLNIDFVESYRTSTGQILSTCPYTSSTTVYSHFWTNLLTSPIGSDEDFDD
                     ATNNIHGQQRATTCPLPNFNNLQTYHYTNDIPLGVTPFSKDSTLTSLSSDSVFELPAG
                     NYSLPFKVTIPQGTPESLESLKPANIVYMLQSSIVPYNDIPLKTSKYLRIIRSLSTLE
                     LVRNEEFLAENSWPGKLQYKIRIPRKGVSLGSTLKVNILVIPITKGLKLGKISFQVVQ
                     YLKMKIDRDINEEKVVYHQSMPPIPQYQLSNDIWALEAKLPLPKSITKISPDFGCKTI
                     SIKHRLLLFINLVNPDGHVSQIKSKIPLSFHIDPDIPIFAKTPRIDNEGNVEFMKEKT
                     LLFADAGEAPLMDQEPELFICPIDDMNPESFLFNDDPYSLAHDQRKDVPPTYTDSLKD
                     MIFDPKSPTSSPHPSSTSLMELGLTEEAPQYGSVFDDDSSVGEPTPIYVPKDTSRSLP
                     ASRSSTPIQIAKSNSLLHLSRLSHGYGSFRSKLSMHQNRSDIDSQEMLDV"
     gene            <584188..>585129
                     /locus_tag="C5L36_0C02760"
                     /db_xref="GeneID:40384130"
     mRNA            <584188..>585129
                     /locus_tag="C5L36_0C02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465952.1"
                     /db_xref="GeneID:40384130"
     CDS             584188..585129
                     /locus_tag="C5L36_0C02760"
                     /inference="similar to AA sequence:RefSeq:NP_013597.1"
                     /note="PKUD0C02760; similar to Saccharomyces cerevisiae
                     YML110C (COQ5); ancestral locus Anc_8.833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321812.1"
                     /db_xref="GeneID:40384130"
                     /translation="MPTSTHWDVFYGGDIQTTPQMAFGITPRLTRATGLISSAARHLS
                     TSAVALQQDFTHFGYKTIPKDEKENLVKGVFSSVASNYDVMNDVMSMGIHRLWKKHLI
                     EKLDCGMRPNSNEPLDFLDVAGGTGDIAFGLLDHARLKYGDNKSTMTVADINPDMLRE
                     GEKRCLSTPYANSPRIQFLEQNGEKMDAIPDNSKDVYTIAFGIRNFTNIQAGLNTAYR
                     VLKPGGIFACLEFSQVNDPALDYLYQAYSFSLLPLMGQLIANDRDSYQYLVESIRKFP
                     NQETFANMIREAGFYVPGKGYENLTFGVAAIHIGVKL"
     gene            <585830..>586369
                     /locus_tag="C5L36_0C02770"
                     /db_xref="GeneID:40384131"
     mRNA            <585830..>586369
                     /locus_tag="C5L36_0C02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465953.1"
                     /db_xref="GeneID:40384131"
     CDS             585830..586369
                     /locus_tag="C5L36_0C02770"
                     /inference="similar to AA sequence:RefSeq:NP_010923.3"
                     /note="PKUD0C02770; similar to Saccharomyces cerevisiae
                     YER007C-A (TMA20); ancestral locus Anc_7.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321813.1"
                     /db_xref="GeneID:40384131"
                     /translation="MFKKFSKDDVHTRTNVKSSIAKNIRNKIVEQYPLLQDHIDDIMP
                     KKVSVSLYKCEGKIQLYVVNGEILFYQQFDDFIPELRLVHKYPEAFPRVQVDRGAIKF
                     VLGGSNIMCPGLTSKGAQLPDEDWPVNKIVVVYAEGKESAMAVGKLAMSINDIKTINK
                     DTGVELYEYLGDGMWNFRE"
     gene            complement(<586401..>588302)
                     /locus_tag="C5L36_0C02780"
                     /db_xref="GeneID:40384132"
     mRNA            complement(<586401..>588302)
                     /locus_tag="C5L36_0C02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465954.1"
                     /db_xref="GeneID:40384132"
     CDS             complement(586401..588302)
                     /locus_tag="C5L36_0C02780"
                     /inference="similar to AA sequence:RefSeq:NP_010920.3"
                     /note="PKUD0C02780; similar to Saccharomyces cerevisiae
                     YER005W (YND1); ancestral locus Anc_7.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321814.1"
                     /db_xref="GeneID:40384132"
                     /translation="MSHELQSKNRSVYNLRFFRIVFPLWKGTSATLPTTMKYALIIDA
                     GSSGSRALVYQYTNDSTTVLPQIQQISNTKTKPGLSTYGYLKKGSYDLWGDHFATLIE
                     TAKGIIPANLHSITPVFVQATAGMRLLPSKSRDRILKQVCDVISKESEFVVLPCEEHI
                     EVIDGDTEGLYGWLALNYLSGKLEDVNSIPYGFMDMGGASTQLAFVPSDKEQVNKHGD
                     DMYTVRLRQNDGSLHEWPVFVSSWLGFGANEARRRQLDALINALPPNINYDKNGDGKG
                     DLTDPCSPVGMQTDVEYNGKTYTVTGSGEYEGCLKTIYPLLLKHMPCAEEPCLFNGVH
                     GPAMDFSKEKFVGVSEYWYTAHDVFKLTDEYNYEMFEKATEEFCKTPWETIKAKFDNH
                     EYGEALTLELLQTSCFKASWIVNILHEGFDIPRLGVDESKSIEGKDEPIFKSVNNIQG
                     NELSWTLGKMVIYASSQTEGADEVGVFPGPTVAEKHEKEKTSQTIVEIDDNVNSPFVT
                     FGLFLMVTLVLYYGIIYKFGNLKNFFRKVQGYRKPQFLQEAYDLEEGRSLSHSQKSKE
                     LKSTLRTRSTMNLHELQSSNNGDEYNIQTNLPHSFTFTSFRDPNLHLPGNKKLFKNGN
                     TSTPSLKSM"
     gene            complement(<589325..>591415)
                     /locus_tag="C5L36_0C02790"
                     /db_xref="GeneID:40384133"
     mRNA            complement(<589325..>591415)
                     /locus_tag="C5L36_0C02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465955.1"
                     /db_xref="GeneID:40384133"
     CDS             complement(589325..591415)
                     /locus_tag="C5L36_0C02790"
                     /inference="similar to AA sequence:RefSeq:NP_015026.1"
                     /note="PKUD0C02790; similar to Saccharomyces cerevisiae
                     YOR381W (FRE3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321815.1"
                     /db_xref="GeneID:40384133"
                     /translation="MRSAIGALLVLALSTTTLADELYLKTTIGTDSGAAEFWTCYEGI
                     EDYVYDYTPLMLAEYSTYYDAMCGYPPAVATLLNCCFSLAEDKGDQFHDTVFKYAATS
                     CKRYSSYHYSWTYYKDQYENGTKYYVPLDNIKNISLPLYAPTNANITAIEPTYVGYKN
                     YYFNLDSGTWFSVGICGYFLLLIVISAIHNFSRKTAISKSINNSPFVKVLQKYIIFPT
                     VLPNGKFAQAYGWKYFSLLFPNRIQFVTDLFIFALQVAFYCVDYRQNQGYWFGPARTT
                     WQRFLGDRTGIMAFGKIPLLILFAGRNNFLLWITGWSAATFLHFHKVIASWMALDALI
                     HSCAYTAYSKGSYVSSLKQTYFACGVAATVLCGVILLQAFHPFRVWYYEYFLTFHVVL
                     AIAFLIMCWYHCNTLGWMEWLIAACCVWFFERLLRVIRMFGFGWKTATISVVDENLMK
                     IKVPKPSWWFHQPGTYSYVYFAGWIFWENHPFTTVIEGDNLCSYIRVKKGITFRVWNQ
                     LVANGGKMNWKVCLEGPYGGDCASKLKKYDEALLIAGGSGVPSILENAAQVSKGKFIW
                     IAQTLKSVQVYHNLLAQVHTEIEIYITREQGTDKITTLSELTNLEEPTTESSEKESDI
                     EKTTSSGGVNIFYGRPNMGELLDYNVRNASANNIAIISCGPPALTDEVRNIVSSNVTS
                     WDKSIDYFDELEVW"
     gene            <592826..>594409
                     /locus_tag="C5L36_0C02800"
                     /db_xref="GeneID:40384134"
     mRNA            <592826..>594409
                     /locus_tag="C5L36_0C02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465956.1"
                     /db_xref="GeneID:40384134"
     CDS             592826..594409
                     /locus_tag="C5L36_0C02800"
                     /inference="similar to AA sequence:RefSeq:NP_010921.1"
                     /note="PKUD0C02800; similar to Saccharomyces cerevisiae
                     YER006W (NUG1); ancestral locus Anc_7.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321816.1"
                     /db_xref="GeneID:40384134"
                     /translation="MRVKKPTSKRMTTRLREGIKKKASAQRRKDKKAAKKDVTWKSRH
                     PKDPGIPASFPYKEQIIAEIEMRKQEREEQKRLMREQRKAVQAGSLEDAQDAMEIEGE
                     LGDDMAALMESAQAAAREYEGEDEQDDDGDAMVEDDYEVIERDLPLDDEEVDDERANK
                     SEIEKSRKQFDKVFKNVVDDADVILYVLDARDPENTRSKKIEESILQSQGKRLILLLN
                     KVDLVPDEIVKKWLDFLGSSFPTIPIKGSSGSNNGKTFNKKLTQNATANQLLLALKAY
                     ASKSNLHRTITVGVIGYPNVGKSSIINALTNQHSGKGSNKSKQPCPVGNQAGVTRTLR
                     EIKIDNKLKIIDSPGIVFPENVKKSGSLTTRQKKEYEAKLAILSAIPEKQIEDPINAV
                     SYLLKRLSTDNSMAESFKEFYKLPALASIDLNDFTKKVLIHISRSQGRLGRGGVPNLH
                     AASLVVLKDWRDGKFQGWTLPKSSSAKSGDSTEVETKIPNGASGAKPPAKVEQTTIVK
                     EWAQEFDLDSLFADVFGKN"
     gene            complement(<594828..>595262)
                     /locus_tag="C5L36_0C02810"
                     /db_xref="GeneID:40384135"
     mRNA            complement(<594828..>595262)
                     /locus_tag="C5L36_0C02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465957.1"
                     /db_xref="GeneID:40384135"
     CDS             complement(594828..595262)
                     /locus_tag="C5L36_0C02810"
                     /inference="similar to AA sequence:RefSeq:NP_013144.1"
                     /note="PKUD0C02810; similar to Saccharomyces cerevisiae
                     YLR043C (TRX1) and YGR209C (TRX2); ancestral locus
                     Anc_5.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321817.1"
                     /db_xref="GeneID:40384135"
                     /translation="MLGFLLLVFAVVVVNKYFSYQNTQLNSQGSKTYSNLSPSPKMVQ
                     VIKSESEFSTAIKADKLVVVDFFAVWCGPCKMIAPMLEKFSQQYSNVAFYKVDVDELP
                     SVAQSQEVTSMPTLLFFKSGELVGKVIGANPAAIKQTIDKLA"
     gene            <596505..>597893
                     /locus_tag="C5L36_0C02820"
                     /db_xref="GeneID:40384136"
     mRNA            <596505..>597893
                     /locus_tag="C5L36_0C02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465958.1"
                     /db_xref="GeneID:40384136"
     CDS             596505..597893
                     /locus_tag="C5L36_0C02820"
                     /inference="similar to AA sequence:RefSeq:NP_013091.1"
                     /note="PKUD0C02820; similar to Saccharomyces cerevisiae
                     YLL010C (PSR1) and YLR019W (PSR2); ancestral locus
                     Anc_5.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321818.1"
                     /db_xref="GeneID:40384136"
                     /translation="MSFLSSFLCCFEPDSSSRHQNNHRREGQHIQYRTISNHSNQRLS
                     KTQSNLQRALTPSPTNKSHPPSGIPSSLKNSSLVDPYKNTKSSPYNMDSHQQKTMYSN
                     INPLSSGKTLAKNSTNNNNIGNAINNTKIVNGNAKMIDANNTAKMSTPPEYKELVEEI
                     ADSKESTESSKNDDDDIVRIHDNQTASTDEMEKPPYNSHNDSGNNTTNNNNNTNTNTN
                     TGNYTDHNPTSEMANNIHNPISTYDPNNPLNSQINNQSFYDDQFGLDLTEILPDQTVS
                     STGWLLGPQPEKLKGKKCLILDLDETLVHSSFKYVRQCDFVIPVDIENQIHNVYVIKR
                     PGVDKFLERVGQLFEVVVFTASVARYGDPLLDILDPHKTIHHRLFRDSCYNYQGNYIK
                     NLSQMGRPLEDLIIIDNSPASYVFHPHHAVPISSWFSDSHDCELTDLLPFLEDLASSN
                     VDDIRLVLDITL"
     gene            <598779..>600098
                     /locus_tag="C5L36_0C02830"
                     /db_xref="GeneID:40384137"
     mRNA            <598779..>600098
                     /locus_tag="C5L36_0C02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465959.1"
                     /db_xref="GeneID:40384137"
     CDS             598779..600098
                     /locus_tag="C5L36_0C02830"
                     /inference="similar to AA sequence:RefSeq:NP_012267.1"
                     /note="PKUD0C02830; similar to Saccharomyces cerevisiae
                     YIR002C (MPH1); ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321819.1"
                     /db_xref="GeneID:40384137"
                     /translation="MTTESWKNQLNIPTKDSRPQTDDVVGSKDATFESFNLKRELLMG
                     LFEAGFEKPSPIQEEAIPIALMGRDILARAKNGTGKTGAFVIPTLEKIKPKVDKIQAL
                     ILVPTRELALQTAHVVKTFSRHMGLQVMVTTGGTSLRDDIVRLHDPVHVLVGSPGRVL
                     DLAARGIAKLDSCNMFVMDEADKMLSPEFQNIVEQILLFLPYKNSPNGKIKDYQTLLF
                     SATFPRTVEAFMKKHLYKPYEINLMDELTLKGITQYYAFVDEKQKLHCLNTLFSKLQI
                     NQAIIFCNSANRVELLAKKITELDYSCYYSHSRMKQADRNKVFHEFRQGRVRNLVCTD
                     LLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHYGLAINLINWNDRFSLYQIE
                     QELGTEIKPIPANIDESLYVVQEPSTVPRPFKANVRHQQDQQEQPDQ"
     gene            601351..601423
                     /locus_tag="C5L36_0Ctrna7R"
                     /db_xref="GeneID:40385088"
     tRNA            601351..601423
                     /locus_tag="C5L36_0Ctrna7R"
                     /product="tRNA-Arg"
                     /note="PKUD0Ctrna7R; codon recognized: AGA"
                     /db_xref="GeneID:40385088"
     gene            complement(<601619..>601840)
                     /locus_tag="C5L36_0C02840"
                     /db_xref="GeneID:40384138"
     mRNA            complement(<601619..>601840)
                     /locus_tag="C5L36_0C02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465960.1"
                     /db_xref="GeneID:40384138"
     CDS             complement(601619..601840)
                     /locus_tag="C5L36_0C02840"
                     /inference="similar to AA sequence:RefSeq:NP_001032579.1"
                     /note="PKUD0C02840; similar to Saccharomyces cerevisiae
                     YIL102C-A; ancestral locus Anc_5.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321820.1"
                     /db_xref="GeneID:40384138"
                     /translation="MLLLATFIFAYYTIWTFITPFLAEDNILQNFFLPRYYAIALPVI
                     ALILGVTLVTTFIGMVIVKSAQKKKGKKN"
     gene            <602660..>604345
                     /locus_tag="C5L36_0C02850"
                     /db_xref="GeneID:40384139"
     mRNA            <602660..>604345
                     /locus_tag="C5L36_0C02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465961.1"
                     /db_xref="GeneID:40384139"
     CDS             602660..604345
                     /locus_tag="C5L36_0C02850"
                     /note="PKUD0C02850; Pfam Domains: MFS_1(1.5e-36)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321821.1"
                     /db_xref="GeneID:40384139"
                     /translation="MDTKMAENLEPLKTRATILEEVENDWVPGTVYLVDIQHNLSVQH
                     NGKSDIVLIPQPSDDPNDPLKWSKWKKEFQFFILFYWSFLTAVATNWNGPVWSIWVDI
                     FKTSYTTLNATSAMCWLGLGVGCLFLQPTAMSLGRRFVYLFATILQTVGNIIGGVSKN
                     IGELYGVNILTGFAGAPCDSLVQISTTDIFFQHERATRISLLTFALYSGSYLGPFVAG
                     YIVDNETLGWRWCYWFLVIFFGSLFGIQLFFMEDSTFVGQRKNYTQEGKEILTEVLSK
                     EENIIDDISNEKDNVILDIRETDKNSMLPQKRTYFEKLKPMETRYNDKRPWYKIFLRP
                     TCVLLLPAVTWGGFSYGVSVMWLSLIATTQSEFFSVEPYNMSPAAVGNTNLASLIGSF
                     LGMIWGGPLSDRFVAWKARRNNGILEPEFRLWFMVVPALVTAGGLLLYGIGMNNGINW
                     VGPAGFGMGFLGFGIGSSGAIILTYALDSYPQFQSESMVMMLFIRNMIGMGFTFAIQP
                     WLDTDGTVTTTWLMFMLSVIFNFSCLIFIKWGKKWRIMTKNYYLKCSDPDFFF"
     gene            <605196..>605864
                     /locus_tag="C5L36_0C02860"
                     /db_xref="GeneID:40384140"
     mRNA            <605196..>605864
                     /locus_tag="C5L36_0C02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465962.1"
                     /db_xref="GeneID:40384140"
     CDS             605196..605864
                     /locus_tag="C5L36_0C02860"
                     /inference="similar to AA sequence:RefSeq:NP_011872.1"
                     /note="PKUD0C02860; similar to Saccharomyces cerevisiae
                     YHR008C (SOD2); ancestral locus Anc_5.590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321822.1"
                     /db_xref="GeneID:40384140"
                     /translation="MFSALRTSAVRVNTSFIRNSIRTKVSLPELKYKFTELEPFISAD
                     LNTLHYTKHHQTYVNGINQALEQHAQAEAAGDLKKCVELQQNIKFHGGGYQNHCLYWE
                     SLAPQSNGGGKLPSEDSGLYKAVTTQYGSFENLIKKANAALAGVQGSGWVFIAKNTDN
                     GAIEIVQRYNHETCSGNLKPLLALDAWEHAYYLQYKNVKAEFFSAIWNVANWAEASRK
                     YDQA"
     gene            complement(<605974..>606954)
                     /locus_tag="C5L36_0C02870"
                     /db_xref="GeneID:40384141"
     mRNA            complement(<605974..>606954)
                     /locus_tag="C5L36_0C02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465963.1"
                     /db_xref="GeneID:40384141"
     CDS             complement(605974..606954)
                     /locus_tag="C5L36_0C02870"
                     /inference="similar to AA sequence:RefSeq:NP_010500.3"
                     /note="PKUD0C02870; similar to Saccharomyces cerevisiae
                     YDR214W (AHA1); ancestral locus Anc_8.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321823.1"
                     /db_xref="GeneID:40384141"
                     /translation="MVVQNPNNWHWVDKNCIDWARAYFDEKLKNVEAQDDSTTVKLTS
                     VKKVDGDCEVCQRKGKVISLFDMSIEINYESSTGHKGVISIPEVMYDTEPHEYQFNLD
                     ERVDEKTRVLIRSKLIPKIRTILEDFGPTLINVHGSDIQVDEDQVMSTFTKGNQNMSH
                     MKPVIKEKTTLNKGNSKSESKSTPLPEYAQKYNISKLNLSTEFNTTAEQLYITLLDPQ
                     RVAMWTRSPPGGIEPKVGAEFKLFGGGVEGKILRLVENKEIEMLWRISSWKQGHYVKV
                     TFTFDQGHGETIMNVSMNGVPVGEEELVEENFKDKYFKAIKLTFGFGAVL"
     gene            complement(<607198..>608703)
                     /locus_tag="C5L36_0C02880"
                     /db_xref="GeneID:40384142"
     mRNA            complement(<607198..>608703)
                     /locus_tag="C5L36_0C02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465964.1"
                     /db_xref="GeneID:40384142"
     CDS             complement(607198..608703)
                     /locus_tag="C5L36_0C02880"
                     /note="PKUD0C02880; Pfam Domains: Aldedh(2.2e-231)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321824.1"
                     /db_xref="GeneID:40384142"
                     /translation="MSALFRTIETPNGKTLEQPLGLFIDNEWVKTNRTFETINPSTGE
                     AICHVYRAGVQEVNDAVEAANRAFRNESWSGLTGSQRGDLLYRMYQVIKRDAESIASI
                     ESMDNGKPYAAECLDGDLGEAADVFKYYAGWADKITGELIGSSVLGKNKMCYVEPTPL
                     GAVGGIVPWNFPFTMMAWKIAPALATGCTVVMKSSEVTPLTALWYGKIALEVGLPKGV
                     LNILSGFGSDVGSAMASHPKLAKIAFTGSTATGKKIMEAAGGSNLKKVTLECGGKSPY
                     IVFDDADLELAVEWAYWGIWYNKGEVCTSTSRFLIQEDIYDKFVESFVELTKTRAITA
                     DPFDDRCTIGPLVSSSQYEKVKKYVEIGKNEGAKLLTGKFIDGPGYFCEPFIFSECTD
                     DMTIMKEEIFGPVVGITKFSTVKEAIERANATTYGLGAALFSSNITKAHSVAAKLEAG
                     MVWINSNGDSDIHIPFGGSKMSGIGRELGPYALDLFTEKKAVHVNLSLPVK"
     gene            <609131..>612988
                     /locus_tag="C5L36_0C02890"
                     /db_xref="GeneID:40384143"
     mRNA            <609131..>612988
                     /locus_tag="C5L36_0C02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465965.1"
                     /db_xref="GeneID:40384143"
     CDS             609131..612988
                     /locus_tag="C5L36_0C02890"
                     /inference="similar to AA sequence:RefSeq:NP_013848.1"
                     /note="PKUD0C02890; similar to Saccharomyces cerevisiae
                     YMR129W (POM152); ancestral locus Anc_2.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321825.1"
                     /db_xref="GeneID:40384143"
                     /translation="MQKEDLGYEKTVNTKKPPIKSTNGGRLLISENVLDAESQRYYVW
                     AMFILIQAWKGYELFLIHNNGILEKSANTLTENGWSLFSFLNPKLSFLFKYFFLDSLF
                     ILAIPFLNIPQLTFTPTFSLMVLFGINALTLLLTFSINFSITSLLYPIYRSIVPEKEL
                     AIMEKYMVTDEIINQSQHFKGKKTIRYAPDSSIKINPFNQQFCIRPIKNEKIKIPVKV
                     ESTYDLKYLQINYRDFNSIDTVLNYTQRELKSFVVSDYYNSPYVRYDPTVLADSNIQL
                     LEIPIDRAGYYSIKLATDKKEKQIRSYRSDTIIPVCPEASFVEKKPHSMDRCIGESLD
                     DLEISVLGVPPFTLYYEEEIDGKLSKLPPTTVFSSRKIDSPLNSKDFQSKQGHAKFAS
                     HYLQDISWAKSYNVVVPLGEKRLQKPGKYIYTINKIVDGFGNVVTYTPHPNDKSTFSS
                     FISHPQSVLKLVDPDPTTPILLNHNKYLNLLISNVDSESPFEVTFQYTPEEKDAVNML
                     GTFTKVFDAKGNKSILADKPGTYSTIKGNSKYCPCKIETPSLNVPLAKLPSMDVKLDP
                     IVDGCVGTTGFKFIFDFLGNAPFEIGYKISKLDPNDSRKVLRIEKVASIRSESSSLEH
                     IFKPSTEGSYSIEFMSLSDKYYKKHVVYMEGEHRYVTYFKQRPKAYFSKNKLVQRIKC
                     CHGGASDVVLNIEGKPPFNVTYEIMSPDQNIEFFTLNNIFEKKVKIHTPNFNKGGEHI
                     LSLRSVNDSSECDVEFRGQEIHIDVKRDVPELSFYKDGSFEIVKGKSFNVPLNYHSSG
                     LVDLVYSYSSFDNKENQLFTLNSFDPRRGLDFSKEGVYKLVRFKHDGCPGKITNDYEL
                     RIQYKSMPSLSIIEGQSLKQYSDNVFDKSKVCQNQNDNILFKANGEAPFIIVYDVLYP
                     NGNVQTEMEQINNDNFSLELAATESGIYKYTIKEIFDSIYTDNVVSYLKRSSGYNFKK
                     LEIRHEVAALPEARFLDNKAKIQTCVSNLDNLSQLDPIHIQVDGALPVSLKVDIYHEA
                     DGSLEVIDFENIQTNQVDLLSVYENLGLGTHVLTFNQVIDANGCVSDEGILQEQSLTI
                     QVNDIPKIRHLVEGSNQLVDLRFSEFSNYYCVGDQISYILNGIPPFSIDYEFNSVAQH
                     VTVQGNYFKRRAPGPGVLNIKSLSDSSARECRVDYAELKREDLKAYIYDLPSVEIVQG
                     DSVEEDIHEGEQVDITFLLTGTPPFKLTYIRRELDDTSKIVETEVVEDIMSNEYHIMA
                     NLEGTYEAIEIQDKFCIARNEKI"
     gene            complement(<613097..>615310)
                     /locus_tag="C5L36_0C02900"
                     /db_xref="GeneID:40384144"
     mRNA            complement(<613097..>615310)
                     /locus_tag="C5L36_0C02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465966.1"
                     /db_xref="GeneID:40384144"
     CDS             complement(613097..615310)
                     /locus_tag="C5L36_0C02900"
                     /inference="similar to AA sequence:RefSeq:NP_013135.1"
                     /note="PKUD0C02900; similar to Saccharomyces cerevisiae
                     YLR035C (MLH2); ancestral locus Anc_2.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321826.1"
                     /db_xref="GeneID:40384144"
                     /translation="MRIQRLSRNVSAAVLSTSSISTQVSVLKELLENAIDAVDNKTEL
                     DADAYAQIQIELDKDSAGLDYMLVRDSGVGVSKNDRNLMCLNCTTSKLHSVDDLSKGV
                     KTCGFRGEALNLIARISDTMVISTKTEEDTLVESWSVNKSGLPNTDAKMVPGANGTSV
                     KVTGLFHSTPVRYKYLKEQRKRLLKALDEVVLTFAVIYRKIRFQIIYVKFSPNGRITL
                     VENKTFSNKFNREHFFYDALDVRKKGWLENSDLVFEIHNMTQGSLAIFANVLLPTMTA
                     DFPIIKNSLKILAVNSRPLNLSLRVGKLILRMINEIYTRNGLLKPCVWYISLTFPTNS
                     VDFNIEPEKSDIIIVNEEKVLERLSEELNKTVRKQHKLENEDALCAPSKSHQALESQI
                     ANNNSIDHGITITQKTSENKPERPSTFEELAEHFVQSDDESLVRELESTIKSVQMQAI
                     DNGLSFDNRNELDILLPCSGKIGPNTKSDITENMCLDSTVQQKKEKHHGKTIINRDCN
                     QQENREDTIHSIDDGHFGNFDISEGDDAEWSHTIYNTTRLSSELDVPSISLNPNKELS
                     HQLTASVQNSSSLANFSYETHDSSKYDGSTLVEPSTLLAKPLRDAAFVKSPSPLSHAN
                     TGKTPKKQTSLTSFGTYILREPLKASTDSSVIRLPRITECSKHTKGSVVKVPFDLTLD
                     SKNRIIQLEDDENWTGREGIPSSTILEGASKLYESTSYNPSRVKLLREVGIYRYA"
     gene            <615556..>616980
                     /locus_tag="C5L36_0C02910"
                     /db_xref="GeneID:40384145"
     mRNA            <615556..>616980
                     /locus_tag="C5L36_0C02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465967.1"
                     /db_xref="GeneID:40384145"
     CDS             615556..616980
                     /locus_tag="C5L36_0C02910"
                     /inference="similar to AA sequence:RefSeq:NP_013134.1"
                     /note="PKUD0C02910; similar to Saccharomyces cerevisiae
                     YLR034C (SMF3); ancestral locus Anc_2.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321827.1"
                     /db_xref="GeneID:40384145"
                     /translation="MRLDLKKLIKFVGPGLLVSCAYIDPGNYSTSTAAGAQFHFSHLF
                     FILISNVFAVILQCLCIKLGTVTGLDLSENCRKHLPNWLNRLNYILAEIAVIFTDLAE
                     VVGTAIALNILFNIPLKIGVLLTILDVLVIIFAYNPDKSLKHIRKFEIFVSMLVILTF
                     VCFVALVAKVDIGSKRDVIKGFLPSKILFQNKNAIYLGLGIVGATVMPHSLYLGSNLV
                     KPRLKEFDINSGSCSFEEHENGEVYHKPSLNAIHYCLNYSYIELILSLCIIAVFINSS
                     ILVVSAASLFGKPGAEDADLISIYDMLCHYISKQAGLIFALAMFFSSIAAGIICTMSG
                     MVIAEGSIHWKLNPFIRRIITRSISIIPCLFMAIFSDRSGVAMILNLSQVVLSLILPF
                     VTAPLLYFTASSSIMSVKVINDEQSHPANETTALVSNNDQIKMKDFSNSLVMNILGIS
                     SWALIGFLNIYLIIQWIRGEDIHF"
     gene            complement(<617065..>621189)
                     /locus_tag="C5L36_0C02920"
                     /db_xref="GeneID:40384146"
     mRNA            complement(<617065..>621189)
                     /locus_tag="C5L36_0C02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465968.1"
                     /db_xref="GeneID:40384146"
     CDS             complement(617065..621189)
                     /locus_tag="C5L36_0C02920"
                     /inference="similar to AA sequence:RefSeq:NP_009637.1"
                     /note="PKUD0C02920; similar to Saccharomyces cerevisiae
                     YBR081C (SPT7); ancestral locus Anc_3.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321828.1"
                     /db_xref="GeneID:40384146"
                     /translation="MEVRSKRVLKRRRTLEVFEKGDEKNLWCLTKDLLDSGFFNCYLT
                     PQQYNLLFEIVHFNENSQGDNIIWKSFLNGSLMLKFKEDGDDLSNSIENMYLKPGYPS
                     MRHLNATVRYILYEKAVDYFYSGNNSDSFEFQLLTERNLTDTTQKKMPSPKIKPMIST
                     SKDSDEDDNYDDEDDEEEEKGEERKEEEERCDSDGGTRYEGVDAIHKQAIIDAESDNK
                     ESSVIIDDSTKDYVFLVSKEDMLKKPIYPEIFDMTQEEEVIGQLHPILGTSSAIESSI
                     EKQNELRLIKSFNKIYHGFENDLPNIFKKQKLERSDKELEISEEEEKKGNMDNSNSKE
                     VDKLISLGGAANLSLKNLLKRIDDNRDKLGVTDIELKNLIMDVRKNRSKWANYNKIGQ
                     EELYEACEKVVLELRGYTEHSTPFLNRVSKREAPNYYQIIKNPMDLNTVLKKLKTLQY
                     QSKKEFVDDLMLIWSNCLLYNSDPKHYIRVDALAMRKKTLALIPLIPDITIRDRAEVE
                     REAAEQAAKEKEEEEDEKEETGRRSTRNMGQNISRKGRKVVQSSEPTHNGTLGSYKTE
                     YVDTEIPAATPTPMDSGTGSHPSETSSSNNGPKEENDQHFRDSAEDEKLDEIRGIQLS
                     VEDKNEDNDDLEISTWKSLTSSVRYRLCNERSKLFNGNQIQPNTEAVIRTQTQMYNFT
                     KYLEDESKVVLHRNRKYFDENDDPYLIEYDVCGGIPSINQSSFDFDKIEEQLLENMIE
                     EGKTLKDLPESRFKVKLQGSTNLIIENISLMQDIRKICFKINLIRTMQTSQFVHKSQF
                     VAPDFPKIRFEDIDPMSKLKTRDMMSEAMASQALKKSVSALLMLSGFEKTNPLCAAIL
                     TEITETYMGNLAKSFKLHLESNSINKMPVQRKRPMTCKEVLQVVLQYNGIEKPDAIYS
                     YYKEHLTKQHKKLNDLKSGLEGFLCDLLRPSMQELSESQFNDDSEQFLNGEFSDEIGD
                     DFFGFKELGLDKEFGLLTSSVPLHLLQSKLSHQFSQLSKNMTRRQYDHFKNLKFPKLT
                     KKDIPKQIGILRPFYEDLYLKSKMLYDKQLKKYQVQLQNGEKVEEPMQEIANDDELIL
                     IEDDDLPLKQRNNRPKIPPNGKITQVKKKFIPTAFFLEKQDELKNRLEAIVQKSGELT
                     SASEEFHETSDKTKEKDAPLDKTLDQLDTIEQGKELNLKSARSDIPLKEIKVVEEKET
                     KVDKQIAPDLKAVEGDVIYENKKSGNGVEKEKDVGKADEKECNTDFIVETKGDLKTKA
                     NKDHKGGIEEDAQKNDDDDENGDESGDESGDENGDENGDENGDDENDAEIEEKNEDEE
                     DEEEQEEQDGGDDEEEEEQEEQEEKDGGDDDDDDDDDDDDDDDDDDDDDNSSLF"
     gene            <621426..>622682
                     /locus_tag="C5L36_0C02930"
                     /db_xref="GeneID:40384147"
     mRNA            <621426..>622682
                     /locus_tag="C5L36_0C02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465969.1"
                     /db_xref="GeneID:40384147"
     CDS             621426..622682
                     /locus_tag="C5L36_0C02930"
                     /inference="similar to AA sequence:RefSeq:NP_011881.1"
                     /note="PKUD0C02930; similar to Saccharomyces cerevisiae
                     YHR017W (YSC83); ancestral locus Anc_1.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321829.1"
                     /db_xref="GeneID:40384147"
                     /translation="MPDFVDKVFEYTSKILGGTNAVLQNVYSTTADTLQSSIDSTKVV
                     GETVLNGTKGVYSKAQEIIPQGFEVVTNATGLSKVSQTPAPTGVTDRLVGFLTKNVFT
                     IGLGIAFPAAGFAAYNVYRTLVPYQRYAKRLQNRYRYEVVLVVGSMNSTFVSKLVNDL
                     NNRGYVVFVTVSDEQELRLVEEYNDQDIKPLVIDYTNDSSVRNSLLKLGQFLDMKISS
                     IFEESYYNFKGVLVIPDYSKLPKLKSLEELSSREFSRVTENFFLKFNTLLYNGLLTFI
                     RESNSRRDTVESYNGQKVEGGYSKLLFVNFLVVPSNDNRRLVHTLALEMNRLLYNKLY
                     QDHSVSIKESFLRLVKKPSNISQIDMTMLDIYLHKNSNSTLVSDSVFHNVLSRVGKKL
                     SPKQIHHKIFDLLNHDVLMKNYKIEN"
     gene            complement(<622837..>624906)
                     /locus_tag="C5L36_0C02940"
                     /db_xref="GeneID:40384148"
     mRNA            complement(<622837..>624906)
                     /locus_tag="C5L36_0C02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465970.1"
                     /db_xref="GeneID:40384148"
     CDS             complement(622837..624906)
                     /locus_tag="C5L36_0C02940"
                     /inference="similar to AA sequence:RefSeq:NP_116685.1"
                     /note="PKUD0C02940; similar to Saccharomyces cerevisiae
                     YFR029W (PTR3); ancestral locus Anc_1.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321830.1"
                     /db_xref="GeneID:40384148"
                     /translation="MVTAQDIAHHLQLLTSIPVDVDISTSEQIIKYGPANDAVILSCG
                     CIVSAKLAHKLESSPKNTPKCPICYSSNITVLAKCSKLRDLNTYLVKLTDELSNENSI
                     SSLQDHQKDTSYIPHKPTKNIDLANTDSTDMRSMFSNINIDSSSCVLPLEKQPASLIT
                     HEARSDSANLTFLTAFHEALIEADSSSVDSTVTAKPSPLNAKDSFNVHDFNHSPKNSP
                     SHSPKSLSLISCAGSPHKQRPRHSFSQNTSNLTRMLTTNSQATTKQQYTSKPSINKEF
                     IYSKNFPFFRRVHTFNIHNSNFFLKNKLYVQTHLSADLTKLVLLSEKKWEVYSIDTEK
                     PEVPPKLLCCGKSDASYGSDFDHLKKMNKEQILSNSNISNNKKNALELLDNWEHLNCQ
                     ITKNLLIISGTRGFLRVIDINHKGKCIFTYQCNFPIRCLDISPNEDLIALGITGKDKY
                     TQVEQAVIILLKLVPKTSKTPLQICTYPFSLPHRDPIGKLKFSSDSIMLAVSTVLESR
                     FLIINLTHPSRPTLVMKSQRRLDTSLDSEGITDMAFFPDNRLMTICSLSHNSEPIIID
                     TNIASISGPDGIAKPKLLMKIDEVGSTIHKCCVSPRGDSVAYINRSGNVYIMTAPRMD
                     DNDNRRVVSVFEVSNATRVKEAASLKFDPDGYKLYTLDRKGVLTIADFTAGTVEDHTV
                     TRSKIVS"
     gene            <625065..>626849
                     /locus_tag="C5L36_0C02950"
                     /db_xref="GeneID:40384149"
     mRNA            <625065..>626849
                     /locus_tag="C5L36_0C02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465971.1"
                     /db_xref="GeneID:40384149"
     CDS             625065..626849
                     /locus_tag="C5L36_0C02950"
                     /inference="similar to AA sequence:RefSeq:NP_010901.1"
                     /note="PKUD0C02950; similar to Saccharomyces cerevisiae
                     YEL015W (EDC3); ancestral locus Anc_1.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321831.1"
                     /db_xref="GeneID:40384149"
                     /translation="MYLLGTLLQQDIILSLYYINQTTMSQFYGYTVDITLKDKDETIR
                     GIIEKIGDKEITLRNPVNVKKDGSYAKVDSSQLNISSSTIADLDVIELAKNDNKYIKK
                     QMKLLKNKDQSQSRSQSNSEPLQQSESSQSKEKEKRGKSNKKKNTNNRLTSTSTSTSF
                     GDSDSCLSPKNDLDVRYVDVYNEKPSQKKKKSDLMDEFDFAANLQKFDKKSVFEDISN
                     NDHIDESNRLVSINRNDNKKEKYGIDEMVLKKNKHDGWDNNDNFDYSNVINGSNKAKK
                     NTSSDTSQGNDSNISLQSRAVSTASYERKPSLTPSFAQFFSSIYDESPVPTCSTLQIS
                     DVFTLCKTKFELTDQILNENAGNNLSDLVVNKIIGGFRIALKNHNEAPLVLLLVGNNK
                     AGSVALTTARHLFNKGMKTMVYLLYNTKISQDELFDEVDDELKRYSKIGGKMTNSIEQ
                     LEQYLNNPDGSPLEFIIDGLQGFDTDINDYGEQESAEANKLIHWCNSSKVPVLSLDIP
                     SGLNPSSGTNDSDESLVVNSRFVASIGLPLSSNLNMYKFGYCEKGRVTHYLVDAGIPR
                     RVYTMKGGLRKFDRRWFAESGSVELKVV"
     gene            <627108..>628925
                     /locus_tag="C5L36_0C02960"
                     /db_xref="GeneID:40384150"
     mRNA            <627108..>628925
                     /locus_tag="C5L36_0C02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465972.1"
                     /db_xref="GeneID:40384150"
     CDS             627108..628925
                     /locus_tag="C5L36_0C02960"
                     /note="PKUD0C02960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321832.1"
                     /db_xref="GeneID:40384150"
                     /translation="MKDQTSNNVTEATNLLTKMLKGGKVTYSIEQLLELKDTAIPKDN
                     LDLPERSFYRFDASVMKKMNNYYNNLNNPTPNKKERSGGRRGQHNLHHHNRILSNEKH
                     SRHYQKTSDENNEEEEEPQPEWMEETDFKVDHDFKLYMKSGTHTADDFEREKQMYLSK
                     NKSNDTNDAIISSNNGTDTKSIDDGKKFSQQFNPELESELRKQLEEPEILGPTEEEYF
                     ENLKKKESKLEEEEAKGEIEKLSGLKPKIGFGDHQFSLEMETRKQVDHDFMNTMLMRN
                     TKLNDAIPKSPVGSITSESSVASNGATSSFSLPPSLKRTGSQILPDELKPASSPLLNG
                     DNFTNQGKVQRASSPMVSNNQPTQIDAHMEHMRLQKIQVLQMQRMQQIHQMQRMQQNS
                     TQGTNLPGTKMPINTPPGFISAPPGLNNPAGVMFSPTGLTNPVTGFQGSQGATNVQLP
                     PGLNHPQVSPNVTQFPLGPTAHRVNPIGVTASNLANTTPQGASPMLPPGLGSVSNVQQ
                     PHIIQGQFLHSSNTINSGPSSHIPPPNMLPSPFREKFHQLQQALMHFQQNGHPPPPQL
                     LHEMAQFHQILERTFGGNRTVPDPGVSSTNNGPVLNQNV"
     gene            <629102..>629680
                     /locus_tag="C5L36_0C02970"
                     /db_xref="GeneID:40384151"
     mRNA            <629102..>629680
                     /locus_tag="C5L36_0C02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465973.1"
                     /db_xref="GeneID:40384151"
     CDS             629102..629680
                     /locus_tag="C5L36_0C02970"
                     /inference="similar to AA sequence:RefSeq:NP_012523.2"
                     /note="PKUD0C02970; similar to Saccharomyces cerevisiae
                     YJL011C (RPC17); ancestral locus Anc_5.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321833.1"
                     /db_xref="GeneID:40384151"
                     /translation="MKIIQQRDKLLSNFEVYQHICDVQRENQWGFTIPPPEKKRKHKF
                     NPQLLDLEIITRDLGQYLTKIGQGNDVETNSFVQLMLYLNALELEIIEKLMIVNSLPR
                     SLVTLYAIIEECEERFTTEVCEEILQNIERLFPSGVVAEDEEMQDAQEDQIHENPEEE
                     EDEDAFVDDMQLEHESYAKKVQEEKDIDEVDS"
     gene            complement(<629771..>631924)
                     /locus_tag="C5L36_0C02980"
                     /db_xref="GeneID:40384152"
     mRNA            complement(<629771..>631924)
                     /locus_tag="C5L36_0C02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465974.1"
                     /db_xref="GeneID:40384152"
     CDS             complement(629771..631924)
                     /locus_tag="C5L36_0C02980"
                     /inference="similar to AA sequence:RefSeq:NP_012787.1"
                     /note="PKUD0C02980; similar to Saccharomyces cerevisiae
                     YKL135C (APL2); ancestral locus Anc_2.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321834.1"
                     /db_xref="GeneID:40384152"
                     /translation="MSKRIETKIRKFFNIPRKGENYEFRSGLVSQYADERKDTIQRVI
                     AAMTVGKDVSALFPDVLKNIATHDIKQKKLVYLYLMNYAKTHPELVILATNTFMRDAE
                     DPNPLIRALAIRTMGCIRVDKMVDYITIPLKKTLRDDNPYVRKTAVICVAKLYELNPQ
                     VCQQQGFLDILLELVDDPNQMVVANAVATLIEISNSTKKKFFEIDTAILTKLLNTLND
                     CSEWGRISILSALLEYNAESVAEVHQIIEKISPQLQHENAAVVLSSIKILIKQLDKLT
                     NSEVKNVLNRLSSPLCSILTSAPEIQYVALKNIRILLEKYPFILDKELRAFFIKYNDP
                     LYLKLEKIEILVRIANESNCMLLLAELREYAMEVDSALVNRAINGIGQIAIKIEKCSK
                     KAVEVLYELFLDRHEYVVEEIVIVIQNILRRYSKEYVSSVITMIADSKLEFLNRSEAL
                     SSYMWVLGEYPKEIPHLEAKLDMIVEGFEDFDPIVQSAALASLVKISLIKPTANTPHL
                     LQTILTKATKELENAEVRDKAYLYWRLLSTDDKKLQEEIILNKLPRLESTIETFPPGL
                     LEELLDNLGKLSSVFYKPASTFVTLNSNNKFITSSDLQNMKFEELQQIAKNEIVNKAV
                     RADNLLDFDDDQEIADKGSQNDQDRSDGTVLDELNDLFSGLGTSSTSATNGNNQDLFG
                     ILGSTTGTKSEESSATSSGIVNKNATKNNDILDLF"
     gene            <632145..>633374
                     /locus_tag="C5L36_0C02990"
                     /db_xref="GeneID:40384153"
     mRNA            <632145..>633374
                     /locus_tag="C5L36_0C02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465975.1"
                     /db_xref="GeneID:40384153"
     CDS             632145..633374
                     /locus_tag="C5L36_0C02990"
                     /inference="similar to AA sequence:RefSeq:NP_012790.1"
                     /note="PKUD0C02990; similar to Saccharomyces cerevisiae
                     YKL132C (RMA1) and YMR113W (FOL3); ancestral locus
                     Anc_2.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321835.1"
                     /db_xref="GeneID:40384153"
                     /translation="MPLDLQLHRVQKLLKLLKNPHYKPQFIHVAGTNGKGSVCSYISH
                     ILEEAGIANGRFNSPHLITARDSIQINNNPVSLPVYEKFRNLILETNDRYDVGCTEFE
                     LLTCTAFQIFAEFNIPIAIMEVGVGGRLDATNVIPADRTLVVGITKVALDHQNLLGNT
                     LAEIAFQKVGIFKEKVPAIIDGSNETTVIDIAKKEAANVLAPLVIATRKDCWIQPTLL
                     GDYQYDNLAVALKMIDQIKDQKITRESVKKGIEKTVWPGRLQEYNFPIQHLLHETSEP
                     TFPMLLDGAHNTQAAFELGKYLEYIRPENGFVFIIAVTKGKDLSTLFKHIITKNDDIV
                     FTQFHDDIEGMPWIESSPVEFLEKQINDQKIPHATVHTIPNIEDSLKEAFRISRQTAK
                     RVVVCGSLYLVADVLRI"
     gene            complement(<633486..>635183)
                     /locus_tag="C5L36_0C03000"
                     /db_xref="GeneID:40384154"
     mRNA            complement(<633486..>635183)
                     /locus_tag="C5L36_0C03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465976.1"
                     /db_xref="GeneID:40384154"
     CDS             complement(633486..635183)
                     /locus_tag="C5L36_0C03000"
                     /inference="similar to AA sequence:RefSeq:NP_012783.1"
                     /note="PKUD0C03000; similar to Saccharomyces cerevisiae
                     YKL139W (CTK1); ancestral locus Anc_2.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321836.1"
                     /db_xref="GeneID:40384154"
                     /translation="MVCQREKELPPLPPQARKNVEIPVLPSVTNDIKSTTPTQNIPSL
                     NRHKTVDVLDTPKEGNSSLSKQSIGAQKKFVPQLSIRRSGPTLTLNLSHSSNSEVSGN
                     NDIVSRPFDASLTSPHVYSASSADEAFLFSQEDNELTPSEKSKYMSLSMNSNNETSDN
                     MPSHKKKIVINQNPPSNMLSVRSMNKEKPELSLSSKSLHRRNIKKLTLDPIDTSNLQD
                     SKLDTPLFSSTSSLGKMEIKDPDRRIDADELIQNIKNLELGLEYQMPIRAEELVSLKR
                     LGSGQSGTVSKVLHLPTQKTMARKTVHLEAKEVIQSQIMRELRIMHECDSPFIIEFYG
                     TFMHEGNVVICMEYADCGSLEHVFKITGPFPEFMLKHVAYCVLSGLIYLYDNHRIIHR
                     DVKPSNVLLTSKGKIKLCDFGVSRELINSMADTFVGTSTYMSPERIQGGVYSVKGDVW
                     SLGIMLYELASGKLAFTNSESGQTSILELLQRIVNEQPPSLSVKDGFSREVSDFVSLC
                     LKKEKQRSSPWELMSHPFLADFLEEDGVRVNSKYRGDIRKWAKNVRRVQKGKPVKTG"
     gene            <635569..>636666
                     /locus_tag="C5L36_0C03010"
                     /db_xref="GeneID:40384155"
     mRNA            <635569..>636666
                     /locus_tag="C5L36_0C03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465977.1"
                     /db_xref="GeneID:40384155"
     CDS             635569..636666
                     /locus_tag="C5L36_0C03010"
                     /inference="similar to AA sequence:RefSeq:NP_015348.1"
                     /note="PKUD0C03010; similar to Saccharomyces cerevisiae
                     YPR023C (EAF3); ancestral locus Anc_8.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321837.1"
                     /db_xref="GeneID:40384155"
                     /translation="MEYFDEKKKSLISVAPDKRFPKELLSEVCYMVHYNGWNSKWDEW
                     VLVERILEYTNENLMLKESLVLELQEKEKAKQKKLEEEEHQKELKRLQMKVQKNGRNR
                     LKADNHDSMKIRLLVNGSKLNNVVNRHGGDSRIGKPQKDKQKLIRNCNSRIKGEYSEN
                     GSHSFENGLLETLQNKRKKLNESLHYESKTGFTHHEMKVLVPDDLKRILVDDWEQITK
                     NSKLVALDGENNVARTLDDFSKYIKSTFNDEEKELNVLLEITESLRNYFEQCVGVFLL
                     YRYERHQYNKILEDEERVKNLDAIYSPIFLLRLLSIFPSILMMNGVDAATIKISKAYL
                     DIILNWLDLHKTKYLKIEYENQSPYLSLIHS"
     gene            complement(<636856..>638355)
                     /locus_tag="C5L36_0C03020"
                     /db_xref="GeneID:40384156"
     mRNA            complement(<636856..>638355)
                     /locus_tag="C5L36_0C03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465978.1"
                     /db_xref="GeneID:40384156"
     CDS             complement(636856..638355)
                     /locus_tag="C5L36_0C03020"
                     /inference="similar to AA sequence:RefSeq:NP_011050.3"
                     /note="PKUD0C03020; similar to Saccharomyces cerevisiae
                     YER124C (DSE1); ancestral locus Anc_8.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321838.1"
                     /db_xref="GeneID:40384156"
                     /translation="MCALNLKSSYWKVDHTDNGNYIHSIPTNTSMSMDGNTIAVSSNY
                     ITEGLKVYELSGNSLIHLASITLPDIHTLKFLRPIKNAPKEFKYLLSGHSNGIVHLSA
                     IPLVENTVFENAEIIKRFNHKKHLDQSFQFGRTNPILNNGKVSTTISTIELTNSAWTS
                     APLNSMVTAYDYNLFYWDTARSRAPLSIVHKNGLSNVSINKCVDSLSAVVGSFGLSLF
                     DFRADDRSGFSDIYVSKSSMQKSDGVLDGFTNAIWCDSNPNYIATNHELDNTVYIWDI
                     RKHQPVSKLTGFTDSIVKMSWKKEDHLWTADKDGCITKWDIGRVDDIADTKLTMRSNH
                     QLKGFWNSEVNDKDIGMTKIKAGISAKISESKIISMEFPSTHPGSILCLDGTHLSFHD
                     NAKPFKPRNVPELYSCAQFVTPPLPCKPELNHRISSYASKSSIGTFAHTVSGDSFNIF
                     DRYSYSNQSAGIPITPNSQVSFPRNSCESFAIAQKDRIEINGTNGRNNR"
     gene            <639889..>642207
                     /locus_tag="C5L36_0C03030"
                     /db_xref="GeneID:40384157"
     mRNA            <639889..>642207
                     /locus_tag="C5L36_0C03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465979.1"
                     /db_xref="GeneID:40384157"
     CDS             639889..642207
                     /locus_tag="C5L36_0C03030"
                     /inference="similar to AA sequence:RefSeq:NP_011051.3"
                     /note="PKUD0C03030; similar to Saccharomyces cerevisiae
                     YER125W (RSP5); ancestral locus Anc_8.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321839.1"
                     /db_xref="GeneID:40384157"
                     /translation="MSSSNRSKITVKVISAEGLYKREIFKSPDPFAVLTVDGSQTQTT
                     ETSKRTSSPHWNQSFEFNVTENSILIVQVFDQRKFKKKDQGFLGVINIRIGDYINLSD
                     PSSEQTIAEELKKSNSNLPVSGKITISLSHKNRSRDSRDPTNFANRNNVNNSSTRHSH
                     TNSASSTPHVQSPTQGGSSQFPGVAAGHASSPATSTSRQFSSFEDQLGRLPPGWERRT
                     DNFGRTYYVDHNTRTTTWKRPTLDTNDLNSTSRPSILNSAAGSSHPPSHANIGNDQQL
                     TEQEASALEATGQTIPGLGELPPGWEQRFTPEGRPYYVDHNTRTTTWVDPRRQQFVKS
                     FGANSGYNAQRLSAMGPLPSGWEMRLANTSRVYFVDHNTKTTTWDDPRLPSSLDQNVP
                     QYKRDFRRKLVYFRSQPALRILPGQCHIKIRRERLLEDSFREVMRQTPEDLKKRLMIK
                     FEGEEGLDYGGVSREFFQQLSHEVFNPAYGLFKYASSDNYTLQINPNSNINPEHLNYF
                     KFVGRVVGLAVFHRRFLDAFFVGAMYKMMLRKKIVLQDLESVDSEMYKSLCWMLENDI
                     TDILYETFSVEEDRFGETVTIDLKPNGREVEVTNENKNEFVELKTEWIISKPVENQFR
                     SFMEGFNELIPQELVQVFDERELELLIGGLAEIDVEDWKKHTDYRGYQESDEVIQWFW
                     KAVTEWESEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEIDQLPKSHTC
                     FNRVDLPPYKDYESLKKKLTIAVENTVGFGQE"
     gene            complement(642473..642545)
                     /locus_tag="C5L36_0Ctrna8R"
                     /db_xref="GeneID:40385094"
     tRNA            complement(642473..642545)
                     /locus_tag="C5L36_0Ctrna8R"
                     /product="tRNA-Arg"
                     /note="PKUD0Ctrna8R; codon recognized: AGA"
                     /db_xref="GeneID:40385094"
     gene            <646095..>648287
                     /locus_tag="C5L36_0C03040"
                     /db_xref="GeneID:40384158"
     mRNA            <646095..>648287
                     /locus_tag="C5L36_0C03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465980.1"
                     /db_xref="GeneID:40384158"
     CDS             646095..648287
                     /locus_tag="C5L36_0C03040"
                     /inference="similar to AA sequence:RefSeq:NP_015161.1"
                     /note="PKUD0C03040; similar to Saccharomyces cerevisiae
                     YPL164C (MLH3); ancestral locus Anc_8.688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321840.1"
                     /db_xref="GeneID:40384158"
                     /translation="MSRIQKLCSGICTTLQSQVKLNSLSDVVRELVQNGVDADSSSIS
                     IKVYVNYFENSIELSYSDDGIGMDPETLEVFGKRNYTSKLTTELNSENLDLSVLSDVH
                     TFGFRGEAMNSLRKLCDTVIVISRTVGYNNAFKAIFKSDEMIGDVVRHPFVFPRGTSI
                     KVLGLFDSVVIRKKLLLEQLKDSWITDTFEIRKEVFNSMIDKPRIKINIERVEFKNGK
                     WTSKKVLTSGLPRYTECVPFQLQMKLLNLTFGGSISENYEICKVEYQGYKLKIGIGTT
                     VSQSKKFQFAYINGRPLVNQEFFKFVNILFQKGYEKWGTTVKYDANKPSSMYGRPYSV
                     NPIFVAYFNLPFEVDDLIQDPKKYCYNTKHLPILQRMLSKSVDIYFEIFCNHKIRENG
                     EYHSEYIPVKKQKIQHHYISDMKADIRKLNLKDSEAERRLSNEDIHTMGKNVVFESGE
                     IQEGLTSRSMSPKTRGTMLAIDETKPAEACECENTRNIEINSQVPYSQKDLKNTSKFF
                     SRQDNLMITRESIKQFKIVGQVESKFILVKFRNMLIGMDQHASDERINLEKTYQSLIQ
                     KSIDQVYHQVNEVRRVSFHPSDLELIKRYEDTLKFWGIMFDPEFTKITHLPELVYRKV
                     SKLDFRLLEKGIIEFVYNLHNSEKREMKLSEKHQNDDRFWWVTYITHMPALYRETIKS
                     YSCRQSIMFGEQLTRKEMELIITRLEACYQPFECAHGRPSLYPICTLL"
     gene            <648790..>650856
                     /locus_tag="C5L36_0C03050"
                     /db_xref="GeneID:40384159"
     mRNA            <648790..>650856
                     /locus_tag="C5L36_0C03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465981.1"
                     /db_xref="GeneID:40384159"
     CDS             648790..650856
                     /locus_tag="C5L36_0C03050"
                     /inference="similar to AA sequence:RefSeq:NP_116670.1"
                     /note="PKUD0C03050; similar to Saccharomyces cerevisiae
                     YFR015C (GSY1) and YLR258W (GSY2); ancestral locus
                     Anc_1.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321841.1"
                     /db_xref="GeneID:40384159"
                     /translation="MTRDIKNHYLFEVATEVANRVGGIYSVLKSKAPVTVAEYKDRYM
                     LIGPLSYKSASVEVEELPVTNKALKNTLDSMESRGIRYLYGRWLIEGAPRVILFDIGS
                     AAHHLNEWKTDLWNIAAIPTPESDIETNDAVLLGYLTAWFIGEFSVQQTEKAIILHAH
                     EWLAGVALTLCRQRKIDCSTIFTTHATLLGRYLCAGSVDFYNNLDKFDVDHEAGKRGI
                     YHRYCIERSAAHAADVFTTVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAVHEFQNL
                     HAEKKEKINEFIRGHFYGQLDFNLDNTLYFFIAGRYEYRNKGCDFFIEALARLNHKLK
                     AVNSNMTIVAFIIMPGKTNSYTVETLKGQAVIRQLENTVKDIQDAMSKRLLNWCQDPH
                     HFNDSSKTELPELDDILKSSDRVLLKRRMIAMKRDTLPAIVTHNMVDDANDPILNQIR
                     SCQLFNRKEDRVKMIFHPEFLNSSNPILPIDYDEFVRGCHLGVFPSYYEPWGYTPAEC
                     TVMGIPSITTNLSGFGCYMEDLIENSQDYGIYIVDRRMKSVDESINQLTDQMFEFTLK
                     TRRQRINQRNRVERLSDLLDWKRMGLEYVKARMLSLRRAYPESYNQNINPFDSDEKVK
                     LTRPLSVPGSPRDNKYGAMTPGDLGTLQENNDTDYFTWSLKDEEEDVTLRGASVAPSD
                     HEESDH"
     gene            <651184..>652281
                     /locus_tag="C5L36_0C03060"
                     /db_xref="GeneID:40384160"
     mRNA            <651184..>652281
                     /locus_tag="C5L36_0C03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465982.1"
                     /db_xref="GeneID:40384160"
     CDS             651184..652281
                     /locus_tag="C5L36_0C03060"
                     /note="PKUD0C03060; Pfam Domains: DAO(6.5e-30)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321842.1"
                     /db_xref="GeneID:40384160"
                     /translation="MSNFVIVGAGVIGLTNAYEILKENPKNKVTVVAMHFPTDFEFKS
                     VYTSPIAGANWESFASINDTFVQEIDAIGYDRFYELIRTRPEAGVTARKNVVLITRER
                     FQGEGSVKRLPWFAHGSFGEKCGFRELDKEEYDLSKFEYGYEFDGMVIRTSYYMTFLI
                     NECWRLSGESEGPRARFALKRGTVKRLSEAFELHASCKRADYVINCTGLLARQLEDVS
                     VAEREKMYPVRGVVYVARNTTGLDKVTIVEVDTPDEALYLMPRREGELIIGGCFQVGN
                     ESRDVEAGLRERILGRCREYLPDYLWDGLEIVREQVGFRPFRKGGYRIEREGRIIHCY
                     GMGGAGFQSSYGCAQHVKRLIADADKKSSKL"
     gene            complement(<652359..>652598)
                     /locus_tag="C5L36_0C03070"
                     /db_xref="GeneID:40384161"
     mRNA            complement(<652359..>652598)
                     /locus_tag="C5L36_0C03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465983.1"
                     /db_xref="GeneID:40384161"
     CDS             complement(652359..652598)
                     /locus_tag="C5L36_0C03070"
                     /inference="similar to AA sequence:RefSeq:NP_009948.1"
                     /note="PKUD0C03070; similar to Saccharomyces cerevisiae
                     YCR020C-A (MAK31); ancestral locus Anc_1.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321843.1"
                     /db_xref="GeneID:40384161"
                     /translation="MAQRKDALQLIAREYVFDIKDGRSVCGILVAIDDQSNLLVSNAR
                     EIYNTHNRELGLVSIRKNTIDKISVSKHDYADLFG"
     gene            <653070..>653489
                     /locus_tag="C5L36_0C03075"
                     /db_xref="GeneID:40384162"
     mRNA            <653070..>653489
                     /locus_tag="C5L36_0C03075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465984.1"
                     /db_xref="GeneID:40384162"
     CDS             653070..653489
                     /locus_tag="C5L36_0C03075"
                     /note="PKUD0C03075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321844.1"
                     /db_xref="GeneID:40384162"
                     /translation="MPKIDHASIKRISADQGLESITLRSDLAARYTFLNETLLEGIGA
                     VEVDSKFKSSVDLHDVVTEQDGMPIVDEHAYLEKWEARLQEEVALLEKQQATATGASA
                     VVAGVIDSQQDMDPQLVLIQRLDGPFTNEDEVDAVVQ"
     gene            <653819..>654624
                     /locus_tag="C5L36_0C03080"
                     /db_xref="GeneID:40384163"
     mRNA            join(<653819..653823,653940..>654624)
                     /locus_tag="C5L36_0C03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465985.1"
                     /db_xref="GeneID:40384163"
     CDS             join(653819..653823,653940..654624)
                     /locus_tag="C5L36_0C03080"
                     /inference="similar to AA sequence:RefSeq:NP_010904.2"
                     /note="PKUD0C03080; similar to Saccharomyces cerevisiae
                     YEL012W (UBC8); ancestral locus Anc_1.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321845.1"
                     /db_xref="GeneID:40384163"
                     /translation="MSSSLENSTRRRIEMDVMKLLMSDFRAALVNDNLRELHVCLEGP
                     QNTLYEGGLWKVHVELPEQYPYKSPSIGFDTKIYHPNIDEHSGSVCLDVINQTWSPMF
                     TITHIFETFLPQLLDYPNASDPLNGDASALYLNNRDKYEEKVKTYVAKYANPRDVSRA
                     FNLEHGLPDEDRFDNKFNANDVNGQVDSRTTSRRTDMDDNDDNDDDDEDVEDLSSLDE
                     DSADSDLDMDL"
     gene            <655029..>657629
                     /locus_tag="C5L36_0C03090"
                     /db_xref="GeneID:40384164"
     mRNA            <655029..>657629
                     /locus_tag="C5L36_0C03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465986.1"
                     /db_xref="GeneID:40384164"
     CDS             655029..657629
                     /locus_tag="C5L36_0C03090"
                     /inference="similar to AA sequence:RefSeq:NP_012110.1"
                     /note="PKUD0C03090; similar to Saccharomyces cerevisiae
                     YIL156W (UBP7) and YKR098C (UBP11); ancestral locus
                     Anc_5.712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321846.1"
                     /db_xref="GeneID:40384164"
                     /translation="MDNNHMLKVQRRISLQTKARDELQELPESVIKSIAQHQNALFNN
                     KLSMLEKAYSLEREDAKFKKIMNDWVYIASNYCFLLVENHLDGCDELAVELFTAFHII
                     LTNALLPNRNNLLLSDVERQYIEIFRVKHNTLMQSRRSRYYSIIIKYLNRLKKIDEMN
                     INASQKRRSLDPKAFQSIQLRSPSELYPQTGMGKLRLSGSSLEEATSSDSSDNDSVLE
                     MMHSLKTIDIETFLQVDPRNLTIINIQVRKLNSQKRNIITIDPSLVSDSASIDHLIIP
                     YLKQNEVIVLFSKSPNISGLETEMFNQLSKRGFDDIYWLQGGFNTFKLHCISPQTFSP
                     STRSLLTPKIPLLNSDSYEHFNTTPSSRSPQVIPQPIPPPIPISQPLIKQTDVSINGI
                     INGYSNNSQSNLNNLNNGSHNQHSIVSTSTTTYNEPSKLSYKPIVRLRNLGSTCYINS
                     LIQCLFSLEKFRGFFLNDAKLKDYLTNLNGSKAWLTSSIHELFNDFYKYSPHNTQPPV
                     IDMTRFLSIVAKKNPEFNIPHEQQDSSQFLYYIVDQLHKELKFSSSRALELHLVEINN
                     RLSEKYTKYQYKLLEDEGYSYIKDLFNIREGVKMKCNRCGYTSVKYDTSIMLHLSINK
                     RSTSLNEIMSFNFQPEEMSERLGNAWSCDGCKESEKRFNELQDKVDTYYDIINATTKL
                     EPGINEQHHKKKKKFFRPFGITSSKGPKHSDSEVISRQESVDPEMEKFINSFTDAEKS
                     EYDKLLDITTRERVAYRTVEIIDLPNILVICLSLFHPNKQDTKVNMKSLKFPEKLTME
                     YESCCRVYKLNSWVDHWGGSLDSGHYTATVDLLSTQWLVCDDDKIQPAYSKMGGVDDS
                     NVYLLFYEAL"
     gene            <657911..>658972
                     /locus_tag="C5L36_0C03100"
                     /db_xref="GeneID:40384165"
     mRNA            <657911..>658972
                     /locus_tag="C5L36_0C03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465987.1"
                     /db_xref="GeneID:40384165"
     CDS             657911..658972
                     /locus_tag="C5L36_0C03100"
                     /inference="similar to AA sequence:RefSeq:NP_011936.1"
                     /note="PKUD0C03100; similar to Saccharomyces cerevisiae
                     YHR069C (RRP4); ancestral locus Anc_5.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321847.1"
                     /db_xref="GeneID:40384165"
