GenomeNet

Database: RefSeq
Entry: NC_042509
LinkDB: NC_042509
Original site: NC_042509 
LOCUS       NC_042509            1383544 bp    DNA     linear   CON 16-JUN-2019
DEFINITION  Pichia kudriavzevii chromosome 4, complete sequence.
ACCESSION   NC_042509
VERSION     NC_042509.1
DBLINK      BioProject: PRJNA545694
            BioSample: SAMN08558011
            Assembly: GCF_003054445.1
KEYWORDS    RefSeq.
SOURCE      Pichia kudriavzevii (Candida krusei)
  ORGANISM  Pichia kudriavzevii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
REFERENCE   1  (bases 1 to 1383544)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Population genomics shows no distinction between pathogenic Candida
            krusei and environmental Pichia kudriavzevii: One species, four
            names
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1383544)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1383544)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 1383544)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP028776.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 01-DEC-2017
            Assembly Method        :: HGAP v. 3
            Assembly Name          :: UCD_Pkud_6
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 93.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1383544
                     /organism="Pichia kudriavzevii"
                     /mol_type="genomic DNA"
                     /strain="CBS573"
                     /isolation_source="lab strain"
                     /type_material="type material of Candida krusei"
                     /db_xref="taxon:4909"
                     /chromosome="4"
     telomere        complement(1..553)
     gene            complement(<2711..>3982)
                     /locus_tag="C5L36_0D00100"
                     /db_xref="GeneID:40385098"
     mRNA            complement(<2711..>3982)
                     /locus_tag="C5L36_0D00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466886.1"
                     /db_xref="GeneID:40385098"
     CDS             complement(2711..3982)
                     /locus_tag="C5L36_0D00100"
                     /note="PKUD0D00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322746.1"
                     /db_xref="GeneID:40385098"
                     /translation="MRRSCILFRQPAKLVNKYIPPSERAIREYKKYQEEKNRKQKYGK
                     YIQYGVLSLVGSAVLMYYWQPWNPYSTDVSKELRKGLWEERDGKDDYLNALKHYQLAL
                     KQSQAEGMDQLSLKYTGIVLKIAEMYEHLNMMDKLIGTYHNLSNFIFEHLIRNNIDKE
                     NPERDLLIDRDLIVITRWSMLRQKSKDKDWKNEIQTEIRDRMEFIENYELTERLPWLQ
                     IKDKDSEFNIFELMDIWAFRKNKLFNKEELKKQWIDKHVQSKDGQEFLKCWDLFRSYE
                     KKEWPVWISSYLKLRDYFGMFELSTGNSLNAIKILQSNIIWLTIAGIEDAVNGPTQFL
                     NLASAWFQYGQSANSPKAYKNSELIYKKLISIVNQEDPILPITYYSLGVLYLQTNRRD
                     DALRAFDTAKSKAVDLDQIQIIDKIDDELLK"
     gene            <4203..>5702
                     /locus_tag="C5L36_0D00110"
                     /db_xref="GeneID:40385099"
     mRNA            <4203..>5702
                     /locus_tag="C5L36_0D00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466887.1"
                     /db_xref="GeneID:40385099"
     CDS             4203..5702
                     /locus_tag="C5L36_0D00110"
                     /inference="similar to AA sequence:RefSeq:NP_013828.1"
                     /note="PKUD0D00110; similar to Saccharomyces cerevisiae
                     YMR110C (HFD1); ancestral locus Anc_2.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322747.1"
                     /db_xref="GeneID:40385099"
                     /translation="MKDIQDRHRTLKESFSSNPRSVRDSKDLLSKFRNVLSQSFEPIA
                     AAVKADFNKPQLEFYVAEFGQAIAETNNIINNLESMLSSPSPKTVPVTFSTMFMEVEK
                     IALGTVLIISPFNYPLILSISPLVGAIAAGNNVVLKLPYDQLPNFSRALTEVLESVFP
                     PEVLLVVGGGVTESTYLLNECKFDKIFFTGSTKVGKIVYEAASKNLTPVVLELGGKSP
                     VFITKNIDLSSIDALLDRLLWGKFSNAGQTCVAPDYVLVDSVVYEKVMNHLQKAFEKF
                     SKIDNKSDYSHVVNQRNFDRLNGLIESTKGDVIGGRTVKEDLFIAPTIVSNIDWNDPL
                     MCEEIFGPILPIIKYDGSFQSIIKKVTENHDTPLAAYLFSSSEEDLTMLRKYLRSGSI
                     LVNETLMSAGCFVTPFGGIGSSGFGNYHSKWSIDTFTHERAVLKQPLWAEFLLAERYY
                     PYTEKKLRKLMLLSKIPEIPFQLVKSILFYCLVFICGYFVGGVWNSFSR"
     gene            complement(<5803..>10101)
                     /locus_tag="C5L36_0D00120"
                     /db_xref="GeneID:40385100"
     mRNA            complement(<5803..>10101)
                     /locus_tag="C5L36_0D00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466888.1"
                     /db_xref="GeneID:40385100"
     CDS             complement(5803..10101)
                     /locus_tag="C5L36_0D00120"
                     /inference="similar to AA sequence:RefSeq:NP_010621.1"
                     /note="PKUD0D00120; similar to Saccharomyces cerevisiae
                     YDR334W (SWR1); ancestral locus Anc_5.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322748.1"
                     /db_xref="GeneID:40385100"
                     /translation="MAEYMSVTENKLLDILADSDILIDELFHLQNFNTIVNYNPSPDQ
                     IILNKESESFSIFKNDNNLNVWPQNSKRSTRNATTTQNSKLLLIKERLSSRINDKIRE
                     KLENDTNCLGKRKKDDFDSTSVNKKQKTLNKTSKVKFRISVKPQIVTHPDHIPVHQFN
                     STEELFGSYRNVLEDPAPEIETSEYKDYLESQVSLVNKIKNAIEDKELLYIDYNENPF
                     RPVPNGVREPTMIKRNPAYHINNYKPPGVPFRIKNDLTHYDHLLAQAMKSSKLIHDTR
                     ALKIQKCKRIAQMIELHFKRLSQENEKQEKEFRKKIVRLAKDTAREVKKKWNIALKAY
                     KILEEREKERERMLKSKEQLSKILDHSTKVLGAQLVGKSISNTPSLDPEDRIEAKSEN
                     SEHDGGDSDDESSDEMLSSSSEDDDDDENNDALCGDRAIDNVDDSKLTVEQLKEKYKH
                     LESIKIDGAPSLRSTSLAEIYKDDSSIGDKSSHSRENDDTKTVGGVSAKSILDDDNDS
                     YSISDESMSESSSDGGSDDEDNESEKAPGLADLFATNENKDSDDEDDESVYSDHFENE
                     TPSSSPEHPNQIESVDMEMTDDGIPSVPTPVLLKGTLRPYQKQGLNWLASLYNNGTNG
                     ILADEMGLGKTIQTISLLSYLACEKNEWGPHLIVVPTSVMLNWEMEFKRFAPGFKVLT
                     YYGSPQQRKEKRKGWNTPDTFHVCITSYQLVVHDQPIFRRKKWKYMILDEAHNIKNFK
                     SQRWKALLNFNTEHRVLLTGTPLQNNIIELWSLLYFLMPSSKEGNASMPEGFADLMNF
                     QQWFGKPVDKIIQQGTSDRESKETVNKLHQVLRPYLLRRLKQDVEKQMPAKYEHIVYC
                     RLSKRQRLLYDDFMSRAQTKETLASGNFLSIINCLMQLRKVCNHPDLFEVRPILTSFS
                     EEKAVSSNYEIKNRIVEKLMKFNTTDTVNLSFLNLVSGMKYTNNSPSYHLQTICELNA
                     SNVFTRTINELEEKLAGKKIIPNYNDLESYYEYLLNKENSDLLELMKYRRYVNDFNCN
                     KSQLLSSSLVDMLTLRKNKNHTSQLVNLDLVKSIVKVSEMMSTIVDKFAFVTPKAVCL
                     NIPDLMFPADAKNELIYASQSNRILNPFHQAQVKTSIAFPDKFLLQYDCGKLQKLAKL
                     LHDLIPAGHRVLIFTQMSKVLDILELFLNFNGYTYMRLDGATKIEDRQLLTERFNNDP
                     RVKCFILSTRAGGLGINLTGADTVIFYDSDWNPAIDKQCQDRCHRIGQTRDVHIYRFV
                     SEYTIEANILKKAEQKKHLDDVIIQEGDFTTDYFTKLTVQDLLGKSGDTESDKKLILG
                     GGKDFTKALEMAEDVEDAKAAEIAMKESNVDVEDFSDEENRGNVGRMDSEPTPVEESA
                     EIEKLATRVEELSTHHHSKQAEEVAETIDNGLDDEIGHIDEYMIRFIAGGYYFD"
     gene            <10483..>10953
                     /locus_tag="C5L36_0D00130"
                     /db_xref="GeneID:40385101"
     mRNA            <10483..>10953
                     /locus_tag="C5L36_0D00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466889.1"
                     /db_xref="GeneID:40385101"
     CDS             10483..10953
                     /locus_tag="C5L36_0D00130"
                     /note="PKUD0D00130; Pfam Domains: NDUF_B8(4e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322749.1"
                     /db_xref="GeneID:40385101"
                     /translation="MFSRSLLRSGLINQSFKRFNSTSAKYGIPKFLPDAEKEFGIKTP
                     ENYVPPQYRDPYEKYDDQQNRVNFGEEIHPYHDYMDMWSPDHFQSVKDHVAVRQFLTF
                     MGLLGVFAYAIYVTDIWPERPNMPRSYPYDGLYRDLGGREGEQELMQARVDKGN"
     gene            complement(<11229..>12980)
                     /locus_tag="C5L36_0D00140"
                     /db_xref="GeneID:40385102"
     mRNA            complement(<11229..>12980)
                     /locus_tag="C5L36_0D00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466890.1"
                     /db_xref="GeneID:40385102"
     CDS             complement(11229..12980)
                     /locus_tag="C5L36_0D00140"
                     /inference="similar to AA sequence:RefSeq:NP_012965.3"
                     /note="PKUD0D00140; similar to Saccharomyces cerevisiae
                     YKR039W (GAP1); ancestral locus Anc_1.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322750.1"
                     /db_xref="GeneID:40385102"
                     /translation="MSTEKTYNEKEYVSTSFSPVNELEDNASHAYSTERENKGFYQNF
                     IDGFKPIDLGEIDPNLTDIERANLISARAPLKRGLKNRHLQMIAIGGSIGTGLFVGSG
                     SALATGGPAALVIAWILTGCMMYCTVQALGELCVAFPVSGSFVQFNTRFISSAWGFCM
                     AWNYALQWLVVLPLELVAAAITIDYWNSEVSSAAWVTIFYVLVLFINVFGVKGYGEAE
                     FIFSALKVLAIIGYIILGIVINCGGGPKGGYIGGQYWHHPGAFAAGFKGVCAVFVTSA
                     FSFAGTELVGLAAAETENPRKSLPSATKQVFWRIALFYIISLTLVGVNVPYDDPRLLG
                     NSGAAASPFVISIQNAGIRGLPSVMNAVIMIAVCSVANSSVYGASRTIASLADQGFAP
                     RIFGYIDREGRPLAGVVTSLIIGLLCYLAASSHHDDVFDWMLALSGLSSIFTWGSICA
                     CHLRFRRALYVKGRGTDELPFCAQLGIYGSIFGVLLNCLILMAQFWVALFPIGEKANA
                     TSFFQVFLCVPILIVCYVFWVFYKKDYKFFVRSADIDIDTGRREVDLELLKQEIAEEK
                     AFIASKPFYYRIYKFWC"
     gene            complement(<13823..>15577)
                     /locus_tag="C5L36_0D00150"
                     /db_xref="GeneID:40385103"
     mRNA            complement(<13823..>15577)
                     /locus_tag="C5L36_0D00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466891.1"
                     /db_xref="GeneID:40385103"
     CDS             complement(13823..15577)
                     /locus_tag="C5L36_0D00150"
                     /note="PKUD0D00150; Pfam Domains: AA_permease(8.3e-189)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322751.1"
                     /db_xref="GeneID:40385103"
                     /translation="MSTRKSYNEKELASTSITPVSEIEDDVSTNAYSKTKKDQGFFKN
                     FIDGFKPIDLGEIDPNLTDIERANLISARAPLKRGLKNRHLQMIAIGGSIGTGLFVGS
                     GSALATGGPAALVIAWILTGCMMYCTVQALGELCVAFPVSGSFVQYNTRFISSAWGFC
                     MAWNYALQWLVTLPLELVAAAITIDYWNSEVSSAAWVTIFYVLVLFINVFGVKGYGEA
                     EFIFSALKVLAIIGYIILGIVINCGGGPKGGYIGGQYWHHPGAFAAGFKGVCAVFVTS
                     AFSFAGTELVGLAAAETENPRVSLPSATKQVFWRITLFYIISLTLVGVNVPYDDPRLL
                     GNSGAAASPFVISIQNAGIRGLPSVMNAVIMIAVCSVANSSVYGASRTVASLADQGFA
                     PRIFGYIDREGRPLAGVVTSLIIGLLCYLAASSHHDDVFDWMLALSGLSSIFTWGSIC
                     ACHLRFRRALYVKGRGTDELPFCAQLGIYGSIFGVLLNCLILMAQFWVALFPIGEKAN
                     ATSFFQVFLCVPVVIVCYVFWVFYKKDYKFFVRSADIDIDTGRREVDLELLKQELAEE
                     KAFIASKPFYYRLYKTWC"
     gene            complement(<16377..>18251)
                     /locus_tag="C5L36_0D00160"
                     /db_xref="GeneID:40385104"
     mRNA            complement(<16377..>18251)
                     /locus_tag="C5L36_0D00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466892.1"
                     /db_xref="GeneID:40385104"
     CDS             complement(16377..18251)
                     /locus_tag="C5L36_0D00160"
                     /inference="similar to AA sequence:RefSeq:NP_011003.1"
                     /note="PKUD0D00160; similar to Saccharomyces cerevisiae
                     YER080W (AIM9); ancestral locus Anc_7.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322752.1"
                     /db_xref="GeneID:40385104"
                     /translation="MLSRSTRTALKYSRSILRTPRKVSICALNQVRFQSTKIGTAPKE
                     TTTNLFDDSDPKRNHIFEYSWGTWLKNDKQEKQKRFTKFSIQGLNETLKNINSLGKSL
                     GETNPDAIERVDKVKVLSNNIKNFFGNDGEVKDINQVLSLHEGKHHRIYRIQLEGLDK
                     KLVLRLPYSLGSKVFTKRKIESEVATMDFLSNALNLNIPKVLAYSGEYDNQLGHPFML
                     MEYIEDVESSLMKKWNPLVDSKDDRLDCNEAISQLNEVIEPLADFNKIVGDFIFDNYG
                     SIYFKDDCPKGLEAIAYEGQDRWVIGPSVESAYYRNKEYVAGEDIDRYVGPWKRSEPL
                     KMIQDLVDLEILSLRNRLAAIEKGENVKDDIADLKDAIKIFEKLRLVAGEMFNLNPKE
                     TIIPNLAELLKPRLLIGDLDPMNVLVRKDNKGFEFLDFENCVVKPFLISNYPKFLEYN
                     GEKIFSLQQEVNNFNQLDDVEKEQYRFMFKRTRNQFLWEVSINKNSKELVGVISPVIK
                     LVKSCYLNILNFKNLKDALYIENGLIEISTMWENYNGNGVLGKAKGEPNPIKFNENEI
                     NEFAKKIQEYEISNGSKPFTATGGWVPQDMFNRLEEQGLLIKDNDKDEWKIDTDKVLK
                     "
     gene            <18497..>20128
                     /locus_tag="C5L36_0D00170"
                     /db_xref="GeneID:40385105"
     mRNA            <18497..>20128
                     /locus_tag="C5L36_0D00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466893.1"
                     /db_xref="GeneID:40385105"
     CDS             18497..20128
                     /locus_tag="C5L36_0D00170"
                     /inference="similar to AA sequence:RefSeq:NP_012193.3"
                     /note="PKUD0D00170; similar to Saccharomyces cerevisiae
                     YIL072W (HOP1); ancestral locus Anc_7.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322753.1"
                     /db_xref="GeneID:40385105"
                     /translation="MSNMTMTNTNGRRRVSERFTKQQSERTVIDILTISISCIFFLRG
                     FFHDSFFTDDKFYINKDLANKKFKKDYIRVKKIKRNVSDDVDMILNWINISIQDALHK
                     KYLKAINVSILLDDKVPAKVFESYVFDVKYSDIQPESISFNDDILISPVELTKLQIFN
                     LLKKIILLTQALPPLPSKKFLSMRLLFNDKCPNDYYPEYFTDCTNCKPDSIRIPVPVY
                     NDIVADCGGVNSVHHNVTAKLVSLSTLTNSDYENANIIDVDPFEIFGCMKEENDKEKD
                     DIISLNTQVSQVTKDLYDMLTTYENQVHDGETQVHMKSNDASTKEIEENITISCECKA
                     ETYLPYTSLIKCQKCQKWVHKVCYSYQSNPPDFLCITCAGNISLDDDLQILFNIRKLI
                     ACYESNNTSQIVSLTTAAEQIGFTSTQMLTNQKISRSVIDAFSVLIYKGLLSFKAQKS
                     FNHNIFSVEFDGLLVENKPISIGKYFVQPNFNNRNTINKLLDLNFNRSKSFQEILADY
                     NQSNDETMVEDENYSETLSKYKKMKISKSKDIFQI"
     gene            complement(<20188..>22548)
                     /locus_tag="C5L36_0D00180"
                     /db_xref="GeneID:40385106"
     mRNA            complement(<20188..>22548)
                     /locus_tag="C5L36_0D00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466894.1"
                     /db_xref="GeneID:40385106"
     CDS             complement(20188..22548)
                     /locus_tag="C5L36_0D00180"
                     /note="PKUD0D00180; Pfam Domains: Voltage_CLC(3.2e-46)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322754.1"
                     /db_xref="GeneID:40385106"
                     /translation="MTTLSMCAKIYDKKELVGYFVMNEEVTKLYPTDEDLFKSFPSTV
                     PVVTFREETASSEPNAKAIGKEIFNEGEYLDGQIIPWGKLDKLRQNENLHRVESSSSV
                     LDRFVNRYNQWPIIILASVTLSLLAIFLDWSSTWLNDIKYGYCSTDVFKVRSACEPSS
                     WKLYGGNHRGMAKSFADLVIVLICTVVLSFLGLMISSANSWIVKSGISELMAIIAGAV
                     NNDFLNWSIILKKYVSLIFIVACGGLLLGYEGPLIHISCGVINFFLNFLSGQFHIFNN
                     LNNEVVRREFLSIGFVIGISLAFGAPIGGLLFSLEKLKLGKRFHMLMWNGFVCSTIAT
                     FIFFKVHPFKKITINKAFTVDLANGYVLLELIPYLFVGLICGFLSLAFNSLQLRLTEF
                     RKSSKCFSDSKAIQYLLDHPIAEITLLATITTTILYPLKFSDLTMNDLLVTLFHDCTD
                     PNKSNNNSQSVCTAKHETLELIYYLVVIFIQSNLAYTLDIPGGILLPSLVIGGLIGRI
                     IGRIVELFQIHLGSDIFAQCFQEKRNCVSPGSYAIVGAASFFAGVTNTSVAAVVIVFE
                     ITGAVTYLIPLMMGVVVAKSIVELFDSRGFYEMWLSKTHKNYLAPETVESLKLSPFSD
                     VAILGALKESKNRIVYYDELIQIKEFIKKLDQIIEDNNFEKELINNDGFVVLQSVHNR
                     SLVGFVDYASIDRLVRLNGHSDSTLISFSSPESEVNNTAVLNLSRYMKSRKELFIVNS
                     RYPLLSTYDLMEKMLVTNLFVCEDTTDGEKFRGVLRISDLTDYIRG"
     gene            <22818..>23735
                     /locus_tag="C5L36_0D00190"
                     /db_xref="GeneID:40385107"
     mRNA            <22818..>23735
                     /locus_tag="C5L36_0D00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466895.1"
                     /db_xref="GeneID:40385107"
     CDS             22818..23735
                     /locus_tag="C5L36_0D00190"
                     /inference="similar to AA sequence:RefSeq:NP_013716.1"
                     /note="PKUD0D00190; similar to Saccharomyces cerevisiae
                     YMR003W (AIM34); ancestral locus Anc_6.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322755.1"