                     /translation="MSVISITLAKPRDRHENEHEEDSMMQDDELDDILETKKRQVLGL
                     ENNTIVTPGELITEDATWMRGHGTYYLDEHTYTSTAGVVSKVNKLLSVIPFNGRYRPE
                     TGDHVVGRIIGISNKRWKVELGAEHAGVLLLGAVNLPGGVLRRKSDSDELQMRSILKE
                     GDLLNCEVQSTFSDGSASLHTRSLKYGKLRNGVFVKVSSSLIVRTKNHMHDLPGGVSV
                     ILGVNGYCWIFKTKINANAGEVNKSIGKAESELTAANKGYSIGMGSVSITRLEEESSW
                     EIYSDKNDDISSNLKETISRYRCCLVALGFCNIAIDVKRLVKAYEISLGYGDVNSLIS
                     GDVKRSIGEDLINAEKMRG"
     gene            complement(<659081..>660328)
                     /locus_tag="C5L36_0C03110"
                     /db_xref="GeneID:40384166"
     mRNA            complement(<659081..>660328)
                     /locus_tag="C5L36_0C03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465988.1"
                     /db_xref="GeneID:40384166"
     CDS             complement(659081..660328)
                     /locus_tag="C5L36_0C03110"
                     /inference="similar to AA sequence:RefSeq:NP_013252.1"
                     /note="PKUD0C03110; similar to Saccharomyces cerevisiae
                     YLR151C (PCD1); ancestral locus Anc_8.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321848.1"
                     /db_xref="GeneID:40384166"
                     /translation="MSYLSSACATPSSYSSCAISSRARVLLYAPQALSKLQQVKIMSP
                     NREIPLDKEQLQHLVDSWETRPTRSLPTLHKQSLPPPPLPNSNYHTRITRHAMESRYL
                     INLVNFKPQFFKAQSNVSVWHKVPVKRRSAVMVLLFLGKEGELRVILTKRSRKLKNFS
                     GHISLPGGKADHGLESEFQCARREMEEEIGISRHNSLLRNKYGFVLDELKTLPSYLAR
                     TFLAVTPCIGFINWNENTQHHERILRDLVLNPGESASIFSVPLRDFLQPPSEIFHPKE
                     CLKQSHIKTKWGGLPWNLRSFVFPQLNHNEVPWLEDVEDLSSESEDETHEDQEFDVRT
                     RNCWGLTANILHDVAEIIYNGKKSVIGEEDLIWSLLNHGQLQSSGRTEFELRLSNNTK
                     GCLFSEVLPDDEIKRLKVLYKNP"
     gene            complement(<660592..>666261)
                     /locus_tag="C5L36_0C03120"
                     /db_xref="GeneID:40384167"
     mRNA            complement(<660592..>666261)
                     /locus_tag="C5L36_0C03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465989.1"
                     /db_xref="GeneID:40384167"
     CDS             complement(660592..666261)
                     /locus_tag="C5L36_0C03120"
                     /note="PKUD0C03120; Pfam Domains:
                     PP2C(1.5e-44)|Guanylate_cyc(1.7e-25)|RA(1.9e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321849.1"
                     /db_xref="GeneID:40384167"
                     /translation="MPGNPRVDKPRFNSKYIEEDKNLYINSSRHEDDNEQRQRHYSQS
                     SASSTSPNTTRNSSHGMNLSSIEGKLGLKSLSGHNASHNHENFRSSDNGVEKEDRSSI
                     GSFSMGASKSFSGFLSSKHNSIPSQSSSSSKKSGKRNIFNRLLTTRKGSETSPHGEYT
                     GRHFSTSSKKSTSSNSPGLSPTMPLHQHKNSDASHYSHFPPLDQPNTSYIRGRLPSEQ
                     NIPHVQPLSKYRSSFSAVPTLHHDAHPSRKSQMIDTNLDQDIMSTPMNSTNSLAQSYG
                     ISLIDEDSSNDMNSISNSAVGMSRVASTNSTIANNNHEDLKSFWKPPDSWKVTSDTHE
                     QSDEHVSSIGAKNRNGNESDTSSDISLNSLASPDTTVIESDSNKFKAPKDKLLTTSSS
                     SPNLNNAIKNANKKIIKGSSRSSVRIFKGDKSSLIPCTTETTCENIMNALRRKRFLKQ
                     DDDHMLVLKCGGLTRILSYDERPLRIQRKMLFLYGYTERDNLDYIERTDLSFLFKFVV
                     EEKGIEVISEEKRRLINPHNVNLDNWNLQDIPNFLFAEPIVTLEVSQNPSLLFARDFM
                     HDSKNMTSLSFTRSGSPVFPPAIVDIPRLLNLNLEVNYIRMVPDDIAKLSTLISLNLA
                     CNRLTTLPDSFGDLKHLQFLNLGSNRLKKIPEPIYKLENLKQLDLSYNSIAEFSDQIA
                     KLSDLEGLVVAGNRFTGDLPEFFDQFKNLLKIDIRFNKFSSIDSLKRSPKLEVIRATG
                     NNISVFRSRARNLFEVELNINPLTYVYFEIDMENLKIVDFSKGKLTSCTFTQKLVAVE
                     KLNLDSNHLSILPDHLDKMKNLHTLSISRNNLTNLPDSLCMLKRLQNLDLHLNNIGKI
                     NPNIWNLGSLEVINLASNLLKSFPEPPESFINNFNNQKVLRMLKSKKHVQNQKQIDGE
                     IDDHAIEESGSSAVSGEEEEEEEAHNTVAKLPNVRPTSPNNRRLSGSVSFPVLDKEHS
                     LASSLKKLCLVDNKFSDTIFPTISVFQNLRCLNLSYNEIYEIPAGFICKLKQLKKLFL
                     SGNYLSSLPVEDLDELENIETLHLNGNRFGTLPAELSKLCKLKELDVGSNQLKYNIGN
                     IPYDWNWCYNKNLRYLNFSGNKRLEIKAQQNIDEETGETLDSFLSLKDLMTLGLIDVT
                     ITTDAVPDQSVDTRIRSTVSQLGKFGYGISDSLGGSDTLTTRDAVIEKFRGNPDEFLI
                     TIYDGKNSLQRGGDKISKIIQETFEIHLAEELESLGKNVIPGIDSPKNVEDCLRNAFI
                     RMNTEMCISINKDELSTFSSAAVHRTKTMDKLTYDEDGLSGCSATIIYIKKDYVYVAN
                     VGDIMCILTRSDGEFSMITTKHEPYAPKEYDRIRDSGGYVTTDGLLDGVSDVSRAVGF
                     FKLIPHINAKPSISKFKLTQNEEMIAVCTSEVWKQVSFELAADIIRQEKSNPLGAAEK
                     LRDFAISYGSVNKKVTAAVLSLRQFTSKQKHYGGSKPVEDSTLRKLDDEIEPPTGYIA
                     MVFTDIKNSTLLWDSYPVAMRSAIKVHNAIMRRQLRIIGGYEVKTEGDAFIVSFPTPT
                     AALLWCFAVQTQLLTTSEWPAEILTSDQGFEIKDNEGNLIFRGLSVRMGIHWGRPVCE
                     MDVVTKRMDYFGPMVNRASRVSAVADGGKITMSNDYRHELEKVTKIHEMIKEGKVKDI
                     NGAYGYKSRGQDVENQMEQLDKIGIVIESLGARKLKGLETPENIWLVFPKPLSSRLKM
                     ITNKDGEINNKSNKLAVGGITVETAWILRKIALRLERVISFTVSNSLGQNIQFQHFSD
                     GIQEEAENTMEKKLANVESFMMLFLDHTITRIENCVTVLGTHMVLADSGINSNGISMI
                     DTIKSMATELKELKAQVHEYQTHKQTLQLPPSSTCPFTSDSSSPSSE"
     gene            <666573..>669488
                     /locus_tag="C5L36_0C03130"
                     /db_xref="GeneID:40384168"
     mRNA            <666573..>669488
                     /locus_tag="C5L36_0C03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465990.1"
                     /db_xref="GeneID:40384168"
     CDS             666573..669488
                     /locus_tag="C5L36_0C03130"
                     /note="PKUD0C03130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321850.1"
                     /db_xref="GeneID:40384168"
                     /translation="MIGDLFRKRDTSSLASAGPTQTGSSGMIGMPQIKAPSCYSQENE
                     NTAGIPGNPSTFNLNHPLSSIPLSHLSREHGNTLSSNYEMNNIHRVPLPEGDTLTDQT
                     NVNMPSLYGLSPDMKLPSPTFRLSDKLPCIRMVIVQDAGIRKKQPLFDSAVVFNKNFS
                     AMQQKLNKKIHHSINELSLFMFGSFGMPISENNISTKIHYLPSLPGMPSSILITRLFS
                     IDASFVLKPSQTCQDISDWHPTPLIRTNEMPQHENTSIRFSIGLVIPTSSSMESVRDE
                     VTENWLEFSKSFLDIQNLIVIKLKNLHFIQQRIKLKPIQQVQVSVNSSVSCMDNSKLD
                     KLNFQAYCLQSDPEVYQEFSSFIKSIVSLIEIPRLFIDIKHSNQSLIDWASTLSLWLE
                     LKDGRSHCYDNVDMIHTSMQETFTGSTPLNATNSIKFLAFLLSILLPLRNKLFSSPHK
                     EATLYSTMRIVIGTANPVVSQKLILILAGLLGYEEYSGLYDESLDLKIDRKNRSRNGS
                     IAVDSRPDPIPIPSGKTSDDASTGTPVCSVQTRNNSLVVDSLNMSIENSVKYPNSPSV
                     STFSANVKPQRISVPSLTRTSSYASLQNLSSSYNNSVGSQSSWRAGFGSFMDRWKSSV
                     TPSPTTSQHSHASSMPSPNIVEYDEFPWSMNKKSTNLLSSSPAPSMMSEQTSFSKHTA
                     KYKLSNTLHTNTYKAKGEYSISRSTNNLLGAKLNSLSLLVSDQINQIMRDEFECYLDA
                     CNESVVDVSMKNKDTCITTNGTVIPLPMLTGYVPQFMPKFSMLACPNKYVQEQLFVPA
                     MKNDLRRDNISNTTIFSVNLGMRRVNVLEMKAKEKFSRDESCKLYSTRSSSDSNCSTD
                     GDTLKSKPKSNLTKSFHTEYELNQSTLFAPNKMSNADNIDFKKYINSLEKTDALDKIL
                     DRISLTIENFFDDLSLASDNSEEDGDDENTQKSRENECCERIRDSIEEIMCLFPVET"
     gene            complement(<669612..>673031)
                     /locus_tag="C5L36_0C03140"
                     /db_xref="GeneID:40384169"
     mRNA            complement(<669612..>673031)
                     /locus_tag="C5L36_0C03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465991.1"
                     /db_xref="GeneID:40384169"
     CDS             complement(669612..673031)
                     /locus_tag="C5L36_0C03140"
                     /inference="similar to AA sequence:RefSeq:NP_013487.1"
                     /note="PKUD0C03140; similar to Saccharomyces cerevisiae
                     YLR383W (SMC6); ancestral locus Anc_4.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321851.1"
                     /db_xref="GeneID:40384169"
                     /translation="MKRSRSDDYLDDTSRHETDTNFAETDTEFTPNATPPSKKGRLGS
                     HPDESFNLAESGFERIKESQLNVEDAMTQVDDKWNKKRRKRTIEKMTQMPNTSVPDDE
                     SPSEAGVIERLELFNFMCHHAFSLNFGPQTNFIIGRNGSGKSAVLTGISVALGAKATD
                     TDRGNSLKCLIMHGKNTARAIVTIKNQGPEAYMPEEFGDKIIIERTLRADRPHSLAIK
                     NSRNKTISTTKKTVDKILEYFGITIANPMTILTQTEAKTFLAHSSDKDKFNSFMEGTR
                     LKESFGNIKHIERNANEIKFTLERNQAVYEELKDKFKKAKKVWSSFKDSEEFSRKRET
                     LFGKKIWVEYKKQEKASRQALRVKQNKEDEIADNLKKIDVEKSEIAQMESELQLLETG
                     EIEESRRKVEDLSLEKQSTQGIVTAHQSEVKKIHSQITHIKSQIDDDNRKILKLEKMI
                     AAERKRAEDSNDDNIDKLKRFKTEKEKRLGELSSQKFELSSSIDILRNDLKELDNRAK
                     QELGSLNGEIRNLENKVRSAKQQESSNRPENAFDSNMNRLMIDLRSQRFKNEIVGPLG
                     MHIEVKKDYAKWGHLLENIIQRQLTMFVASNHSDVAVLRNRFRFFNIQSEIAIRQREV
                     FDYSHTTPKSKYPSILDVLKIEDESIRCMLVDTMKLNATLLVPNRIEAQRELETDSQG
                     LISSIFCLVDNNVIRIYKRNNSLQTDPFNLSQRSPARLRIEGDSIAGILQRDLDEQLK
                     ARTEKEKELHLAKQSKSSEITAMQSKLNECRTQTAEINQAIKKVEAKLENLEVGTSKL
                     ESLEEEKDIMVSNVALSVQKLEPLQAQLNEAEKNVDIQIDLYKSISAEYKNAKSAYTE
                     KIKQQKSHSSLIGFKKQAIKHHISDNIRLSDDIKKLDEFLEYTKQELETLHEQASKFC
                     SFDEAQLDKRTTIESIDAEIKSITEYLAEIENRQGITKEQAELNLIKANSELKEIHKK
                     FEDTVILHNQLHKALEDRLNNLLQTTYLTFQEVESVFVQALKIRRFRGKIEFNIKKGT
                     LTLKVATKETGPLRPVESFSGGEKSYSQIAFLFAIWGPMHSRIRGLDEFDVFMDNVNR
                     RIALKLILNKVAENPKRQTIFITPLSVANIEGLDSSTVHIHEISPPDRANL"
     gene            <673362..>676130
                     /locus_tag="C5L36_0C03150"
                     /db_xref="GeneID:40384170"
     mRNA            <673362..>676130
                     /locus_tag="C5L36_0C03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465992.1"
                     /db_xref="GeneID:40384170"
     CDS             673362..676130
                     /locus_tag="C5L36_0C03150"
                     /inference="similar to AA sequence:RefSeq:NP_013486.3"
                     /note="PKUD0C03150; similar to Saccharomyces cerevisiae
                     YLR382C (NAM2); ancestral locus Anc_4.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321852.1"
                     /db_xref="GeneID:40384170"
                     /translation="MANSNLARRAKVVAQGLVDLASLDQKWLARWRARCNNKFINPRR
                     LINEDKKDLKKMYSLTMFPYPSGSLHMGHLRVYSISDTLARYYRMKGYDLIHPMGWDA
                     FGLPAENAAVERGVNPEVWTKSNIQKMKAQMELMLTDFDWSREVSTCDPEYYKHTQKI
                     FLEFLKHGLAYRKKAEINWDPIDKTVLANEQVDSEGRSWRSGAVVEKKLLEQWFLGIT
                     KYAGALNKDLELLEDWPSKVKAMQRNWIGESKGAEIKFQVCKDAKSHLEGHLPVDILD
                     IFTTRAETIFSVQYLALSFSHPITQFISKNDPKLREFIDRLNKDGEESEKSKEGYLLP
                     DVYATNPLDAGVKIPLFVAPYVIGTYGSGAVMGCPAHDVRDFEFWINNMGSSSAIIHS
                     VEPINESDYIEGEPFVSKEGKMNINSRFLEGMTTSDARIQVVKELKLIQMGYFKTNYR
                     IRDWLISRQRYWGAPIPVIHCDSCGIVPVPDEDLPVKLPHVDKLLGRGGSPLAQIEDF
                     VNCECPKCKKPAKRDTDTMDTFMDSSWYMFRFLDSKNESLPFDDKIASKYMPVDQYIG
                     GVEHAILHLLYSRFVSKFFNDIKWYENDAMRGEPFKQLITQGMVHGKTFINPKNGRFL
                     KPEEYELNENGDAIIKESGEIASVSYEKMSKSKYNGADPAECINRHGADATRAHILFQ
                     APINDILDWEEAKIIGIERWLKKVLKLSVDLADRSETGAMCAIDARVEPDTTSNIELH
                     NEVYDFERGIDSAFGKTPSLNTLIAYYMKYTNSLIDAMKKNDVTNDFLQYKFLNLLKF
                     MAPVTPATCEEAFELFNYRNTRGDSYPFLLEAEWPQVSPKIESHVNYNVMIDGKMRFV
                     HRAHENFSNASTDECISQLVTTSDGEKYLSNVEVKKVILKKDTIVIMTNQPKKQRKKK
                     GPQNTTEK"
     gene            <676377..>677279
                     /locus_tag="C5L36_0C03160"
                     /db_xref="GeneID:40384171"
     mRNA            <676377..>677279
                     /locus_tag="C5L36_0C03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465993.1"
                     /db_xref="GeneID:40384171"
     CDS             676377..677279
                     /locus_tag="C5L36_0C03160"
                     /note="PKUD0C03160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321853.1"
                     /db_xref="GeneID:40384171"
                     /translation="MVLERSLVKIHIFQQRLQFISSLLTSPKFYRALNNVFSDPSKLD
                     RTLGTLCYLALFVSAILKKYPKFRRKIQEVVVYLERLTAVFYNSTIQRFKLKHGLFEI
                     SENDLSPTLKDDEIPPKIANIAATLGDFSSYISDIRIFNRGFSIPGCIADMLEASSLL
                     KCGNVYDFISTWCISLYQPAETIAFLFDHNWLLRDRQGNNCLWWYAVSTRLWFVWVVA
                     ELGKVSLAILRKRGRHIPKSQFIEFIEHLATLPLCVHWSLEDGWLSPLSVGFFGTLAG
                     GLTTIDMWKDICRDLGKKDLRNQL"
     gene            complement(<677324..>679006)
                     /locus_tag="C5L36_0C03170"
                     /db_xref="GeneID:40384172"
     mRNA            complement(<677324..>679006)
                     /locus_tag="C5L36_0C03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465994.1"
                     /db_xref="GeneID:40384172"
     CDS             complement(677324..679006)
                     /locus_tag="C5L36_0C03170"
                     /note="PKUD0C03170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321854.1"
                     /db_xref="GeneID:40384172"
                     /translation="MLFTTRLGMRLKRLFCKLHINKRVKTVLVAFITCCIVIILCTVN
                     SYHNSMDGSSTLFDISSWFLNADSLKIDTVKFGDYATIFESLAKSKPQTRPLVQYKKE
                     NPKIQRFQDDNEKFTIEYLSSLLKVSEHAKSKLKESYHKYMGLLGKRKLPIYGSFHDG
                     EIKGKGIVMVGGGKFSWLALLNIHQLRKVGSNLPVEVYIPVKRDYDETFCSEILTDLN
                     ARCVLGYEDLPLSEVKSYFRHNRFQHKSMAILASKFEDILLLDADNVVTQAPDGLFNW
                     DTYKEFQLVLWPDCWVRTTNPFIYELFGIKLGEPPQNALYDLHQLPGAIPNPSTESGM
                     MLINKKTHANTMLLALYMNMYGLDYFYPLITQGGAGEGDKDTYITAAFALNQPVYQVQ
                     YGVNFVGSFDYDGAFTSGGLGQCNPMDKIERYIHDRHITTEKCPDYMFIHMNHPKYYP
                     DEIADNFITNKGRYFLEFENINLKDDYDFELQIWEILTQLLCDGRRPNDEQPHNPASN
                     PLDPKYLLSARGMRYIKSLKMDKICKSKILPRLQFLRGQFKVKEEKKNNKGQ"
     gene            complement(<679348..>680289)
                     /locus_tag="C5L36_0C03180"
                     /db_xref="GeneID:40384173"
     mRNA            complement(<679348..>680289)
                     /locus_tag="C5L36_0C03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465995.1"
                     /db_xref="GeneID:40384173"
     CDS             complement(679348..680289)
                     /locus_tag="C5L36_0C03180"
                     /inference="similar to AA sequence:RefSeq:NP_012873.1"
                     /note="PKUD0C03180; similar to Saccharomyces cerevisiae
                     YKL051W (SFK1); ancestral locus Anc_2.589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321855.1"
                     /db_xref="GeneID:40384173"
                     /translation="MKIGALNLPNVSPGKAWILPFLAVFFWYAMLISLMICWFVQGRP
                     ILDTDHTEMPHYIVYLSNIGATNLQPIFICGSLFMGIFFVWAVIEDYYLRTPERKYFP
                     PIFHWFLTAVHALAIALSIIASLCILMASCLKDNWQYSRPHSVFVVLFVIFVFSYLCA
                     HMLTYIIYYKHYGVKFYRNMIIIKVIWIAIAIVFVVTYGAFMGKGNSGGRHSIWWGYS
                     AIMEWVLVFWYGLMFPLLMADLNVKNYGNQAEYLMGQGNEAGSASGSGNDDYDMERIT
                     KQETWDNHNPFDNRYENEHTTGVQENLTQGYNNRQFL"
     gene            <680574..>681533
                     /locus_tag="C5L36_0C03190"
                     /db_xref="GeneID:40384174"
     mRNA            <680574..>681533
                     /locus_tag="C5L36_0C03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465996.1"
                     /db_xref="GeneID:40384174"
     CDS             680574..681533
                     /locus_tag="C5L36_0C03190"
                     /inference="similar to AA sequence:RefSeq:NP_012355.1"
                     /note="PKUD0C03190; similar to Saccharomyces cerevisiae
                     YJL180C (ATP12); ancestral locus Anc_1.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321856.1"
                     /db_xref="GeneID:40384174"
                     /translation="MLARSYKLLTVRSTYRAISRTFASHSGSGFTSYDTNKKTETNRL
                     EKSLSKFWEKVDVAPASGKPGYAVTLDKKSVKTPLGFELNVPENKKSLAYLLANEWRS
                     LPSLQVKPHLLPLTSITARCIDLHEAQKTEDEEIKAKVGDLSTIKTLLLRYLDTDTML
                     VFSPKEDCDGLLRDEQEKCYRPIIADMEQFFAKFSEDGKPLKFTFLDCEKSGFASNFQ
                     TEETKKAVNKYLNSLSTWDLVCLENATLVSKSFLAGVAILRNADYNDKFIIDIEELSR
                     LVNLETVIQTSIWGEVEDTHDVNRVDIKRNLSCASIVAFSSKD"
     gene            complement(<681596..>683824)
                     /locus_tag="C5L36_0C03200"
                     /db_xref="GeneID:40384175"
     mRNA            complement(<681596..>683824)
                     /locus_tag="C5L36_0C03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465997.1"
                     /db_xref="GeneID:40384175"
     CDS             complement(681596..683824)
                     /locus_tag="C5L36_0C03200"
                     /note="PKUD0C03200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321857.1"
                     /db_xref="GeneID:40384175"
                     /translation="MHTTLFPIQEAANSECSLAPTSTVSIANPLVAAYAVSESQYRDE
                     LQILSSIVRSFDPVYDNYYDDSLDDVTNEMVAVRKQRNNQFLHIVTSLREKHIELSRI
                     FSYTMEELLVGFAKWALDINTFYESYLEYYKLDLNQCKSEIKIRRRPLVRIKHLLNFT
                     TSLKLLVAQSTPQHYTPELISDLEIITYKLSKTLQESNNLDANEREKCELHVNIIHAK
                     DIVQLKPICVDVSSSIFSGAAIIADVHYVNNLEQTSLSFMNMEVYIASEKFCMVERDT
                     LGKSLLFAPLRRNEFTLIDKDKLLFHHTIHSDIQLCFSIRGDPSLADILIDYFPSKTD
                     SYQYSTPSFGLGFQDAEIKTPQSQSPAHSRTSSVESTEPLELNTSNIPLYKLKFASSS
                     TAIATSLHPVQYIQDRPQMDRETELSKSFLTSIANDEDSDDEDNDAESIISDTTEPVL
                     EMPVTKKIDFSKYKPSAVTKEQKIKKKNIFSSFSSLFKKQKQEPNLSKTAHPQIVRKS
                     SIPDFLSNPQTRELPNANVGVWNSMSWTKPEDVRIRLHEQDESHYLEVKMRSPLLLQL
                     NEFTKCAVHAIDIHLTSKDHDGWKHTILIRPSNRRDLDLLSKVISHPEIGIVESFSVE
                     SELSKITRISNTESDKTGNSDITQNETKEMSWTGVGNLNQIRNGKLIDLNRCVMTITN
                     RSGEIDLDFTGFEFGAIDLKTQAAKFNKLSELEISVDDYIVTFDDLKDLQQFNECVFV
                     LG"
     gene            complement(<684157..>686109)
                     /locus_tag="C5L36_0C03210"
                     /db_xref="GeneID:40384176"
     mRNA            complement(<684157..>686109)
                     /locus_tag="C5L36_0C03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465998.1"
                     /db_xref="GeneID:40384176"
     CDS             complement(684157..686109)
                     /locus_tag="C5L36_0C03210"
                     /inference="similar to AA sequence:RefSeq:NP_013612.1"
                     /note="PKUD0C03210; similar to Saccharomyces cerevisiae
                     YML097C (VPS9); ancestral locus Anc_8.876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321858.1"
                     /db_xref="GeneID:40384176"
                     /translation="MSFNNTFNKSGFTLPSFTNVQPTVGISEVKTSGGLENEDPNKNS
                     DNKSNRNYAETVMETLLEDLKSDGNGTQNAGTPASCSQENGWQDKIEQASNSDNLNLL
                     TPGTNNVETNKSERPNFEDELYEDVKSSHDIEGRETLQLGNEVDDTRISKSKQSSNKD
                     SLADTEKVGLASKEIKRGDTGQSESNEEMEMEKGYEKLSSLPLEEESDDCISIDEKAE
                     VPVEEEPVPQEDSMQNPQDNIPESVEDARIADEITNELEIRRTSRKNSIKDIPNPPSN
                     LRKQQAFDFQTFLVQFKSAKCQPVHKYLKSFLSQFNQRTWSIEEQVKLVHEFEEFLYE
                     KLRECMEIENSKEGIEKLVMTRVYNSVFSPVMPYLKLTETNKHDRVMDRKFLLNVHIY
                     EWIEPKNLDLCLNIEKEPMERASEQLMKIDDFKSPRDKIVCILNACKIIFGMIREQES
                     EENADSFVPLLIYVLIQCKLKHLYSNLQYIERFRNSEFLVGETSYYVSTLQIACNFII
                     GMNRDQLTVEEEEYERQVALARERIRELQGTRGDIPSQVLTKSAEMVRQTISQLLTHT
                     NDNEVDNDNNNNNNQEVQHQRESSAISDAVAQSVLEAQEHAQKVQTLAEIGSMFPYLE
                     GEIVASVFAACNDNAEQTVDALLEMA"
     gene            <686323..>687276
                     /locus_tag="C5L36_0C03220"
                     /db_xref="GeneID:40384177"
     mRNA            <686323..>687276
                     /locus_tag="C5L36_0C03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029465999.1"
                     /db_xref="GeneID:40384177"
     CDS             686323..687276
                     /locus_tag="C5L36_0C03220"
                     /inference="similar to AA sequence:RefSeq:NP_014611.1"
                     /note="PKUD0C03220; similar to Saccharomyces cerevisiae
                     YOL031C (SIL1); ancestral locus Anc_7.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321859.1"
                     /db_xref="GeneID:40384177"
                     /translation="MKSKLVCYLLCSLVTVFAVEEFIPSSEWQVVKDGQHIPPGLEIR
                     LDLENMQREARIPLEGEKQLSNIKNHEIVVVQPDSDITRAIDALTHGDYSSIDYLVDE
                     SSDIEHGVIIAKNANKLLPLLEIKQLSHDIYKIIAASLRNNVDAQHEFGNIVHIQKFM
                     DGLLDLQDVRKENTKIKLSVLGALVGNGTFQLNNELKTKLLVLYVQANEEALRHKIIN
                     ILNDGEGDVKRRFCEVAEEALPTATLNKNTWSVLRELARLKQEERKLFKAGSKFLDWL
                     DVNINLLRSEADTVPLRELIRYRHEVFGNRFGSRRDDLDEL"
     gene            <688506..>689107
                     /locus_tag="C5L36_0C03230"
                     /db_xref="GeneID:40384178"
     mRNA            join(<688506..688517,688760..>689107)
                     /locus_tag="C5L36_0C03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466000.1"
                     /db_xref="GeneID:40384178"
     CDS             join(688506..688517,688760..689107)
                     /locus_tag="C5L36_0C03230"
                     /inference="similar to AA sequence:RefSeq:NP_116619.1"
                     /note="PKUD0C03230; similar to Saccharomyces cerevisiae
                     YFL034C-A (RPL22B) and YLR061W (RPL22A); ancestral locus
                     Anc_8.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321860.1"
                     /db_xref="GeneID:40384178"
                     /translation="MAPITKKTEKATRTFVVDCATPTENGVFDPESYVKYLVEHIKVD
                     GHLGNLGDLISVSAEGSKVVVVSSTKFSGKYLKYLTKRYLKKNQIRDWIRFISVKKNE
                     YKLNFYSTSVDEEEDEE"
     gene            <689455..>692850
                     /locus_tag="C5L36_0C03240"
                     /db_xref="GeneID:40384179"
     mRNA            <689455..>692850
                     /locus_tag="C5L36_0C03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466001.1"
                     /db_xref="GeneID:40384179"
     CDS             689455..692850
                     /locus_tag="C5L36_0C03240"
                     /inference="similar to AA sequence:RefSeq:NP_116583.2"
                     /note="PKUD0C03240; similar to Saccharomyces cerevisiae
                     YFL034W; ancestral locus Anc_8.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321861.1"
                     /db_xref="GeneID:40384179"
                     /translation="MCGKSGTSDHMFTPSHFPASTKIKDVSTNEKLPISQIPNIEDDA
                     LRRISSSSTTSSRMNIDVIPSKDTTDFIEFEYSKPKYNQTETIKEISHNFNNLEPNSP
                     QTKHNGGELKPTADRELIPTRQIKPKEFDIDDSSDEDDEWKEMETQLNYGDIYNLKGE
                     KIEFAHSKDDITYENSVQQQKEHKKKKKSTLQKVMNLGKNEKEEQLKEKYRRAHLMNS
                     DTSNQGYTKIDEEKQAKRFEEMDKRFDFLFQNENNNLRKLHNASSAELITTDLFKATD
                     GFVSNDKFDEIFQQEGHDDNELNPEMQMMSTKSMLNDSQKIAYAALVKLVIVQLNTSL
                     VSIRGSNSTKILKKLAKCHTSFMRWSINIMNAIYKHLDIQNDQEINMIETLSCHGVES
                     SDLSKTFNKNIQIENHLNKENLHIINLNGAELECEKSLDIDIKWTLICDLFLILLEAS
                     VYDARSRTLLIHFAEAIGITEVEILQFERRITDSLEIDEAFEIINNNQTWDESDILKE
                     HKRKAKNKRIVKIALATAAGGLVIGLSAGALAPVIGAGLAAGLTTIGISGTGGFLAGA
                     GGTAIITTAGTMTGMNAGKTAMQHRVGSVKTFEFIPLHNNRRVNLIITVSGWMSGTMD
                     DIRLPFSTVDQVMGDLYSLLWEPEMLTSMGQTINILANEILTQSIQQILGATLLITLM
                     SGLQLPMMLSKLGYLLDNPWNNSLDRAWRSGKVLADTLRRKKLGMRPITLVGFSLGAR
                     LIYSCLLDLAKSGDYGIIENVYLFGSPIVIHEDEMAQVRSVVSGRFVNGYMKQDWILG
                     YLFRATSGGLRRIAGLSPVDGEKFNVENMDCSEHVKGHMQYREAMPKLLRDIGWEVLE
                     DQFVEIEQPNPEEEERQRKLLSEIEKRQHSKKKKTWYNKLWRKKNKEWWEMYEEGEKE
                     RESRNKKDNDNDATADTSKPERKTDENEIFSASVDLDALKQEVLKIELEAKKLEEKNT
                     KKNPKTGKANTDQNTPELNSTLQPHSTPNSISNLEVEEPNTIEKQQDIIQLTQSPEKQ
                     EKSDIAGLKPFKIRSATHVHKGGASVGVDVVEELHDEYGEYDVPKTEEKLEIMFDDDI
                     KNLEEKIRLQQKDHPGYGVNTGIDYGDEDEFPEDEGNIQFTIQ"
     gene            complement(<692899..>694668)
                     /locus_tag="C5L36_0C03250"
                     /db_xref="GeneID:40384180"
     mRNA            complement(<692899..>694668)
                     /locus_tag="C5L36_0C03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466002.1"
                     /db_xref="GeneID:40384180"
     CDS             complement(692899..694668)
                     /locus_tag="C5L36_0C03250"
                     /inference="similar to AA sequence:RefSeq:NP_013161.1"
                     /note="PKUD0C03250; similar to Saccharomyces cerevisiae
                     YLR060W (FRS1); ancestral locus Anc_8.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321862.1"
                     /db_xref="GeneID:40384180"
                     /translation="MPTIAVDKQDLFDLLGRSYTTKEFDELCFQFGIELDEDTTEDVK
                     GTDERPQLKIEIGANRYDMLCIEGIAQALNQYLGRSPIPNYTLSPEKPQTSLTIKEST
                     SQIRPYAASAILRGITFTQRSYDSFIALQDKLHANLCRGRTLVAMGTHDLDTIQGPFT
                     YEALPPKDIKFTPLNQTKEMNGEELMQFYKNDKNLGKYLPIIEGSPVYPVILDANRNV
                     CSLPPIINSDLSKITLDTKNVFLDVTGTDRTKVEIVVNTLVAMFSRYCETPFTIEPVE
                     IISEHNNETRICPNLEMRELQVEAEYINSVLALELSRKEICDYLLKMSLFATPNSENE
                     KLIDVKIPITRSDVLHACDVMEDCAIAYGYDNLVKTYPKTEATTAYPLPVNKVGDILR
                     TASAQAGWLEVLPLTLCSHDENYKFLLDDDDSLAVKLENPKTVEYQIVRTSLVPGILK
                     TIKENKNHALPIKVFESGDIVYKVPESERGAVNQRNWCAAYAGKNSGFENIQGLLTKI
                     MQTMRVPWLEKDNGKRGFWTEGSDEKKMFFPGRGAVILYRAKDDEKAVKVGHLGVLHP
                     QVLSHFEIPFALSIVEINAEIFL"
     gene            <694933..>695547
                     /locus_tag="C5L36_0C03260"
                     /db_xref="GeneID:40384181"
     mRNA            <694933..>695547
                     /locus_tag="C5L36_0C03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466003.1"
                     /db_xref="GeneID:40384181"
     CDS             694933..695547
                     /locus_tag="C5L36_0C03260"
                     /inference="similar to AA sequence:RefSeq:NP_116650.1"
                     /note="PKUD0C03260; similar to Saccharomyces cerevisiae
                     YFL005W (SEC4); ancestral locus Anc_8.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321863.1"
                     /db_xref="GeneID:40384181"
                     /translation="MSAGKKGFDKSMKMLMVGDSGVGKSCLLLRFVDDKFNPSFITTI
                     GIDFKIKTIDLDGTKVKLQIWDTAGQERFRTITTAYYRGAMGIIIVYDVCDQNSYDRV
                     ETWYKTVQQHAKEDAQVIVVGNKCDDEESRAISTQQGEQLAESLGVPFIEASAKTGLN
                     VSDVFYTLARRILAESKGQDEPAEGESSIDVSKGSNTSNNSGCC"
     gene            complement(<696278..>700432)
                     /locus_tag="C5L36_0C03270"
                     /db_xref="GeneID:40384182"
     mRNA            complement(<696278..>700432)
                     /locus_tag="C5L36_0C03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466004.1"
                     /db_xref="GeneID:40384182"
     CDS             complement(696278..700432)
                     /locus_tag="C5L36_0C03270"
                     /inference="similar to AA sequence:RefSeq:NP_010004.1"
                     /note="PKUD0C03270; similar to Saccharomyces cerevisiae
                     YCR081W (SRB8); ancestral locus Anc_6.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321864.1"
                     /db_xref="GeneID:40384182"
                     /translation="MSSVGIKSKEKSQQIELLTLEGGEINPPSNVYPLNWISNTDAYK
                     NIHNQTNADNQEHNKEQNVYPDFEVWRQSAEENEIMKTHLQKGYYQSPVVKHEDQSGR
                     PLMAEILNKEESTKKRKLRVMGQVFIDAMHRRSVFNSIKNRESYKPPPRVTLTEHKKE
                     IWLQRLADKKNPLKDISRAIPHGLRNKYLLEQCLSHNIPITRAIWLIKCISSNEQRHL
                     KRKNASISKWVVEWTEQVTSFLEFVIESCFQDNTNWRNRFNYAIVLVVNLYSDELMNR
                     IIFLTWIVRFTSHIVTKASTFEDLRELLVHQSIIKLFWFKIIVHDYLTKELSESMLMI
                     LAKISQLSKGTKFDVLSQKITDSFQYLIKYLFYYNSDIFILPSNWSNLKPHLRKTLDM
                     NLPPVYDQFNLISYRNETLTIDESAESSCSDIIPNDKTSLILNKLNNLESESIQSISK
                     MIFEDMGSNWRQYIDMLFEWSIQSFSDSRISQQRISLICSILQFRLLQLIQSKSKRYK
                     STRSELENKVIDFVHSMSEIINYKTLAEPQGEFFDISSFLILINKLYVMKLFIVSSYL
                     RRLIASGVIYLSEPDRTCYIHILILNSLPVSDPNLVSILKRLIDSTKLEIPCIKNKDL
                     IKQERVIHIDSIFKNDNIGTITFTSDPMYIGEQLELDSFTYFEFESRLKNEELNLKES
                     NLNALYELFSRHPSCLSKFFISIMDGLDSGTVKIDSAETMCLLCKMIFMNSKLLKCSI
                     FSIKMTILDLIYKKIKEWGETNKFNIIASLIRSGTPIDLIPCDINVSNVSVGEEFLKP
                     EELAILEVGSYERLSTSAEFTHYTTLAITKYVNSVRAGVSDFLIVRFLKSLQRWKQQE
                     FEKCVHDYIFRFIKPTLQLEYDINLKVLVKMVCDELFDFKNIIGIFENSGDIFDAQED
                     KHILWDLLFNVNEGVVFQFARWVYIHQNANDYFKILRDMIFASFKVSNSKVDSTGTPN
                     DVDLMDSFEIVKPFEIGQLNGQVVDAFWSLVNEHRNIFLELFYDTSVGTYEVEASLKG
                     FIFGRVLKIPDDDIFRHLTYFNLPIMQWAFTKTFKENNIEGIIEQLAVVRGLNEKLVG
                     ELFAHLQDDVKYDMLITCEEKYLNSEAFPKVIVYGVDITKFVGSIIGSCSRFHSRMKM
                     EMGDATFFALTSGLEKLINLCNHGNKRDLECGVKMVSKIILLHRYFIVEHVLRRSIHL
                     QRDVFIQSLMKLFNHKMMYKDLKLKNLLYDVLMSIKVIISECLTQQLQRKHESPTQGR
                     DTPTNLNANTNLSAGTNPASASNNTPPSNSGYIIMPNILNVKPPSFNNSLRNLLEMFD
                     MKDTVREHDTNLLFTVNQHWDGTIGGDEPLMRYERRPFDEIEGGNESSVNISLFGVVA
                     KRENPR"
     gene            <700640..>701773
                     /locus_tag="C5L36_0C03280"
                     /db_xref="GeneID:40384183"
     mRNA            <700640..>701773
                     /locus_tag="C5L36_0C03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466005.1"
                     /db_xref="GeneID:40384183"
     CDS             700640..701773
                     /locus_tag="C5L36_0C03280"
                     /inference="similar to AA sequence:RefSeq:NP_011739.1"
                     /note="PKUD0C03280; similar to Saccharomyces cerevisiae
                     YGR223C (HSV2); ancestral locus Anc_5.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321865.1"
                     /db_xref="GeneID:40384183"
                     /translation="MNAQRPLVVHVKSKEPKLNNAAFNQDQSCFAICTDTGFKVYSTY
                     PMELKMERDFSKGSFGIKETRDSSSTTRNVNSGIGIVKMLYKTNYVALVGGGKKPRSP
                     LNKLCIWDDLKEKNSIVLEFNTPLLNIHLSRTHIVALLKNNALVYSFKSKPELLFSFE
                     TDDNEPGASDLAICESSSILVFPGRNNGQIHIVDIINTQDKKSVSLIKAHRNPVQCLA
                     LSPRGNLVASASTKGTIIRIHDTKNCTLVYEFRRGVDPAIISDMKFAPSGTKLAVLSD
                     KCTLHIYHLGEENKKHLLKDLPLFPNYFKSTWSVMSKNVGNKSDLVNDIGTLGWVNDN
                     VLVIVWKYKGIWEKYDIISNEMDSVSSEESRKWEIVKEGWRSV"
     gene            complement(<702315..>703043)
                     /locus_tag="C5L36_0C03290"
                     /db_xref="GeneID:40384184"
     mRNA            complement(<702315..>703043)
                     /locus_tag="C5L36_0C03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466006.1"
                     /db_xref="GeneID:40384184"
     CDS             complement(702315..703043)
                     /locus_tag="C5L36_0C03290"
                     /note="PKUD0C03290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321866.1"
                     /db_xref="GeneID:40384184"
                     /translation="MRLTKADFTLGSMAPSNVVNGRYASNLVHTNNYYLIFNNVFQMA
                     TYLQQFMKDQPVINEQHINLALCNDFVTHLRFIYPEVCPDLSDLPLLFEYGLKSKKIK
                     NQKGKYKSVSKICGKLVTSRIDAVRRYQDPSIKCLFEAARSFYTHERDMVKQINRSHC
                     VILNGVPANIHKNKILDFLWDLHWSNDENTCIRKFNLTPNGLFCSYVLVFEDETSSRR
                     CIERTDRQHLFYDHCLPLVTAEAL"
     gene            <703914..>706397
                     /locus_tag="C5L36_0C03300"
                     /db_xref="GeneID:40384185"
     mRNA            <703914..>706397
                     /locus_tag="C5L36_0C03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466007.1"
                     /db_xref="GeneID:40384185"
     CDS             703914..706397
                     /locus_tag="C5L36_0C03300"
                     /inference="similar to AA sequence:RefSeq:NP_013088.1"
                     /note="PKUD0C03300; similar to Saccharomyces cerevisiae
                     YLL013C (PUF3); ancestral locus Anc_5.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321867.1"
                     /db_xref="GeneID:40384185"
                     /translation="MATNWDPSNQAASIDESIVSNPWEKVHNSSSNLNSMGVPNPISP
                     IMTRRVSHAQDDVASIISGLSSVNVGKANNVSAFLGGYNQPKNLSVFDEAVMSDSGSD
                     ALRDAISAISAPVAAKSRFGANIFGPASVAGVNVTGFKAPNTSSFLEKFSSVTEKTRE
                     LESNTFVNTSRRTSVFNNDTTSPQQSYREPRKQSFSEKLETYINTTTPTNISRHLSFS
                     SDVNAATNNSITITNKMSESNSSMHDNVSVHDGLKPQWNPATATPFHPSYPMDFAYAQ
                     HQMVMMQGFANGSQSYPNGGFFPQMFPPFASNGYNIAHPEPPSAIQESDEPQSENMKP
                     TDTTKSEYGSKTSDLDDESSDSNKQPNNNGPHEFFPVGLNRSNSPYVVPPFTPYGIFP
                     PNGANSGMYSPIMPIPGPGSPVGTTPIMFSPVVGMHPIGARGEGRDHHSPEPSSPVKN
                     SKSPLNSSHRKGGRNSRTKHKNIVRSPLLEEFRSNKDKTYTLEDIASHGYEFSKDQHG
                     SRFIQHELSVVSDDTKELFFKEIRNNAMDLMTDVFGNYVIQKYFEHGTAVQKKVLFES
                     MRGSFNTLSLQMYGCRVVQKCLEGVPLDDQLEIMEELKPNILNLVKDQNGNHVIQKAI
                     EQIPIEKIPFILNSLRNQIYHLSMHPYGCRVIQRLLECSDTEDQEFILNELKGFVYYL
                     VQDQFGNYVIQHIIESGKKKDSDVILDVVLKNLIELSKHKFASNAVEKCIINLPAESR
                     IQIYETMLKDNLDKDSPLSEASNLVLMIKDPFANYVVQKMVELIDPERKKFLVYKIRQ
                     YLKVIQKNNHGKHLASIEKLNQICRAYDI"
     gene            <706662..>707321
                     /locus_tag="C5L36_0C03310"
                     /db_xref="GeneID:40384186"
     mRNA            <706662..>707321
                     /locus_tag="C5L36_0C03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466008.1"
                     /db_xref="GeneID:40384186"
     CDS             706662..707321
                     /locus_tag="C5L36_0C03310"
                     /inference="similar to AA sequence:RefSeq:NP_013152.1"
                     /note="PKUD0C03310; similar to Saccharomyces cerevisiae
                     YLR051C (FCF2); ancestral locus Anc_8.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321868.1"
                     /db_xref="GeneID:40384186"
                     /translation="MMSTVDTTLNIDDIFTLLKETRAKEQKFDKTESEKKNNSNVLYE
                     EIKKKVSHLPTIEAHVVTKNTKDLGKNKQRGVQKIDDSVESVLPDMNQKTVTDRRLLK
                     EERSMKWFSLPKVEMTDDIKRDLVIIKNRKYLDPKRFYRGEKWEIPQNFQIGEIVEGV
                     GEYAGRIGRKKRGKTLTDEILKDEKAKEWFGKTYSEIQKKKSSGGKNFLKDKINKRKK
                     Y"
     gene            complement(<707580..>709160)
                     /locus_tag="C5L36_0C03320"
                     /db_xref="GeneID:40384187"
     mRNA            complement(<707580..>709160)
                     /locus_tag="C5L36_0C03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466009.1"
                     /db_xref="GeneID:40384187"
     CDS             complement(707580..709160)
                     /locus_tag="C5L36_0C03320"
                     /inference="similar to AA sequence:RefSeq:NP_116632.1"
                     /note="PKUD0C03320; similar to Saccharomyces cerevisiae
                     YFL021W (GAT1); ancestral locus Anc_8.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321869.1"
                     /db_xref="GeneID:40384187"
                     /translation="MPDRKALNYLNSYAQSGRECHQQTQPSEQISQQLSQPIQPLQAP
                     QAPIPAQPATIVPTTSSLKASTYNAIIDQPPYQPFHYSQYTHPTYPPSSASNYYYYEQ
                     SRSVPQLPIQIVSSQQQQQQQQHLPELTQQHSGQITQQPLQQHLSSTLHAYPLHPSTS
                     NPSNYQSTIQLPVQYPSNFIPPPVTTPPYYHNNNNSHNHSNTTTNNNDNINNENHSFI
                     NDRTRTQSELHNATEIETSYKHSSRLVDGNYKVDKKSIPYTFKPNSSKSSVNHFRVDS
                     KLRRSPEVDNWKNAKSVELFQKLKWLNSNKREILELMRVVDNDEKLQSLLYAEIESGS
                     NTDCKIEEFYNHINTYANSKVLKFHSVSQNLSNLTNIWLKMKKIESHGSVDSQPIIDQ
                     KFALTLQPSTSSPFATGTQPNKYNLNNINPTSSYPGESVSLQVVPLRLNDKQQHIDFK
                     SQGVLHPDLSIKMKMVCAHCGSTSTPEWRKGPEDARTLCNACGLFHMKLVKRIGAEAA
                     AKELRKRRENGEQNNRRL"
     gene            complement(<709513..>709965)
                     /locus_tag="C5L36_0C03330"
                     /db_xref="GeneID:40384188"
     mRNA            complement(<709513..>709965)
                     /locus_tag="C5L36_0C03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466010.1"
                     /db_xref="GeneID:40384188"
     CDS             complement(709513..709965)
                     /locus_tag="C5L36_0C03330"
                     /note="PKUD0C03330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321870.1"
                     /db_xref="GeneID:40384188"
                     /translation="MFCPVVRLVYVRLMQEHFPHRKNASRAASMHPVGRKMGDGDGSD
                     ICSPAAIVLGNVPCRAWCIKYTYKPRSRLFADYKLIRTPFIALMSAPMHLHLRAVEDI
                     DTDLHFSFGKVYLLLTIVVPLALNGKIVTSFHLPIFHWSYIHTYMYIF"
     gene            <711744..>713867
                     /locus_tag="C5L36_0C03340"
                     /db_xref="GeneID:40384189"
     mRNA            <711744..>713867
                     /locus_tag="C5L36_0C03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466011.1"
                     /db_xref="GeneID:40384189"
     CDS             711744..713867
                     /locus_tag="C5L36_0C03340"
                     /inference="similar to AA sequence:RefSeq:NP_015467.1"
                     /note="PKUD0C03340; similar to Saccharomyces cerevisiae
                     YPR141C (KAR3); ancestral locus Anc_3.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321871.1"
                     /db_xref="GeneID:40384189"
                     /translation="MCSRKRSEAQAQAKSLPEHPLQRQRYSHSHSQSRIPLQIVSNPS
                     SFLNSSDHTFSKRRKLDLQNPKSMAAIIKTVYTDTNTQIDELTRMKYEKLNELDKIKS
                     QTWKLQSQIPDLELKLDKVRSEMERVKSKFNFIERQIIGLNSLKSQKVESLKKSISIF
                     KNTMKEKFDDKVNSLNVKYEEKITKIIQDGIESFKAKEKKLKDEIKDLKDELGSYSSD
                     VLQIDKKKLDKELRQELDNYTKTENIDIRRIKSECNELTLKIEDLFVDIKTLHDKYET
                     QTQSKLESLKTISNDLLIQHEEIQIQERALNSKMNELNTTKDGECNKLLKLKGQCRQY
                     KQDIESFHEQVKKEEHYRRFLHNQLQEMKGNIRVFCRLKPEPKHQNEMFNYQIRSMLD
                     TSNFKETLLITEPKTANSNGNKSRVLKQAKTYTFSFDKVFDENATNGDIFEEISQLVQ
                     SSLDGFNVCIFTYGQTGSGKTFTMSNSIDGLIPSSIKLMFERLNTLNFIDKHYHLYGQ
                     FFEIYGDDTNDLIEDGFLHINNNDELVGLDNDRLENIKMIKLYSTEQIEGLLKHASEK
                     RATASTMANDVSSRSHSIFKVYIISYNETLQKYENIGILNLVDLAGSERLSHSQVSGI
                     RLKETLAINKSLSALGDVIANLKGKSSHIPYRNSKLTHVLKDSLGGDSKTLMFVNISC
                     LNSHFNESLSSLRFASKVNNTVLRK"
     gene            complement(<713985..>716633)
                     /locus_tag="C5L36_0C03350"
                     /db_xref="GeneID:40384190"
     mRNA            complement(<713985..>716633)
                     /locus_tag="C5L36_0C03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466012.1"
                     /db_xref="GeneID:40384190"
     CDS             complement(713985..716633)
                     /locus_tag="C5L36_0C03350"
                     /note="PKUD0C03350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321872.1"
                     /db_xref="GeneID:40384190"
                     /translation="MSLYSKGTRILTRACVSRPNYMLVHSILENLIRLKSKSPMYSTA
                     SFIQSDSKRFYSLPSNKFADFEKQRIDYFLQLQDTFKNQSMSPKIKSERLKLIMLQLI
                     PILPNGEFSNKQLPFINSVINLIDNKASPNDSFTPDEMILLLKSVLGGMSLKDVRFID
                     FFPRFYNALRESQEYASDQALRLELFEIFINYVLLSTKRNTVSKVIDAFIDEEQNIHN
                     NEANQQVVEIVLHAFESVRPDTETVLLLANLCPDLSLIKKELSDCTMLELILSNFFKA
                     SDEEISETFEDNFVSERLIKLIDIIEGKVDDPILSYVEILYFATKNHFNDVSVSILDK
                     LERKTSFFKESDQFQTLYEADTLFALVSASLKFNKVINATNLLAHLRDNKKETEFVEE
                     EWMALLQYDAFQLHEYKPAIELINDYNSKLESLNKEYFFQDVDSLNLVLESLCWSKKD
                     FPYIDKFREDFQEMYQVPVDAKSVSTVLNYLCEDESNNESIKLASSYFLKFKDLVDWE
                     NDYEGFYMLSLFQLTANIWKNESLSWNEKMEVYKNVQRYEYLFNKECIYEMMKSAIKY
                     NAGTFAIKVLLDQTPELKKNDPRLKVPNYQKIFDCIYDYLTKSPDKELNKRVYKYLAE
                     YFSIPYEYYPGFIKMFIDCGDPEMSLKVFADMKRLSKESKLPPPNEEFYIYLLKSFAK
                     FQYEEGIFKLHLSIKMDLSINLDIKLLNSLMESYAALEDPFKTRDVFNLAFSLPKENG
                     TNNESAYWMLKSLKYATLGHANDFYNGLSQYDMIPDPYLFGELLIANCYFEQYRTAFE
                     TLQLAEQNGDYHLINTYVLKTLHNHCLHDGVRDELKAYYQEKFPKEWDELTKTGQLQD
                     NREKYPNLLENPYERPYIETKQISDS"
     gene            complement(<716871..>718076)
                     /locus_tag="C5L36_0C03360"
                     /db_xref="GeneID:40384191"
     mRNA            complement(<716871..>718076)
                     /locus_tag="C5L36_0C03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466013.1"
                     /db_xref="GeneID:40384191"
     CDS             complement(716871..718076)
                     /locus_tag="C5L36_0C03360"
                     /inference="similar to AA sequence:RefSeq:NP_015466.1"
                     /note="PKUD0C03360; similar to Saccharomyces cerevisiae
                     YPR140W (TAZ1); ancestral locus Anc_3.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321873.1"
                     /db_xref="GeneID:40384191"
                     /translation="MSFHDVLKRGDEEILKTRPQRSAIWNTLSHFTCVAVTGFSKLIL
                     ATCYNVEVKGIDNLDSSLAYARSTNRGFLTIMNHMSTCDDPCIWACLPWRYFKSWNDI
                     RWGLAASNVCFTNKAATTFFSLGKILPCERFGRGPFQSGLDACIRILSPDDTIDPSHV
                     LSSLDSVKPASLARNALSLFDTKYTPPILRYQTSWVHIFPEGYVCQLKPPHSNSMRFF
                     RWGTARLILEPTVQPVIVPIFTDGFEKVKPEEIDMKTDYLTPNNFGAKITVNIGRAID
                     DNIISKFRQEWRDLCAKYPNLENPNDLSDELMFGKEARELRSRVCSFLREQVASLRLE
                     NGFPEEDPRFKDVNFWSRYTKSRGKSDPDVQFIGFNWAIKEYQKNVKIYDDRGNVIGE
                     RESERPEGL"
     gene            complement(<718290..>718823)
                     /locus_tag="C5L36_0C03370"
                     /db_xref="GeneID:40384192"
     mRNA            complement(<718290..>718823)
                     /locus_tag="C5L36_0C03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466014.1"
                     /db_xref="GeneID:40384192"
     CDS             complement(718290..718823)
                     /locus_tag="C5L36_0C03370"
                     /inference="similar to AA sequence:RefSeq:NP_012548.1"
                     /note="PKUD0C03370; similar to Saccharomyces cerevisiae
                     YJR014W (TMA22); ancestral locus Anc_5.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321874.1"
                     /db_xref="GeneID:40384192"
                     /translation="MTLYCGVCTLPVEFCEFGKTLKKCKAWLQEENPSLFDVLYNSNN
                     ESSLSSETEAKLSSSIAKMQLKEERKQERELENLKNSKILIKRIPRSKHKNICAIQNL
                     EILGNDIDLKKTAKKFASKFATGSSVSKNAENKEEIVIQGDVGTEVEKIILEMMKERG
                     LEIKIEHVTERFTNKKR"
     gene            <719611..>720201
                     /locus_tag="C5L36_0C03380"
                     /db_xref="GeneID:40384193"
     mRNA            <719611..>720201
                     /locus_tag="C5L36_0C03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466015.1"
                     /db_xref="GeneID:40384193"
     CDS             719611..720201
                     /locus_tag="C5L36_0C03380"
                     /inference="similar to AA sequence:RefSeq:NP_010985.1"
                     /note="PKUD0C03380; similar to Saccharomyces cerevisiae
                     YER063W (THO1); ancestral locus Anc_7.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321875.1"
                     /db_xref="GeneID:40384193"
                     /translation="MTKYATLLKGKLQELLAERGLPTDGTKDVLVERLEESDKIAAEL
                     DQDLEEPVANSSQGATTDKNVEDQTVPTTNDATVTDATTTPTAVGDATESLQARAVKL
                     LEGKIARVRRFGDESSAVALQKQLARVVRFGVTPGSALALEVEGPPTVNGDSPLHHGH
                     SHGHGHHHHHHGHGHGPHGRRVGYVRKVRETAKVHK"
     gene            <720762..>722660
                     /locus_tag="C5L36_0C03390"
                     /db_xref="GeneID:40384194"
     mRNA            <720762..>722660
                     /locus_tag="C5L36_0C03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466016.1"
                     /db_xref="GeneID:40384194"
     CDS             720762..722660
                     /locus_tag="C5L36_0C03390"
                     /inference="similar to AA sequence:RefSeq:NP_011654.1"
                     /note="PKUD0C03390; similar to Saccharomyces cerevisiae
                     YGR138C (TPO2) and YPR156C (TPO3); ancestral locus
                     Anc_3.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321876.1"
                     /db_xref="GeneID:40384194"
                     /translation="MSSHSSSVSSISSIDNRIDAENAPQVYDPEDAQSQISGNLSSTL
                     SRAESLRMVKTETSKSLKDRGLSRAVSIADPVRPSTVENPIFPEEYTLETETGLVPVQ
                     TLREIGRSRAATKSQISRTSSKTPTKIPTQVPTDVESLQPHDESTKPFDPEIQFVTFT
                     LNDPENPHNWKPILRWTFTIVLSLMVVCVAFGSSIVTGSLGPMSEKYHVSTEVSILSC
                     SLMVLGFSVGPLLWSPLSEQIGRRPVYFISFGLYFIFNIPCAVAPNIGTILVCRFLCG
                     VFAASGLANVGGSISDMFPTETRGKAIAYFAAAPYGGPVIGPLVGGFISRYDGRISLI
                     FWVNFAFAGLMWLVGSLIPETYAPVILKKKAKRLRKETGNEKIMTEQEAAGLSLKELV
                     QTCLYRPLKFAITEPVLDLMCFYVCLIYSLLYAFFFAYPVVFGELYNYGDDLVGLVLI
                     PIIIGAFLALLTTPVIENAYVKMCHRRDPTPEDRLVGAMIGSPFPAIALWILGATSEK
                     HVIWVGPASSGLAFGYGMVLIYYSLNNYIIDTYAKYAASALATKVFLRSAGGAAFPLF
                     TMQMYHKLGLHWASWLLAFITTAMVALPFAFYKWGAQLRKKFCKENYSAFPWDDEEEN
                     TDSSIEKN"
     gene            <723744..>725966
                     /locus_tag="C5L36_0C03400"
                     /db_xref="GeneID:40384195"
     mRNA            <723744..>725966
                     /locus_tag="C5L36_0C03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466017.1"
                     /db_xref="GeneID:40384195"
     CDS             723744..725966
                     /locus_tag="C5L36_0C03400"
                     /inference="similar to AA sequence:RefSeq:NP_010986.1"
                     /note="PKUD0C03400; similar to Saccharomyces cerevisiae
                     YER064C (VHR2) and YIL056W (VHR1); ancestral locus
                     Anc_7.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321877.1"
                     /db_xref="GeneID:40384195"
                     /translation="MENLDGSHSDICQLGVEIGVGGRRDKRRKERGKRTIGNHQPFQY
                     LSGNCMSCEVYTHMHDVNSKMSIHRGNRSHPHAQGATSIIRDKLGFKDEAMWKRFSSR
                     RLQLVESLSMSSKKASEQDEEIKICAKTLMKEFGFPDDTLPEFDKLVRLAIQSVRRNK
                     RRSEKRLASKLETLTSDDEVNNKRIKLDDENDLSSNPSSNRLNDEIRNNNHNNVVDFS
                     SYTNIDNEKNVQHSDNLTNSKENDDNNSNSTRLHDKLYDTIVAINQLVSPIIEQDQLP
                     SLKRLNENPQFTKSSKIILHFIKQSKTCFEFSRVSNSEYSNNGKFTLLEEFGSNCIST
                     AVLFTLEKWFDHLSPDSSSYIKLRLKSDLTLGLIIKNLDNSSTEVNRLSNYVASQLFK
                     KFIGACVKDFGFDSILNPLCDIFHGIILRDYPIITKKSASPNLISSQPLKDNGRKNSN
                     NNNNNNNNDNPFFSSKEISVIDAALAKPFVSASSSSHSHSHTHLNLESPSSPILHHHP
                     ITSTRGQSMMPDFPLSTSQIPIPPAISDHHISYNHHQQLLPNPPVLRSKQYTQVNIKF
                     KDQELNFRYSIDSNAAPTIMELITNCKQAFGILNSTRILNLKDLRSGKIIKNDHDLER
                     LLRMTVMLSDDGCGEVRLELGYNNLSQGFLNLNHEPADKTWQHDNNISGNNNSNNNSS
                     NKSNNVNSNISHDTNIENGATNVSGDTMIGRYLPPPRPILPDTQPRPRGGFMKFQPLL
                     "
     gene            730774..730845
                     /locus_tag="C5L36_0Ctrna7E"
                     /db_xref="GeneID:40385087"
     tRNA            730774..730845
                     /locus_tag="C5L36_0Ctrna7E"
                     /product="tRNA-Glu"
                     /note="PKUD0Ctrna7E; codon recognized: GAA"
                     /db_xref="GeneID:40385087"
     gene            complement(<731055..>731561)
                     /locus_tag="C5L36_0C03410"
                     /db_xref="GeneID:40384196"
     mRNA            complement(<731055..>731561)
                     /locus_tag="C5L36_0C03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466018.1"
                     /db_xref="GeneID:40384196"
     CDS             complement(731055..731561)
                     /locus_tag="C5L36_0C03410"
                     /note="PKUD0C03410; Pfam Domains: DLH(1.5e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321878.1"
                     /db_xref="GeneID:40384196"
                     /translation="MPDILFGNPYPLGGDAQLWFANHPVSKTKASVSGFLQYVKRNFK
                     NVKFVAGIGYCFGAKYFANHLTETGINDVGVFAHPSLIKESELRAIKKPLMISAAEID
                     RTFTDELRYKSEDILRTLSIPYQIDLFGNVSHGFAVRSDLSDKRVKYAAEKAFADAIY
                     WIQYHATK"
     gene            <732167..>736954
                     /locus_tag="C5L36_0C03420"
                     /db_xref="GeneID:40384197"
     mRNA            <732167..>736954
                     /locus_tag="C5L36_0C03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466019.1"
                     /db_xref="GeneID:40384197"
     CDS             732167..736954
                     /locus_tag="C5L36_0C03420"
                     /inference="similar to AA sequence:RefSeq:NP_013901.1"
                     /note="PKUD0C03420; similar to Saccharomyces cerevisiae
                     YMR176W (ECM5); ancestral locus Anc_6.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321879.1"
                     /db_xref="GeneID:40384197"
                     /translation="MSDELNQLVSHDQNGDVYSKLHASSALDISYNHDHNLTEKHQHH
                     LGEENHTEENPPDTEDFVISTNMLSSFVNSAKGDLVFDAHDPMDNDENQDLMIQEAVA
                     AASAVTSAMSPSNLSTMLSESESQKRLFPDPQLGSNKKQQAFSLLGNDSDDFSADLNS
                     LHDPLSGSRSKTIKFTPNRTSENIKKQHTYVTNPNSKKSKRESIKGPPKNSRFFKVYG
                     LEGAKNIKASSLHHYNPYRYPQNRSKLNPFPDFIKNRKEESVDVSNERGINTSSQKNP
                     AIPDLEHHRSDSKKNKIPELRPTLEEFEDIYSYIESIKDIGEKFGAVKVIPPKEFSPK
                     FAINLESFWIKSNRQLWNSPSDELNSRCEFYNQLKNALKDSGISINKLPCIDKRAIDL
                     YRLYRVVNLRGGFENCCNDKLWAQIGRELGFYGKISSSLSSSIKTVYQKYISPWEKKY
                     QGTRDQDYLNLVRNDEAQCLFPQFGEDDGLAQVPIILGSSNPFPRNRQHLVDSGFSTY
                     FDQSTTQKKGITVSDTNTLPTYDFYRWSDPNQVDDVDPRELKISSLYTLKQFYDKSRI
                     VKNTVLSKFNDTEHFKFENMEYLESSFWSLLKRSDVMFETEVSFNQYTNIHDSSYENK
                     FLSDKSGNLSDSILGSLNFNNTAIYDGSLLQYADSYSNSLFHSCLNFAMFYGCQSWKS
                     EDHWLYNVDYHYLGDAKSYYVIPPEYREKYEDLIRSYIELQNKAYERTAINLQKFEKA
                     IDNSDIFNACLENQISYDMNVSRARPLEPKFEKLVDQDTYPIRYNTDIMLTPEILRKN
                     GIPVYHTFQEVGDMIIKFPKSYSSYFSLGTSVTESVQLANVDWLSCSLEADRWLQKQQ
                     ILPNFSTFLLILRAARDSDDIKILKAIKPILEKMITDELDKRVELRKNLKETSYNKYL
                     ADFKEYTNNNVLDKKHNGEATIGTELIYKLGSINRMTDSDLADIFPSFVLAKSAVPLQ
                     SSFTMSVSSFMQRKDQIVFENMGLEFELVTMCSDEYLTQSVDILHGKLEGIDSWIAKY
                     SEIISASSRPDLNKVVPLIEKGNTLFNAKNTRYYTDYQKEKFKSTFDKFMMLKKEVEK
                     TEVWQRKAQILTKIPRENFNTLFPFSEFKTLVDEIKHLNLYVDEIREIQAMSEEIITF
                     DLLAVSALDKANTKVDLAELEKLYAVGSNIKVELETLTLIGKIVRRASWMELLRKDVN
                     TVEELKEIYDAGKSFDSSNPEDIKLLDELKNKIDHIGKILLQYDEIKQTNHQVATKEL
                     LELEKECMGFPLKEVQDYIKILLIDSSNMQNGVIPIIDIIKEKISVQSNETSAVGRIN
                     AFLKYYGMIKKGITDLKFDEIYQTLCKFEEYQDAAKIFKEQIIDGPLTSIKELSEKFK
                     RLLNFGRDDTKFQNLGEVDCLNHLVSYDMDILTNQEERYCVCRQKHEGNMVECEECKQ
                     WFHFNCVGYVKTDTENDKYFCPLCDIEGKYPSTQNFYLNLLKKTTLEELIQTADKMAV
                     RGSICISFEHSFFNAVLKYVDFYNLLLEQGAIRENNGEIDVCISDEAYLRSLLQKVNG
                     CVINFRKLQSALQNKYASLRLIKDGTSAKVGNVAGLSGDIYTC"
     gene            <737265..>738956
                     /locus_tag="C5L36_0C03430"
                     /db_xref="GeneID:40384198"
     mRNA            <737265..>738956
                     /locus_tag="C5L36_0C03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466020.1"
                     /db_xref="GeneID:40384198"
     CDS             737265..738956
                     /locus_tag="C5L36_0C03430"
                     /inference="similar to AA sequence:RefSeq:NP_013902.1"
                     /note="PKUD0C03430; similar to Saccharomyces cerevisiae
                     YMR177W (MMT1) and YPL224C (MMT2); ancestral locus
                     Anc_6.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321880.1"
                     /db_xref="GeneID:40384198"
                     /translation="MFLKPSTIHALGQSYRRGNFLGLGPKSSFVNAVPQFAKRHHSHS
                     HNSTSCDGHSHSHGSGTDDIPEKKVHHFYEYTPETGTRKTVAIKGEKVIYDPEDKIAP
                     QTREGPGHGHSHAEFPEMDLMDFNGDDYTINVNPKKRSAWTKVKDFFNPHTPLAEMMG
                     SHSQEHSHTHSHVNDAETLKLYDPKNLADEGVKITWIGFGVNCGMAVTKFAGGFYFHS
                     QALIADAVHAVGDLISDVLTLTTVRFTNKKPDKLYPFGYGKIETCGSFMVSFILLYAG
                     FQIGWSSFYEIVAPIVPNAIHDLMALVPVHSHNHVDVSNVISESAAHVHSHDHAEATV
                     PAGTPEVANINAAWLALGSIAVKEWLFRATRNVGERLNSKVLIANAWHHRVDSLTSVV
                     AVATISSGYFLGVYWLDAVGGLLVSMLVMKVGISGVVQSFKELIDKALPVDDTRYMKI
                     EDSINVILMKKDSHVLIKELNILPSGTNLNLVVKLGVSPFNAEYEKRLTLEQMGSIAD
                     FLKSELSKEFHNIKHTSVQFISNKQEAEEGAEENQENEEESIDKAISEPTQSKKA"