                     /db_xref="GeneID:40385107"
                     /translation="MLRTARSLPSLRLLYQSEIKSLHEPVKAATTYAFKSGDLFHTQT
                     KLSVRHVHQTSKKETILLDISSHKGKYTSMNLQGLKMECRKRGLKVSGRKIDLVQRLI
                     AQEQSGIENSRAYSGLSEQHSSDRSILPLEVKKQSSAKLSKKAEVKSGKSGKTKTNEQ
                     SITASKTRLSKKSTSKNENAKGQLSSQEANTRSDTTLEAEQEKHRLQSAISNAAFSVT
                     NQHIVSNVLKKANEQSKEQIIEKSKKQIKARAKEQQRTHYEQSQRKHYNETKTREENQ
                     HENVRLTNRDIGFLSAFGVSTVAWWSMKE"
     gene            complement(<23919..>25373)
                     /locus_tag="C5L36_0D00200"
                     /db_xref="GeneID:40385108"
     mRNA            complement(<23919..>25373)
                     /locus_tag="C5L36_0D00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466896.1"
                     /db_xref="GeneID:40385108"
     CDS             complement(23919..25373)
                     /locus_tag="C5L36_0D00200"
                     /inference="similar to AA sequence:RefSeq:NP_014593.1"
                     /note="PKUD0D00200; similar to Saccharomyces cerevisiae
                     YOL049W (GSH2); ancestral locus Anc_7.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322756.1"
                     /db_xref="GeneID:40385108"
                     /translation="MTQKDFPVLNDQKLQELVHEVSQFGLSNGLVMYPPAPYKDYEPV
                     LAPITIFPTPFPRKQFEKSYDIQKSYNKLYANVVSEKKWLEGIIEKLSIHDKPFTGKL
                     WDCYQKALEKGIPQDVSLALTRSDYMYDETLNLIKQVEYNTVSVSFGGLSPKVGQAHT
                     YLNKIGAYTGVPLSQYYEENELPISESDKKLARGLHSGVKYYNDKYLKGENKSIVLMV
                     VQPSERNAFDQRSIEYNLLNEFNVLTKRVELPSVSRLVHIDPNSRKLFYQGYEVSVVY
                     YRSAYGPAEFDLPETWRCRSMLESTLAIKCPSLLTQLSGSKKVQQLLTKQDNLSLFLN
                     DKEIESLGDSFCKIYPLDDSEDGSLAKKLAFESPEKFVLKPQREGGGNNIYKEEIPLF
                     LKSIQENEWEAYILMELINPKIHENLILRNGEVLNDGIVSELGVFGSYLFNENTGEII
                     DNQVCGHLLRSKTSSSNEGGVAAGYGCVDNMYLY"
     gene            <27192..>31658
                     /locus_tag="C5L36_0D00210"
                     /db_xref="GeneID:40385109"
     mRNA            <27192..>31658
                     /locus_tag="C5L36_0D00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466897.1"
                     /db_xref="GeneID:40385109"
     CDS             27192..31658
                     /locus_tag="C5L36_0D00210"
                     /inference="similar to AA sequence:RefSeq:NP_009474.1"
                     /note="PKUD0D00210; similar to Saccharomyces cerevisiae
                     YBL079W (NUP170) and YER105C (NUP157); ancestral locus
                     Anc_7.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322757.1"
                     /db_xref="GeneID:40385109"
                     /translation="MSFSVSQVPGLTSDPFHDASTINSNVLSANKSNPATVNYNIQRS
                     EIQRRRAARNSMLNRPMGNSYIGSFPFFGGSNANNQSLINKKDSVVTDLSHLPLSTSS
                     PIDLAQQCVNAQIEKDNSTPTLYEVFSAYVVDNYNFNPNQTKNPFSRFEKVSFFSIPE
                     KLLDKNSDSLVTNMGVFPEIQRAWLSLDSKLYIWNYNASLTDQEFDTIDDFEGTILKC
                     ALVRPKKDVFVESVNYLIIVATSKEMKILALEYSPDSKKLEVSDTKMSVSVHGLIVNQ
                     IVCLEYTNDIFFSGAGSSDCVWKLNYSNTHDWFSKNISKEQVTNSSFSSSLSGIPILN
                     WLNDSTSSKTEFVVDLKIDQSRKILYTLSSNSIIKAYKLQFKNGKVVLGQPLIKRISH
                     LLKELSTTSINIRSSLLRSNLKLINIFPVTDKENTSLFLTAVASNGVRFYLNGSTLYG
                     DRLTLTTNFVKFPPIDLKLYETIEKRKEKMISQNQNIDEAQIMPAPQMHNNRSSFYSR
                     SSQKSGVNADPYFPSTYQNNLNINNRDNDKSITKSFAAPLISIEELKDAQEKSLLLHN
                     TSHTLIISPGIFIGFSKDLGLYTSTPDYGVLKKSSQYVEDFEIFEKYSEVFDIVQLTS
                     SFKTTNSPKGYANEFASQYTDEPLEFAVLTNNGIVVYRYRTPDLILEDSMNDSVFKQF
                     ASKYGYDEACSTMLFLACKYDKSETFRNIATKYFITGGQNSKLDKALSPVIDNVEPSD
                     RFFAVLILFSRLIRGIWNKEVFKLRPEVKFDKFGYVDTKSLNSIKTDKHILLESLNIK
                     KQELEYLLCSILIIIKFFEENRNIIPGLSKDINSQGENTSWKGKATEVCVQAEQICFD
                     SISKFLNIVKEGLSFLTILLEETESESLTSHENFKSIISFLPIQAQVDLSCITFSDFF
                     AKSDINVSRLIKDLLSCIINKSISQGNSVELVSNTLQEKCGYFCSTGDVLIFKAVESL
                     KKAKDYSDAKDDQLKLKYLENAVTLLKQTSDSLSDEMIANCVNTILELGYYPNAVKFL
                     LDIANTPELVKLSTQYQKDVQLSMVTDPLKKNSYQRKLKLFHIIFQILVDIDKKALSS
                     VEQAAESTLIGSSTNNTGKFKDFQSVFVDREGNLTTYYSKLRDECYKICLEVQDKMFH
                     FEFYKWFVINGVGEKLLYIDTPYILEFLQSQATNDLEMSKLLWVYYSKKGNYYEAASH
                     LYYLSLSTFDITLEDRIHFLSVANSFIQVIETQYLHQDVMVLASQISDLISVSNLQDE
                     LLSTIMNDSRISDLAKSVAKEELNGEILTVNDLYNKYIDPLGYYELSLLCFKISDHRN
                     LEDILGKWESLFDKWYVEYSQKPDCSNTPFYAEVVNKFSAIADRLSDVESLFPIDQLI
                     NIMLKSIQKHSDSSIAIPTGVIVDAFIKSGVALNRLYYSMRKLIEGSTYELFEGYNKL
                     LNSEMVYLIKTWFKSDKKLRELISSDEIVNMTEYDHETDPIYKFTKTTGSAL"
     gene            complement(<31762..>32760)
                     /locus_tag="C5L36_0D00220"
                     /db_xref="GeneID:40385110"
     mRNA            complement(<31762..>32760)
                     /locus_tag="C5L36_0D00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466898.1"
                     /db_xref="GeneID:40385110"
     CDS             complement(31762..32760)
                     /locus_tag="C5L36_0D00220"
                     /inference="similar to AA sequence:RefSeq:NP_012002.1"
                     /note="PKUD0D00220; similar to Saccharomyces cerevisiae
                     YHR134W (WSS1); ancestral locus Anc_2.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322758.1"
                     /db_xref="GeneID:40385110"
                     /translation="MIFILSLRGEGGVCGLVSIKELSYIFNSLLFFLFSVVFFFFNST
                     LLLHQNFFQYTWLKFLVNRSVMVIKGRGRYPKKKPVEIESPTPHILKLASLKRQDAAD
                     KALELLHEVAALVAPVMSHYGFKVGLLCEMYPKDKCLLGLNVNRGQKICLRLRSPTDN
                     KWFLCRDEIVGTMLHELTHNWHGAHDNTFYKTLEELKDKYLEFQVNSSLRNSTYRNNF
                     SAPRPLRFSANKPKAKYTTRVSKLGTNKTLTTPTQLDPSTLRAILFKAAQRRINDTKI
                     CADVESAKLSNVPEDDELKIIEVISLDTDITNSQRGIEQLSSSDDPHDSPEVIVLD"
     gene            complement(<32843..>33826)
                     /locus_tag="C5L36_0D00230"
                     /db_xref="GeneID:40385111"
     mRNA            complement(<32843..>33826)
                     /locus_tag="C5L36_0D00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466899.1"
                     /db_xref="GeneID:40385111"
     CDS             complement(32843..33826)
                     /locus_tag="C5L36_0D00230"
                     /inference="similar to AA sequence:RefSeq:NP_014914.1"
                     /note="PKUD0D00230; similar to Saccharomyces cerevisiae
                     YOR271C (FSF1); ancestral locus Anc_8.720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322759.1"
                     /db_xref="GeneID:40385111"
                     /translation="MASSVPGPIPLPDSRHDLSTYLGRVKHCAEISDPTMLLTTSKDI
                     EESKRLIWDYKNGLIPEMTPKLWRAKKILDSSIHPDDGKTVLLPFRMSSCVLSNLVVT
                     AGMLTPGLGNMGTLFWQVANQSLNVAINTANANKSHPLTTKQMATSYLMAVGASCGVA
                     LGLNSIVPKLKNVSANTKLILGRLVPFAAVVSAGIVNVFLMRGQEIRKGISVFDEDGN
                     DLGTSKRAAFKAVGETALSRVINATPIMVVPPLLLVQLQKSVLRNKSLGVVTAANIGL
                     IFTTSLVALPFALAVFPQKRIVDPSSLEPQFHNLKNKEGKLITSVWFNRGI"
     gene            <34123..>37188
                     /locus_tag="C5L36_0D00240"
                     /db_xref="GeneID:40385112"
     mRNA            <34123..>37188
                     /locus_tag="C5L36_0D00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466900.1"
                     /db_xref="GeneID:40385112"
     CDS             34123..37188
                     /locus_tag="C5L36_0D00240"
                     /inference="similar to AA sequence:RefSeq:NP_014207.2"
                     /note="PKUD0D00240; similar to Saccharomyces cerevisiae
                     YNL192W (CHS1); ancestral locus Anc_2.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322760.1"
                     /db_xref="GeneID:40385112"
                     /translation="MHGQGEQGRSRQENYFKNIRRLNRASQSTSSDHGYEFVHSNDSE
                     MSLGHFDIPAVSYSPDRYTRGSRRNSHSPIHEIYSRSPSVSPSRVLLQNQSSYFLSGN
                     PFTIPELPQLKNVNYEHLNTHSGKKHGTQSIPLYEIGPTEDPFDDKYKTHDDPSCYDH
                     LERGDFFGGYEFDDDELEGGAEENFDPFPVLGNSYYPINTPYDVYNPFEVEYSSDNSS
                     DGSVSVSSTTNTASKSSLLTRRDSTFKNAKAVAKTVEFYNNGEHIDEDVTNPSAKQVR
                     MVDGNLVLDCPISEILLNKYKVPLSEKDREFLFMRFQACTAEPEEFQQKKFSLRQLFY
                     TKPRETELMIVITMYNEDEILLARTLKGVMKNIRYLYSLKNSSTWGKNSWQKIVVCIV
                     SDGRQKLNPRSKALLAALGVYQDGFAKNQINDEEVISHIYEYTTMVGISKIYNDRVTL
                     TTENQVPIQMVFCLKEQNKQKINSHKWAFKAFAPVLKPNVIILLDVGTQPENKSLYKL
                     WKSFKDNPRVAGSCGEIKASLGKGWRLLLNPLIAAQNFEYKVSNILDKPMESVFGFVT
                     VLPGAFSAYRYEALLGEPMDKYLRGEDLSKNNEDGIFNANMYLAEDRILCFELIAKKN
                     EKWILKYIHSAGAYTDVPERIDDFISQRRRWLNGSFFAALYSVCKFFKIWSTNHSFGR
                     KIMLQVQFVYQLLNLLVSFFSLGSYFLVFRILSCYLAEPSVKFAPGNILSVFFLWLYM
                     ASLATTFVLSFGNKPKGTRMFYLIIVVFFAILMCYMIFASILLSVQSFEEIIGDKDFS
                     WDFIFVKTQFRNLIISTLSTYVLYLIGFIMFLQPIHMFTSFIQYLLLSPAYVNILNIY
                     AFCNMHDISWGTKGQDKVNDLGVAKKGSSDKDELEIVIPTTKYQIDEGYSSMVKELMV
                     PRDSGNNNTEINLDEKTVFYFAFFRSMAVLVWMFSNFILVAVVTETGGLSQLFPNSDS
                     ESDSILPEKQSFIFLSVILYIVAFMALFRFLGSSIYLIQRGLNKIGYRT"
     gene            complement(<37260..>38027)
                     /locus_tag="C5L36_0D00250"
                     /db_xref="GeneID:40385113"
     mRNA            complement(<37260..>38027)
                     /locus_tag="C5L36_0D00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466901.1"
                     /db_xref="GeneID:40385113"
     CDS             complement(37260..38027)
                     /locus_tag="C5L36_0D00250"
                     /note="PKUD0D00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322761.1"
                     /db_xref="GeneID:40385113"
                     /translation="MLFNAGIMNSMMYGTSKRTPLLFRQFHISRNVLEKIKMGEDQEK
                     YFVPNNGEEYQIRYRTHGNSFYSQRLDKKYRLGNTPIYQNPLINFVIGSKRLSLAFGA
                     VGCVFAYLMDRTGLVYTEISQLVAIFSLLPFPAVTYLFDPVVARVWRIYDTTKPQVYE
                     NLVADEKIVLEKLNWNGFRTYNELVRVDSLHVPKGKNDYRGRFGFVNLFSYDEKLKST
                     KYYYINDGFTNFKMERIIALAEKRSGIKNSGRSFYGF"
     gene            <38365..>40026
                     /locus_tag="C5L36_0D00260"
                     /db_xref="GeneID:40385114"
     mRNA            <38365..>40026
                     /locus_tag="C5L36_0D00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466902.1"
                     /db_xref="GeneID:40385114"
     CDS             38365..40026
                     /locus_tag="C5L36_0D00260"
                     /inference="similar to AA sequence:RefSeq:NP_014210.1"
                     /note="PKUD0D00260; similar to Saccharomyces cerevisiae
                     YNL189W (SRP1); ancestral locus Anc_2.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322762.1"
                     /db_xref="GeneID:40385114"
                     /translation="MDSADSSRYVPDYRKANFKNKNRFQADEVRRRRETQQVELRKQK
                     REEMLSKRRNFTGNEHISGLPESDDEDAASTDEYNNDQMFYTQLQQELPLMIQKINSG
                     NLEDQLEASIKFRQILSKENNPPIDLVIESGVVPKFIEFMQTGPEVLQLEAAWALTNI
                     ASGSSEQTKVVVDSGAVPHFVQLLYSPSPEVKEQAIWALGNVAGDSSAFRDYVLSCNA
                     MDPVLSLFQSSKMSLIRTATWTLSNLCRGKNPQPDWQIVRSALPTLAKLIYSVDVETL
                     IDACWAVSYLSDGTQEAIQAVCDARIPKRLVELLGHESTLVQTPALRAVGNIVTGTDL
                     QTQIVINAGVLPALGPLLRSSKESIKKEACWTISNITAGNADQIQAVIDANLIPQIIR
                     LLTTGDYKTKKEACWAISNASSGGLSRPDQIKYLVSQGCIKPLCDLLAIADNKIIEVT
                     LDAIENILKVGEIEKEARNSNINENAVFIEEAGGAEKIFECQNNVNDKIYNKAFHILD
                     TYFGEEEDEGDMANYDTMQPQVSENGQQFGFGVDPKLQDGGFNFN"
     gene            complement(<40604..>41215)
                     /locus_tag="C5L36_0D00270"
                     /db_xref="GeneID:40385115"
     mRNA            complement(<40604..>41215)
                     /locus_tag="C5L36_0D00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466903.1"
                     /db_xref="GeneID:40385115"
     CDS             complement(40604..41215)
                     /locus_tag="C5L36_0D00270"
                     /inference="similar to AA sequence:RefSeq:NP_014209.1"
                     /note="PKUD0D00270; similar to Saccharomyces cerevisiae
                     YNL190W; ancestral locus Anc_2.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322763.1"
                     /db_xref="GeneID:40385115"
                     /translation="MKFSTVLNSALLATAVCAEAEAHTPTTTVTVVKSGAEVTHKFGR
                     FNNTHHETTTSSSSTGTHKFGRFNNTHHETTSSSSSTGTHKFGRFNNTHHETTSSSTS
                     TGTHKFGRFNNTHHETTSSSTSTGTHKFGRFNNTHHETTSSSTSTGTHKFGKFNNTHH
                     EQTTTTVYEGAAANAAVNPFVMKNSVVAWSAGAVGCAAAALLL"
     gene            <42197..>44386
                     /locus_tag="C5L36_0D00280"
                     /db_xref="GeneID:40385116"
     mRNA            <42197..>44386
                     /locus_tag="C5L36_0D00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466904.1"
                     /db_xref="GeneID:40385116"
     CDS             42197..44386
                     /locus_tag="C5L36_0D00280"
                     /note="PKUD0D00280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322764.1"
                     /db_xref="GeneID:40385116"
                     /translation="MANTRAPVASRGTPSTSSDLIADLNEHNIIPLIKRRRLTRSTYG
                     SVAEIPIVLDSSSSSSDEDDSDSDSGSDGTTSDSRAKNGNSDIKAMESEIGRHTTRAT
                     TTSNKRKNEPTNLPSVTVTTPQRQPISARFFSSNSISKTTSLSREKLISRVSAHNTDD
                     KPISDTQTLQNGKGVAKSAGLGNSGSNKKSKSEEATKKDGNVKNTNVSNTGIDSNHNR
                     NSNKINTTVEKLPVNTNSATNNSRKVDLNLKLDLDTVLKGDRLLKRSQKTANVNTHPR
                     NGQEQSNPMEREKPEAKSTNRAKTINELLNKNPPYSSSTKTSSTTPSTSPLPPPTKSK
                     IQQKPLKVDTVKAGHDYPASKTKKKEAEPALQKKESNIEIDYDSIKVRRDVYNTCCIS
                     CKKNGRAQYCNKQKPCDICVGKKLRHCSYSDNAKVIIQGKDLPRNVDGKLKKLVLTQQ
                     RLPLVRKDLDRSQSKGGILAVPSGVPKNVSEPIKPLGLLHSIKPSKIPQIRNVDIVEK
                     IARQNTTQATQAMVQNSSKSGEKSTKEDDHKAPFGETDESDDADEYSSEADVEEEDDD
                     ADADEDEDDDEDDNTNDFESEDDEYDEHEEERRRKRRGSRSRAKERKSTTPADEFSRA
                     ERMLRELEFEKRDMNDIFTTRRRRAATKENYYIPSDVDEEEDLDNGYAMAEARNEQVI
                     LSEDEEERRMLRGDIDMSYLQSLRLEREKQAQHESSDSLSSDEDIEL"
     gene            complement(<45437..>46453)
                     /locus_tag="C5L36_0D00285"
                     /db_xref="GeneID:40385117"
     mRNA            complement(<45437..>46453)
                     /locus_tag="C5L36_0D00285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466905.1"
                     /db_xref="GeneID:40385117"
     CDS             complement(45437..46453)
                     /locus_tag="C5L36_0D00285"
                     /note="PKUD0D00285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322765.1"
                     /db_xref="GeneID:40385117"
                     /translation="MGQKYRTMFGDKIAVDVERGEIYKDEHKDRGHILRIVSFMYMLI
                     LGAIVTRFCITGDLFSQTMAKGLPVPPKHNFEVPFTDFKSVGSSMEAETKYQSAPDHW
                     KGHCGQQFERMYDLNITSGMAYDRLGNFANVTLVNHDFYGPLIEASVGDTLIIRVNSH
                     TDNATVKMELDGDFSSTVETVDATYIFKLQIHEHNAGTFLYRIQSGDASLCIGPLIVH
                     SPCEDSNIASYSSDFTFLLTTDNIGNTEDSLSHFLKFHHGTTRIRLINTDPMKFLNFS
                     TKTRKFEVVESKGEFMKPIFTKTLRIDPNGTYSLIFRRTSILGKISAKASIIMKKFQF
                     PAWS"
     gene            complement(<46880..>48904)
                     /locus_tag="C5L36_0D00290"
                     /db_xref="GeneID:40385118"
     mRNA            complement(<46880..>48904)
                     /locus_tag="C5L36_0D00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466906.1"
                     /db_xref="GeneID:40385118"
     CDS             complement(46880..48904)
                     /locus_tag="C5L36_0D00290"
                     /note="PKUD0D00290; Pfam Domains:
                     Pkinase(6.9e-66)|Pkinase_Tyr(2.6e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322766.1"
                     /db_xref="GeneID:40385118"
                     /translation="MTDQSKIPLRPESSVRLSFNERNLNQYATPTNKRFSLASVNNKR
                     LSRIPIPVQSSKNLNMLLNNENMNPEILYKRSSMVIHPTTQAENTSVEDVNLSRFAEM
                     SLDGSRIPRSPSTNNISRTPSLNKRHSMIMETPQKKSNRNRIPHLNIIHDTPTKRSIN
                     RDRCSDLGPSNSKLKFNYLTSTKTDYIHKPAENRHSGIWKESRKESLQPLVYLSSTNN
                     YVKTNKVKVRDLDELKYLLNVSSNLKEKFANGTMDADPDENVPSYKYDELSTKRPDLF
                     EKLNMYERIMQFREVYFTGISKELKIKVELSNSKDNYGFDDKERNYKIIIGDHIKYKY
                     EIMSVLGKGAFGSVVSVADHSHGKRPIYACKIVKNDPKCSLQAVEEIKLLKKLNHGNI
                     LKYHEHFQFRSHMCIVTEILGISLYEAIQETKFRGFSLGIVRKLTYEILKGLSYLHLQ
                     GVIHCDLKPENIMFSNQLDIKIVDFGSSCYIGKPRYSYLQSRFYRAPEVLLGGRYDSG
                     MDVWSLGLISLEMFSGTPIFQPQSEWELFTLLIEYLNVPSRRFIMRLREEIQQYGVVG
                     FDAQNNNYEAHYYRNNTLLWKAFDDKGGLNHEYVVRKSRSTNKFKPGSKSLKRFIMKN
                     RDEQLIETGEADILLLQYLEFIEGCLVWNKATRKTASQLLESPFFHMDEE"
     gene            <49185..>49685
                     /locus_tag="C5L36_0D00295"
                     /db_xref="GeneID:40385119"
     mRNA            <49185..>49685
                     /locus_tag="C5L36_0D00295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466907.1"
                     /db_xref="GeneID:40385119"
     CDS             49185..49685
                     /locus_tag="C5L36_0D00295"
                     /note="PKUD0D00295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322767.1"
                     /db_xref="GeneID:40385119"
                     /translation="MDEASFAVEKIPTDIQLLLCQLVLDAKSDTTWADIVERINSHPI
                     VTRLHRSDYAGNQIADSNVANFVSKVIIHTLKQEGTMRPRGRKKTKIMDNDDGIDNEK
                     CTDICYYQIPEGTEDNSKNTGNGRHLLQKAISILHQRRIDEIHQQLSHHKKAFAKLLR
                     EAESIG"
     gene            <49756..>51705
                     /locus_tag="C5L36_0D00300"
                     /db_xref="GeneID:40385120"
     mRNA            <49756..>51705
                     /locus_tag="C5L36_0D00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466908.1"
                     /db_xref="GeneID:40385120"
     CDS             49756..51705
                     /locus_tag="C5L36_0D00300"
                     /note="PKUD0D00300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322768.1"
                     /db_xref="GeneID:40385120"
                     /translation="MRDFIHHENIVFVSRDLLASVVFSWPVVCRDSTQFMVCKKMGKD
                     TVNSDPDRACIEKLQKFIESTDVSALESMSYAEKLQYVLSSKDFMSNMAAGLLVDNKK
                     TLYTSSKSLEPHYIKNIETSDNSCVTEPANTLNNSNSFLNEFSKEEKLEIQKKLAIYD
                     RTLKMTLEAIKNGKISEDIINSSLSSDHLTQSSEERARIYRTQKTQNHIASQNLPSDT
                     DVNILLKNIESNNVRKLKVDDNITVSLESADKQFEADDKPNKNPDEYIEQMVQIINQD
                     KKFDNFLEEVSKLENFNKQDSVDTEETSKYYDTTLQKANRKDELVFRHDQLSDIESEK
                     VFRKMINTHIIKALESFKLDEGMKKDISGTIAKSIENNTMFHGKNDDRYLGSKNDEVP
                     IEGFADDMKEFQKAYAEQLKDMNFEEMANYLQKCGTEQNILKQEDDEQKNLHHEQHKL
                     ERQLPEGQQKHQKNDDVYQIHVNGPAYVATSDSLNEADLGHDFSNYYSDKYMRPTLEE
                     RQRLQKECLERLHIHPDDGTKKSKKKKKNKKRSSAVSAKSINHIGLNDPHNDTWLCEL
                     CEYQIVYGEVPIFLTEWLQKKTHHHDKMESYQRYLMQQRKERKKEQEQEGNTRNEKHT
                     SHVHQHRVLDEHGNYSTPDNPKTSI"
     gene            complement(<51795..>53687)
                     /locus_tag="C5L36_0D00310"
                     /db_xref="GeneID:40385121"
     mRNA            complement(<51795..>53687)
                     /locus_tag="C5L36_0D00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466909.1"
                     /db_xref="GeneID:40385121"
     CDS             complement(51795..53687)
                     /locus_tag="C5L36_0D00310"
                     /inference="similar to AA sequence:RefSeq:NP_014124.1"
                     /note="PKUD0D00310; similar to Saccharomyces cerevisiae
                     YNL275W (BOR1); ancestral locus Anc_1.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322769.1"
                     /db_xref="GeneID:40385121"
                     /translation="MSTKSWFSKKKTKYKNNEIFHIRHFGRGIYYDIKNRLVSYYISD
                     IKEGLTYRTIPSTIYIFFTNLLPAIAFAQDMFDHTKNSYGVNEILLSSAMAGIIFGLF
                     SGSPLCIVGVTGPISIFNYTVYEIIEPKGIPYFPFMCWICLWSMLFHFLLAFTNAVNF
                     MRYVTKFSCDVFGFFINIVYIQKGIQILSNQFEKGTVASGFASVMVALLMGIFGISAQ
                     FFGSKSQYLPYKIRTFIRDYSTPLCVVFFTGFIHFGGYLNNVDFIKLPITKTFRPTDT
                     VNRRDDWFIRFWEGVTVGNVFLAVPFAILLTALFYYDHNISSLICQSSEFPLKKPASF
                     HYDFLLLGITTGVSGLIGIPAPNGLIPQAPLHTHSLCVYEFDPKTGANIISKVVEQRL
                     SNTLQGLMTLGMMTRPLLVVLGTIPQCVLAGLFWIMAITTIDGTDVMKRLRFLFLNKE
                     WKKKLAQIVIADYRAEQERKAMSSLGNGCINYENESDVAFSRTRGDIPSTECSSRKEN
                     TSTTEEKVEHIVPADFPYEYYITEPKYFIIYLVFELLAFAGEYSITCTKGAIGFPGVL
                     ILILVLVPIVFPRVFPKEQLDLLDSEAADELILESLKLKKQTSETENVSSIDYELGHL
                     NSMTGR"
     gene            <53930..>55231
                     /locus_tag="C5L36_0D00320"
                     /db_xref="GeneID:40385122"
     mRNA            <53930..>55231
                     /locus_tag="C5L36_0D00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466910.1"
                     /db_xref="GeneID:40385122"
     CDS             53930..55231
                     /locus_tag="C5L36_0D00320"
                     /inference="similar to AA sequence:RefSeq:NP_014844.3"
                     /note="PKUD0D00320; similar to Saccharomyces cerevisiae
                     YOR201C (MRM1); ancestral locus Anc_8.611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322770.1"
                     /db_xref="GeneID:40385122"
                     /translation="MRFLLPQLILIRFFTTPFSLKPLFFPPSTGIMYTNCLSYSSKVL
                     CSLRHMSTGPKAPFSTPHVKDRSAVSFEKNMPQFVKKKAWEKTGEDKESYFKRKHAHH
                     HVLQAPHRELTELKYKSFEEKNKRERQEIIRQREEYRQSKLKFRELKANPSVDYIFGT
                     NSVLAALQGKKREKFGKLYIYNPKETNKVNELLSLAKELHIPITETSKQDLNQLTDNA
                     VHNGVVLESRPLDIPNVKSMTSNFTESSFEVVSGDDLLQLNEKVGYHTNAYGKRYPFG
                     LYLDEISDPHNVGAVLRSAYFLGVDFILFSERNCASLSPVVAKASSGALEFIDMFKVD
                     KPLHFFDESKKHGWKFVSTVAPTDSRNKNKHVNPEAVSDLLQESPVILVVGSEGTGIR
                     TNLINKSDFMVAISNGREMNACVDSLNVSVATALLISKILP"
     gene            complement(<55403..>56524)
                     /locus_tag="C5L36_0D00330"
                     /db_xref="GeneID:40385123"
     mRNA            complement(<55403..>56524)
                     /locus_tag="C5L36_0D00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466911.1"
                     /db_xref="GeneID:40385123"
     CDS             complement(55403..56524)
                     /locus_tag="C5L36_0D00330"
                     /inference="similar to AA sequence:RefSeq:NP_015207.1"
                     /note="PKUD0D00330; similar to Saccharomyces cerevisiae
                     YPL118W (MRP51); ancestral locus Anc_8.613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322771.1"
                     /db_xref="GeneID:40385123"
                     /translation="MFKGVQGTSTLGKHLKNTKISQFQASIGDRVLNANKDFPTHQII
                     EAPLASFSRRDFGLKMRIPKKIKTRRIIVNDLDNKYGLPNFETLNGDYFKKLRFKELG
                     VPVTAKFYDSQTEKMLRERSEEGKNASVNKNPLFESSKQYFVPNSIADLLHIRNQPLN
                     SSNFTRHIKPELKSLRRPFLTWLATNYPSSLVSNDLTLLFKKFIETEKPQLLAKSKDY
                     IPSTYSESLSGTAGLGYNLKGRLFQTPNGPQKSRLVPGRLVGRGDNGAKFAVGGFITS
                     LRTRGNDQTYQRLLLQNRTNQDNKFSREVQVPGSITQVTLDLKNRQLNFDSTAITKEN
                     NSSKFKPLSSKNRNNSFSQDAGFLDILNLLQSPTTPKSE"
     gene            <56940..>59762
                     /locus_tag="C5L36_0D00340"
                     /db_xref="GeneID:40385124"
     mRNA            <56940..>59762
                     /locus_tag="C5L36_0D00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466912.1"
                     /db_xref="GeneID:40385124"
     CDS             56940..59762
                     /locus_tag="C5L36_0D00340"
                     /inference="similar to AA sequence:RefSeq:NP_011336.3"
                     /note="PKUD0D00340; similar to Saccharomyces cerevisiae
                     YGL179C (TOS3) and YER129W (SAK1); ancestral locus
                     Anc_8.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322772.1"
                     /db_xref="GeneID:40385124"
                     /translation="MGNKRDISTQYKLLEIIGRGKFGTVHKGYNVDTKQVVAIKILNL
                     DTDHEEVKDIQQEIQFLSSLKSVPNITHYYGSYLKGHKLWILMDYCAGGSVRTLLKPG
                     PLQEKYISVITRELLIALQFIHEHNVIHRDIKAANILISKEGRVKLCDFGVAAQLSST
                     ALKRTTMAGTPYWMAPEVITEGATYNVKADIWSTGITIYEMATGNPPYSDKDALRAMQ
                     YITQHEPPRLEGRQYGPLLKEIISICLEEKPDVRPSAEELLKTKFIKNGKGYPTTLIK
                     EVIGKYLVWRDNRAENNSHEDSPNGNTDREPTNPNEVGRPINDNNINGDGLTELEMSS
                     TVSIAETTTSQGEGENIKWDFDSLKSAEFISENNIHLHGEETSKFEDFAFEANMNTNR
                     EFTTSPYNRTFTIGNTMINNGISNNKHLINTATTNQLDSIINSQVELPSMREPPKALL
                     ELFMEDAEYTGTSNNNPRNNSNNAKEYNNGYPDYDQNPLADLNMKKVEKPISISNPPQ
                     SEPSIPSRQQISSPLVSIEIPNMDVIENEIQEREKQRSRSATVNLMPNSHNNSNVTLN
                     PSLPKVESFISDQPLPVRKPTMSMPHRTPSPARALEQLNTNLQSSPSKQSSPLHMKPL
                     SVTISQPLLQPLNNSSNKNKLQINLASIPNNKSATSSGPQTAPITSSTNAELLDSSIR
                     QRSQMRIQMPVPVSATVGSFSNVFKENNTRQGSEGTDVNQFGFEVNSSSIPLAMTPVT
                     EKPFFPNNTTTPEKELSRGESNPSHGSKISSFTSTSNSQLSKPFERKSSMESSLKYQP
                     FSLQSTASVDNHYFSNQHSDNDKNTSIESDDYEKADVTLTNENISSNENAVTGLGMTT
                     LNDSNKAVSQKNISEQHNFLAQDKLHDILTNTYMDINIISGFGLSINGSENDDEKQTN
                     EIYTAEIDNLLRNMGDVLDILITGLR"
     gene            <59950..>61278
                     /locus_tag="C5L36_0D00350"
                     /db_xref="GeneID:40385125"
     mRNA            <59950..>61278
                     /locus_tag="C5L36_0D00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466913.1"
                     /db_xref="GeneID:40385125"
     CDS             59950..61278
                     /locus_tag="C5L36_0D00350"
                     /note="PKUD0D00350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322773.1"
                     /db_xref="GeneID:40385125"
                     /translation="MASHVLFTWDERSFKNKTSEKDGLLYTRIAVSEKIKINNANDPL
                     LQHLKHETISNHGNTHFKGLTYRLDILSINEVNFEQYSSTITEGNLEKINNNGLLKDM
                     GIDNLYLWVYGLLVEGTYNNEKLYRFELLETLGELNWTIKYLYEGLFRAVLSVRLDKC
                     GDVNMDEYFLEDLQELYRKDLLNQQKERIWNSERRHLMEQIHLLESRTEIDKLREDVR
                     NMRKLQLAYFIPLINEYNNEIRQLKRQLDSNSDSLFINSRKRCTTSNTSLSKDVEVVD
                     EKKSSSDFDGNDQIFLRDRDKRMKIISVEDKHTQQAFEGGECGVITIKDEEYSRRDNR
                     SPKYNTTSRKRIVSHDSNRSSTAPQQSISMEVAETQRDSPEEPLPSFAVQNVIVLDSL
                     TQPNAQLNERSVFSDKELSSSKQSLKTAATVVSDDEGTDISTDDSTDISE"
     gene            complement(<61310..>62701)
                     /locus_tag="C5L36_0D00360"
                     /db_xref="GeneID:40385126"
     mRNA            complement(<61310..>62701)
                     /locus_tag="C5L36_0D00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466914.1"
                     /db_xref="GeneID:40385126"
     CDS             complement(61310..62701)
                     /locus_tag="C5L36_0D00360"
                     /note="PKUD0D00360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322774.1"
                     /db_xref="GeneID:40385126"
                     /translation="MNNAISQVSPCTSVSCLSVHVPPQRNKSYCVVKDLQILNNGFKS
                     KNLNGPTSIQFDNNPQLCFAGELDISFSTLEENRTSSHSHLSTSSVSPNSIFTVSPSL
                     KSAYTMRRNSSLRYLQRKNSVYSFSRELRMNTYNLNSKSTSPVSSRRTSVLVCQFDLG
                     PNDPLSFTSNLCQGKKDCYFEIEKAPIRKPQLTSNLKIPPLCIGYSIKPKFTCFIDRL
                     QSRLAKHSYTIPHSRCRCHCDIPLETFSLHSEALPTMHENIELATKDPGDYHPVTIPG
                     QIKRCREERVNSKYLLQYAIYTSNEIHGYFRDITMEDIDIFDELLIDTYSIVAESMKV
                     ASIEMFFDDCFTCKLRRKFESRGLLKEIDKELIDNLRLASVTRFKLWNTATLHPRCDE
                     IPSINRITDDVYSPFSVETCRVPWLSITDLKEGKAINRLNKKAGLLKGSNIQFVLKNC
                     SSKRWIPTNANSL"
     gene            <62966..>63967
                     /locus_tag="C5L36_0D00370"
                     /db_xref="GeneID:40385127"
     mRNA            <62966..>63967
                     /locus_tag="C5L36_0D00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466915.1"
                     /db_xref="GeneID:40385127"
     CDS             62966..63967
                     /locus_tag="C5L36_0D00370"
                     /note="PKUD0D00370; Pfam Domains: Pkinase(1.2e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322775.1"
                     /db_xref="GeneID:40385127"
                     /translation="MDWARRVLGRPNKDGGDGRRRNSLRKFPERQYGVQRRILGQGSS
                     CKVFLYEKCGEKSLFAVKTFTRSDLKDEDQIRMIEKELLIHRLASHEKYTVKLIDAFT
                     VKKKMDFFIVLEYMPCSLADLYNTYKALLPQTDRLCYFKQIVEGVMYLQSKDIAHRDI
                     KLENCCIDTRGNIKIIDFGSSTLGNLGYGMAGSPIYCAPEIQNSLSYNSFVSDVWSLG
                     IILVNLFYVSTTKWKTAHRNDRFYVVYLKEPIMKNVVNSLAGDLSSEFVSLQPAVDDI
                     ILKLLTVDVTHRITLQQLTQNELWFNEISCCTDTNHENGSPPLIHSHSLFLNRLSSL"
     gene            <64161..>66149
                     /locus_tag="C5L36_0D00380"
                     /db_xref="GeneID:40385128"
     mRNA            <64161..>66149
                     /locus_tag="C5L36_0D00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466916.1"
                     /db_xref="GeneID:40385128"
     CDS             64161..66149
                     /locus_tag="C5L36_0D00380"
                     /inference="similar to AA sequence:RefSeq:NP_009819.1"
                     /note="PKUD0D00380; similar to Saccharomyces cerevisiae
                     YBR260C (RGD1); ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322776.1"
                     /db_xref="GeneID:40385128"
                     /translation="MSDQVPPSSPALLEEDKIKEILVSDSSFSILAQRLKQSIRACEE
                     FSSFISRKCHAEQKYSKEIGRIVNHCDHSIVSNNVIVGGSFIESLKKVIHFDEKVNGV
                     KDPYITALQTMADQLEALVQHFTMLRKQLKERGNKAEKEVMDAISMAKKARNRYFNLC
                     TELEKVRSADKNQTKITLQGRKTNSQQDEDLKIKIKDAEDDYNKKANASQRLKNSLIT
                     RERPKIANQFKNLIIELDYAMQIQLQKYSIYTESLVVGMGNQINPINGSDSMKKIATN
                     VDLEKNLYYYLKGSTQRKNESLEPVEFKRHPIVGGVLPKPATKSSTSKPRNFSTNSKA
                     ATSSGVPPPVSSQNLSVTPIHNSTFNDSTKGNLKASEISTGGNGQQYSSLISSKSTLP
                     PIPTLDMEDPSLAKSYNSLDPGRSPQLKGPRPFDSDHNDSTASFGDNSMNFDSTNGYM
                     LSTDSLGGHLFGLPLEALDLNEEAVPLFVIKCIELIEKYGSNTEGIYRLSPNKATFDE
                     LKHAINMNPQNLSLLEPKNPNNVSSEYVYMISSLLKRFFASLPEPLLTNEQRDYYLQA
                     AELSDKMERQTKVHQLIFELPDSNYFTLRDLLGHLRRLSQLPTVRMDSKNLSIVWANN
                     LLGGDFDSKEELEIQSRVVEDLIEFAPSIFTYEDEEGE"
     gene            complement(<66327..>67427)
                     /locus_tag="C5L36_0D00390"
                     /db_xref="GeneID:40385129"
     mRNA            complement(<66327..>67427)
                     /locus_tag="C5L36_0D00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466917.1"
                     /db_xref="GeneID:40385129"
     CDS             complement(66327..67427)
                     /locus_tag="C5L36_0D00390"
                     /inference="similar to AA sequence:RefSeq:NP_011053.1"
                     /note="PKUD0D00390; similar to Saccharomyces cerevisiae
                     YER127W (LCP5); ancestral locus Anc_8.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322777.1"
                     /db_xref="GeneID:40385129"
                     /translation="MSLTNQESLDDLLLSISESVDSTASVLGKIENDFDLNNTEIQNE
                     LVNSLVKTLDLSSNPLDSLSLLSLKNSALLGYVTDLALLMALRLKSLKEQDKNSLNQE
                     RDNLLKSTVTNRVVLEKGVKSLENKMSYQLEKMVNAYHRREKEQDDVEKKINENNASD
                     VGDVGSSSEGSDGGEEEEEEEEEEEEEEGLNFKPNPSALLNRKNQNVNSGKTMAGGDD
                     NEGEAKSNEKYRPPKISATAINDPDKQVKGRKQRNLQSMDEYLQDISEAPSMEKSIGS
                     TIINNGRDMKSRKQMEKEAEIQRYEEENFTRLPATKTKEDKRARAKRMRNEFMGEDWS
                     MFDNNMNPDEASGAKKRKRLSAWERAKRKIDH"
     gene            <67678..>68463
                     /locus_tag="C5L36_0D00400"
                     /db_xref="GeneID:40385130"
     mRNA            <67678..>68463
                     /locus_tag="C5L36_0D00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466918.1"
                     /db_xref="GeneID:40385130"
     CDS             67678..68463
                     /locus_tag="C5L36_0D00400"
                     /inference="similar to AA sequence:RefSeq:NP_011052.1"
                     /note="PKUD0D00400; similar to Saccharomyces cerevisiae