     gene            <739294..>739746
                     /locus_tag="C5L36_0C03440"
                     /db_xref="GeneID:40384199"
     mRNA            <739294..>739746
                     /locus_tag="C5L36_0C03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466021.1"
                     /db_xref="GeneID:40384199"
     CDS             739294..739746
                     /locus_tag="C5L36_0C03440"
                     /inference="similar to AA sequence:RefSeq:NP_015099.1"
                     /note="PKUD0C03440; similar to Saccharomyces cerevisiae
                     YPL225W; ancestral locus Anc_6.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321881.1"
                     /db_xref="GeneID:40384199"
                     /translation="MSAIPASFDPENPDNLEDIEKQFAVKAVQQMSTYWSLLNAVPPS
                     KLKLTQFDDEIVEEFFKAFPEYNNKEKLAVLNEDELKTKEAKERWREYIKNFENKIDD
                     YNFGTLLRVNASEEYSEENTIFVVRIQFYAFELARNRFGLNDWVYEKK"
     gene            complement(<740501..>742112)
                     /locus_tag="C5L36_0C03450"
                     /db_xref="GeneID:40384200"
     mRNA            complement(join(<740501..741130,741361..741451,
                     742105..>742112))
                     /locus_tag="C5L36_0C03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466022.1"
                     /db_xref="GeneID:40384200"
     CDS             complement(join(740501..741130,741361..741451,
                     742105..742112))
                     /locus_tag="C5L36_0C03450"
                     /inference="similar to AA sequence:RefSeq:NP_011439.1"
                     /note="PKUD0C03450; similar to Saccharomyces cerevisiae
                     YGL076C (RPL7A) and YPL198W (RPL7B); ancestral locus
                     Anc_6.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321882.1"
                     /db_xref="GeneID:40384200"
                     /translation="MAGIPRPESQIKKAKRVERDQKAVVAARKARKFVNKEKRNALFK
                     RTEAYTAEYAAAERAVIDAKRTARAEGSYFVPAESKVVFVVRIKGIMKIPPKSRKVFQ
                     LLRLTQINSGVFVKVTKATTELLKLVEQYTAIGYPSISTVRQLVYKRGYGKVNKQRIP
                     LTDNAIVESVLGKYGIESVEDLIHEIVTVGPNFKQANNFLWPFKLSNPSGGWGVRRKF
                     QHFIQGGSTGNREEYINQLVKKMI"
     gene            <742481..>743400
                     /locus_tag="C5L36_0C03460"
                     /db_xref="GeneID:40384201"
     mRNA            join(<742481..742523,742607..>743400)
                     /locus_tag="C5L36_0C03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466023.1"
                     /db_xref="GeneID:40384201"
     CDS             join(742481..742523,742607..743400)
                     /locus_tag="C5L36_0C03460"
                     /inference="similar to AA sequence:RefSeq:NP_015125.1"
                     /note="PKUD0C03460; similar to Saccharomyces cerevisiae
                     YPL199C; ancestral locus Anc_6.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321883.1"
                     /db_xref="GeneID:40384201"
                     /translation="MASAGVASRGPMLNGNERDYNHVSDKEYVKFRNLAEEAYSKRQK
                     LSALSQQAYQKGDKKSASELSRKAKEQLSIAEGYNEKAATYVFLENNKDSDDDDIDLH
                     GLYIKEAEYILKQRIISGISKNQPKLDCIVGKGLHSKDGVAKLKPAVEELCRKANLKC
                     WIDEKNAGVLHIGLKNASIPQSWYDINPHGIGAMDDNYFAYHPNEIPQGHQPSHQYNY
                     AQSQPQPQQQANTNIQPYHQQNYHQQQQQQQQQQHNNNNNEEMALALCSVAAALFKCF
                     YR"
     gene            <743660..>745084
                     /locus_tag="C5L36_0C03470"
                     /db_xref="GeneID:40384202"
     mRNA            <743660..>745084
                     /locus_tag="C5L36_0C03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466024.1"
                     /db_xref="GeneID:40384202"
     CDS             743660..745084
                     /locus_tag="C5L36_0C03470"
                     /inference="similar to AA sequence:RefSeq:NP_010192.1"
                     /note="PKUD0C03470; similar to Saccharomyces cerevisiae
                     YDL091C (UBX3); ancestral locus Anc_2.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321884.1"
                     /db_xref="GeneID:40384202"
                     /translation="MPNPVMSELNRLQHIFNSIINELNQTTQQQQVDDVEAIPQLQMP
                     GGLDLPTSETQNSEDNSNTNKVENLFKKLLLIIAICVLLIVFLPIYVIYMILMFLFVF
                     TVSIYNKIHQGKYSNLRNTDPSDIARRFIMNFDERIGNNLAGIDSSDPMEDQDQPNTL
                     IEEGHLGEIGRPDFLECAYSQALYIVKKDIRWLLCYIESGENQECVDFTKEVLVHPVF
                     LKFIKNKNFLVWGGDISDSEAFQVCNQFNITKLPFLGLLCMTVNQIPTSSGMQQSEPV
                     LSLVSKIQGYKDLETTIHKLQRAYSKYNPIVSQLKRDNPESLQGVVRELQDEALQNSI
                     RRIRPLRNSYSREPQRRSREEKRLQWLKWRKSTLEPEPNEPGQYARLAIKFPDGSRKQ
                     IKIGKTSSLEKIYATLECMYLNEVELGDATVYQCPDDYEHEYRFRIYTVMPKQIIPMS
                     SNITIEETTSIYPSGNLVVEMVVD"
     gene            complement(<745177..>745654)
                     /locus_tag="C5L36_0C03480"
                     /db_xref="GeneID:40384203"
     mRNA            complement(join(<745177..745545,745631..>745654))
                     /locus_tag="C5L36_0C03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466025.1"
                     /db_xref="GeneID:40384203"
     CDS             complement(join(745177..745545,745631..745654))
                     /locus_tag="C5L36_0C03480"
                     /inference="similar to AA sequence:RefSeq:NP_010191.1"
                     /note="PKUD0C03480; similar to Saccharomyces cerevisiae
                     YDL092W (SRP14); ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321885.1"
                     /db_xref="GeneID:40384203"
                     /translation="MAVLDNNEFFTQVTGLLTKNGGKSSIYITQKRLSYNIDDEIEGI
                     NPLSDLPKNVKPLLHEFNPDQKTHPILIRVTDGNRDKSKKVKLSTVVEPQNLAIFWKE
                     YTNIIKAGFPGLKKKSKSKKKVKKTSKK"
     gene            complement(<745838..>747235)
                     /locus_tag="C5L36_0C03490"
                     /db_xref="GeneID:40384204"
     mRNA            complement(<745838..>747235)
                     /locus_tag="C5L36_0C03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466026.1"
                     /db_xref="GeneID:40384204"
     CDS             complement(745838..747235)
                     /locus_tag="C5L36_0C03490"
                     /inference="similar to AA sequence:RefSeq:NP_010193.1"
                     /note="PKUD0C03490; similar to Saccharomyces cerevisiae
                     YDL090C (RAM1); ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321886.1"
                     /db_xref="GeneID:40384204"
                     /translation="MPNDEVKNQQSEVAVSSLIETSQNQGISFLDFDTLLNMLDASYD
                     SFSNCNASLGEVLTDTIEKKMEVEVDVQTIYEDILSEGSDKIPKLNREMHSRYIHEML
                     NRPLPAPFSKLDASKTWIAFWLMNSAALIDNLNTKEQNNAAKQLMYFYKTSSGSKNTV
                     AGFGGGLHQLPHLAASYAAVLALLLSKNENAWREIDTQKVKKWLLQCKNKDGSFSMHV
                     GGESDTRAAYCALCIAQLLNILDDDLRKGVADWLIKCQTYEGGFAGAPGDEAHGGYTF
                     CALSALFILLNPDELMVSGLNLEILIKWTVDRQYSLEGGFSGRTNKLVDGCYSHWVGG
                     TVALLELLINYNKYKINDPNKYLSLIDRQRLQNYILCCCQDTFGLRDKPGMNSDFYHT
                     NYVLCGLSMCQHFQIYDPSKAQKYGNAFSAYPIEIEQPNTITILDDNHVLGIDAIFGV
                     PYGYALNMYTFFSNL"
     gene            <747636..>749069
                     /locus_tag="C5L36_0C03500"
                     /db_xref="GeneID:40384205"
     mRNA            <747636..>749069
                     /locus_tag="C5L36_0C03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466027.1"
                     /db_xref="GeneID:40384205"
     CDS             747636..749069
                     /locus_tag="C5L36_0C03500"
                     /inference="similar to AA sequence:RefSeq:NP_010195.1"
                     /note="PKUD0C03500; similar to Saccharomyces cerevisiae
                     YDL088C (ASM4) and YMR153W (NUP53); ancestral locus
                     Anc_2.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321887.1"
                     /db_xref="GeneID:40384205"
                     /translation="MFGGINTSAPNKQSLFGNSGASSSKTNTFSQPYQQQQQQLQQVQ
                     PTQGLPLQSSIFQNPGQAIQQMKSPSRFEKYELKGASEPKLFASDVKTGASHSDTNDP
                     SKSKHRKRTIPSHLVKRLNKNKSTLDEEDKPSVPILPFKATKQSQTDTFDEDFAYLYE
                     HDKLPSRSLLDPLTFNDEYTPGEILMEGSDFNKMTQEPFEFKNAFQRPNRSTISQKTT
                     GKENRETKLPWSKTSNEMQIDDSDLSVKTELVPTDTKQTRSLTSEKLYCAVIVYGFDD
                     ENFRVLIEHFAKYGKIMEDLMISDFNYYYGQPGNVLAVDKLVDINDRSNAKLGNKNAF
                     PIFLGEGWVKITYDNPNSAIRALADNLISDNNGNILGVIPYTREDLELLLGQKISDSM
                     DVGAGLKGLNHELELDMKLADNYIGRYLRAARNGLTRKDSNSGDLRSKSLAIKDGSNL
                     LLKKDKHENRKTIWNSGMGFLFGKGEI"
     gene            complement(<749214..>752984)
                     /locus_tag="C5L36_0C03510"
                     /db_xref="GeneID:40384206"
     mRNA            complement(<749214..>752984)
                     /locus_tag="C5L36_0C03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466028.1"
                     /db_xref="GeneID:40384206"
     CDS             complement(749214..752984)
                     /locus_tag="C5L36_0C03510"
                     /inference="similar to AA sequence:RefSeq:NP_010622.1"
                     /note="PKUD0C03510; similar to Saccharomyces cerevisiae
                     YDR335W (MSN5); ancestral locus Anc_5.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321888.1"
                     /db_xref="GeneID:40384206"
                     /translation="MSAEGISQIITSLDIIYNPASTNAQRQEAQGFLETIKALPDCPY
                     WGYQLALIDNGYNNIVRHFALNLLLSSITSYYHDWDRPKKLAVRSWIVELATKVSPQD
                     PHYLKSKIAFLWVEIAKRCWGECLLKQNPSLAAGLGNIENTDPLAVPENKDVYQFTEE
                     EKIDSWMSMDSNLLELWNHSQITRELSLIIMKTLFEDIYLLDDPIVSKRRTVLISLCP
                     EIVVAERILSAKYEQNDTVRLFVSQSEGWLLQWCQVLDECIQFLIFNDLSNNNSNVFV
                     NNSDINTTKSYYLDTTVKLLEILKISLFWIIPLALKEVDIITKLFKLLTIDDMRIKLL
                     TIECFDSLYNKPYSNPEDNEWLVNSAFNNTAYEIFFETYKSVQINYEDIDYDDYTLQK
                     KIVEFLIILSDYITSKESIKTSDRDFTNFYKLILETTKNESPSVSAISLQFWCTMLRA
                     DELSDQPDFESVLPELLENCANRLINYVDSDPESIPLQYLNYDFDNQSDQQSFVSDFK
                     KMNDDIVRIIVCKKPKDALMWLAERLNNFFSSLLGMESLNNLNLTYKGKGSEAYITAY
                     SQFSIIETCVRGITRWQIWYKEDDAQEIKAYLTDQVDNLCKLLIMLQIQNPVLVRKQI
                     QTLVQFTPLLKDLNSTMFKVLERVIETCTFPYPENASDEELENIRDLRASSGTELNRL
                     AYLMPESLKNIFSELEAVIDTILSQKELISHEIVAFKSFLLVVSQRSSLENKEETFKR
                     IVDPELMAWSDPNTMKGLSDLHWFMERLGIVKIAEYFRSRGITASTNLLEAQMDETGR
                     QLKKQLKDQWSSVFPIRATRILIQYSIEKLDHESETYKNLLKLWQPRVEPILPYIFQL
                     IYQIQAYHNPANWVGLPDEVQSFVKYTTMERFWQQGISIQSRESFVDENVKAMHTLRD
                     FADSVGHIIRYTREYSYLMIGTITELEETLYVDPKNASLLWKALTEESVGITLHSWRH
                     MINLVVRNVIKNCPMDYFDLFMLGFLPQVFIKLDELLLQRWNRVYEKGLRLEGNESDE
                     QLSEEMLEEHMLRQLTQVIDRMLIDIAGQKVRTSLTDRQKETREFLIYNFEVLAPFLK
                     LLCDIISFRDTRCSFNAILILRHISQELVGLNDERVDKIILENIMPILIDLICDKFYT
                     DAHSEAAYTLSILYIGERFKSDYPLQLLKNKLGVNQETMANFENVFSACQKSRERKNC
                     LLTLFNNARNDGNPDAYIEQRNKMIQGATRAKKKNTVDGLEGGLGGLFNTDD"
     gene            <753360..>754733
                     /locus_tag="C5L36_0C03520"
                     /db_xref="GeneID:40384207"
     mRNA            <753360..>754733
                     /locus_tag="C5L36_0C03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466029.1"
                     /db_xref="GeneID:40384207"
     CDS             753360..754733
                     /locus_tag="C5L36_0C03520"
                     /inference="similar to AA sequence:RefSeq:NP_010602.3"
                     /note="PKUD0C03520; similar to Saccharomyces cerevisiae
                     YDR316W (OMS1); ancestral locus Anc_5.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321889.1"
                     /db_xref="GeneID:40384207"
                     /translation="MNSFLLRGEMFCGLGALRKKQTSIVFKDALRCWYSTSSKLPPKP
                     PKFHFKTKKELTPEEQKKIEDDRKYNEAINSGSSIKKWGAIVGSAAFNKKATKYYIGL
                     YVIFLCYGIHYFRKLFARHLEEEDLKKLRDEGKPMSEYQKLRIRDLSGDLLRTKDTQK
                     LKAYYQLKEEYDSKSEEERKEIGPFNPKPEDIEDIVDLKFEECILPPKDLSEFYDKLA
                     DEYDSDVGTEEMMSFMKSKRKWVMKHCKGDVLEVASGTGRNIEYFDPTAVSSYTFLDA
                     SKKMMDVCYDKFHEKWSKFKKVKFVVGKAEELVELSTTRKSVDSKAFKYDTIIETFGL
                     CSHQDPVKALKNMRELLKPGGRIVLLEHGRGKYDFINDILDKRAHKHSEKWGCRWNLD
                     IGELVDESGLEITEEHRAHLGTTWMIVCKRPEDVLETEEMTFSERYLFPRRTNTDSSA
                     PKPVSSS"
     gene            <754933..>755829
                     /locus_tag="C5L36_0C03530"
                     /db_xref="GeneID:40384208"
     mRNA            <754933..>755829
                     /locus_tag="C5L36_0C03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466030.1"
                     /db_xref="GeneID:40384208"
     CDS             754933..755829
                     /locus_tag="C5L36_0C03530"
                     /inference="similar to AA sequence:RefSeq:NP_010588.1"
                     /note="PKUD0C03530; similar to Saccharomyces cerevisiae
                     YDR302W (GPI11); ancestral locus Anc_5.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321890.1"
                     /db_xref="GeneID:40384208"
                     /translation="MASRKSKRVSFDNSSKIVEITEENESEFSESVTISKDEFDPDSM
                     NIDLTTGKKRRNIGQSSEKSSSNGGGDSKEEFTVPLLTTSWALVPYHLLLLLFNIVVD
                     GTIMEDVREGVQKAFYGLSVLSLIFAVLVNEAVKGEKTKNARSDGPTNFEFFYVALSF
                     PLSIMLSVPVYLTFLLFGAPAGRLNALTFYLASHVSVIAFYPLLNVYKFTDKNAKKIW
                     WKLLTFQVANWKFNQVYCTAIGTLVGCWLGVLPIPLDWDRDWQDWPITVLFGAYAGGF
                     LGGLASYAYGCYVYSKMKSRIS"
     gene            <756160..>757179
                     /locus_tag="C5L36_0C03540"
                     /db_xref="GeneID:40384209"
     mRNA            <756160..>757179
                     /locus_tag="C5L36_0C03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466031.1"
                     /db_xref="GeneID:40384209"
     CDS             756160..757179
                     /locus_tag="C5L36_0C03540"
                     /inference="similar to AA sequence:RefSeq:NP_010574.1"
                     /note="PKUD0C03540; similar to Saccharomyces cerevisiae
                     YDR288W (NSE3); ancestral locus Anc_5.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321891.1"
                     /db_xref="GeneID:40384209"
                     /translation="MSRAKRSALNGEISGELSDLDISRSERNSLKRQRIESSSNSVKE
                     DAARRIAIATGRVMLGLSSRNQALNKTIISKIIETENERGTGLQFKKNVLPILSNMMF
                     DTFRYAVEELPSKKVLMSSISVKEKTKGETKAGPLSDGFILTNNISASLRALNYTFMA
                     KNTRNIGKSIKGMQTPKENMSKLKVYGEGLPKPTSMIVQNGFKLLIICVIILHNNNIL
                     QSDLTNVLKTKFGLSFKEKEQVSILGNQTLSEFIAMLSKQDYIERMLISNTDGSGGIS
                     QRSLNSKNAKHDDNSLVLKLGRRCLAEWTMEEFVGIFRQLMQSQWTDQLQEAAIFTVS
                     NIWKS"
     gene            <757415..>759595
                     /locus_tag="C5L36_0C03550"
                     /db_xref="GeneID:40384210"
     mRNA            <757415..>759595
                     /locus_tag="C5L36_0C03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466032.1"
                     /db_xref="GeneID:40384210"
     CDS             757415..759595
                     /locus_tag="C5L36_0C03550"
                     /inference="similar to AA sequence:RefSeq:NP_013876.1"
                     /note="PKUD0C03550; similar to Saccharomyces cerevisiae
                     YMR155W; ancestral locus Anc_2.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321892.1"
                     /db_xref="GeneID:40384210"
                     /translation="MGSRFEALDGDDVLVSEQVIQPHNVPKDRHKLRKRVSLICSSIA
                     ALASGTPYLYGVYSPQLINRCGFTAIDSSYLSFGGNIGSSIGGFLAGLIIDAFGVKAG
                     LLLGAFLQFSGFFTLYINFKNEWHYFIQLLFAMCSIGFGSVLSYFATIKVATLNFPNH
                     RGLANAFPVSSYGLAALFYAFVSTFWFTDNVEGLLRFIACFSGILISISSIFICIYEN
                     GDEGDEDDEQIDTGGHYNTMDSSAYNEEDERRGPETSKNEMEVGIEYLLKGHRGSFAQ
                     INNFNRSDSSSSLFSDMTGASSMVSTSASSSSRLPPNFTTSATNIPIQNSSNFIRSDS
                     LNKKSVSSSEVSSSPFDLRVQRNHYRAGSFKLSSSINNSPRNARGFGSFSNLKQFKDN
                     PNVSEDLSLSIERSASSTPETNQSSNILPQSLCEIQSSPMASDSDVGGAKPHGLYDAS
                     QFVQSNTTQKASPNKRKRHKRKTTTKEHITQLFRNQLFLSHYILNAFYCAIGQVYIFS
                     IGFIVRAQVNYYNMHKPSEITFILQLAEKLTVPHRKENATPSNLAVAYQALQVSIISF
                     SNFLGRLISGPTSDLIHKKMKKSKIYVLAVSTIIMGCGQVSLVLSNKLDLLSLISFSI
                     GLAYGAIYGTMPSIVADSFGAKNFATTWSLLGTGPITIFLLLSNYFGSIYDENSEWGY
                     IGDDRIKMCLLGKNCYSSVFTLTSLICLMIFIFYNVLIQYSKKQ"
     gene            <759962..>763978
                     /locus_tag="C5L36_0C03560"
                     /db_xref="GeneID:40384211"
     mRNA            <759962..>763978
                     /locus_tag="C5L36_0C03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466033.1"
                     /db_xref="GeneID:40384211"
     CDS             759962..763978
                     /locus_tag="C5L36_0C03560"
                     /inference="similar to AA sequence:RefSeq:NP_010587.1"
                     /note="PKUD0C03560; similar to Saccharomyces cerevisiae
                     YDR301W (CFT1); ancestral locus Anc_5.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321893.1"
                     /db_xref="GeneID:40384211"
                     /translation="MDVYNQFVNPTTSLLSLYCNFVSKDEDNLIVSKGNLIQVFKIVD
                     VSSKFDSIKDEKIDLSGYHAISEENYKLILVTEYTLNGVILDMHRFRTTGENVDYLLI
                     STEPAKISLVKWNPADFTVSVVSLHYYETVLNSLLMEKLKDSVVSHRTDPNFGCSIMQ
                     VEDLVVFLPFVQVDHDMELNDDYDPLENSDKTNELSKNDLFEESFIVNASTLHHGLKN
                     IIDIQFLNSYRSPTLAILYAPDSETWAGYLPKRKDNLKLIVLSLHLKEKSANVIIEIN
                     SLPYDLYRIVPLDDPINGLLIVGANEIIHINSLGSPKGIYVNEFYCLSSSFPLKSQQE
                     LNLFLEHSAVAQVGKNEVLLVTKDGEFYTLIFDEIGGVSNLNRIVSNSPSNYADISVN
                     SILSIETIPHKNMVFMCSRGSDSVLVKWEYRLQPTTSSDNHDGDEIVDTDDDFWLYND
                     NGAQNNDELSTSLTNCKFTMIDALINTGPLSDFTFGYSSTEKKLHGLTNPNYKECAIY
                     GTSGLGKSGSVSIITPTAKPLIKSSLKFSHASKIWTINSHDGETKYLIITDQKMSTTQ
                     IFEVSKDYQEYKTKAFRGKHFSVQFGSISINEKIRPVQIIAHEVLIYNLSFGFICSLK
                     VEKEVNLSIIYDNYIVLLMKTGEIEILEYDDNSKELARMDLPALLNFQIFTNAWITKS
                     DLLTWAVPAKKRDAVGELVDVKKDIRNEEVLFWLVTADNRLLVFRKEHLEKVYEFEGI
                     HNMPEYLQLTAMNPNYEADVDPILKQCIFTQIGDKYDREDYMIILTFGGEVIMYQLFY
                     DTQKKYFKFMKANDLFQLPITGAPGNSYSFATKVERNLFKIDDVGGSSVIMVSGALPF
                     IIYKQYNSVPRMFKFTSMPFLYFAPYSTNICSDGIITIDDKKSCRMVQLDFEYDYSNK
                     LPIKKCKVGETIDKIAYHEDANVFLVSTISTENYNLLDEEGEDTIDHNRDLKKPAQNY
                     RGAIKLLSPGNLTVIDTLDLDENEVCTALNVSNLRINGTEGKRAQIFVGTGIYQNEDV
                     ATMGAYKYLDIINVVPEPGFPEAKHKLKLLSTETYKGPILDVCEVDGRFAVIQGQRML
                     VRQLKGESNSTPVAFVDTSLFSSKVKAFENFILIGDSYQSVSLHGFEAEPYRMVSLGK
                     DEHNMKLNECEFIVHNQSMFILASDDNRVLHILQYDPYDVNSLKGHKLLRRTALRTNS
                     YTTKMLRKDRREACFSMVNTLPIRKDVDLGFEVIGCNIDGSIYKVSPINEYQYRRLYS
                     LQNQIADKEAHWLGLNAKMNAVGDLQDEMNVIKRPIIEYRLLTRFSSMAEDKKKMFAI
                     KLGKDALVDVYRDMISLQ"
     gene            <764491..>765501
                     /locus_tag="C5L36_0C03570"
                     /db_xref="GeneID:40384212"
     mRNA            <764491..>765501
                     /locus_tag="C5L36_0C03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466034.1"
                     /db_xref="GeneID:40384212"
     CDS             764491..765501
                     /locus_tag="C5L36_0C03570"
                     /inference="similar to AA sequence:RefSeq:NP_010601.3"
                     /note="PKUD0C03570; similar to Saccharomyces cerevisiae
                     YDR315C (IPK1); ancestral locus Anc_5.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321894.1"
                     /db_xref="GeneID:40384212"
                     /translation="MVRREQTDFMDGCVAFSEDGETSSPPRNHMLLTLDVLHDLEFIG
                     CGSANAVFAYWGDRDDLKHKIIRVRLLHSEICTTVIYNALVSGKFDSLRSYLVACSIL
                     QVDPILLQKLEDFGRKKVANFNLNLEEKYVLLMDNIFSYPLSRYNCYRLSKYHTFFVE
                     KGNNETILEFKPKWLYTLPENHKSCRNCLNAMYKGQKFNPCHLKLLQKNGIDIWCNEV
                     QQELNRRGINKSVKNDLRETIQRNYNLFETLYALQNKSDVHKLLLNLKSEEDVTEELK
                     FEMTIRDVSLLMKLNDKKVFVIDLDEKPATKWIRWKEHEAEFEDKYSEDLGLQCSFEA
                     NN"
     gene            complement(<765466..>766458)
                     /locus_tag="C5L36_0C03580"
                     /db_xref="GeneID:40384213"
     mRNA            complement(<765466..>766458)
                     /locus_tag="C5L36_0C03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466035.1"
                     /db_xref="GeneID:40384213"
     CDS             complement(765466..766458)
                     /locus_tag="C5L36_0C03580"
                     /inference="similar to AA sequence:RefSeq:NP_011934.1"
                     /note="PKUD0C03580; similar to Saccharomyces cerevisiae
                     YHR067W (HTD2); ancestral locus Anc_5.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321895.1"
                     /db_xref="GeneID:40384213"
                     /translation="MIRSFCSHISQRFTGKLKLALKLSDEEIKEFKSRLLNSSWEIKD
                     EFVSTLPAKQIYVTTQSLLDRSCPLFMESLNKNSDQTHTVNLNEMFPIGSGLPLAYSL
                     GYCNPLSNESELGIDGYDNYHAPCDKKVEFFKRRMWVNGSFAYNHSNPLKFGDKLNFT
                     ETVKRVKVLKETGTIFAEYKRCFNNQNGSCIVEMRGLGYLADLYSSYKQRFSTIENPD
                     KSITVVPTLLTNFRMSAVTFNSHQIHYNPEYAKSIENYPDIVIEAPLLISLASQFWLN
                     YNTDIWVKSFKYKISAPSFVNKPLTISYKKLNGVTKLWITNQNSVVCFEATLQT"
     gene            complement(<766691..>767668)
                     /locus_tag="C5L36_0C03590"
                     /db_xref="GeneID:40384214"
     mRNA            complement(<766691..>767668)
                     /locus_tag="C5L36_0C03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466036.1"
                     /db_xref="GeneID:40384214"
     CDS             complement(766691..767668)
                     /locus_tag="C5L36_0C03590"
                     /note="PKUD0C03590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321896.1"
                     /db_xref="GeneID:40384214"
                     /translation="MPLIQKIQARPISFHSIKSLFKSTGSTASTELEKPLTSLPNATG
                     IGAFAEPVTYQVLGSSSNLLNIKLPKSSILNLRYSSSNQKIIAMNGHINSLCLEISKT
                     ADSGLIFQRCFNEKEAMSFLIAPKAHNSCFAVAENGESNWILKKSSLLSWSGPGIRPV
                     SPKNNYSYVQMIGSGSFVISCPGQLIQLDLKEGENIQVNTKSIVAYTHSRGDDGSFNE
                     LEGNVKSIVDFSVGRAPASLRFNWVLSYLKIPESVSTDPNFKMILHTLHSLTNYIKTA
                     ILKLKSLIPYHRSDVFVELKGPKTLFLTNSVHVNDRVLTKAEINRLTYT"
     gene            complement(767968..768039)
                     /locus_tag="C5L36_0Ctrna5F"
                     /db_xref="GeneID:40385072"
     tRNA            complement(767968..768039)
                     /locus_tag="C5L36_0Ctrna5F"
                     /product="tRNA-Phe"
                     /note="PKUD0Ctrna5F; codon recognized: UUC"
                     /db_xref="GeneID:40385072"
     gene            768321..768392
                     /locus_tag="C5L36_0Ctrna6F"
                     /db_xref="GeneID:40385078"
     tRNA            768321..768392
                     /locus_tag="C5L36_0Ctrna6F"
                     /product="tRNA-Phe"
                     /note="PKUD0Ctrna6F; codon recognized: UUC"
                     /db_xref="GeneID:40385078"
     gene            768400..768471
                     /locus_tag="C5L36_0Ctrna3H"
                     /db_xref="GeneID:40385067"
     tRNA            768400..768471
                     /locus_tag="C5L36_0Ctrna3H"
                     /product="tRNA-His"
                     /note="PKUD0Ctrna3H; codon recognized: CAC"
                     /db_xref="GeneID:40385067"
     gene            complement(<768649..>770751)
                     /locus_tag="C5L36_0C03600"
                     /db_xref="GeneID:40384215"
     mRNA            complement(<768649..>770751)
                     /locus_tag="C5L36_0C03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466037.1"
                     /db_xref="GeneID:40384215"
     CDS             complement(768649..770751)
                     /locus_tag="C5L36_0C03600"
                     /inference="similar to AA sequence:RefSeq:NP_010457.3"
                     /note="PKUD0C03600; similar to Saccharomyces cerevisiae
                     YDR172W (SUP35); ancestral locus Anc_8.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321897.1"
                     /db_xref="GeneID:40384215"
                     /translation="MSEQKDQTPQNGQFDQNNLAQGMQNMNLNAGTPAFNPNAIPTFV
                     PGVGFQAPAFDANQQLPQQQQYQNYNNYNNNNGYTKNYNNRGGYNNYNNYNNYNNRNN
                     YNSRNNYNSNGYNNYNNNNNNNNYNNNYNNNYNSGYQPQEQQEQSGSQQMSFEDYQKQ
                     QQEKLNAAPKKKVLKLNLKSSTVKIPSKPNSEEPKTEKVKEDTIEKEKVQEDLQAKKT
                     EETKKNKESKAEEPKKVEPTKKAETMKKSDSVAKASAKEVEDQIDPAIVNDMFGGKEH
                     MSIIFMGHVDAGKSTMGGNLLYLTGAVDKRTVEKYEREAKDAGRQGWYLSWIMDTNKE
                     ERNDGKTIEVGKSYFETDKRRYTILDAPGHKLYVSEMIGGASQADVGVLVISARKGEY
                     EAGFERGGQSREHAILAKTQGVNKIVVVINKMDDPTVGWSEERYNECISKLSLFLRGV
                     GYAKEDITFMPVSGFTGEGLKERIPKEHAPWYNGPSLLEFLDNMPLAQRKINDPFMLP
                     VSGKMKDLGTVIEGKIESGHIKKGQSLLLMPNRTNVEVLTIYNETEAEADSAFCGEQV
                     RLRLKNVEEEDVSVGYVLTSTLHPVHTVTKFEAQVAIVELKSILSSGFSCVMHVHTAI
                     EEVTFTQLLHKLEKGTNRKSKKAPAFAKQGMKIIAILETTEPVCLETYDDYQQLGRFT
                     LRDQGQTIAIGKVTKLLE"
     gene            <771179..>773047
                     /locus_tag="C5L36_0C03610"
                     /db_xref="GeneID:40384216"
     mRNA            <771179..>773047
                     /locus_tag="C5L36_0C03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466038.1"
                     /db_xref="GeneID:40384216"
     CDS             771179..773047
                     /locus_tag="C5L36_0C03610"
                     /inference="similar to AA sequence:RefSeq:NP_010746.1"
                     /note="PKUD0C03610; similar to Saccharomyces cerevisiae
                     YDR458C (HEH2) and YML034W (SRC1); ancestral locus
                     Anc_5.577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321898.1"
                     /db_xref="GeneID:40384216"
                     /translation="MDAQIYLADDFDISKLTVPNLRSVLVEHEVPFPSNANKQELINI
                     FNKHIKPRALQILKKYQTEPSSEEICEAVHEDKHGADSSKSEKSIPSKRHSEATSKKA
                     KKKIRKTNTELLDSSSSFLGIEKFEPNENDDIFNNSIDTSTILRKTRFADKKPASTKD
                     ILSHFDKSIPSSKSFNDSVSSDSKTRSHSPVERKDELNIIEKVKESRREAENNIHNSQ
                     GNEFLLIEDVETEFGDDLVEEGELREEVPLTINFPGESEVNPHKILEGPIKSIKEVVS
                     VNNNESLEKVKEEVLTEGNKLVSTIQVEPLGSPETNNSSSDKNLTTIDINEEASNKKN
                     ADSNQTTQSEWKDKHVVNEHGRGEEVEKLETIQTVGNINNGYRTNRIPILLLILFYGI
                     TVVNLLIPTLLLLCFREIKLNTGYCGFDKPSKTLDLWGKLPDAYTSKLLNLKPYFVQV
                     ETLISDSVHFQCSECPPNSKCQFNTLQCDYGYVKTYPLKSVFGLIPLQETCEFDFLHE
                     QKMHYLSEYTIKYLRRHHDQPLTLEELHDYIKSTKSSYISSSDFEEYWDKFVKYELLH
                     DEQVTIDAQTNVVTLTHKVPSEFYTRTYGVDRKKRSKNLFKKHTPTVDFRDYYTKN"
     gene            complement(<773185..>774681)
                     /locus_tag="C5L36_0C03620"
                     /db_xref="GeneID:40384217"
     mRNA            complement(<773185..>774681)
                     /locus_tag="C5L36_0C03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466039.1"
                     /db_xref="GeneID:40384217"
     CDS             complement(773185..774681)
                     /locus_tag="C5L36_0C03620"
                     /note="PKUD0C03620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321899.1"
                     /db_xref="GeneID:40384217"
                     /translation="MIEHQNHASTLSSLRNNFKYSFVVQWIYLLKHVIKLADAFDVEN
                     FEEELLGIAPPTFLNSLKSKLILFLKNQKIVSIDMEFDFFVDQIYKDYNLLELNGLEP
                     ENAGGHDDNGNENKDGANYLNDNDGDDDDDDDDDDDSPVITYSKLPLSEKIDVLYNLI
                     KLANTKSYSNFRKTVDKFEKPQFDLKITPIYETVKGNTKEEYIILQDARVYRRKWEFS
                     KLEIPVEKSEYNEKVKNPYTDLAKLSPKLVEWTCLTTGIYQYDNYIKDLRKSFGKKTS
                     SDEYALSQALEANIDFIIQHDLKKRKQSAQRKREIEMQMLMANRKRSSRLEEKERRKK
                     EEEAVRMKELEVLKQQAAEMRAAKRQKLKESMYSTNNDGEINTALSREERLRKRHETT
                     PLDNSEQDGAENHRDNGEINTESNADSSLVEIQDPNVQESPQQNESIKDTSSSETPAL
                     ADNPTQITQLIPQSTNSIGSIQNDKVLGGADTETKRTNNDYTLSPRST"
     gene            <775641..>777626
                     /locus_tag="C5L36_0C03630"
                     /db_xref="GeneID:40384218"
     mRNA            <775641..>777626
                     /locus_tag="C5L36_0C03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466040.1"
                     /db_xref="GeneID:40384218"
     CDS             775641..777626
                     /locus_tag="C5L36_0C03630"
                     /inference="similar to AA sequence:RefSeq:NP_010264.3"
                     /note="PKUD0C03630; similar to Saccharomyces cerevisiae
                     YDL020C (RPN4); ancestral locus Anc_3.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321900.1"
                     /db_xref="GeneID:40384218"
                     /translation="MATTLSRTNTEVMDDYLPLTTQITNQSDISQVQAQSIQPNQSSQ
                     QHSSQNDFYQYISLPNMSQDSLQKFSENEEPINPISEAAAPALTRNTNNNNMSNGNDV
                     HDITNRSNFGNIYNPYASMDSYTVPLTADPLNPEIMNLTTDESNYNNEDIQIVNPRQT
                     TTNPTPSNFNNSINQNINQSEKIEYDDDILMVPQDNYFVYDQQDTQNIPELMELELQN
                     KQFPQSNELNIFKANDVFYEFSDEEDEDDEVDLQNKLDDDEMEMKMDENDDDEELDEL
                     DKFQKSPFSEDRDNSLENHATNYIKYNGNWNASSNNYGYDNLNSIYSLTVPNQLNSIS
                     ANQNGISVSGISSPLTSFEDVDLYATDDTKDSSTNNVSNSFNVTDDELHQIHNHNTFN
                     MRHFDDYEEEEEANEREIHDHDDDEEDEEGEFYDDEYAIDIDMDSDLHTPVFKDRKES
                     VTAESRPFLRKERRSSSLRTSSRPKRLSRKSAFASLMPHQAPSLRKPRVSSHSHSENC
                     RVEYDENKNEEHICTIPNPKTGKPCLKKFSRPYDLVRHQNTIHASKRSFYRCMFCEDD
                     LRRKHGLDSINEVVIACKYRDTQFSIDNSQSHTASSHNVKKVKTGTVNNSGYLSNKTF
                     SRCDALTRHLRFRHGLNNNQLVDAMDFAKKNVEYYDN"
     gene            complement(<777894..>779129)
                     /locus_tag="C5L36_0C03640"
                     /db_xref="GeneID:40384219"
     mRNA            complement(<777894..>779129)
                     /locus_tag="C5L36_0C03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466041.1"
                     /db_xref="GeneID:40384219"
     CDS             complement(777894..779129)
                     /locus_tag="C5L36_0C03640"
                     /note="PKUD0C03640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321901.1"
                     /db_xref="GeneID:40384219"
                     /translation="MMPMTLPQGMTMFPVFIVLASIAFALYKIIEKAANNGKVTNQSF
                     SKTYIPVSVKDANNKHRTVGHWKAEIFEYPAVEEFKNWSIKDTPPLPYRAFKHTYFFT
                     MGIRSMEWNSWIEMDNEWMKFHNRKLERLEKRRSELVGTQDDVWDAAIELLMEFREYL
                     PKRYPTLFTKTEKGLNNLVTGEVFEFNNIPKSEFKKDPMEMAALMTQDDLAILKENED
                     GQYILKGGAIMLAGFWRLKDKINLPLSAIHTTGDVPKYNEKLKTPMEKFFTRLTCDKP
                     VVRNNYFIQTDDDLAWSSSIGSEDIPDVGWNTAEPANDVNMIYYRSERQSVRRLPLTG
                     CIVFTIRTYFLPITKMCLEPHVPKRLLDGILSWDDDVRRYRGYEKFKDVLIPYLEEQT
                     KLQEERGITVVNEPNSYPF"
     gene            complement(<779651..>780439)
                     /locus_tag="C5L36_0C03645"
                     /db_xref="GeneID:40384220"
     mRNA            complement(<779651..>780439)
                     /locus_tag="C5L36_0C03645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466042.1"
                     /db_xref="GeneID:40384220"
     CDS             complement(779651..780439)
                     /locus_tag="C5L36_0C03645"
                     /note="PKUD0C03645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321902.1"
                     /db_xref="GeneID:40384220"
                     /translation="MFKSLLNFFNPFHGVPGGTTKETAALSKSHEKNEKIIDQPPNKD
                     KRLNDTAEPGKEDIITSIPERPTLSVCEIVNEDLVLTDDGHEIPNTESELTDKSEKID
                     KSNDSSEKRLKRGDNLDQKVKNGYPVDSEKVPDHETQQTSGKIPGKLSKEEADDSKSD
                     SMDESDTGIKHIKIQDIATQNKIEENPNETKKQKGKQKKVGSDIARKRARHTKSVKDI
                     AEEKYAKKDETGAAILPPAKKRKTMQSIRKLAKLRKNVDNPVKH"
     gene            complement(<780797..>781507)
                     /locus_tag="C5L36_0C03650"
                     /db_xref="GeneID:40384221"
     mRNA            complement(<780797..>781507)
                     /locus_tag="C5L36_0C03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466043.1"
                     /db_xref="GeneID:40384221"
     CDS             complement(780797..781507)
                     /locus_tag="C5L36_0C03650"
                     /inference="similar to AA sequence:RefSeq:NP_014738.1"
                     /note="PKUD0C03650; similar to Saccharomyces cerevisiae
                     YOR095C (RKI1); ancestral locus Anc_2.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321903.1"
                     /db_xref="GeneID:40384221"
                     /translation="MSDLVEKSKKLCAYTAVDKNLKPSHKVIGIGSGSTVVYVAERIG
                     QLENKNHYVCIPTGFQSKQLIIENGLRLGGLEEYPTIDIAFDGADEIDTGLNCIKGGG
                     ACQLQEKLVADSATEFIIVADDRKNTGALGKGWKKGIPIEVIPNAYAKISKELRELGG
                     NPVVRSGAPSKAGPAITDNGNFVIDCDFGEIEVSKVEALNSKIKAMIGVVETGLFVNM
                     AKKAYIGNADGSVTTLSV"
     gene            <782137..>782703
                     /locus_tag="C5L36_0C03660"
                     /db_xref="GeneID:40384222"
     mRNA            <782137..>782703
                     /locus_tag="C5L36_0C03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466044.1"
                     /db_xref="GeneID:40384222"
     CDS             782137..782703
                     /locus_tag="C5L36_0C03660"
                     /inference="similar to AA sequence:RefSeq:NP_014739.1"
                     /note="PKUD0C03660; similar to Saccharomyces cerevisiae
                     YOR096W (RPS7A) and YNL096C (RPS7B); ancestral locus
                     Anc_2.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321904.1"
                     /db_xref="GeneID:40384222"
                     /translation="MSAAAKVLNPNPTELELQVAQAFIDLETNSDLKAELRPLQFKSV
                     KEIEVSGNKKAIVVLVPVPSLAAYHKVQIRLTRELEKKFPDQHVVFLAERRILPKPAR
                     GSRLGQKRPRSRTLTAVHEKILDDLVFPTEIVGKRVRYMVGGNKIAKVLLDSKDSTNI
                     DYKLETFQSIYQKLTGKQVVFEIPSKTL"
     gene            <783034..>786867
                     /locus_tag="C5L36_0C03670"
                     /db_xref="GeneID:40384223"
     mRNA            <783034..>786867
                     /locus_tag="C5L36_0C03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466045.1"
                     /db_xref="GeneID:40384223"
     CDS             783034..786867
                     /locus_tag="C5L36_0C03670"
                     /note="PKUD0C03670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321905.1"
                     /db_xref="GeneID:40384223"
                     /translation="MYVLAVSLKFFFFFKFHLHKKLQIIYILQIIYILQVIYTLQVFL
                     HAMFWRKHLTVLTCPGSRIECIGVSHTNVFNHRSFCSLKPNKNNKSVHKSNESSTKGH
                     DSVRTDFKTSIIIPSTSLNIGLFEFKKQFSLLNDGTIPSRKLGEFKESIDKLILQATY
                     DIDLQLRSIKPIIVHSLLNLPDDDFVELLIYLLSKGITILDNQVSLRVTEIMRSGNLT
                     LKYKIIFGVSKKDVNLLSFRASLPPLYRKVMQKSFSPKVIQSIITDVYLPLRDRSKIL
                     EYLGILEDIMENTEYKRFADSVKCVLFDLKIPIAAYKMESISNNKKFDGFLKYLLSLP
                     STLLDIMFEKFILSNFEKVTSKTLFLYISLVYGDVSKCFPSLIGYSDIESVNYEGHKS
                     RSTIAKDTQQIPINIYYLFFRKTISELRVQVLKNLIHDVSILGPTNEITKCFNFALFE
                     LAIELKDTKKNFHNYAMDYLSHTDFRPPRFAALPIIDLKSYYSNDTAQLLNIMDTYGS
                     DRFFTLDTDDVKEMFQDLSNPEKDQFIHILMKHKFSLPDGSIMEQWIEEKPERIQYLV
                     PDDCDVNSIKKIISLLTPVQMFRLITKYNENFPKHTEILKVLESFNYNIEYHYAALSA
                     LKIPNAKAYTQLKTLSDYLHAEHLIDKVTEEQRLRLYNIFIKNCIQSNFASGIICAST
                     IVPSYRDQTDTIVKLTSYVKPKRLLPVSGKHKLPVDIFMVALKSSLRNAESDFNIIYW
                     YKLCMSYARSIEKVEEKVRFRQEVFGLLQSEIVTKGSSPMILYKLYSYAESDAFSPDW
                     KLKVDMSETLEKYFKESLLKNDKKSEYSIVETLSTVAKYESDITLSADLISSLFGKVP
                     DKEKIFFIKLLRNMSHTVPYVEKIGSFLHSEFRKKNPDVYDLLGLDISNPLINSPTAK
                     RTKWMKFDNRYFSPLIEQFMQRFISKEKNISIKGMMQDSLGYMDYSKDTIKCLKFYEL
                     YHSVFTFRGKTCDLKGCDIDEFVSECKQVFNGSEDILPPYLLEPFMLHFLYTRSLSYD
                     LQTMVKMIYIINNGDANFGKSGLWNIINSDEKQRLEAYFTEVPRCFDTFVESNVVLLY
                     NILFSICKNSQDLSTSELMYIIDFSEYLLRKPFMSKKAKFNIMNCVFILVGKHSDLLS
                     IFYKRMITILPEYKVSKLLITDLLYSATMNDFVNIDSILTYLIKSNDNVLMNQACESV
                     IKRLMEEDQNVIAQELYVKYTQLVPRFKIKDIDQNMSWAKASKPNIHVDSGSEVSMQI
                     NRFKVKLYDYEKLTK"
     gene            complement(<786933..>787997)
                     /locus_tag="C5L36_0C03675"
                     /db_xref="GeneID:40384224"
     mRNA            complement(<786933..>787997)
                     /locus_tag="C5L36_0C03675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466046.1"
                     /db_xref="GeneID:40384224"
     CDS             complement(786933..787997)
                     /locus_tag="C5L36_0C03675"
                     /note="PKUD0C03675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321906.1"
                     /db_xref="GeneID:40384224"
                     /translation="MAAPKIFDKFNKIRTRESSPIRRTEVPITSSSPVSTPRKVRSHT
                     NPNAKLIPIKKNLGLIPTLDSFSDSSNEGKRHMNDVAIEVKMDNQNVHPMDEPLVLRN
                     GKEIYPSINSSVDNKEKSDLMVILAGLLEAFTGIVIRFWNSDLHFKITISEGKPLKVH
                     IPSLVYSLIGFKLIHTLFFKDSNQSVRITQTPTNYGGFKAPFVIIMVIVIAGWFFSQN
                     LSREQSRSTKIPHKSATSAMSNSSINSTDIEDEITLVDSLGSKKFSENELWDNKTPDI
                     TPPTSRKNSFEMKLDTLLAREKIKIDKFSTPVQCRREARHKTTKTLNLNLPTNYKKRK
                     SNEFDEMTIQAREQLLKAFY"
     gene            complement(<788483..>789400)
                     /locus_tag="C5L36_0C03680"
                     /db_xref="GeneID:40384225"
     mRNA            complement(<788483..>789400)
                     /locus_tag="C5L36_0C03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466047.1"
                     /db_xref="GeneID:40384225"
     CDS             complement(788483..789400)
                     /locus_tag="C5L36_0C03680"
                     /inference="similar to AA sequence:RefSeq:NP_014743.1"
                     /note="PKUD0C03680; similar to Saccharomyces cerevisiae
                     YOR100C (CRC1); ancestral locus Anc_2.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321907.1"
                     /db_xref="GeneID:40384225"
                     /translation="MSEQKIQSNFWTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM
                     IKQGRLARKYDGIVECFSRTAKDEGIVSFWRGNTANVIRYFPTQALNFAFKDKFKKMF
                     GFKKEEGYWKWFAGNLASGGLAGGTSLLFVYSLDYARTRLANDAKAAKGNGERQFNGL
                     FDVYKKTIASDGIAGLYRGFLPSVVGIVVYRGLYFGLFDSLKPVLLTGSLENNFLAAF
                     LLGWLVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAFDAFSQIVAKEGVKSLFKGCG
                     ANILRGVAGAGVISMYDQLQVILFGKKFK"
     gene            complement(<791271..>792255)
                     /locus_tag="C5L36_0C03690"
                     /db_xref="GeneID:40384226"
     mRNA            complement(join(<791271..791839,792222..>792255))
                     /locus_tag="C5L36_0C03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466048.1"
                     /db_xref="GeneID:40384226"
     CDS             complement(join(791271..791839,792222..792255))
                     /locus_tag="C5L36_0C03690"
                     /inference="similar to AA sequence:RefSeq:NP_012133.1"
                     /note="PKUD0C03690; similar to Saccharomyces cerevisiae
                     YIL133C (RPL16A) and YNL069C (RPL16B); ancestral locus
                     Anc_2.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321908.1"
                     /db_xref="GeneID:40384226"
                     /translation="MSEFQPVVVVDGKGHLLGRLASIVAKELLNGQKIVVVRCEEMNV
                     SGEFFRNKLKYHDYLRKSTNFNHRRGQFHFRAPSRIFYKAVRGMIPHKTARGAAALER
                     LKVFEGVPPPYDKKKRIVVPQALRVLRLKPGRKYTTLGKLSASVGWKYDSIVSTLEDK
                     RKARAAEYYAKKLVAAKKLTAAKASVAESEASQKLAALGY"
     gene            complement(<792763..>793608)
                     /locus_tag="C5L36_0C03695"
                     /db_xref="GeneID:40384227"
     mRNA            complement(join(<792763..792915,793000..793070,
                     793144..793420,793519..>793608))
                     /locus_tag="C5L36_0C03695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466049.1"
                     /db_xref="GeneID:40384227"
     CDS             complement(join(792763..792915,793000..793070,
                     793144..793420,793519..793608))
                     /locus_tag="C5L36_0C03695"
                     /note="PKUD0C03695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321909.1"
                     /db_xref="GeneID:40384227"
                     /translation="MSHDPHSRINGHVSLVEYNHHGGVTHYASNYTMRYYLKELREKP
                     SYKVVHLSSILFDVERLKTLREEMTVDDSLMSNIQVAQTLSLSQMLITLKQLKYIPQC
                     IILEDLDEAFNVSMFEDQRKSGRIMIEIIKHIRDISQNHLTTVIITQRKPRQSIGLHR
                     VSSLLRNMMDNQILIDGDNVQIDSIYDDIDVFLNAK"
     gene            <794441..>796177
                     /locus_tag="C5L36_0C03700"
                     /db_xref="GeneID:40384228"
     mRNA            <794441..>796177
                     /locus_tag="C5L36_0C03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466050.1"
                     /db_xref="GeneID:40384228"
     CDS             794441..796177
                     /locus_tag="C5L36_0C03700"
                     /inference="similar to AA sequence:RefSeq:NP_013658.1"
                     /note="PKUD0C03700; similar to Saccharomyces cerevisiae
                     YML054C (CYB2); ancestral locus Anc_4.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321910.1"
                     /db_xref="GeneID:40384228"
                     /translation="MLLRSLNSSARCVKQTTRTKVRYLSHVSGASMAKPTLKNNSRES
                     NKSRNYLIAAVTALAVSTSIGVAVHVKDPLYNDATGSDSPRSISVDEFVKHNSQNDCW
                     IAINGKVYDFTDFIPNHPGGVPPLVNHAGYDGTKLYEKLHPKGTIEKFLPKDKFLGVL
                     DGEAPKLEADYLVDDDEQERLDYLNNLPPLSSIQNVYDFEYLAKKILPKDAWAYYSCG
                     ADDEITMRENHYAYQRVYFRPRICVDVKEVDTSYEMLGTKTSVPFYVSATALAKLGHP
                     DGECSIARGAGKEGVVQMISTLSSMSLDEIAAARIPGATQWFQLYINEDRNVAKGLVK
                     HAEDLGMKAIFITVDAPSLGNREKDKRLKFVNDTDVDLGDSADRNSGASKALSSFIDA
                     SVSWNDVKAVKSWTKLPVLVKGVQTVEDVIEAYDAGCQGVVLSNHGGRQLDTAPPPIE
                     LLAETVPTLKRLGKLRPDFEILIDGGVKRGTDILKAVAIGGQDVRVSVGMGRPFLYAN
                     SCYGEAGVRKLIQNLKDELEMDMRLLGVTKMDQLSSKHVDTKRLIGRDAINYLYDNVY
                     SPIETVKFNNED"
     gene            complement(<796321..>797469)
                     /locus_tag="C5L36_0C03710"
                     /db_xref="GeneID:40384229"
     mRNA            complement(<796321..>797469)
                     /locus_tag="C5L36_0C03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466051.1"
                     /db_xref="GeneID:40384229"
     CDS             complement(796321..797469)
                     /locus_tag="C5L36_0C03710"
                     /note="PKUD0C03710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321911.1"
                     /db_xref="GeneID:40384229"
                     /translation="MNVNEYFIFMRDSRRSNETRSLDRKSGNLLGMNIPSELMTSDIV
                     FARRITDEDLEQEFKSMDCLRLKSDKDTISEEEAKLDPKDIHICRWDDCSTQFREMDE
                     MVNHINTNHFKQPNTDHSCKWGNCPRYGTPQHSRFALLSHIRTHTAEKPFYCLLPECL
                     KAFTRADALLKHLKAVHNINGNSLQDAYENINRELIHEIHEFQRENDFRVDFESSGKK
                     IAFDIEKRVRNELIQDHNKLINNFNKLKRQRDISDDHDDEVEELIADHYKIKEIKFNP
                     SMVIEGTQKIKESLMSYSNKKENAAKGGKVVNVEDIGDIDSMTVEQLEQTIQKQTDYY
                     ARLVRLRKILEQKLVKYNSSARYYWLKKQYLLNHLLLKEEVAMKKGSK"
     gene            <797627..>799111
                     /locus_tag="C5L36_0C03720"
                     /db_xref="GeneID:40384230"
     mRNA            <797627..>799111
                     /locus_tag="C5L36_0C03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466052.1"
                     /db_xref="GeneID:40384230"
     CDS             797627..799111
                     /locus_tag="C5L36_0C03720"
                     /inference="similar to AA sequence:RefSeq:NP_116631.1"
                     /note="PKUD0C03720; similar to Saccharomyces cerevisiae
                     YFL022C (FRS2); ancestral locus Anc_8.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321912.1"
                     /db_xref="GeneID:40384230"
                     /translation="MSDLQLTILKALGEKGSIPDSSVEFPNEDSQQLQAALNSLLARS
                     MITYKTKETETYNLTDEAKEIVSLGSHEYRLLNKVIESLEGLKISEIDSVMGKNGKIA
                     QGRAFKNGWISKDGDKLVAKVEDSSSVQDTTAEQLKEIVATGSLSNKKDLADLKKRKL
                     IAPVKVFTFSIEKGPEFALEIKQLETDITSDMILSGSWKSASFKPYNFNTEGELPHSG
                     ALHPLNKVREEFRQIFFSLGFSEMPSNQYVESGFWNFDTLFVPQQHPARDLQDTFYLK
                     DPKTALPPSDKEYLENIKAVHQDGAFGSIGYRYPWHLNESLRTVLRTHTTAISSRMLK
                     ELAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVFADYNLTLGDLIGFMQQFFEK
                     MGVTNLRFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGLFRPEMLEPMGLPKNMRVL
                     GWGLSLERPTMIKYGVSNIRELLGHKVDLDFIENNPAARLEVDI"
     gene            800668..800740
                     /locus_tag="C5L36_0Ctrna7A"
                     /db_xref="GeneID:40385086"
     tRNA            800668..800740
                     /locus_tag="C5L36_0Ctrna7A"
                     /product="tRNA-Ala"
                     /note="PKUD0Ctrna7A; codon recognized: GCA"
                     /db_xref="GeneID:40385086"
     gene            <801967..>808638
                     /locus_tag="C5L36_0C03730"
                     /db_xref="GeneID:40384231"
     mRNA            <801967..>808638
                     /locus_tag="C5L36_0C03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466053.1"
                     /db_xref="GeneID:40384231"
     CDS             801967..808638
                     /locus_tag="C5L36_0C03730"
                     /inference="similar to AA sequence:RefSeq:NP_012405.2"
                     /note="PKUD0C03730; similar to Saccharomyces cerevisiae
                     YJL130C (URA2); ancestral locus Anc_1.223; intron in 5'
                     UTR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321913.1"
                     /db_xref="GeneID:40384231"
                     /translation="MSFHNPISPSFEKLGTNLVTLETQEGIAIQGYSFGANVPAAGEL
                     VFQTGMVGYPESITDPSYEGQILVITYPLVGNYGVPDRKLMDDVVKSLPKYFESNKIH
                     VAGLVVAHYTEEYSHYLATSSLGSWLKEQGIPAIYGVDTRSLTKRLREKGSTLGRFCL
                     KKESIDVDAALSDADWKKNFEIPEWVNPNTQNLVAKVSTKEPVIYEPPKELAKLGPDG
                     KVIRIVAVDVGMKYNQIRCFVNRGVSLKVVPWNYDFTKEEYDGLFISNGPGDPSVMTD
                     VVEKLKVSLEEAKTPIFGICLGHQLMARASGASTLKLKFGNRGHNIPCTSTVSGRCYI
                     TSQNHGYAVDANTLQSGWKELFVNSNDGSNEGIYNTEKPFFSVQFHPESTPGPRDTEF
                     LFDTFIQAVIDFKKSKILRAVEFPGGLKEENEKLHPRLKPKKVLVLGSGGLSIGQAGE
                     FDYSGSQAIKALKEEGIYTILVNPNIATIQTSKGLADKVYFLPVTPEFVRKIIKQERP
                     DAIYCTFGGQTALNVGIKLKDEFESLGVKVLGTPIDTVITTEDRELFARAMDEINEKC
                     AKSETASNIDEALAAVEKIGFPVIVRAAYALGGLGSGFADNKEELIELCNKAFAASPQ
                     VLVEKSMKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDY
                     NMLRTTAVNVIRHLGVVGECNIQYALNPHSKEYCIIEVNARLSRSSALASKATGYPLA
                     YTAAKLGLNIPLNEIKNSVTKVTCACFEPSLDYCVVKIPRWDLKKFTRVSPLLSSSMK
                     SVGEVMSIGRTFEEAIQKAIRSTDYQNLGFNATEALMSIDIDSELQTPSDQRLFAIAN
                     AMSTGYDVEKIHRMTNIDRWFLNKLYGLIKFGDYIASFGTKEQLPIKVLKEAKQLGFE
                     DRQIAKFLNSNEVAIRRLRKDAGIIPVVKQIDTVAAEFPAFTNYLYITYNGQDSDVDF
                     NDHGVMVLGSGVYRIGSSVEFDWCAVTAIRTLRKNGFKTIMVNYNPETVSTDYDEADR
                     LYFETINLERVLDIYEIENSAGVVVSMGGQTSNNIALQLQRQNLKVLGTSPAMIDSAE
                     NRYKFSRMLDNIGVDQPAWKELTSLKEAEEFAEKVSYPVLVRPSYVLSGAAMNTVYSR
                     DDLESYLSQAVEVSPDYPVVITKYIENAKEIEMDAVAKDGKLIMHVVAEHVENAGVHS
                     GDATLIVPPQDLAPETVKRIVEATAKIGKALDVTGPFNIQFIAKNNEIKVIECNVRAS
                     RSFPFNSKVVGTNMIEMATMAIMDLPLTPYPGQKLPDDYCAVKVPQFSFSRLSGADPV
                     LGVEMASTGEVACFGHNKYEAYLKALISTGFQLPRKNILLSIGSYKEKQELLPAIRKL
                     AQLGYNLFATSGTADFIQEHGVPVKYLELLNEEEESQKAEYSLTQHLANNLIDLYINL
                     PSANRFRRPSSYVSKGYTTRRMAVDFQIPLVTNVKCAKILIEAIARNEPLEAEEIDAQ
                     TSHTTVQLPGLVSIGTYVPTLGEHGAAAFEATTKAAVASGFVFNSIIPITSDGAAIVD
                     ARTLTRATEIINGNAYSDYSLCVAATETNAQLLQQVSAQTSALYINAADFDTSFIPSL
                     SSHFNNWPSNKPIIVDAKSTSLASLLLLASLFNAKIHVTNVTDKNDLALISMSKQKNM
                     KITCDTAIYSLFFSQADYPGASFLPTKEDQKALWDNLESIDCLSVGTTPYKLAQHLGE
                     EITPGIGFADSIPLLISAVSKHKITINDIVSKLHENPISILGLSDSESLIDVNVDRKP
                     STLKSPVKVWTPVKDVDGSVERVYMNNQTVSLEGEFVVTEPLGRESTALHTASISNEF
                     AIEAGVATTAAATPRTRRGSKFSFDSNRRRSLIDSLKDGEEEDSPSGADLVSFMPPKE
                     LSPPNAISTYIKGHNPFLRKNILSVSQIGRRELHALFTVAQEMRLAVEREGVLDILKG
                     RVLTNAFFEPSTRTSSSFNAAMQRLGGRVVSISEQGSSVKKGETLQDTIRTMACYSDA
                     IVLRHPDEESAEIADKYSPIPVINGGNGSREHPTQALLDLFTIREELGTVNGITVTFM
                     GDLKYGRPVHSLCKLLRQYQVKIYLVAPEELRLPENLRDMLRESGMLLGESTELTPEI
                     VSKSDVLYCTRIQQERFKDPEQYLKLKGSYQINNKVLSNAKQHMCVMHPLPRVDEINE
                     EVDFDQRAAYFRQMRYGLFVRMAILAMVIGVEF"
     gene            complement(808910..808981)
                     /locus_tag="C5L36_0Ctrna9T"
                     /db_xref="GeneID:40385097"
     tRNA            complement(808910..808981)
                     /locus_tag="C5L36_0Ctrna9T"
                     /product="tRNA-Thr"
                     /note="PKUD0Ctrna9T; codon recognized: ACG"
                     /db_xref="GeneID:40385097"
     gene            <810116..>811434
                     /locus_tag="C5L36_0C03740"
                     /db_xref="GeneID:40384232"
     mRNA            join(<810116..810145,810235..>811434)
                     /locus_tag="C5L36_0C03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466054.1"
                     /db_xref="GeneID:40384232"
     CDS             join(810116..810145,810235..811434)
                     /locus_tag="C5L36_0C03740"
                     /inference="similar to AA sequence:RefSeq:NP_012610.1"
                     /note="PKUD0C03740; similar to Saccharomyces cerevisiae
                     YJR076C (CDC11); ancestral locus Anc_1.531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321914.1"
                     /db_xref="GeneID:40384232"
                     /translation="MVTVIESSSALRKRKILKKLLNFSIMVIGQSGSGRSTFINTLCD
                     QMVVESSSTINLYSPEELSLPTRELQLRKSNVELEDNEGVKISLNIIDTPGFGDSLNN
                     DESFKLIKDYIKYQFDEILVEESRLRRNPRFKDGRIHACLYFITPTGHGLREIDVEIM
                     KQLGEYVNLLPCISKTDSLTLEELKLNKKLIMEDIEHYKLPIFDFNNDYFSYDESLDD
                     ETVELNKYLQKTIPFALMGSNTTIKDTATGEIKRVRKYPWGIVDIFDNDVSDVSILKN
                     TLLITHLNELKDFTHEVLYENYRTKTLGDANEDYESSNSFSAQKATHNAVERDVSHSI
                     TREISMGHYEPESANEGQTDADIQLKEELIRKEEERLRAFEERVQKDLLLKREEIEAR
                     ERELAELERRLAEENLA"
     gene            <811721..>812579
                     /locus_tag="C5L36_0C03750"
                     /db_xref="GeneID:40384233"
     mRNA            join(<811721..811787,812035..>812579)
                     /locus_tag="C5L36_0C03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466055.1"
                     /db_xref="GeneID:40384233"
     CDS             join(811721..811787,812035..812579)
                     /locus_tag="C5L36_0C03750"
                     /inference="similar to AA sequence:RefSeq:NP_012607.1"
                     /note="PKUD0C03750; similar to Saccharomyces cerevisiae
                     YJR073C (OPI3); ancestral locus Anc_1.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321915.1"
                     /db_xref="GeneID:40384233"
                     /translation="MGLTEIALELYNDIDFNDKKFQTSLFFIIFNPLYWNFGARLEYY
                     TKILSTLCFGSKKLAVYVFSLTVFTLGIFRDEIYRAALTDQATSPYLDNALFKLLGVG
                     FFGYGGVLVLSSMYKLGIVGTYLGDHFGFLFDERIVDFPFNVCDNPMYDGSTLCFLGT
                     ALFYAKPAGLFASALVYTMYQIVLLIEEPFTAKIYSQRVQKQK"
     gene            <813364..>815298
                     /locus_tag="C5L36_0C03760"
                     /db_xref="GeneID:40384234"
     mRNA            <813364..>815298
                     /locus_tag="C5L36_0C03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466056.1"
                     /db_xref="GeneID:40384234"
     CDS             813364..815298