                     YER126C (NSA2); ancestral locus Anc_8.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322778.1"
                     /db_xref="GeneID:40385130"
                     /translation="MPQNDYIEQHIKKHGKRLDFDERKRKREARESHRIAKDAQSLKG
                     WKGKQFAKKRYAEKVAMKKKIKAHEESKLKGPSKPKEDDGEALPTYLLDRQQQNTAKA
                     ISSSIKQKRMEKADKYSVPLPKVRGISEEEMFKVLKTGKQKNKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVVHPELGVTVLLPILAVKKNPQSPMYTQMGVLTKG
                     TIIEVNVSELGLVTAGGKVVWGKYAQITNEPDRDGVVNAVLLV"
     gene            complement(68652..68724)
                     /locus_tag="C5L36_0Dtrna9R"
                     /db_xref="GeneID:40385795"
     tRNA            complement(68652..68724)
                     /locus_tag="C5L36_0Dtrna9R"
                     /product="tRNA-Arg"
                     /note="PKUD0Dtrna9R; codon recognized: CGG"
                     /db_xref="GeneID:40385795"
     gene            69331..69402
                     /locus_tag="C5L36_0Dtrna7Q"
                     /db_xref="GeneID:40385788"
     tRNA            69331..69402
                     /locus_tag="C5L36_0Dtrna7Q"
                     /product="tRNA-Gln"
                     /note="PKUD0Dtrna7Q; codon recognized: CAA"
                     /db_xref="GeneID:40385788"
     gene            <69740..>71002
                     /locus_tag="C5L36_0D00410"
                     /db_xref="GeneID:40385131"
     mRNA            <69740..>71002
                     /locus_tag="C5L36_0D00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466919.1"
                     /db_xref="GeneID:40385131"
     CDS             69740..71002
                     /locus_tag="C5L36_0D00410"
                     /inference="similar to AA sequence:RefSeq:NP_012872.2"
                     /note="PKUD0D00410; similar to Saccharomyces cerevisiae
                     YKL052C (ASK1); ancestral locus Anc_2.588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322779.1"
                     /db_xref="GeneID:40385131"
                     /translation="MSAMSEETESRDLMEDEMQRQKRLLEVDLMERDETDTDQQPRLS
                     FFFDSNSLKSSTNRENILSEIDRVEQLVTLNLQKINENIVLSNEVITNQLVPKLEMFN
                     KNSNKIYNNITHIKEFYENAANVNILTKKDVDIDEEEEETEGEKPEGSGNGGDTGNEE
                     EHAVSAEGDNDTRFSGAALHGGVSPERVDRDGGGVLARGESNTEMEVSCSSFEFGEGL
                     ADGEDRLVVEQSEANEVTKGNTSMQRDGLSMDTGHPQHVRLHSDTIIRGFKLGMDDES
                     TVKTTAMDATEGVSSIRDLPGPLTELKEMSGYESPEWEEPPELQSTKFSNKRRKTQRR
                     NRTRDAAVFGSDETTTKSLGLTDRFSTLKDIDMDTSEPTAANPFQSPKNGKEEKVVVE
                     EEEDDDVLTSSSFEEAPELLSEHLGRRP"
     gene            <73191..>74831
                     /locus_tag="C5L36_0D00420"
                     /db_xref="GeneID:40385132"
     mRNA            <73191..>74831
                     /locus_tag="C5L36_0D00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466920.1"
                     /db_xref="GeneID:40385132"
     CDS             73191..74831
                     /locus_tag="C5L36_0D00420"
                     /note="PKUD0D00420; Pfam Domains: Amidase(1.6e-63)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322780.1"
                     /db_xref="GeneID:40385132"
                     /translation="MHYKEVAADKVQSLLTKIPHEWILTSIPSVEEQRDVDGYINRFI
                     PERERSITEMSASQLLELQQGGKLSAYEIAFAYCHRAALIHQMTNCCTEIFFERAFQS
                     ARELDSYLATTGNLKGKLHGIPISLKDQINLPGVTTAMGWIAPHVSPELELKVARKQS
                     TNDISLIAEILQQEGAVFYVKTTVPMAMLGNETSTNMTVTYNSLDRKMSPGGSSGGEG
                     ALLAAKGSLIGIGTDIGGSIRIPSLVHGLYGLRGTTNRFPYLDISNSYPNQLCVPSVV
                     GPMARNIDDLILVSEAILSNGLCVRDPKCVPIKWDSGKVTDFKEKIRIGVLKSDGEVL
                     PHPPILNNLEKLESHLLKHNDLFEVTKLKECEMPVKFSDLGNLLLSLYNCDNFEEIKE
                     FCKLSGEPLPELFTRSFTAPNHMDNVSEFFDKAGLKLRYQRLFDDWLRDLDCFIIPSY
                     SATCWRIGENANISNFYTRALNVLDYTVMTFPVGRVTENDVSYDREFFNESDKKNWNY
                     YNLDDCLGKPVNVQLVCKRYKEEECCKIVKKITELLQH"
     gene            complement(<75147..>76214)
                     /locus_tag="C5L36_0D00430"
                     /db_xref="GeneID:40385133"
     mRNA            complement(<75147..>76214)
                     /locus_tag="C5L36_0D00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466921.1"
                     /db_xref="GeneID:40385133"
     CDS             complement(75147..76214)
                     /locus_tag="C5L36_0D00430"
                     /inference="similar to AA sequence:RefSeq:NP_013157.1"
                     /note="PKUD0D00430; similar to Saccharomyces cerevisiae
                     YLR056W (ERG3); ancestral locus Anc_8.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322781.1"
                     /db_xref="GeneID:40385133"
                     /translation="MDLVLEVFDTYLFDRAYATLLPKTVAPLLPEPPLLLTKIVETIN
                     NNTDYSTREIYGFNEKYHFFDETVYANLSLLPRYNILRQVISLFLITSTFGWLLYFTV
                     AWLSFHFVYDKSNFNHPRYLKNQISMEIKQASTAIPIMVLLTIPWFIAELHGYSYLYY
                     DINESTGGWKAIILQFPSFLLFTDCGIYFIHRALHWPSLYKNLHKPHHKWIVCTPFAS
                     HAFHPVDGYAQSLPYHIFPMLFPLHKVSYLFLFTFVNFWTVMIHDGEYMSNDPVINGA
                     ACHTIHHLYFNYNYGQFTTLWDRLGGSYREPDAELFDKDKRVDKKTWEKQTQLMDQIR
                     EDVEGKEDYRDYVSSDSKKTQ"
     gene            <77196..>78758
                     /locus_tag="C5L36_0D00440"
                     /db_xref="GeneID:40385134"
     mRNA            <77196..>78758
                     /locus_tag="C5L36_0D00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466922.1"
                     /db_xref="GeneID:40385134"
     CDS             77196..78758
                     /locus_tag="C5L36_0D00440"
                     /note="PKUD0D00440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322782.1"
                     /db_xref="GeneID:40385134"
                     /translation="MLSNTTRIINKRSIQIGLSSTIKRWNSSQKDTYKVNEYSNFPED
                     AADATSTILTDAIDFQRRIESKQRVTWWEILEKDRLRKQEGKNIDSLTMDDVKTEKVI
                     EKTREDSFSFIPLPFKDDLSLRDFYINAPGRLRFGHLFQDLDGLAGRVAAKHCKPAEP
                     MNVTASIDRIYVTKTIDEIDKYNFLIVGYCSYTGNSSMEISIKGYAYEDALPDSHSIT
                     PKIVETAASKCFLSANFTFVARNPATHKAHKINKLLPTNELEWIEYKRAESHNAAKKL
                     RAKVSALDKNPPTADESKIIHSLYNSSKKIFQIPKNERPKNLKLMKDTKLSATQIQQP
                     QYRNRHGIIFGGYLLRQTFELAYCAAGAFSRSYPRFISLDNTTFKAPVPVGCVLSMEA
                     EVCYTEHIHDVEEDANSANVISKLMKDYDTSANKMSKNDKELLSSPGTLIQVKVDTKV
                     NDLSDATTSTPSGTFVYSFFVPRDVDGFDNPGYCSVVPESYGEMMDYVEGRRRAYDTA
                     AYAEQLRLTGQE"
     gene            complement(<79009..>81375)
                     /locus_tag="C5L36_0D00450"
                     /db_xref="GeneID:40385135"
     mRNA            complement(<79009..>81375)
                     /locus_tag="C5L36_0D00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466923.1"
                     /db_xref="GeneID:40385135"
     CDS             complement(79009..81375)
                     /locus_tag="C5L36_0D00450"
                     /inference="similar to AA sequence:RefSeq:NP_012126.1"
                     /note="PKUD0D00450; similar to Saccharomyces cerevisiae
                     YIL140W (AXL2); ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322783.1"
                     /db_xref="GeneID:40385135"
                     /translation="MNPLGIVLLLLSAIATANPYVGFPFSQQLPNIARVGENYQFTIN
                     EQTFKSDSNSQITYSVYELPSWLHFDTSSLTFSGLPSDADKLGTINFILEGADNQGKL
                     NQSCSIVLSDQPAPILNEKELVIQQLGDIGTTNGYNGIVFKPQEPFKITFDKSTFQIP
                     SSSSNHIVTYYGKSANRTSLPSWCFFDEDSLTFSGTTPPVNSVNAPSLEFDLTLIATD
                     YNGYSAAYTDFNIVVGGHQLFINGTYNSSVMVNPGSKFDVDLPLNLIYLDNQVIDTSQ
                     IDRIENSNGPNWIQITDKSKLVGDVPEDQTDNIVANITLFDIYGDSVFMNFDINVLHE
                     IFNVNSLDNVTVSNGKFFEYTLPDSIFHNKTATELDVVFSDEWLTFYHSNNTFIGKVP
                     SNFQNSKITLNASINSLKQSLSFYLIGNPTKSSSLYSSKTSSFSSRTSGSSSRNRSSS
                     TTKLSVLKSSSSPSSSAYTSTSAGYYSSSSSPSSSSLVSPIMSKSSNTKGLAIGLGVG
                     IPVGVIILAAILFFFCCFRRRKNKDDSDVDDTNNDTYINDNEKGFLPKDNNSFLSSDT
                     LNGSTKIMAANNLSNLEKDSDVSSYYSTNQSTLNDGTLYQAANTQMSTDQLLGNDSDP
                     VVTSKSNANKSGVFNSWRKSSSNLKTRDSLNSLATVATNDLLTVNVVNDDRVRKSQMN
                     LPSISKLRNLSSSSSSLYNSSYTNTPTNLTFSNSSSNHNSKEFNSNLETLRENDLSRE
                     SSYNTLSSNPQLVEFNESGSLSRKIIQREEKSYQGELYNVSDDISNHS"
     gene            <81990..>82244
                     /locus_tag="C5L36_0D00460"
                     /db_xref="GeneID:40385136"
     mRNA            <81990..>82244
                     /locus_tag="C5L36_0D00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466924.1"
                     /db_xref="GeneID:40385136"
     CDS             81990..82244
                     /locus_tag="C5L36_0D00460"
                     /inference="similar to AA sequence:RefSeq:NP_012870.1"
                     /note="PKUD0D00460; similar to Saccharomyces cerevisiae
                     YKL053C-A (MDM35); ancestral locus Anc_2.587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322784.1"
                     /db_xref="GeneID:40385136"
                     /translation="MGNIMSTSFAPECNELKEKYDTCFNTWYSEKFLKGKGLQNECET
                     FWDDYKRCIDIHLAKQGIKPMLDEARKELPLENEGKPRDE"
     gene            complement(<82485..>83126)
                     /locus_tag="C5L36_0D00470"
                     /db_xref="GeneID:40385137"
     mRNA            complement(<82485..>83126)
                     /locus_tag="C5L36_0D00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466925.1"
                     /db_xref="GeneID:40385137"
     CDS             complement(82485..83126)
                     /locus_tag="C5L36_0D00470"
                     /note="PKUD0D00470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322785.1"
                     /db_xref="GeneID:40385137"
                     /translation="MFKNRSTKKKSLSTVDNLLSTYLQTSDKKISKSVKHNASSILES
                     KAQSQKKRSKSEMKKFKLKERKLRNKNLKRNQILNEKIDMLTKLQNGDDKLINDLVAR
                     KIDALKRLDSITSDSDLQELQNDVLNLISKESTKDKLKNSNERDQLRARISKLDNFSE
                     KVSRGYISVNGLTPGLAQPGDDSDSEEDDDNYNQETQESSQLRNFRDDFDDYN"
     gene            complement(<83630..>85456)
                     /locus_tag="C5L36_0D00480"
                     /db_xref="GeneID:40385138"
     mRNA            complement(<83630..>85456)
                     /locus_tag="C5L36_0D00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466926.1"
                     /db_xref="GeneID:40385138"
     CDS             complement(83630..85456)
                     /locus_tag="C5L36_0D00480"
                     /inference="similar to AA sequence:RefSeq:NP_013670.1"
                     /note="PKUD0D00480; similar to Saccharomyces cerevisiae
                     YML042W (CAT2); ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322786.1"
                     /db_xref="GeneID:40385138"
                     /translation="MRLSKMARQLYKYQEKLPSLPVPPLQHTLELYKESIKPFYKDGE
                     RDTEYINYAAIIDKFAIDEGIKLQEKLIKFASNKRNWLAEFWDNYAYLEYRDPVSPFV
                     SYFFNHGDVKYKNVLSNDQLLKSTFIILKVLEFSKSIEDESLTPELVKNSPFCMESFK
                     WMFNNSRIPNAKRDINVKYDPKEGRFVIILSKGWVFKLFTHDSRNDEILSFNEIYNQL
                     IQIEKTCNLRGENPNPIGILTSSNRDEWFENYQILSSISSQNVSNLLDINKSLFVLCL
                     DDNSPTTIEEKSRNSWHGNGFNRWFDKPVQMFVSRNGNSGFLGEHSKMDGTPTLRMND
                     WLVEEMKNFKLSPSDLNRNDNIQSIELKFDINGKLSKEIQNQMVKFKETVGSLSIKTW
                     QYFGLGKNDIKLFKCSPDSFVQMLIQLAYYKYTGTLKPTYESASTRRFFKGRTETCRS
                     VSLEALQFVKDWENPTVPVERKLKSLDLALKSHNNYIRLASNGEGVDRHLFGLKQMVE
                     EQTPIVDKFFNNPIFNYSSYWYLSTSQLSSENFNGYGWSPVVPEGLGLAYMINSDWLH
                     INITAFKENPMNLKPEEMAYYLTVAVNELKDALSQKKLDPKL"
     gene            complement(<85983..>87191)
                     /locus_tag="C5L36_0D00490"
                     /db_xref="GeneID:40385139"
     mRNA            complement(<85983..>87191)
                     /locus_tag="C5L36_0D00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466927.1"
                     /db_xref="GeneID:40385139"
     CDS             complement(85983..87191)
                     /locus_tag="C5L36_0D00490"
                     /inference="similar to AA sequence:RefSeq:NP_013156.1"
                     /note="PKUD0D00490; similar to Saccharomyces cerevisiae
                     YLR055C (SPT8); ancestral locus Anc_8.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322787.1"
                     /db_xref="GeneID:40385139"
                     /translation="MKDITPIVAIPHSPSVYSVALTRGPQWMFTGGEDGMIRKYDFIA
                     SVEGKSPLTLSQRHQLVDSVHYGGVICSYWENEVPQSKQAFLSSTKVKTTTTNTGTNT
                     SSSYYEPHLSPVYSLYAQREGHWLLSGLSNGSIALHSVRSQEGSIQWVFQQGHTSTVS
                     ALASYNDNQSFLSGGWDRKICEWDLNQGVLSRDYDGMSGQISVLEYYTGQGFMSASID
                     GRVCLYDIRSNANNGNGIVQIPLLKGTPPWCMGAAVSHMDGPSDCNVSSNTIVCVGRR
                     NSTVEIWDLRKLTNNCEDQQGGATPLDILKLPPASGPVSSVSIFPPKDNGGNSQYIAV
                     GSQDAVRVWDRNTGKCTILPGHAGGVVSQLAHDENGKFLVCASGNRGWAGKAGEMAFI
                     YEVDGGDAKS"
     gene            <87355..>88419
                     /locus_tag="C5L36_0D00500"
                     /db_xref="GeneID:40385140"
     mRNA            <87355..>88419
                     /locus_tag="C5L36_0D00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466928.1"
                     /db_xref="GeneID:40385140"
     CDS             87355..88419
                     /locus_tag="C5L36_0D00500"
                     /inference="similar to AA sequence:RefSeq:NP_116625.1"
                     /note="PKUD0D00500; similar to Saccharomyces cerevisiae
                     YFL028C (CAF16); ancestral locus Anc_8.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322788.1"
                     /db_xref="GeneID:40385140"
                     /translation="MCTLDMCIFIFNIVQCLPLDESLFKFMYVSFFLPRSPFFFITLP
                     LFFYRAHLFFFHVKNCHRSLQCVQIVHGSNKTIFAITTSIGPYSLSSYTNNRTMSVVT
                     RSLTFAYPNSTQGLHNIDLTLPLGGKILLVGPNGAGKSTLLKILAGKKLISSGEIELF
                     GIDPFNLRENWKLNEKNIVYLGTEWANNEIVKRDIGVHELVESVGGSHFPERRALLID
                     ILEIDVNWRMNKCSDGERRRVQLAMGLLKPFDLLLLDEVTIDLDVLVRQKLLNFLYDE
                     TTTRNASIIYATHIFDGLGTWPDTVIHLNRGEIAESHNRNNISFTNTPGVAQNGLQLL
                     IGRVSSLYPLALSWLQKDRE"
     gene            <88969..>91818
                     /locus_tag="C5L36_0D00510"
                     /db_xref="GeneID:40385141"
     mRNA            <88969..>91818
                     /locus_tag="C5L36_0D00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466929.1"
                     /db_xref="GeneID:40385141"
     CDS             88969..91818
                     /locus_tag="C5L36_0D00510"
                     /inference="similar to AA sequence:RefSeq:NP_013380.1"
                     /note="PKUD0D00510; similar to Saccharomyces cerevisiae
                     YLR278C; ancestral locus Anc_6.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322789.1"
                     /db_xref="GeneID:40385141"
                     /translation="MSNPGKKKGRSTSCYLCQKRKQKCDQRLPSCTNCLKSKSECIKP
                     ERYGENQPSNSNDEYTKFLEKKIRQLEKMLDLKVKNKLNDVKLNNSKLTQNDEKILNY
                     KKIGMHIDYSNGRNNNSGNAGSRNSNDSSSSGADDNGDNNINEIFDIVSQNFDTFMNI
                     NTYSFQNSIISKFHLQEMIKIDPVLKIDSKLSENLTSLYFKMMQYKFPLLDEVEITNF
                     NRNYQNNKVLQNDLNNCYFQCSRLFFIYSLSALLFKSTGKYKGPNPFNFFSAGLRFFI
                     LLSNNINQLDKIELLILMCMFLIRADKNSNNIYLIITEIMNNCINLNLHKSSTYLNIN
                     PLVKDLRMRKFWCAYILERSILITISKPFILSESEIDDNIPLFDYEPSKFSKKGKVFF
                     INQSIKIKRLESKFSEDLLLLLPSKSISKNQLAKVESYFQELQNWRIECKGFNSNGIE
                     NQTLLFYYYKAIRNLIQPYLELLDPNDRLFKECQAAAGQICQSIKNYHSKTYHGFSIL
                     NIHIVFIAGITLVYCLWLQRNRDDMRRKLLGDDKKHTRPTVSEDLFRGLDDLRACSIS
                     LYTMSERTKFALSFRDIFEEIMNATIGNYILRCGPDSSEILYRGSGLPPAIFRKPLKH
                     FQIESNYLDKSDDDKLEDEERLRRRGHLKRSAIPKGLSHLLLHPPGLEDLKHDSMRDE
                     SVNRDDLASSSKSNSRILPPPITLPIPKQQRLSTSLTSNDSNLARKYSQIHDVADANS
                     SLLSSNSPNSRHDLLKTPSVSSDLSSTSTISNIYKKFKPSPRIELQQLQEQQHQHQQL
                     QRQHMQQVNHVHQVQQAQQVHQQQQQQQQQQQIQHHYYNQQDNPDSLSGSLPFVGGTN
                     EMITNISTWTEESGQQTGLPKGDSTNLDINLDINSLQQLTNNNFQDSSIQNTNLDSIQ
                     GSSLQNGVTDTFNSLFDVVGNDDFWGLSRDFGFMP"