                     /locus_tag="C5L36_0C03760"
                     /note="PKUD0C03760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321916.1"
                     /db_xref="GeneID:40384234"
                     /translation="MESLGNPSFILRGYMFERYSKNILTCLVGLGATAIGVAIGSFFN
                     DNETIEELHDYLDKEQYIQYLVSSFIKKDEFIELFKYAVLSIIFMIAFALAFAGFTLV
                     KLKKQDKTTALKLENIHEKISNIEHVIESILRDHENIDIEQLKFFKSEIDQQRITFKN
                     LISNKTLELETKISAATSVCSKAKTQVQTDLKNAKDMICHSDYLKNELNAIQQTLNNV
                     KLKSQTIETDMTELYDSISEKRTFIEQEFKEKFTSLNEKLNSQYVDIHKCNNLLLDSQ
                     IMLEAAVIEFEKVSNPTDIAKSSNITERTILCLRKALEVKSYYETGTETENLCSSSMI
                     TELPFTSGNIETDPNKNSVNASLIKIMSHVSDIEERLDVQEVLIKKNCSDLKNSLNLT
                     ATKVSDIKAYSDEWITSWIAVLYALFNSTFMNLEDQLFGIDYMEYKTIFQFESNKSNE
                     NSNLLQDIVEKCKKTCLKTINEVNLLIFEYYLVQKSSPECGSSLVSLCEAKIDEELED
                     LFESIKIALGRSSITEPQKSNILNTLHKLKQDLVSDLKCDTRRYNSLVKQNLKDFHLI
                     HDTIKTLLTKPEHKGLSLSEDESVIEVSDNSISLISENINSSYSEDDSSFLNEGLSGS
                     SLRPFKITTSLKTKGNLLRG"
     gene            <815492..>816271
                     /locus_tag="C5L36_0C03770"
                     /db_xref="GeneID:40384235"
     mRNA            <815492..>816271
                     /locus_tag="C5L36_0C03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466057.1"
                     /db_xref="GeneID:40384235"
     CDS             815492..816271
                     /locus_tag="C5L36_0C03770"
                     /inference="similar to AA sequence:RefSeq:NP_014921.1"
                     /note="PKUD0C03770; similar to Saccharomyces cerevisiae
                     YOR278W (HEM4); ancestral locus Anc_8.734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321917.1"
                     /db_xref="GeneID:40384235"
                     /translation="MGKSIILLKNETIPHDPYREKFKEKSIDVHFLPLLTHNPINHAE
                     IIGFLTGDMFLKEYKAFIITSQRCIESLDTVLSMIDDKDTLNQILQKPAYTVGPATYD
                     VLSALGFRNIKGGMNAGNGSILSDLIMSDELFKDGNKKILFLTGEIRKDIIPKKLKSA
                     GFDLKELVAYRTQVRGDVVLRYTKLYNQLVSNDNEKWVVFFSPQGTEYITQHLINNKP
                     DFKIASIGPTTEEYLRNLDIQPNVVSGKPNASSLLESISKA"
     gene            complement(<816311..>819760)
                     /locus_tag="C5L36_0C03780"
                     /db_xref="GeneID:40384236"
     mRNA            complement(<816311..>819760)
                     /locus_tag="C5L36_0C03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466058.1"
                     /db_xref="GeneID:40384236"
     CDS             complement(816311..819760)
                     /locus_tag="C5L36_0C03780"
                     /inference="similar to AA sequence:RefSeq:NP_013945.1"
                     /note="PKUD0C03780; similar to Saccharomyces cerevisiae
                     YMR218C (TRS130); ancestral locus Anc_8.735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321918.1"
                     /db_xref="GeneID:40384236"
                     /translation="MGTKVGNKSIDLDVGFYDPLSIFQGGFRTDFEEHIRIPSFYWKD
                     NSDNLRVLKNVMFNFIEEIPHTESKDVKFLKFLFITCQTVEDYRSRIRPLILQWLGSM
                     KKEQPKIPYFIFFFENTELRTAADKYLKTNIFHKLKSDFDNREFTQENIFKIKSIYSN
                     IDEKKEVWKIISSSTSSLLANSINRQLKYFENSPLKCASIFEHLHQQEDAMVLYSELF
                     NAFPSIPKAEFLSVGVSEILEMVDVNGDNDPKETSSSFHKKMCYYKRLKNVLQTEQPT
                     KMGYLKKMKLLAESLLSFLNSLEICYKRNEIAFAMIEMFLSSSYLKETLQLHTENSET
                     IITSIGKLLHLQRNELIALGTSQGYSLRGSLSIIDIQFENEDYVVESEEIQKIMKTQK
                     TFSDYVIEKTRELIANYNDYGVNLNTIATLSTELALILFYSTDDYETSCNQLLKSFDY
                     FFSTGWEFIGTSLLEVYIENLNKLVEQRGECVVSQLLASYITLAERDPTKIDDGKFRK
                     LCDELATLERMETNNIFTVESLSSVYCSEVDVYEIDLLMKSELCSTVDKIKLEMVDDV
                     GNTVVFTYTKKLHLKRKNPITLRCADLVFGRFEAKKLSVFSNKLVLVQNVCAAVGITP
                     IETFYCMKNESSKANTTAKMEVSKTRYLNKDLLVFEVKVGSNDVSDIEMVFVKTDPDK
                     LSKEEDYSMKCIQNGITSCVEFEVIEDTKKLLFRPSKSHKWQTEDTLCVEIPYYFPPY
                     VVNTMLELSYELKFKSHPPEGETLLCSRKHKSVVESLLPIAVAADEFFGTSDEHSGQD
                     FFLLSHYTVNAISVDNPIRIQDTSLISDNELITGWKSPKDTVAFLEQGSTFFFKIKDF
                     NDKSVLLKIKYNCILEEIIGIMKLTFLNFITKMEMVGPVDVFCFSNAASKIWPCLNYK
                     VNFFAITNRIIITNFHEAKLKDCYNFIDKKKIGTFSEAVLDFIESIKDLEIDEKMKND
                     VYSSTACELHIPVDLPPLNMMNTVKYEFKRELQYLVCEPINVKVVIDVHIVNLTKNQI
                     EEFDKTEKKVRFCGNEESVSYGFHGNSASLEMAFTGNDQKWVISGLKNIAFFVDLKEA
                     SETGSHHEFDLTFIPLKPGKLQLPNIEIKNNNQYLNMEVAYRNTSESVLIVSELNKII
                     HSF"
     gene            <820052..>825646
                     /locus_tag="C5L36_0C03790"
                     /db_xref="GeneID:40384237"
     mRNA            <820052..>825646
                     /locus_tag="C5L36_0C03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466059.1"
                     /db_xref="GeneID:40384237"
     CDS             820052..825646
                     /locus_tag="C5L36_0C03790"
                     /note="PKUD0C03790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321919.1"
                     /db_xref="GeneID:40384237"
                     /translation="MDGAERENRQEISTNENKEKLIVRLSRRNTLIEQATRRHYENNP
                     NVIFVYEEEEVLDTPEYWATIARRANIPVEEDDVEEVPSLVDKGDSKCYDNPRELYEK
                     LLARQQAYKKLSTEAEDEYYANIEYEYQLKKNRKRKSDEKDSDRESKIDNFMKLFNYQ
                     QSSLRGSKDAEPSVNTSAENNAEKPDDVDSDVSLVILSEHDDVNDKVGHQEEIAEGRC
                     TGNYDLETGSNRIADGDGFEVEELYEEEKSSLLDDVEDVRNYNNEEIIDIHETLNPEG
                     DYENFSDNYDMGMNVRAEEDINLTHKIIPGIQEVGYTYFEETVTTSEACETDGTNLSE
                     EISEKNEETEEGAGSEADYVVKNDKATEVNNFVSLDSDSDSYGKFGNNNSMSNEGLNE
                     QGLSEELSEEELSEEELSEEGSNRKRLSEEEEEEEEEEEGNKLNRENNYLANDAVYAF
                     FSAQLENQRQANTEQPLEEEVVEIQRNEIEPRNQAGIQENHVFSEDASLDDSLLGNNT
                     ETIQVYPESDTKISSIDETTFHSAIGNASIEGSTPVNENNALEMSIQQEVLEPSHRHV
                     IFKPMTPPRPPTPEAPQLFIGLSELLSASLDIQSKQSAGHDVDPELVETTSKLIEKTS
                     NVIGEISDTELERIISRPSTVDREQKIDAEEEDKVESEAEYTEHMVVIDEPQIKVTRD
                     KQSTPLPENYITKKAASVLDNLASESFSVLSESSMLANTKNEGADNCVNEEDYINSLI
                     TETLNDTNRTNLVAASGGVYGETILESNGDISNCNQSFFVESLSDQKDEDGMEDNVTD
                     NKEETFNNNDDEEIIDHKSTDTDELEDSVTHDVTSFIHVTNNAIQSNVEPNAEVDDNF
                     TIGSDTSETGKLRNEATLASNEHLRNEHEATESLTASFQEECSNASNLEKEEKKVKKR
                     AFDEVEDISNNFDSTGEFPRLKRRQFSIFNPFSWFGKTTFKNVENKNIFEFSNGEKIE
                     SNKLFQNESIGEGVDGVAEDNCSYSTQEKEKEESEPASATELEINHNSAYAEQEETNT
                     FKQPNEQTENERSEIVDSKYNSYQPNAFEKAKPICGVSTEGEVDTSHEPNILTASPNI
                     STNSESADIGAQDVHKKVGMVFLDDTSISDDQEGKSTENSKNLNENENAGGEMDLSTQ
                     KSWFSGLISAVKEFSKGALIDGAVDDDTDSSSSTQSLNDSDSATDSSVSAKHGVASTE
                     ESTNTGEHTSTESSYTESKNDSVSRQETTLNIEQVDEPETFELYENEQPSADSTVHEI
                     TDFLSIVEEKLDEEIFNVVNSPSETEAGNSEHFKNYEQEVTEFMEVHEYEDGKEKSMR
                     IELSSDPKDDNQQMETTKCGDGDDVERPPVETRYSEDGISDLGGAHYIESKANKDDNE
                     VVSHSGSENCNLELPKPLGNSRDSNFSGISNELTLYPYKLVSSEETLEETAELKKTKH
                     SHELQKQEDNFVETIYVHDAVQEVKDTETGLGKDESNFNDAESSEEKKIVSSANFGDV
                     LVSNNDAAPSGEVIKETSNGEKREATPETDTMEVVDSEDMEEPNGEKNSHDYKIQTNE
                     SVDATEIIKVDPLDYEKITVKSSKIPKVEVELLKKPNKRGRGENSDSEEEEDSLNKRL
                     HLQDSKLEAPPVAVRTRSRSPSRKPSDSSTSRNLSFGESGKTSLNFLANRVLSYGSDE
                     DPVEINEERLPRDYTDLIEEADNFIVHELERKPSAAGVKSTNSDNEDIDRTASEKEQL
                     NNPLVVPKRTRSNVSSSSKSETDKTSVELKTIRGLRSRPSNSVTPEIMSRSGSDVDTG
                     SDSEATLGDRLAAASKRSKKNSPSGKGDRDASGRGRGRGRGRGNGRGRGRGRGRGRGR
                     STRGHSSSRGSTRASGKGKSSR"
     gene            complement(<825804..>826193)
                     /locus_tag="C5L36_0C03800"
                     /db_xref="GeneID:40384238"
     mRNA            complement(<825804..>826193)
                     /locus_tag="C5L36_0C03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466060.1"
                     /db_xref="GeneID:40384238"
     CDS             complement(825804..826193)
                     /locus_tag="C5L36_0C03800"
                     /inference="similar to AA sequence:RefSeq:NP_012762.1"
                     /note="PKUD0C03800; similar to Saccharomyces cerevisiae
                     YKL160W (ELF1); ancestral locus Anc_5.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321920.1"
                     /db_xref="GeneID:40384238"
                     /translation="MGKRKSSAKPVKKIKQRLDTQFTCLFCNHEKAINCTIDKKSSIG
                     TLNCKICGQSFQTAINSLSEPIDIYSNWIDACEAVAEEEAKRVQHNNGYNVNDDDYEN
                     DDDDEDDERKPSIKSRPAKVEDDEDDF"
     gene            <826680..>827837
                     /locus_tag="C5L36_0C03810"
                     /db_xref="GeneID:40384239"
     mRNA            <826680..>827837
                     /locus_tag="C5L36_0C03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466061.1"
                     /db_xref="GeneID:40384239"
     CDS             826680..827837
                     /locus_tag="C5L36_0C03810"
                     /inference="similar to AA sequence:RefSeq:NP_011919.1"
                     /note="PKUD0C03810; similar to Saccharomyces cerevisiae
                     YHR052W (CIC1); ancestral locus Anc_5.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321921.1"
                     /db_xref="GeneID:40384239"
                     /translation="MASRKTRSSTAKASTEKPVESPKTTKVSKSTKSTKPNKTSKTSK
                     NVVEDSKPEAPKSTNSNMINDEEVVQAINIKDKAIENAVSALSKWNKKQQETSAKKNL
                     FDEDDEEIPVYLQVTANKYLSKSNVLKPRMITVPHPIHDLDDARVCIFVKDDLLDEES
                     AARIEILKENELKNLAQIITVKDLKTKYNAYEKRRQLLSEYDIFLTDSSIANMIPKLL
                     GKIFFESSKLPLTISVTENKKLSVDKFVKNFQKALNSIGFILPMGINMGFRLGMLGQD
                     INNMKENIHAIARFLERFNIRLIQLKLTDSPSLPIYINKKIFTEDDVLKTDDTQNDGN
                     RLNDIPLSIYAEGLKELGLDEEEANQIFGRKRKSDQLKDDSKTTTTKKSKN"
     gene            <828046..>828933
                     /locus_tag="C5L36_0C03820"
                     /db_xref="GeneID:40384240"
     mRNA            <828046..>828933
                     /locus_tag="C5L36_0C03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466062.1"
                     /db_xref="GeneID:40384240"
     CDS             828046..828933
                     /locus_tag="C5L36_0C03820"
                     /inference="similar to AA sequence:RefSeq:NP_012763.1"
                     /note="PKUD0C03820; similar to Saccharomyces cerevisiae
                     YKL159C (RCN1); ancestral locus Anc_5.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321922.1"
                     /db_xref="GeneID:40384240"
                     /translation="MKKGGNSSNTLIITDSALVHPESHDLLQETISAIKEFVNELNTE
                     KLIHSCLQILHLKSFRRVLLIFTESKIAKLVFEYFQRLGIQIGFARNDNRLTTCDLNS
                     DCTVDSNVSGSSLNPQHIHISDPINERYIPGDTGVAGRENNLTFLRVPHPPIQMQSPP
                     ASPYEGWIPQPEEPPSDTTLSFHPKTLGHVLYTYDGEEVPQGLGQMRKVFSSFIDDEM
                     PMSRINESLEDLNLGEGLEDTNERGGNGDDRDLLKGSLLQKNKFVENNEFKIPILVIN
                     QKEAENLRQVATNFDLDKA"
     gene            complement(<829040..>830974)
                     /locus_tag="C5L36_0C03830"
                     /db_xref="GeneID:40384241"
     mRNA            complement(<829040..>830974)
                     /locus_tag="C5L36_0C03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466063.1"
                     /db_xref="GeneID:40384241"
     CDS             complement(829040..830974)
                     /locus_tag="C5L36_0C03830"
                     /inference="similar to AA sequence:RefSeq:NP_011914.1"
                     /note="PKUD0C03830; similar to Saccharomyces cerevisiae
                     YHR048W (YHK8); ancestral locus Anc_5.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321923.1"
                     /db_xref="GeneID:40384241"
                     /translation="MAKKHNRRKIPAKSRRLSNTNYLMGSSADTSTDSPNNTPNLNSS
                     YNIKHHNFHHSSNPIHVRRGDSLKYAILNDDILEEGAMLSSSEGYDASSNNSSANSQS
                     LMAEDQPLDEFIQNSLSQGNYSSIHYQDSVFSEISDSILLLQDREHHNSLKWYRRPSI
                     FMVSVLVFSYCFSLGIAMSSDLDLIMKAVCYLVNGEVNNCSTPSVQQMNANLQKYNNF
                     IGSFIKILVSVKMGKLSDIYGRKPMFLITFTLSCLSKFMCVFILTPRYFTFNRVILAN
                     IVDSFGGSIFVLLSIANSYVCDVVHERERLPALSKVTGAFFLGLSLGPLTSSFLGSTF
                     NIPSIHFVGASAALFFMSIIFVIWCIPESRGEKLRDKSRRFSIRSRRELESSPSWTYK
                     LGLSGVIDSFESLKILWITRPRQFSTNENNSEYEMNPSQDPSSLQKLEIDLPARVNGI
                     LLLAIDLFFVICSAGSSLPIALYMIYKFNLSQSQLGLFVGVISGSRAIVLSVLNPWVQ
                     HNLLNFFSHDPFNVDFIDITTIGVAILSEIVASLLCSISPTLWILCFYFILTSLSAVG
                     SPVIHSALLKYNPNPSKNGEFFGALALIKNIVNLVAPWFFLTVYSFGIGIAKPEIIFY
                     IILGSFSIAGLLLGNIRVKN"
     gene            <831678..>836333
                     /locus_tag="C5L36_0C03840"
                     /db_xref="GeneID:40384242"
     mRNA            <831678..>836333
                     /locus_tag="C5L36_0C03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466064.1"
                     /db_xref="GeneID:40384242"
     CDS             831678..836333
                     /locus_tag="C5L36_0C03840"
                     /note="PKUD0C03840; Pfam Domains:
                     RasGEF(1.1e-45)|RasGEF_N(1.9e-15)|SH3_1(1e-08)|SH3_2(1e-
                     07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321924.1"
                     /db_xref="GeneID:40384242"
                     /translation="MSQKPIMTAHAIRNYLPSNDLKNCLQLLQDDVVYIMDKSDNQWW
                     DGVVLDPIGNVQRGWFPASYVEPYTQLHRRSHSRSHSRPRPSSNSKSRSSSLSKSQSQ
                     SRSNSNSNSNSNSNVNSNPNINPNSRSRSRSCSVSSLKKSARLNSSSKSNLVPANEIA
                     IGDQHQLKSKSSTPGYEYNPSNSTTPNINTSSSGQFSPASQNIQPRRHSTRPRMQSYG
                     GPHQMSTLHKQQQLPQQHVHSRVSSPHASHFIRSNSAEVQPHSPSASIFKEKNYFISK
                     HDSLLSMNSQQQQINESRQSSQAFTDISATSLSNSIHIVSSDEVKSYFQPDNSKSQPS
                     FNFVPTWIPQFGQNLEVLYKNQALNVYTNDIPYIDAGFINESTLYETPDTTNLINDLN
                     ILPYSSKRSCNDVACVNMSRKISRGSSKGNDSVNYNINHSCSNAFHSNSNRSLPEHTH
                     ILHNLPSFVDSRPTEIYYTETSDLLTWDSLVSSFINAIDGSISCLIKKEKMGFKTHLN
                     DASNKLSFYHIACRQIHPLLDSSNKVSKLSSILKKITDTFIQFRIWSNLAIVSIDAQI
                     SHRTGSKLGFEDNLMNGSTINDYIKNSTIARSKLEKLSIHLIKFMSTVPIMVHNGYTQ
                     KNTSKMLPMVYTRFIKDKFEGGNYKNKLTYSKYHHNDYFIDVNHDQPNILLDEAVTDK
                     LKVLEINIFDSLKQINDILLTQPSKDMSLQQFNEKINISLLTAVYKCVPLLSQFINTF
                     ESIDLTVFAMIDRMAKKPSDYKRNTTLIKSEVEDPLSPSSTPLHHTSNIETLSSSTSD
                     FGNSIDSGEDSEKSSQSFYDATAKVFRPLICEFLQLKQSLHSAFSDLILDSQTITADD
                     PETFSTMRDDSSLYTKPSKFKMVADILLMKLQKADYELHRRNSYILDPKLKLMETINV
                     SKDRIKLINILIIQLRDERRTILNYCSRLMNSDFNIASLFIAERHNTIVSKSSQATAT
                     FSGKYSSGSYMNEDDERENSVDEKLPDYGYTFTNANTNEEHVPWYMTMDHDEEKLIYE
                     GSILKGGPVRGLVSKLVNPNNQPDELFEQTFLCFFSTFVKPAKLFEILIEKYNLSMPE
                     ALSYEEYGIWIEQKLKPQQQRILDIFIKLFSRYWIVNYTTSELINTWDYFVEETPSVK
                     IELINLSAKVFSFDNQEEYIDYFKLGNMEPKTIPVAPLSNSILHLRLQSLNINYVAEQ
                     ITAVQAFYYRKLNMWDLLGRTYNFARILRGDNEMKHSNVNMRDPLGTKNISNFIKCCN
                     NLTHYTSFMILKNSDLNERMESIKFFILLAEKLMAMNNFSSMTAIISGLGSTSISRLR
                     KTWDQLPQVYINKFQKMDNLMSIGKNYSEYRNILKFVNADDEAYMPFLGMYLSDLRFT
                     TDGNSDWLTKRRGSKGLVNFAKRVSIMKIINEVLDFNNTLYNIRLDEEFSCYLQEMFK
                     GLPDDEKMYQLSIEIEPRVSVLKNGKGLATVGLMEIADGTYQGSVTPERSSTLSSFFG
                     TFNSIGSFSTPDGRNNNERHNSNDRNSTQAQMQGNEGHHSHSHRKHSHNHKHHYKQK"
     gene            complement(<836779..>837366)
                     /locus_tag="C5L36_0C03850"
                     /db_xref="GeneID:40384243"
     mRNA            complement(<836779..>837366)
                     /locus_tag="C5L36_0C03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466065.1"
                     /db_xref="GeneID:40384243"
     CDS             complement(836779..837366)
                     /locus_tag="C5L36_0C03850"
                     /inference="similar to AA sequence:RefSeq:NP_011674.3"
                     /note="PKUD0C03850; similar to Saccharomyces cerevisiae
                     YGR158C (MTR3); ancestral locus Anc_4.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321925.1"
                     /db_xref="GeneID:40384243"
                     /translation="MNTIDRRRRIGPPNAVPLYFPAQPSKVVEKSSKDEKLFIQVNNI
                     PTATGSSFIQSGNNILLASVYGPRPSFKRTFNDKAVLKVTFHSSPFLTTRNDPYNNNF
                     NARKSEIEVDPDFQIIDSVVLSTLETACANLIVLDQYPKSNIEIFVNLINTDNKTTFI
                     QLLPLIHNSVNLALVDSGIALKNSQQHVLPKTTCS"
     gene            <837646..>838329
                     /locus_tag="C5L36_0C03860"
                     /db_xref="GeneID:40384244"
     mRNA            <837646..>838329
                     /locus_tag="C5L36_0C03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466066.1"
                     /db_xref="GeneID:40384244"
     CDS             837646..838329
                     /locus_tag="C5L36_0C03860"
                     /inference="similar to AA sequence:RefSeq:NP_012248.1"
                     /note="PKUD0C03860; similar to Saccharomyces cerevisiae
                     YIL016W (SNL1); ancestral locus Anc_7.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321926.1"
                     /db_xref="GeneID:40384244"
                     /translation="MDVMVPYLYNSIDKAASLASPYVSPEKLDQVCRWLKQHDEAVLY
                     STLGALVLGTLYLASSGNGKTKKRSKKPSSKKSYQVKVKKEKVVPVDPVKQSYDTINS
                     VKDELKNVFTPQVDQLEKDVERELAGKKEIEGKKNKHKKKKAGSKNKLKEHTSNEAPE
                     GAAKTSSYKDSTKYRYLYLNEALLKLLMRLDGVETQGIEDIRVQRKATIKLVQEQCKR
                     VDALKDYVN"
     gene            <838513..>840051
                     /locus_tag="C5L36_0C03870"
                     /db_xref="GeneID:40384245"
     mRNA            <838513..>840051
                     /locus_tag="C5L36_0C03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466067.1"
                     /db_xref="GeneID:40384245"
     CDS             838513..840051
                     /locus_tag="C5L36_0C03870"
                     /inference="similar to AA sequence:RefSeq:NP_013727.1"
                     /note="PKUD0C03870; similar to Saccharomyces cerevisiae
                     YMR014W (BUD22); ancestral locus Anc_2.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321927.1"
                     /db_xref="GeneID:40384245"
                     /translation="MKENTLFKLDLLQAHYLQKPARFGVTKQMLRSEKYQSKKSSERE
                     NSKRVEKSKHKLLQLSREEAFNLIKQFQNEAFDKKVHFLQTDLHRVIFRVLKKERQRL
                     ANKLDLEEDGNKDEEKGKAKTLIDKIDSLLAKDSSLLSTNIKHKIFKVILKAFPDKVN
                     LKESKFEGLSEPNIEFLKTMKETNPYLTNGDQLNNLLSNVYSDKAVKESLNKINTLEL
                     VWGPKKDNRENKSDMEGFEDENSEYEEVSDEDSKSDGEEKRVSKELQQADIEAIYDNY
                     KDGLVASSDEEQEGEGDDVPYLDPNVNYNEITDEEPSEEEIDVDIDDDEEVENGDADA
                     GDRNQKSLKKRDNEPIEEDDFFSPHEPQSKKQKNTNEGLGLKDIQLPKLATGYYSGGE
                     SDEDTRDSLVDEITAPRKNRRGQRARQKIWEKKYGSKAKHVQKEHERSKSERERLRIE
                     YEQRAAKRAEKQKIRDMKERELQEKKVQQTEKKQTLHPSWEAKLKQKESLNAKFSGKK
                     ITFD"
     gene            <840275..>841945
                     /locus_tag="C5L36_0C03880"
                     /db_xref="GeneID:40384246"
     mRNA            <840275..>841945
                     /locus_tag="C5L36_0C03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466068.1"
                     /db_xref="GeneID:40384246"
     CDS             840275..841945
                     /locus_tag="C5L36_0C03880"
                     /inference="similar to AA sequence:RefSeq:NP_011095.1"
                     /note="PKUD0C03880; similar to Saccharomyces cerevisiae
                     YER168C (CCA1); ancestral locus Anc_8.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321928.1"
                     /db_xref="GeneID:40384246"
                     /translation="MLFRSLRNSRCLTIRISKTTKHLLSINSKMNNPYTSKHVPGVIP
                     DIQLDKTESQVVNLLKSYTQAHNSQTEDPNDRITLRITGGWVRDKLLNQPSHDIDIGI
                     DNCSGESFVNGLKQWLDAKSDVDGRRGDDGDAEKINSIHKIKKNPDKSKHLETCTTKL
                     FGLDIDFVNLRSELYTEDSRIPTITTGTPDEDAHRRDATLNALFFNLETMKVEDYTKK
                     GLEDLSKGILRTPLEPTKTFLDDPLRCLRLIRFASNYGFKIEQATLDAMKRDDIHKAL
                     ETKISRERIGVEVKKMLVNKRWVYGTLDALALIREVNFPNVFGLGDTKVPDEWLSNNK
                     KRLISDISQNIDSLNKYLIDIIDSNIMNFSKVIDIQDSSDNDKILFYSSIILNHWRDM
                     KVKVGKRDNYVSFFCVLNGIKMPLKLADNVALVTSQIERIRTDVGGIRGFTRSEIARR
                     FVLPFQDKWEINLLINSCLECFEAPDQSTTILNRYEGVIKTVYDLKLEESFKEQILLN
                     GKELMKIINKKPGPWLKPLNERLFQWQLDHPGATREDMVGYLSTISIE"
     gene            complement(<842097..>842603)
                     /locus_tag="C5L36_0C03890"
                     /db_xref="GeneID:40384247"
     mRNA            complement(<842097..>842603)
                     /locus_tag="C5L36_0C03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466069.1"
                     /db_xref="GeneID:40384247"
     CDS             complement(842097..842603)
                     /locus_tag="C5L36_0C03890"
                     /inference="similar to AA sequence:RefSeq:NP_012867.1"
                     /note="PKUD0C03890; similar to Saccharomyces cerevisiae
                     YKL056C (TMA19); ancestral locus Anc_2.584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321929.1"
                     /db_xref="GeneID:40384247"
                     /translation="MKIYTDIFSGDELLSDAYDLKLVDDVVLEADCQMVQVKPGADVD
                     IGANPSAEGDDDDVEEGVETVNNVVYSFRLQQTSFDKKSFLTYIKGYMKAVKAKLAES
                     DPDAIPTFEKGAAAYVKKVIGSFKDWEFYTGESMDPDAMIVLLNYREDGETPFVAIWK
                     HGVKETKI"
     gene            complement(<842966..>843736)
                     /locus_tag="C5L36_0C03900"
                     /db_xref="GeneID:40384248"
     mRNA            complement(<842966..>843736)
                     /locus_tag="C5L36_0C03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466070.1"
                     /db_xref="GeneID:40384248"
     CDS             complement(842966..843736)
                     /locus_tag="C5L36_0C03900"
                     /inference="similar to AA sequence:RefSeq:NP_012868.1"
                     /note="PKUD0C03900; similar to Saccharomyces cerevisiae
                     YKL055C (OAR1); ancestral locus Anc_2.585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321930.1"
                     /db_xref="GeneID:40384248"
                     /translation="MPTLSRSFLKGQRAVITGGSTGIGSALATEISSLGGLVTILSRN
                     QARLETKVQELNREFPNEEGKHDFVVYDLKNPHNLPQTLQDMQTFQEATILINCAGLS
                     QARMLMNTPLTEIQDIVNVNLVSPIILCKFFLKHAVRSRPSLGNSTSLNRSIINISSV
                     VSQDDINLPGSSVYTASKGALTRFTHVLREEQQLIEKRRPTGPHIGVHVLNLGLVPET
                     AIGSTVKHDNPLFPTTSPTEICSRVAQLLQEDFSYRRT"
     gene            complement(<843924..>845315)
                     /locus_tag="C5L36_0C03910"
                     /db_xref="GeneID:40384249"
     mRNA            complement(<843924..>845315)
                     /locus_tag="C5L36_0C03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466071.1"
                     /db_xref="GeneID:40384249"
     CDS             complement(843924..845315)
                     /locus_tag="C5L36_0C03910"
                     /inference="similar to AA sequence:RefSeq:NP_014516.1"
                     /note="PKUD0C03910; similar to Saccharomyces cerevisiae
                     YOL125W (TRM13); ancestral locus Anc_3.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321931.1"
                     /db_xref="GeneID:40384249"
                     /translation="MTELPDSKRHKVNETNILDNKCAYFKPKNGKRCGLQVRKGQIFC
                     FAHIDVANGTTVKDVSTGVSTKEAEITRTDKNGKIIRRVKCTIDPTHTVWEDRLTKHV
                     KNCNVVKKKKEIADMERNVDWFSIDYNVKEASTAEATKTDEKEWKTCMHKWIAKHDLI
                     FTDELPLENIQFKQGLEERFAELSNQKHIIQQSSLIGQLINNGLISENENPGIVIEFG
                     CGRAEFTRYFNRAIEEINKNKPHCGEYLLIDRENPRLKFDKKIAADSEAKGNQNVKVE
                     RLKVDIKDLKLIEALRGFQMQKDSSIVGKEYLGISKHLCGVATDLTLRCLINTTRDIS
                     LSKDDLHLKGCLVAMCCRHCCKYEWLLTESKDFLREQFEIDETNFIYLRKMFAWATNG
                     VPPGKSKDEVGDHFSGLSIGEREVIGLKMRRILDESRKYAMVKKGFEVKIVRYVERNV
                     SLENNCIIVKNAI"
     gene            complement(<846304..>847236)
                     /locus_tag="C5L36_0C03920"
                     /db_xref="GeneID:40384250"
     mRNA            complement(<846304..>847236)
                     /locus_tag="C5L36_0C03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466072.1"
                     /db_xref="GeneID:40384250"
     CDS             complement(846304..847236)
                     /locus_tag="C5L36_0C03920"
                     /inference="similar to AA sequence:RefSeq:NP_013444.1"
                     /note="PKUD0C03920; similar to Saccharomyces cerevisiae
                     YLR340W (RPP0); ancestral locus Anc_4.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321932.1"
                     /db_xref="GeneID:40384250"
                     /translation="MGATREKKAAYFTKLRELVEEYKSLFIVGVDNVSSQQMHEVRKA
                     LRKDAVVLMGKNTMVRRAMRGFITEFPEYEKLMPLIKGNIGFIFTNADLKTIKDVVLA
                     NKVAAPARAGAIAPADVFVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITSDVRILE
                     KDQKVGPSEASLLNMLNISPFTYGLTIIQVFNEGNLFPASILDITDEELLGHFTTAVS
                     TITQISLASGYPTVAAVSHQIVNSYKNILALSVATDYTFEGSEQIKDRIANPEAYAAA
                     APAAAASSSSAAAEEAAPAEEEESDDDMGFGLFD"
     gene            complement(<847566..>851585)
                     /locus_tag="C5L36_0C03930"
                     /db_xref="GeneID:40384251"
     mRNA            complement(<847566..>851585)
                     /locus_tag="C5L36_0C03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466073.1"
                     /db_xref="GeneID:40384251"
     CDS             complement(847566..851585)
                     /locus_tag="C5L36_0C03930"
                     /inference="similar to AA sequence:RefSeq:NP_013440.1"
                     /note="PKUD0C03930; similar to Saccharomyces cerevisiae
                     YLR336C (SGD1); ancestral locus Anc_4.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321933.1"
                     /db_xref="GeneID:40384251"
                     /translation="MSKKRHAINIPGVMLDSIRDSEEIYENDARFKRQKIKGPSVIHR
                     KENRRQSRMEKKQSKKQLANEHMKLYKEKQKEYQLQKKKSFNKKPSLKQLSTRKDGAV
                     DSNKCSQKKKKRVSFSNNDDICEIPARESNSENEIDVDFEKWEKEFGDESDDSEQFYS
                     NSENDSEDENEEEETSNLIATLKQLKKVQRGAHTSDGYGSDDVTAASGNNVTHDICNE
                     LEYSENKANLDEEQQRVMNQLAVLKGKKKSGNINVRIVKEDELEDDTFESSDDDDDDD
                     DDDDDNDEDFSDNSLKESDDDQKSIMTHLAKSKSRKNKELPGATNTYHGADVRFDKYD
                     GSSDKSIDSDFKSDSEFYEAEEEVMAKLRATKGKRIQSDQNLRIIKEDELSDADSTSQ
                     DEEEKLDPVLDDLDDEQKHVMAKLALLKGKVNSNSGIRIVKEDELSDDSETSNESDIV
                     RQSGSEVDPSSGKDTDEDREEEEIMKKLAAIKGNKRAPMKLKIVKEDELSDDSTSDIG
                     YSSDERENEEIDYAEPQFRSKNDEELDYYTQKLKLDKNTRMKRESEDDFVGGLFEGLD
                     FMEKYDNADNIDYEPKQKKSEVKEKKTKKENSPKPKDQKHQRIISAHDREMIQKEKDD
                     MMFYAKKLGINPKKGVSKQGDDDFIGGLFDGLDLNYSDETETGDDEDLSEGKEQSSSE
                     SAYENEREASKNFKGGDDDINSEDFDDDDDLDDDDKALLREMYGLENSDSDSDSDFAS
                     DSDDSDSPKAKKNPYMAPVDPSTLGLDNPSGSRYIPPALRKKLAMNENTEDSEVMKRL
                     LRLVKGPFNKLSESNFSSSISELNEVYIDNPRQFVNEAVLKVVIQSVCISTPMLESFL
                     VLYSSAIVALYKLQGVEFGAFVIQKLVEDFLKEIESTERAKQELINLSGMIGYLYTLN
                     LISATLIYDIIKWKLIVNPTELKTDILLKLIRSCGSKLRTDDSTALNAIITELTKSVK
                     LNESRGVKISTRTRFLIDTITDLKNNRLRNMENVNTVSMINRLKKQLGSISNSRNLDA
                     IKVNLEDIENIEERGKWWLVGSAWKGNEGSKTEVTEKSDVGNVNEDFLKDEDELTGEG
                     DVNWMELARQCRMNTDVRRAIFISIMSAEDFKDAFMKLEKLSLKKSQKGEIPNILMHC
                     ATLESNNNPYYSYLGKKLCDDHGMRRAFQLNLWDFIKELDGEESSTTILHNANEEERL
                     WKILNMGRFFGFLLGEGSLSLNVLRVVNFLTASSDVKIFLEIMLITVLDIIAKKSQVD
                     QFGSGKSKRNVTYTGKLVAERIAKCDEQPLLLKGLQYFLNDKLRDSNFIKGKKQQARI
                     DWGIDTLSAMIGEMLKSQK"
     gene            <851825..>852898
                     /locus_tag="C5L36_0C03940"
                     /db_xref="GeneID:40384252"
     mRNA            <851825..>852898
                     /locus_tag="C5L36_0C03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466074.1"
                     /db_xref="GeneID:40384252"
     CDS             851825..852898
                     /locus_tag="C5L36_0C03940"
                     /inference="similar to AA sequence:RefSeq:NP_011542.3"
                     /note="PKUD0C03940; similar to Saccharomyces cerevisiae
                     YGR028W (MSP1); ancestral locus Anc_4.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321934.1"
                     /db_xref="GeneID:40384252"
                     /translation="MNRNDAFKLISECVLLTTASFSVYYLLNTLMGDPSHRNNDEKKR
                     TAKHLSKLKKQSPEMKQVLDSLSNYEKIMLAYLIPPTDIEVSFNDIGGLEDVVSDLRE
                     SVILPLVYPQLFTQYGSLLAAPKGVLLYGPPGCGKTMLAKALAKESGSNFISIRMSTI
                     MDKWFGESNKLVDALFSLASKLQPCIIFIDEIDSFLRERSSTDHEVTATMKAEFMTLW
                     DGLVSSGRVLVLGATNRPGDIDSAFLRRMPKRFSIGLPNDEQREKILTKLLSDVQLDC
                     SVKDLVSITDGMSGSDLKELCRNAAVNSTREYIRKHILDTNGEMQIHNTKEISLRPLK
                     TKDFLDAMDPEKVMKLNVTSDLD"
     gene            complement(<854596..>856362)
                     /locus_tag="C5L36_0C03950"
                     /db_xref="GeneID:40384253"
     mRNA            complement(<854596..>856362)
                     /locus_tag="C5L36_0C03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466075.1"
                     /db_xref="GeneID:40384253"
     CDS             complement(854596..856362)
                     /locus_tag="C5L36_0C03950"
                     /inference="similar to AA sequence:RefSeq:NP_013031.3"
                     /note="PKUD0C03950; similar to Saccharomyces cerevisiae
                     YKR105C (VBA5)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321935.1"
                     /db_xref="GeneID:40384253"
                     /translation="MSNGSNLSSLHEHYEEVEVLEKKGETLGSDAYIKQHELTEEEHH
                     ESIKNANILTGPQLYLCMFSGLLCLFLVALDQTITVTILTTVANKFDAFSEVTWITTA
                     FVLPLGCLAQFWGKFSVIFGRKFTMLISVFLFEIGSLICALANTMNTLIGGRTLQGIG
                     GGGVISCIFIIVSEITSDDKKPLLLALNGATYGIASVLGPIVGGLLTKASWRWCFWIN
                     LCFAAVVFPCFYFSYNSDWKGDKSFKNIYSKLKEIDYVGTVTMVASLVLLLLGISIGT
                     SYRWGGVANITCFVLGGVIFIFFMYWNWFLSKAPVLPPLILKVGKMNINAAISFLANG
                     LFLSTLQFMSLYYQIIYDEKPLDSGVSMLSNIILTSVGTLVVGYSMNRTRRVKEFVFI
                     SGFMSALGIGIYQVVKVNSRKALFIGLQTICGLGFGFGFHPPLVSAQLVAPKPSVTDK
                     GMDMKSSVMLSTSYITFSKNIGSAFLSEISQLIYTTTLSKNLRKVALDENIPNSEILI
                     LVKNVDYMSTLIEKHGYEAGISIKKAFLQAIQNVFWLTFACSLLMTTLGCLMSNKRLP
                     KPQSKEVGKGEKDASLSMTEDT"
     gene            complement(<858001..>858480)
                     /locus_tag="C5L36_0C03960"
                     /db_xref="GeneID:40384254"
     mRNA            complement(<858001..>858480)
                     /locus_tag="C5L36_0C03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466076.1"
                     /db_xref="GeneID:40384254"
     CDS             complement(858001..858480)
                     /locus_tag="C5L36_0C03960"
                     /inference="similar to AA sequence:RefSeq:NP_010725.3"
                     /note="PKUD0C03960; similar to Saccharomyces cerevisiae
                     YDR437W (GPI19); ancestral locus Anc_5.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321936.1"
                     /db_xref="GeneID:40384254"
                     /translation="MDPTMAASAAQPLSLVSDELARDSDVTVSTGVTPQAEYKGFAAH
                     VVSGVFLAIWIAWSILPENVLHALGVYYYPSRWWALAIPAYALVVLAYLYVGVFSYNT
                     EVLTLPVCDNRNIVDHTGVVITELQDVKHVEDVLKYTHRSTSGIYDLPIGVVDQILG"
     gene            complement(<858758..>860395)
                     /locus_tag="C5L36_0C03970"
                     /db_xref="GeneID:40384255"
     mRNA            complement(<858758..>860395)
                     /locus_tag="C5L36_0C03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466077.1"
                     /db_xref="GeneID:40384255"
     CDS             complement(858758..860395)
                     /locus_tag="C5L36_0C03970"
                     /inference="similar to AA sequence:RefSeq:NP_013948.1"
                     /note="PKUD0C03970; similar to Saccharomyces cerevisiae
                     YMR221C; ancestral locus Anc_8.739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321937.1"
                     /db_xref="GeneID:40384255"
                     /translation="MYFFEAPKRRRYLQVVCAVIWCLFGAGPIFGFAALKPTLIEQGI
                     YEDLCTTTNFTDSESVDSFVDLLSRLTPPSLKTELHPDGVVSKCSKQDLKLNTMFTVG
                     AALTNVSALLIGRTLDQYGPRVCGLIGAFFLFVASVVFIYADSIKMFDPYLFGYSFMA
                     LGGPFSYISSFQLSNAFPEKSGLVLALLTGAFDTSSAVFVVYKKLYLSYPSYFTLSKF
                     YQIYLAVPVFMVVVQLLIMPNESYLTPPPELIPNPTDQQRALSLAAAQEEHIHSAVSC
                     GSTNETTPFLNNARRRSSLGDAYKSVYIEEELEDATKSKTELSYSIFGILHGYSVNYQ
                     FKTWWFILMCLFSTIQMLRLNYFVATVNSQYVYLFGSIDMANSLNKIFDIALPLGGIV
                     SIPFVGLFLDSFPTYIVLIALLGVSLFIGILGIVRNSFIAGVLHVLVFVSYRPFFYTS
                     ISDYCAKVFGFETFGTIYGSIMTIAGFGNFLQTLLDKYTHTTFNMNPIPLNLTLVGVT
                     LIVGIITVVYVFIKTREYAYVKLKGTEPRGQSGFSDD"
     gene            <861139..>862236
                     /locus_tag="C5L36_0C03975"
                     /db_xref="GeneID:40384256"
     mRNA            <861139..>862236
                     /locus_tag="C5L36_0C03975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466078.1"
                     /db_xref="GeneID:40384256"
     CDS             861139..862236
                     /locus_tag="C5L36_0C03975"
                     /note="PKUD0C03975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321938.1"
                     /db_xref="GeneID:40384256"
                     /translation="MNGELFAYKTDGFGDGLGKGPIWKSYFGQPVLQICCYESTIFIL
                     HPFSVSVGQINTGSAEPPCFEISGEVKQLSSVNQCIYQMMKMSEITNTLIIATSNGRL
                     TMYNLPDLNIYDEINLEHKIQTFDMMLNYLVVSTNNRENEIFDTSCRKFIHLKKQSSG
                     FKYPITTAIKILNSTTDMNDLPHDLIFAQAGLEGKVSIVTTTIESQTEPTVTLNTAAR
                     SAPISSSVTNPSGIYIPHDEKKFIFRAHRSTLSDNNILVGPIYSLSMVNGYLVTSGYG
                     GDNKQGGKVEGSVCFWDINHKRRVKLCRGFPHSVVQTCSWNTESGKSILVCGCSDDSF
                     KNMPVPAESSSFVHTVPPSSIVVMVLGERKW"
     gene            <862486..>863538
                     /locus_tag="C5L36_0C03980"
                     /db_xref="GeneID:40384257"
     mRNA            <862486..>863538
                     /locus_tag="C5L36_0C03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466079.1"
                     /db_xref="GeneID:40384257"
     CDS             862486..863538
                     /locus_tag="C5L36_0C03980"
                     /inference="similar to AA sequence:RefSeq:NP_013077.1"
                     /note="PKUD0C03980; similar to Saccharomyces cerevisiae
                     YLL023C (POM33); ancestral locus Anc_4.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321939.1"
                     /db_xref="GeneID:40384257"
                     /translation="MSSNSDQRSSSKSKLNSRTATTTSISQSLTGLKRLASGAQFYWY
                     LTLLSTLYSSILCILNSFIRGSNNEVTIGYYSMALSSILTTYLIIMRQTYKYKPLSVL
                     IGQIWHLFQHLSTPNQSNRENQPTQGDTSSDSGTSAGTGVERHSQLNPKYSNNILRDE
                     NAQYLLFAFAHWLFASPSFGAINSSVLYSFTIYAFFHACHYTYTNIIPLVPNISKERK
                     AQWTQVLQYIFRLNHERSRMVAANSEIFLVTYYITPLIKIVLRLISGRFWSAARGETT
                     QFWFDFKSVILFFVTIIFLRARFLIDKYTRTQVQGYDANLLRVVASPMFPAPLRNTVL
                     NFRQFWLSLAKMVSVI"
     gene            <864217..>866104
                     /locus_tag="C5L36_0C03990"
                     /db_xref="GeneID:40384258"
     mRNA            join(<864217..864766,864891..>866104)
                     /locus_tag="C5L36_0C03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466080.1"
                     /db_xref="GeneID:40384258"
     CDS             join(864217..864766,864891..866104)
                     /locus_tag="C5L36_0C03990"
                     /inference="similar to AA sequence:RefSeq:NP_013950.1"
                     /note="PKUD0C03990; similar to Saccharomyces cerevisiae
                     YMR223W (UBP8); ancestral locus Anc_8.742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321940.1"
                     /db_xref="GeneID:40384258"
                     /translation="MTAIAKKSVATKSVPSKSVPKKSTPFDNSHYNNPTQKETCDIIT
                     KPQTNYLENKGLESFVSFPPCIHLQKVMESSSRDAILKTYSASIKIVALGLQSLDEER
                     NNNSNNNPNAYSRLAYVDKEGKTLSLKALQRARSKIIKCNDCVNSNSACHTKLLMCLQ
                     CTNIGCWSGKHALMHAKSTGHVFGINANNGELICLKCTDLVSHPLLERIRCKTLKSIG
                     VLKNSLNTPYFKVEHELNKRQIIHDLSHLPSLKETMGLRGFINLGSTCFMSSVLQTVI
                     HNPYLKRYYLSGGHLNCPKDRNECLSCCLNDIFQDFFTNPAIVGYGLTSFIEAAWRVK
                     RSLAGYSEQDAHEFWQFLIHQIHKNDTTSARYLKNKESTPAVENDNTRQPEPKSCDCI
                     IHKTFSGTLESTLTCTVCGSSRKIEDPMLDVSLEIQDKRDGEKASLADLHSCFMKYTK
                     VEDLDVLYECQSCKTRTKVTKRLALKKLPPVLSIQLKRFEHLGVSSKIDYHIDIPHIL
                     DVQEYVSKSGYNNQVTTYELFGIVCHLGSVNTGHYLAYVKATNGMWFKFDDAKITRMN
                     EADVRKVNAYMVFYCISEYSK"
     gene            complement(<866165..>866950)
                     /locus_tag="C5L36_0C04000"
                     /db_xref="GeneID:40384259"
     mRNA            complement(<866165..>866950)
                     /locus_tag="C5L36_0C04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466081.1"
                     /db_xref="GeneID:40384259"
     CDS             complement(866165..866950)
                     /locus_tag="C5L36_0C04000"
                     /inference="similar to AA sequence:RefSeq:NP_014924.3"
                     /note="PKUD0C04000; similar to Saccharomyces cerevisiae
                     YOR281C (PLP2); ancestral locus Anc_8.743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321941.1"
                     /db_xref="GeneID:40384259"
                     /translation="MLPGFPDQKVQVEVDLTEDTEWNDILRSKGIIPEKEPDPTEQLE
                     EALADAIAKQHENRLEDLDIDELEALEDEEDEDFLAIYKQKRMAEMRQLASREKFGSI
                     YPISKPEWQREVTEASKDATVFVHLSNESQLQSRLLSIILREAAQKFKEIKFCEIEGQ
                     RAIEGYPEKNCPTILIYKDGELVKQLVTLLMLNGNDTTLKDVEALLVDLGSIDIKDKR
                     LIINQEEDDDLRESHKLRFQKKSLRGKSGLSDDSQSDEDDFFD"
     gene            complement(867079..867170)
                     /locus_tag="C5L36_0Ctrna6K"
                     /db_xref="GeneID:40385080"
     tRNA            complement(867079..867170)
                     /locus_tag="C5L36_0Ctrna6K"
                     /product="tRNA-Lys"
                     /note="PKUD0Ctrna6K; codon recognized: AAA"
                     /db_xref="GeneID:40385080"
     gene            <869855..>872668
                     /locus_tag="C5L36_0C04010"
                     /db_xref="GeneID:40384260"
     mRNA            <869855..>872668
                     /locus_tag="C5L36_0C04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466082.1"
                     /db_xref="GeneID:40384260"
     CDS             869855..872668
                     /locus_tag="C5L36_0C04010"
                     /inference="similar to AA sequence:RefSeq:NP_014281.1"
                     /note="PKUD0C04010; similar to Saccharomyces cerevisiae
                     YNL118C (DCP2); ancestral locus Anc_2.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321942.1"
                     /db_xref="GeneID:40384260"
                     /translation="MSIPLREGFVDETLERCLEDLLVRFVVNCPEEDLSSIERVLFQI
                     EEAHWFYQDFLRTLNPLLPSMKMKQFTNTLIAQCPLIWKWGDPSEALAQFGKYKSTIP
                     VRGCALLTPAMDKILLVKGIESSSWGFPRGKISKDESDVDCALRELEEETGFDATDLI
                     DEDAFVERTIKGKNYKIYIVKNVPEDTVFSPKVRCEIVDIQWKEIKQLSKAVKTSGNY
                     YLVGSMLKSIISYIKRIKNNDSEQELKRLATIQLKKILGINEFSTDKEEYETADPGRA
                     LLSALQSSAKGAQVPTELEKQIVTQNQTMLQQYPQQFQQPQQLQQQLPVHPNLQGLSS
                     HPFMSPNLLSLQQNRMIPAHSHNPFALQMFNPYMAPFGVPPHMMFNNPPVPPIMGAGV
                     SSQSMQLAPSASTFSKPQFSLANKRQSTENSKELLSILKSKPKQEQKKSNSIELLNIL
                     KKEPVNQQSSPSSAPSSAPVPIRILKREKPPTKEESKLDSFSATEEKERSNSRNVQEP
                     LDITEPANKETSRDISKPLSSGKPIVLLRKNSNISAFSTTGTSKPETKIEPLREAPSS
                     IGAGGVAQKTKQKPQKSLDNLSLLNMPNPDNIKDPSAELLNILKNSPATGNATPANST
                     PGSRSASVNASSDPSRNLLDLLKSKPTTPLPLRTSRSPELGSSKDLLDVLKGKPNNSN
                     DQVSSQNLSNMSHAQSGTPVAASPDSDPSKNLLDKLRSTPRTPVVTDTDPSKDLLNML
                     KSKPTTHNSPVPSQSADLLSTKAAKTAAPNTPFVDPSKDLLSLLKDEKVPPVSSVMDT
                     SDKLLSMLKSKNDTDETPANKEADSTAAILEAHNQARTTPIAVSQDELVDLLKNAKKS
                     TEYNTTPNHTTTSATTPSSKQSACLLSVLKGPSSQNVSDVTFNDDSDSDDEEDEFQDF
                     EDFDDVDDIEGEYILNGGLYADD"
     gene            complement(<872703..>873470)
                     /locus_tag="C5L36_0C04020"
                     /db_xref="GeneID:40384261"
     mRNA            complement(<872703..>873470)
                     /locus_tag="C5L36_0C04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466083.1"
                     /db_xref="GeneID:40384261"
     CDS             complement(872703..873470)
                     /locus_tag="C5L36_0C04020"
                     /inference="similar to AA sequence:RefSeq:NP_011618.3"
                     /note="PKUD0C04020; similar to Saccharomyces cerevisiae
                     YGR104C (SRB5); ancestral locus Anc_3.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321943.1"
                     /db_xref="GeneID:40384261"
                     /translation="MVQQLSLLGQISESKIRRLILTLSTLTGNIHSEMNQHTVILKPR
                     YPFTPEIVPGKVTQIESYRIRMNRIWESGYPLDISARDDIKGDSITKQKKEFLNDSIW
                     TLQLSDIPAGGNQPVLIQNLYETTIYETDDIIGYLDELGYMHETEFWSHGRRFFYGDV
                     IIEVLRLFIIDSQSIEEVEDERVKLKLLDDSGSYLVKAYVNVGTINDVENVTYGIKQL
                     EKIKRILEEVIELHVPDRLAMDSRINSRIANTNRQNI"
     gene            <873672..>875921
                     /locus_tag="C5L36_0C04030"
                     /db_xref="GeneID:40384262"
     mRNA            <873672..>875921
                     /locus_tag="C5L36_0C04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466084.1"
                     /db_xref="GeneID:40384262"
     CDS             873672..875921
                     /locus_tag="C5L36_0C04030"
                     /inference="similar to AA sequence:RefSeq:NP_015006.3"
                     /note="PKUD0C04030; similar to Saccharomyces cerevisiae
                     YOR361C (PRT1); ancestral locus Anc_7.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321944.1"
                     /db_xref="GeneID:40384262"
                     /translation="MMKNNAIECTTIPNIIEDIQFEFLEVTMSVEFDPSTVDISQLDF
                     SDLEEKYSVKQENNLIDCCVLCDGAPIAPESKAPVLKKVLTKLFSQSGKVEDMYLPVE
                     DGKTKGYLIIRFSNPIEALKAIKSLNGKKLDVKHRLLVNKLSDIEEYVLSGKVNDEFN
                     APEFPPFKETGHLNQWLVDPKGRDQFLINYNQSVGIYWYRKNLENEAVIEPREQWTST
                     YMKWSPKGKYLFSMFPQGVQSWGGEGFQRINRHLHPGVRLIDFSPNEKFLVTLSPEPI
                     MDPMELREELRKDYPFKSEDIGKKLVIWDIAIGLPVKTFALPPNLENATRMPWPLIKW
                     SYDDKYCARMGPDALAIYETEKDFQLLGKNTVRIEGIQDFSFAPAGIKLSSSKKSDPL
                     DVVLTYWTPETENQSAKVSVMSIPNKSVLRTIPLVQVKDIKLDWNESGKYLCCNVTRH
                     KKSKKTFFSNMHIFQLSEKDIPVDKIELQDLVLNFKWEPNSNKFITISRIDKGELSNS
                     NVATESNTITFFDVEEVKVGTTSLKKWVKLTSLENNTCTDISWSPKGRFVILTSFNTQ
                     NPELKFYDVEFDDDKPKDQNPKVQSNLKLLSTQTFSGLTDLQWEKSGRFVTAVSSSWK
                     TKINNGYSIYDVAGHLLKEEHINGFKEFLWRPRPESLLTSNDKKRVRKNLKEYAAQFE
                     EADTMDTNAALREIILRRRQLLQEWNEYRNQVRSKLQLKDVSENVEVETIETVKEIIV
                     EEKEEVIED"
     gene            complement(<876121..>876420)
                     /locus_tag="C5L36_0C04040"
                     /db_xref="GeneID:40384263"
     mRNA            complement(<876121..>876420)
                     /locus_tag="C5L36_0C04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466085.1"
                     /db_xref="GeneID:40384263"
     CDS             complement(876121..876420)
                     /locus_tag="C5L36_0C04040"
                     /inference="similar to AA sequence:RefSeq:NP_009353.1"
                     /note="PKUD0C04040; similar to Saccharomyces cerevisiae
                     YAL046C (AIM1); ancestral locus Anc_7.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321945.1"
                     /db_xref="GeneID:40384263"
                     /translation="MFNQIYRSSIPLIRRYSTAHLDDAEKHIYNKLKATLSPTTLEVR
                     DVSGGCGSMYAIQIVSEKFNGLPMIKQHRLVNEILKEEIAKWHGLQLKTKAANRV"
     gene            complement(<876967..>878151)
                     /locus_tag="C5L36_0C04050"
                     /db_xref="GeneID:40384264"
     mRNA            complement(<876967..>878151)
                     /locus_tag="C5L36_0C04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466086.1"
                     /db_xref="GeneID:40384264"
     CDS             complement(876967..878151)
                     /locus_tag="C5L36_0C04050"
                     /inference="similar to AA sequence:RefSeq:NP_011795.1"
                     /note="PKUD0C04050; similar to Saccharomyces cerevisiae
                     YGR279C (SCW4) and YMR305C (SCW10); ancestral locus
                     Anc_5.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321946.1"
                     /db_xref="GeneID:40384264"
                     /translation="MLLTSVLQSLALALSVSASPVAHLHHAHKRDVVHVTETVMVTVG
                     GANTNFDQAPAATQTTIDSQPTEGTQTAYAYQVTVLQDSDDNNTATASTSTPVKNFET
                     QAAAAAATSSEETTSSSTSAAPASTSSSSSSNDDTSGAFSAGSKGLTYSPYNSDGTCK
                     DLESVKSDLEKLADYSLIRLYGVDCNQVENVLQAKKDGQKLFLGIFFVDQLEEGLEQI
                     ANAINSYGSWDDVHTVSIGNELVNDGSATPSQIGSYVSQGRSILKSHGYNGAVVSVDT
                     HVAIINNPELCQYSDYIAFNAHAYWDGSIVGADAGPWLLLQMQRVWSACGGKDVLCTE
                     SGWPHAGDNNGVAVASKDVQAAAIKSIQTTCGDDTIVFTAFDDLWKQPGSKNCEQYWG
                     IY"
     gene            complement(<878990..>879706)
                     /locus_tag="C5L36_0C04060"
                     /db_xref="GeneID:40384265"
     mRNA            complement(<878990..>879706)
                     /locus_tag="C5L36_0C04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466087.1"
                     /db_xref="GeneID:40384265"
     CDS             complement(878990..879706)
                     /locus_tag="C5L36_0C04060"
                     /note="PKUD0C04060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321947.1"
                     /db_xref="GeneID:40384265"
                     /translation="MQEKVDADGRWAYYQDDNRRVREDVVGIVVAIVVSAVCVVYLDK
                     ASIKRVIGVWIEQIVGINLPNGTNTTNTTTNNTTNTTTIIITNTTTTIDTNTILTVIG
                     IGTLLYSLAVVFRTVARVGGGATARGGGDGVLVVRGVGVSLMTSRRHPNGGVKFVPWG
                     VILRAVKVEIFQGCRVCEQVYLVCLEDNNNVKFLLSNPCNAAAVAAQQNACCAGATLI
                     PIVGGEELQERVYNFVNTCL"
     gene            complement(<879977..>882085)
                     /locus_tag="C5L36_0C04070"
                     /db_xref="GeneID:40384266"
     mRNA            complement(<879977..>882085)
                     /locus_tag="C5L36_0C04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466088.1"
                     /db_xref="GeneID:40384266"
     CDS             complement(879977..882085)
                     /locus_tag="C5L36_0C04070"
                     /inference="similar to AA sequence:RefSeq:NP_014359.3"
                     /note="PKUD0C04070; similar to Saccharomyces cerevisiae
                     YNL039W (BDP1); ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321948.1"
                     /db_xref="GeneID:40384266"
                     /translation="MSSINKSGKRFIPKMAGRGRRAATATPSAPVSVTRPVLTPIATP
                     VSTQTSTQATEVENLLESQTPLNTQEAQDASVNSKPLPTPLSTQHSIPIVPEEENEEE
                     NEEPLSDVDELKEDCNSIDAGSSGSKVAPALNQVARKTSINVCGEERKPSATSSGLNF
                     TQPKPHRTRLNSLSQPSPIPGVNNTRRPSATTVSGLENGSRRGSQVIPMIPVSRRGSV
                     NISRRSSVGTVGAVGILVGENGRRGSVVGENIRNESSVSVSIPVFKSKKRRVSVRQER
                     GGDWNGVTEKLFGKKESFMDKQLVGDVREHGMDGMDEDAEGATERAQEVKKDREEEVG
                     KLEITDEDEKLGKKLIYNNETKKYEAVDVEELRNYIAVENLPIKYKFSHSVESARELR
                     DIRVKAEGKLSKNLKINERKILMGELCKPFLPIGETSDNYERALEAEAKMMKTRVERR
                     KIREKARQLRMSEEEVVKLSENYNLQVMEINESERRAKVKELMDKENEDTRRHNVPVL
                     TMEGGKVTYSHESTVVDRHEDTKVEMERVEENPFENIVTSSSYTKRRTTMKWTAQEVA
                     ELLRGVSLWGTDFGLIAQLFPHRTRKQVKARFLLEEKQRPHLVEFALLRKAPVDVDEY
                     SGKSGVKFKDLSEYKREFEELKEKHEQEILKMGEARERAIAEDRAGGGGGVVIPKKRS
                     RKAVLAEFRKNEEVVGVLEK"
     gene            <884949..>886106
                     /locus_tag="C5L36_0C04080"
                     /db_xref="GeneID:40384267"
     mRNA            <884949..>886106
                     /locus_tag="C5L36_0C04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466089.1"
                     /db_xref="GeneID:40384267"
     CDS             884949..886106
                     /locus_tag="C5L36_0C04080"
                     /inference="similar to AA sequence:RefSeq:NP_014363.1"
                     /note="PKUD0C04080; similar to Saccharomyces cerevisiae
                     YNL035C; ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321949.1"
                     /db_xref="GeneID:40384267"
                     /translation="MSAVELPDWVISLAPSSEYIYASTAKGTIHQLPLNTTKWPVMKT
                     IHAHAAPIHKLQTDPVNDNILYSCSDDATVKIWDSRTPLTNSVNTLTNSRNLPFFSLD
                     VNHGLISAGSQLKGTDSELVLWDLRKLDTTLRSFIDSHNDDITETKFHPTLNNLLLSG
                     STDGLVNIYNLDIVEEDDALFQCINYNSVHSAGFLTPNRIYILSHMETFGVFDLSTQQ
                     EFNPEDGETKGKINNDKDHGDIRSKWDCEYVVDLYAPGYIACGSNSKEVVKLYEFDPI
                     KEDFLPKNRLWTFAGGHGDEIVRDIKVVNGVAYTAGEDNHIRAWNCDAKNTERWFFKE
                     EDDGSVEERMDIEYDARKKEKKEKKEKKKDKKGKKKTSTSSKNKKHRFKPY"
     gene            complement(<886165..>888171)
                     /locus_tag="C5L36_0C04090"
                     /db_xref="GeneID:40384268"
     mRNA            complement(<886165..>888171)
                     /locus_tag="C5L36_0C04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466090.1"
                     /db_xref="GeneID:40384268"
     CDS             complement(886165..888171)
                     /locus_tag="C5L36_0C04090"
                     /inference="similar to AA sequence:RefSeq:NP_012171.1"
                     /note="PKUD0C04090; similar to Saccharomyces cerevisiae
                     YIL095W (PRK1) and YNL020C (ARK1); ancestral locus
                     Anc_2.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321950.1"
                     /db_xref="GeneID:40384268"
                     /translation="MNFASDVYPPGTQLTVGTHQVVVDKYFSKGGFAQVYTCTIQPAW
                     KTQTQACLKRVMVPDKPSLVTLRKEVDAMRKLQGLSCIVSYIDSHAARSRGNSAMAYE
                     VFVLMEYCPNKGLIDYMNTRLVNKLKEPEILSIMEQITEGVAHMHALNPPLIHRDIKI
                     ENVLIDANMSFKLCDFGSVSTPIQPPKNIEEFKYIQDDILRNTTPQYRSPEMLDLYKN
                     QPIDEKSDIWALGVFLYKLCYYTSPFEKNAINNNLNVGYDENFLILHGMYSLPPTPAY
                     SPRLKNMISKLLVVNPSQRPTVFQLLEEICNMRGKPYPQIKKQTTTFLPTPISTSSSV
                     RSYVPVTPAKMATGGGTVDNNPTSGFKYNALKQTLSNTESLVTTNDPVREITSGRSRR
                     PLSLYNKYPADRSNNRDNSVDIINFMNELSTEEVVKLSPDGKKSDKKTEFIPNALDYI
                     KSLSRQNTNQSMNKSNSTSKSKKRSSITSIKNLLTGGSTKSIDHTNDRPSHRSSLHLK
                     RNTSVDSLPDSSAYKPSTQLADLKEMSPEGKKPPQFESIDATKGSKRSIHNRIKTLFN
                     DSNEPKIKTASGYGKYTDNIIKSNTIASISPAEASHKVITKPIKSSATIDSATTANIV
                     KSKKPPPPKPKKPAYLRSTTDTQNEDFDALERRFERKFVTIDKI"
     gene            complement(<888430..>890286)
                     /locus_tag="C5L36_0C04100"
                     /db_xref="GeneID:40384269"
     mRNA            complement(<888430..>890286)
                     /locus_tag="C5L36_0C04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466091.1"
                     /db_xref="GeneID:40384269"
     CDS             complement(888430..890286)
                     /locus_tag="C5L36_0C04100"
                     /note="PKUD0C04100; Pfam Domains: zf-MIZ(1.8e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321951.1"
                     /db_xref="GeneID:40384269"
                     /translation="MDESELPSSPSDFTTPLPFDAEDGNGYQGDILRETNAPVVPSPN
                     QQFVNLPSPSLGNGRVYQFQQDGKLKLKISLKGLGECPSIDDVCNRSVEQGAPQQTAH
                     SQNSHTATSTQRDDTELSSTPNGEIPSNTQASQSVMPPSVLVQPSFIESNTNENDVDD
                     IFSDDVNLSEIEDAKIDSMKLSDSISCVKSKTTFQIVLKFSPENKYKIHTDNLSCLES
                     SKRINAKTKSKVLTPKKTKAKKRPKPLYSRLMVKNSAGVPLSVVEDNLPQAANEDDHE
                     DDGLIEQSVRLSLMDPLSGSKMVTPLRSRFCSHVECFDYGSFLAMYNLRPFRIAMRRH
                     GIASPNVGDVDILKILEDTKREVINVQQHNVQTTSFQYNAKLRTLKEKGKNLNELEWF
                     CCPICKLEFNIKKLGDVYVVGEFIDLLQDLQFEENHEHVHDVEIDMSNRGSWRWIKEE
                     DTVSTSQTPNPHKHPSTATPDPPDSEHQHDHHRSSKQTINNVEVISLSDEEDETDTQL
                     HGPSSGQQLPTKNSNEGTTVVSTPAFQKSDLVVENSEEDMLRQLDMLFESELFQKQSN
                     LHNAKFIQSANQEIQRPGVVAFRPGPFTATPATPEPVFMHGIGEEDDPIVLD"
     gene            <890619..>891770
                     /locus_tag="C5L36_0C04110"
                     /db_xref="GeneID:40384270"
     mRNA            <890619..>891770
                     /locus_tag="C5L36_0C04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466092.1"
                     /db_xref="GeneID:40384270"
     CDS             890619..891770
                     /locus_tag="C5L36_0C04110"
                     /inference="similar to AA sequence:RefSeq:NP_012241.1"
                     /note="PKUD0C04110; similar to Saccharomyces cerevisiae
                     YIL023C (YKE4); ancestral locus Anc_7.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321952.1"
                     /db_xref="GeneID:40384270"
                     /translation="MRGFLKLALTLSIITLARGHPHSVDEGHQDFMKIGLDEVLVKPE
                     STIQYIFNKLFPFGPAGNAILATTYISGPPNLILALIPSNIDVSSLNLLVSFAIGGLL
                     GDVFLHLLPETFTGQSVDLSIGTSKYVLVDDRKNIILGLGMFFGFLLFFVIDKTMRIL
                     ENDGSEEHGHSHSHTHSTVQGAEGDSANGNDNANGNDNDDDKEKEKEINPSVKTSAYL
                     NLISDFTHNITDGLAISSSFYISKSVGSTTAIATFMHEIPHEVGDFALLIQGGFSKWQ
                     AMGAQFVTAVGAYVGTFIGIALQQSLETHLDSSVEAAPGLFGTSLQMADMTLPFTAGG
                     FFYIAFSVIPELLEGERGVSRCHAAKQFLLQLLCMLSGIGFMAFIALNE"
     gene            <892217..>892765
                     /locus_tag="C5L36_0C04120"
                     /db_xref="GeneID:40384271"
     mRNA            <892217..>892765
                     /locus_tag="C5L36_0C04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466093.1"
                     /db_xref="GeneID:40384271"
     CDS             892217..892765
                     /locus_tag="C5L36_0C04120"
                     /inference="similar to AA sequence:RefSeq:NP_012240.3"
                     /note="PKUD0C04120; similar to Saccharomyces cerevisiae
                     YIL024C; ancestral locus Anc_7.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321953.1"
                     /db_xref="GeneID:40384271"
                     /translation="MDQVYLSGSFDGWTKRHVLMFDCKDKVYKCTLHLDKRTRFYYKF
                     VVNGKWWVSPRESVVQDELGNVNNVHYGEDAIGGVDAHGLDGRFCVVSTGSDDTWSFT
                     QLSPVATHHSEYSILELAHANGDANVISKGDESISSLGGTTINSYNVEESKSSTDVCP
                     SVVRHPSITSHTLLGRIRNMFS"
     gene            complement(<892876..>893343)
                     /locus_tag="C5L36_0C04125"
                     /db_xref="GeneID:40384272"
     mRNA            complement(<892876..>893343)
                     /locus_tag="C5L36_0C04125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466094.1"
                     /db_xref="GeneID:40384272"
     CDS             complement(892876..893343)
                     /locus_tag="C5L36_0C04125"
                     /inference="similar to AA sequence:RefSeq:NP_012237.1"
                     /note="PKUD0C04125; similar to Saccharomyces cerevisiae
                     YIL027C (EMC5); ancestral locus Anc_7.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321954.1"
                     /db_xref="GeneID:40384272"
                     /translation="MLTTMGSLYGLCYEKILTVVGILTLSHTAWNVYLFNHEMKWIVN
                     SHSVMTYPKMVYLELVLSMMLILYGILASLFVPSSPSIVLKEGVWTVSLMEENARHPL
                     RSISISRANSYTERMGKSTFALLETRPSFASLPERALSFQRAVGHMHATEVGK"
     gene            <894057..>895145
                     /locus_tag="C5L36_0C04130"
                     /db_xref="GeneID:40384273"
     mRNA            <894057..>895145
                     /locus_tag="C5L36_0C04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466095.1"
                     /db_xref="GeneID:40384273"
     CDS             894057..895145
                     /locus_tag="C5L36_0C04130"
                     /note="PKUD0C04130; Pfam Domains: AOX(2.1e-125)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321955.1"
                     /db_xref="GeneID:40384273"
                     /translation="MLATDFHLRTITRAVHVSGSTRHLIRAAAGNAALRSISRGITTT
                     TEKKTEAPHIELERLPPAHNTSLVRLTTESEREDGKFLTKPVFQHPGYDLEDMKAIKF
                     EHRPVQSPRDAITYNFMKYLRKSFDFCTGYIEPRDEKHQIEIGKGPNRMTREKWLARV
                     IVLESIAGIPGAVAGFLRHMHAMRLFRRDMAFIDTLYDEAFNERMHLLTFLKMARPTI
                     FTRFLLWIGQVAFGNCFFTAYVFSPKTCHRFVGYLEEEAVNTYSRLVRDMELGLCDDF
                     KNSPVPQIAKDYWKLPENATMYDVILYIRADEAKHREVNHTFANLKQKGEERNPFALQ
                     IEGVDKPQPSKTLKNHHAKGWEREELIL"
     gene            <895678..>896796
                     /locus_tag="C5L36_0C04140"
                     /db_xref="GeneID:40384274"
     mRNA            <895678..>896796
                     /locus_tag="C5L36_0C04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466096.1"
                     /db_xref="GeneID:40384274"
     CDS             895678..896796
                     /locus_tag="C5L36_0C04140"
                     /inference="similar to AA sequence:RefSeq:NP_012172.1"
                     /note="PKUD0C04140; similar to Saccharomyces cerevisiae
                     YIL094C (LYS12); ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321956.1"
                     /db_xref="GeneID:40384274"
                     /translation="MLSASRLSLRRAYTTATKNLTIGLIPGDGIGREVIPAGKQVLEA
                     LPSDYGLKFNFINLDAGFELFKKTGTALPDATVDALKSSCDGALFGAVSSPSVKVAGY
                     SSPIVALRKKMGLYANVRPVKSVEGTGRPVDMVIVRENTEDLYIKEEKIFEKDGQKVA
                     EAIKRISESATRRISKMAYEIALQRQQVRDLGGESLHSKPSVTVVHKSNVLSVSDGLF
                     RETCKKVYEENVDKFASITYQEQIVDSMVYRMFREPEIFDVVVAPNLYGDILSDGAAA
                     LVGSLGVVPSANVGDNFAIGEPCHGSAPDIEGRGIANPIATIRSTALMLEFMGYSEPA
                     AKIYSAVDANLKEDTIKTPDLGGKSTTQEVVDDIIKRF"
     gene            complement(<896891..>898354)
                     /locus_tag="C5L36_0C04150"
                     /db_xref="GeneID:40384275"
     mRNA            complement(<896891..>898354)
                     /locus_tag="C5L36_0C04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466097.1"
                     /db_xref="GeneID:40384275"
     CDS             complement(896891..898354)
                     /locus_tag="C5L36_0C04150"
                     /inference="similar to AA sequence:RefSeq:NP_014376.3"
                     /note="PKUD0C04150; similar to Saccharomyces cerevisiae
                     YNL022C; ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321957.1"
                     /db_xref="GeneID:40384275"
                     /translation="MQVYRDAQQFLLPSQKKGSLQTRIFETCKNSKFIKSNPKHLYAL
                     VSSTLKYKPFILKIMKKTKIMEVEKKAKIPEPVMILMIHDLLFSKSKRIQSKQHAWKD
                     AIIRNKPRLESELARMKIKHGVKSLEELIEDDDTPIRWFRTNIIKTNTESLLREFKHL
                     KKVNSISEIEAPGVIYFDKYIPNLFGIHPKEKLTSTDAYKQGRLIIQDRASCFPAQIL
                     NPIPGEDKVIDACAAPGNKTTHLACILQNSKRSIVAFEKDNKRVKILRTMCEKAGGLD
                     CITIHHADFTTTRPGDFPEITGMVVDPSCSGSGIFGRAFDEQEEISEEEAREKLVERL
                     EKLSAFQFKIVKHALSFPNVRKVVYSTCSIHDEENEGVVKRLIEDEDVQKQGWKVSKQ
                     ADVLPTWPRRGHSEVFEGHQDKEELAAGCVRSLPKVDGGIGFFAVCFERGEQPIYKQP
                     SFEYCGDKELTGNCADDYIGNVGDNDDDGQKWTGIED"
     gene            <898899..>901154
                     /locus_tag="C5L36_0C04160"
                     /db_xref="GeneID:40384276"
     mRNA            <898899..>901154
                     /locus_tag="C5L36_0C04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466098.1"
                     /db_xref="GeneID:40384276"
     CDS             898899..901154
                     /locus_tag="C5L36_0C04160"
                     /inference="similar to AA sequence:RefSeq:NP_014377.1"
                     /note="PKUD0C04160; similar to Saccharomyces cerevisiae
                     YNL021W (HDA1); ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321958.1"
                     /db_xref="GeneID:40384276"
                     /translation="MAGDLIQPGKRPLEVENANGNSLSVSTPTIKSEHYDNDMKMEDA
                     NPETTVTKIKSEHQDIIIAPTRPNLQYVLLKTGLVYDVRMRYHAKLYTSYFEYIDPHP
                     EDPRRIYRIYKILAENGLIIDPSLCGSDEIGDFMQKIPIREASKEEILAVHSEDHLKF
                     IESTQHMNKEELLKATEKGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGKVKNALAVV
                     RPPGHHAEPDAPGGFCLFSNVAVAATTILKNYPESVRRIVIVDWDIHHGNGTQKAFYN
                     DPRVLYISLHRYEQGKYYPGTKAGGADQVGEGDGEGSNINIPWPVGGVGDADYIYAFR
                     KVVMPVCNEFQPDLVIISSGFDAADGDVIGGCHVSPAGYGQMTHMLKSLAKGNLCVIL
                     EGGYNLDSIAKSALRVAKVLIGEPPEELKKSYPKTESIEVVEDVIKIQAKYWKSLGPG
                     YSGLDFSTPLSMGDYDKLIAKSPDPSFIEVASRHDRLNDAVRNEQRNELFKKYKFTTL
                     PLFVEKLPDTPSYNESTILCSPEVYKSDKLVIIVHDPSRIWARRDPVTGDLDSANAVT
                     VDKSLDFIDWALKEKWGVIDINIPITVSGKDDATYNNINTSQDIMLYLWDNFLTFFNV
                     QKIAFIGVGEAYNGIIHLCGHRDVRKLVKASINFVDRATALRAVISTIDESVVDWFFR
                     NSLVFTSSKHSCWGDKDSGSTKRPRKKYGRVLRADVDNLDSIIDERFEEVCTFIQESL
                     EDYDSETDSEA"
     gene            complement(<902318..>905767)
                     /locus_tag="C5L36_0C04170"
                     /db_xref="GeneID:40384277"
     mRNA            complement(<902318..>905767)
                     /locus_tag="C5L36_0C04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466099.1"
                     /db_xref="GeneID:40384277"
     CDS             complement(902318..905767)
                     /locus_tag="C5L36_0C04170"
                     /inference="similar to AA sequence:RefSeq:NP_009962.2"
                     /note="PKUD0C04170; similar to Saccharomyces cerevisiae
                     YCR033W (SNT1); ancestral locus Anc_1.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321959.1"
                     /db_xref="GeneID:40384277"
                     /translation="MPPKHHKGGGGRYYKDEGLRRGGRRYYSQYNNYSSYNSYPTNQS
                     PYSQPSTPSPYFQPSTASNQTQPSTQSPNGQQSANPFSSRRSDTVSLNNVNVPHQDYK
                     SATNNWYYNTSHGKRSNGYLGNRPRSTSTLTTQHSRRGMSGVYREDNQRYPDYNGYSP
                     YTNSHDSYPGKPPFGKGKYYLSNHLDEYRDFNSHRQELERFPSKVESTIPKSEDEQSY
                     EPEVMEREVKREVLYKENGALSKVPTNNEMTETQTENVEGDTTDNPKLTVDDKLALDS
                     RNDNMITDQIKEASVLHEKEPSEKENPTLQENLSVPSQEDIASTRLDTAVTEQPVTKN
                     EPSMEKPQDGIKSESSDVHSNLDESSHPEKKKIETTFQTGEDGYPEIEGCIFPMLKNE
                     YRVWELKHHPKSKRIQNLKYLNESKLTRLSQYSFWNKALLVFQQADAFLLFNSLKEIQ
                     TDVKKKETKLLEHFVYQNYIWKKAVSFCDKQLEEVYGVPEKEPPKVEEKPEPRSHTSR
                     RSRHHGDSVRTEAEFMEILATLEQERERDPLIKAQYGAAIIPDMIMDPIEKYAMTRVM
                     DSNNLIKDKEAWAKRIITDPIDTFTEVEHERFCELYALHPKKFGRISYEMGGLRTSED
                     CVLHYYNTKKTTNYKQLVANKNKKNKKKVAKKKKDNKGRAETSTPDTSTVENEVQKQA
                     SSVKPDIDESGSEQGNKRKILTIDIPMKQRKVSQDSPINSTGTDSIGIIVPPPKESVT
                     PVTETPKVCAIKKDNLNSSLLDVKSELTETETISHIGTQDSSHHSNIQGTNIDEPHTQ
                     STAETCIEDRKAKKPKKHDEKPHHISSYWSVHDINKFPLLLEQHGSNWERIAAELGTK
                     SSTMVKNYYQRGLVDHPEWQEIVKLKKESDGAKQDNHAIQQDTMSLKGPSMGYFYKPN
                     NGYSSQFPYTATVPQISSHVPSQQVMSSIPVEGTIHNPKLPSLESINDANPVYRPIVV
                     DNFPSISTGIQKLPLPPHQFLTKPPPVHSLPIPSTRNNIMNMSSLLNASAVNDEMNQM
                     AVPIAHGLPHMNTSYHQSQAADGRLNLMNLLNSPTNPRGDEKVPQVPPFVNSQSTFQP
                     SISSMMNPLQQPPILEQHTVSPSQPQMQQEKPLDQVPQQRNAYTGGTSALDALARIAF
                     ERK"
     gene            <907320..>908957
                     /locus_tag="C5L36_0C04180"
                     /db_xref="GeneID:40384278"
     mRNA            <907320..>908957
                     /locus_tag="C5L36_0C04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466100.1"
                     /db_xref="GeneID:40384278"
     CDS             907320..908957
                     /locus_tag="C5L36_0C04180"
                     /inference="similar to AA sequence:RefSeq:NP_012341.1"
                     /note="PKUD0C04180; similar to Saccharomyces cerevisiae
                     YJL194W (CDC6); ancestral locus Anc_1.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321960.1"
                     /db_xref="GeneID:40384278"
                     /translation="MNHSSLKRHFNLFDENHDDLRIESMKKQKTGILRPTNNTGLLSP
                     PVTPEHVMKATMLNVDSLKPVSKNLCAKLSLPTKLVSPYTTAKNLFHRCSIPYTKSKF
                     CLSGREKESRLLNDHIVDSLQGLYSSSIYISGPPGTGKSAQTNASLNYILEHSKLIEP
                     EKNLYHLSQIGDQFIDRKIRVIKFNCMTLSNPSDLLKRLYTSITGKKCERSIESSEIL
                     RLFNSSLDGCDMTILILDEMDNIVSKSQQPLFELFTSASNRFDGNQKSKLLLIGIANA
                     LNLTDRFLPRLRANCINPTLIQFLPYTADQIKSVITEKLMTLVPHGKENKSMPPLVHP
                     AAIQFCAKKSAATTGDLRRAFDIMYASIDLFEQSQIQKVQLVELVKQDIENLPKVMIT
                     QVVKVCSNSFNANFEMKLKPLTIQQKLLLAFLFKFEEMVETETSRKKAGFLKSTNDTS
                     LNAFFAYYTEKCKNHEHINSLKRSEFLEIITALDIQGLVLINTIGASSSIKASTSNTI
                     SSLNFDNHKVTSNLPKSEFFKNVTDVPILKKIIYTSY"
     gene            complement(<909088..>910407)
                     /locus_tag="C5L36_0C04190"
                     /db_xref="GeneID:40384279"
     mRNA            complement(<909088..>910407)
                     /locus_tag="C5L36_0C04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466101.1"
                     /db_xref="GeneID:40384279"
     CDS             complement(909088..910407)
                     /locus_tag="C5L36_0C04190"
                     /note="PKUD0C04190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321961.1"
                     /db_xref="GeneID:40384279"
                     /translation="MDLDNNNFGILTTGIAVAIILYLSKLVYGRLYASKSKVKAKTYA
                     SSEKEPVPTPDPLYITPDQVKTRDDRPWRPFRFPYHQTMSIFKLDINHWLDMDKYYYQ
                     YIKEKERVIHAYGPDNFDWLPGSEEACRELMDIVKEHMMKRYPLLFTTSDNGDHVMNE
                     LTKEELDFTEPLKEHPLVYVSKMAKEDFYVVLQDKEGVHRLMAAAVPFPGGSFGIRYK
                     LGKTLDVIHGDVPYYEEKLKPSMERWFARMKPADLVERASWYISWDHKLLLNNIYALK
                     KGDKVQSDVEPTEFNVRVERQTLRRLPKSRAIIFTNHPVFYSIEEMKDEPLVPSLIKK
                     IIYEAPEGIIKYKNFEAFRDHILPYLEKLEERQVKLGLIEPSTPVKTLPTYPFAQFLK
                     DSTPEKGWSNPKHPTNYSEKFNEEIENAAELEVRTFERSAKVGTVGF"
     gene            complement(<910747..>913764)
                     /locus_tag="C5L36_0C04200"
                     /db_xref="GeneID:40384280"
     mRNA            complement(<910747..>913764)
                     /locus_tag="C5L36_0C04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466102.1"
                     /db_xref="GeneID:40384280"
     CDS             complement(910747..913764)
                     /locus_tag="C5L36_0C04200"
                     /inference="similar to AA sequence:RefSeq:NP_015025.3"
                     /note="PKUD0C04200; similar to Saccharomyces cerevisiae
                     YOR380W (RDR1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321962.1"
                     /db_xref="GeneID:40384280"
                     /translation="MDHSHQSLIKPSYRERLVCQKYYVLSSCIYSNLNFLISFKVSFI
                     GLFTCLTSVPRVHCPITERNPKVMSGNQRLQSKRRQVPSEKRKRALFSCDRCKLRKTK
                     CNRIQNNDLKYDNITPCLQCTKAGVACTTSIPRKKRFYGPVKNIAFHYKCLLSLVAGL
                     FPDSDIYSFEDLIDLGHKLKIEMPKLDLADEEDNETLENLKTEKEAQPDKAITEKTDL
                     MPKKPAVIKSESVSHAANKNEDIPRKKLTKRRNEIDSLEATENQESTSKQLLITENKE
                     QPKLPKLPPGVKLKNSDNERLIMDRFGHTHFIGNFGTASLLNGLCDIIIKNSFNKKKP
                     PTSTQDLRDHSVQTITSDNAPAYQYPKQLYNFDRIEIDRFPLINTIEKEEADFYMKIF
                     FEKVHPYYFIFNRELFMEKYHIFWEEIDADMNREEADTHTVLRLSSAEICSIYMVWIL
                     GKRFQQYSFPEILPSNAKLDDETISKLIDIIKLSFTDVVLTPSIDGIRLLILFSVYLS
                     SIKVRESGYCLMELAVIQAKSLGLHRKSIVAKFNDKKADVMKRILWSLAKSETILSYS
                     FGRSSGIPWEEIDIGLPTVEDETDEEFKVFYSRSCMLTKIIFEILDYKKKSHKEPLSL
                     VSVEKALYFRRKLEKFWEGVPEIWKDYKSLPINRYKPKLHIQYHYYYIALTLPMFLYI
                     VNSQSYIIKNDDPFLALLVCGIKSSFKTAEIISYTDSKGFFNGTIYFDIFYCYNAIMV
                     LTLSYTLFKSSQNSKEKQIIDLDNLDKKYGINLDEVLKSINLIRKLIWKNLGKIDGTM
                     RRMSDIIETLLDDLGIIQILVVKYGAKPSNVKNIETKDETGKTSVSSISTGYRKIKLN
                     LNQQGRSKRTRTPTPKNERPSKSPARSKKPRRFDNMPSGGGLYPFSPMGDDQAEPYSL
                     IPTESPMGKDTISKTDSPRNFEATELDNPALGSNEIHLANNATSASDNQPALDINAND
                     NINDVLNSLSLNNDLMDALFGSELFNLEEDLLL"
     gene            <913800..>915188
                     /locus_tag="C5L36_0C04210"
                     /db_xref="GeneID:40384281"
     mRNA            <913800..>915188
                     /locus_tag="C5L36_0C04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466103.1"
                     /db_xref="GeneID:40384281"
     CDS             913800..915188
                     /locus_tag="C5L36_0C04210"
                     /inference="similar to AA sequence:RefSeq:NP_012178.1"
                     /note="PKUD0C04210; similar to Saccharomyces cerevisiae
                     YIL088C (AVT7); ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321963.1"
                     /db_xref="GeneID:40384281"
                     /translation="MTIQHYEGASIASSVINTVNTVIGAGILVLPYAFRTQSIIGGTF
                     IIIFAGIANGVGMVLQGAASKFLPQGTATFFTVCRITYPGLSLLFDFAIFLQCFGVGV
                     SYIVLTGDLLPLVYTFDGWDEHSMKFFYVLGSAFLVVPLCYMKKIDSLKYASIIALLA
                     IVYIAFLIYGYFFYAIFTNYEKIPPEKLGGISFFKPEGIKPVFKTLGVVVLAYTCPTQ
                     FSIVGELANPSMERITNIVFISLGIISSIFVSVGLAGYLTFGNTLSGNILLMYENNFY
                     TQTGRALLVLMVVLSFPLMFHPARVSFNNVCHIVTKSVVSSGTGNDVAVNSRSPLLPS
                     NEEEHHVHLLELVEEEDVPMSNTRFFILTVLLLAASYTTALSLKSFELILAVVGATGG
                     VLISFVLPGFYGYKLIASDDERYTRRLYKYSPNEAQNRIFQSKLLKNVSLFLIVWGLV
                     VMMICLWAIFFT"
     gene            complement(<915304..>916458)
                     /locus_tag="C5L36_0C04220"
                     /db_xref="GeneID:40384282"
     mRNA            complement(<915304..>916458)
                     /locus_tag="C5L36_0C04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466104.1"
                     /db_xref="GeneID:40384282"
     CDS             complement(915304..916458)
                     /locus_tag="C5L36_0C04220"
                     /note="PKUD0C04220; Pfam Domains:
                     TRAM_LAG1_CLN8(1.2e-53)|TRAM1(9.5e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321964.1"
                     /db_xref="GeneID:40384282"
                     /translation="MHGNSSSVEPLSSDYDEMRQRSALEKQQTIVDKDEKNSKFIPKG
                     NKREQRQEQKRLYEIHQIQNSELVDKAIIISSLIFYLILFIASRFVSLKFKKFYKLSY
                     KYEDSDYYDIGFDDLYFGIFWIINLLFLRSFLILFCFNPCAKLLGIKKFKATQRFIEQ
                     AWSMVYYSFSWGFGFYLYYNSDYYLDCYNIYANWPHDVLSAPMKFYYLLQSASWFQQF
                     IVLHIESRRKDHYQMLAHHIITCILTTASYSLYFTKIGHVILLLMDIVDVFLSTAKIL
                     KYAGFQTVCDLMFLFFMVSWIIFRHGVYNYVLWFTATRARDIMGNKCSTFLPSETYKA
                     CYTDLQVDIFMLLLVALQVIMCIWMYMIFRVAFHVISGGSADDVRSDTDD"
     gene            complement(<916771..>918120)
                     /locus_tag="C5L36_0C04230"
                     /db_xref="GeneID:40384283"
     mRNA            complement(<916771..>918120)
                     /locus_tag="C5L36_0C04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466105.1"
                     /db_xref="GeneID:40384283"
     CDS             complement(916771..918120)
                     /locus_tag="C5L36_0C04230"
                     /inference="similar to AA sequence:RefSeq:NP_014373.3"
                     /note="PKUD0C04230; similar to Saccharomyces cerevisiae
                     YNL025C (SSN8); ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321965.1"
                     /db_xref="GeneID:40384283"
                     /translation="MSADYWGSSQRAKWQFTKEKLHSYRLNIFQWEKQKLSTNPFYLR
                     HDTNARIYIHQLISKLGRRLAMRQIVVATAEVYVSRFLTRVSLFEINIYMLVTAAIYL
                     AGKVCECPQHIRTVLSEARNSWPEYVCADFTKLAELEYYLIDELECYLIIHCPYNSLN
                     QLVNVLGRENKPSDIDKYDENGIRCHVNLTDQEIENTWHIINDSFITDLPLLYPPHVI
                     AIAALHIVLVLRTETFDIQKGHAKMSSDSSLHIALDNTGQLTRNNWGNSPTKPKSKSS
                     KVHLINTDKVTPGDVTSLQDDIDVLSPSTNVAAGLISSNNFSLKSNIKGSLPHNNQYM
                     NVPQLQYQGGLRRKLSQSINSGQTRQHKNVVTTTMGVSTGKHNDTPDIYQNTRIEAFT
                     NFLAGSNVNLEEIIDSVQQLLTLYETWQDYDESAVRQNFRILLMSVHTSSLKNGMLG"
     gene            <918334..>918747
                     /locus_tag="C5L36_0C04240"
                     /db_xref="GeneID:40384284"
     mRNA            <918334..>918747
                     /locus_tag="C5L36_0C04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466106.1"
                     /db_xref="GeneID:40384284"
     CDS             918334..918747
                     /locus_tag="C5L36_0C04240"
                     /inference="similar to AA sequence:RefSeq:NP_010594.3"
                     /note="PKUD0C04240; similar to Saccharomyces cerevisiae
                     YDR308C (SRB7); ancestral locus Anc_5.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321966.1"
                     /db_xref="GeneID:40384284"
                     /translation="MTDRLTQLQLCLDQLLDIMFSAISYVDQNHDVIPANINEPKAID
                     PTYNPPSEFEFQASQNELAVDIILKTRQILKIIDTLPGVGVTKNEQLLSIRNLRIELE
                     QAEKEKADAVERKDKLLGFVNQLILQVSGAIAESR"
     gene            complement(<919352..>922249)
                     /locus_tag="C5L36_0C04250"
                     /db_xref="GeneID:40384285"
     mRNA            complement(<919352..>922249)
                     /locus_tag="C5L36_0C04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466107.1"
                     /db_xref="GeneID:40384285"
     CDS             complement(919352..922249)
                     /locus_tag="C5L36_0C04250"
                     /inference="similar to AA sequence:RefSeq:NP_012437.1"
                     /note="PKUD0C04250; similar to Saccharomyces cerevisiae
                     YJL098W (SAP185) and YKR028W (SAP190); ancestral locus
                     Anc_1.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321967.1"
                     /db_xref="GeneID:40384285"
                     /translation="MSGFWKFTNNYASKVNKILENENVSLEDLLDERETVSELLSSNA
                     KLIEYIRRPEILEKLVDFIVDDDDYQRKSAEFESNNEFNNENSSNSGIDEMNGSSNGK
                     ITDDISNFPSDAHDHEKANEVDAENNNNNSNSSNSRNNNNIDFEKLSQDAEGLDTSIV
                     DEDTKIEKAAAGKGEDIYLSNNEEDDDDENHNSGSESESNSDNEAEDNDEDDEEDEDE
                     DGVDDDIDEEEKHSRRAQVAAEILSMDVWSITDAFMESVDLIKKLWCLLDKEPPLPIF
                     SATYFMKINEHLLDMKTDEMIQFIHQEPNLVTRFMRHIETPPLMDFLLKVISTDKPDD
                     STGIIDVLKDQGLIPKLISFLDKSIPSSVQSAAGDFLKAFITISANNAENTTIGPNEL
                     TRQLVSEPMVKLLVEKMIQGGTGLSNGVGIVIEIIRKNNSDYDPVPVVYVTLESHPPT
                     PRDPIYLGTLVKIFAENMPKFTELLEQKVEKMLPTPFGEIEPLGFERFKICELVAELI
                     HCSNMALLNDIKGQAMVKERDEIRAILIAKHKELMKRAETDSQNSSEGIDVSKEIENL
                     KSLIKQEGTVDDTSVDDEEENNENLQSGEGGFIDNEESLREHPIVGDQLKIALYDNKI
                     IVTILDMFFKFPWNNFLHNVVFDIVQQILNATMEIGYNKYLAVDLFDRCHITTAIVQG
                     HNKCIEYEEETGLRLGYMGHLSLIAEEVVKFISLDIHRTTPKSQIIDEVVNQEDWKYY
                     VDETLADIRNKYNAVLGSDGKQMNEHDMNLFQQVYGSGEYDDEDEEDDDVILEGNDNM
                     VNGYMESEENGVETDKFSRYLGDEMSNDLNGRYEDENEGEDENDTAQKDTDDLNQSDE
                     FEGVVDSQMGGHPYHEMSAGGLDDDNIKIDDDYDIDNISDDDDVDEDEDVGDGNVVER
                     YLSHGDYGDYDDYEDPNDDGQSYKKMNHPLYQADGSLRSLSNEKFSGSSSE"
     gene            complement(<923176..>925428)
                     /locus_tag="C5L36_0C04260"
                     /db_xref="GeneID:40384286"
     mRNA            complement(<923176..>925428)
                     /locus_tag="C5L36_0C04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466108.1"
                     /db_xref="GeneID:40384286"
     CDS             complement(923176..925428)
                     /locus_tag="C5L36_0C04260"
                     /inference="similar to AA sequence:RefSeq:NP_012436.1"
                     /note="PKUD0C04260; similar to Saccharomyces cerevisiae
                     YJL099W (CHS6) and YKR027W (BCH2); ancestral locus
                     Anc_1.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321968.1"
                     /db_xref="GeneID:40384286"
                     /translation="MPQLADRRVCTTTGKGKETMPSTSTTRRSSVSAVGSSNGSVSTP
                     ANLNSRSASLNAKSKPQIITPKIQESQLGEAIQFRGQILPEFKELGQPDLVHISKYER
                     SMKQEIGEYHYVTGINTSSVIQPFMYIQTIQLNDKELATNKHMKVGTYCCYNIFSRGD
                     LRIRCQFPGSASPMVQFVPSNKSKITIQITDDEKSRKLHKETYVSSLIRAILFADSPD
                     RQLPGMCKFNPIQSTKDSKEAIVLLCHFLDRGPETGCSDIYNRPSLINNHLVDALLKL
                     LSITKYYDIAIKEIENLMSAMKLNLNVLIVKILLLKSEYAKAVRLMHDCLIRIPRDGW
                     MLNEQALFLINQNRPDLALLPAMKSVECLPSEFVCWKNLILVYILQNDLKNALLALNS
                     SPMYVNKRKDIYSALKPSNFEFPFPLEGKIENVWKDCETFGCISGPGGIVEFSSNAEV
                     SKTNKYRLKVYDEMKLNYTFKEAYDLLALMTKKCGWSELLKLRSKIFVMEDEYNEVVN
                     SEKIKENKSEDTKTIKDKSTISLTEISTRFKTKRLSEKWLDSLFLIFYENLKNVLIYQ
                     NELNANPDIQFCPLEWELVADECFRVHYFKESIVAYETCINKRFSVFAALKLLNHFLS
                     YTTNERAFDALNGEDESSAKLDEDFILNICCKLISWSARFYSEFPLICFQALATLINL
                     PDSDATVVKSKLEYKLTEIEQQQQQKRMDMTTSDKAVYREMDNSQGVMALVDRYISWL
                     QQFDQEEFSF"
     gene            <925682..>926221
                     /locus_tag="C5L36_0C04270"
                     /db_xref="GeneID:40384287"
     mRNA            join(<925682..925774,925940..>926221)
                     /locus_tag="C5L36_0C04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466109.1"
                     /db_xref="GeneID:40384287"
     CDS             join(925682..925774,925940..926221)
                     /locus_tag="C5L36_0C04270"
                     /inference="similar to AA sequence:RefSeq:NP_010925.1"
                     /note="PKUD0C04270; similar to Saccharomyces cerevisiae
                     YER009W (NTF2); ancestral locus Anc_7.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321969.1"
                     /db_xref="GeneID:40384287"
                     /translation="MSVDFNTLAQQFCDFYYQQFDQDRSLLGNLYRDHSMLTFESSQL
                     QGQRNIIEKLTSLPFQKVQHRISTLDAQPASENGDVLVMVTGELLIDEEQNPQRYSQV
                     FHLIPENGSYFVLNDIFRLNYA"
     gene            <926646..>929086
                     /locus_tag="C5L36_0C04280"
                     /db_xref="GeneID:40384288"
     mRNA            join(<926646..926672,926738..>929086)
                     /locus_tag="C5L36_0C04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466110.1"
                     /db_xref="GeneID:40384288"
     CDS             join(926646..926672,926738..929086)
                     /locus_tag="C5L36_0C04280"
                     /inference="similar to AA sequence:RefSeq:NP_012268.3"
                     /note="PKUD0C04280; similar to Saccharomyces cerevisiae
                     YIR003W (AIM21); ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321970.1"
                     /db_xref="GeneID:40384288"
                     /translation="MDIPQVPTTRPKRSKSTSPDTFESPQVPNTRPSRTVGASPIPNV
                     PSTRPKKAHEQSVSCTVPNIDHKPSSENSDLPIPSVPKSRPKAPKASYCDRQGSEESL
                     SKPTTGTIVAERDEVSSVGQHVFHAGSESQVNLLSDDDTAEKQPSLSIPIENEGNTEQ
                     LGTKAQSIISDELKRETEYEIQEEKADQENKQALDLGEKSNEFLALQNETSVNPASKQ
                     KELESTKSLDDSKNEYSFGSSDSSMADEDITYAKKDDDESKSIGKVPSEEEPQNDQTG
                     LLKEKTSTEEPLTASVVDNAEYSCIADAESRRGVPPSTEEILPESDIKHTEEPAEESI
                     EEPLSSLFTANSESVKDQAAQNFPSTAEESKSEKQVLVSQTEADTSFDVAKNSSTVSL
                     DEPIKKEEHTNKEENYEPQGLQNDGGKTKNTPSVPASRPKVHEKETPVVPTTRPKHVS
                     INSSEDTTESASASTVNKKPPPRPKKPSSRIAQFQEMLEQQQKQDLGLFNKPKPKSPA
                     KRPTFTNEIPEPNEKSIGADDSEKQYPVNRLNSNFAESLNGMIGVGLPGMAFGAGSYE
                     AIRKVKAVASSLSNEDEAESGGTVETDEVNAKDAKGDIRRARAKGPRGRKLPGSLKKV
                     VEVNDLTLGNKFSVQVFDIWTLRTDLKTCKDDTDGPKHLGLEESESTYSGKGLNEDEI
                     DLTRVNTEQDTSVREDANQRENERESVLADASETTPEGLLVDADSNKLNEIEEKKEEI
                     VEEQEGKNGAKDEEEEIEEEKVHFGATDQGKQEEENSNNDDISIVDAYLVE"
     gene            <929594..>931015
                     /locus_tag="C5L36_0C04290"
                     /db_xref="GeneID:40384289"
     mRNA            <929594..>931015
                     /locus_tag="C5L36_0C04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466111.1"
                     /db_xref="GeneID:40384289"
     CDS             929594..931015
                     /locus_tag="C5L36_0C04290"
                     /inference="similar to AA sequence:RefSeq:NP_014612.1"
                     /note="PKUD0C04290; similar to Saccharomyces cerevisiae
                     YOL030W (GAS5); ancestral locus Anc_7.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321971.1"
                     /db_xref="GeneID:40384289"
                     /translation="MKLASLLSLASTFIASANALTPITVKDNAFYVGNTDERFYIRGV
                     DYQPGGSSNLTDPLGDPDICKRDIPYFQDLGLNAIRVYTVDNTLNHTECMTALNDAGI
                     YVIIDVNTPKTSISRHDPACSYNLDYLTEIFATIDDFATFNNTLGFFSANELVNNVYS
                     FQFSPYVKAVTRDMKQYMRAKKYRAIPVGYSAADVSEVRLPLAHYLNCGDNDDERIDI
                     LGVNDYSWCGHSSFVVSGYKEKVADYSGYSIPIFLSEFGCNKVSGDRPFTEIQAIYST
                     QMSSVFSGGLVYEYFEYVNKYGLVEVDTNTDDVTKLGDYNNLKNMLSSTENPQGDGGA
                     AHYNFSECPTGLNFSISVPSQPSGFAQLVKTGPNGNNYGLEANTQDACYDDDDDSDIA
                     SSSVSSSSASSTSIKSSFGSSSTALKSSTTSSSSSSSSSSSSSSSVSSVSSISSHSHN
                     AGSAIVSNTLFSIAALTLNLLSF"
     gene            <931255..>933411
                     /locus_tag="C5L36_0C04300"
                     /db_xref="GeneID:40384290"
     mRNA            <931255..>933411
                     /locus_tag="C5L36_0C04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466112.1"
                     /db_xref="GeneID:40384290"
     CDS             931255..933411
                     /locus_tag="C5L36_0C04300"
                     /inference="similar to AA sequence:RefSeq:NP_014660.1"
                     /note="PKUD0C04300; similar to Saccharomyces cerevisiae
                     YOR017W (PET127); ancestral locus Anc_7.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321972.1"
                     /db_xref="GeneID:40384290"
                     /translation="MLAIHKRRTLDFYYKSRYVIEYVRFQSTECSDTAQLDANGAVIS
                     HLAEKLNNETTERAINPVTPVSTGVVRGSILPQYVSLKKYNDSQDLIPRLSHKLDRTL
                     FSPGVHYLQDPRTHFTNFDASLLSIPHLNELNMDKISNFIPSSRDTKLLDISKDLNSN
                     KTGKHSVNFFSSTSSMTGVLTKFHKFLSGNRPINTGNFSKVFPSQTTFTSTIDVPTSL
                     VVTPKDEDATTFSIDADRSTDSEITLSVLGNALELMLTKKPKEFNKYLKSSKLEPEAD
                     KSAYHYAKIGKFLIRSQLDAFHQNLPGRGTFDIKTRAVCAIRFDLAHTDYYPTNYEIV
                     RTHGLFESFERELFDAARIVMFKYGLQARLGNMDGIFMAFHNIKKFLGFQYLPLSEID
                     NIYFGDISDEFTRYGENVLVKTGSDYNKKGGTNTDDKSNKAGVSNQEFLSNIVNDIGN
                     HFQTKREALSTYVANKELRFSMKLLENLMDVILKDTGGVPFRMIFKKMKGKKAAGIES
                     REDEIFDDSSPFNEKSSDGRMVVIVNTLTPEELTELQMLSNEKIEKSKILLKNSQDEK
                     MSTTARIKFFSKYASEFKGKFFRLNKQILKNSKSNGGFFGYEINIQHFFNDKPSSDKY
                     PMPSVDILEDKKYKWDIKYSVNKINEEADLVYLFNKFVSNIGYSAFRSSESDANVDVY
                     TDDGYVQIDENASELQNITRAYSARALKRKSLKVKK"
     gene            complement(<933526..>935328)
                     /locus_tag="C5L36_0C04310"
                     /db_xref="GeneID:40384291"
     mRNA            complement(<933526..>935328)
                     /locus_tag="C5L36_0C04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466113.1"
                     /db_xref="GeneID:40384291"
     CDS             complement(933526..935328)
                     /locus_tag="C5L36_0C04310"
                     /inference="similar to AA sequence:RefSeq:NP_009759.3"
                     /note="PKUD0C04310; similar to Saccharomyces cerevisiae
                     YBR200W (BEM1); ancestral locus Anc_8.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321973.1"
                     /db_xref="GeneID:40384291"
                     /translation="MASIFKKAKDRSSKEKLRTSSGTSVHSHYNPENPLNAPSEVAQA
                     TRSHIARNNNELSFKKGDFFHIVARNVVASDGTIEIFDPIHGSRGRAPASCFKFFEKT
                     HNSITSPISAPNSDTESSNRGSSNIRINSTSSSVSSKHEKPTGSLFGVVLYDFKAERS
                     DELSVNAGDIIYICAHHEFEWYIAKFLNKVGEVGLVPVSYVQLIDAVTRIPFKESPRL
                     IIEGENLPTVDEWKAIKNKHKASSKNVGSNSQRNTHNSNHSNLYIFPVNPNIESFSST
                     NNKFWFLIKVTMSDNSTRMLCRYYEDFFNFHQKLLSTFPHEGGKFDTKDRRERILPFI
                     PGPVVDVTENLCHKRLIDLNDYLIQLLSLPDYISKCPLVQSFFDIMDGDEDSHHPSNR
                     SGLAVEPQRPAPNLKIINSDNTINSNSTPNNNSSNNPQQQQNHHQQRTSETLSQSNFD
                     RRSQYESTNMRSSHVSNRFSDLNKRNSTSSSTSSILSQQLQQVHLNSQKSTNSLINKP
                     DRIKLKFYYNEDIFALSVPSNIKLYDLKLLIAPKLDESNLTKDIQSAIQLFSKDDVNR
                     DNGNFEISTAIVNDDQLSGDKNFIDKGKFLVIVQ"
     gene            complement(<935748..>936977)
                     /locus_tag="C5L36_0C04320"
                     /db_xref="GeneID:40384292"
     mRNA            complement(<935748..>936977)
                     /locus_tag="C5L36_0C04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466114.1"
                     /db_xref="GeneID:40384292"
     CDS             complement(935748..936977)
                     /locus_tag="C5L36_0C04320"
                     /note="PKUD0C04320; Pfam Domains: SIS(1e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321974.1"
                     /db_xref="GeneID:40384292"
                     /translation="MTNTHHIESLPCTRGSSSSLSTLSTYIPSDASPLLDVAVGRMGL
                     VLATQSEALISLERLYSQFPTLSRGGNEVDGTSDQWAVAQLRTSLRILNNALAVGGKI
                     VLAGMGKSHKIAAKSVATLNSLRVHAALLHAGEALHGDLGIIREDHGDALVVVSASGN
                     SPEIDQLLNHVPTNVPVILVTCTRHSPLESEGRVVSIILAEVPPQCKETNIYGLSAPT
                     VTTTLCLAILDAVAIALAELHISDYQVRKELFAINHPGGAIGINHQREKLGSFNNTNN
                     TSLLSVNTVATSMTSLYSNGSIAKTQTITLEKLPDLELDILRLLTLNDYIVLSENSIL
                     LTVERLGPSTEIVLSMTIHGLRPVTQFSSLPCLIPPLDYNWSPFLLLLLLLLFSHYNS
                     LTACIASLYLQLHLLFI"
     gene            complement(<937663..>939339)
                     /locus_tag="C5L36_0C04330"
                     /db_xref="GeneID:40384293"
     mRNA            complement(<937663..>939339)
                     /locus_tag="C5L36_0C04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466115.1"
                     /db_xref="GeneID:40384293"
     CDS             complement(937663..939339)
                     /locus_tag="C5L36_0C04330"
                     /note="PKUD0C04330; Pfam Domains:
                     FAD_binding_1(5.1e-22)|Flavodoxin_1(9.5e-
                     19)|NAD_binding_1(1.6e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321975.1"
                     /db_xref="GeneID:40384293"
                     /translation="MEVLIVYSTQSGTSEDLSFRFSRKVSACKVVNTSQIQDLDDLKG
                     FPIVVFFISSYGDGEPCDDGIRFIQMLKDEKKLHIKYSLFGCGNSLYDDYQGAAHQFK
                     KLMDGLGGDLVGDVGYSDEAFNGVVDDFESWSFDYLNLLSDMGIKLNRSNGYREAYQI
                     TEVSEMPKQQSRPPYHEMNPFYARITNIVRNKDQYMHFEVELDSVHSRMKYQSGDHIG
                     IYPVNDGEIVDELMAILGIVDCGSVRVMPVNRMESCKWNRVYSSIRELLMGHVEISGV
                     LSRKFVKDLTDYFITSESTKRRLQELIRSRDVFRREVVERKLTIVRFFKEFDLSKNDY
                     TSIPLSFILETFGHIKPRYYSITSSECVEKDRVGVMIKLVKDKPNNFVGQCSQTIMLA
                     KSDTALGVFIRRSKFKLPYDLSRPLIFVGAGTGVAPFRGFLMEIVSAKYKLDQITRVV
                     MYLGFRTASACHYLYADDFARYKELLGDRLSIRIAESQVTGKYVQDLLVEDTNLVKRL
                     VENGGCVYVCGDKAGLALGVRRALGQILGGSSTHSLEYLAAVGRFKEDVW"
     gene            complement(<939526..>940656)
                     /locus_tag="C5L36_0C04335"
                     /db_xref="GeneID:40384294"
     mRNA            complement(<939526..>940656)
                     /locus_tag="C5L36_0C04335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466116.1"
                     /db_xref="GeneID:40384294"
     CDS             complement(939526..940656)
                     /locus_tag="C5L36_0C04335"
                     /note="PKUD0C04335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321976.1"
                     /db_xref="GeneID:40384294"
                     /translation="MTVRINNEQVNREIDTIRGIYRKQTFWKYHIVKISPHEFYMTTN
                     PDSRHLYIRHAPSYFVKLEIPQDDSKQSQVDKGFRLVFRQVGNETYKPIVIEKLNKKD
                     GGGWNVQCQYNEHVNGLKVDNIEGRNLKEMIAKFSAVNDTNYGEDFTMIKGYQFGNGL
                     HVCGLRERRKNLFSRGKIDGVKLAKANSVYFIDTVLFKSMKWYDPVIAVFRPCNRNMK
                     NKIAKSMLGMNSMKAKKYKLNVDFGRMNLKKGDGHGGREEEEGDDDDDDGDDEDDDED
                     DDDYADDDEVDDEISGTGGDGGYENKDQKIYEARDGLIHRHPKDDSPNDYKVGWLTIY
                     EKGRYFEKVAQGGNWQMVLGLTFAIGFEKMIDKYLKELEEVV"
     gene            complement(<942998..>944164)
                     /locus_tag="C5L36_0C04337"
                     /db_xref="GeneID:40384295"
     mRNA            complement(<942998..>944164)
                     /locus_tag="C5L36_0C04337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466117.1"
                     /db_xref="GeneID:40384295"
     CDS             complement(942998..944164)
                     /locus_tag="C5L36_0C04337"
                     /note="PKUD0C04337; Pfam Domains: Zn_clus(2.5e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321977.1"
                     /db_xref="GeneID:40384295"
                     /translation="MSSEEHSFCLNDSIEDSKQTSSVKKPCSSHHPSTNTKKSNFLEK
                     ILTDDKATSPNGNADEDSQCNSNNSILSNSACNVDHSHDLHICKKKKRARRSYNCGPC
                     KKHKIKCDMEIPCGNCKKYNRVDACLKNPPNPPSKELNAIREERKRKYLEKKMLAKQM
                     NKKLPPGNANNPDNIVPLPLPIISHEPVHVLNPNVYASSNCYVNTEPVPSLERSSTNR
                     SSSSTISNMAPTYPVIYVNQPPLPRQQPLQLSQQQSLQLSQQQSLQLPQQQQTIYQHP
                     YGPFLGSLQTQHTLQQQAAQTLPPPHVPHSLPLDYHYQYYRHPSIRPLPNQTFIQPQF
                     QSLKLSVPQQHPPLFANTLPPPMVVKSPSNDDLQSPPTRVYRAQGNEESVSKNQ"
     gene            complement(<944907..>945989)
                     /locus_tag="C5L36_0C04340"
                     /db_xref="GeneID:40384296"
     mRNA            complement(<944907..>945989)
                     /locus_tag="C5L36_0C04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466118.1"
                     /db_xref="GeneID:40384296"
     CDS             complement(944907..945989)
                     /locus_tag="C5L36_0C04340"
                     /inference="similar to AA sequence:RefSeq:NP_012170.1"
                     /note="PKUD0C04340; similar to Saccharomyces cerevisiae
                     YIL096C; ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321978.1"
                     /db_xref="GeneID:40384296"
                     /translation="MARRGKGNLASKLRHQQFEEKTQKELSKRLANKELNYSKNAKKL
                     QKNKVNEELMEKGVEIPYDEKKVFIPFNYNDRIIIIGDGDFSYSLSIVKKKLIKPSKL
                     ITTSYDSLEELYGKYTRETIDANINELRELGVTRIYHEIDGTRLCESFGIQSKNKKRG
                     DGSGKSIKMLGGLTVQNILFNFPHIGKHIKDVNRNIMKNQEMLHAFFKSCLELYQVLR
                     KQRENFKGKAEEEEVVESRESENNQDSEGGFDDYNSNHSKHNDDVFGQQKNNDEEKEL
                     ITVTLFDGQPYDNWMIKRLARDAIGYSVQRSGKFEWRFYNGYQHRRTAGLGNTNKAAH
                     TRSARIYKFEVFSPRKHSKTHQYDSD"
     gene            complement(<946239..>947642)
                     /locus_tag="C5L36_0C04350"
                     /db_xref="GeneID:40384297"
     mRNA            complement(<946239..>947642)
                     /locus_tag="C5L36_0C04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466119.1"
                     /db_xref="GeneID:40384297"
     CDS             complement(946239..947642)
                     /locus_tag="C5L36_0C04350"
                     /inference="similar to AA sequence:RefSeq:NP_012169.1"
                     /note="PKUD0C04350; similar to Saccharomyces cerevisiae
                     YIL097W (FYV10); ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321979.1"
                     /db_xref="GeneID:40384297"
                     /translation="MQAIKDPDHYLNINRQQFKTPLEVLRKNFRNVQKRIEKNKRDLV
                     ELQHEFQTASEDNRLEIVDRMIRIQRDFNDKIKHRIEHHNEYVDKMVVRIQYFVKIKE
                     LSRKYLNIKLANMNDMPEDLQEFYRHEINVMIVDYLLKNLDIEDFKDVDTHPGVKVAR
                     TLKLNDFIDSTIILQGLKIAHEIKDKHNLKLLKKWCIENKKNLKTIKELKSSKLGDIE
                     FECDFQLFIDHIINKRFSQGLIFARNNLQLNVKKLSIGSTVIWAQSLIEHINSIHAPK
                     PSNPLDYYTKSREPENTELVLAEYLKYLKNDRWIHLSNLFLLNFKFIYGMNERSNLET
                     MLILGASVLKTKSCKKLKTSGTFGDFKIPRLSSGLFIQANDCPICSIELNEICDSVPC
                     SIQSKSNIYDDAVLLPNNNVYSFKKLMFYNREDTSIQFHEFQPGGFPSLDDGRKVLDP
                     LTGETFNAYQLKKVFPL"
     gene            complement(<948059..>949480)
                     /locus_tag="C5L36_0C04360"
                     /db_xref="GeneID:40384298"
     mRNA            complement(<948059..>949480)
                     /locus_tag="C5L36_0C04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466120.1"
                     /db_xref="GeneID:40384298"
     CDS             complement(948059..949480)
                     /locus_tag="C5L36_0C04360"
                     /inference="similar to AA sequence:RefSeq:NP_014361.1"
                     /note="PKUD0C04360; similar to Saccharomyces cerevisiae
                     YNL037C (IDH1); ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321980.1"
                     /db_xref="GeneID:40384298"
                     /translation="MSPLSPPPRPSGSSAAPVVPHKSPPPRKCQLSALRSSHSLHPPK
                     CKNSSRVSSNPFFFPHFYLPHLFTHIHFTLYSCRYLLFGPPSTLLNSSTHQISLRHLY
                     LPLLFSKQIMFSSIYKKSLIQSTQTMRAMATHSLPKKYGGKYTVTLIPGDGIGKEITD
                     SVQQIFHHENVPVEFETIEMSGLEGHESKIDEAILSLKRNKIGLKGITHTPTDPFVKS
                     LNVAFRKELDIYASLVFIKNIEGVPSKLNDIDFVLVRENTEAEYSGLEHQSVPGVVES
                     LKIITKYKTERVARFAFDFAKKNDRKLVTAIHKANIMKLGDGLFRNTIKEIGVKEYPD
                     IQVKDLIVDNASMQAVSKPQQFDVMVTPNMYGAILSNIGAALVGGPGFVPGASYGREY
                     AVFEPGCRHVGLDITGKNVANPTAMILSAVKMLEHLGLDDYATRIEQATKDVLAEGKT
                     VTMDIGGNASTTEFTEAIIAKLN"
     gene            complement(<950388..>951116)
                     /locus_tag="C5L36_0C04370"
                     /db_xref="GeneID:40384299"
     mRNA            complement(<950388..>951116)
                     /locus_tag="C5L36_0C04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466121.1"
                     /db_xref="GeneID:40384299"
     CDS             complement(950388..951116)
                     /locus_tag="C5L36_0C04370"
                     /note="PKUD0C04370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321981.1"
                     /db_xref="GeneID:40384299"
                     /translation="MGLEREVADIVDQLGSIDSDVIAEGVEHLEKLLLGVCMDTNLEK
                     AFLDVQTRHLQYSLARLLLPLLLHSTTSPSPSTLPLSLQLQMYPLLRGVLLLHPESRR
                     LATRRDLAQVVANITRFGAGGNIDANSTHLVCENLLLSVALSLGDSGTVNFNILVKEM
                     QIFDGVVTLLDTGGLSSNFSNNGYSNKHSQDQVRVRCLEWLFFFIGKTSASELRRMAR
                     TRLEPAFLDRLVAEYAAENPFFLN"
     gene            <951863..>953440
                     /locus_tag="C5L36_0C04380"
                     /db_xref="GeneID:40384300"
     mRNA            <951863..>953440
                     /locus_tag="C5L36_0C04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466122.1"
                     /db_xref="GeneID:40384300"
     CDS             951863..953440
                     /locus_tag="C5L36_0C04380"
                     /note="PKUD0C04380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321982.1"
                     /db_xref="GeneID:40384300"
                     /translation="MKSHIVLGCVAAVVSSAAQSIGLILQRKSYLSPSSESSSSWYNT
                     NRQLWHLGLFLFLSANIFGSSIQITSLPLILLSPLQSIGLVFNTLFHSILLDEEFTDY
                     SLYGSILIALGAVLTAYTGGYLVEPDHNLSQFLQFARGSLFRSWVFSNVAIVSILSAW
                     ILLINSQLNRNFITLSLHNNQFLIARWLTALFSLSPQELQKLKGCLYGSISGILSAYS
                     LLMAKSSIDILIDTFSNKNWTSLLNFSAFSIVLIFVSLGLSQLFLLNKGLQNISTSIL
                     YPLVFFIFNLTSISNSLIFYQQLDQITIFLFLSLLVGSLSIISGVFLLSKNKCQDQPI
                     KLPTSPASVAPSPTDSHYVSFNSLRDLNPSDDDSVDNDNFLQPIIGKIKKQSSTSDLM
                     PSSYKSSISFSIKNLSNSLNNSYNHNHNHNHSYTNNHSHNQSLNYNSSQWKDDDYNPN
                     NTFNYSANNTLEEIQNQMAAYTDEPKSPIRLPKRQDLDTKKYHDHLKKVSELQANTKH
                     KRVLSYEQSLLLNELRK"
     gene            complement(<953605..>954300)
                     /locus_tag="C5L36_0C04390"
                     /db_xref="GeneID:40384301"
     mRNA            complement(<953605..>954300)
                     /locus_tag="C5L36_0C04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466123.1"
                     /db_xref="GeneID:40384301"
     CDS             complement(953605..954300)
                     /locus_tag="C5L36_0C04390"
                     /inference="similar to AA sequence:RefSeq:NP_012969.1"
                     /note="PKUD0C04390; similar to Saccharomyces cerevisiae
                     YKR043C (SHB17); ancestral locus Anc_1.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321983.1"
                     /db_xref="GeneID:40384301"
                     /translation="MPSHTPRCILIRHGQTAWSKTGQYTSHTDLSLTPFGVKQMEITG
                     KYLVSKDGYTLIHSDDVKLIITSPRKRAIETRDLVFKGYDLKSEIDEDIREWEYGDYE
                     GLLTKEIIELRKSRGLGEDWNIWEYGCENGEDSEDVRKRIDRLIAKIRAIHKEYMDRN
                     ESCDVVVVAHGHILRCFAARWIDIPISRNPKFMLDAGGVCVLSYQHHNLDEPAMFLTG
                     AFTVPVEEEGKGI"
     gene            <955205..>956809
                     /locus_tag="C5L36_0C04400"
                     /db_xref="GeneID:40384302"
     mRNA            <955205..>956809
                     /locus_tag="C5L36_0C04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466124.1"
                     /db_xref="GeneID:40384302"
     CDS             955205..956809
                     /locus_tag="C5L36_0C04400"
                     /note="PKUD0C04400; Pfam Domains:
                     cobW(4.7e-65)|CobW_C(4.6e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321984.1"
                     /db_xref="GeneID:40384302"
                     /translation="MTVAYQRDEPIPVTLISGFLGSGKTTLLENILKQEHGYKIAVII
                     NDISSLNIDASLIKNHKIVTTEEKVIQFQNGCICCTLRGDLLEELIKVCKGDQFDYII
                     IESTGIGEPMQVAETFTQEFSELMAETAGNEEDIGILKEIVQMGGLNKLARLDTCITV
                     VDAVNFSNDIETTDYLADRWGSKNNSMSEEDRTVTDLLVDQIEFSDLIIINKVDGVSK
                     RMLKKIKKIVHTLNPVARIITTNYSKVSNDKLLNTRLFNFTKALTSPGWLRSLDESNN
                     RIGYGNDLEKNRVTPKPETEEYGINNFVYRARKPFHPQRLYDTLCDKFQIIERINLPE
                     ADGVDENVSEEEDEEQEEEGNEQEGEKEDEENGEGEEGEDDDDEEEEEEGQELTKEEM
                     LRNKRNSPLNHVVRSKGFFWLATRYILRGEWSSAGSMLTFSAGTPWFGAMAKEYWPQD
                     PETVASVRADFEGVHEDRRNEIVFIGFKINPAKIKALFDSCLLTDEEYEEFNKVASQR
                     DLVKIEKELSTMYEDGFEDWDFIQEE"
     gene            <957180..>958754
                     /locus_tag="C5L36_0C04410"
                     /db_xref="GeneID:40384303"
     mRNA            <957180..>958754
                     /locus_tag="C5L36_0C04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466125.1"
                     /db_xref="GeneID:40384303"
     CDS             957180..958754
                     /locus_tag="C5L36_0C04410"
                     /note="PKUD0C04410; Pfam Domains: MFS_1(3.1e-36)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321985.1"
                     /db_xref="GeneID:40384303"
                     /translation="MSDIEKEQTSVDIIPTFSKDNLDPHAVLSHVVSIDGRVVDVTGD
                     VDEAMKYAFDAEEVELTDEQARKLLFKIDIYLLPLICLLYSIQFMDKVSSSSASVMGL
                     RTYYHMHGTQYSWVGSSFYLGYLILEIPMSMILQRFPVAKTIGIIVVIWGAILCLHAA
                     ASNYPGLITLRTLLGIFESGVTPAMVIITGQWYKAEEQFLRTAIWFACNGLGTILGSS
                     IAYGLAIRMNSYSIEAFKVLFIVIGCMTISVGVMIFFHIPDLPVKAWFLNKTEKKQVV
                     LRIKSNQQGFGNKHFKLHQLKEALLDINTWIFFFWAIAANIPNGALTNFGNILLSDTF
                     GYSATKSMLMNMPTGAVEIVGCILFAWMIKFVRHKLAVSLLTTIITLAGICMLAFAKQ
                     SPHSRLAGYYLVFIAPVATICALSCFTSNVAGHTKKITVNAIYLIGYCTGNLIGPQTF
                     IAKQAPEYRGGQIAMVACYAIAVVLNGWVYYNYWSENKRRDSLLVEGKIDIPHIENIE
                     FADLTDRENVTFRYHL"
     gene            <959261..>960841
                     /locus_tag="C5L36_0C04420"
                     /db_xref="GeneID:40384304"
     mRNA            <959261..>960841
                     /locus_tag="C5L36_0C04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466126.1"
                     /db_xref="GeneID:40384304"
     CDS             959261..960841
                     /locus_tag="C5L36_0C04420"
                     /inference="similar to AA sequence:RefSeq:NP_012686.3"
                     /note="PKUD0C04420; similar to Saccharomyces cerevisiae
                     YJR152W (DAL5); ancestral locus Anc_4.291a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321986.1"
                     /db_xref="GeneID:40384304"
                     /translation="MSDLEKEKDQSNVEITSTFSKNNLDPHAVLSHVVSIDGRVVDVT
                     GDVDEAMKYAFDAEEVELTDEQARKLLFKIDIYLLPLICLLYSIQFMDKVSSSSASVM
                     GLRTYYHMHGTQYSWVGSSFYLGYLILEIPMSMILQRFPVAKTIGIIVVIWGAILCLH
                     AAASNYPGLITLRTLLGIFESGVTPAMVIITGQWYKAEEQFLRTAIWFACNGLGTILG
                     SSIAYGLAIRMNSYSIEAFKVLFIVIGCMTISVGVMIFFHIPDLPVKAWFLNKTEKKQ
                     VVLRIKSNQQGFGNKHFKLHQLKEALLDINTWIFFFWAIAADIPNGALTNFGNILLSD
                     TFGYSATKSMLMNMPNGAVEIVGCILFAWTVRFFRHKLAVSLFTTVITLIGMCMLAFA
                     KQSPHARLAGYYLFSISPISMICALSCFTSNVAGHTKKITVNAIYLVGYCTGNLIGPQ
                     TFIAKQAPEYRGGQISMVVCYAVALLLNIWVYYNYWSENRRRDALLAEGKIDIPHIEN
                     IEFADLTDRENVNFRYVL"
     gene            complement(<960964..>962214)
                     /locus_tag="C5L36_0C04430"
                     /db_xref="GeneID:40384305"
     mRNA            complement(<960964..>962214)
                     /locus_tag="C5L36_0C04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466127.1"
                     /db_xref="GeneID:40384305"
     CDS             complement(960964..962214)
                     /locus_tag="C5L36_0C04430"
                     /inference="similar to AA sequence:RefSeq:NP_011726.1"
                     /note="PKUD0C04430; similar to Saccharomyces cerevisiae
                     YGR210C; ancestral locus Anc_5.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321987.1"
                     /db_xref="GeneID:40384305"
                     /translation="MARDPLIGIVGKPSSGKSTTLNSLTDANAKIGSFPFTTIEPNRA
                     TGYLKIDCACSRFGKEDLCKPNYGWCEQGKRHVPIELLDVAGLIPGASQGLGLGNKFL
                     DDLRHADALIHVVDVSGTTNAEGKATRGYDPLKDIEWLQDEIRLWIEGNLLKRWGSIV
                     RRHTATKSSIVDTLRAQFGGYGANLNLVKEAVDSIKDLPPLEEWDNEWITTVVKAFMR
                     YKFPTVLALNKIDHPDADKNVSKILLKYPDTKAVVTSAITELFLRKLKKQDYIKYEEG
                     TEFVDTFEDLGEESGLKPLDEKLKEKLENIRDLVLYRFGSTGVVQVLQEAANVLDLIP
                     VFTVRNINTFTGNSGNYVFRDCMLFKRGSKVGAVARSIMGEVTIAVIEGVGGRRISPD
                     DTIDVGKNDILTFKVAPGGGPTQE"
     gene            <962540..>964744
                     /locus_tag="C5L36_0C04440"
                     /db_xref="GeneID:40384306"
     mRNA            <962540..>964744
                     /locus_tag="C5L36_0C04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466128.1"
                     /db_xref="GeneID:40384306"
     CDS             962540..964744
                     /locus_tag="C5L36_0C04440"
                     /note="PKUD0C04440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321988.1"
                     /db_xref="GeneID:40384306"
                     /translation="MSTEHLEYTSGRILLNEKLLSTDYVKQRLRRPSEDDDLYRSLFN
                     EFSLTKNMNEELFLDYFDQLGTLIVKSKGSINPDQFCRDAVQFYSSMKGITKSPPNTI
                     GISKYLFEVLRTNKTSLPSEKIMISFLMTFGSWTQCNSFKDSCYNLLVSRIQQCCFSL
                     DSFSNPLSQRSLMLDKILERSVSQLGPILFLYAYQLGNTNVYSNQDYDMPRTLKNFLL
                     YCAKSTIFLLKWSTSVLLVNYFSAADYSQRSHNFSNLLPYIIDLTYQEAGNTTIIKVF
                     TKLCSLPLDMYPLALISKILKGAPDINKVLVEVDYVSFISNVINDYYNEEEKYIAEGT
                     SFKLSLCLNILAHLGMVNDKNKLRISSGPASTLVSNTLVKHLEILKYMRTSECKGNID
                     IRIANKAIYCSTNLTFAACTILRSLSRSASLLRSQFKSDNNVQLLIEILSVNGEDLYV
                     PYQYDSEEKLKSLILNILANLVLELNSPKRSINYSVLLGLVRGFLENGKSEELVCASL
                     SLLRNSLFSSDEFFIQKFKENVPATLILKYSKSKNDKIKLSSLNIIRNLFACSLDVSN
                     YIFNEFKDINQGPECKFIDFLKGELCHSQNMEIVLSLCYIISNLSVWQPVNKIFIVKN
                     EGLMMIMKEYLAKPINQFPKTDLAWSIKSCISWIVMNVLTNGSMEESERICHVDLEDA
                     SLADPTQRAKLLISWGFLNSLGDMIHSCDDVDSRLVLNRAFVLLNTIGTTLH"
     gene            complement(<964813..>966945)
                     /locus_tag="C5L36_0C04450"
                     /db_xref="GeneID:40384307"
     mRNA            complement(<964813..>966945)
                     /locus_tag="C5L36_0C04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466129.1"
                     /db_xref="GeneID:40384307"
     CDS             complement(964813..966945)
                     /locus_tag="C5L36_0C04450"