     gene            complement(<91915..>92628)
                     /locus_tag="C5L36_0D00520"
                     /db_xref="GeneID:40385142"
     mRNA            complement(<91915..>92628)
                     /locus_tag="C5L36_0D00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466930.1"
                     /db_xref="GeneID:40385142"
     CDS             complement(91915..92628)
                     /locus_tag="C5L36_0D00520"
                     /note="PKUD0D00520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322790.1"
                     /db_xref="GeneID:40385142"
                     /translation="MSVSTRHSIQWADGEECEPTITVVITSPNGLFVDVRELKTGGFD
                     WFFAGHEIEHESRHESKQVIEFNHDFLDSQFIRTGQKPSVDLGEFSDSSNETERMNGI
                     RIEKGKMANPANGDVQEYKEKWITCDPLCGDLVYIGKDYGANEVDFVVLETIEGSIVD
                     NKSVHVGRIVKYGHWIQGVYYDKTNKSEGVIRKFKDKDLILHGPKSIWPELNGDTSLF
                     KLHDEIEMNGVIWRVVETR"
     gene            complement(<92839..>95055)
                     /locus_tag="C5L36_0D00530"
                     /db_xref="GeneID:40385143"
     mRNA            complement(<92839..>95055)
                     /locus_tag="C5L36_0D00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466931.1"
                     /db_xref="GeneID:40385143"
     CDS             complement(92839..95055)
                     /locus_tag="C5L36_0D00530"
                     /inference="similar to AA sequence:RefSeq:NP_116624.1"
                     /note="PKUD0D00530; similar to Saccharomyces cerevisiae
                     YFL029C (CAK1); ancestral locus Anc_8.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322791.1"
                     /db_xref="GeneID:40385143"
                     /translation="MPRLGFSSLAHKLHEETHHHGNKGNKNTSVNGNVNHSGTHESRS
                     PSSLSLSLGASSPRHRPLDPVVHSQDTVNAGGININQNTQYNHPSATTSAIASPSSPL
                     AISTLNNSLNNNQNHHLNSTPMNHSHSSSKRSFFGLSIRRSHSNESQSSIMSDDNYHG
                     HGHGHGSLASPQHSHGGKNGSMVQLKKFFRPARRTNDSHLNLTSLNPPNSSSYLRKPQ
                     NVRRNSSNPSLSTMNKAEQQKFSTQPSTPTFTHDANNNMIVKTDQKFWDDLEGSVTKK
                     YGKLGKVLGSGAGGSVRLIVRESDGVTFAVKEFVARRPNESVKDYAKKCTAEFCIGST
                     LHHPNIIQTLDIINENNHFFEVMEYAPIDFFAVVMSGQMTRSEINCCFKQITLGVSYL
                     HSVGLAHRDLKLDNCVVTKDGIVKLIDFGSAVVFKYPFEDDIVMAHGIVGSDPYLAPE
                     VLTSTSNYDPRFVDIWSIAIIYCCMTLRRFPWKAPKQEDPSFNLYCMEDDQPHDYVES
                     ARKHKELLLERRKKIEKMKQEQLQSKANEGEVHEGKDQHKEDSNVKALTEKVENIKID
                     EEAQSEKQMQYENPQQTQQPETTKQQPQPESSQQIQKPETTPQQQDQDEQPQQQPQQQ
                     PQQQPQQQPQQQPQQPGQEHEKQHHHHHHEGTSDTPERRALTKTSKQIHGPYRLMRLL
                     PHASRPIISRMLSVDVSKRATMQDILNDEWFSDIKYCTIDKDGHTVNDPGHHHTIV"
     gene            complement(<96025..>97305)
                     /locus_tag="C5L36_0D00540"
                     /db_xref="GeneID:40385144"
     mRNA            complement(<96025..>97305)
                     /locus_tag="C5L36_0D00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466932.1"
                     /db_xref="GeneID:40385144"
     CDS             complement(96025..97305)
                     /locus_tag="C5L36_0D00540"
                     /inference="similar to AA sequence:RefSeq:NP_014885.3"
                     /note="PKUD0D00540; similar to Saccharomyces cerevisiae
                     YOR242C (SSP2); ancestral locus Anc_8.670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322792.1"
                     /db_xref="GeneID:40385144"
                     /translation="MQHHGSERDTGGRLSLREADIAATVCGVSQAQACDGCRYHNSSY
                     TFRHCWHQHARHGCFHDTEDGHTSQERPILDHYPKSTGDERFSFRELAKTLLFPQEPS
                     LGDQSKHTKDHNDHGHIHEPCQIKGSREDLLRKGKVLQPKNNIMEKSCSKIANSPSCY
                     YILPDTTFKIVAITQIGKPLSISSLLSQIYGGPLEKVELVLRDQQRHFYNDDSLYQTE
                     ERTDWSKVSVFLYFTCNEDAMSFYRYSKSDMFKVNGDSLNTLWMPDVDEDVDEGGNKG
                     QQIQLGRRQLQQAMGGAERARRVLVFKRPIEEKAYNRGPRSHSFTRKNGHLSLVSECH
                     TTVKHNLDIDPKEIKRDFGEYGHLIEVFPIVSRKLSFGVHYYNVASAILVKRVLENAT
                     EERFSAVDLEMRRKYGAWHVWYGRDPTERAVPSP"
     gene            complement(<97675..>99711)
                     /locus_tag="C5L36_0D00550"
                     /db_xref="GeneID:40385145"
     mRNA            complement(<97675..>99711)
                     /locus_tag="C5L36_0D00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466933.1"
                     /db_xref="GeneID:40385145"
     CDS             complement(97675..99711)
                     /locus_tag="C5L36_0D00550"
                     /inference="similar to AA sequence:RefSeq:NP_014886.1"
                     /note="PKUD0D00550; similar to Saccharomyces cerevisiae
                     YOR243C (PUS7); ancestral locus Anc_8.671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322793.1"
                     /db_xref="GeneID:40385145"
                     /translation="MAEVASAKRGHEGTVDGVNAKRQRVDAESLEESVGGVTEVDVGI
                     TEFLCHSQSNVRIRGTLKQRYTDFMVNEIGTDGRVIHLTDLGFKAKELTAEEKEIIAE
                     QEREAREREANLSISDEDKGKLREYFDDSQIEEISSLMRDGKKTVEINKVFDDKEIRT
                     KIHQLIREISSNRIESVTTSTNSFIFGHNANKSRRRKNNKVATNIDHDLGERKNFLHF
                     NLYKENKETMEVASILSKFLKAQVKAVKYAGTKDRRGCTVQRMSLERFTVERVTTLNK
                     ALKGCKLGSFEYKDQPIKLGDLKGNEFIITIKDVESVDPNVSIEDAIVPILNSLRDVG
                     FINYYGMQRFGTFSISTHEIGKEILNSNWGKACELILSEQKIAIPGSIEARKIWSETK
                     DPSAAIKKMPRKCNAEYSVLSRLDRSDKGEDGEFSEGAYFNAIMGIPRNLRIMYGHSY
                     QSYVWNTVVSKRMQLFGLKVVAGDLVLCNNPKIMDEYKQDLETKMIDHEEDGNIIQDI
                     KEVHGLRARPITQEEVDANKFDIYDVVLPTPGFDVVYPENEQLRNVYVEVMGRDGLDP
                     FNMTRKVREFSLSGSYRHIVSKVNHLEYYFRKYNQVTDQLVRTDLEMLQLREQSPDKA
                     VEIKQILDGVPDGGKTAVILKLQLGVSTYATMALRELLEGDTSRFGGVVNLKTA"
     gene            <100204..>102696
                     /locus_tag="C5L36_0D00560"
                     /db_xref="GeneID:40385146"
     mRNA            <100204..>102696
                     /locus_tag="C5L36_0D00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466934.1"
                     /db_xref="GeneID:40385146"
     CDS             100204..102696
                     /locus_tag="C5L36_0D00560"
                     /inference="similar to AA sequence:RefSeq:NP_015172.1"
                     /note="PKUD0D00560; similar to Saccharomyces cerevisiae
                     YPL153C (RAD53); ancestral locus Anc_8.676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322794.1"
                     /db_xref="GeneID:40385146"
                     /translation="MESKRSPLKQSRIENIAIKSTSISSNKLMMTKPTMKKPYTSEPK
                     GPVDTVTQPTQPSSYNPRTDPIEQDLIEQGILCRLIGRTVDESFQIDVKFKDAQRKSV
                     LDDGVENIQQEWTFGRNGNTCCYQLPVHSTRISNKHFRLWMNLDSKNTSAGKYTKDNN
                     IMIQDLSTNGTWLNNSKLAPKQNFILTQGDEIAVGIGVEQDVIRFIVHFPNPSIQGEE
                     QDATHTDYEEEAGINKDFIIRDEIVGSGAFATVKKAIERSTGITFAAKIISKKKALGG
                     LDGVARELQILKKLNHPGIVRLKASYEDDDNYYLVMEFISGGDLMDFVACNGAIDESA
                     SKEIARQILEAIKYVHSKGISHRDLKPDNIMIAQDDPVIVKITDFGLAKSQENESRMK
                     TFCGTLAYLAPEVITNKKNQLKNKKRYLGNGRITEDLYSNKVDMWSIGCLLFVIMTAH
                     LPFSGSTQDMLFKHITNGDYHSKLLETMNISIEGRDFIHRLLEVDVTLRLNANDALKH
                     PWFKDNLEYPSQVSLSQHLSQSQKIIKSQPKPPTQAPQILSRISSSEEGVDNMENSRD
                     FKIPVIPSQRNNDIPALPLDISSSETENHGELTRVVDPIPSEERTSRTTYLGEPFNPI
                     PKATFIMLKPLTKLSGKETPIMYIPQGIPTFYIGRLNNLNVVMSDERISKIHCVILKR
                     RHPTNDSDATGDNSPLNINEETNPNIFSSPAMGLDDVWLLDFSTNTCYLNNLKIGKGK
                     KIKLRDQDIISLFIDKKNGVKLNYQVNFIDTTGLFIEDANLERIRVPIDENDRRMFET
                     KLKEGMKPIMDRSTKKRQQVKSIGDFPNKRRA"
     gene            complement(<103091..>104311)
                     /locus_tag="C5L36_0D00570"
                     /db_xref="GeneID:40385147"
     mRNA            complement(<103091..>104311)
                     /locus_tag="C5L36_0D00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466935.1"
                     /db_xref="GeneID:40385147"
     CDS             complement(103091..104311)
                     /locus_tag="C5L36_0D00570"
                     /inference="similar to AA sequence:RefSeq:NP_015171.1"
                     /note="PKUD0D00570; similar to Saccharomyces cerevisiae
                     YPL154C (PEP4); ancestral locus Anc_8.677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322795.1"
                     /db_xref="GeneID:40385147"
                     /translation="MNIHSSVLTSVVLLLASITGSDAKVHSASIHKNPFQDNYKDISY
                     LEYVDSIKNKYVNNFVKNFNAPFVPFVEDAVIEDTHELPLTNYMNAQYFTEIQLGTPG
                     QPFKVILDTGSSNLWVPSTKCTSLACYLHSKYDHDASSTYKQNGTEFSIRYGSGSLEG
                     FISQDLLTFGDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDTISVDKVVPPIYNA
                     IDKGLLDEPQFAFYLGDAAKSNDDGGIITIGGYDESKFHGEITWLPVRRKAYWEVKFD
                     GLGLGDEYAELEGHGAAIDTGTSLIALPSQLAEILNSQIGAEKSWNGQYTVDCASRES
                     LPDLTFTFDGYNFTITPYDYTLEVSGSCISAFTPMDFPEPIGPLAIIGDAFLRKYYSI
                     YDLGNNAVGLAKAI"
     gene            complement(<104645..>105508)
                     /locus_tag="C5L36_0D00580"
                     /db_xref="GeneID:40385148"
     mRNA            complement(<104645..>105508)
                     /locus_tag="C5L36_0D00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466936.1"
                     /db_xref="GeneID:40385148"
     CDS             complement(104645..105508)
                     /locus_tag="C5L36_0D00580"
                     /note="PKUD0D00580; Pfam Domains: Aldo_ket_red(1e-104)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322796.1"
                     /db_xref="GeneID:40385148"
                     /translation="MAIATHLTLNSGYQIPTIALGVYQTPPEETEKIVLAALEAGYRH
                     IDSAQYYHNEEDVARAIAKWIAKNPAHNKRKNIFYTTKIYDQHVYEKTKKAVEVSLER
                     AKDIDYIDLLLLHSPQSDYERRHGSWLAFQEFVESGKVRSIGVSNYGVKHIKELLEYP
                     DLKIKPAVNQVELHPWLTREDIVDYAAKHGIIIEAYSPLVRGQKMDDPTLVKIAEKYN
                     KTPAQILINWSLSKGYIPLPNTSQISRLASNHDAAQFELSKEDIGTLSSLNERLHTCW
                     DPTLYPLGDEK"
     gene            complement(<107096..>107977)
                     /locus_tag="C5L36_0D00590"
                     /db_xref="GeneID:40385149"
     mRNA            complement(<107096..>107977)
                     /locus_tag="C5L36_0D00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466937.1"
                     /db_xref="GeneID:40385149"
     CDS             complement(107096..107977)
                     /locus_tag="C5L36_0D00590"
                     /note="PKUD0D00590; Pfam Domains: Aldo_ket_red(1.1e-112)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322797.1"
                     /db_xref="GeneID:40385149"
                     /translation="MAIATHLTLNSGYQIPTIALGVYQTPPEETEKIVLAALEAGYRH
                     IDSAQYYHNEEDVAKAIAKWIAEDPAHNKREDIFYTTKIYDQDHGYEKTKKAVEISLE
                     RAKDIDYIDLLLLHSPQSDYERRHGSWLAFQEFVESGKVRSIGVSNYGVKHIKELLEY
                     PDLKIKPAVNQVELHPWLTREDIVDYAAKHGIIIEAYSPLVRGQKMDDPTLVKIAEKY
                     NKTPAQILINWSLSKGYIPLPKTSKVSRLASNLEATQFELSKEDVDILSALNENLHTC
                     WDPTVYPLDNEKEAEKK"
     gene            complement(<108313..>109623)
                     /locus_tag="C5L36_0D00600"
                     /db_xref="GeneID:40385150"
     mRNA            complement(<108313..>109623)
                     /locus_tag="C5L36_0D00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466938.1"
                     /db_xref="GeneID:40385150"
     CDS             complement(108313..109623)
                     /locus_tag="C5L36_0D00600"
                     /note="PKUD0D00600; Pfam Domains: PQ-loop(1.5e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322798.1"
                     /db_xref="GeneID:40385150"
                     /translation="MVGLLKSHPVGLDPSIIQRLDSLSELSGYLSVSFWLFAQLPQVI
                     KNHKDKSVDGFSLGFLLCWFAGDFLNLISCLMNNAMMFQILLSGYYCLIDIILAFQYY
                     YYKRMYHNPNSKWYHRPKKHIHSPRTSLRDNLANYGSIDAEIGQPQARPPTGSRVKGI
                     FKNQQSFGMTRLISTAIVGSLPKVNGIPIQVITYEKKENNSFIYRLLYLILHLDYNMG
                     KVLAWLCTLLYLTSRFPQLWTNYTLKTTKGVSLKLITFALFGNLFYSMSLLLSENSLR
                     GGEESKEFWKAELSYFLGAIGTVLFDFIAILQWIHYDSHSNRTNHIQSVRLKAYTPKS
                     LKSQTIPKSVPLIHSRTSSMRDGTKIDPIEMAASVKSTLSPQNVRKLNEFTPLSPMDL
                     LLDEHISRSYVSSTDTKTIPQKKRPDSIKSLHRHNEDLLMTFEE"
     gene            complement(<109877..>110806)
                     /locus_tag="C5L36_0D00610"
                     /db_xref="GeneID:40385151"
     mRNA            complement(<109877..>110806)
                     /locus_tag="C5L36_0D00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466939.1"
                     /db_xref="GeneID:40385151"
     CDS             complement(109877..110806)
                     /locus_tag="C5L36_0D00610"
                     /inference="similar to AA sequence:RefSeq:NP_015168.1"
                     /note="PKUD0D00610; similar to Saccharomyces cerevisiae
                     YPL157W (TGS1); ancestral locus Anc_8.680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322799.1"
                     /db_xref="GeneID:40385151"
                     /translation="MSICKENAVAGVDAVVENTNGDTKLQVPNSFDNHYDNNDMNEIF
                     NEEHQFTGIMKKYWNQRHDLFSKYDEGVILTKELWFSVTPEIISKYTAKLIELAFRDK
                     KDPLYVMDAFAGGGGNVNQFLECFDVVFGVDINHTHLECTEKNARIYFPKEQLSSRLK
                     LLPLNWVYSDPSLPEDFVDEQAESTEGYSTKRESLESLEILHHMKFDCIFGSPPWGGP
                     EYINEKIYDLNHLLPFTLPKLLSVLLQYTDNVALFLPKNSNLYQLQRVTTMLFPDKSY
                     HRVLKTCLHGRPKGLLVCWGPAFVNIDISKVEL"
     gene            <111145..>112491
                     /locus_tag="C5L36_0D00620"
                     /db_xref="GeneID:40385152"
     mRNA            <111145..>112491
                     /locus_tag="C5L36_0D00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466940.1"
                     /db_xref="GeneID:40385152"
     CDS             111145..112491
                     /locus_tag="C5L36_0D00620"
                     /inference="similar to AA sequence:RefSeq:NP_012509.1"
                     /note="PKUD0D00620; similar to Saccharomyces cerevisiae
                     YJL025W (RRN7); ancestral locus Anc_5.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322800.1"
                     /db_xref="GeneID:40385152"
                     /translation="MARYQRGQVCGVDNCPSRLWKRIDGRNVCQYGHINEFDIELDDE
                     DQALEALGNGAGGDFSRRLRNVAGLTVSQAARDKVTRLGDDRTIRRKYGEDFRKLQSR
                     CFQIILAKNTRYIIEQLKLEDDIRDEYVAVVKMLWAKLLGESVARKLETVTKHHDIAH
                     LNILNYLAILQMELPVYLRDFIALTYGKKYSLERTEYALPRELRLQIPYSQSSTFHGT
                     LIANYIDTLTRKFPLQHIRDHASHVNINYYPLIVRTLSELSLPLEISQCIRNCIEKHK
                     IDLTMAIIPKEKTHPELKVMALIVIFTRLYLSKYPDRLATWKREYTPSMKARVLFQTS
                     FHELCNWSRQEVYTFLTEYEAHHLPSIRSTNIASSHSYKDRNESRMAHSLMELFPKRP
                     PPPDSTHTHPPTVTDTGRDWNIDDALGQHIVAHYQCSSFQMERTVRRAWYQIKRKS"
     gene            <112768..>113718
                     /locus_tag="C5L36_0D00630"
                     /db_xref="GeneID:40385153"
     mRNA            <112768..>113718
                     /locus_tag="C5L36_0D00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466941.1"
                     /db_xref="GeneID:40385153"
     CDS             112768..113718
                     /locus_tag="C5L36_0D00630"
                     /note="PKUD0D00630; Pfam Domains: Aldo_ket_red(6.8e-118)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322801.1"
                     /db_xref="GeneID:40385153"
                     /translation="MTVPEVCTKSYTLNTGASIPAIGLGTWRSTDDECYTAVMTALQN
                     GYTHIDTARVYGNEEAVGRAINDFLKESKTPRERLFITTKLWCSECQNPEKALRKSLQ
                     RLNLDYVDLYLTHWPVAIDPNSSELMPTNESGQRMVLPFEEWSYLDTYRGMQKLVTLG
                     LTKAIGISNYNIPKIKRLLADPEVEIVPACLQVEMHPCLPQNDLVEFCKSNNIVVQCY
                     SPLGSTGAPVLQDETLKKIAASKNVHPATVAISWAVARDTVVLPKSVNPERIISNLKV
                     IELSDDCVKEISEIGERNPKRVVNPEWTVKKNIFENFDYY"
     gene            complement(<114138..>116177)
                     /locus_tag="C5L36_0D00640"
                     /db_xref="GeneID:40385154"
     mRNA            complement(<114138..>116177)
                     /locus_tag="C5L36_0D00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466942.1"
                     /db_xref="GeneID:40385154"