                     /inference="similar to AA sequence:RefSeq:NP_012903.1"
                     /note="PKUD0C04450; similar to Saccharomyces cerevisiae
                     YKL022C (CDC16); ancestral locus Anc_2.665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321989.1"
                     /db_xref="GeneID:40384307"
                     /translation="MVNDSPNNSILTFSPLMTTKKVRDHFQTPNQKNTKTTTVQQNQN
                     TQRLNSAQKSQFFPLPNSYLHQSSPQNARLINSIMEDPNDETNNNTAEEVKNVMNSTT
                     QVNEDPDKSGPYTNNINNLETSTIVDMNQPLTQADKLRLWRHDALLQHHYKTAVYIGD
                     KILSLTGDPNDAFWLAQVHYSSGNYQVARNLLLGPKFEDSIGCRYLAGLCLYKLDKLD
                     EALDIIGEINPFKKDHSIRNGDGGIKLEASMCYLRGLVYNKQNNFERAKECFKEAVLV
                     DVKCFEAFDELISNHLLSPDEEWELLECLNFDDADNNNELVKMLYTTRINKYKNLKMF
                     EESKQRLIEEFNLGDNIDVLLSQAELYFIQCKFQKCLELCSTIIERDELNIPALSKYL
                     SCLYEVGGKNKLFLTAHKLAEDYPNHYITWVAIGIYYFSIKQTADARMFFSKASIINP
                     NFAAAWIGFAHTFAADGEHEQAISAYATASRLFPGTHLPNLFLGMQYLQMNNYTLAWE
                     YLNFAYSVCSSDPLLLNEIGVLNYHKDELQRAEFYLRKALGASRSLEYGSKSWCSIHC
                     NLAHVYRRMNKLEKSVMHFNEVLKISKDDVNIFSTLGLIYLKMGKIANAIEYLHIALS
                     IQPTDSIATDLLDKALDLNLKLANKKMLDKSLSEGTNKANSNLQQQKNFSGILGEFSG
                     GNKRNRKGLGRYQNEVDDDDEIMDIESE"
     gene            <967475..>968596
                     /locus_tag="C5L36_0C04460"
                     /db_xref="GeneID:40384308"
     mRNA            <967475..>968596
                     /locus_tag="C5L36_0C04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466130.1"
                     /db_xref="GeneID:40384308"
     CDS             967475..968596
                     /locus_tag="C5L36_0C04460"
                     /inference="similar to AA sequence:RefSeq:NP_012300.3"
                     /note="PKUD0C04460; similar to Saccharomyces cerevisiae
                     YIR034C (LYS1); ancestral locus Anc_2.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321990.1"
                     /db_xref="GeneID:40384308"
                     /translation="MANKVILHLRAETKPREARAALTPKTVKQLLDTGNFEIYVEEAP
                     QSTFKTDEYRQAGAKIVPFESWKTAPKNRIIIGLKELPEETFPLIHDHIQFAHCYKNQ
                     AGWKDVLSRFSYGGGILYDLEFLENDQGRRVAAFGYYAGFAGAALGVLDWSFKQLNSE
                     DKDLPGVTPYPNEDLLVADVKKQLSKAYKKTGRYPTVLIIGALGRCGSGAIDLCKKVG
                     IPESNLLKWDINETKRGGPFQEIADSDIFVNCIYLSKPIPPFINLDLLNKDSRKLRTI
                     VDVSADTTNPHNPVPVYTIATQFDTPTVLVDTTKGPKLSVISIDHLPSLLPRESSEFF
                     ARDLLPSLKELPNRKTAPVWKKAEDLFDHHVKRLNQSKL"
     gene            complement(<968736..>970073)
                     /locus_tag="C5L36_0C04470"
                     /db_xref="GeneID:40384309"
     mRNA            complement(<968736..>970073)
                     /locus_tag="C5L36_0C04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466131.1"
                     /db_xref="GeneID:40384309"
     CDS             complement(968736..970073)
                     /locus_tag="C5L36_0C04470"
                     /inference="similar to AA sequence:RefSeq:NP_012904.3"
                     /note="PKUD0C04470; similar to Saccharomyces cerevisiae
                     YKL021C (MAK11); ancestral locus Anc_2.663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321991.1"
                     /db_xref="GeneID:40384309"
                     /translation="MSSSKQVQFRIIVGSYEHSLLCVSVTIPLDQEGEDSDSKKQAHF
                     HPIFHFSAHSLSIRSMDIAKRYLVTGSNDEHIRIYDLQKRKELGTLLQHQGSITKLLF
                     SNEVDDENHDKEKDERNEDADSNLGESKEDVYLTHKRGKWLLSASEDGTILIWRTKDW
                     EKFGVLKGHKGAVEDIAIHPSGRVAISVGADSTVRLWNLMTAKKASSMFLRGALTRGQ
                     TAQFIQFDSTGEFFVIGFRDRIMFWTTREAKMLNLLGTNKVVIMDVQFVVLSGREFMV
                     VALNNGSIDFYEFEDSLFKLESKKIKDIDGATLENLPKPTYSLQGHASRVKGISFYKE
                     IINGKLHEYMVSISSDGKIVVWNLDLAVMDQVAVYSTGERLNVVSTVQETIEKASTMK
                     PIYNPDDKYKDVATDSEYESDGESLAHIMKGGKRVSKKKQRKEKKKLLSVEIE"
     gene            <970496..>971326
                     /locus_tag="C5L36_0C04480"
                     /db_xref="GeneID:40384310"
     mRNA            <970496..>971326
                     /locus_tag="C5L36_0C04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466132.1"
                     /db_xref="GeneID:40384310"
     CDS             970496..971326
                     /locus_tag="C5L36_0C04480"
                     /note="PKUD0C04480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321992.1"
                     /db_xref="GeneID:40384310"
                     /translation="MTLQGSGNEYYSGETSRGPSSRWSGDHKGGLPGTDADTDMDTAM
                     DTGLGGLGDSLGSSRYDDLNRSRDRSRSRSRSRSASVDRIFHEGRSMGYGGERSYRSR
                     DETPRATLYVRGFVTGVRAKTLADVFERYGPVAQVDVLPPRRSDGEQYAFVAFRSISA
                     MNAVLDDIESGRPIDGGVAIDPKVGLLCERARRLPVSRRVTTAGSQRRDGRYGGRHGV
                     GLSRESDYDRGSRHERRERDCERSYRGMRSIPRSGSIPRSRSGPTSRSRSPDCAVAEK
                     "
     gene            <971707..>975510
                     /locus_tag="C5L36_0C04490"
                     /db_xref="GeneID:40384311"
     mRNA            <971707..>975510
                     /locus_tag="C5L36_0C04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466133.1"
                     /db_xref="GeneID:40384311"
     CDS             971707..975510
                     /locus_tag="C5L36_0C04490"
                     /inference="similar to AA sequence:RefSeq:NP_012299.1"
                     /note="PKUD0C04490; similar to Saccharomyces cerevisiae
                     YIR033W (MGA2) and YKL020C (SPT23); ancestral locus
                     Anc_2.662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321993.1"
                     /db_xref="GeneID:40384311"
                     /translation="MDTFMTFINGSHSSKKFGTATEDPIIAGMAKYNNTNDKTPLSST
                     SVSICGQLFETEADEVLSEFLNPQFLKQEDQGDYETPSDPKLSTSGTKMETSGTPDSV
                     CTQTTETMRVLPNTPTPSAPSPTTVAFNEQLKMFEDSKEELMNIKFGLNNEAKYIHHS
                     NVGLQYTTLPVTEHPEDPDVTATYLPMEYTEAFLRDSSEFPYKMSIADLPAQSRVETQ
                     IKLELSVSPPPKQFLLHLPRDTITKPKFTLAENTLPESIKKHLLYLEMFVIGSESISS
                     KDGRLKSCNVCKRCMRRELKRASRRKAGLVDDSSNWDLNLPKRALIINSKEIVSFPSP
                     SGNEVARKLELLSRIVCYCRHHQELDGFRIAIFLKNEQDEIIGKCHTTPILIMDRKKS
                     SKSSNSNNTGALVSNKEHLSASKNSITISQESSSEFSMATSISSTKLNPKLVTKPLET
                     DIMMARDSSNSSMGVPKTNIMSILSLKDGKNNTHGNKPPKTGRGMFSSIFSFDPSNLL
                     GDESSRQTKRQKRLWSQSDSGSYHDSINQQRYHSQSEANKGNVQDTPAMNSGHIMQIK
                     KEAISPLSSDAVSPHNHMLSSATSIFSATPERRIYEGQKMNLTSSFNDELAMNVENID
                     NIGSNSGVLDLNGLDLDVDMEMNVNLNLGEPVPTIRKIIPAQGSIRGGIEVTLLGSNF
                     KPGLEVKFGSNISLATQCWSDSTIVTYLPPAPQAGPVLVTFDSSDIAANNSVPHQIFT
                     YTDDTDKQLIELALQIVGLKMNGKLEDAKNIAKRIVGNNQMDDPSSTSFGQGDQSNSS
                     STSNQLNQQLQLNWMVVASNKIKELSTSTLNHEDILIKFLNILQIPNYIITSPNWGVC
                     NSEGQTMLHLACLKNYSKLTNFLLKSGSRVDYRDKNGFTPVHFAFIPGNRKIITMLMK
                     YNANVSNKLDNGILLSSIADSNVLDLIDGHVDVSRRSSDSTSYEDLEIDDTFDDEMEA
                     CGMDEIGFNSAYKSSSKTHYTSSYRNRKSQYARKKRVDDSEADDEEEDVDLDMDLDGS
                     DASTDKSSSGTSSIKSLDRKKNTNSFGLNLWIAMREAITSKVIELSDGQHKHGGRKHS
                     RPIHGTNVETSQHLDKTNEANDNDGEEGDALPTYDDLFPNGASLRAFINFRGHTDGED
                     DEKLSKTNRSAELEEDVGDSDVDIIAKKMHTSITSDTKLMFFWLPFMLLLLLVVIGVK
                     MNMISLNSLQLIKIRESVGSFMLGKDRFTNLLNENINYGRERMENLLHDVNGVVKTAV
                     SGVGR"
     gene            <975820..>977253
                     /locus_tag="C5L36_0C04500"
                     /db_xref="GeneID:40384312"
     mRNA            <975820..>977253
                     /locus_tag="C5L36_0C04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466134.1"
                     /db_xref="GeneID:40384312"
     CDS             975820..977253
                     /locus_tag="C5L36_0C04500"
                     /note="PKUD0C04500; Pfam Domains:
                     BCDHK_Adom3(6.1e-76)|HATPase_c(6.8e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321994.1"
                     /db_xref="GeneID:40384312"
                     /translation="MSQWKISEALRQQIYKYAKLPQTGVSLRQMVQFGPRPNQGTLFH
                     ASYFAVHELPIRLSHRVRELENLPHGLSEEPSIKLVRDWYAISFEELMAVKEPNLTEE
                     MKEILLKDRKDEFGWEKSPADHERRRAAKRRKEFIFEDDGIVIDRRNKDSALEKDDSA
                     SIIEVEDTKSHEESEFEKPIGLKTYFQRCPNDIVYPKEVIDYNINVTKVLTKIKRRHD
                     ATVSTLATGVQNWKQKQNHKYLNSPINQFLDRFYMSRIGIRMLIGQTIALNQQAQRNM
                     QNDDYVGIICLHCNIKEIIEDAVDAARFACEEHFNTMEVPKVQLYCPSDLTFRYVPGH
                     LVHMLFETLKNSLRATIEHHSKLNPGVPLDDIEYPPIKIIVAKGDEDITIKISDEGGG
                     IPRSAIPLVWTYFYTSAEKQIKEDDMLDVTNNYRAPFMGLGVGLPHSRLYARYFSGDL
                     KLISMEGYGTDVYLHLNRLSSSSEPLQ"
     gene            <977490..>979214
                     /locus_tag="C5L36_0C04510"
                     /db_xref="GeneID:40384313"
     mRNA            <977490..>979214
                     /locus_tag="C5L36_0C04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466135.1"
                     /db_xref="GeneID:40384313"
     CDS             977490..979214
                     /locus_tag="C5L36_0C04510"
                     /note="PKUD0C04510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321995.1"
                     /db_xref="GeneID:40384313"
                     /translation="MILCARELSSRRLPLRFGLCYLQKREQSRLPAISKFENDLFNTF
                     TKEHHHGMAQSCDDQQLFADSQFQMLKISEHGSLIQHEENTHDYLFNDQCMFDEEELN
                     LRNTFQEKDTEINFIRNMPKYSRSKNPNETKPFRLIKLSNDAKIESSSIDDFFCRVIG
                     NEAAVKDYHYQMPVFPTELTNYSLKHYLRQVNVIDLNYDIHGFEKLIFFQILKICRNI
                     SRFDGILDIVVLHELIKFLGKYGMIRSIFKVIDAFEHLGIHPNKDTLHLLIYKLNDIK
                     GLRWRKDLLNFYVLLGTRKWGVSPDKTTEVLSAIQSPPGRPRLAITKRLINEGIDDSY
                     FQNTMFHDYVTIEIESREHPYFERFYHFLLKRKAITDTHENKRILFNMYIEKLASCCK
                     LRHAIEEMKTHEELTTPDTYTALIDQTIKNNVWTGFALLNHLMSQGNVRVSDIGMAII
                     GNYRTIQENFTKQAQNVNRLHQHNMPQIYNIVIKMLLAKCGYQISGNNKFLLPVERDL
                     PLDEETVISDFQKIQFWNLDTEYSHYNGLLTSRCGGSWIFKLWDVMDIESSPQDNLYI
                     NPITFPWR"
     gene            <979495..>979776
                     /locus_tag="C5L36_0C04520"
                     /db_xref="GeneID:40384314"
     mRNA            <979495..>979776
                     /locus_tag="C5L36_0C04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466136.1"
                     /db_xref="GeneID:40384314"
     CDS             979495..979776
                     /locus_tag="C5L36_0C04520"
                     /inference="similar to AA sequence:RefSeq:NP_009827.3"
                     /note="PKUD0C04520; similar to Saccharomyces cerevisiae
                     YBR268W (MRPL37); ancestral locus Anc_1.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321996.1"
                     /db_xref="GeneID:40384314"
                     /translation="MLRQSVRFFGSTRAVLQSSCKEGTPINLNIYKAGKPIVAKKDEE
                     YPDWLWGLLDNDLQMENLKKEDWFRYNRKLIKKQNVQRIKMNNFMNNMK"
     gene            <980023..>981720
                     /locus_tag="C5L36_0C04530"
                     /db_xref="GeneID:40384315"
     mRNA            <980023..>981720
                     /locus_tag="C5L36_0C04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466137.1"
                     /db_xref="GeneID:40384315"
     CDS             980023..981720
                     /locus_tag="C5L36_0C04530"
                     /note="PKUD0C04530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321997.1"
                     /db_xref="GeneID:40384315"
                     /translation="MKRENKIFHIGEAPNDRFYMCMRSRRLNLIYTRRVMYSTMLSRC
                     RVQWSSSIAKPRCLLWGKRGIITGHGKTGSNAVPKTGNVSGEEKSKSSSGSPFDSSFS
                     FQLFLIVGAMGAGYTLGKTAIETSPPVTLFPNGSTTSYEDLKEFEKVDKERLQKRYDM
                     FRRCALRILENKGIEVDMKYGKNEFLFEEKYCSKDVSQIMNEPDEIGDVFFGKDVKEF
                     KDKEFVWYPETTEDVSAILKTCDEFKVPVNSKSSRVPSIGLTFSIDFSNFDKSDDSDN
                     KIALTCNMTNEEIKAKLKNTFDLNNRLDALDLFFIDCGLKLSSSNNKLINNRFDSKDV
                     DEIECVLPDGNIINVRNDINDKDNYKLYQLLTTFQDDVAIITKAYIDKSKRVDQHSAA
                     DEKSLIVIGANDMSQLQNLIKEIKHKVNEEVAIVDNNGCLQILDRFGEYRTFAIVKTD
                     NTTLTKLNKKFQNGLVVADGCRIESLPVSMVGNPALQSGYLSDCVTSGGNGVLVKEKL
                     SATQVKAYYVTSPVAETKVVDPQSTLRSVLRRLKLAMDNGRILNSGSAVATVSTSNM"
     gene            <982241..>984754
                     /locus_tag="C5L36_0C04540"
                     /db_xref="GeneID:40384316"
     mRNA            <982241..>984754
                     /locus_tag="C5L36_0C04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466138.1"
                     /db_xref="GeneID:40384316"
     CDS             982241..984754
                     /locus_tag="C5L36_0C04540"
                     /inference="similar to AA sequence:RefSeq:NP_011442.3"
                     /note="PKUD0C04540; similar to Saccharomyces cerevisiae
                     YGL073W (HSF1); ancestral locus Anc_6.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321998.1"
                     /db_xref="GeneID:40384316"
                     /translation="MNGPNRNDREASQMGNLNDGRTVSTQSNDNNKQYSPNQIESLQQ
                     IPIEGKGENHTVQGSVQPLKGSSRSADHLNTNSLPMATTPLFLEPVYPDDPVSMDILN
                     TNTDINGDLNKDSIMHSMMPSLSLNTMDKDETTNSKIVPLTSDSIGYDAENGSTSSTF
                     ESINQIAKKSEKSLAELTNSTEKSLAALKKPKLKKTTLAPAKRPAFVVKLWKMINDPE
                     NEKYMTWIKNGNAFQVNDRENFMKYVLPKYFKHNNFASFVRQLNMYGWHKMQDVNSGS
                     LAQTEEIWRFEHPNFRKGREDLLDSIVRNKPGKDNEEEDVDIKVLMDQLEKMRQNQRA
                     ISDDLRRVREDNEMLWKENFIARERHKIQSETLDKIMRFLASIYGNNTSRLLDQVNDP
                     NTSDLVSHNNNVQYGPTQGRPDYNYYNQYASPNNNSMYNGYPNNNNMNNSIALRGQVQ
                     GKGYPQSPRVLPQSVATRQQAHRRSNTPQTYMNSQTPQRQQTDQLYTVQTPYYEASQS
                     VASSENPVQTKKMLLLTNRSNNSLSSSSTRRTSKNPNELRMKNVGYSASTSDSTDSNI
                     QEIHRGPENRNSQINGYSQVPDYVNMPRQFGGQGQSRIVHLSPYDSQDNEGLQFSPPT
                     TGGFNSRNPNVQGESLARDNVDNVGQEQDPLQKYVDDGYISMNNTQKLTPNEYIIHQP
                     QAQRLSRSESQSNSGSGSDMVGTPIQIMGNIHQQLSKNQGALKQVNDWLNKYNGGAEP
                     DMPAPDDFKVDDFLKGPLELSVAPTPIEFNDNDFINVNTPIHTPTIPTAQLNTRIPGN
                     VLNVSSKRPLIHDDSSLDLDEHLLNSGTVHPDPKRFKPA"
     gene            complement(<985128..>986504)
                     /locus_tag="C5L36_0C04550"
                     /db_xref="GeneID:40384317"
     mRNA            complement(<985128..>986504)
                     /locus_tag="C5L36_0C04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466139.1"
                     /db_xref="GeneID:40384317"
     CDS             complement(985128..986504)
                     /locus_tag="C5L36_0C04550"
                     /note="PKUD0C04550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029321999.1"
                     /db_xref="GeneID:40384317"
                     /translation="MAGYSMTFKRFSVFRNYKCRFFSKVSVVREEYDNPRIDILSKLI
                     NVARLEGSEFETSLDEESIIECLRGMTNVPVPKSKYPFLSYSNFPRSKFLPPMPKSES
                     KEELVQFVDKLTTFQYPKPRIPQISRLIHESVSAHPEFFPKESYLKIVYFYNYHSNLK
                     LCFDILNTMIQRTDLKQDIEFHNVIISDTFKPSNMKKVIERLESLEHRGMKANTNTWY
                     HGFTRMKNSDPKIQLIEMMQELNIPLYPILHLLKPLAGYFTPEKLNKLFEKEGVSIER
                     DTLTSPLFNILATSYLRHNQISELWDLIEGTPQLRPFMNTGLYVTFIEHFLSNNQLGF
                     AFAFTQYVQSKFGLRVSKILISMIVNKHLPNCSYFENWISIVRILYPKAIRDSSIFLN
                     TKTLSNLQDYATLYRFDNNFESVSRKDKEIKRMIDKSLVWKDKPIFSLSENAKSFIDC
                     AKMVGQPI"
     gene            <986832..>988025
                     /locus_tag="C5L36_0C04560"
                     /db_xref="GeneID:40384318"
     mRNA            <986832..>988025
                     /locus_tag="C5L36_0C04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466140.1"
                     /db_xref="GeneID:40384318"
     CDS             986832..988025
                     /locus_tag="C5L36_0C04560"
                     /inference="similar to AA sequence:RefSeq:NP_014302.3"
                     /note="PKUD0C04560; similar to Saccharomyces cerevisiae
                     YNL097C (PHO23); ancestral locus Anc_2.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322000.1"
                     /db_xref="GeneID:40384318"
                     /translation="MDHDVVVPVKTSQRILERKQRQLEKEQEEKRKEVKTIADAQESD
                     ICLGLNELTDALQAFPQGVISYFTLLKEIEAKCIYTVPHLMAYIKRFLAMRKDHPKRG
                     LLLSRIRECIKELMPCLEEKMHVATIANDLVRKYTTRLDQAYDIIVTNEIPEIVRIGP
                     LWEPCMKVSEPKTLQQQRSESRREAIAAKRAKNGDEEYESAVGEDSMGPSKKGVKGKK
                     EKVYQNTQYAGNPHSSNVNVFPNGRKRRNGDVVNEDEYVNAKQVNSNGTRNVSSSNKK
                     TKAIKSSKGVRKESGNGGNNAAPSNGKRKGGGGATDYGDGANARPKTKKEEKVEEETG
                     SREAYEGEPVYCYCQQVSYGEMVGCDGEHCEKEWFHLPCTGLKEPPKGEWYCDECKVK
                     LGIKP"
     gene            <988224..>989330
                     /locus_tag="C5L36_0C04570"
                     /db_xref="GeneID:40384319"
     mRNA            <988224..>989330
                     /locus_tag="C5L36_0C04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466141.1"
                     /db_xref="GeneID:40384319"
     CDS             988224..989330
                     /locus_tag="C5L36_0C04570"
                     /inference="similar to AA sequence:RefSeq:NP_012906.3"
                     /note="PKUD0C04570; similar to Saccharomyces cerevisiae
                     YKL019W (RAM2); ancestral locus Anc_2.661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322001.1"
                     /db_xref="GeneID:40384319"
                     /translation="MSEIKPELGFYIWQYCLGFLFVYLDSHFEENPPCMEMECGEYNF
                     DDISPLPIGDEAAEVKDIVLCKIMYTDEFKQVFSYLRALMEKEELSRRAMYVACRAIS
                     LVPAHYTVWEYKFRIVKELVNKNEYDVLQELEWCSHVSLANEKNYQIWHYREMVIELL
                     INTAYGGEKEKYDLCGEYDIIKQMLARDTKNYHVWSHKRWVVQYFGLFRSGEELQYTE
                     TLIDEDVRNNSAWNFRHFILFGDKADAKKNRDTLSHEIGFTISQIARAITNPSSWNYL
                     KFLYGECLQEEFRDLYDEIKKTVLQYTLSASGDEERLLDQGHHRVAVPAFEVLAEMHA
                     HEGDADAQRHVYGLLAEKLDPVRRNYWKYKSSLV"
     gene            <989645..>990679
                     /locus_tag="C5L36_0C04580"
                     /db_xref="GeneID:40384320"
     mRNA            <989645..>990679
                     /locus_tag="C5L36_0C04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466142.1"
                     /db_xref="GeneID:40384320"
     CDS             989645..990679
                     /locus_tag="C5L36_0C04580"
                     /note="PKUD0C04580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322002.1"
                     /db_xref="GeneID:40384320"
                     /translation="MSTLSKKTKGQLVEIAEDLSIDISDCKVKKEVYEVVKSYFINNA
                     DSFDTNSKYYELATLSKMGSPKKTVFVEGDDGDVKEVDIIEEEENETEQAPDSEETDG
                     ESSSDTQGGNEGVQDDKEKDVPGYKDEEDDDDDDDDDDDLDFECYTNFFKALQHGTLP
                     DYIELKNYEIRDYLGDPYSINEVAFYIESLILLYSLSQFTHLGVYLPSSVSSILPKFI
                     NNIPVLSVDSFTCENIVTVSLWYLFAKALPLFFSYYINFTYDFDRDAFTEALAKLFFA
                     IIVFKADVPTTIKDEIKYAFTYDSISVSTFKHFAYVATANLRYIFGNWVLIDALFTSI
                     LALYANLAFV"
     gene            complement(<990973..>991629)
                     /locus_tag="C5L36_0C04590"
                     /db_xref="GeneID:40384321"
     mRNA            complement(<990973..>991629)
                     /locus_tag="C5L36_0C04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466143.1"
                     /db_xref="GeneID:40384321"
     CDS             complement(990973..991629)
                     /locus_tag="C5L36_0C04590"
                     /inference="similar to AA sequence:RefSeq:NP_012591.1"
                     /note="PKUD0C04590; similar to Saccharomyces cerevisiae
                     YJR057W (CDC8); ancestral locus Anc_1.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322003.1"
                     /db_xref="GeneID:40384321"
                     /translation="MRFSEDILYAMPRGALIAIEGLDRTGKTTQTEYLLDKLSKLKVK
                     HKLVKFPQRDTDIGQLINTYLTNKSLLLNDQAAHLLFSANRWELSEQIKNDLNDGITV
                     VLDRYVYSGIAYSSAKGLDFDWCYAPDKGLPKPDLTIFLKFENEENSNRSGFGEERYE
                     VVEFQRKVKLQFEEFTGNREWCPLFVDGLDREQVHSRIWDLIEPTIKSVQDKELLFFK
                     "
     gene            <992486..>994072
                     /locus_tag="C5L36_0C04600"
                     /db_xref="GeneID:40384322"
     mRNA            <992486..>994072
                     /locus_tag="C5L36_0C04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466144.1"
                     /db_xref="GeneID:40384322"
     CDS             992486..994072
                     /locus_tag="C5L36_0C04600"
                     /inference="similar to AA sequence:RefSeq:NP_013944.1"
                     /note="PKUD0C04600; similar to Saccharomyces cerevisiae
                     YMR217W (GUA1); ancestral locus Anc_8.733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322004.1"
                     /db_xref="GeneID:40384322"
                     /translation="MSSEEVAPPAHQIYDTILVLDFGSQYSHLILRRLREFNVYAEML
                     PCTQKIAELPFKPVGVILSGGPYSVYEEGAPHVDPAVFDLNVPVLGICYGMQELAWIN
                     GKGVSRGTKREYGPAFVHVVDEACALFKGVNNSQVWMSHNDKLTALPTGFKTVATTDN
                     SPYAGIAHEEKPIYALQFHPEVTHSLQGKILLRNFALDICKAKTNWNMENFIDSEIKR
                     IRELVGPTAEVIGAVSGGVDSTVGAKLMKEAIGDRFHAIYVDNGLMRKNETVNVKKTL
                     DEGLGINLTVVDAGDEFLGKLKGVTDPEKKRKIIGNTFIHVFERVAAEIKPNDGSQIE
                     YLLQGTLYPDVIESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRELGK
                     IMGIPDELVWRHPFPGPGIGIRVLGEVTPAQVKIAREADYIFIEEIRAHGLYNKISQA
                     FAALLPVKSVGVVGDQRTYEQVIALRAIETTDFMTADWFVFDAAFLKKVASRIVNEVD
                     GVARVTYDITSKPPATVEWE"
     gene            complement(<994165..>994620)
                     /locus_tag="C5L36_0C04610"
                     /db_xref="GeneID:40384323"
     mRNA            complement(<994165..>994620)
                     /locus_tag="C5L36_0C04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466145.1"
                     /db_xref="GeneID:40384323"
     CDS             complement(994165..994620)
                     /locus_tag="C5L36_0C04610"
                     /inference="similar to AA sequence:RefSeq:NP_015177.2"
                     /note="PKUD0C04610; similar to Saccharomyces cerevisiae
                     YPL148C (PPT2); ancestral locus Anc_8.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322005.1"
                     /db_xref="GeneID:40384323"
                     /translation="MPKVLGIGTDIHKLSRFFDILKRNGPLDSYKTQRFSERILNPVY
                     ELPTFIEYKSKHDIERCARILSISWCVKEAIFKTLDGEDQSNFVMSDWYKTNDLRGRP
                     QVGNDKYLKIKQEEFLCSLSHDGNLVSSFIIRQSKPSVTNCWNGKQCND"
     gene            <994828..>996120
                     /locus_tag="C5L36_0C04620"
                     /db_xref="GeneID:40384324"
     mRNA            <994828..>996120
                     /locus_tag="C5L36_0C04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466146.1"
                     /db_xref="GeneID:40384324"
     CDS             994828..996120
                     /locus_tag="C5L36_0C04620"
                     /inference="similar to AA sequence:RefSeq:NP_013936.1"
                     /note="PKUD0C04620; similar to Saccharomyces cerevisiae
                     YMR209C; ancestral locus Anc_8.722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322006.1"
                     /db_xref="GeneID:40384324"
                     /translation="MPRVKTKIETLQESSIFISRISFVLVFHLISTAVFPSSKIPLIF
                     STLFSATIVSQTTMFRNLRRQISRYAYEINEVKEITLPDDRKDLIISIYDLKSYLANA
                     QKWNNRRRLLFRQMSPLQQKIASSINYPNKLNLVDQYFEKNNKIIDQIVKSSINKYNV
                     KDYELQFVEEQASLQKRNQFFRVVESLCHYARDWSKKPSEEISPLLEYIMLQCKDLND
                     DKTVAIVPGSGLGRVAHELAAQLKLSSVHAVEFSWSMVLMNEFLYSTMENVNDLNVYP
                     YLHTYSNHLTIEDQVRPVEIMHSLEKPQSLNIHHGDFTQFNLSDHLKANEDPENLLIV
                     TCFFLDTAENLISYFQAINKLSSGFNGKVKWINLGPLKYGTAAKIELCDDEMKAIIKT
                     MGWNFVDEQKPKLLGYLTDKKGLWQGYYDVTMWTAEKQ"
     gene            complement(<996232..>997593)
                     /locus_tag="C5L36_0C04630"
                     /db_xref="GeneID:40384325"
     mRNA            complement(<996232..>997593)
                     /locus_tag="C5L36_0C04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466147.1"
                     /db_xref="GeneID:40384325"
     CDS             complement(996232..997593)
                     /locus_tag="C5L36_0C04630"
                     /inference="similar to AA sequence:RefSeq:NP_014915.3"
                     /note="PKUD0C04630; similar to Saccharomyces cerevisiae
                     YOR272W (YTM1); ancestral locus Anc_8.721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322007.1"
                     /db_xref="GeneID:40384325"
                     /translation="MSESQPASKDQIKVKFFTRDEDESLHCSSNPIYIPVSLKRFGLS
                     EIVNHLLETETPVPFEFLVDGTILKTDIQEYLVKNGLSTEAFLTLEYTRAVLPPKFLS
                     SFNNDDWISSVDSIGSMELTDGQGGTLQTDPKILTGSYDGIVRIYNSSGKVETQLTGH
                     SQPVKAVKFISPTKFVTAGMDRSIRLWRAGVISNEDVDKDTQAGHTFALLDYHKSAVS
                     TLDLHIGSNRILSGSYDNSIAYWSTNPKEMNTADAVDPSERLSSSSRKRLKLAIKDSS
                     IKRKSPLAILESHRAPVEGVLFDSNDPTIAYSVSQDHTIKTWDLITARCVDTKQTNYS
                     LLSLTSLKNMNLLATGSSARHINLHDPRSSKVTTSQLIGHTNFVVSLTTTDNDYMLIS
                     GSHDGTAKIWDIRANKAMYTITRESQEKRSKVFAVSWEKEIGILSAGSDKKLQINSSA
                     EFK"
     gene            <997872..>999243
                     /locus_tag="C5L36_0C04640"
                     /db_xref="GeneID:40384326"
     mRNA            join(<997872..997949,998029..>999243)
                     /locus_tag="C5L36_0C04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466148.1"
                     /db_xref="GeneID:40384326"
     CDS             join(997872..997949,998029..999243)
                     /locus_tag="C5L36_0C04640"
                     /inference="similar to AA sequence:RefSeq:NP_013935.1"
                     /note="PKUD0C04640; similar to Saccharomyces cerevisiae
                     YMR208W (ERG12); ancestral locus Anc_8.719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322008.1"
                     /db_xref="GeneID:40384326"
                     /translation="MVSYPFLTSAPGKVILFGEHSAVYNKPAIAAALSLRTYLLVTKN
                     KKEDNCIYLEFPDIGLHHAWKESDMPWHLTTSEQGRPPASEELNAELVNGLTPLLTSI
                     QSPLHYAAAYCFLYLYLSLCHESVGGGITFTVRSTLPIGAGIGSSASISVCLASGLAY
                     MGGHIKAANIERDSMVLRDSDECMFIDAWSFMGEKCIHGNPSGIDNAVATHGGAVMFQ
                     RMANSMPSVRTSMRNLPSINLLLTNTKTPRRTADLVSNVARIVNDFPMTSGCILEALE
                     AIAREAYNLMVRPFLDIDSKKRLMELIRINHGLLVSLGVSHPNLEKIKLFCDELKMGE
                     TKLTGAGGGGCAITLLNDEMDKAEYEQKYRTLLDKFEGHGFETFQTTLGGKGVGLLTS
                     PSDSLLEFMNVEKFVGFKDTTEIEKSVGCSAVDEWKYW"
     gene            complement(<999350..>1000432)
                     /locus_tag="C5L36_0C04650"
                     /db_xref="GeneID:40384327"
     mRNA            complement(<999350..>1000432)
                     /locus_tag="C5L36_0C04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466149.1"
                     /db_xref="GeneID:40384327"
     CDS             complement(999350..1000432)
                     /locus_tag="C5L36_0C04650"
                     /note="PKUD0C04650; Pfam Domains: DAO(1.1e-25)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322009.1"
                     /db_xref="GeneID:40384327"
                     /translation="MLKSVLCTTRKQTKQKPMGMSNIVILGSGIIGLYTAYCLLEVAS
                     VPGSKIRVIAEYLPGDSSINFTSPWAGGNFSCISPNDQDTLAFDKFTYLNLEKILAEL
                     GPRCGLAMKPSTEFWDVYPGDVKINSLKTYLKDFKVISRSSLPDGVAFGISYKTWNFY
                     CPFFLSNLKRYLMRHGVTFERQKLTHISQAYLPHTEAVFNCTGIGSFSISGIKDTKVY
                     PTRGQVLVVNAPHVQENRMRWGEDYATYIIPRPDSKGQVILGGFLQKDNWTGDTFEEE
                     SKDILLRTTTLLPKILDKPIEIIGTAAGLRPSRHGGARIQADIVDGKLLIHNYGAGGY
                     GYQAGLGMSKKAVELYLENKMLLCKL"
     gene            complement(<1000904..>1001926)
                     /locus_tag="C5L36_0C04660"
                     /db_xref="GeneID:40384328"
     mRNA            complement(<1000904..>1001926)
                     /locus_tag="C5L36_0C04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466150.1"
                     /db_xref="GeneID:40384328"
     CDS             complement(1000904..1001926)
                     /locus_tag="C5L36_0C04660"
                     /note="PKUD0C04660; Pfam Domains: DAO(1.8e-32)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322010.1"
                     /db_xref="GeneID:40384328"
                     /translation="MSEVVVVGAGIIGLYTTYCLINDGGISPDKITVLAKYMPGDQSI
                     FYTSPWAGGNFSCITPNDKETLALDKYTYTHLAEIQKKLGGPTCGLDMKHSTELWDEY
                     PGDEKINSLKSYIKDFKVIAKQNLPHGVQYGITLTTWDFNCPMFLTNFKKYFENIGVK
                     FVRKELSHISQAYQADTKVVFNCTGIGARSIAGVSDDKVYPTRGQVVVVRAPHIKENR
                     MRWGADYATYIIPRPYSNNELVLGGFLQKDNWTGDTFELETEDILRRTTELFPEILDR
                     PLEIIRVAAGLRPSRHGGVRIEVENVEEKLLVHNYGASGYGYQAGLGMAQKAVSLYLK
                     SKRAKL"
     gene            complement(<1002217..>1003458)
                     /locus_tag="C5L36_0C04670"
                     /db_xref="GeneID:40384329"
     mRNA            complement(<1002217..>1003458)
                     /locus_tag="C5L36_0C04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466151.1"
                     /db_xref="GeneID:40384329"
     CDS             complement(1002217..1003458)
                     /locus_tag="C5L36_0C04670"
                     /note="PKUD0C04670; Pfam Domains: Peptidase_M19(1.1e-140)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322011.1"
                     /db_xref="GeneID:40384329"
                     /translation="MTVQDRKKIDEKFDQIVKRFPIVDTHNDFPYSLRCQLHYEISTT
                     PEFDFDSLLTSHTDLVRMREGKIGIQFFSCWIECKNDDPLYQDFNTPTTIVRDTLEQI
                     DVVKRLVDEYSNSLKFVKTSDEALQSFRDSKGKKISITLGVEGLHQVDLSLAVVRQYF
                     DLGVRYITLTHNCDNPFATAASSVTGGLPDKGLTSFGRDCIKEMNRLGMMVDLSHVSY
                     KTMLDTLECTQAPVIFSHSSSFTLTPHERNVRDDVLKLVKDNGGVVCINFLPQFLKRE
                     GKSADDVTIDDAVAHLVHIITLIGWDHVGFGSDFDGIPCGPKGLEDVSKYPELVKKVW
                     EVTNATEEQIVKLMGLNVVRVWKECEMVSDRLKNKIEPVESNWEQREWIFHEYCKTFP
                     ELFPGSFELKNNIYKDTIDLY"
     gene            <1003938..>1005521
                     /locus_tag="C5L36_0C04680"
                     /db_xref="GeneID:40384330"
     mRNA            <1003938..>1005521
                     /locus_tag="C5L36_0C04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466152.1"
                     /db_xref="GeneID:40384330"
     CDS             1003938..1005521
                     /locus_tag="C5L36_0C04680"
                     /inference="similar to AA sequence:RefSeq:NP_116600.1"
                     /note="PKUD0C04680; similar to Saccharomyces cerevisiae
                     YFL055W (AGP3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322012.1"
                     /db_xref="GeneID:40384330"
                     /translation="MEKDKNITLETQVSDGYRQNEDGDEILDSGLKAGLKNRMINLIA
                     LCGLIGPGVFIGMGNALKSGGPVGLLVGFAIVGILVLSMMSSIGEMNATLDSNFAILG
                     SRFVSKGFGATIAIYYVILWITNIIAEYTSLSSAMQTYSDTVPTYGWYLIFWFVFTVF
                     QCLDVSWWGEAEYVLGFVKLAFLSGFYLFSIIYAAGGIPNHKPDNPFGNYPLKDGFKG
                     IANSFVYAGVFYSGIEGVSVIAAEARNPRKAIPTAVRSTVFRVFFVYFGLSIFYGITV
                     PYNDPLLNDANNVMKSPMTIAITEAGWPGSKYFVTTMIWITCFSSINSAIYFASRSLF
                     TWSKAGFGPKIFTKVNKKGVPYVAIHVCHIFGFLSILSYSSGASVAYSYIVSVTGVAC
                     FIVWTSISITHLRFRQGWIAQGYPLEALPYRSFLFPWMNYVAIVIGVVLTLVQGWSCF
                     KPFDYKTFVDSYIMLPLFFICWFCYDKFYFKSWFIKVEDMDFESGKRPDLDDTVGTEL
                     DNCGKSEVVYTGSSNEEEF"
     gene            complement(<1005747..>1007558)
                     /locus_tag="C5L36_0C04690"
                     /db_xref="GeneID:40384331"
     mRNA            complement(<1005747..>1007558)
                     /locus_tag="C5L36_0C04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466153.1"
                     /db_xref="GeneID:40384331"
     CDS             complement(1005747..1007558)
                     /locus_tag="C5L36_0C04690"
                     /note="PKUD0C04690; Pfam Domains: Zn_clus(2.6e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322013.1"
                     /db_xref="GeneID:40384331"
                     /translation="MDNFEATHRVHRDKGAGNGVGKSKEKGKGNGTAKGKIKGKPTRS
                     KSGCLNCRKRKKKCDEVKPICTGCLNRNLICEYRSLAFHPFIENKLDIVTDSNPINNN
                     LPNNILPIDEKITKISNLENLVGETVMRIFDNNNSKLSNLFENQQVQEDLPNLDEFDI
                     QKTKTLDDLLPIDSDFLNIFFEDQPQYLDLFKNPTPIIPPSLDIKLPVPLTTLELSYF
                     EFFCKSILSDLSILPQEFNYYTKIYIPLAFKEESVLYTLVGWGCRRRKNMNLNYQVEN
                     KEADSYIGKVNEIILYHESILDREKFITNFVCYMLLVCMEISFGDTSKWSHYFTCCFN
                     MINKMPGNFRYLVSTCSIEGNLLAENFAYFDVLASQSNENGTFYPMADYYELFNQNNT
                     TKIVHDPLQGCIRPVILLIGEIVSLLVEHNSLQASLDLSECDKFEIINKMMTKSDMLD
                     ESIKFSKPDLSCLQYLDSSSQLEIHLTLFEVYQIASQIYLRQVIRKLPPIVPEIQVLA
                     YNLKKDLRLLLESLELKNSLAFPMLLLGISSTSADDKKEVTGMFKRLIQVCGYLSSYQ
                     KLFIVVQKIWDLNNNGSLYIDWFRVTKQLGWRLNLGR"
     gene            <1007870..>1009063
                     /locus_tag="C5L36_0C04700"
                     /db_xref="GeneID:40384332"
     mRNA            <1007870..>1009063
                     /locus_tag="C5L36_0C04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466154.1"
                     /db_xref="GeneID:40384332"
     CDS             1007870..1009063
                     /locus_tag="C5L36_0C04700"
                     /inference="similar to AA sequence:RefSeq:NP_011266.1"
                     /note="PKUD0C04700; similar to Saccharomyces cerevisiae
                     YGL248W (PDE1); ancestral locus Anc_3.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322014.1"
                     /db_xref="GeneID:40384332"
                     /translation="MPTNKRRFEVIILGCSGGPISGKTCSFLLKPADVETVDIIQSDE
                     DNGCLLALDAGSGLSNILDILDSKDKCTSFQLSNASYLLDLYPASDSDNGNNGDAYRI
                     SDYLNLENMLLRIPFQSADSKSLNKSNYQIADLLLNKINGYLITHSHLDHVCSLVINS
                     PGFTKKKEVYGLESTIEPIRKDLFNNSIWPDLVSMGIISLNYLEHNQPSRMISPRYEV
                     TAFRLSHGKLCQDNRRFISSAFLITDLKYDYSMLFFGDVESDLCSGIDYNLFVWGKIA
                     PLIRDDKFNTIFIECSTVDKPGPLYGHLTPSNLIYELLNLRKSIVCLDNTSVSNLSYD
                     DPYFQHLKVQPLRGLNVIIIHVKETTDNVNPRTLILEEVEILNKTHHLQINFSIGLSG
                     ISLLL"
     gene            complement(<1009326..>1010150)
                     /locus_tag="C5L36_0C04710"
                     /db_xref="GeneID:40384333"
     mRNA            complement(<1009326..>1010150)
                     /locus_tag="C5L36_0C04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466155.1"
                     /db_xref="GeneID:40384333"
     CDS             complement(1009326..1010150)
                     /locus_tag="C5L36_0C04710"
                     /inference="similar to AA sequence:RefSeq:NP_116708.1"
                     /note="PKUD0C04710; similar to Saccharomyces cerevisiae
                     YFR050C (PRE4); ancestral locus Anc_3.574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322015.1"
                     /db_xref="GeneID:40384333"
                     /translation="MNHDPLHWGRPDDSTYGGYNYNIAHASNVDRNKTQAKTEFPKMH
                     TQQPMITGTSVIAIKYNDGIVMAADHMGSYGSLMKLDDLQRIIPVGNSSVCGISGDIS
                     DFQYIERLLDDLQIEDGYDMEDDNLKANHLGEYLTNVMYNRRSKMNPLWNAIIVAGFD
                     DKGEIYMKHVDLLGVSYSSPTLATGFGNHLAIPLLRKKVDSEEDVAKLSKEEAIQTVK
                     DCMKVLFYRDARSWNKYSLCIIEKSTKSINIEKDVAVEGMKWDFARHITGYGVPQL"
     gene            <1010450..>1010805
                     /locus_tag="C5L36_0C04715"
                     /db_xref="GeneID:40384334"
     mRNA            join(<1010450..1010519,1010606..>1010805)
                     /locus_tag="C5L36_0C04715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466156.1"
                     /db_xref="GeneID:40384334"
     CDS             join(1010450..1010519,1010606..1010805)
                     /locus_tag="C5L36_0C04715"
                     /inference="similar to AA sequence:RefSeq:NP_116707.3"
                     /note="PKUD0C04715; similar to Saccharomyces cerevisiae
                     YFR049W (YMR31); ancestral locus Anc_3.572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322016.1"
                     /db_xref="GeneID:40384334"
                     /translation="MKASLRILQRVPSIKFVGGPHPIVSHPVGAHPCAPNGMRPSANA
                     SPVASASAASNVAFQSRNNLSKRFRYRPIEEIEIEDVELGGALIN"
     gene            complement(<1010933..>1012870)
                     /locus_tag="C5L36_0C04720"
                     /db_xref="GeneID:40384335"
     mRNA            complement(<1010933..>1012870)
                     /locus_tag="C5L36_0C04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466157.1"
                     /db_xref="GeneID:40384335"
     CDS             complement(1010933..1012870)
                     /locus_tag="C5L36_0C04720"
                     /note="PKUD0C04720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322017.1"
                     /db_xref="GeneID:40384335"
                     /translation="MYVDLNKVKQKTIPPQSYRILFDKETLYHYCNLILDEYNSKKVS
                     LVLFKNDLQWGPRDSNASIYLHPFQYNHKWHLALGFKDINKIILVNCQGNIDKVSSFP
                     IEASLEIKSFVLFFKHKLSKSALKYPANFIEYFEPPSNFNSINLLSVVLTFCLDPITL
                     TNCFCNPNASPRKFDISQVSPVIDNIDLEFRSNYLFMIEEKLKEKRNLEFKLLDEQRR
                     KHKEQLARIDEQRRHREREELERKEKLQREIQEREKAYREKLERERQIREQQRIEIER
                     QEMLAIESRIQAQNKDYGRTAKSEDENENANKNEVASGTENIVKRRKLDPRPLGTVDA
                     PFEINDLEDSDGKEDEERQYEEYLLAKKEVTPEPPNRVNNSVNDNNFNVGPNSIREDT
                     NKLKLEKKEVLGELFTEEISNEYFQKVKDLTLFGEGKKFDKMFEFIHSLSYNRITNPA
                     AFGKNGKLERPPITVQKSLMVTYKRRMKQEFDESQLHQMLETNYENQIIPLIFENGSI
                     FLVNIRHTEGINCIVKVACISNRVSRSEREIMKNYAFRRLIEIYVAKYNRLVIKIYCN
                     IICVRSASFYKIAMQSICTLHYILWRNKFNVSSVKPRNEALDSYISFFENMLTCTSQG
                     DLFKAELNLKRLIKYVLQNNE"
     gene            <1014411..>1018218
                     /locus_tag="C5L36_0C04730"
                     /db_xref="GeneID:40384336"
     mRNA            join(<1014411..1014552,1014695..>1018218)
                     /locus_tag="C5L36_0C04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466158.1"
                     /db_xref="GeneID:40384336"
     CDS             join(1014411..1014552,1014695..1018218)
                     /locus_tag="C5L36_0C04730"
                     /inference="similar to AA sequence:RefSeq:NP_010579.1"
                     /note="PKUD0C04730; similar to Saccharomyces cerevisiae
                     YDR293C (SSD1); ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322018.1"
                     /db_xref="GeneID:40384336"
                     /translation="MDKFNANTDGHIGEDSFESPTVKTTGDKPKTIHVAHRRSPSELT
                     TLMLEQLSLQRQLEIVQAQQQQILQQQQQQQQQSGGTSNFGYQNMLQPPPSLGQPQNS
                     NRSNHHRKTSSSFQKETEYGTPRSHRRSQSSVTSVGSIPFSKTDSRPQALGHTRRHSL
                     GLAEAKKAAAEAHAQRYNSPSKLSIESSQVNLNENESTPPSFKFPGSPNLSSNEAEFS
                     TPPANYHSRTRSSLSGDKSPQRGFQFPPKDQNQLLQPPQPSFSGSHVRTGSDLSSNWR
                     KPTSNNQSSPSSYHHHNNSQSFESSNFLPGHRPRNSYGGSISSVSQYNNNNQGQRKSL
                     FAPYLPQNSLPDLINEGKLVTGVLRVNKKNRSDAYVSAEGLLDADIFICGSKDRNRAL
                     EGDTVAVELLVVDEVWSSKREKEEKKRRKDTKSNFDIADDVHNDASTSSTDPSHSNSG
                     SLNRKGSLKQRPIQKKNDDLEVEGQSLLLVEEEEINDDAKPLYAGHVVAVIDRIPGQL
                     FSGTLGLLRPSQAAKKEKEREENGGDFSKNEHKPKPKPKIVWFKPIDKKVPLIAIPTE
                     QAPKDFVENHEKYANQTFIASIKRWPITSLHPFGTLVSRLGATDDKSVEVESILRDNN
                     FMCDEYLDGEEKYMLDFPTSDYILAKRPRKEFDDYVIACSQNGQFSDHAFHVRGVSDN
                     TIELGVHIVDVSEYVQNGTNLDKRAKKRSHGVFLPQKSVNLFPDTINKMISFQENVRS
                     PALSVIFTIDSLTFEIENVWMGETSVKPTTRTEYSEIDKILEKLEVADSSDNQNALSS
                     YFATLSLIALRLKEKRLNNPKLSSNRMLPLLDQLDDERVKLSLNIYENIKSASILDEI
                     FHTVNAAVAQKIHSALGDLAFLRKFPIPTLTKFEYYQSKIAELGVHLDTTNAGSFQNS
                     ILAIEDPIKREAVETILVKCMGRGKYTIAGKCDQELAHYLFNLPTYTHFNAPLRRYAD
                     IIVHRQLKHIINNSVDSYTEDVNSLKVISDYCNFKKDCATATQEQAIHLLLCQTINDM
                     SSKTGQVLCKGVVLQVYESAFDVYLPEFGIEKRVHGDQLPLTKAEFDKHNKILKLFWD
                     PNVDAATFVPEDENEPLSYRNSIKNKFRVSSENAARAQDESVSKESGLLSDEMYNKLT
                     KLKLTPPKIDILIPKEGEDPLAPYIKPLSTRIEGNNHMQDIKLLDTVPVILRAEIGMS
                     LPCLTVRVLNPFYKERK"
     gene            complement(<1018451..>1027357)
                     /locus_tag="C5L36_0C04740"
                     /db_xref="GeneID:40384337"
     mRNA            complement(<1018451..>1027357)
                     /locus_tag="C5L36_0C04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466159.1"
                     /db_xref="GeneID:40384337"
     CDS             complement(1018451..1027357)
                     /locus_tag="C5L36_0C04740"
                     /inference="similar to AA sequence:RefSeq:NP_010434.1"
                     /note="PKUD0C04740; similar to Saccharomyces cerevisiae
                     YDR150W (NUM1); ancestral locus Anc_8.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322019.1"
                     /db_xref="GeneID:40384337"
                     /translation="MSQFDDLLEDWSETPLDSNSSHIPNSGSAGIPESMDLKNQLLQL
                     QQKLNLSDIKPVRTPNGVDPEIHLPPTLSNTMATTTHDNDKSVDFLGDLSDSLLMESR
                     RLNYENKQYKIKVKELSESNSMMKKELNNLNLLNDQLSKREENQTDKIWKLESDLESL
                     QLSLEKSNNELKKVQSENLASKSSIESLKNAIDNLELEKQQLLDSTNSTIAKLNSQLY
                     EYKESNDSLNDENDILHKNILALKAEVEELKLSADKNPNPVEEETSFSEFDDSIVLDP
                     VPAFLTKDASDLDSKTLKKNINIIHRQMLKLKNQNSKMRLELRKAKLQSPIHGSQVQD
                     DHINPDDSWTKFNDDSFAKKNVPELSYNADSENENDDDNNNNINTSFLSDLSELDGSS
                     PVSSRKVSMAQIKSYMLIVPKTTLDTNPTITAEQIDFSKFKTLKLPENTVTSLLSCSE
                     IVDNDGSDFASSENLQLIPLSLIDNLNGELNSLNMVVNTNPDKPQLSNPNISDTICKL
                     KELRNEILEKFVLLPKTKHADILLEINNLNTEIRKANALNDEQLSQITSLRDQLNDPP
                     LDLLKSKSESLDHIVIPKEKHNDIISKVGALENELETKSKLLDKLNSELFKLQEFNES
                     PDIEYLKNKSLGHMHKLVSDSEYSELLKKISNLEYEIELKSESLSKLDGELSELRKDY
                     ESPDINYLKLKASAFDHSLIPQQKYSELLEKYSSLENEISTKTKTITSLESELNETTK
                     KLNNEIKHKESLLEDTTAKLEKLKAQLEEPDLKFIKDKSEIHDHIAIPSAEHRGLLSE
                     KIKLESEVGEKTALLDKMEGELESLKFKNNKLLELNRSISENVEISQAETKKFALDIE
                     QLKKQLEEPSLTYIMTKSKSLNHVVLSDSEHAQISTDIKLAKKKIQELEDKYNDKVDC
                     FEKLDSQLKKTNKSLESTASELDELKKRYENPTASYICSKAPDNGLVAIESENYRSTL
                     LNVENLENKLNEVTSTASRLSEEFKCITSEKEKLEQMIHQPELEYIHEKAAILKHAVL
                     PEDELAEMNSKLTVLEAKLEEKISRLDELQREKDSVDSRLQETLEELTDSQVKFHDLQ
                     DEFNKLQKLYDSPTVDYLKLKALSLNMVPVSTEELEKMKREVAKGDKTIEKLSLDIKS
                     LEGEVLKLTVVLSEKEIEYNVLEKEFQKLTQERKGLLAKLDLPDAEFIKSKASLHKLQ
                     VISMAQHNSMVSELKTKTDKLEKMKRLKTDLDSKHKQIESLLKSQEELCEKIEKATSN
                     LTSMEKELQTKEFKVNLLQKQVDSPTLDYIKEKASVYKHSLLPLSEVESLKKQIQETQ
                     ESLVNKERELEAIKKIKEDLEIQGSKSVSLELHESTQEDLHVTKRELDDQKQLLNEHK
                     QRIDKLREVENLLVEKESEMVKLKTISSELSCKLEELDLARSEIKDLKNKNKELDEKR
                     KEIESMKKSQNDLQSKIDSLLLKEKELESALENLKSKDSQLKELESAYEAPEFAYLQE
                     KAKSIGYLPIPIAEHNENLRKSDELKAVKSEMRELSNEVIALTSANKSLNETNTKLKS
                     DLTELSVLKDSLESPDLEYLKEKSKKAGLIPLPIDDYDVLNDRLSTMSSEIKTLKSKL
                     DASLAEKSNINEELKKLQHIQANPSMEYLKSKSASLGIIPIPIVEHTSLKSDLKRKNI
                     LVKENKQQLEEIKSLKAEISEKKAKLKETIDQLENLEKLRDNPNIEYLESKLDTLSYA
                     AIKKNDLKLLETSKAEALKMVDSLKEKLSDVEFQLIEKESLLDELHRKVEKERKTHER
                     ELTEVKSKLALMELNYDNLKSENEVKEGKIEDLTKTVEEVEKSKLTLELQLRELQKQI
                     EASTEAQNTAENKITTLTENINQKELQVQELKSQVESLKRDNKKYESINEEIKEVTST
                     LNNDLDCLKKKCELLETEKARYIQACSEFESTISDLKSVSESHEAEKERYREAKSELE
                     ISISGLKERCTLHEQSKNNAEEAIASLESELSKLRTELELHVKSKISSSNTIEEMESE
                     ICQLKSGIEVQSKSNTELEATVEKLEFEVKRLTEEADVLVQDKRAAQETKADLETEIT
                     KLKAQIESHEEEKRILNENIGQLLCEIRKLNEDVSDHEVQKGVASDKIVQSESQIDIL
                     RKELRSHQKEKELADAQIISLESKVASLKNEMSEHLGSKDQLASRIAQLESELSSMKG
                     YAVDLEQKKDGMEKEISDLNAESEKVHNPFDKIQSAVNLEDYQKGMNMQKSSSIATVT
                     SENVKNIENQPIELLISAISEAGYTVLSQLELENLLKSRTGEKRTTDLADISHEIENI
                     ESDIESKKSILAEMRSRRNSFASSASSIQTTASIPVENILSQKEAKLSEKIKEISASL
                     SDLKAKKEKIQKQSYRLSDVSIEVPSQGLSVKLNKKISKLNSEIQLKEVELQSQQSAL
                     AAVRAYLDKSRDLDLPPIITPLHDETEKLESEIKELQQKYSEKKADMEKLKISLLQSD
                     EPTILAKRLSFLGYNVTSPSGESLILEEIKLNGLTHHVRSIIMGKCFDKKNGCFNADQ
                     FLEENNLKIMGLQEVERMKNAAMFNIADIPLEDLKNRIKESGYTVVENKDWEELTEKS
                     GEAKMPDFLDHSTLAEYASKLNLSLLSAEDVSRLKQRTITSRELANKANELNLVLLNE
                     DEVKMLKANEPLTKENIVEKAKEFDLLCIPKSQFVATTVSRTPDIPNVTVLPNSYYKI
                     LTKSHEWYKKNKNTALKSVSQPPTIAENATLDIPEQFNPQQFAQPPGPGNTHLPGQNI
                     DVLSLSTLDTVVSNKKEIIAAVTQTIIGDYLHKYYRKLGPFTSISDTRHERYFWVHPY
                     SMTLYWCAINPVAGVPAKSQIKALSILDVQSVPDNNPLPPGLYYKSIVIRSYEKTIKI
                     TCPTRKIHNIWFNSLRYLLDRTSDSWVNDDDLENQYEQDFSLDKKTEIERMQSLRTPS
                     IKRSPSGLSTRGTLRSASLRSHRK"
     gene            <1027642..>1028290
                     /locus_tag="C5L36_0C04750"
                     /db_xref="GeneID:40384338"
     mRNA            join(<1027642..1027644,1027721..>1028290)
                     /locus_tag="C5L36_0C04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466160.1"
                     /db_xref="GeneID:40384338"
     CDS             join(1027642..1027644,1027721..1028290)
                     /locus_tag="C5L36_0C04750"
                     /note="PKUD0C04750; Pfam Domains: UQ_con(7.2e-41)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322020.1"
                     /db_xref="GeneID:40384338"
                     /translation="MIRLRKIQQAKAEAARNGTSPPTVNRSVAFMRAKKDIQEYEDIP
                     SVEIQYDRDDPMHIKLQVIPDKGYYANGKFNFECTIPNDYPNSAPEFRCLQKIYHPNI
                     DLEGHVCLNILRNDWKPTLTLQLVFAGILHLFLEPNPNDPLNKDAANDLAKFPESFGR
                     HVKQAMMGGYVGEELFEPVVASMRNSQRYY"
     gene            complement(<1028647..>1028997)
                     /locus_tag="C5L36_0C04755"
                     /db_xref="GeneID:40384339"
     mRNA            complement(<1028647..>1028997)
                     /locus_tag="C5L36_0C04755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466161.1"
                     /db_xref="GeneID:40384339"
     CDS             complement(1028647..1028997)
                     /locus_tag="C5L36_0C04755"
                     /note="PKUD0C04755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322021.1"
                     /db_xref="GeneID:40384339"
                     /translation="MAPIAISSLNLGAKHMIRLSSMTSRSSKLFLSYTSMKKSSMEQD
                     YYASFALHNESLDNSHAEFVSTNAGGKVESGEMHFVKNSHNANTSPSDVKDGEFTPTV
                     SSTNDISGHGHSHA"
     gene            <1030471..>1030971
                     /locus_tag="C5L36_0C04760"
                     /db_xref="GeneID:40384340"
     mRNA            <1030471..>1030971
                     /locus_tag="C5L36_0C04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466162.1"
                     /db_xref="GeneID:40384340"
     CDS             1030471..1030971
                     /locus_tag="C5L36_0C04760"
                     /inference="similar to AA sequence:RefSeq:NP_014139.1"
                     /note="PKUD0C04760; similar to Saccharomyces cerevisiae
                     YNL260C; ancestral locus Anc_1.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322022.1"
                     /db_xref="GeneID:40384340"
                     /translation="MTCDNSVDFDSVVNLEENFYRDSYHNAHEIGFEHTKLDGKQFGI
                     QTGFQRFVLLGALKKFTQLVDEELQNNDDLPNKISDKMLKSINEILKLSQGFYSDGLI
                     ETSNTPADVESYEKQMKLIKSKAKILYSKLGYKSKFSDLESTCRSLSGDIPSTQINTG
                     DENDMW"
     gene            complement(<1031010..>1032542)
                     /locus_tag="C5L36_0C04770"
                     /db_xref="GeneID:40384341"
     mRNA            complement(<1031010..>1032542)
                     /locus_tag="C5L36_0C04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466163.1"
                     /db_xref="GeneID:40384341"
     CDS             complement(1031010..1032542)
                     /locus_tag="C5L36_0C04770"
                     /inference="similar to AA sequence:RefSeq:NP_014138.1"
                     /note="PKUD0C04770; similar to Saccharomyces cerevisiae
                     YNL261W (ORC5); ancestral locus Anc_1.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322023.1"
                     /db_xref="GeneID:40384341"
                     /translation="MICLDKVLCSSMLDIKGELLSRCKYKSAEVQLLTSFLQPDINLS
                     MPSIIVEGPPSSGKSYTLNTYLELLKKGKGLNHIIIECEYCFTQREILRRLQKELLKH
                     YKLLKIKNTDKMQLSDSISTFPGCMQEMIKYHKLANNGRIDPVVIVLDRIDRLPIFEN
                     PGELIKCLGRLYELGEDFQYFSVVSVVTRCDFLDLSTLSLPIVNFERYSLKEFKEILV
                     VHWPEFWDNRLYCIEEDNSDSENETEKIELELDDNMKKGIFRQFIDLMMDTYSGYLGL
                     SVEIVIPILRRIWPIFLNPILKEGTIMKDKNDILTTFIKNKKMLGKSIAVVGKLDNSD
                     LSLSKYTKVDQVSLGNVTELEVRKGHYDLSFKTKYLLIAAFLASYNEAKYDRQFFSKG
                     NQYNSSIIRQRKKRMVNIESGNGQLRRAMNAAIPFKLERLLAILNSIWTSNVEDSTTI
                     IDDVELMTEIATLVSLKALVKFKGGDTIGGQTKWKCNVHWNVIKKFADDVGFEIENHL
                     QE"
     gene            complement(<1032876..>1033001)
                     /locus_tag="C5L36_0C04775"
                     /db_xref="GeneID:40384342"
     mRNA            complement(<1032876..>1033001)
                     /locus_tag="C5L36_0C04775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466164.1"
                     /db_xref="GeneID:40384342"
     CDS             complement(1032876..1033001)
                     /locus_tag="C5L36_0C04775"
                     /note="PKUD0C04775; MFa pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322024.1"
                     /db_xref="GeneID:40384342"
                     /translation="MNGKAIQQEQQEQLDNADFETWSQATWKAYFNWNLCTCTIA"
     gene            complement(<1035614..>1036582)
                     /locus_tag="C5L36_0C04780"
                     /db_xref="GeneID:40384343"
     mRNA            complement(<1035614..>1036582)
                     /locus_tag="C5L36_0C04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466165.1"
                     /db_xref="GeneID:40384343"
     CDS             complement(1035614..1036582)
                     /locus_tag="C5L36_0C04780"
                     /inference="similar to AA sequence:RefSeq:NP_013327.1"
                     /note="PKUD0C04780; similar to Saccharomyces cerevisiae
                     YLR226W (BUR2); ancestral locus Anc_8.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322025.1"
                     /db_xref="GeneID:40384343"
                     /translation="MDTGVKQTGFDGVSFANHNMHSEEYWEGIVDIERGDWIIDFNQF
                     ETDTPSRHTGITCQEELCKRVKGISYIFSCCKQLRLSRSVGLTASTLFHRFYLFESLS
                     KLHYYEVGATAVFVACKAEESRRNLKDVVKVCSKIALGKSDIDEESKVYWKWKDLLVR
                     IEELLLHHLAFDVTPLNPYKITMDALKIGQEPMEKDAPNMEWDAKARTLFGHCTFLFE
                     IMFKLPLCLFYPVEVLCALTTVLSAHKLKISFPVDYLQSSFHIDMNVILKCHDDLIFT
                     ASEIETMDKYFRVLPHIPRISHIDIKSVFSGQVESTLRDSLRDDDS"
     gene            complement(<1036881..>1039268)
                     /locus_tag="C5L36_0C04790"
                     /db_xref="GeneID:40384344"
     mRNA            complement(<1036881..>1039268)
                     /locus_tag="C5L36_0C04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466166.1"
                     /db_xref="GeneID:40384344"
     CDS             complement(1036881..1039268)
                     /locus_tag="C5L36_0C04790"
                     /inference="similar to AA sequence:RefSeq:NP_013323.1"
                     /note="PKUD0C04790; similar to Saccharomyces cerevisiae
                     YLR222C (UTP13); ancestral locus Anc_8.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322026.1"
                     /db_xref="GeneID:40384344"
                     /translation="MSERSYKKINIEPFYVGAANATISGDGALQATAVLEDVIIIDRN
                     SNKVLHTIQGDGSDVTTLRLSPDGSKLAIVYLSQQLKLFDVTKGQFYKSYKLSAASYI
                     SACDRTSSLFSFGLTDGSVIVWDIEGSFITHNFKGHGCTVSALCFYGDFNSKNWKVAS
                     GDIMGTVKVWDLVKRKNVFTAKEHNAAVRGVNFDPTGELFVSAGRDNLLMLYSTKRWT
                     EIKSIPLELSIESTGFIEVEGTTYIYTGGEGCVLHIWDFKQERLFAKTKKPLETSEEL
                     SITEIIQIQEDNQKLILVLSDQTILDVDLSTDLKDNNYIIPVTRIMAGNHGTIADIRY
                     VGSNKNLLAMATNSPSLRVVDLYNTPLDVDIYEGHTDLLNMLDASVDGKWLATASKDN
                     TARVWKLDEDNGKFECYAVFEGHGSSVTAVGLPRDLFTGHPKFLITASEDLTIKKWTI
                     PKPPKSSDMLPLSVKSADYTRKAHEKMIHAIDISPNNDFLATASHDKTSKIWDLNGGE
                     TLHVLRGHKRPVYDISFCRYDRLIVTASGDQTARVWNLEDASCIKSYEGSSNAVQRVD
                     FLCKNQYIVGAGADGLIKIWEVSSGECVNTLDNHDNRIWALIVKNNGEEFISADSDGA
                     ITIWQDNTEEVNAEKEIARKVEVEKDQELRNCILHGKWVDAFILALDLDHPMRLYNVL
                     KECIAQNQDVDSKLGSFELEELIGKLEEDKILLLFKRIRDWNTNARLFEVAQKVIRVV
                     LDKCDLDRLYQIKGIMQYIDAIVPYSERHYTRFESLIEQSYILDYVSRKMDELIS"
     gene            <1040962..>1041933
                     /locus_tag="C5L36_0C04800"
                     /db_xref="GeneID:40384345"
     mRNA            <1040962..>1041933
                     /locus_tag="C5L36_0C04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466167.1"
                     /db_xref="GeneID:40384345"
     CDS             1040962..1041933
                     /locus_tag="C5L36_0C04800"
                     /note="PKUD0C04800; Pfam Domains: Mov34(3.2e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322027.1"
                     /db_xref="GeneID:40384345"
                     /translation="MASLNLTKPNYSHPRIIAPLNISIDSSALLEIIEFIYHDNSADE
                     ESSTSRLIGTLLGINSEDGNIVIKSAYVVPHKEIDGDLIFEESFHFSTYQLYKRSNPN
                     LQVVGWFSTNDNLDLSAGLLHEFYSKSSPHSQQILLTLNHTDENGQIVSPVVKTYISG
                     PVGLPASSQLAQKIGLDKSGAYAFAEIENTIKYSQNELTSLQFINKAAKNHDQLTDIT
                     SSDELRQLKSSLTKINEMITVLQEYTDRVSKGEIQGDEKIGQLLQSALKFQIPESEIS
                     QFKSKIEEHTNDALLIEYLSSCIQQQLELSSKLTNFVLPEDALKAAH"
     gene            complement(<1042228..>1044681)
                     /locus_tag="C5L36_0C04810"
                     /db_xref="GeneID:40384346"
     mRNA            complement(<1042228..>1044681)
                     /locus_tag="C5L36_0C04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466168.1"
                     /db_xref="GeneID:40384346"
     CDS             complement(1042228..1044681)
                     /locus_tag="C5L36_0C04810"
                     /inference="similar to AA sequence:RefSeq:NP_010509.1"
                     /note="PKUD0C04810; similar to Saccharomyces cerevisiae
                     YDR223W (CRF1) and YLR223C (IFH1); ancestral locus
                     Anc_8.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322028.1"
                     /db_xref="GeneID:40384346"
                     /translation="MPPSSKVPKKSYSASKSVAKKGPFKTTTTKKVSRRFSIMSNSSS
                     EDSSDAESSDSDSESESDDYDGDMYVKNKPVQVSNVVASSGSEDDYSSSSDDENIDFV
                     QLTKQRRLKAMKAVKGLKKQANEKSSVSPSASPMNSEGLLVENEESELDDDLVDAVIE
                     NEERKLDNLDTNLDDVNDRSNSSNVDLNDDFEDIDFDFSFDGQSKEPNPVNFQNAKEK
                     DDRNVLDKLRDEDIGEVVDEESVSKEQIKSDKVEDNKIDIDVPKFNEKEINSDADYEF
                     DNNDLIQTLLKDNDDLELQNMDNSDDDFDYLIANQHNIDHNSINKPNLKDTSIDSLNN
                     TDDAYMMKEETQAMLEDFEKHPKQSYKNRRSSMYYQQLQNEYKDDVDDLDLDILDNFE
                     QFLPKQQAMRRRSSILNQSLLSSDDEERKLNSDPKYTKRYRKKSVKGSMRKNTTGNSN
                     AGNVHTKDIRKMLGISNTDSNFTSKFTSNAIADSDDDTKLLEYIFEEDSDSENMNGSV
                     VDGDETDEDENLPKKSGNIVGSKHAKEILSSSKDQFRAPKLGTFITKKPFSVIDGFST
                     RFLQPLSDTHSLVQKAAALGKPESTNNANNSNNIALDELINISEFDEDYPNNEQKEDF
                     EDFFGDKRIPLTAFRNKGLKNPANDISLTRRFSFTERNRRKSHHKLSKGKLKNAKLIG
                     HSSHKHYKQSTQSQTLIPKPRNTPTDMSADPIDPNQVDEVLLIGLEPLELNETFISNP
                     DFEISAPYNAPSSRRRKSMSRASKAKYRRASIAEAHAEGLRQTKNGLFDEQVMDDVEA
                     LLIDMGDAAEYQFIFGDEV"
     gene            <1045538..>1047394
                     /locus_tag="C5L36_0C04820"
                     /db_xref="GeneID:40384347"
     mRNA            <1045538..>1047394
                     /locus_tag="C5L36_0C04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466169.1"
                     /db_xref="GeneID:40384347"
     CDS             1045538..1047394
                     /locus_tag="C5L36_0C04820"
                     /note="PKUD0C04820; Pfam Domains: ABC1(3.7e-32)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322029.1"
                     /db_xref="GeneID:40384347"
                     /translation="MISVGASIRGACVYQIAPLRVYSSAGARKPVRLTNRPPSKTHFW
                     ASEKPITSATISSPSKAKKTDRQPTRFWKKALIGLFGSTFLIYLGDSYLGHGIIERNV
                     RSISTLIALSVDYKMHFQEDYDVDALHERNAQRLYDLILENKGLYIKLGQMIAVQGTM
                     FPKHYQDKFKMLFDRAPVEPWSTCDMTLRKELGQDYQEKLFQSIEKEPVASASIAQVH
                     QAVLKNGEKVAVKIQKNSVSRQMESDLFTYRYVMYFYGWLFEMPLEKTVNYVCDKMRE
                     ELNFKKEYQNAKMITKLIEDDDEFSKSQQYYIPKYYGDISSAKILISEWMDAQLVSKY
                     QELSDYGFNLKILLTQITKIYARQVFTWGLVHCDLHPGNLMVRNIEVENYNWLTSMFW
                     RRKNIQQLVILDHGLYENFTPKFKRQYAEFWKYSMEKHYDKTKEVLSSWGIEVDEMTM
                     TLIGIGDRHSPLIKEHVKKVMNMTYFQRQLMLKEKMKEFFQNTDKFPLCLVFVMRSMR
                     ILQGLNRNFGAPVNRLALLVDEANKSVEHLILQTGEADNWKDYFTRKYVSLTVKVVSN
                     ILFSINKTYIWLCNRISNLHVQNLEDAYDEEIVAAGQMMGFESVPSSKELIV"
     gene            <1047871..>1049538
                     /locus_tag="C5L36_0C04830"
                     /db_xref="GeneID:40384348"
     mRNA            <1047871..>1049538
                     /locus_tag="C5L36_0C04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466170.1"
                     /db_xref="GeneID:40384348"
     CDS             1047871..1049538
                     /locus_tag="C5L36_0C04830"
                     /note="PKUD0C04830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322030.1"
                     /db_xref="GeneID:40384348"
                     /translation="MDLIKLPQNVIENIALQMGSSDRIRLALTNKTMFQHVIGSVYHT
                     IIYQPSSEYPIIKRNDNVIDNVTLINDGNITLFFETISRPSVLNFYYSDLVIELYLEK
                     ISHLSAFDLVSWRQTQMPHFSCLERYQFPEEISIPPITFQDAPNLNTLIVDRNFCDYL
                     DHSVESINFLHSEKIQNMYIKGVLGRNEDMTMFKLLTRNPQMIRHLQELHFLVDRHEN
                     YEVVYRRIVGFFAILRKMNLGMHQVHKLSVTLTNRSSSSIISLISKHIIFENLSELTL
                     FIQDDGKVLTLVKSLDRLTNIIRYHGSNIRKLNLRYDLVGEDIEKNHLRSMMLLKLCE
                     SFQNLTHLNYDLKISGLNFSNMLMILGSPITNNIKSIIDLRINVYQPSENLVGNIVST
                     LEEAMQLFPYLNFLNRCNCLICQSIVETLALEADNSPLLFDETIKVSTLLIIGQELDM
                     AQRLSESSINSSSVVNKHSSCLRKDDYPKNGFLFDHLINLQLNHSLNYLPNLKNFELC
                     GLMYKRVVYGFHNSTSHYNHHFDLLYGNEFRGLEDTIVSNIMGMGHI"
     gene            complement(<1049674..>1051734)
                     /locus_tag="C5L36_0C04840"
                     /db_xref="GeneID:40384349"
     mRNA            complement(<1049674..>1051734)
                     /locus_tag="C5L36_0C04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466171.1"
                     /db_xref="GeneID:40384349"
     CDS             complement(1049674..1051734)
                     /locus_tag="C5L36_0C04840"
                     /inference="similar to AA sequence:RefSeq:NP_015001.1"
                     /note="PKUD0C04840; similar to Saccharomyces cerevisiae
                     YOR356W (CIR2); ancestral locus Anc_7.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322031.1"
                     /db_xref="GeneID:40384349"
                     /translation="MLAFVERRSSKAILNAGNRQILAAFLQKNNVRNLKTLHTGSNTP
                     QKQTSSFKRVSGMTFSTASPRFNSIEYAKNELDEDELEMLSETRAVDTVDVCIVGGGP
                     AGLATAIRLKKIDNEKGDGELRVVVLEKGDIGSHILSGAVLEPRALNELFPELLENGK
                     KIPLPEELVTLVTEDHTKFLFEDGLAVDLPEPPQMKNAGKNYIASLSEVTKWMSEQAE
                     ELGVEIYPNTSVSELIYDSHGGVRGIATRDSGLQRNGSISEDFERGMEFHARLTVLAE
                     GCHGSLSKQVINKFELRNGANPQTYGLGIKEVWQVQPDKFKKGYVSHSLGYPLSDGLY
                     GGGWMYHFGDNLVSLGLVIGLDYKNPWISPYQEFQRMKLHPYYKDILEGGKCISYGAR
                     ALNEGGWQSVPQLHFPGGVLVGASAGFMNVPKIKGSHTAIKSGIIAADTMYEKVVALK
                     EQQEAELAFTQEKNSSEDKDKEEEEEEDESTGMPLPEWKAIDLSEYQTAYKNSWIYDE
                     LYEVRNVRPSFNSDLGTLGTLVGLGMSGLVTMITKGKEPFTLEHTHTDSSCVEDASKY
                     EKINYPKPDGVITFDLMTSVSRTGTYHREGERCHLRIPDMDLQKHKDISWPKFKGVEQ
                     RFCPAGVYEYVKKDENNSDDDVEFKINSQNCIHCKTCDIKIPSQDINWTVPEGGDGPK
                     YQMT"
     gene            complement(<1052042..>1054552)
                     /locus_tag="C5L36_0C04850"
                     /db_xref="GeneID:40384350"
     mRNA            complement(<1052042..>1054552)
                     /locus_tag="C5L36_0C04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466172.1"
                     /db_xref="GeneID:40384350"
     CDS             complement(1052042..1054552)
                     /locus_tag="C5L36_0C04850"
                     /inference="similar to AA sequence:RefSeq:NP_009359.1"
                     /note="PKUD0C04850; similar to Saccharomyces cerevisiae
                     YAL041W (CDC24); ancestral locus Anc_7.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322032.1"
                     /db_xref="GeneID:40384350"
                     /translation="MSSFMTPIRHVSTSSNTSVSSPNSSSPTTGGPTSSANTPARVIN
                     SAMSTTSVLTNRTVNSNDSMYYICLRLMNSLAKIPGMLPYIELAYNQADAAAEQQAMA
                     ISSMESNEFLYRDDATINSSSLGSIANTNTNVSSHSSHSFLSSWNSSLFTFASGLLPA
                     QISYDPVTSISKLLRQGTPLCVMYNALKPENKIDIVSSDDLKICKMNIYQFLSACKLH
                     LNIRDDELFPVTMVFSDNTAHLLRVIHSVEFVLNLEPSFLSPPIPDEIKITDSRSKIV
                     KELIETERRYVKDLDIMVQYRDDLVSSQSILSEDINMLFPQLNEIIDFQRKFLIGLEC
                     SASVPHIYQRIGSVFIHAGVEGFKIYENWSLYQSFANDLIKREANKLRNCSKIIKDPY
                     DLQNFFLIKPIQRLLKYPLLLSQLLKESDPSWPNYNELHQAYIISKEVAMDINESKRR
                     SENIQHLNNLMEEVVDWKGYNTNNVGELLFFNVVTVKDLLTDGHSNEKEVHCYLFEKV
                     IYFFKDVSSKNKILGSKKMSNLSFSSNSSGPLQLSLSGIVYVNKIYKITPADNSPYFA
                     ATQGHFLTLRWKGNKDTGGCIMKFRSEEQLNQWNNTIKKLSADSNSDDTINSHNSAKS
                     LSSLSSSNSLLTGTTNRTSNTSSFNYNNRNSDRTRSSSDSFMKKLRSTSSSSFSNLNA
                     PYPPLPTEKSIRSMSISSPSKVSPVKKSSSGTSLLTNEEVASNFSNMTLSTVNHLAAN
                     TEPHTNIKLLFNKNQSVINLCVPSDIKYNTLVEILVQKISYHLGLDSEVSNSKMSFKF
                     KDEDGDFIRFNGDDDWSIAKEMLAELKQESRILEIMVS"
     gene            complement(<1055645..>1056880)
                     /locus_tag="C5L36_0C04860"
                     /db_xref="GeneID:40384351"
     mRNA            complement(<1055645..>1056880)
                     /locus_tag="C5L36_0C04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466173.1"
                     /db_xref="GeneID:40384351"
     CDS             complement(1055645..1056880)
                     /locus_tag="C5L36_0C04860"
                     /inference="similar to AA sequence:RefSeq:NP_009358.1"
                     /note="PKUD0C04860; similar to Saccharomyces cerevisiae
                     YAL042W (ERV46); ancestral locus Anc_7.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322033.1"
                     /db_xref="GeneID:40384351"
                     /translation="MGKGPTLFNFDAFARTIDERKIKTSTGGIITIICAITTFILLFN
                     EYQDYNRIVLRPELVVDRDRNKHLDINLDITFPEMPCDLVSLDVMDGTGDIEFDLLKN
                     GFTKIRLDETGNEIEVLQFDANENIEDTHIGANEDGYCGPCYGSLNQNDNENRPDHEK
                     VCCNSCNSVRDAYARAGWKFYDGKDIRQCEQEGYVERVNSRLNEGCRIKGSAEINRIG
                     GNIHFAPGASLTIGGRHIHDMSLFDRHPDKFSFKHRINHFSFGEDIHELENIFKNDKH
                     DHRTSHPLDGNSVSANNKYELYTYYLKVVNTRFEYLNGLKIDTNEFSATQHHRPAQGG
                     RDEVNPNTVHARGGIPGLFFYFDISPLKIINREDYNKSFSAFILSLCSAIAGILTVGS
                     ILDKTIWSARSFIKEKKST"
     gene            complement(<1057148..>1059199)
                     /locus_tag="C5L36_0C04870"
                     /db_xref="GeneID:40384352"
     mRNA            complement(<1057148..>1059199)
                     /locus_tag="C5L36_0C04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466174.1"
                     /db_xref="GeneID:40384352"
     CDS             complement(1057148..1059199)
                     /locus_tag="C5L36_0C04870"
                     /inference="similar to AA sequence:RefSeq:NP_014148.1"
                     /note="PKUD0C04870; similar to Saccharomyces cerevisiae
                     YNL251C (NRD1); ancestral locus Anc_1.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322034.1"
                     /db_xref="GeneID:40384352"
                     /translation="MLESTTEFRNTFKELGSLKPPGVSGSRIKNLKDYFLSHVDDEDN
                     LVNILIEEYNQIPVSNKLGPLYVIDAITRGLIDECGSNVEINADAPNGTAPAAIYKIS
                     EKIEDWLNDAIPMANDDVKDKICKLIDIWINCSTFRIELLNSIKEKYFKTFTPPGTPP
                     RKKAQLSTSTSTSTTNDGGSTNSSINKDPTSVLQALANLAKSTSKSNNANNTSNTSPS
                     SSTITTTKKNDTNATNSVNNSISSPPSSSSNISNDSNASNPNAIFQLLQNMNKMTNTP
                     SNNQSNEDTFRDRNDRGRGSGHTSSSNSNSSYNDRKRERSPNRDSNNKPGHDGERNEP
                     SNPHFRPKKSFIDNTIPQGCINVYSRTIFIGGVPHSMDDYQLIQTLKPYAEVQTCIIN
                     TARKHAFVKVYSRAEADQVIQAFSVSHPSGLRARWGVGFGPRDCCNYQTGISTIPIQR
                     LTDADRKWILSAEWGGTTPDLPLQSGLFIEEPDIEVGHGVSSKSISRKMPTNSAFNGP
                     KSDNRGHNNNGNNNNNHGGYNNQRFNPNHMPLNGSYGHNQFMQPPMPQQPMMSGYPQP
                     TPPQHHQQFPPMGGAPPPHGMPPIPGMGSPQMNMPGMNMNNQPPMDQSQMMQAMMQAM
                     SQMQNQQGGLPPAQAQALQGMNSAPNSGNGSNGTPDMNAMFQVMANMMQQQQQRPPSS
                     Q"
     gene            <1059699..>1060469
                     /locus_tag="C5L36_0C04880"
                     /db_xref="GeneID:40384353"
     mRNA            <1059699..>1060469
                     /locus_tag="C5L36_0C04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466175.1"
                     /db_xref="GeneID:40384353"
     CDS             1059699..1060469
                     /locus_tag="C5L36_0C04880"
                     /note="PKUD0C04880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322035.1"
                     /db_xref="GeneID:40384353"
                     /translation="MEKGTLFGETDGIMARCTGTFETESGFEGEIRRWSEEERPKAET
                     KRKRLNRYEGIEESVLDGMEYLLSQLDNVIALRAMFPNLEKRMNNVKFLKPLKMVLAQ
                     VAKIYVIVILLYIRRFLMRLMRLNRLIKMVKTEYTILENNFQTITRVKNKNNANGCGN
                     YTKNNRKTNKVTQYHEKSLQILYTEKAKAIFELVGYVSDLLLNLGALTRRIKLGKPIS
                     RILGIFSWALNMYRICRDGNNKNEQFIHELETRYSDVL"
     gene            <1061685..>1064804
                     /locus_tag="C5L36_0C04890"
                     /db_xref="GeneID:40384354"
     mRNA            <1061685..>1064804
                     /locus_tag="C5L36_0C04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466176.1"
                     /db_xref="GeneID:40384354"
     CDS             1061685..1064804
                     /locus_tag="C5L36_0C04890"
                     /note="PKUD0C04890; Pfam Domains:
                     Fungal_trans(2.2e-25)|Zn_clus(7.7e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322036.1"
                     /db_xref="GeneID:40384354"
                     /translation="MSVNIEQACDSCRKRKLKCSKELPRCSKCIAHKWDCVYSPKTIR
                     SPLTRSHLTQVENELQQIQNVLQYLIPDKSLEDIIKIVQHAQSSSDPSTTLNSSHNNN
                     NNSCKNNSNNNSSNNNNGCNTNNNNNNNSIATLKENVVKNFNTSLLIPSSLKSQPKLP
                     ERYLTDNTEKSVFEWTEFDEDSNTDVEDYQAISPESSPKSSFSKSNSVVSLSNLVTPA
                     PSSTKLSSLPYVSSFNSLDGMGANPTSKSGFLGAGSSTTFLRIMKADELNENTQSQEQ
                     QHHNHIPNQHQPHTQQLHNQRQYQYQYLRNTNNSNQKLNLADKKTEIDFIDAYFKTYH
                     MSYPLLNKSHFISNMEKNLPKDHSSWWCLYYTVCALGSWCVSGDSTNYDLFYYKLAKH
                     HLSQVFESGNIDYVISLILLSNYAQKRNKPNTGWNYLGLAVSMAVSLGLYKQIEINES
                     KKKNIDDLKSFIYDQEIKRRIWWCLYIFDAGAAITFGRPSHIPNPENIDVKLPTNISD
                     EKLDALLNDSTFLSSYEKLPESDEPTIYSALIEQAKMSILTDPFYEKIISQKRPSLAE
                     CHMMHKKLQDFQSSLPDYFNNDFPQIVKKYFNDDLSTVPEWFTLSRSRLLWRISNLQI
                     LIFRPYIWQKIVLISTGKGSKNSSKESTLSEDSKNARRVCLNAATKTIESIMEYLNAS
                     STPINALSSWYTTYFLFQAILIPLSCQCSNPKSKHNRDWWSDIIKGKRALAMLATSNS
                     ACFKLIQLIDDILRRHNAMLKLNNFELNDLIRTSTDTDMSNTIIGQKRTVNPLMKQIS
                     DDMIFDFGTAKRKQYNSLFSPSSRSSSTSSLPKVFNPKPEPPKSPLSNFSSGYKSIPT
                     ISPSLMEKKFNNDCKNISHLSLNSALTMSAVPSDSSLNGTTTNSTSKTAPVPVSSTTK
                     TNNIQHNDDMFSGFMKVKDEKPSEETTNAYLSNIQRMADNLMVTTSPMYTPSNTANSS
                     NEPASTTSADRILDSNLSTVSSVPMDIDPAGSLNKEELLNDIYSMMFEEFQDPSSLTY
                     NFNYDVNGF"
     gene            complement(<1064954..>1066486)
                     /locus_tag="C5L36_0C04900"
                     /db_xref="GeneID:40384355"
     mRNA            complement(<1064954..>1066486)
                     /locus_tag="C5L36_0C04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466177.1"
                     /db_xref="GeneID:40384355"
     CDS             complement(1064954..1066486)
                     /locus_tag="C5L36_0C04900"
                     /inference="similar to AA sequence:RefSeq:NP_009832.1"
                     /note="PKUD0C04900; similar to Saccharomyces cerevisiae
                     YBR273C (UBX7) and YJL048C (UBX6); ancestral locus
                     Anc_1.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322037.1"
                     /db_xref="GeneID:40384355"
                     /translation="MGSLTFLTDAVSAIKKSVSDNLPLMLYISDHASETIGDNPTDNN
                     NKDEYITRVIIDNKHLSEECISCISEKFIRLKIIKGSTDYLNLLAIMPLFDKVVVPCL
                     FFIYSGQVIDAFPQDIDPIKVEGKIMGLLDKISKQSATLTSSSTPAPPGARVPTTTNV
                     SSPPPEVDQSIRSSNSMFYSTSNTTSQEASSGSNNPSKSNAKSLKEEAAELAALKYRE
                     SLLKQRQQAMEDRQRILHLLEQDRRENKPTENVTKQLEVHENIHNVKLQNREKYTIQL
                     KLLDGSTKRVNFKANDRLLDVRSYILKELPEYNSFPFYFFKNIDRITYGDAEELQSLK
                     SLNLNMSTLIIKPMDPEDIPKANITNEYPNTSSFGWFKSKIYSFLWPESNPAASETDN
                     ESDKGLVYHTPPSHTPCHDSNSSLRPVLSSFNLYGSQSFLSSSSIDLVQESNSIPPAS
                     STSSQSLPQAPTAITSSPSPPAHSSEACIKKSKNKPDKKKDENNVDNGNSVSIHVPED
                     QN"
     gene            <1066796..>1070107
                     /locus_tag="C5L36_0C04910"
                     /db_xref="GeneID:40384356"
     mRNA            <1066796..>1070107
                     /locus_tag="C5L36_0C04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466178.1"
                     /db_xref="GeneID:40384356"
     CDS             1066796..1070107
                     /locus_tag="C5L36_0C04910"
                     /inference="similar to AA sequence:RefSeq:NP_015165.1"
                     /note="PKUD0C04910; similar to Saccharomyces cerevisiae
                     YPL160W (CDC60); ancestral locus Anc_8.683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322038.1"
                     /db_xref="GeneID:40384356"
                     /translation="MSSTVASEGQKAVVMENTSRRDALTEIEKKYQALWEVEKPFEVN
                     APTNEDIAYGTPTDELHEKFPKYFASMAYPYMNGVLHAGHVFTYSKAEFTIGFERLRN
                     KNALFALGFHCTGMPICAAADKLKREIELFGEDFSGVPAEAEEEVEEPKKDDKVKTDP
                     TKFSAKKSKVAQKTGRAKYQFEIMQQLGIPLDDIKKFQDPYHWLEFFPPLVEKHVKLL
                     GGKVDWRRSMITTDMNPYYDAFIRWQMNRLRELGKIKFGKRYTIYSVKDGQACMDHDR
                     QSGEGVLPQEYTAIKIQVTEFTDKALEHFKSENFDLEGKKVYLVAATLRPETMYGQTC
                     CFVSPKINYGVFKASEDEYYICTERAFKNMAYQDLTPVRGDYTSSAKVNGSLLVGSKI
                     HAPLAVHEILRVLPMETILENKGTGVVTCVPSDSPDDFVTTRDLFNKPEYYKIEKEWV
                     IEEPVAIVNTEKYGDKCAEYLVKELKINSPKDANQLAQAKELAYKEGFYNGTMIIGKY
                     KGEKVEVAKPKVKSDLVASGEAFIYNEPENVVMSRSGDSCIVSLEDQWYTDYGEENWK
                     EQALECLARMRTFHNETKNAFEGVFDWLKNWALSRSYGLGTKIPWDDKYLVESLSDST
                     VYQAFYTICHLLHKDFNGQEIGPLGVKPEDLTDEAFDYIFCRGDSVENIPVPKEKLDV
                     MRREFEFYYPLDESISGKDLIPNHLTFYIYCNVALFKKEFWPAGIRCNGHLMLNNAKM
                     SKSTGNFYTLEQLVNKFGADATRIALADAGDTVEDANFDETNANAAILRLFNLKEWFE
                     EMVKNKDTLRDGAYNFFDRAFDNEMNQLIEETYKNYEITYYKAALKTGLFDYQYARDF
                     YREISLSTGAGLHKDLVFKYIETQVLLLSPIAPHFCDYVYRELLGKGSIHHAKWPVPE
                     AAVSNELSAALSYTRNLQRTIREAEGFALKKKKGGSSEVNKDADCSLAVYVCSSFPQW
                     QAKYVELAKKLYSEGKFDDMKSVKAQIDGKDMKRAMPFINELKKQLSTEKPEEVFNRE
                     LLFNELDVVRQAVESIKKAPTVLNVAEVQIIAFNNGSSTGKNIINDSDVDIPPKVKSI
                     ENAVPGHPAVLFKNL"
     gene            complement(<1070270..>1071334)
                     /locus_tag="C5L36_0C04920"
                     /db_xref="GeneID:40384357"
     mRNA            complement(<1070270..>1071334)
                     /locus_tag="C5L36_0C04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466179.1"
                     /db_xref="GeneID:40384357"
     CDS             complement(1070270..1071334)
                     /locus_tag="C5L36_0C04920"
                     /inference="similar to AA sequence:RefSeq:NP_014889.3"
                     /note="PKUD0C04920; similar to Saccharomyces cerevisiae
                     YOR246C (ENV9); ancestral locus Anc_8.684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322039.1"
                     /db_xref="GeneID:40384357"
                     /translation="MSTFNPDQLDYVNPNSERRVCLITGGNSGIGFYTVLHLYLHGYT
                     VYLAGRNKLRVTTAISAIEKEALERRSKYSTAQLNARHLGSLHHLSLDLLSLDSVEAA
                     TKEFKQLEKALHLLILNAGIMAVPYEKTKDGFEIQLQTSYVSHFLLTDRLIDLMTSEE
                     SDQQVRNGVLGDPASVKNRTGSIIRDPRIIFLSSIGHWFAFFPFKLDWQYNYWPNMIF
                     TLFRYGMAKCAGIQFMKSLAIRHPSVLSVSVHPGIVLNTNLFTHLTTLPLIGTIYWIL
                     FKLFELVIGISNEEGSYSSVYCALSSNVNRDKDNGKFYTTFGVESNPSYIANNPSLID
                     KSWAWTVHQLDSRGHKIDSL"
     gene            <1071538..>1073028
                     /locus_tag="C5L36_0C04930"
                     /db_xref="GeneID:40384358"
     mRNA            <1071538..>1073028
                     /locus_tag="C5L36_0C04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466180.1"
                     /db_xref="GeneID:40384358"
     CDS             1071538..1073028
                     /locus_tag="C5L36_0C04930"
                     /inference="similar to AA sequence:RefSeq:NP_009833.1"
                     /note="PKUD0C04930; similar to Saccharomyces cerevisiae
                     YBR274W (CHK1); ancestral locus Anc_1.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322040.1"
                     /db_xref="GeneID:40384358"
                     /translation="MFQTQKNGADNEKISHSLPRLRLARGDRKKPAPKLSMNIPLEEP
                     QVPVLNLFAHPTIPSLPPMPKQLKKSPSIMQKDKKMNKLTLNFSDDLHNGNNNNNVNN
                     NGAITNGLPSAATTLTVTSISTLYEQSPQDQSSLITSFKNRLNIDNDNNDDDDYDGEN
                     NSDSFNELTDSYTNTPTEQNEHLFTLLTKGIEMLTEEDWKVLHEEKMIETLEVLGEGN
                     GGSVKKCRILTKNPAVFALKIITTNPSPEFQKQMVRELNYNRKFNSDYIVKYYGTFLD
                     ESSSSIHICMEYMGGGSLDAIYKAFKERDGRLSEKPLGVIASSVLKGLAYLNEHKVMH
                     RDIKPQNILLDSKGNVKLCDFGVSGDVVNSLATTFTGTSFYMAPERIKNEPYTISCDV
                     WSLGLTVLEGALGEFPFVRESSPDLHISPLDLLIIILEFEPILEDEPDEGIKWSRGFK
                     DFIKVCLTKEGRQRPSPRQMLEHPWLIKMMNKSVRMDKLVELCWGK"
     gene            1074547..1074620
                     /locus_tag="C5L36_0Ctrna6I"
                     /db_xref="GeneID:40385079"
     tRNA            1074547..1074620
                     /locus_tag="C5L36_0Ctrna6I"
                     /product="tRNA-Ile"
                     /note="PKUD0Ctrna6I; codon recognized: AUU"
                     /db_xref="GeneID:40385079"
     gene            <1074992..>1076158
                     /locus_tag="C5L36_0C04940"
                     /db_xref="GeneID:40384359"
     mRNA            <1074992..>1076158
                     /locus_tag="C5L36_0C04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466181.1"
                     /db_xref="GeneID:40384359"
     CDS             1074992..1076158
                     /locus_tag="C5L36_0C04940"
                     /inference="similar to AA sequence:RefSeq:NP_014315.1"
                     /note="PKUD0C04940; similar to Saccharomyces cerevisiae
                     YNL084C (END3); ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322041.1"
                     /db_xref="GeneID:40384359"
                     /translation="MPKLEQWEIKKYWEIFRGLKPQDNKLNGEKLAPVFKNSRLEQDK
                     LTKIWDLADIDADGSLDFEEFCIAMRLIFDLVNGNTTNVPSNLPSWLIPGSKRHLLDA
                     EEAVSTRMNNVNAGSESDTDEEYTLDSDFDWYISPTDKSTYEDVYNSSCDNYGRIKFS
                     SLDDLYKSLSKVPLTDISYAWNMVNPKQSETIDKDQCLVFLHILNQRSNGKRVPRSIP
                     ASLRATFSKEIPDYDPQSQQGNISQPAFNSDTKREDSFASGYLNKLGASKSPLVSNGT
                     DFSETKGTDWEEVKLRRELEDLEQLLEKAEMEKNNKGKDNHLALVKHEFEQLLKYKEE
                     QVKQMDSKHGGGVNLDSAISNINSIEIQVQQLEQYLQSKQDELSRLNREIEAAK"
     gene            complement(<1076412..>1076912)
                     /locus_tag="C5L36_0C04950"
                     /db_xref="GeneID:40384360"
     mRNA            complement(<1076412..>1076912)
                     /locus_tag="C5L36_0C04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466182.1"
                     /db_xref="GeneID:40384360"
     CDS             complement(1076412..1076912)
                     /locus_tag="C5L36_0C04950"
                     /inference="similar to AA sequence:RefSeq:NP_015071.1"
                     /note="PKUD0C04950; similar to Saccharomyces cerevisiae
                     YPL252C (YAH1); ancestral locus Anc_6.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322042.1"
                     /db_xref="GeneID:40384360"
                     /translation="MFKNLAHTGKFALNRALTRRSAPSMLKSGELIRSFQSSAVSFHG
                     HIKKPKPGEELHITFITKEGEMKTFEVAEGDNLLDIAQANHLDVEGACGGSCACSTCH
                     MIIDPAYYDKIPEPDDDENDMLDLAFDLTETSRLGCQVVMTKDLDGIRIALPTMTRNL
                     INKDMN"
     gene            <1077210..>1077857
                     /locus_tag="C5L36_0C04960"
                     /db_xref="GeneID:40384361"
     mRNA            <1077210..>1077857
                     /locus_tag="C5L36_0C04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466183.1"
                     /db_xref="GeneID:40384361"
     CDS             1077210..1077857
                     /locus_tag="C5L36_0C04960"
                     /inference="similar to AA sequence:RefSeq:NP_013924.1"
                     /note="PKUD0C04960; similar to Saccharomyces cerevisiae
                     YMR197C (VTI1); ancestral locus Anc_6.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322043.1"
                     /db_xref="GeneID:40384361"
                     /translation="MSELFNGYERDFKIEYSDAQSKIEQVYGLDDESRRVELMKSIES
                     SIDDCLDLLDSMSLEVQQIATHQRSSYNAKVRTYRNDIDRIKKDLKNLMDDKDRRQLL
                     GGSHNGDVDSNQRQKLLNTNATIERSSQRLEDATRTARESETVGSSILNNLRSQRDQI
                     LNARDTLSEADTYVDRSLRTLKSMTRRMATNKLITYGIIVILVLLILLVLYNKIS"
     gene            complement(<1078046..>1081192)
                     /locus_tag="C5L36_0C04970"
                     /db_xref="GeneID:40384362"
     mRNA            complement(<1078046..>1081192)
                     /locus_tag="C5L36_0C04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466184.1"
                     /db_xref="GeneID:40384362"
     CDS             complement(1078046..1081192)
                     /locus_tag="C5L36_0C04970"
                     /inference="similar to AA sequence:RefSeq:NP_013923.1"
                     /note="PKUD0C04970; similar to Saccharomyces cerevisiae
                     YMR196W; ancestral locus Anc_6.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322044.1"
                     /db_xref="GeneID:40384362"
                     /translation="MPLSDKPSREETRLQEDKKRTKYWKKWGTYVAERTWGVPREDYT
                     DEGDAWQFDFETAKSRVFRWNEQGLAGVCDTHQLFNTTMALWNENDDILKESLFGLPG
                     GASSKSGNHGEDVKELYYYLDNTPTHSYAKFLYKYPISKFPYEKLYEENAKRSKQEDE
                     FEITDTGVFENNNYFDVYFEMAKDGDDPEELNFRITAYNRSNAPAPLHIIPQFFFRNT
                     WSWNLESEADKEKPTMYKETENTIRMKHYKLGERKIIFAPSPGYEGSADDVEPKLLFS
                     ENETNFKRLYNVENKSLYCKDGFHDFIVDEVNGAVNPENYGTKACAWFVFDENGGVPP
                     GDYVTIRYKLTKDLSNTYLDEELLDYVIASRVKEADEFYWNVSPLPIPPQLRNVQRQA
                     FAGLLWTKQFYHFVHEYWYKGDPDSELPPTEGRANNRNKEWKNLYNENILSMPDNFEY
                     PFYCSWDTAFHTIPLAMIDPEFAKNQLDVLTREWYMSPQGQIPAYEWNFSDTNPPVQA
                     WAAFRTYKIEKKNWGTQDRFFLERVFQKLMLNFTWWVNRKDVNGNGIFEGGFLGLDNI
                     SVFNRSEPPHGVRLLQADASGWIAWYSLTMMNIALELAKENPVYEDIASKFFEHYLLI
                     ADAMTFLNKSEKNCSPTSDSLWDNDDQFFYDKILWEDDSLTPIKVRSLVGLIPLFATT
                     TIEPEVLNRFPSFKKRLEWLIRNKNYLFKRHIASMDAKGDCDRLLLSLVNKERLVSIL
                     EKMFDETEFLSDYGIRSLSKYHEEHPVSMHINGEDFYLSYIPGESDSGMFGGNSNWRG
                     PIWFPMNFLLIESLVKFFLYYGSSLKIEMPVGSGDYLNLGQAAEEIQQRLIHLFMPNK
                     EGYRAYHGRPCDTLDNEDEIELNEDQIRHNEILEKLNKDEYFKDLLNFYEYFDGDTGR
                     GLGAKWQCGWTALVARMIQDVGVICREPNAPFRRRSFYDANEIQNYEPAPQPYALFGR
                     RKSGKSLFNLAAAHLEFDEEEKGIHQVPGLSRRSSVKTMESQESQNEDFLKSVKDAMA
                     KYQISDEVNIHAGEYETN"
     gene            complement(<1081447..>1084941)
                     /locus_tag="C5L36_0C04980"
                     /db_xref="GeneID:40384363"
     mRNA            complement(<1081447..>1084941)
                     /locus_tag="C5L36_0C04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466185.1"
                     /db_xref="GeneID:40384363"
     CDS             complement(1081447..1084941)
                     /locus_tag="C5L36_0C04980"
                     /inference="similar to AA sequence:RefSeq:NP_011946.1"
                     /note="PKUD0C04980; similar to Saccharomyces cerevisiae
                     YHR079C (IRE1); ancestral locus Anc_5.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322045.1"
                     /db_xref="GeneID:40384363"
                     /translation="MFCRLWAVLFWILGVPLILDGVGPSLICSSHPTENEHPNINKPN
                     KELIVPHGEPLQKTAYSEMSSIIGRGISASRIDEFEVTNLILASDIEGNLNAINRKTG
                     ELLWSLVGGQPLVQIESDIDKNFRYTHTTPVSSPSKGATQEPEDTYNRYNNPKMNSEN
                     TASQKKGNTYYNDANRINNSRNSRQKYGNEITWIVEPYGEGTVFQFTGRNGLEKLPLS
                     IKQFVMNSPFSLDGFVYTGRRISGMIKINSRTGAIVETFGLDSIGICSTRDEATLNSF
                     STVDFPEDSDEFLYENFGDESRYYGSHEFNSGDNKNGPFITLGKTVYDLTVHSKNNTS
                     WNITYVHWGPNNLHTPLAEQNTHSLDDIYIQPFHDSSLLALDAEAKSVKWVSNLPFVT
                     VNIFDVLLPDHEKSEYIILPHPIDSKKSTVPSRENGATYLDRTKEGSWYALSEEHFPS
                     LVRSAPLAKYISNERWRLPAIFANDDLLEISIAGVHDDSLKRADESLEIDAANIVATY
                     PSATGNTQVPVKYSRYISGGDRSLDVKGLLDGSISYNENELEPNYLARNPTSTFKNST
                     FSQLIFRALENVFVALVCLAIFYVLNRFGLFNNLIAKTDNFDHHSAVEPLTGEKDSNR
                     ISDNETFVDTDAYQANADLTIEAVTSANKIPAVETFEGGFSAKADEMPDTAGLDKTYD
                     TELAEITKKKRKRGTRGGRRNRRKDDEVIVSQIITSSIQEGEEDEAQQDGKACVQTRN
                     TRISNNLVVTDEVLGFGSHGTIVFKGIFENRPVAVKRMLIDFYDVASHEINLLQESDD
                     HSNVVRYFCSQEYNKFLYIALELCSASLEDVVERKKNIYCSVDKQNILYQIANGVYHL
                     HSLKIVHRDIKPQNILVAISKKAIKGPENKDITKTEYRFLISDFGLCKKLENDQSSFK
                     GTTANAAGTSGWRAPELLLDSSPAYRDQSLKHKIRLTRSVDIFSTGCVFFYVLTSGYH
                     PFGDRYIREGNIIKNEYDLSKLDNIRDSYVAKDLISRMIQKNPRARPNIVYVLKHPYF
                     WSIDKKLDFLLKVSDRFEVERREPPSELLLKLESIAPKVLGPGGWFNKFDSEFIDNLG
                     KYRKYDGHKLMDLLRAIRNKYHHYQDLPESLAAQMGPLPDGFYWYFAAKFPQMLMTVY
                     SLMNEILRDDELLAQFFI"
     gene            <1085500..>1087620
                     /locus_tag="C5L36_0C04990"
                     /db_xref="GeneID:40384364"
     mRNA            <1085500..>1087620
                     /locus_tag="C5L36_0C04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466186.1"
                     /db_xref="GeneID:40384364"
     CDS             1085500..1087620
                     /locus_tag="C5L36_0C04990"
                     /note="PKUD0C04990; Pfam Domains:
                     Acyltransferase(3.2e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322046.1"
                     /db_xref="GeneID:40384364"
                     /translation="MFQLVYELLDWFLQIVVDIFFREVSIRGSFNFPSSGPTIVVIAP
                     HANQYLDAAISVLSAKVVSNRQVFMIEAASSYRNSWMSLWSKWSGAIPVERPQDLLAP
                     KDGIIRFANYPTDQLTIVGENTHFLRDCGPKGLIGLPNKAGNVKIAQIVSDTKLVLAS
                     KMKKQAGIELLLKGTTYMFAPRIDNSQLFEKVFDALKEGTCIGIAPEGGSHDRPELLE
                     FKPGVALMALGAVAKYSDINVTIVPCGLNYFHPHKFRSRAVVEYGTPIVVGQERVQSY
                     KNDSRKAVSDLMAEITAAMNLVTTQAPDYETLQVIQAVRRLYSYGRFHRPPLPVVVEM
                     NRNLLIGYKEFKDDPKVIHLRDSVLDYNHKLRTFGLKDHQLEDASLNKLQTFQLLIKR
                     VCLLLFYGVLSLPGTILFSPIFITCSVMSKKKQKIALSKSVVKINATDVLASWKVLIA
                     LFFAPVCYFIYSVTSVLLIIHYELLPDTTRSFSGKILIFCVSWAVLVCTTYSAFKMGE
                     VGMDIYKSILPLVLFLSPFSQQLVKLKEERKNLSIEVTELINELGPKVFKKFNETFID
                     DLKEQVEQEEEEIRSNSRSRSTSRSRSASRSRSSSKLRLIQNSGSLHNPTPSLSRTSS
                     NYSGFSNFDGSDDHGKLPDFSHVSIFSDQLQMPDSETSATSSFENISSFNEALSTGVE
                     TSSLTEKIKKAVIQRNLESESQEK"
     gene            <1088002..>1091595
                     /locus_tag="C5L36_0C05000"
                     /db_xref="GeneID:40384365"
     mRNA            <1088002..>1091595
                     /locus_tag="C5L36_0C05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466187.1"
                     /db_xref="GeneID:40384365"
     CDS             1088002..1091595
                     /locus_tag="C5L36_0C05000"
                     /inference="similar to AA sequence:RefSeq:NP_013603.1"
                     /note="PKUD0C05000; similar to Saccharomyces cerevisiae
                     YML104C (MDM1); ancestral locus Anc_8.824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322047.1"
                     /db_xref="GeneID:40384365"
                     /translation="MVYLALLNMRMVDLCVTILVALIYSRMILQLFYGFIGLIFGILT
                     LIVISNYIPLEQFDEIEFSRKRVHKTAFSKRKNWSSKLNQLKEDATIASDDQQIYPEN
                     FVINDTLNNLITLIIRDFVDLWYKRVSGDKLFQSSLFHELSYVTKQLKERLVEVDFSD
                     LTIHTLIPLLNDHIEKIMVAHEVTRVSKIEGKILQKIKTTADDYVLASHYNRGKLHQG
                     IKLRSDDPEKDLKKYLNRLASKMLPHLLEEEEVNSAPIRILVGEILSSFVLLPVCMML
                     SEPEFYNELLVSVLNRQMKDRIDVKRFRNVLRKHSTTFDTGRQINHPFLEIMPYHLSL
                     STSKTEFELLHNIVEKTNDRDTLLKFKYFMILQHEKILEPVKEASSDPKLQQKYIKRF
                     DMLIGMINNKLSKIMQEQLPKVASEGNLSEFNQQITGLPTIQKEFEFHEILLSSTKLD
                     FFKEFMKSRGDRYLILQFWVEANDLRNPLEYVNYSYDAPENIESQPVSNKIKPNEEDN
                     AEDNYETNTLFFDKQLSQAEDIERIYNEYFSFSVMKIPPQVHLVVERFVKSEFADVLL
                     YHRARKNIFKLQEFEYFRMMKSDFVAFKTSPMWTKMIIEEAVNRNKTTISKIEAISLH
                     DFVSNDKLASLIESGSVDDENYGDPLEKYSEREGNGNYVDVNVSGKVSNKVIKAVEDA
                     LNEITTASAFKSQLDYVNNEKKNSRLVSDDVAKDLFGSDDRDNDLFGSNSLPPLNDTE
                     DDLVPSIDDAASTASESTDQMESSDLQEVPDDLNLSEQIAKLNVEVERLEQQKSIINT
                     LLQKAEIINNVPELKILKKSFISLEKELKLKVMQKEQYVVQEGKNSLYQKSAVDILNV
                     ISTKDKNGKSFTMYVIKVVKFTDSDLSRIAASWMVTRRYSQFYFLHNYLKKTYPEVSD
                     IEFPKKRLVVKFMQNPLIEERQMKLRAYLQELIKNKNVCTDSVFRNFLSSEIFSASHS
                     TNTSTIRPPKSDTSGTKLYNVVSTQALYPLLSLINQKGIIDYQLSGFEKNLFFSDTHE
                     IGVDQEVKTKDISFFKPIGDLIVTIFHLNNSTSWLRGKALVLLFQQVFGSTVEKVVRS
                     NIDGKLKQEETVSDLLTTLQDKLWPNGTFRERSKPRSSIDKERHKQQVRYLLHAFLRD
                     TSAKIFGQTAAKEAAETIFLSFQNELLNRHLILSILDEIMLKIFPELTSTD"
     gene            complement(<1091670..>1093124)
                     /locus_tag="C5L36_0C05010"
                     /db_xref="GeneID:40384366"
     mRNA            complement(<1091670..>1093124)
                     /locus_tag="C5L36_0C05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466188.1"
                     /db_xref="GeneID:40384366"
     CDS             complement(1091670..1093124)
                     /locus_tag="C5L36_0C05010"
                     /inference="similar to AA sequence:RefSeq:NP_013997.1"
                     /note="PKUD0C05010; similar to Saccharomyces cerevisiae
                     YMR270C (RRN9); ancestral locus Anc_8.825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322048.1"
                     /db_xref="GeneID:40384366"
                     /translation="MFFKSEFSDEEVTDHKRYVNRQSRRTRRNAKNIQPKKEPVVYII
                     SDSDTSERSLGSSTAESGESSESSESSESSEKSEENEESEESEESEKSEDGQEEHDDN
                     NESIDIRKDGDSSFEDSSSDETNDDIDIVQYKSLVNDVIGYFQSKEQPEIHDVFSLCS
                     ELPKEIQKYTNLLLDFNIEFTKDLPLHLYSVYLLSTRNRNVPPPGFSNWPLQTQDLIT
                     PRNAIKTTDFQSLGQQARAFRVKMNWTRYTKINFSENNLLHKPKLRMLEFWHPEINAT
                     DELNECMDAIFEKRINKQIEQYSEENRYDKHGLPSRYRYQRHTPEDIRMDPILRNNIK
                     TKLDNIIDRMVESYQTGLLTNESLGRKLAAKVYKPPEYGLNWLNVLTNIDQKDKKARM
                     HLLMLFNLKLEKDILSGPINTYSSSFEPFANAQIYKDKVLKGIAIKRKRAAVPYSTNL
                     KNMNRVTKKQKSHIRYNLDDFLNLSLPSKEQKQR"
     gene            <1093336..>1094196
                     /locus_tag="C5L36_0C05020"
                     /db_xref="GeneID:40384367"
     mRNA            <1093336..>1094196
                     /locus_tag="C5L36_0C05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466189.1"
                     /db_xref="GeneID:40384367"
     CDS             1093336..1094196
                     /locus_tag="C5L36_0C05020"
                     /inference="similar to AA sequence:RefSeq:NP_013602.1"
                     /note="PKUD0C05020; similar to Saccharomyces cerevisiae
                     YML105C (SEC65); ancestral locus Anc_8.826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322049.1"
                     /db_xref="GeneID:40384367"
                     /translation="MVASYSVILTQRNMPSLEEIEDIEDIDNLDMDLAEFDPDLVTPI
                     APAKPKAQVSRSQDQDQSDISDIFKGMGFNSSPGNQQFQATQPQERNPPMTMYDSMTP
                     EQRKEFKMMQIVYPCYFDKKRTYKEGRRLAIEHCVENPLAKTILDACRILQIPAVFEP
                     EKTHPQDWGNPGRVRVGLKYEKNPTHPVLKTKKQALEAIAEYLKTHPTTFKSVKDLPG
                     PPDLMQSTWEPSEIPVPKGFKMNTIVPMHSFLIMKHPETAGAYMKSAAETEKPVEAKK
                     IKHKIQRIRG"
     gene            complement(<1094285..>1094944)
                     /locus_tag="C5L36_0C05030"
                     /db_xref="GeneID:40384368"
     mRNA            complement(<1094285..>1094944)
                     /locus_tag="C5L36_0C05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466190.1"
                     /db_xref="GeneID:40384368"
     CDS             complement(1094285..1094944)
                     /locus_tag="C5L36_0C05030"
                     /inference="similar to AA sequence:RefSeq:NP_013601.1"
                     /note="PKUD0C05030; similar to Saccharomyces cerevisiae
                     YML106W (URA5) and YMR271C (URA10); ancestral locus
                     Anc_8.827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322050.1"
                     /db_xref="GeneID:40384368"
                     /translation="MPSYKETFLQAALDAEALKFGTFTLKSGRISPYFFNMGLFSTAK
                     TLSTLGESYARAIVESGIEFDILFGPAYKGIPLAAITVTKLYEIGGAKYANIGYSFNR
                     KEKKDHGEGGSIVGCNMKGKKILIIDDVMTAGTAINEAFGIISAEGGNAVGCIIALDR
                     METTKDSNDSATNIVAKRYGVPVFSIVCFDDIIEVLKDQLSEEQMEKINEYRKQYVPA
                     K"
     gene            <1095300..>1096820
                     /locus_tag="C5L36_0C05040"
                     /db_xref="GeneID:40384369"
     mRNA            <1095300..>1096820
                     /locus_tag="C5L36_0C05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466191.1"
                     /db_xref="GeneID:40384369"
     CDS             1095300..1096820
                     /locus_tag="C5L36_0C05040"
                     /note="PKUD0C05040; Pfam Domains: zf-C3HC(7.6e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322051.1"
                     /db_xref="GeneID:40384369"
                     /translation="MSSENVYNETSLTTNNIMNILQQISISPPGSPYEVNGVTPIITG
                     LSTSQRSNKSSLQHFHSLPKSIRPKRRLSSSSSFSTISTTPAATTGNNFDKNHKRQIV
                     NLRGLSQLQSGRLIPSPFSRSFLIQRLNTFSVFNWTIDNPKLSPLACALQGWKCHAVR
                     KNELHCTGCHAGIIIKLPEVPGSDVSTYPDEKKVFNNQHHMDDYNQVLNNTERYELQF
                     EFKFLDDELDEDEDDYNDDIHIYETLVNSFTSRLINDHYPTCPFVPFVPLTPKDENYY
                     LSPKDISRELNKFTNRLLILMANKNRLIGRNFKTQFLSSDERIFLLEYLRESSRQNDT
                     TIATDIEDEDGIKNGITCDYETDQRVNPCLDVILPALLGWELKVQTFHNKKFLLLNCE
                     CCTRRILLSSTGIESVKDIEELKPCPYRAEIPAREQLTEFDETIGIRNQDLFEEDYDE
                     ELIDLELEHDTWCCMKAGWRIVLEGLRSITDVDLKNIHHGLHNDEYRQTIENLRSL"
     gene            <1097118..>1098254
                     /locus_tag="C5L36_0C05050"
                     /db_xref="GeneID:40384370"
     mRNA            <1097118..>1098254
                     /locus_tag="C5L36_0C05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466192.1"
                     /db_xref="GeneID:40384370"
     CDS             1097118..1098254
                     /locus_tag="C5L36_0C05050"
                     /inference="similar to AA sequence:RefSeq:NP_013999.1"
                     /note="PKUD0C05050; similar to Saccharomyces cerevisiae
                     YMR272C (SCS7); ancestral locus Anc_8.829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322052.1"
                     /db_xref="GeneID:40384370"
                     /translation="MGASLPLFAKSTVEQHNTEKSCWVTLYNRKVYDVTNFLEEHPGG
                     PEYIMDYAGKDITQILADAESHEHSVSAYEMLDDGMLIGYLATPEEEKELLEKHKDIK
                     LKPEYDDDGLRVADLTEFGEIPDDLLHLKTDHSDDYKKHKFLDLDKPLIMQVLRSNWT
                     RDFYIDQIHRPRHYGKGSAQLFGNFLEPLSLTPWWVVPCLWLPVNFYILSIAARNLSP
                     LTTFTFWAIGLFTWTLIEYCMHRFLFHLDDNLPENRFAFTLHFLMHGVHHYLPMDKMR
                     LVMPPTLFVVLAYPFYRLVFALLPYYIACAGFAGGFLGYIMYDVTHYSLHHKRLPDYV
                     EKLKKNHLEHHYKNYQLGFGVTSMFWDHVFGTDLHPNDVYRKRN"
     gene            complement(<1098492..>1099961)
                     /locus_tag="C5L36_0C05060"
                     /db_xref="GeneID:40384371"
     mRNA            complement(<1098492..>1099961)
                     /locus_tag="C5L36_0C05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466193.1"
                     /db_xref="GeneID:40384371"
     CDS             complement(1098492..1099961)
                     /locus_tag="C5L36_0C05060"
                     /inference="similar to AA sequence:RefSeq:NP_011889.1"
                     /note="PKUD0C05060; similar to Saccharomyces cerevisiae
                     YHR024C (MAS2); ancestral locus Anc_5.268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322053.1"
                     /db_xref="GeneID:40384371"
                     /translation="MLSRFTSAKRQVSSTLKRHVRFNSNVSTPTIIETLPNGIQVAID
                     PTPSYFSALGFYVKAGSRYEGTYGLSGCSHILDKLSFKSSQNFDLKNMTESLNKLGGN
                     YMCASSRESMIYQASVFNNDVEKMFELLTETVVRPKLTQEEIDEQLLGTEYELNEIWL
                     QSDLLLPELFQQVAYSHKNLGCPLLCPADRLNKIRRDDLLKYRDTFYNPENLVIAFSG
                     VEEDQAHKLIEKYMGDFKSKSNAKLIMEPAQYTGGEFSLPIPKGIEYRGEEFHHLYVG
                     FEGVDIQSKDIYKLAVLQMLIGGGGSFSAGGPGKGMYSRAYTRVLNQYGFVESCKSFI
                     HNFTDSGLFGVSLSCVPQADRVMAELVGYEFNLLMSHDVGKGGISDREVSRAKNQLKS
                     SLMMNLESKMVQLEDMGRQVQIYGKRVDVIEMCEQIDSVTRSDVIKMAEKVFTGSEPT
                     IVVQGNREDYGDIRGMLNRYGLGQQPKTSEDNSKSRKWF"
     gene            complement(<1100738..>1101451)
                     /locus_tag="C5L36_0C05080"
                     /db_xref="GeneID:40384372"
     mRNA            complement(<1100738..>1101451)
                     /locus_tag="C5L36_0C05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466194.1"
                     /db_xref="GeneID:40384372"
     CDS             complement(1100738..1101451)
                     /locus_tag="C5L36_0C05080"
                     /inference="similar to AA sequence:RefSeq:NP_010917.3"
                     /note="PKUD0C05080; similar to Saccharomyces cerevisiae
                     YER002W (NOP16); ancestral locus Anc_7.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322054.1"
                     /db_xref="GeneID:40384372"
                     /translation="MVSVRKRKMNRSGVAKVRRKNNNKDKFNPKSNPVISKYWDKDLT
                     AKQNYKKLGLTLKIGGPSGGEEKKIVIKPIHHNNMEEDLLESEDESKEELEQEGAEEE
                     LDPYDPANILEGTAKMVRNEQGEVVKIIYGTKKITKTGTGASDSQDKEDEDEEEEQTE
                     EAKKVIAELEALAALPKKKEVHKMNELEIYRYEKLIEKYGDDYEKMKWDKKLNPFQLS
                     PGQLRKQIKKYLELHATVN"
     gene            <1103184..>1104689
                     /locus_tag="C5L36_0C05090"
                     /db_xref="GeneID:40384373"
     mRNA            <1103184..>1104689
                     /locus_tag="C5L36_0C05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466195.1"
                     /db_xref="GeneID:40384373"
     CDS             1103184..1104689
                     /locus_tag="C5L36_0C05090"
                     /inference="similar to AA sequence:RefSeq:NP_012266.1"
                     /note="PKUD0C05090; similar to Saccharomyces cerevisiae
                     YIR001C (SGN1); ancestral locus Anc_7.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322055.1"
                     /db_xref="GeneID:40384373"
                     /translation="MSSHLVGPLTFRNTEGGKQPNNLVESLPDNSEDSLSSKDSTSSL
                     TLSSTASTDSTISSSLKSHLGRNSKNLHLESQIPELDEPLSNLDLSQDLDGTSSSSDS
                     CEEEPQLKDAVPLGPHQPKNQREIDSRSIYVSNIPFKISPWKLKQIFTYGTPSIPGCG
                     ENSINRVTIVCDRYSGLPKGYAYIEFSDKKYVENSLRFNGLDVDGRNIEVYKKRTNLP
                     WINANSARKHFYLNGNHNDKFGNNYNFFSKHGTFKNISTENNHSIMDSNNNSMDKNNN
                     NLRDSNNNIIDNSNNLMDNNNDYMDNNNSFMDNSNSVTDNNYKTKFNDLMGNKNNDNK
                     QFGYFNRNFTKHRNSNYNFLNHDLRNTKYSPSNFKHHSIPSKMESPGGYSSVDVNENK
                     DSNVENRDNTTSEHGHEHELTNVSSPLGSDNSLEGSVSSNDTYHPGGMSSRGRASRGV
                     RGRGRGSSRGRGRGRGSSRGRGGLALHGKLVIDDHHYLTPSSRVGIYNNSE"
     gene            complement(<1104880..>1105380)
                     /locus_tag="C5L36_0C05100"
                     /db_xref="GeneID:40384374"
     mRNA            complement(<1104880..>1105380)
                     /locus_tag="C5L36_0C05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466196.1"
                     /db_xref="GeneID:40384374"
     CDS             complement(1104880..1105380)
                     /locus_tag="C5L36_0C05100"
                     /inference="similar to AA sequence:RefSeq:NP_012262.3"
                     /note="PKUD0C05100; similar to Saccharomyces cerevisiae
                     YIL004C (BET1); ancestral locus Anc_7.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322056.1"
                     /db_xref="GeneID:40384374"
                     /translation="MSTSRYSAKAQKRDRQALFSVEDLSKSPSPLPLNTSSAYVYNED
                     NVHAGSEINTGVSTPYERPKHVAYSAKAAEMAMLESQSDESMNTMKYKLGALKDLSLA
                     MGEQINKSKKNLSELGDDMGLSSERIKWNMGRMRRFVEKSGVGWRVWGVFSIIILWLF
                     FWVWLF"
     gene            <1105603..>1106166
                     /locus_tag="C5L36_0C05110"
                     /db_xref="GeneID:40384375"
     mRNA            <1105603..>1106166
                     /locus_tag="C5L36_0C05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466197.1"
                     /db_xref="GeneID:40384375"
     CDS             1105603..1106166
                     /locus_tag="C5L36_0C05110"
                     /inference="similar to AA sequence:RefSeq:NP_012288.1"
                     /note="PKUD0C05110; similar to Saccharomyces cerevisiae
                     YIR022W (SEC11); ancestral locus Anc_2.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322057.1"
                     /db_xref="GeneID:40384375"
                     /translation="MNLKSIRLQLNNILTMAMVLAGSFAVWKGLAVVTNSASPLVVVL
                     SGSMEPAFQRGDILFLWNREEFVNVGDIVVYNAPQRDIPIVHRVVREHIVEEKPTKLK
                     NKNVNSATSKKTQQYLLTKGDNNERDDLPLYGYGKSYLNREKDIVGNVKGYLPKVGYV
                     TILITENVYFKYAMFGFLAISALFTQE"
     gene            complement(<1106235..>1107833)
                     /locus_tag="C5L36_0C05120"
                     /db_xref="GeneID:40384376"
     mRNA            complement(<1106235..>1107833)
                     /locus_tag="C5L36_0C05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466198.1"
                     /db_xref="GeneID:40384376"
     CDS             complement(1106235..1107833)
                     /locus_tag="C5L36_0C05120"
                     /inference="similar to AA sequence:RefSeq:NP_012913.3"
                     /note="PKUD0C05120; similar to Saccharomyces cerevisiae
                     YKL012W (PRP40); ancestral locus Anc_2.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322058.1"
                     /db_xref="GeneID:40384376"
                     /translation="MAWERLKDSSSGRSYYYNNETELTQWEFPDDILLQTLQKHGWDR
                     AESDGNVYFYTVDGSTSSWNLPEQVLIELKSIFGDDLSEAEIKGESSVNGEEEIAESE
                     SETQNQQEQEHEPQQQSPASVNPEKDHDSNSEKKVVPKTNELLGIEYSGIEEGGSTAV
                     DVSMASDSPPKDQVENDFIGLLESLDIPTNSTFNQCIPTLVNHANYWEVTDPLLRKEL
                     FTQFITQKRALELQNSKDKIRPLFMEVMAKNNVKYYTRWETFEKLIMDDDLCNTISDD
                     VKREFFDEYVSKLRSEKEYQIAKTKQNELVELEKELRATVELNTEFTKTAVQLQSKYK
                     NVTKSEILDVFEKVMSDKEKEQELMLSIEKKKNYRTDRKARQGFIRLLEKLLESGEFK
                     PSSQLRWYQFVSVFKDKPEFLELCGHRGSTAIDYYWDIVEKENLKLQDKVELFKQQLV
                     NANKKLGDVDEKMFIDIMLRASKAEVCNTPQEDMLSIYRLIKSPEAQTTQKRGTHQTD
                     FPEGRLGVSKDGPQKRQKITLRRS"
     gene            <1108090..>1108599
                     /locus_tag="C5L36_0C05130"
                     /db_xref="GeneID:40384377"
     mRNA            <1108090..>1108599
                     /locus_tag="C5L36_0C05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466199.1"
                     /db_xref="GeneID:40384377"
     CDS             1108090..1108599
                     /locus_tag="C5L36_0C05130"
                     /inference="similar to AA sequence:RefSeq:NP_012912.1"
                     /note="PKUD0C05130; similar to Saccharomyces cerevisiae
                     YKL013C (ARC19); ancestral locus Anc_2.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322059.1"
                     /db_xref="GeneID:40384377"
                     /translation="MSQSLKPYLTAVRHSLNSALCLQDFSSQIVERHNYPEIESKRTQ
                     EILLNPLYISRNEFERVLIEPSINSVRVSIKIKQSDEIEEILVDKFTRFLTKRAENFL
                     ILRRVPVEGYDISFLLTNYHQEVMMKNKLVDFIIEFMEDVDKEISEMKLFLNARARFV
                     AEAYLNMFD"
     gene            complement(<1108878..>1111313)
                     /locus_tag="C5L36_0C05140"
                     /db_xref="GeneID:40384378"
     mRNA            complement(<1108878..>1111313)
                     /locus_tag="C5L36_0C05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466200.1"
                     /db_xref="GeneID:40384378"
     CDS             complement(1108878..1111313)
                     /locus_tag="C5L36_0C05140"
                     /inference="similar to AA sequence:RefSeq:NP_012272.3"
                     /note="PKUD0C05140; similar to Saccharomyces cerevisiae
                     YIR007W; ancestral locus Anc_7.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322060.1"
                     /db_xref="GeneID:40384378"
                     /translation="MLSKPSLGRKIIGRVDERDFINTIMRDPIVTKPLLVNNKGQIVE
                     RDTGRVVHLNGINFASNAKLPHTPIQKTHFNPETCGFYGEGDSVSFTNRPFSLDDAYE
                     HISRIKQCGYNTIRFVITWEAIEHEGPGIYDTDYVDYVIKLFQVIYEVGGIYVFIDPH
                     QDVWSRYSGGSGAPMWTLYAAGLEPRNFKETLAAKLHHMCPDPSKFTKMVWATNYGRL
                     ASQVMFTLFYSGKIFAPKAMLNGKNIQDFLQDNFIEAFGYLMDRLKDRIPHIFDSCLL
                     GVETMNEPNSGFFGFSDLNHCSESQKLKLDEFPTPIQAMRLGMGFPESVDTYSLTIFG
                     PLKNGSKWIDPKGIRAWVTKEDNRDNVYGFKRSPYWELGKCIFGQHGVWDIHTGELIK
                     PDYFKVHPETGEYLDEDKFINGPILTCWGKFRKRMRQVDENMFLILQPPVLQIPPRIE
                     NDLRYVDNKTMIALHYYDGMSLMFQKWNRIMNVDTLGIIRGRYINPIFGLNLGESNIR
                     KSIRKQLKEMENESKNNAGYGIPVIFTETGMPFNMEEKRAYKSGCYDSQEAATDAILS
                     GLESERLHFTFWCYNPENCHKWGDYWNLEDFSIYSNNENDKKVFIRGNSYKEWLDKNA
                     GKSIGEYTPQTGSSADSDDATSIQASTASDDSNTTKLLLRESTKQYNGSGAQEPLELN
                     LFDGIRALNSIVRPVVMATNGTVTVCEYNYLTKDFHLEVSSVVPKCDVYPDIITLPRC
                     HYNNNNYSLNVSDGSVQVKGNHLLQWIEWDHSGVSSGNVTLDISINKEIPRNMRGSDA
                     LCGNLKELACGYV"
     gene            <1111511..>1113259
                     /locus_tag="C5L36_0C05150"
                     /db_xref="GeneID:40384379"
     mRNA            <1111511..>1113259
                     /locus_tag="C5L36_0C05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466201.1"
                     /db_xref="GeneID:40384379"
     CDS             1111511..1113259
                     /locus_tag="C5L36_0C05150"
                     /inference="similar to AA sequence:RefSeq:NP_012640.4"
                     /note="PKUD0C05150; similar to Saccharomyces cerevisiae
                     YJR106W (ECM27); ancestral locus Anc_7.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322061.1"
                     /db_xref="GeneID:40384379"
                     /translation="MSGNAPLLTCEQVGLLPSTEQCAFVHQQCSNHPGLVNSFTLYYC
                     IGTSETARHWVGIPILVLLLLALFGSIGLVTGNCLVPNLNAITVHLRIPENISGLTLL
                     AFANGSPDIISTYTSFKTGNVMLAFGEIIGAAYFINTVVIGSIFLIKPFDIVPHSTDG
                     QIDLPEHRLSVYNARGTYLRDVSFFIVAVLILIYCVQDGMLTRTEMMALISIYLGYVT