     CDS             complement(114138..116177)
                     /locus_tag="C5L36_0D00640"
                     /inference="similar to AA sequence:RefSeq:NP_014918.1"
                     /note="PKUD0D00640; similar to Saccharomyces cerevisiae
                     YOR275C (RIM20); ancestral locus Anc_8.726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322802.1"
                     /db_xref="GeneID:40385154"
                     /translation="MERQKKIKKKLLLFFVYLFLYVSINGVLLQKVLKLSSVTCTMEL
                     SESGFLFIKPLSTSYFDFVNVLSPLISVELHQNPKDFAFNLKQLNDLRVETLSNPSTI
                     TFELITKLKKYQTLLPYVKTHFPNLMFEWENQLVDFNKELQNINYNLSAYYSILATSL
                     ISSNLKRSAIYFQYSASLNDQFMNILLGQAQEIYYQTALSNSFKDSLITKITIQVADF
                     YDQRETEGIWSYVYLKYVYFRCLSYLKYSLNCKDKGVAKACLQECQNLYSSIGDIQDV
                     EFAQLSQDLENIKLKVINRFDEMEDVDVGKLGELKRCILAKPIEPPDLEVEAPFQKLI
                     PKNIVEKLLVYEKTFDEFIQNELMTPLVELNIDLNVSNIEYELEKITGKFVPEIILQY
                     RDQLIELGGIEKLDNLWNTLTFLKNECRLKLDNIWILLKNQTQYEETLALEHGYENWK
                     LEILENNQQAGPIINSFKIYENYIKQAENGDNLINIQINEIRPFISIFHKMPILKEYI
                     PDAEYIDMNPQLKDVVQSLRKCIEDIKSLVEERNKFTAQLKHKAKRFDAFQKYQKGED
                     LNSLLKNEIMTYSKEIEFVDNSKQKQLNMIETLNEQTVQFSRIKTSLKVSAKRIETIN
                     VLKASFEGFLETLKNAKQGVEFYQNLLENIKSKTSQLDLFLSKRIGLVKSIRNSV"
     gene            complement(<116262..>117077)
                     /locus_tag="C5L36_0D00650"
                     /db_xref="GeneID:40385155"
     mRNA            complement(<116262..>117077)
                     /locus_tag="C5L36_0D00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466943.1"
                     /db_xref="GeneID:40385155"
     CDS             complement(116262..117077)
                     /locus_tag="C5L36_0D00650"
                     /note="PKUD0D00650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322803.1"
                     /db_xref="GeneID:40385155"
                     /translation="MLTALENNSRAVVLYIRTSTTPPWFKLAKNRRFKEEYSSRIKEV
                     TLLTLADLVILVDDDHWWGQYMFVVIDSMAELYSDALDNIKDLGNDVVTRYYKSTRLL
                     FHKLQKIASNKFVFTIGGMKLFNQRVHVQSESVDSDNNDKETPTVKSAIQQILVPIIS
                     LKSDLNLYYTNRLIIYRDWVQDNEFGLQSKLTDFTESVVALNKGHMKCVPHYLYIDPA
                     PITPSHSSKSGFFLVDGNGNLLDIDTDDAELQLGDDGMEVINSQEDDDSDVWD"
     gene            complement(<117770..>118540)
                     /locus_tag="C5L36_0D00660"
                     /db_xref="GeneID:40385156"
     mRNA            complement(<117770..>118540)
                     /locus_tag="C5L36_0D00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466944.1"
                     /db_xref="GeneID:40385156"
     CDS             complement(117770..118540)
                     /locus_tag="C5L36_0D00660"
                     /inference="similar to AA sequence:RefSeq:NP_015518.1"
                     /note="PKUD0D00660; similar to Saccharomyces cerevisiae
                     YPR192W (AQY1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322804.1"
                     /db_xref="GeneID:40385156"
                     /translation="MDADQELGYSSHKETPASLFKLQGSLRNLLYVVSGEFIGTFVFL
                     WTAYAIASAANIAGVVNDSNAAKTIMIAFGFGFGVMIGIALTAKISGGNLNPAVTLTL
                     ILARAVDPIKGLCMMVSQIIAGMAAGGAAKGMFPGPVTFANAMGNGTNKGQGLMLEAF
                     GTALLCITVLMAAVEKSALNDFAAVVIGISLFLGHLFTINFTGAGLNPARSLGAAIAL
                     RSFPVYFWIYWIGPIIGSIIAVCIWYLWALLKVEEDEE"
     gene            complement(<120094..>122718)
                     /locus_tag="C5L36_0D00670"
                     /db_xref="GeneID:40385157"
     mRNA            complement(<120094..>122718)
                     /locus_tag="C5L36_0D00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466945.1"
                     /db_xref="GeneID:40385157"
     CDS             complement(120094..122718)
                     /locus_tag="C5L36_0D00670"
                     /inference="similar to AA sequence:RefSeq:NP_013993.1"
                     /note="PKUD0D00670; similar to Saccharomyces cerevisiae
                     YMR266W (RSN1); ancestral locus Anc_8.819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322805.1"
                     /db_xref="GeneID:40385157"
                     /translation="MTSTTSTSTRDVLTSITSNGVFCAIFVTLFLLLRLRFKRVYEPK
                     SHCDILPSEERPDPLPITPLFWLKALITMKPSFMIKYSGVDGYLFLRYLCIVSSFGLG
                     GMLIWIILLPVNATGGNHETGLNQLGISNVGNVGRYYAHVFMSWIYYAAIMFTVYREL
                     HFYTNLRYLLLSTPHYARKLSSRVVVFQTIPDQYLNEREFKKLFDGVRKIWVAKVSPE
                     LSKKVSERDGLVSNLENALNNILKKCVSVKAKKEKKGEHIELEQELVSYIPQKKMPTI
                     KKPKIIGKKHDLIEYSKERIAVLNKEIEELQKDSNNKKIKPLNTIAVEFENQYFAQLA
                     YQTIIHDQPLHFDPKHIGVEPGDIFWPNMRYYWWEKLSRTSVAVAAIIALIIIWAIPV
                     AFVGFISNLTYLTNKMHWLRFIYNLPKQLLGLITALLPSVMLSVLMMLLPIFIRSMAK
                     LSGCLTAQSIEYFTQQAYFAFQVVQTFLVVTIASSVSSVVTQIIENPTSSLSLLSSNL
                     PKSSNFFISYIILNGFSVSGTILFQLVTFILFYAFSFLDKTARQKYNRYVGLGEMAWG
                     TTYPIYEVLAVISIVYSIISPIILLFTFVAFLLLYLAYMNTLNYITGIGTDNMGRNYP
                     RAMFHLMVGIYLGEICLIGIFAVSKSWGCIVLEVIFACATVLFHVQMNVAFDKLMTVL
                     PNTCMRPLDGESETLSWKNTDAKVLGNDGGDGKESPFEDEEEMKQRLIEEPLIIEGDR
                     SDIYRPNIVLRYLQPWKYLTYHDLKEYIPPMYWEYPADDGYGAGHDADYSCPDLSAKA
                     AVVWIPRDPMGLSKQFIEEFEGIVEMSDENAEFDQNNKIVFTGEPPQSGLKIYREDDK
                     SGNNDYFHDESRDSKDFL"
     gene            complement(<123030..>124052)
                     /locus_tag="C5L36_0D00680"
                     /db_xref="GeneID:40385158"
     mRNA            complement(<123030..>124052)
                     /locus_tag="C5L36_0D00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466946.1"
                     /db_xref="GeneID:40385158"
     CDS             complement(123030..124052)
                     /locus_tag="C5L36_0D00680"
                     /inference="similar to AA sequence:RefSeq:NP_010360.1"
                     /note="PKUD0D00680; similar to Saccharomyces cerevisiae
                     YDR075W (PPH3); ancestral locus Anc_8.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322806.1"
                     /db_xref="GeneID:40385158"
                     /translation="MLDLDKILEDVKACRIIPEQDVLEMCLLGQELLISEGNVQSVAV
                     PVVVCGDIHGQLHDLITLFKIGGEPPLKRYLFLGDFVDRGFNSLETFLLLLVYKLKYP
                     DKIYLIRGNHESRQITSVYGFYDECLRKYSNANVWRYCCELFDYISLGAYIMGGLGGR
                     DGVFCVHGGLSPGLETLDEIRKIDRKQEVPHDGSMCDLLWSDPEKDVDGWALSPRGAG
                     YLFGEGETSKFLHRNGLSLVARAHQLVMEGYKELFDGGLVTVWSAPNYCYRCGNVAAV
                     LALDESLTREYTTFESAQGKNDNNDRDGYDPTTITNNNNNNNVGFQRGNVFLTTRQKP
                     ATDYFL"
     gene            <124243..>125253
                     /locus_tag="C5L36_0D00690"
                     /db_xref="GeneID:40385159"
     mRNA            <124243..>125253
                     /locus_tag="C5L36_0D00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466947.1"
                     /db_xref="GeneID:40385159"
     CDS             124243..125253
                     /locus_tag="C5L36_0D00690"
                     /note="PKUD0D00690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322807.1"
                     /db_xref="GeneID:40385159"
                     /translation="MYYIEELTSKAMTIERKKVPPIVPKKNRELSLRGDKNGSETLHL
                     SIPVGPITPRIQDRETTEKETLERLVEEISLNSEYELPRRHRNEPKVIKFDDIMASNR
                     VPAIKPTKHASTSINTITNTTTKPKPQPKPKPVLESLLQQESPDIYPKQNATPQDTLW
                     LNLKPKPLVKPKPPVKTKPEIKPSFHCIQHPLSKTCVVPPQTRTEKETPAFLHNVLQQ
                     HIDLQSKSAPLQMVPLPGLATSAVFPIPAKPSQRAHTVDNSSLGVTRGRGKKLTHPNK
                     TRSRGPRRRLPKSVSTSEGDKTSANAPTYAAKCTETPLLSQPLGKKKPPVPPKKKIQI
                     TV"
     gene            <125581..>126929
                     /locus_tag="C5L36_0D00700"
                     /db_xref="GeneID:40385160"
     mRNA            join(<125581..125594,125666..>126929)
                     /locus_tag="C5L36_0D00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466948.1"
                     /db_xref="GeneID:40385160"
     CDS             join(125581..125594,125666..126929)
                     /locus_tag="C5L36_0D00700"
                     /inference="similar to AA sequence:RefSeq:NP_010878.1"
                     /note="PKUD0D00700; similar to Saccharomyces cerevisiae
                     YEL036C (ANP1); ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322808.1"
                     /db_xref="GeneID:40385160"
                     /translation="MSGKVKPFDYRTRSTIYTLAIFVVGILGLFSWYSSFLPTFTEKQ
                     QSLYRPQFDDTLGVTFADLRYDSQGTANGWQNEERVLFLVPLRDAAEHLPMFFSHMRN
                     MTYPHHLIDISFLVSDSKDDTLGVLYSSLKSIQESSDPDLPFGEIEIFKKDFGQSVGQ
                     GFSDRHGFAAQGPRRKNMAKARNWLTAVALKPHHSWVYWRDVDVETIPPTIIEDLMEH
                     DKDIIVPNVWRPLPDWLGGQQPYDLNLWQESDGGLELASLLSEDAVIVEGYPEYATWR
                     PHLAYLRDPYGDPQTEMQLDGIGGVSILAKAAVFRYGSHFPAFSFQKHAETEGFGKMS
                     KAMGLEVVGLPHYVIWHIYEPSDDDLKHMAWMAEEEIRQAKMKEFSKIYNKNFKLGFE
                     PVTSEEWEIEKGKILKNSDPIKLNKFIYVDWSD"
     gene            complement(<127028..>130099)
                     /locus_tag="C5L36_0D00710"
                     /db_xref="GeneID:40385161"
     mRNA            complement(<127028..>130099)
                     /locus_tag="C5L36_0D00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466949.1"
                     /db_xref="GeneID:40385161"
     CDS             complement(127028..130099)
                     /locus_tag="C5L36_0D00710"
                     /inference="similar to AA sequence:RefSeq:NP_010871.3"
                     /note="PKUD0D00710; similar to Saccharomyces cerevisiae
                     YEL043W; ancestral locus Anc_1.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322809.1"
                     /db_xref="GeneID:40385161"
                     /translation="MILVMFMLACAGTLWLAHRFSLLMSLPIETSVKSLSIPIPKVPL
                     LSVDKVTDTSIAFHWSDVSGNTENGDSKKEKDDLVSSSNIDHYILYINGIQTLRIKGD
                     VNKCTLEELEPSSNYQIDLVAFNLAGFRSKSSPIFIKTSAKHIEDSKLQSLQNIDNVI
                     KYLLREQERESLTRTDPFKSTTASSASNGRSRSGTLDGNQQPPTTSTSTNPTIDSKHP
                     HLIDDINELKWILESGLEEVQQLMRSYKEAEFEFQEEESNLIATRDEARTRRKFEDNN
                     RTNLRQEIKLLEEQRVRGASRVSADQKKIKERERKIDELKHQIEKLNSDTIRMQKELE
                     FQTKQNPKKLLKLENEVMNLNKEIFVSQEELHNLEDELRYEISLRKTLESTKLKVIEL
                     FEKINENIDEVTGLLRPEGVQYLNDLFKLKPEWEKELYQEIKEIDEKAESDYRHLQAR
                     EWEKFELKKKQIDEEKRQRILQNVQNVQNVNSNPILPTVNINTSNENVTTGTTPTNVN
                     GYLYNQLPSHSNGSAFNSQQFNSNSMRSLMGLRSENNGSFQGEFDDSASLNAFNGKNN
                     IWAINNSDRQSVNMLLPQNLIDSEEIDQLLTNTNKSNNHTVLSPHINPLSQPSLNPQN
                     GSAASPNISQINQFDYYQNNGLNGMVLGSSPHHQRITSLSALTTAASQMNLMNSPPQS
                     LHAQLSNNDSIVTTQSPFNNNNSMNMQLNTNPVSGGNDIDPVSMYLTSNGLSDNTSSH
                     HYSKIFGTLGSDLQETNINNANSNSNNYNLNSNSTSTNVNTTIKNNNNNNSSTRGRSS
                     SFGSSIWSNGNTNNNHANSGSWGGLQPNNGFSFLGTPASLNQSEQQSLVSTMNDQIGQ
                     SPSTSIVEQSNTNKVVNTTTGDHHHPNSPSFLKSMMGKFGASPTKTLSNKTVEHHFDA
                     HGHISLFDETIEENPKDEKSPITHNKSSSFGSSRFFKLPRKNSMHSTSQASAATLGST
                     DGSIIGSSISEDPNAVNGNGGSGSGSGSGSGGGGFMGRKLSFAFKRDKDKE"
     gene            complement(<130484..>131620)
                     /locus_tag="C5L36_0D00720"
                     /db_xref="GeneID:40385162"
     mRNA            complement(<130484..>131620)
                     /locus_tag="C5L36_0D00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466950.1"
                     /db_xref="GeneID:40385162"
     CDS             complement(130484..131620)
                     /locus_tag="C5L36_0D00720"
                     /inference="similar to AA sequence:RefSeq:NP_010868.1"
                     /note="PKUD0D00720; similar to Saccharomyces cerevisiae
                     YEL046C (GLY1); ancestral locus Anc_1.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322810.1"
                     /db_xref="GeneID:40385162"
                     /translation="MPEQTQQFPTHNEFRSDTFTVPTQKMLESVLTCTVGDSVYKEDQ
                     DCLDLEDKVARLSGHEAALFCSSGTMSNQIALRAHLFQPPHSILCDYRAHVYSHEAGG
                     LATLSQAMVSPVRPANGNYITLDDILENYIPDDGDIHMAPTKVVSLENTLHGIITPYE
                     EIERISQWCKETGILLHCDGARLWNASAETGISIHDYCRLFDSVSLCLSKSLGAPFGS
                     ILVGKKKFIEKCNHFKKQNGGGIRQAGMLAKMASIAIDDNFDKIKISHQYAKNVGQFC
                     VEKGIPLESPVDTSFVFLDSKKFKVNPSTYDIISKKYNVRTMGNRLAFHYQNSPEAIE
                     NLKSALLEAYQDSLVHPYTTKGAAKLYRTPSVSSTKTLVEHVHH"
     gene            complement(<134163..>134429)
                     /locus_tag="C5L36_0D00730"
                     /db_xref="GeneID:40385163"
     mRNA            complement(<134163..>134429)
                     /locus_tag="C5L36_0D00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466951.1"
                     /db_xref="GeneID:40385163"
     CDS             complement(134163..134429)
                     /locus_tag="C5L36_0D00730"
                     /inference="similar to AA sequence:RefSeq:NP_065435.1"
                     /note="PKUD0D00730; similar to Saccharomyces cerevisiae
                     YCL057C-A (MOS1); ancestral locus Anc_1.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322811.1"
                     /db_xref="GeneID:40385163"
                     /translation="MSALQQQQQQQQQLTVPSSTIISSAWDVALSNAIVKTGLGFGGG
                     VVLSVLLFKRRAFPVWLGVGFGLGRSYAEADSVFREAGIRRIDA"
     gene            <135389..>136315
                     /locus_tag="C5L36_0D00740"
                     /db_xref="GeneID:40385164"
     mRNA            <135389..>136315
                     /locus_tag="C5L36_0D00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466952.1"
                     /db_xref="GeneID:40385164"
     CDS             135389..136315
                     /locus_tag="C5L36_0D00740"
                     /inference="similar to AA sequence:RefSeq:NP_012611.1"
                     /note="PKUD0D00740; similar to Saccharomyces cerevisiae
                     YJR077C (MIR1); ancestral locus Anc_1.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322812.1"
                     /db_xref="GeneID:40385164"
                     /translation="MSSSSAPVIPSFSVLDYSKFALAGAIGCGVTHGSMTPIDVVKTR
                     IQLEPTVYNTGMVGSFKKIISQEGAGALLTGLGPTVLGYSIQGAFKFGGYELFKKIFI
                     DYLGYDTASKYKDAVYIGSAATAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRI
                     LKEEGVGSFYAGFTPILFKQIPYNIAKFLTYERAAEAIYAAVGTPKDQLSSTATTGIN
                     LGAGVIAGCMAAFVSQPADTLLSKVNKTKKAPGQSTVGLLIQLAKELGVRGSFAGLPT
                     RFVMVGTLTSLQFALYGSIKGALGCPAVVTLK"
     gene            complement(<136659..>137660)
                     /locus_tag="C5L36_0D00745"
                     /db_xref="GeneID:40385165"
     mRNA            complement(join(<136659..137447,137595..>137660))
                     /locus_tag="C5L36_0D00745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466953.1"
                     /db_xref="GeneID:40385165"
     CDS             complement(join(136659..137447,137595..137660))
                     /locus_tag="C5L36_0D00745"
                     /note="PKUD0D00745; Pfam Domains: RRM_1(1.6e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322813.1"
                     /db_xref="GeneID:40385165"
                     /translation="MSSLLEKSLDEIIGSSSKGPTRNRNAHKTGKRGGVNKPSHRGGR
                     GARGNSRSGGHRGARPFGGSGSNGKATEIKVTNLHPDLTAQDLGKLMETIGPVVQVDL
                     KFNTLGKSTGVAYVEFESSRDAREAIRRFDGRLAAGQIINVSTTMSLLDRIGGRQGQE
                     LRRERQAPKSKKNKPKAPPRKSLEDLDNELLQYMNGAAPVDAVGGQPAQEQAQGQTDM
                     SVPADGSAEQQQQWGQVAAAVPAVGHVEDAGQGIASTEAHEIHGDEANGGAALDAFPV
                     ANNDVAME"
     gene            complement(<137934..>138944)
                     /locus_tag="C5L36_0D00750"
                     /db_xref="GeneID:40385166"
     mRNA            complement(<137934..>138944)
                     /locus_tag="C5L36_0D00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466954.1"
                     /db_xref="GeneID:40385166"
     CDS             complement(137934..138944)
                     /locus_tag="C5L36_0D00750"
                     /note="PKUD0D00750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322814.1"