                     IIVTWQWYFKKEMDRIRIDHRARSMYNENVLVPPRIDEHIEIEDTFNYNPQIIRNLEF
                     ETILSGLTAHRKYGIYVDNSGVPYTDNDNLANEDININSNEVDLIEPPRKSLVHSVLD
                     IMMLPFVKLFRHSIPILTSSDYEGEYKPALTKLMELLTSLVISPIIVTQTFFPQVSLL
                     WKVLMIILAISGEYFAYHNLIKSSNPSAVVKCMISLLGVFASVSWVSIIASEIISILT
                     LISSLTFIKPSTLGITIFALGNSVGDLISCIVITKMGYPLMALAACIGGPLLNILMGL
                     GISGLFSVDDKIEISTSVSIKMCLMGLLFNLSVVLMVIVPLGGWRCDRYIGAGMIFVW
                     FVGVAVSVVVDTFFSP"
     gene            <1113475..>1116045
                     /locus_tag="C5L36_0C05160"
                     /db_xref="GeneID:40384380"
     mRNA            <1113475..>1116045
                     /locus_tag="C5L36_0C05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466202.1"
                     /db_xref="GeneID:40384380"
     CDS             1113475..1116045
                     /locus_tag="C5L36_0C05160"
                     /inference="similar to AA sequence:RefSeq:NP_011352.1"
                     /note="PKUD0C05160; similar to Saccharomyces cerevisiae
                     YGL163C (RAD54); ancestral locus Anc_8.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322062.1"
                     /db_xref="GeneID:40384380"
                     /translation="MGKVDFKNYKAKPKEPVYVSTALGTGAGLNPTLKRRRIQTEPSV
                     LLKPFKPPISRPSTRDISSSSTLNGRAVRKARLRGPKSYAEGTLPGDSKDSDTLYLDE
                     NSYGQYTQKRKNALHPRLVLGDSDKNMNTLVKKFVVPLKDKPEEWQARPRAPPPLGNR
                     KKIYFPPRALHDPLGELAIVLYDPTVDVIPELKEEEEKAMAEEKAKRETSKQASPVPE
                     LSQRPSRFKLYNKKSLNELLGISSNEEDLKTKFPNVPVVIDPKLAKILRPHQREGVKF
                     LYRCCAGLVDARGHGCIMADEMGLGKTLQCITLMWTLLKQGPRGKRTIEKCIVVCPSS
                     LVKNWANEIDKWLGKGVLNSLAIDGKSQKGLGIGDAVENWALATGKGIVSPVLIISYE
                     TLRRNIDRLQNCEVGLVLADEGHRLKNGDSLTFNSLNSINCLRRVILSGTPIQNDLSE
                     YFSLLNFANPGLLGNKAEFRKNYELDILRSRDSEATEKEKQKGDTKLKELKELVQKFI
                     IRRTNDILSKYLPVKYEYVIFCGLSDLQKQLYHHFITSPDIKKLLKGLHSQPLKAIGL
                     LKKLCNHPNLLTLPEDIEGSEDLIPDDYRDDRNNTGRNREIQTWHSGKFLMLERFLFK
                     INKETDDKIVVISNYTQTLDLVEKLCRQHRFGSLRLDGTMNINKRQKLVDRFNNPDGK
                     EFVFLLSSKAGGCGINLIGANRLVLMDPDWNPASDQQALARVWRDGQKKNCFIYRLIS
                     TGTIEEKIFQRQSAKMQLSSCVVDSADDVERLFSTDNLKQLFQFNTKTICETHDTFKC
                     KRCDADGRQRIKPTTMLYGDATTWNHINHGNLDQNEDFLIQNESQYNTVDFAFQYISH
                     "
     gene            complement(<1116111..>1116890)
                     /locus_tag="C5L36_0C05170"
                     /db_xref="GeneID:40384381"
     mRNA            complement(<1116111..>1116890)
                     /locus_tag="C5L36_0C05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466203.1"
                     /db_xref="GeneID:40384381"
     CDS             complement(1116111..1116890)
                     /locus_tag="C5L36_0C05170"
                     /inference="similar to AA sequence:RefSeq:NP_015323.1"
                     /note="PKUD0C05170; similar to Saccharomyces cerevisiae
                     YPL002C (SNF8); ancestral locus Anc_8.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322063.1"
                     /db_xref="GeneID:40384381"
                     /translation="MITRLPSFFLLPVDVRVMSQERGISSLHNEVVDQKYKHLGTALS
                     NEQKEQLLTQLQVFQTALISFQEEHSSEIINDEQIRTTFQEICSAFGIPPLVVASTLE
                     GQEAEIERNNQLCLKMIELCTETRPINGGIITVDDLVELINEDSWVNKDLHMKFTSKD
                     VLEACSHLKIMGGELQLIQIGKRNYIKSIPQELDVDQSTIIDTANILGYVSISILRDN
                     FGWKSSRCRSTIDEMISYGILWVDKEPGHETKYWAASWINV"
     gene            <1117053..>1118480
                     /locus_tag="C5L36_0C05180"
                     /db_xref="GeneID:40384382"
     mRNA            <1117053..>1118480
                     /locus_tag="C5L36_0C05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466204.1"
                     /db_xref="GeneID:40384382"
     CDS             1117053..1118480
                     /locus_tag="C5L36_0C05180"
                     /inference="similar to AA sequence:RefSeq:NP_010938.1"
                     /note="PKUD0C05180; similar to Saccharomyces cerevisiae
                     YER021W (RPN3); ancestral locus Anc_7.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322064.1"
                     /db_xref="GeneID:40384382"
                     /translation="MTTESEIAPNEHQLFKQLVGFLELIKESSVKFDPRYILRVFREL
                     TAIRRQISADDLVRLVHQFYPAIHPNVENLIEALTPFRISLTENTGDEMEIDNDQTSD
                     SHEVLPEIDVFVHLLVQIFLHDKGETKALYNFNKHVINVLKTYNYRTLDYIQAKVWYY
                     IFRASELANDLVNIRVELMNAFRTATLRHDTETRASVITLLLRDYILSNDINQAYNLV
                     EKTEFPDEASNPVVARYYYYLARIHTIQLDYSSALECVTTAIRKCPQTKNASGFLQSA
                     TKLQIIIQLLTGEIPELSSFENPQLVKSLKAYSEVTKAVRLGDLTIFSDALETFGEQL
                     KKDKNYNLVLRLRQNVIKTGIRIISLTYKRISLKDICIKLHLDSELTAEYVVAKAIKD
                     GVVEAMIDHTKGYMESLEVSDVYSSVAPQEEFDRRIKFCMQLHNDSVKAMRYPMNKER
                     RDVDADIQAREREQELLQFLQEEDF"
     gene            <1118698..>1119534
                     /locus_tag="C5L36_0C05190"
                     /db_xref="GeneID:40384383"
     mRNA            <1118698..>1119534
                     /locus_tag="C5L36_0C05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466205.1"
                     /db_xref="GeneID:40384383"
     CDS             1118698..1119534
                     /locus_tag="C5L36_0C05190"
                     /inference="similar to AA sequence:RefSeq:NP_015193.1"
                     /note="PKUD0C05190; similar to Saccharomyces cerevisiae
                     YPL132W (COX11); ancestral locus Anc_8.641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322065.1"
                     /db_xref="GeneID:40384383"
                     /translation="MLRRIFRTSIQAPLRDVGLIPELAHHRRYVHASCIAKYEVPGGG
                     SSEHQVSPRANRKELPKMSLAEFQALRDKYHGEKKRYERQTTIYYSLSMMMIFLALSY
                     ASVPLYRAICQRTGWGGTPITDKSRFTRDKLTPVATERRLRVSFTAETSGALPWKFVP
                     QQREVYVVPGETALAFYKAKNISDKDITGMATYSVTPDHVAPYFNKIQCFCFEEQRLA
                     KGEEVDMPLFFFIDPEFSRDPAMRNIEDVVLHYTFFKAKHDEQHDQLFSEAAKRNENQ
                     TK"
     gene            complement(<1119686..>1120783)
                     /locus_tag="C5L36_0C05200"
                     /db_xref="GeneID:40384384"
     mRNA            complement(<1119686..>1120783)
                     /locus_tag="C5L36_0C05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466206.1"
                     /db_xref="GeneID:40384384"
     CDS             complement(1119686..1120783)
                     /locus_tag="C5L36_0C05200"
                     /inference="similar to AA sequence:RefSeq:NP_010035.1"
                     /note="PKUD0C05200; similar to Saccharomyces cerevisiae
                     YDL246C (SOR2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322066.1"
                     /db_xref="GeneID:40384384"
                     /translation="MTIDSTLDLNNLKEDNPSVVLEKIGEIRFEERPVPEIPEPNYVK
                     IAITHTGLCGSDVHYYEHGSCGSFKVESPMVLGHESAGIIVQVGDSVTRLKPGDRVAC
                     EPGVPSRLSKEYKAGNYNLCPHMAFAATPPYDGTLCRYYVLPEDFVVKLPDHVSLEEG
                     ALVEPLSVGVHANRLIDVKFGDSMVVFGAGPVGLLAAGVAKAFGCDKVLIVDIVNEKL
                     DFAVQHKLATHCFNSKGKTFEDLLACIKDIWDEDELPTCGIDATGNQYCINMCIRSLA
                     KKGRFVQVGMGGDTLDKFPIAAVLEKELTVKGSFRYSVDDYKYSVQLLKDGKINVRPL
                     ITHRFKFEQAVEAYEFSKQGKSIKIMIEGPP"
     gene            complement(<1121244..>1122152)
                     /locus_tag="C5L36_0C05210"
                     /db_xref="GeneID:40384385"
     mRNA            complement(<1121244..>1122152)
                     /locus_tag="C5L36_0C05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466207.1"
                     /db_xref="GeneID:40384385"
     CDS             complement(1121244..1122152)
                     /locus_tag="C5L36_0C05210"
                     /inference="similar to AA sequence:RefSeq:NP_014865.1"
                     /note="PKUD0C05210; similar to Saccharomyces cerevisiae
                     YOR222W (ODC2) and YPL134C (ODC1); ancestral locus
                     Anc_8.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322067.1"
                     /db_xref="GeneID:40384385"
                     /translation="MSIDERPIPFQYQFYAGAIAGISEILTMYPLDVVKTRIQLQVGS
                     GSSGEYKGVVDCFTKIVKNEGPATLYRGISAPILMEAPKRAIKFAANDEWGKFWKNVF
                     GVEKLNQSLAILNGACAGATESFVVVPFELVKIRLQDKSKASMYSGPIDVLMKTVKNE
                     GILALYNGLEATLWRHIVWNAGYFGVIFQVRDMLPKAKDKTQKTINDLVGGMIGGIVG
                     TALNIPFDVVKSRIQSATIVEGQVRKYNWTWPSLGIVLREEGVSALYKGFLPKVLRLG
                     PGGGILLVVFTNCMDFFRGQYYGDKK"
     gene            <1123259..>1123795
                     /locus_tag="C5L36_0C05220"
                     /db_xref="GeneID:40384386"
     mRNA            <1123259..>1123795
                     /locus_tag="C5L36_0C05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466208.1"
                     /db_xref="GeneID:40384386"
     CDS             1123259..1123795
                     /locus_tag="C5L36_0C05220"
                     /inference="similar to AA sequence:RefSeq:NP_014869.3"
                     /note="PKUD0C05220; similar to Saccharomyces cerevisiae
                     YOR226C (ISU2) and YPL135W (ISU1); ancestral locus
                     Anc_8.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322068.1"
                     /db_xref="GeneID:40384386"
                     /translation="MFTRSSLLRQPFKNTLRAAARLQQSRYYHPRVIDHYQNPRNVGT
                     MDKSMENVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSFATEL
                     VKGMTLEEAEGIKNTTIAKELSLPPVKLHCSMLAEDAIKSAIKDYRTKRNKVTLGPEA
                     TAGEAQATAPSPASSGAA"
     gene            complement(<1124154..>1125935)
                     /locus_tag="C5L36_0C05230"
                     /db_xref="GeneID:40384387"
     mRNA            complement(<1124154..>1125935)
                     /locus_tag="C5L36_0C05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466209.1"
                     /db_xref="GeneID:40384387"
     CDS             complement(1124154..1125935)
                     /locus_tag="C5L36_0C05230"
                     /inference="similar to AA sequence:RefSeq:NP_011710.3"
                     /note="PKUD0C05230; similar to Saccharomyces cerevisiae
                     YGR194C (XKS1); ancestral locus Anc_5.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322069.1"
                     /db_xref="GeneID:40384387"
                     /translation="MSLALGFDLSTQQLKIVSCYQDLSLHSKYSIDFDEFKDIYGIHK
                     GVLSNRDTGEVVTPVKLFVHALQTLLDRMHNDGFPFDCVTSISGSCQQHGTIFCTRQF
                     DTLLSNLNPASDTWHSDLSNAFSYENASNWQDRSTGEELAVFEKALGSAEKLCKITGS
                     KAHFRFSGPQMRRRAKEGGVHWEETAHISLISNFLDSILSGKVRGVEIGEACGTNLFD
                     IEQNDWNDELLSLILMKNSNVDGVPLGEQQEASLKARQLLKTLVEPDDYSTIAPYLAK
                     RYGFKRDCKVWPITGDNLATIMSLPLKHDDLLVSMGTSTTVLLLTKNYLPSVNYHLFK
                     HPVVRDIYMGMLCYSNGALAREEIRDEINDKYKTVKWDKFNEILDTRKSPDREVGIYF
                     PLGEIIPNVKPCKRIFKYSAAKGLVEVDREVELDDQVKLIIESQALSNRLRVAPLLTD
                     VETVKEKSVTRDIESARKIVGDSVTIDHVAYTFADIIKRPNSVYYAGGSSQNASILKI
                     YNDILGPKHGGYKVEVGDACALGGCFRAIYGYNDSISFQDWLESKFDFHRHTSPIERD
                     ETHAISTWASYLDKVAILTLAEQQLDC"
     gene            complement(<1126110..>1126394)
                     /locus_tag="C5L36_0C05240"
                     /db_xref="GeneID:40384388"
     mRNA            complement(<1126110..>1126394)
                     /locus_tag="C5L36_0C05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466210.1"
                     /db_xref="GeneID:40384388"
     CDS             complement(1126110..1126394)
                     /locus_tag="C5L36_0C05240"
                     /inference="similar to AA sequence:RefSeq:NP_012544.1"
                     /note="PKUD0C05240; similar to Saccharomyces cerevisiae
                     YJR010C-A (SPC1); ancestral locus Anc_5.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322070.1"
                     /db_xref="GeneID:40384388"
                     /translation="MDFIVTSIQEKLEFPIDLHGQRIAERALWAILSLGGIVALLFAY
                     LLTNLSLTVYVFPLFVSLAGLVTVPSFAKYNEHPLTFLKRPPPKKIDIEL"
     gene            <1127002..>1129107
                     /locus_tag="C5L36_0C05250"
                     /db_xref="GeneID:40384389"
     mRNA            <1127002..>1129107
                     /locus_tag="C5L36_0C05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466211.1"
                     /db_xref="GeneID:40384389"
     CDS             1127002..1129107
                     /locus_tag="C5L36_0C05250"
                     /inference="similar to AA sequence:RefSeq:NP_011310.1"
                     /note="PKUD0C05250; similar to Saccharomyces cerevisiae
                     YGL205W (POX1); ancestral locus Anc_3.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322071.1"
                     /db_xref="GeneID:40384389"
                     /translation="MKQTILPQERAPDASHLIWSERMACTFSLNKMHAFLEGSFGDAI
                     HTLRLMQQIERDPILQVKSNYYEMSREEHRKITAEKIARLAQFMEEDSPNFQVFQDRL
                     NLIAMIDPQLGTRVGVHLGLFLSAIRGNGTQEQFDYWAFQRGAILMKDVYGCFSMTEI
                     AHGSNVAELETLAEYDIEKKVFRITTPHIGATKWWIGGAAHSATHTVVFARLIVKKRD
                     YGVKTFVVPLRDVNHNLYPGVSIGDIGEKMGRDGIDNGWIQFSNVKIPREYMLCKFCK
                     VDEDGNVEEPPLEQLAYGALLGGRVTMVTDSFRTGERFITIALRYSVGRRQFTVKGKS
                     FENQLINYPLHQRRLLPYLAWVYGMSVASYQIQRDHKAVLNGLEEGVRSGDIKVITNA
                     IEQLKGLFADSASLKSTCTWLTADLIDEARQSCGGHGYSAYSGFGKGYADHVVQCTWE
                     GDNNILAQNSGRITIQKVLQMLKNGKVGGTNYQFLYDAKREGAILERLEDYKDLKKLN
                     LAIKSIILRISLNAIDKLNSNGKNWDLIANDKLSLSKLYAAEYILDKWISRIDEVEDE
                     NVAQQLKNLAVLFAISNIDKFGLEFLKFKVVLDHDILEKAQTEFLQIVRKDVIPLTDS
                     FKLSDFFINSVLGGYNGDIYNEYLETVKSMDPYNNGKPPYATEFLAMLNRGGVEEREK
                     FQKSPEVLAKLCGSNDDDD"
     gene            <1129968..>1130936
                     /locus_tag="C5L36_0C05260"
                     /db_xref="GeneID:40384390"
     mRNA            <1129968..>1130936
                     /locus_tag="C5L36_0C05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466212.1"
                     /db_xref="GeneID:40384390"
     CDS             1129968..1130936
                     /locus_tag="C5L36_0C05260"
                     /note="PKUD0C05260; Pfam Domains: PIR(7.9e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322072.1"
                     /db_xref="GeneID:40384390"
                     /translation="MRSTTLSVATLALVAQSLAAYVPSEPWSTLTPSATFSGKHTTDY
                     TKTFAISIDPIATPSSTASSSASTANSKAKRDVVTQIGDGQIQATTATPKTEAPVITQ
                     IGDGQIQATTATPKTEAPVITQIGDGQIQATTATPKTEAPVITQIGDGQIQATTATPK
                     TKAPVVTQIGDGQIQATTSASATVATQIGDGQIQATTTNGKKDSKPAETSPATPSGDY
                     QGFPESCKNPDALSMVLNKGILTDSKGRIGSIVANQQFQFDGPPPQAGAIYAAGWSVT
                     ADGNLAIGEKDIFYQCLSGNFYNLYDEHIGSQCEEVYLKVVDLVDC"
     gene            <1131716..>1132720
                     /locus_tag="C5L36_0C05270"
                     /db_xref="GeneID:40384391"
     mRNA            <1131716..>1132720
                     /locus_tag="C5L36_0C05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466213.1"
                     /db_xref="GeneID:40384391"
     CDS             1131716..1132720
                     /locus_tag="C5L36_0C05270"
                     /inference="similar to AA sequence:RefSeq:NP_011681.1"
                     /note="PKUD0C05270; similar to Saccharomyces cerevisiae
                     YGR165W (MRPS35); ancestral locus Anc_5.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322073.1"
                     /db_xref="GeneID:40384391"
                     /translation="MLSRTLTESSTSTVKSAGFQVSQVRYRRTLAYPFYSKAGNIPPA
                     RKGRKQTVFKRLMDQFLGPKNYKGEYYLNKYAYPKNNHTPNYIDPRSERGNALLEPLS
                     EFDTVDETENDSSKRRNNNAFRPFPLNSKLSTNFQVDNETKIQIVNDILLNKMPSQQV
                     AIKYGLKIQRIEAILKLREIEEKWEQEDKINGDLKRMSQAMYKMFPIFNPRNNAENLT
                     EIPIPKETLQSRFLTIAESEPFGPVDAAKEFNLEPAAVTLEKLSEGGEHSLHHEATQT
                     KNDGSFIAPMHEGDKYAFKFTPVKVGKVGYRYGKVNRDNRKDRKVAYDAAGNKYYPLE
                     "
     gene            <1133366..>1137025
                     /locus_tag="C5L36_0C05280"
                     /db_xref="GeneID:40384392"
     mRNA            <1133366..>1137025
                     /locus_tag="C5L36_0C05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466214.1"
                     /db_xref="GeneID:40384392"
     CDS             1133366..1137025
                     /locus_tag="C5L36_0C05280"
                     /note="PKUD0C05280; Pfam Domains:
                     Pkinase(3.2e-67)|Pkinase_Tyr(2.6e-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322074.1"
                     /db_xref="GeneID:40384392"
                     /translation="MMENNIKMTGLPIDTNPHIKIDEGAERDSQMQNPISLVQLNHGS
                     PATTETTNIQATPSHHNRTSSFSGSEHEYKYTTASPRRTSASSTISVLKSKDSASDQT
                     FSCYDHPKPTIGKSSPASRSHSHTKLSELAHKVSDFLFSTRRSIDLHTTNSSFSNDPK
                     NLNNLSDSSTASPIASRENSHVSLTSLARTGGRQLKTKRRSFLMRPTLSPSRTSDTKD
                     PLGNYILDPPSSNPLSPISNASLGLPSSKNSACHFACSENEEISRRNSHVKETHYVHV
                     EYDPITRKRVLNTYEILKDLGAGQHGKVKLAKDIATGKLVAIKIVDRTGKPALMLSRL
                     SRGTSQTQEDKIRREIAIMKKCDHPHVVKLIEVLDAEKSRKIYMVLEYLEKGEVKWQR
                     TAEEVFQIVQETSKPQKHITLKECIPEPLLTLDETKKIFIDVLSGLEYLHHQGIIHRD
                     IKPSNLLVSKDNEVKISDFGVSFASNLDRTKQDDLELAKTAGTPAFLAPELCSSEDRR
                     SKVTYKIDIWALGVTLFCLLFGDLPFYAESEYQLFKKINKEEPRFPDMACWHVASQLP
                     TCDFNIVKDLLMKLLDKNPDTRIEIENIKSHPFVRQYWKEKKTCNEYAGWRKDMKIDV
                     SNEEVDDAIVGLGNRIKKRISEAFRRRKTNEHKDSNASDAETSKSPSKETLGGLRSYA
                     LAELKDDCSYILSEETPRSSSQVSLSLLNENLSSRPTTLISIENVSGYSSTNMGSASS
                     MEENKNLNDIAEEAEKHDSREINRSELQEHTKHERFATTANLSSFEMQNSSTLGCSNK
                     TVNGDNFEDGEYDYRKELTDGGNPESVNLTVNPSFASLDSFYDDSYAKFLSPGSGGSI
                     VQPSRGSGNRIPVRIHSNSNRGSPNLQPSNGSYEGALTFDALGLNRKDSSSPTNFQYI
                     HNPNVSSLNSLRGKSLKVITPPNQPSSNSITRSPAMMRNQLKAAYANPMISNQNCRVS
                     NGSGDHTKSSKEKSTRPSAFVDSDSDSDSGSDSPIQFNKKSDSTFSFTQRRVNITNDA
                     IKNNAPVSRRAIFTNSDDETDADNDDLEDDSTVDFFAKRSIKPGPESRSMNASPSAVA
                     PSAIYKAPANSNVQLHTPPLLAKSSIYGTKLNLLYHNDDSDESEETDLSGDELILSFG
                     KPKNNTKIDSRNVAMDRSFSSTADVVDVPESIIKKSMNVNQLSQSNVVVNSHGGIVDE
                     VVDLSIDDDNYLGNR"
     gene            complement(<1137158..>1140109)
                     /locus_tag="C5L36_0C05290"
                     /db_xref="GeneID:40384393"
     mRNA            complement(<1137158..>1140109)
                     /locus_tag="C5L36_0C05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466215.1"
                     /db_xref="GeneID:40384393"
     CDS             complement(1137158..1140109)
                     /locus_tag="C5L36_0C05290"
                     /note="PKUD0C05290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322075.1"
                     /db_xref="GeneID:40384393"
                     /translation="MYNRLFLYNFGTTTRNMDDITKEARGKEIRRLSLPFNGDHAFYI
                     PNRRHTLVPVRSILKQKLGENNTISLSSDVYLKEKRRVSFAPEVTLHKIDYRKCDENS
                     SSKRKSSNQASGNEKLSTSQYIGKIYDAPNQHEAPNNLETAHENIEPNLTSTQNDFII
                     DEDTQTMEMSIELTQQILKQQELVKEQHNVQTQDSGNNITIENFRDLFNEVEDNDQSE
                     MEFTETAQTKDLQDDGPRIDNKRFSQNDLPEEMSMELTQPIKELPSDRSGAFSGSTTA
                     IVKQLDSEPEFRREDKVDFHPTKRDLGSLMGHSPSTSESVPTQALQEKTEEFTEMEFT
                     EPIHSDKLQLEPNTHVNEKNDDNQEMEFTQPVDRDTFFLQKESEQQSSSEDKLTTVEE
                     VSEPSTSASTDNFSRVEVENKENMINISSDSSGKMKLQQDIRAIGNGQTEESIVTQLE
                     PQIFHDDSANSSTNDVPDSSELETSLIGTEIVPLAEITGDSTENGAYDSDNSFTDDNH
                     LNVSLDVFLNDVGIQFFDHIGPSESEIQNTLSLLSEIDPTHNPRSPSVADSTSSLSTP
                     SSINTKRTNIIDYIDACSNIPYYHYLVHLVNQYRSSIQSISTMVNTFSNDFLESNPTA
                     IREYYQQAEEVKNDLCTNYQAIAIFTRKQSKCQNLRFVTSLLNQLSISYERSNEQLES
                     DLGVAIDWRKNVLIERQKMIEQKVLLDQIIQKINSLKSNLSISNMNKIKDARKQLVEI
                     EQQHDSTKEKNQKYTSIVEDKEKLIIEKQNIRDQLKLEVAELKEEIYRKQIPSLGDLK
                     KKKRKLESLESSKKVKILGADPIVLLISDVLQVKFIPIASNYKVSVFVYKAERFFPFS
                     SLVDRFINSHEQNIEYMETASFIRTIRRKWISFINLWKEITTIYYLHSGKLDEDKFVF
                     HVSLYVDEFEDCLEFALEGRLDDLLDPETDIKVKLTVQSTTETNYDSHMLLDMFKSSF
                     KNNNVVNRFVS"
     gene            complement(<1140528..>1143722)
                     /locus_tag="C5L36_0C05300"
                     /db_xref="GeneID:40384394"
     mRNA            complement(<1140528..>1143722)
                     /locus_tag="C5L36_0C05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466216.1"
                     /db_xref="GeneID:40384394"
     CDS             complement(1140528..1143722)
                     /locus_tag="C5L36_0C05300"
                     /note="PKUD0C05300; Pfam Domains: Nucleoporin2(1.1e-55)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322076.1"
                     /db_xref="GeneID:40384394"
                     /translation="MFGRPSSGTSGFGGFGAANNTSFGANNSPFGGGGTVGANNTGAN
                     QAGNSIFGANNNTNTGGGLFGGNTANNTSGNNSGGFGFGATSNNTGGGLFGSAQNSTS
                     SPFGASSTPSPFGANNNAGTSTAGGLFGSSNNAANPGMGGFGAPANSTFGSGFNSMSG
                     NQNKGTAAVPFKPFMERDPTLGTSYYQSITAMPEYKNYSFEELRVQDYLEGRRFGSGN
                     AGAAGAAGPSGFGTANASSTGFGGFGSNTSGGGLFGAKPTGTTTGGGLFGSNNNSNNT
                     AGGFGTSFGNTSTAGGFGNNNASGGGLFGGNNNNSGGLFGSNNNNSNVGGFGSTNTNA
                     GGGLFGGSNTSSPFAANNTAGGFGNNNASGGNMFGNNTNTGSGLFGGNNNNASSGGGL
                     FGSNTNNNSGGGLFGNNNTASTGFGAQPAGSTGFGFGNNSNNTGTTGGGLFGNKPAGA
                     TGGGLFGNNNAGNTGNTGGGLFGAKPAGTTTGGGLFGNNNTASTGFGAKPAGSTGFGF
                     GNNSNNTGTTGGGLFGNKPAGATGGGLFGNNNAGNTGGGLFGAKPAGTTTGGGLFGNN
                     NAASTGFGAKPANGGGLFGSGTTPSSTTSGGGLFGNSGNNAGATSGGLFGNKPAGTTG
                     GGLFGNNNTSTTGGSLFGAKPGGATGGLFGNNGTTGGTSGGLFGNNNNNTLGGSSTGG
                     LFGGQQQPQQQLQQQQIIAQSNQNPYGSGALFNNLNNVLVNPVVPVPEKPIATPIKDV
                     EKKKVSLVAAYRLSPKPLFSTSESIIGKPKGAIGVSNVSDSAVEQVIKDSAELKAISN
                     AETDKLILSNPLFSRSKKLTKLLIQKNQESNLLSEGPNDKSQNISLKADLPSQVSSDT
                     FLTAKKDEIEKPEKTSKIDSIKPLTTPPPAAEDEKKSGFINNMGEKKNVDNEIDIKET
                     TRKETPFLPDGYFTIPSFKELSSYEPEKLISVKNFTVGKNGIGQVEFVYPVDLTTIPL
                     SSIGDLIVFEKKQCVVYPDVSTKPKVGEGFNVPAIISLEGCYPSTKDRKGIITDPKHP
                     AVVRHINKLKSVPNTQYLGYEANTGTWKFKVEHF"
     gene            complement(<1144074..>1145267)
                     /locus_tag="C5L36_0C05310"
                     /db_xref="GeneID:40384395"
     mRNA            complement(<1144074..>1145267)
                     /locus_tag="C5L36_0C05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466217.1"
                     /db_xref="GeneID:40384395"
     CDS             complement(1144074..1145267)
                     /locus_tag="C5L36_0C05310"
                     /note="PKUD0C05310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322077.1"
                     /db_xref="GeneID:40384395"
                     /translation="MSLIANSISGNVVGPSPTLVSVMPYQTNLVPFEDKRGSGGHGGS
                     GGHVGSGSHGGSGGSGSGSGGKGGSGGSGSGSGEKGGSGGSGSGSGGKGGSGGSGSGS
                     GEKGGSGSGSGEKGGSGGSGSGSGEKGGSGGSGSGSGEKGGSGGSGSGSGEKGGSGGS
                     GSGSGEKGGSGSGSGEKGGSNNNNNNNNNNHNDPPPPYEAGNNGSPPPYNAFAGNGHA
                     GRYIYNGHNYQYGYPVRYSGNRYYPQGLIYPVMYGGAAGALLNGHVYHTYTSDSTLIY
                     SEVPTVCGTSVSASNQVSASNQVPASNQVSASNQVSQPLSTCIPGGSMTILQNELITI
                     DSQKIKGASYETLSPTGSSNTNVASSSTSVSTISTSSNTHNGSPTLTSSSLLCFLLVL
                     FTILS"
     gene            <1146063..>1147178
                     /locus_tag="C5L36_0C05320"
                     /db_xref="GeneID:40384396"
     mRNA            <1146063..>1147178
                     /locus_tag="C5L36_0C05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466218.1"
                     /db_xref="GeneID:40384396"
     CDS             1146063..1147178
                     /locus_tag="C5L36_0C05320"
                     /inference="similar to AA sequence:RefSeq:NP_012809.1"
                     /note="PKUD0C05320; similar to Saccharomyces cerevisiae
                     YKL113C (RAD27); ancestral locus Anc_2.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322078.1"
                     /db_xref="GeneID:40384396"
                     /translation="MGIKGLNALVKEHAPHAISSCEMKGLFGRKIAIDASMCLYQFLI
                     AVRQQDGNMLTNESGETTSHLMGFFYRTIRMVSNGIKPCYVFDGKPPVLKGGELEKRL
                     KRREDAEKKAEEMKETGTVEELQKFERRTVRVTRQQNEEAKKLLKLMGIPYVEAPCEA
                     EAQCAELSKSGKVYGAASEDMDTLCYSPGHFLRNVTAAESRKLKIEEFDIEKVLEGFQ
                     MDINTFVDLCILLGCDYCETIRGIGPVTALKLIKEHGSIENIIKAIEGNEKSKYKIPE
                     NWPFNEARQLFLNPEVTPSGDVELKWVEPDIEGLIEYMVKENGFSEQRIREGATKLSK
                     ALKGGTQGRLDGFFKVTSTKRVAKEEVKKTTTKRKKK"
     gene            complement(<1147379..>1148512)
                     /locus_tag="C5L36_0C05330"
                     /db_xref="GeneID:40384397"
     mRNA            complement(<1147379..>1148512)
                     /locus_tag="C5L36_0C05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466219.1"
                     /db_xref="GeneID:40384397"
     CDS             complement(1147379..1148512)
                     /locus_tag="C5L36_0C05330"
                     /inference="similar to AA sequence:RefSeq:NP_010169.1"
                     /note="PKUD0C05330; similar to Saccharomyces cerevisiae
                     YDL114W; ancestral locus Anc_2.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322079.1"
                     /db_xref="GeneID:40384397"
                     /translation="MTKRGKRLGSLHNGNTITVLFVLNNRYTAFPGNPMTGPLTWCVY
                     RTNWLLLETSRVFVGMLFDPCRDIVLVTGGSSGLGKELASAFRQKGATVVVFDINLPG
                     KDNQNYVEGVHYYYCDVSNPDMVKERGNEVRMEVGQVTVLINNAGITTGNTLLNLSFD
                     EIETTLAVNLLSSFYTIKTFLPGMLDKRRGYIVTIASTLGYMSPARLSVYGASKSGLI
                     TLHESLNYELGPPTFNTCGVKTLLVCPGQLKTYLFGGVRTPSTLFAPELDPRYVANHV
                     IRAVSYGCRGEVKLPFYGNVLPIFRSIPWPAVAILRYISGINNTMKKFVQKARETTNM
                     STSFMAEKASMFSRMFPFSGATQESMSETPQPLGGRDHQLKTS"
     gene            <1148673..>1149842
                     /locus_tag="C5L36_0C05340"
                     /db_xref="GeneID:40384398"
     mRNA            <1148673..>1149842
                     /locus_tag="C5L36_0C05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466220.1"
                     /db_xref="GeneID:40384398"
     CDS             1148673..1149842
                     /locus_tag="C5L36_0C05340"
                     /inference="similar to AA sequence:RefSeq:NP_010168.4"
                     /note="PKUD0C05340; similar to Saccharomyces cerevisiae
                     YDL115C (IWR1); ancestral locus Anc_2.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322080.1"
                     /db_xref="GeneID:40384398"
                     /translation="MPPANMPPQVLRVKRKRTDDPLQALVMETQRRSIKRPRYVFKLQ
                     RTEENDIKDDTTILTASNGLESSKPVFKIPKAPTKGVDSNSLKNPFIDGSAKPKGDTS
                     PEEANPELSPQLLDMLNDYLKEHDETAVKSDVRLPKRRQSSIIREMESKNGGRPVFDK
                     EEVYNNSNSNAISDVLHEGDETEDSEYVYDVYYRDKAVSDQWDQERIGYIRYDDEAFD
                     VLDDDGDDDMMQTDDEDSNDENFYRNDYPEDEDLDFDDKTESELESMGLEEPSDDQDD
                     EFDILNNRRRFSKLDFMRSEGLKSMSEDEYERLAAEIDEKPSLWGRSPDGLDTTDSYM
                     DDEPGNRGAGDSGEEDDDTQDFPRNEFFKSDRDDPIAVHRDKIFGKLQHMIERQS"
     gene            <1150212..>1151867
                     /locus_tag="C5L36_0C05350"
                     /db_xref="GeneID:40384399"
     mRNA            <1150212..>1151867
                     /locus_tag="C5L36_0C05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466221.1"
                     /db_xref="GeneID:40384399"
     CDS             1150212..1151867
                     /locus_tag="C5L36_0C05350"
                     /note="PKUD0C05350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322081.1"
                     /db_xref="GeneID:40384399"
                     /translation="MSLRGVGKALYRTPYQMFGQKSSDDVIFRQWEHDTKTAIAGLEY
                     LKTENIKWKKFWEKTVTKFLLIIEVFRDLHCQLEDAQKDTKKKMGIASKPKVSDKNEQ
                     FASTTLHELEEAAKLAKLIYERVADMSLEASASFVSKCDDMIKVLKNVEKLMVKRDHK
                     KVDYDISHKKLEASLKHTDSEKGKIKVETNQKKLTDIEIIFKDLNYKVKLIVPQVLSN
                     LSEFLSKLTLKLYFANTDILGFIQRNIEKFNRIHGIVNQSSLLTYEEIVNDFNILHFQ
                     AQSKLQELELLKDFSSLREKNFSTKTVEHVNSAAGTVIDSTVNFTSTVYTKATKPSQN
                     LNVSTKSFKIDNPVKTYSKNGMFESALDPIEFIQQTELENGLHDIDLGSIQMNSPSDF
                     ANEDSSVASNDNGIVSPNSSLSDSNNWMKPLKNSTLNVNKVRPNTEVQSPISPVSDVH
                     SDLASSKSNKTTLNTSLEYGHIANSRVASVHIDEKTKTYKYANVTIDNIAKQIYLAIS
                     TPEIDDVPLTTPRGQIHTPDKLIMQLVTAKSSITANAFATYSN"
     gene            complement(<1152036..>1156163)
                     /locus_tag="C5L36_0C05360"
                     /db_xref="GeneID:40384400"
     mRNA            complement(<1152036..>1156163)
                     /locus_tag="C5L36_0C05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466222.1"
                     /db_xref="GeneID:40384400"
     CDS             complement(1152036..1156163)
                     /locus_tag="C5L36_0C05360"
                     /inference="similar to AA sequence:RefSeq:NP_012233.1"
                     /note="PKUD0C05360; similar to Saccharomyces cerevisiae
                     YIL031W (ULP2); ancestral locus Anc_7.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322082.1"
                     /db_xref="GeneID:40384400"
                     /translation="MTLQTKQFKSLSRKPGQPINTLNPSTSYTTKYSKNSTTSGSSQR
                     SFMSTAARINRRFRLRSNDIEETPLQDANKSNNASSRYIEIETDLNSNRSSDSHIQIN
                     NDPNNSNSEKMEIETKHSNSYSLLDSSGEEDQSENRNNNSIGVNTKQSEQSREEQEAT
                     NDEVDKSSDGIIIRKNSDILNQTFSIDKIIFRRGDEKQVTDEGKGLQVIFLKTKISVL
                     NMTYKTKLNIPYNRIHDIKVSDNRRGINVSTLLFIIDGSISGITKIALKFKYSLSNEN
                     LKQLESFVAHTKHSRKYRARRPTQRESLVYFYTANKWKETNSEEFYKSTLGAASSTTN
                     TNQSPSVMKNDFSSLSRGERSHRTNAQVKYMNEDEEDERANEKMVEENGHVQIADYIP
                     EDEQLYFYPKLKYKFPNKKTFTISHDDFKCLYNENWINDSMLDFLLSYELHVAKETNL
                     LKRHSVELMNSFFFTSLSRPLDNPNDNNYYQNVKTWFKNNDSLFDQDFIIVPVMQDLH
                     WYVIVITNLKQLKTKHLKIQGEEISDENKEFRNKSYSNNEDDLPKPELQDQCESHLNT
                     VNGPDDNSKQKPIKSKTSICTAQICVLDSLRRNHDDAIYYLRRFIIGYANDKFGFCVD
                     MTEIGKRVCVVPQQKNFNDCGVHVLFNIHTMLQNPVLFNNKVLKRPTNRKFLAKALKE
                     NEEIFDKRERLYFRDSLRDLLFRLLKNQVEEENGDHMKVGTITVGEQRKIEMELLRDR
                     NQKALEGENSNNDNKLLHSMNTDQSATNESDDDVMIIHVEKKEPVRESEISTPSSSSK
                     EIKPSVKSKGDDIDPSPATVEIGKNKGHSTAATRKSSRLKYNRNESPNYIDYMSESSD
                     NDRYANYSGNTKLKTKKSTSKRSRKPKSYASGCGNEKSSMNMKTALDLESDDSKKVDI
                     KRDNTVRRRGRRKGSTKVHLSEPLSQDSYDGDQIGHEEPNSPIALFDTDDEKHSAPKK
                     QEPQNSNEVQKQSDTKLESLVTKSLEPGTVIKSTENLTKEFNSVSDPEKILDSSSKGV
                     ELGKKNQAKTSKSELSILGASGVEKDIDAKDQINTNEHNCKDNLNNGKVSLTKRRLRT
                     STLATDSQLGVHFNEPITITDHEKGFKDDYLSDNSSVEKNDSIDKPAKSTAYLLESSP
                     IKGDSSSPSDSDTKKCTINDEKNIECPKVGKEALHVTIFSNGSASLMPNVIRKESTVS
                     HSSLALRRRKIKQSSELIAKSDNTTNTVSRRLRSSTPEADVNGDTRMKQKDPSEMVKT
                     QINNYVYKKPRGYSRRNTRNELIITNIVSKTRKRQQPPNADDINDGKVKRLKTISFAN
                     ASVGSLDDRRDELNATDSRDDRAKGFVQPEEDSQFSLPVDEEPSPVFQSDTVYLG"
     gene            <1156602..>1157837
                     /locus_tag="C5L36_0C05370"
                     /db_xref="GeneID:40384401"
     mRNA            <1156602..>1157837
                     /locus_tag="C5L36_0C05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466223.1"
                     /db_xref="GeneID:40384401"
     CDS             1156602..1157837
                     /locus_tag="C5L36_0C05370"
                     /inference="similar to AA sequence:RefSeq:NP_012242.1"
                     /note="PKUD0C05370; similar to Saccharomyces cerevisiae
                     YIL022W (TIM44); ancestral locus Anc_7.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322083.1"
                     /db_xref="GeneID:40384401"
                     /translation="MYRHTAARTSVVVGGTLSGCRSFATNSMRLAPKSPMQVFVDTFR
                     KEWKKSTELTDQIKQLKSATDELGDSEAFKRAKEAYDAAQKGKGKLGEGVQKTAKVVG
                     DVAYKAWESPVGQAVKKTAETTANVVDAVVEPVTKTKAYKEVSEVFGEGSSSYGLYES
                     KEERAKRREKELQNKPKLVKKNEEAGNALVATDIKPTSNFKEKLKIKPESTIGKLLLI
                     LREKWEEAENPLLVLIRTIFNKIGGLFRETEAAKVVKQFKEFDPAFTSIEFQKQLREY
                     IVPEVVEAYIQGDEAVLKNWFSEAPFNIYAAKQKQLRDQGIFSDGRILDIRGVDIASY
                     KMLEPNNIPVMVIGARVQEINLFRKAKTGELVAGSDEDILMSSYAMVITRVPEEMDNP
                     ETEGWKVLEFVRGGSRAYT"
     gene            <1158086..>1158928
                     /locus_tag="C5L36_0C05380"
                     /db_xref="GeneID:40384402"
     mRNA            <1158086..>1158928
                     /locus_tag="C5L36_0C05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466224.1"
                     /db_xref="GeneID:40384402"
     CDS             1158086..1158928
                     /locus_tag="C5L36_0C05380"
                     /note="PKUD0C05380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322084.1"
                     /db_xref="GeneID:40384402"
                     /translation="MPTKYPSLAQFNAKLVFPKFPDYKIVEVSDFDSSNEESDDNEKD
                     ERNDLSSQRSQYQILPKEGVSRLDRIRGLDGTIDLGLQRSDFAKDEIPDMKTRKLISY
                     DDEGKVELKRGEPNTKVLTPSGGSVGINFEFGDRGSSWRMMKLSKLGKNPSESKIFEQ
                     YATLWDYQLACEEREELESRKIKKRSEWLYGPSQKLLASREEHVKMNMEVVKGFKSKG
                     DDRGRNTSDRVIKMKRYGDVKTSKSKKLKNELKLAHLTSLDYDDDNGFALSREQIESL
                     TTSP"
     gene            complement(<1159315..>1160634)
                     /locus_tag="C5L36_0C05390"
                     /db_xref="GeneID:40384403"
     mRNA            complement(<1159315..>1160634)
                     /locus_tag="C5L36_0C05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466225.1"
                     /db_xref="GeneID:40384403"
     CDS             complement(1159315..1160634)
                     /locus_tag="C5L36_0C05390"
                     /inference="similar to AA sequence:RefSeq:NP_015450.1"
                     /note="PKUD0C05390; similar to Saccharomyces cerevisiae
                     YPR125W (YLH47); ancestral locus Anc_3.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322085.1"
                     /db_xref="GeneID:40384403"
                     /translation="MSINRFSRVVLLAAQTTKFRPVTQRPSLFTPIISSVRLNSSSSS
                     SKDGSDANKSKNPASVAAPVVPVKVDPKKMTIWEKVKHEAHHYWEGTKLLGLEIKIST
                     RLLMKMTAGYELTRREYRQLQRTTADVLRLFPFAMFVLIPFAELLLPVALKIFPGLLP
                     STYESQADKNKKLASLRNTRYKVAQVLTNSKQMVKLPTNLTEEQVADFKDFMKKFKSS
                     RSNEISRQQLLRVAKMFKDDLILDNSPRGTLIALAKYINIRPYGTDQILRYRIRHKML
                     KIKEDDRLIEDEGVDSLSLAELQQACASRGIHMFNATPGQMKQYLNEWLDMRLHEKIP
                     STLMLLTNAYIYGEVERYPSTHEALKAVLTTLPIEFYHEQELFVENDNATTEQRLKVL
                     KEQEHLIKSENVQEEGHKILVKDKLSLDDDSNSGDKNVAKEESTEKK"
     gene            <1162273..>1165989
                     /locus_tag="C5L36_0C05400"
                     /db_xref="GeneID:40384404"
     mRNA            <1162273..>1165989
                     /locus_tag="C5L36_0C05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466226.1"
                     /db_xref="GeneID:40384404"
     CDS             1162273..1165989
                     /locus_tag="C5L36_0C05400"
                     /inference="similar to AA sequence:RefSeq:NP_011604.3"
                     /note="PKUD0C05400; similar to Saccharomyces cerevisiae
                     YGR090W (UTP22); ancestral locus Anc_3.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322086.1"
                     /db_xref="GeneID:40384404"
                     /translation="MAKRQRAGSHSSGDVEKVSVSAATSVREENPSSTDANSSIDAKA
                     EKQSLHSPHDDVYSKGVENGDDGDDGSDLEKSNDRKVESSQSKDRKNIKRQKISSHDI
                     QVARETAELFKSNIFKLQIDELVRELRLKDSHCILIEKVLHKLNNIIQEVPNSDRFSL
                     EEAYAYFEDTNVKIPFPDPKPSSLNYKLQYTAPDDVSLIGSFGLKTATKQKSGMSIDV
                     CLTMGKSLIQPKDYLNYRILYKQAFYLAYLAHHLSIKAPENNLPIIVKFDYHNGNTLI
                     PSLIIKSDPTSDISKPLLFNKTKFEIRILIGLPFGIFESRKLLPDRNCIRIQNSNVTS
                     NNDLPPTPLYNASILSTSTYNYYLKYLYTTRKSTEAFKDAAALGRLWLSQHGFSSNIN
                     QGGFGHFEFNILMAALLQGGGISGNKILLHGYSSYQLFKGTIRYLATQDLCDDGYLSF
                     TSLIDENKSVYKKAGFNVPTIFDKNTKINLLWKMNKSSYSILRKYAIETLDLLNDLVI
                     DRFHQVFLINNSNLNLKYDSSVMIPYSKLIELNEDKFGSLEKIAYVTLENYLAHKIYK
                     ILIEALDNRIYQIDIRWSENSKPWSLNKRKPNNNADDLYLVVGLFLNPSESDKRVTKG
                     PLHTEKELGEKFVSFWGSEKAQVRRYLDNTVQWSCLWEVSPTDSVVLTIVKYILDRHL
                     STSTNESHMLSKHLVVNSSKFTSLLPPPLIPHNLQSQPLILPEHFIKLKAAFENTSKD
                     LTDLNLPLQIRNVLPISPSLRNTSIVLPVPFATGNPNFFNECIIQFETTHRWPEEIKS
                     LEDTKTAFLLKICNELLQTKSNYYNAYIVKDESSVPYNDSIKVLRVLTNDGYGFQFRI
                     VTNNDEFLYLKAIEQASKLTSGPSQVFTIENSYIRFMQKYISSVKHHRSIATLVTHFP
                     YYSATVRLFKLWLDSQMILSHIPEEAIELIVLQPFIDPAPYGVPGSVMAGFLRVLRFL
                     ANWNWKEDPLILDLSREFNSKYREEKDSYVDKISDKIDLHTYQSMNKSFAKLREHDPQ
                     GVKVPYFIGTKEDISGKTWTQGISLVIASRLTSLSRVALDVLTRDDKNYEIKDSLLKL
                     IFTPALKDYDIVIKLSSTTLNHKKLRRLTGIMPTNVKFKNLVDSITEFEDTNQVTDPV
                     LAFYNDLVSRFGEVIVWSISKFDGVSDASERVITGLIVPGNTCRKFRVGIGYPMKPTK
                     EDGKKEVVALDIDDVLKICATLGGDMIKSIDVKK"
     gene            <1166077..>1167078
                     /locus_tag="C5L36_0C05410"
                     /db_xref="GeneID:40384405"
     mRNA            <1166077..>1167078
                     /locus_tag="C5L36_0C05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466227.1"
                     /db_xref="GeneID:40384405"
     CDS             1166077..1167078
                     /locus_tag="C5L36_0C05410"
                     /inference="similar to AA sequence:RefSeq:NP_015434.1"
                     /note="PKUD0C05410; similar to Saccharomyces cerevisiae
                     YPR109W; ancestral locus Anc_3.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322087.1"
                     /db_xref="GeneID:40384405"
                     /translation="MLILCYASELNDTSPNQNDLPVHHYSAHLADARSKVLLPIHLLI
                     TYHHILLIHMIIQMRANDAFKRNDETVYKQQIKFLTKTLNTDNSIVLYVIYYLLLLFD
                     GSLILFILRCFMQMFISHVIEDAMDNNEIVPGLTRSNALQSLTGQNISGVGNGGTSNE
                     VDEFRGFIGNLSMDQKKFLIRKLIAFMVLIWGFMFAYQLSFCMGNTFDGICYDIFGRI
                     TKTLKDSAYIPDYLNSNKLWNVNEAFDSGYLLISVIGEMRFRNPLTKYFTIILLDIMA
                     MGFQFLAIIIDYGIGFGMIDRFTSNDEVENERRFDGMQGKTCICRIDPIHFLKTIYS"
     gene            complement(<1167213..>1168226)
                     /locus_tag="C5L36_0C05420"
                     /db_xref="GeneID:40384406"
     mRNA            complement(<1167213..>1168226)
                     /locus_tag="C5L36_0C05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466228.1"
                     /db_xref="GeneID:40384406"
     CDS             complement(1167213..1168226)
                     /locus_tag="C5L36_0C05420"
                     /inference="similar to AA sequence:RefSeq:NP_015435.1"
                     /note="PKUD0C05420; similar to Saccharomyces cerevisiae
                     YPR110C (RPC40); ancestral locus Anc_3.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322088.1"
                     /db_xref="GeneID:40384406"
                     /translation="MSNIVGIEHDRVTNTTSTDFPGYSADSVGTEWSMENFRKNFKLD
                     ISFISERTANFDLIGIDTSIANAFRRIMIAEVPSVAPEYVYVFNNTSVIQDEVLAHRI
                     GLVPLKVDPDQLTWINKDAEEKDKFTDDNTIVLSLDVVCSKNPNANPNSNDPDNLYRN
                     HKVYAKHLKFEPQGRQVDLFANNPVVPCDPNILLAKLRPGQEISLRVHCVLGIGADHA
                     KFSPVSTASYRLLPVIDIKEPITGKDALEFQNCFPSGVIGINDKGEAFVKDSRKDTVS
                     REVLRHEKFNGKVKLGRKRDHFIFNIESTGAMPPEEIFFKSVRILRNKAEYLRNCPIG
                     NLN"
     gene            <1168645..>1170456
                     /locus_tag="C5L36_0C05430"
                     /db_xref="GeneID:40384407"
     mRNA            <1168645..>1170456
                     /locus_tag="C5L36_0C05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466229.1"
                     /db_xref="GeneID:40384407"
     CDS             1168645..1170456
                     /locus_tag="C5L36_0C05430"
                     /note="PKUD0C05430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322089.1"
                     /db_xref="GeneID:40384407"
                     /translation="MPSPPIVPIAFSPARDTGNSSSPSNLSSESSTPSRSRISSRVFS
                     GSVRGSRTPSLIIPVVSTSGTAEELEKDNDLVDIDVNLNDAETIQETDSQPGFFNEPS
                     SPKLPARPPATPKRPNANDFKPESPEEYGMERVEGLEFSPASIHTSKTRHSARHDDGN
                     DMGETLDSVLGKHSDSEPISVQNEKYLIANRENQIKHVVALLQKANLVVPDGVYFQKL
                     RSSNSYIEVESELQAGSYDTGDFPTLFTLLLNSLRVAETAFSHASKLNPQTEKKLDTT
                     IAGLPFLVNSSSEQKARFKSDISSIYSVLETIGELSIDEYVDINTNSVATVNLNALVA
                     AFVFRFASKNILPQALVLALLLDTFIVKVSEESKEFSFLLLRAVEESDPSFFLYEKNP
                     LGYVNSLIQSNEFWLNLVEQLFTNDKVSNVHPLGLTITLRNIVIHGTNSLVEVIVGLK
                     NQLEIFGGDISKVDGPPLPVHCNILRYHREYTILNDSAASQLTSHTLEKLSAKHDELE
                     SILSRKKHAYDELLNNYKQLNEEKMSVSSKINKHKVENEKLAALKRQLAAQVEQALGQ
                     FDVIKQTMEKNRRVQELNETMVKEIDRLKKENKKLKS"
     gene            <1170788..>1171633
                     /locus_tag="C5L36_0C05440"
                     /db_xref="GeneID:40384408"
     mRNA            <1170788..>1171633
                     /locus_tag="C5L36_0C05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466230.1"
                     /db_xref="GeneID:40384408"
     CDS             1170788..1171633
                     /locus_tag="C5L36_0C05440"
                     /inference="similar to AA sequence:RefSeq:NP_013869.1"
                     /note="PKUD0C05440; similar to Saccharomyces cerevisiae
                     YMR149W (SWP1); ancestral locus Anc_2.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322090.1"
                     /db_xref="GeneID:40384408"
                     /translation="MRLTTIIHSAFALIATLLSCFCCTCHAIAIGKGLIRIDDQNFSI
                     RETGVPLNLTDTRLSIAFTILRDGDSSEFVNPKQVMVSLSSPNIGSEFYLHPHLIEGK
                     IYESNILVSDISSFLLSAEEIKVTVITGDPDTTYNDIISLGSIRPSAKLRQNKHVEYP
                     DRFQAKPEIHHIFREPPKSLPTFVTLQFSLLLFTLLAVLFFSWRYFNAVNFENLGKLS
                     PFTFAFLATIALFEYYFYDYYLGASIFTTLYRVAITGIVALFFGSKALNNLYSLRMED
                     NRKTV"
     gene            complement(<1171677..>1172372)
                     /locus_tag="C5L36_0C05450"
                     /db_xref="GeneID:40384409"
     mRNA            complement(<1171677..>1172372)
                     /locus_tag="C5L36_0C05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466231.1"
                     /db_xref="GeneID:40384409"
     CDS             complement(1171677..1172372)
                     /locus_tag="C5L36_0C05450"
                     /inference="similar to AA sequence:RefSeq:NP_013870.1"
                     /note="PKUD0C05450; similar to Saccharomyces cerevisiae
                     YMR150C (IMP1); ancestral locus Anc_2.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322091.1"
                     /db_xref="GeneID:40384409"
                     /translation="MSSIIKDLTRIASLSIRSIAALHLFTSSCYEISQTEGASMLPTL
                     QVHNDFCVVDKHYKNGNDIQMGDLIVARKPTQPDSWVCKRITGMPGDVVLLDPSRDNI
                     ERLRTNYMDATKKNSAHNIDCTNGDRITDGKGKNEALQGSKLEEFNSRFKELKVEKGW
                     DRDPYDMYIIVPDGHVWVTGDNLSDSVDSRTYSVIPMGLIAGKIIIGMYLPNLMRFKG
                     NYYRWLENTFTDC"
     gene            complement(<1172615..>1176208)
                     /locus_tag="C5L36_0C05460"
                     /db_xref="GeneID:40384410"
     mRNA            complement(<1172615..>1176208)
                     /locus_tag="C5L36_0C05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466232.1"
                     /db_xref="GeneID:40384410"
     CDS             complement(1172615..1176208)
                     /locus_tag="C5L36_0C05460"
                     /note="PKUD0C05460; Pfam Domains:
                     Pkinase(3.1e-85)|KA1(2.2e-23)|Pkinase_Tyr(1.2e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322092.1"
                     /db_xref="GeneID:40384410"
                     /translation="MSSNQESNQSYDINQLKIPKVRHQTSNVAQATPRMLRNASNSAN
                     LSDEYNINPDYQIPQRTPSKRLPSVHERTVSHSNQLESNHGLLPGMDANQGNHSPLRR
                     RTTQQAPSTPSRINPNNQHHLTPQQKTPLQQQQQQQQQQQQQPPQQFHRRSIGDWEFT
                     KTVGAGSMGKVKLAKHRLTQEVCAIKVVTRASKVWQRQHMNDAPTSDPNELAQRKKEY
                     EKEIARDKRTIREAALGKILYHPYICRLYEMYSMSNHYYMLFEYVSGGQMLDYIVAHG
                     SLKESQARKFCRGIGSALSYCHANNIVHRDLKIENIMITNHGEIKIIDFGLSNLYNHE
                     HLLKTYCGSLYFAAPELLSAKPYRGPEVDIWSFGVVLFVLVCGRVPFDDKSVSNLHEK
                     IKKGHIDYPNHLTPECVDLLKKMLVVDVTKRAKIGEILCHKWMNKGYGNIVNSYLPER
                     IPLQLPLDPEIISEISNLNLGSNEVEIHSELTEILTSSYYHRCVSNWIAKRNGERYDP
                     NLLDPTKGFHPLVSIYFLVKEMIARKRAKSLQNSNSNAAETFKQHSNPGQYVTPQIEQ
                     NPVFNVTSPHPNMVHEPQNRIVTQPVPQQYQHTNKNGVGQYQSENNTQNLQPAPLLSS
                     SSNKGQVPPLKNPKQIQSETESHNPDMSIHVPNPAFNLPFPEAAYTSPHEDVSSHSFN
                     RHAANPINESTPPPQQQPSPIGESGINSLMRKISTGNKRKDDVHRVASVKVTSKEKQQ
                     LQVPSASNQLSMSSATRKHIPHHQRATSAYTASIFNPENMQRQDQKPLQHSSSMRKYH
                     PSARANSMGHSRKHSLTFTKSGTYTVDKNAPPLPSFNTNGTDYDGFFDDEMDNIVFDD
                     NEKPMAKLTDKEIIEQFEKAPPNSMPSIEYPKTLFLKGFFSVQTTSTKPLPIIRYDII
                     TVLPQLGVKFVEVKGGFICVHYPSIIDSPKKPFKSHTRASSISSPAKSIHEQQYHQPG
                     IDNVMDDNNGNSNYVDHEGHLNKTNDTDGLKTPTLSDTSSNGLKSKGSLTNDQHAVDT
                     TSYNSSDRLSNSSVVTPSKSNFGHRRKFSLGNGILGPRKGEKIVVSTDGQNYNVEYNI
                     PNTPAPANLNRHSTDDSSESLTLDDTNGASDMLVSSRLEQQNYIRSPTIGGAQESACT
                     KSRSSKTPLKFEIHIVKVPLVGLYGIQFKKVSGNTWLYKSLASEILSRLNL"
     gene            <1179349..>1181370
                     /locus_tag="C5L36_0C05470"
                     /db_xref="GeneID:40384411"
     mRNA            <1179349..>1181370
                     /locus_tag="C5L36_0C05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466233.1"
                     /db_xref="GeneID:40384411"
     CDS             1179349..1181370
                     /locus_tag="C5L36_0C05470"
                     /inference="similar to AA sequence:RefSeq:NP_013254.1"
                     /note="PKUD0C05470; similar to Saccharomyces cerevisiae
                     YLR153C (ACS2); ancestral locus Anc_8.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322093.1"
                     /db_xref="GeneID:40384411"
                     /translation="MTKTHSVVHEANGVIARPTPKPFFEKQPSASLSSKEEYDEMYKQ
                     SIQDPEGFFGPMAKKFLSWDKDFTKVKSGTLANGDAAWFINGELNACYNCVDRHAFKN
                     PDKVAIVFEADDESESRKITFGELLRDVSQVAGVLQSWGVKKGDTVAIYLPMTPEAII
                     AMLACARIGAIHSVIFAGFSAGSIKERVTDANSKVLITTDEGKRGGKIVNNKTIVDEA
                     LKDCPSVEKVLVYKRTGNPKINMKEGRDYYWQDLAPEFRGYLPCVSVNSEDPLFMLYT
                     SGSTGAPKGVVHSTGGYLLGAAMTTKYVFDLQEEDVLFTAGDVGWITGHSYALYGPMT
                     LGVSTIIFEGTPAYPNFGRFWRIIERNKATHFYVAPTALRMLKKSGEEEIAKYDLSSL
                     RTLGSVGEPIASEIWQWYDEKIGHGCCHISDTYWQTESGSHLIAPLAGSVPTKPGAAT
                     LPFFGIDAVIIDPTSGKVLEGNDVEGVLAIKNTWPSMARTVYKNHKRYMETYLKPYPG
                     YYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAVLLEDSKRVSDAAVVGIN
                     DDITGQAVIAFVQLKDNSLVSDEASLLKLRQDLRLSIRATIGPFAAPKTIIIVDDLPK
                     TRSGKIVRRVLRKIVSGEAKALGDQSTLANPECIEPIIVAVESQFGVKN"
     gene            <1181853..>1182674
                     /locus_tag="C5L36_0C05480"
                     /db_xref="GeneID:40384412"
     mRNA            <1181853..>1182674
                     /locus_tag="C5L36_0C05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466234.1"
                     /db_xref="GeneID:40384412"
     CDS             1181853..1182674
                     /locus_tag="C5L36_0C05480"
                     /inference="similar to AA sequence:RefSeq:NP_116710.1"
                     /note="PKUD0C05480; similar to Saccharomyces cerevisiae
                     YFR052W (RPN12); ancestral locus Anc_3.580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322094.1"
                     /db_xref="GeneID:40384412"
                     /translation="MTLDQLISKLTQEFTNENYETCFQLLTPLKIQLIEHNLLVPSIQ
                     TSINPNDLKITRQVLEIGALVSINLLKMQEFSNCITLLKPFYESSTLNDEASQKNKLL
                     SLYLLLLLTQDDLALFHIELEKFQNYNMNVDDLENDEFLSIPIKFEKWIIDGDFNKIH
                     ETLVSKHKFPCKEFNIFEDELLNSMRLNIANNLETVYRQLPIENLRILLFLKEISQVH
                     EFVENFNWKLVNGVVYFEKQNKTVLDETNQIDEINDEKSIIRNSLIYATEMERII"
     gene            complement(<1182986..>1184977)
                     /locus_tag="C5L36_0C05490"
                     /db_xref="GeneID:40384413"
     mRNA            complement(<1182986..>1184977)
                     /locus_tag="C5L36_0C05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466235.1"
                     /db_xref="GeneID:40384413"
     CDS             complement(1182986..1184977)
                     /locus_tag="C5L36_0C05490"
                     /inference="similar to AA sequence:RefSeq:NP_009571.1"
                     /note="PKUD0C05490; similar to Saccharomyces cerevisiae
                     YBR015C (MNN2); ancestral locus Anc_3.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322095.1"
                     /db_xref="GeneID:40384413"
                     /translation="MSKRHRHTAPLIRRPLLFSILAVIALVSLFSFYSNSKLPYIGHN
                     RDGVSSSSNYNKGETEIENTNNNNDHTNTNNVAKGGTFYEMMLHENKDQDSLKIKINN
                     DIVNNKKLVDESVVIADRRINDGIPSTAPSIDPVSDPTKIASLLTNLIHIVGNAAPSL
                     GFQLKEESFYKHPRLKNRRKLKNNHRFIERVYGKNGIVNIAAHDTNLEKYPMLSKQFL
                     LDCLFLPDDLFKDLQKSHDYFVNHIPNHYQDGTYHGDGIVLIGGGKFSWLALLSVENL
                     RLTGSKLPVEIIIPQREDYERQLCEVILPKLNARCVPLYNFINLENPNSHLTGYQLKS
                     ISLLVSSFQNVLFLDSDNIPVSNPDYLFASNLFEENGMVLWPDFWRRVTHPKYYDLAG
                     YQIGTSRVRNFLDKITPPSYYTNEGDDPDTDFPFHDRDGTMPDLSTESGQILVNKKTH
                     FKSLLLSFYYNVYGPRHYYPLFSQGGKGEGDKETFYAASQFFKLPVYQVNKAVGVIGH
                     WDDSKYHGVGMIQYDPAVDYENESKFQEFILDKIENSGKNGNNQFVYDPMEFFNWFTK
                     YNSKPMFVHSNYPKIEPIDLLQNGKLVDDNDMQWRLYADQPDLGFDFELQQWDLIHRY
                     FCSEITPLRLKYMENAQVSYSHLCEDISARLMFLKSTSI"
     gene            <1185901..>1187145
                     /locus_tag="C5L36_0C05500"
                     /db_xref="GeneID:40384414"
     mRNA            <1185901..>1187145
                     /locus_tag="C5L36_0C05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466236.1"
                     /db_xref="GeneID:40384414"
     CDS             1185901..1187145
                     /locus_tag="C5L36_0C05500"
                     /inference="similar to AA sequence:RefSeq:NP_011860.1"
                     /note="PKUD0C05500; similar to Saccharomyces cerevisiae
                     YHL003C (LAG1) and YKL008C (LAC1); ancestral locus
                     Anc_2.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322096.1"
                     /db_xref="GeneID:40384414"
                     /translation="MTQQQPDSVSSGIAPVPPATPTSTHRRRSSVGTIKLGDSAVPSL
                     QSRRSISDINEAEKYQLKEINRTSQSVDDMEVSKKLFTFVKILCYRHTWFAPLLVLIS
                     ANVVYLLSNNYTPSNPLHRFLKLSYEVPNTDPPLYEKGWKDFCFVFYMIIFFTFLREF
                     TMQIFLQPLARYFGIRGKSRTSRFVEQTYAIFYYGITSPFGLYLMKHSPMWFFKTEEF
                     FREYPHLQHTWLFKYYYLFQAGFWSQQALILTLQLEKPRKDFKELVFHHIVTILLISL
                     SYMFNFTWMGLAIYITMDVSDLFLGTSKTLNYIGSPLEVPFFLLFVVVWIYTRHWLNL
                     KILYSVMTEFLTVGPNVLDFASQQYKCWISQPMVFTLILALQLVNAYWLFLIFRILVR
                     FAIYNVKKDERSDDEDEDEDEE"
     gene            complement(<1187589..>1188866)
                     /locus_tag="C5L36_0C05510"
                     /db_xref="GeneID:40384415"
     mRNA            complement(<1187589..>1188866)
                     /locus_tag="C5L36_0C05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466237.1"
                     /db_xref="GeneID:40384415"
     CDS             complement(1187589..1188866)
                     /locus_tag="C5L36_0C05510"
                     /inference="similar to AA sequence:RefSeq:NP_011859.1"
                     /note="PKUD0C05510; similar to Saccharomyces cerevisiae
                     YHL004W (MRP4); ancestral locus Anc_2.500"
                     /codon_start=1
                     /