                     /db_xref="GeneID:40385166"
                     /translation="MSQENAENPPLSPSVSSTPRFQQARDTREEFNSTNSTNNMSFGL
                     IKSPIMANGLNLDPFDYKPPTMAYSGSTSEQLLSSGRLVNSSPREIHSDNNSTTSSSE
                     AGVLYKLRENENNDQYKVDFNKMDPDVHKCLNQIEEFKERVIGNASSEEDSRQQLVMF
                     MESFKSTVLRLNLKNSLLKNEISNIRDDFSMERFMLMKKIDQLEKTLRMTQSENTAIN
                     ERNLKLIKYIKTLKNEKLKFFITENYKLKDRIEMLETQLRLSNPSYVVGSPLSTNSNT
                     LPIHISTPNACTGKTPSDEVLSPKNTTKLDALSLLASEYLHNEYPDIVMDGLSSKRRK
                     SD"
     gene            complement(<139646..>142171)
                     /locus_tag="C5L36_0D00760"
                     /db_xref="GeneID:40385167"
     mRNA            complement(<139646..>142171)
                     /locus_tag="C5L36_0D00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466955.1"
                     /db_xref="GeneID:40385167"
     CDS             complement(139646..142171)
                     /locus_tag="C5L36_0D00760"
                     /inference="similar to AA sequence:RefSeq:NP_013066.1"
                     /note="PKUD0D00760; similar to Saccharomyces cerevisiae
                     YLL034C (RIX7); ancestral locus Anc_4.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322815.1"
                     /db_xref="GeneID:40385167"
                     /translation="MSTRKKGVLQQNLDNSVYNHILKLLDDKTATLKLSPNNETGFTT
                     ALAKDLSYDEIMQYIRLQDKTMGRMKMDLLGKAIDRVWAEIKEEEAVELAELGVTPRI
                     EHPKDEVEESGLMEVTDLNIANKNIVSLWNQANTSTNENGPNDGKTVKTLDKEEKESN
                     KKRRGKEEGSKKKRVKVDRSPPKASLKQLGGLDEVHAELMEVVGMPILHPEIYLSTGI
                     QPPRGVLLHGPPGCGKTSIANALAGDLGVSFINISAPSVVSGMSGESEKKVRELFDEA
                     KSLAPCIIFIDEIDAITPKRDGGAQREMERRIVAQLLTCMDELTLENTNGKPVIVIGA
                     TNRPDSLDAALRRAGRFDREISINVPSEAARYHILKSMTENLKISGELGLKELAKMTP
                     GFVGADLKALVTSAGVSAIKRIFSTLSDENGQLPFDFEEEKTQEEQQEHCEDVDMDRP
                     QDEEFITPLTTPMSPSGNQRAFAEVAISPKLCSPGSSVSIIQKFLEKHPNPLTEKQLE
                     PLCITKEDFLTALPSIQPTAKREGFATVPDVTWANVGALSNIRIELHMAIVQPIKHPE
                     IYLKVGISAPAGVLMWGPPGCGKTLLAKAVANESKANFISVKGPELLNKYVGESERAV
                     RQVFSRARASVPCIIFFDELDALVPRRDTSLSESSSRVVNTLLTELDGLNNRKGIFVI
                     GATNRPDMIDPAMLRPGRLDKSLFIELPNAAERLDILKTLIKSNGTPLSSDIDLSSIS
                     HDERCRNFSGADLSSLVREASVIALKRKIFTGIKNLDEYVDEEASDMSNIVVTADDFD
                     KALDATKPSVSDRDRAKYEKLNKRLGWDKTGVSAPSKEEVADI"
     gene            complement(<143107..>144768)
                     /locus_tag="C5L36_0D00770"
                     /db_xref="GeneID:40385168"
     mRNA            complement(<143107..>144768)
                     /locus_tag="C5L36_0D00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466956.1"
                     /db_xref="GeneID:40385168"
     CDS             complement(143107..144768)
                     /locus_tag="C5L36_0D00770"
                     /inference="similar to AA sequence:RefSeq:NP_116585.1"
                     /note="PKUD0D00770; similar to Saccharomyces cerevisiae
                     YFL009W (CDC4); ancestral locus Anc_8.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322816.1"
                     /db_xref="GeneID:40385168"
                     /translation="MTAKRSLSPLRPLSTSEVSISQVSPGGKRRHLNSVNDDSLMSLS
                     LPSPSASPIHSSTDSSETSNLPLLLSIIKNTPRGELSHLHAFLLNFLKRDILLGLPLE
                     ISIVILSQLDKGDLVHCMMVCKQWNLLINNTPELWKRLIFRDSLITSAEEFERDYAAL
                     EQNGTKRVNIPKQMYKLRYTVLKRWMDPTFTPHRQVLEGPDLNVITCLQFDNEKIAAG
                     SNSCQILIYNTQSGELIHTLLGHTGGVWAMKFYGDILASGSTDRTVRIWNTRTGKCTH
                     IFKGHTSTVRCLEIVQPQRIGTDVQGNPIMFPEEPMLVSGSRDATLYLWKLPINDSDS
                     EAPWEFDVGENPYFVNVLKGHLASVRTVTAYANLVISGSYDSTVRVWDISTCECKYTL
                     EGHSDRIYSVVYDPHRHRCYSASVDNTVRIWDLETGECLHILEGHQILVGLVTASRNA
                     LVSAAADSTVRVWDQDTGHARVVFRGHSGAITCVVNDDFKVVSGSQGMLKLWDVQTGK
                     FVRDLVEGVDGSVWQVCIDWKRCVSAVQRGDVTVLEVLDFTKGLV"
     gene            complement(<144856..>145452)
                     /locus_tag="C5L36_0D00780"
                     /db_xref="GeneID:40385169"
     mRNA            complement(<144856..>145452)
                     /locus_tag="C5L36_0D00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466957.1"
                     /db_xref="GeneID:40385169"
     CDS             complement(144856..145452)
                     /locus_tag="C5L36_0D00780"
                     /note="PKUD0D00780; Pfam Domains: DUF1000(3e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322817.1"
                     /db_xref="GeneID:40385169"
                     /translation="MSCPHAHPRFPTVPTNPAQNLLPYIDLPRVEGANVANPPASRVL
                     KSPHEPIASLYGPEMLLIVPFSTEVKVYSILLQTDVPVTLAIWKNPPSHLDLGTALPG
                     SATFHAHHPAHSIEPIEHHLPRHRFAGVTCVALLLRWEEQMDFDNSLIDVSYLEFRGE
                     STSISRAIGSLAHVVYEKKPQLEDHKTMASFMNNTLLQ"
     gene            complement(<146763..>147482)
                     /locus_tag="C5L36_0D00790"
                     /db_xref="GeneID:40385170"
     mRNA            complement(<146763..>147482)
                     /locus_tag="C5L36_0D00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466958.1"
                     /db_xref="GeneID:40385170"
     CDS             complement(146763..147482)
                     /locus_tag="C5L36_0D00790"
                     /note="PKUD0D00790; Pfam Domains: DnaJ(1.1e-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322818.1"
                     /db_xref="GeneID:40385170"
                     /translation="MDKAEIGKIDPYVVLGIRADADARSVKKAYHKLCLQYHPDKNEG
                     FRQEFDRVQLAYMVLSDEKKRKRYDKTGVLSVDDSGDFDWEAYFEGEFNEVTKEMIEK
                     DRKEYQGSEEERDDIRKELIEAHGNMERLFESVIHLEFSKDEEDRVYKICEELVKEID
                     HHAIPQWEKYVKERKKRVLKLERRRKREARDASESANDIGDMGQLQMMIAGNARRRKS
                     QFDDILDKYSQPQKKVKKKKT"
     gene            complement(<147684..>148796)
                     /locus_tag="C5L36_0D00800"
                     /db_xref="GeneID:40385171"
     mRNA            complement(<147684..>148796)
                     /locus_tag="C5L36_0D00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466959.1"
                     /db_xref="GeneID:40385171"
     CDS             complement(147684..148796)
                     /locus_tag="C5L36_0D00800"
                     /inference="similar to AA sequence:RefSeq:NP_013345.1"
                     /note="PKUD0D00800; similar to Saccharomyces cerevisiae
                     YLR244C (MAP1); ancestral locus Anc_8.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322819.1"
                     /db_xref="GeneID:40385171"
                     /translation="MATKTCAAPNCGKETTSNLKCPICLKQGLNQYFCNSNCFRGSFS
                     RHKAIHKKEGIETYDPYPEYDYRGTLRPVFPLTPRREVPDSIAKPDYAKNGEPTSELK
                     NDRTNKIKVLSGEEIAKMREVCKLGREVLDAAGAMVRPGVTTEEIDRVVHEESIKRGG
                     YPSPLNYFNYPKSVCTSVNEVICHGIPDARPLQDGDIVNIDVSLYKDGFHADLNETYY
                     VGDKAKSNPDTVRLVETTREALDLAIAAVKPGIPVREFGNIIEEHANKNNVSVVRTYC
                     GHGVNNLFHCQPEIPHYAKNKAIGTCKPGICFTIEPMLNLGTYRDVLWPDGWTSTTAD
                     GKFSAQFEHTLLVTEDGVEVLTARTAASPGGPVPRI"
     gene            <149016..>149894
                     /locus_tag="C5L36_0D00810"
                     /db_xref="GeneID:40385172"
     mRNA            <149016..>149894
                     /locus_tag="C5L36_0D00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466960.1"
                     /db_xref="GeneID:40385172"
     CDS             149016..149894
                     /locus_tag="C5L36_0D00810"
                     /inference="similar to AA sequence:RefSeq:NP_009899.1"
                     /note="PKUD0D00810; similar to Saccharomyces cerevisiae
                     YCL031C (RRP7); ancestral locus Anc_1.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322820.1"
                     /db_xref="GeneID:40385172"
                     /translation="MALSPIKGFVPLQISLAATANLPESVHLCYIKPHLSKDPNEQID
                     TTRKLFLINPLPDWTLDSVKDLFRQVNTGCHIEEVLVREAIDKSRVSSIGSGINYDIH
                     VNLSVLTNEELGVELSASEKLPFGSSVVTFLDRDSLELFLDSLKKIKKPLQWSLPNNE
                     TGISRYSRIPVLDRTSLEREVTQALVDFQKKEKIAEEEVSNMRTIVDEDGFTLVVGSQ
                     KKTKSDILGSMKKKSDLEQDEALLKKEKRKEKQDFYRFQIREKKKLEMNSLLTKFKED
                     QERVKLMKQRRKFRPY"
     gene            complement(<149913..>150944)
                     /locus_tag="C5L36_0D00820"
                     /db_xref="GeneID:40385173"
     mRNA            complement(<149913..>150944)
                     /locus_tag="C5L36_0D00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466961.1"
                     /db_xref="GeneID:40385173"
     CDS             complement(149913..150944)
                     /locus_tag="C5L36_0D00820"
                     /inference="similar to AA sequence:RefSeq:NP_009898.1"
                     /note="PKUD0D00820; similar to Saccharomyces cerevisiae
                     YCL032W (STE50); ancestral locus Anc_1.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322821.1"
                     /db_xref="GeneID:40385173"
                     /translation="MSIVEWGNDQVLLWLRNRNQPENVLRSFREHNITGLTLPMLNSQ
                     DLKDMGIPTLRDRLTILENIRELVFEKNALGEVSFDHPLLSELQTTVISSALMKSVAK
                     SIVDETSQKLVETADPSRKEYHTLSVKINKLREEILPILKEMQDHKPLPPPIQTSSST
                     LEQPVHTISRPPSRPISGPTSGPSSRPTSGTASRTVSRATSQNDILQSHQHNRVASPT
                     LNKTPSSPSRRPSLHTTKSKRTSVHEENDTLKQLRAKTEDPCYKILQAAMKSHRLDRS
                     EWRKYVLVICYGGDKERVLRYDEKPVLVFKELSELGLSPSIMLRQVEDSDDTGNINYE
                     DYETPGGRL"
     gene            <151649..>152659
                     /locus_tag="C5L36_0D00830"
                     /db_xref="GeneID:40385174"
     mRNA            <151649..>152659
                     /locus_tag="C5L36_0D00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466962.1"
                     /db_xref="GeneID:40385174"
     CDS             151649..152659
                     /locus_tag="C5L36_0D00830"
                     /note="PKUD0D00830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322822.1"
                     /db_xref="GeneID:40385174"
                     /translation="MMNNMETTYMEQSLKPLKIVRRTTAKENISIREKVKKNVSSCAR
                     MTAEPDYKFNNILQNEQDAVYPFFYSDIQTNEVYLKNKQPKLDFTTDVTFYRNVVKKY
                     TKPVNYKYIPVVGGKRQPLDDPVLQCFTKTKQDSQLQFGDYLLNVSQSGAANLKYEPL
                     ENVQYSDDEVLYRSDEGEVSRLENSDLDNDSEADMTETDGEDEMEISLGPSNLMDAGV
                     LTPSTPRRSVNDHLKTSPKRQETLLRTLANKSPIKRLTNERLNKSKHMNYSKFDSSMC
                     ISAKAIMKMVDDSLVSSDTEIYNQSYTSAHAHGNPFNSLKNVDFSINASDLISALNDN
                     EY"
     gene            complement(<153004..>153273)
                     /locus_tag="C5L36_0D00840"
                     /db_xref="GeneID:40385175"
     mRNA            complement(<153004..>153273)
                     /locus_tag="C5L36_0D00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466963.1"
                     /db_xref="GeneID:40385175"
     CDS             complement(153004..153273)
                     /locus_tag="C5L36_0D00840"
                     /inference="similar to AA sequence:RefSeq:NP_014013.1"
                     /note="PKUD0D00840; similar to Saccharomyces cerevisiae
                     YMR286W (MRPL33); ancestral locus Anc_8.851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322823.1"
                     /db_xref="GeneID:40385175"
                     /translation="MSAPAKYFKVTQLKSTIGLPRLYKDTLETLGLRRRHQTVYHKIT
                     PQQAGQIARVKELVKVELSPVYKDKAQMRAERKPLPGFVVVKRRA"
     gene            <154069..>156465
                     /locus_tag="C5L36_0D00850"
                     /db_xref="GeneID:40385176"
     mRNA            <154069..>156465
                     /locus_tag="C5L36_0D00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466964.1"
                     /db_xref="GeneID:40385176"
     CDS             154069..156465
                     /locus_tag="C5L36_0D00850"
                     /note="PKUD0D00850; Pfam Domains:
                     Pkinase(7.7e-88)|Pkinase_Tyr(3.6e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322824.1"
                     /db_xref="GeneID:40385176"
                     /translation="MLDLFKNIISRKAKKPRGKFQNSTPLSPSTSKESNSGSLSSTQS
                     NTSLGMSDDDTGVLNDKDMPIHETSIELLLEIHPELNKYYKELHPRYLLSDVIGEGAF
                     SQVYKAYDTKEKRYLAIKIINKTGMKPAQINSTLKEIAIMRQLDHKNIVKLYNYQNSS
                     NSKYCFLFMEFVSGGEIFNQIIKYTYFSEELSRHVIRQVAFAVKYLHDNGIVHRDIKP
                     ENILFEPSVYRQRSKKEQLRARRVSDDNNKIDEGEFSIKTGAGGIGLIKLADFGLSTV
                     LPNASALAKTPCGTVGYTSPEQHMNVGYDKKVDMWALGCVLYTMVVGFPPFYSNDQNT
                     NDITEKVMNGRYEFLKPWFDEVSDGCKNLISNLLTVDPEKRYSIEQMINDPWFNIGYD
                     DVPIGGKVSTPAADAPQSTYNNELYQKFSESLINTNNVDDYFSGNQTSNSKDGNGLLT
                     PRVPLLTPRAEAIKLVFDTAKRVTPMSRSVSPSRSDGEKSLSSLDSYMNKMREDMLLT
                     SITDNKVITNRLEEEDDEDDGDDDDNDDDDDEDVSLDSSNDDNDDTEEYPVTLTSLTK
                     IRSPALKKSNHVGLASPTPLSPAASHATAETLTTHTSVTRQPSMKSFKSILNGDHGTS
                     SATAAEKASEYSRPRKTSISFSINEHSRRSGSITSSSSHLSHTSSDLGGSADFINAHP
                     LVVNEIEEEDTEDETTDGNTMNLSTPHNNKLKHEEFRAKCMAHTPYVPHDEGEDKHVL
                     EDTSSVSEGSRRSTPPNELINRLAPQISLEQKLQEHSVVNLQMDTSTILARRKQKIES
                     "
     gene            complement(<156723..>157673)
                     /locus_tag="C5L36_0D00860"
                     /db_xref="GeneID:40385177"
     mRNA            complement(<156723..>157673)
                     /locus_tag="C5L36_0D00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466965.1"
                     /db_xref="GeneID:40385177"
     CDS             complement(156723..157673)
                     /locus_tag="C5L36_0D00860"
                     /inference="similar to AA sequence:RefSeq:NP_116662.1"
                     /note="PKUD0D00860; similar to Saccharomyces cerevisiae
                     YFR007W (YFH7); ancestral locus Anc_8.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322825.1"
                     /db_xref="GeneID:40385177"
                     /translation="MFGSVVKTMDIEDLGELLVEKSKNVSRLVLVMYGTPGSGKTTNA
                     ERLVNYLNNKYNNGAVLDTDKITHFIEEKGLKAKRKYEGRGGPQTRICEYDSTIIDDS
                     IDMSKVPFAAHLKMDGFHLPLKQLAENLHSRRGCQESFEGELVVQLFKLLVQWETEEG
                     DGNNQATGVKIEEGKPWNLLCIPDFDHKLKDPNNPGRYIFSNTKIIVFEGLYLMLNIE
                     PWCQISQIIKAIKDKKPGSHSPIVEVAQVEDNDVEEMSQRVAARHLRSGLVDSLNDGL
                     NRYFANDSINASVVTTLSNHDFDDYSINTSGKTKVYCRSN"
     gene            complement(<158141..>159955)
                     /locus_tag="C5L36_0D00870"
                     /db_xref="GeneID:40385178"
     mRNA            complement(<158141..>159955)
                     /locus_tag="C5L36_0D00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466966.1"
                     /db_xref="GeneID:40385178"
     CDS             complement(158141..159955)
                     /locus_tag="C5L36_0D00870"
                     /inference="similar to AA sequence:RefSeq:NP_012466.1"
                     /note="PKUD0D00870; similar to Saccharomyces cerevisiae
                     YJL069C (UTP18); ancestral locus Anc_1.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322826.1"
                     /db_xref="GeneID:40385178"
                     /translation="MADIASRGIEMTKEAAAEEKETVTILMDNKEVEIPAPDEEELYL
                     EKLVFGDAEGFANNLKNVDNFYDDDDDFEEEDGNQFRFSDSEPDEFLDTLANKQEYGF
                     DEFDKDSEDEDGEEDNQLEQLNDDQLFFNDSEAESDAMDLDEPADGSDAEAEDSEDED
                     VWEDSDDEKLVVDVNSFDRLRKLRETEEERFLTGLEYVNRLKKQYRSTFKVPEWATRE
                     YEDDIEDKTMNNSDDETTSNGQANLLFDKVGPHEQRATVTSSSNPLINFLAQNQTYNI
                     TNETTRLLNPERINIDRLVDANITKRSRSSIQSLSFHPTQPLLLTGGFDRTLRVYHID
                     GKTNNLITSLHMRQSPVQTCLFLKDPETGLTTILSGGRRKYMFKWSIDMGVIEKITRM
                     YGNENKQRSYEHFKASRDGKLVALAGNSGWVNILSVETAQWIQGFKIEGTLVDFEFVN
                     HDRLLVVNQAGEVWEFSLQTFSIINRWTDVTGIGITRIRASPNGRFLAIGSNTGFVNV
                     YDRMKDNRLLKSISNLTTTISSLEFSHDSQVLCIASRAARDALKLVHMPSCNVFKNWP
                     TNATPLGKVTAVAFSPSGGFLATGNEQGRVRLWRLLDL"
     gene            <160204..>160485
                     /locus_tag="C5L36_0D00880"
                     /db_xref="GeneID:40385179"
     mRNA            <160204..>160485
                     /locus_tag="C5L36_0D00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466967.1"
                     /db_xref="GeneID:40385179"
     CDS             160204..160485
                     /locus_tag="C5L36_0D00880"
                     /inference="similar to AA sequence:RefSeq:NP_076894.3"
                     /note="PKUD0D00880; similar to Saccharomyces cerevisiae
                     YJL062W-A (COA3); ancestral locus Anc_1.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322827.1"
                     /db_xref="GeneID:40385179"
                     /translation="MHPSSLARNMMSNKGYYEPHTYRMSPAMLRARQPYFVKNMIGLA
                     VLVAIPVGIYMYTYNFLNQDDFDDIPIPPLDEETIKELQREYAETKNKK"
     gene            complement(<160604..>161128)
                     /locus_tag="C5L36_0D00890"
                     /db_xref="GeneID:40385180"
     mRNA            complement(<160604..>161128)
                     /locus_tag="C5L36_0D00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466968.1"
                     /db_xref="GeneID:40385180"
     CDS             complement(160604..161128)
                     /locus_tag="C5L36_0D00890"
                     /note="PKUD0D00890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322828.1"
                     /db_xref="GeneID:40385180"
                     /translation="MDLGYSSDSDSEVEDHHTEDRKQEDVPLDVTKVFAFQKLGCRVA
                     RPDRVDIADTFRKVLDQRIENSENDEDVPSSDELNLEEEKGQQLDGVPAQGEVAEFDM
                     GKFYKENQEAIESGGFSETQQQNSGKITLHRGTHGVGRLDDVIRFNINNREKIMYQNS
                     ARIAKEKAAAKNKH"
     gene            complement(<161264..>162820)
                     /locus_tag="C5L36_0D00900"
                     /db_xref="GeneID:40385181"
     mRNA            complement(<161264..>162820)
                     /locus_tag="C5L36_0D00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466969.1"
                     /db_xref="GeneID:40385181"
     CDS             complement(161264..162820)
                     /locus_tag="C5L36_0D00900"
                     /note="PKUD0D00900; Pfam Domains: Pyr_redox_2(2e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322829.1"
                     /db_xref="GeneID:40385181"
                     /translation="MNINKIAIIGGGPSGLVTLNELLHTSKDGTSTIQSFEVEKNRIS
                     DDPAFEKIVVFEQGQDIGGVWKYSEERDPSFPKCDPNNYHRPEFVSPAFECPPSEELK
                     CTSREKPFCRDISSQSSTWTKSGIYKHLFTNVPNNLMRFSSGLDIEIPGTASHENPYY
                     PFVTHQQVLQYLEEYTRVNNLREYIRFNSTVVKLHKVDGKWRVTVLNKGDESSKDKWY
                     IEDFDAVVLATGRFNIPFVPYVEGMCEYNESHPTVISHTKAYREVEEYRGKKVLVVGS
                     SISAIDLLQYLIPAAREVWVASDRKVESGGHVKEGQWIHDILSDENAKFHRCRRIQRI
                     HTDGGVEFTDGSIQYDFEKILFATGYHLSYPFLDVPENAGKEYIRILSGKHGSENHAQ
                     TKSDGLFMHTFSVVDPTLAFVGIAHNPLIFLTSEANAMAISGVWSGSRELPPVAEQVD
                     WCAEKLDLERVGLQMIDENDLKDFIDEIYSYAPKDRVSFSYLIKEDEVERSRHVLKDL
                     FYDYTEGRRC"
     gene            <165355..>165870
                     /locus_tag="C5L36_0D00910"
                     /db_xref="GeneID:40385182"
     mRNA            <165355..>165870
                     /locus_tag="C5L36_0D00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466970.1"
                     /db_xref="GeneID:40385182"
     CDS             165355..165870
                     /locus_tag="C5L36_0D00910"
                     /inference="similar to AA sequence:RefSeq:NP_012589.1"
                     /note="PKUD0D00910; similar to Saccharomyces cerevisiae
                     YJR055W (HIT1); ancestral locus Anc_1.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322830.1"
                     /db_xref="GeneID:40385182"
                     /translation="MSFFQGLKPRNHFYNTMLCGVCHEKESKYTCPKCECRYCSLTCF
                     KDDKHKEMDNRAIEKHPIKEDTSEDKSKEVKTEDIQDPMLAKLMQSSEFQEYIASPVL
                     QFHILTVLEIINNISLTNEYSKDGRFEIASRKLNNLRLGGVEENEYVEEFVSWLLTWI
                     ENYKKENTTTS"
     gene            complement(<165880..>166812)
                     /locus_tag="C5L36_0D00920"
                     /db_xref="GeneID:40385183"
     mRNA            complement(<165880..>166812)
                     /locus_tag="C5L36_0D00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466971.1"
                     /db_xref="GeneID:40385183"
     CDS             complement(165880..166812)
                     /locus_tag="C5L36_0D00920"
                     /inference="similar to AA sequence:RefSeq:NP_009609.1"
                     /note="PKUD0D00920; similar to Saccharomyces cerevisiae
                     YBR053C; ancestral locus Anc_3.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322831.1"
                     /db_xref="GeneID:40385183"
                     /translation="MSVIESPNKQVFQVQEVYSGPHGQLLEGTTYDERTDTFFYIDVK
                     AGTVYAVANSTGSTKAAEDKIKAYKVSNTIGFVGLTTDVNKIICAVDLGITLLDLTTG
                     ETEQIAAYPNGNVVNGGQLRSNDGGIDKDGTLWIGTMEGGLHRRFGSMYLLKQKGGVL
                     TELWNECFIPNGINWDEKNGVMYWTESGEHTIYKYDYDASNNHVYLDSKTKYFVDEKD
                     PDGSCLDKDGNLYVAIYGSNKVIRITRKGEIDMEWKFPSQNITCCIFGDKDLSSLYVS
                     CGNGAAEGDLGAAIFKIDLSQLGIKGVPSHKFIL"
     gene            <167516..>170629
                     /locus_tag="C5L36_0D00930"
                     /db_xref="GeneID:40385184"
     mRNA            <167516..>170629
                     /locus_tag="C5L36_0D00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466972.1"
                     /db_xref="GeneID:40385184"
     CDS             167516..170629
                     /locus_tag="C5L36_0D00930"
                     /note="PKUD0D00930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322832.1"
                     /db_xref="GeneID:40385184"
                     /translation="MKKYSLAATHVPVPLVYVQGVDDSIRPIQHETKSELNETSLKID
                     IERKLPDITNGCMTRTVSVLEAGNLREHMWWKDTNINSRPWFNVKYVDGRCTVGVSGS
                     PSILSPYRKWHKGELLPLHWMDKYYDHICTVFISFYELKNGESDFLLVNEVNRIKLSF
                     SNTMIKYVCILVNPGNGNTSHLQDVISRIHMSGNSLFVLNGGDNEARKREQTTFIKKL
                     LVGLRQYSNDFFDLQIQKLKKREIKDTCYSQEMFSTRNLIKLVMFEQFKGGSDSTTKM
                     LEYAYDRLLSLDKQLSSNKEEIYQWLDILCLHIVRSTILIDANVAFRKFMFHISTIPD
                     RKEVNNDWFAFQYLWLGNLLKSVSDPSLIPINTMLYPSKTDGLVNSRCMPNPGFIFLQ
                     AALFKKRGEIGDGSEVISLLTSSIDAFENSSNFRRVESFIYMLLGEVYFRMENYSMAL
                     NNYLVALPVYQRDKWLKIICVLLRNVCQCFIGLGRTKEASQSYIELCTYERDGEYLQA
                     LKGKIDGLELVDTNEIGLLDVKGLFGIQVGVKKFENMINDGIDLQLRITSNSKVMAEI
                     TIDQIRLDLGCREFLIANDPLLKKGYLQIVNEDGKANLDFDHELCKVLQVHLYPKKVG
                     VFRVVEVELLGHFNDLKFQTRIQITPTIERYFTWYSEDCKHQPIKIHYPSNSFKIEPR
                     IPEIKSSLKYDSVGFIGRQFPITVHFLNADKEPDVVIASVAGTASIADKEIEVVSNTK
                     LELSPNDEGTIIATFDIPQNSDILAPCIVELMFEYEVKEVVVAVRKKIRIAVADVFSW
                     QTELRPVVYPFPDLFKIDAENPGTLPMHTRRWQFRLHLKDMADTMEIEEMSFDIRGPT
                     GVSLTLNSENLQGMLKNGETQIIPVQLDVRIIERSARTIPIDMKCHVKYAVSGLTYDY
                     VVDMYKANLPHVDPRVLVYILQERKDGEVEEVDVVYLLENPTDKIFRYQTNMNPLAGV
                     EIVDYVKTSRINLLPFQQLPLKFTYKTRGKLLPEFTLYDRQYQVFVHASVADDRLYFV
                     DGQLLRR"
     gene            complement(<170684..>171094)
                     /locus_tag="C5L36_0D00940"
                     /db_xref="GeneID:40385185"
     mRNA            complement(<170684..>171094)
                     /locus_tag="C5L36_0D00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466973.1"
                     /db_xref="GeneID:40385185"
     CDS             complement(170684..171094)
                     /locus_tag="C5L36_0D00940"
                     /inference="similar to AA sequence:RefSeq:NP_014264.1"
                     /note="PKUD0D00940; similar to Saccharomyces cerevisiae
                     YNL135C (FPR1); ancestral locus Anc_2.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322833.1"
                     /db_xref="GeneID:40385185"
                     /translation="MFALRPRVPQTFRLFRNHPQLARMSTAPSELQIEVISPGDGVNF
                     PKPGDLLTVHYTGTLTNGKKFDSSVDRNKPFQFRIGQGMVIQGWDQGFAKLSLGEKAR
                     LTVPPLMAYGNRGFPGLIPPMSTLIFDVELLKIN"
     gene            complement(<171432..>171812)
                     /locus_tag="C5L36_0D00950"
                     /db_xref="GeneID:40385186"
     mRNA            complement(<171432..>171812)
                     /locus_tag="C5L36_0D00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466974.1"
                     /db_xref="GeneID:40385186"
     CDS             complement(171432..171812)
                     /locus_tag="C5L36_0D00950"
                     /inference="similar to AA sequence:RefSeq:NP_010888.1"
                     /note="PKUD0D00950; similar to Saccharomyces cerevisiae
                     YEL026W (SNU13); ancestral locus Anc_1.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322834.1"
                     /db_xref="GeneID:40385186"
                     /translation="MSAPNPKAFPLADSALSQQILDLVQQAQNLRQLKKGANETTKTL
                     NRGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKTALGRACGVSRPVIAASI
                     TTNDASAIKNQIYAVKDKIETLLI"
     gene            <172441..>172923
                     /locus_tag="C5L36_0D00960"
                     /db_xref="GeneID:40385187"
     mRNA            <172441..>172923
                     /locus_tag="C5L36_0D00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466975.1"
                     /db_xref="GeneID:40385187"
     CDS             172441..172923
                     /locus_tag="C5L36_0D00960"
                     /inference="similar to AA sequence:RefSeq:NP_010887.3"
                     /note="PKUD0D00960; similar to Saccharomyces cerevisiae
                     YEL027W (VMA3); ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322835.1"
                     /db_xref="GeneID:40385187"
                     /translation="MSDLCPVYAPFFGSIGCAAAIVFTCFGASYGTAKSGVGICATCV
                     LRPDLLIKNTVPVIMAGIIAIYGLVVSVLISSSLKQQQALYTGFIQLGAGLSVGLAGL
                     AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLMNSRATQDVVC
                     "
     gene            complement(<173132..>175123)
                     /locus_tag="C5L36_0D00970"
                     /db_xref="GeneID:40385188"
     mRNA            complement(<173132..>175123)
                     /locus_tag="C5L36_0D00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466976.1"
                     /db_xref="GeneID:40385188"
     CDS             complement(173132..175123)
                     /locus_tag="C5L36_0D00970"
                     /inference="similar to AA sequence:RefSeq:NP_012574.1"
                     /note="PKUD0D00970; similar to Saccharomyces cerevisiae
                     YJR040W (GEF1); ancestral locus Anc_1.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322836.1"
                     /db_xref="GeneID:40385188"
                     /translation="MWQQAYNEDPQLRHRTRAFKQYRTIDWPREKIIENSQYLNALKS
                     DNRPSTSDTLSSAMSFLNEISTMKLIKSRIWTGVQVWFIITIVGIVIGSIAAWLSLLT
                     EYLNELKLNWSSFAIVNFIIYMAFSVLFGVFASYSCLKFAPNACGSGISEVKTIVSGF
                     NRPSFLNFPTLILKASMLPFTIASGLSVGKEGPSVHYASCVGNVLSRSIIPWFNDSSI
                     QLSDIVTASAGSGVAVAFGSPIGGVLFALEEISSGLKLATVWKTFYMSLIAIGTLQLW
                     DPFGTGQIVMFSVRYEIDWKWGEVFWFILLGVFGGVYGRIISYWNIKYVKFRQSSIKN
                     GVLEIALLTLVTSVLSYWNIFMRFEMTNVMEMLFDPCIDTEKKQYCLTNDASLFKWVY
                     LITLLLYALIVRMVLVIVSYGAKVPCGIFVPSMTIGATFGKILGLLVGEVVDHQVNSG
                     IYAFLGAGAALSGITGLTVSVVVIMYELTGAIKYIVPSMIVIVTVRVVSVLCGNSEGI
                     ADQMIKFNGIPYIDLKEEHNMDGVIGDVMVRQVYCIDVDIEELDYERILEFGKKEYPV
                     IKNGALVGVVDRESIKELRCDYVSVEIDADTSTVFDIFTQLGPRNVYVTKNGQLVGLL
                     SRKDMIRYEIYSKFEPQDNDNLEWLASLYTSIREHLNPF"
     gene            complement(<175541..>176311)
                     /locus_tag="C5L36_0D00980"
                     /db_xref="GeneID:40385189"
     mRNA            complement(<175541..>176311)
                     /locus_tag="C5L36_0D00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466977.1"
                     /db_xref="GeneID:40385189"
     CDS             complement(175541..176311)
                     /locus_tag="C5L36_0D00980"
                     /inference="similar to AA sequence:RefSeq:NP_010890.3"
                     /note="PKUD0D00980; similar to Saccharomyces cerevisiae
                     YEL024W (RIP1); ancestral locus Anc_1.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322837.1"
                     /db_xref="GeneID:40385189"
                     /translation="MRVTGEWVLFEKFKVVETVQTFFTVNVGLTSTYTYKAFRSSQAM
                     LSRLSIRSAKSVSFVRGISSTVPALKSTYDSPDFSHYLNKSKGSNDKSRDFTYFMVGS
                     YGLLGAAAAKSTVEAFLSTMSASADVLAMAKVEVKLNAIPLGKNVVVKWQGKPVFIRH
                     RTPAEIEEANAVDISTLRDPQADSDRVKNPEWLIMLGICTHLGCVPIGEAGDFGGWFC
                     PCHGSHYDISGRIRKGPAPLNLEVPEYEFADEETLVVG"
     gene            complement(<176431..>176934)
                     /locus_tag="C5L36_0D00990"
                     /db_xref="GeneID:40385190"
     mRNA            complement(<176431..>176934)
                     /locus_tag="C5L36_0D00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466978.1"
                     /db_xref="GeneID:40385190"
     CDS             complement(176431..176934)
                     /locus_tag="C5L36_0D00990"
                     /note="PKUD0D00990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322838.1"
                     /db_xref="GeneID:40385190"
                     /translation="MKIYRSKVIAIHGDPEVGVAEETVTGGDFDNMHATVVDAEPLPG
                     SIKAVSQKMSPSVSKKRKVPRTEKNPKPPSKAEPQGVTTTTTAATSSCVLAPISSSSS
                     AASSISSQYLETLERILREAQQREREITENFQAKIAVAHAQKEAEMEQLARDVAEQVA
                     HAGAQMQ"
     gene            complement(<177299..>178501)
                     /locus_tag="C5L36_0D01000"
                     /db_xref="GeneID:40385191"
     mRNA            complement(<177299..>178501)
                     /locus_tag="C5L36_0D01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466979.1"
                     /db_xref="GeneID:40385191"
     CDS             complement(177299..178501)
                     /locus_tag="C5L36_0D01000"
                     /inference="similar to AA sequence:RefSeq:NP_014333.1"
                     /note="PKUD0D01000; similar to Saccharomyces cerevisiae
                     YNL066W (SUN4) and YIL123W (SIM1); ancestral locus
                     Anc_2.239; intron in 5' UTR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322839.1"
                     /db_xref="GeneID:40385191"
                     /translation="MKLSNTCLFTIASLLVSVKASDEECTTTATTVHMHHQHKRAVAY
                     DYVYVTVTVDGDGNTYEQSTTSTSTFEQPTPSNIPTSSSSSSSSSSSALSSTSEDDSS
                     SSSSSSSSSASASSSSSSNSKGYSYSSSGDLGAYQDPTDDFEDGVIPCSQFPSGNGVV
                     ALDYLGFGGWSGLYHDDTSTGGSCEDGTYCSYACQPGMSKTQWPSSQPGNGVSVGGLY
                     CKDGTLHRTNKDTTHLCEWGIDAARVVSEIDQSVAICRTDYPGTENMVIPTIVGPGSE
                     NLLTTVDEDTYYTWQGKKTSAQYYVNNAGVSQTDGCVWGTAGSGVGNWAPLNFGAGYT
                     NGVSYLSLIPNPNNRDAANFNVKIVAYDDNSVVNGECVYENGSYNGNGQDGCTVAVTS
                     GKAKFVFY"
     gene            <180321..>183176
                     /locus_tag="C5L36_0D01020"
                     /db_xref="GeneID:40385192"
     mRNA            <180321..>183176
                     /locus_tag="C5L36_0D01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466980.1"
                     /db_xref="GeneID:40385192"
     CDS             180321..183176
                     /locus_tag="C5L36_0D01020"
                     /inference="similar to AA sequence:RefSeq:NP_010311.1"
                     /note="PKUD0D01020; similar to Saccharomyces cerevisiae
                     YDR028C (REG1) and YBR050C (REG2); ancestral locus
                     Anc_3.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322840.1"
                     /db_xref="GeneID:40385192"
                     /translation="MSQEVFNEGPTTSQHIESRDDSHFQSTTFKLKRTRSMGLLDNFI
                     TPQSSTPCGGNSSRSRDEIDHACNPTQRSIPNSKLTSGSFIPQESLNKLNLQKDAAPI
                     HVRYRPISLPSQPSSLTNNANTSCSHYMNRNLKVNSPQSFQSDDFSDDYNNSEDSVSS
                     QSSVSLIPKHQLKRKQQQQQQQQQQQQQQHQQHQDRYRSDNEKNKNSDDYDDHLHHHQ
                     DLTNLLHDDIDVKDAPDKHVDYLTHKWAEDEISKSWKYVTLRRSAVADSARLENASWR
                     TWAQTRSNLKTISPEELNWSKDTDVTWLYGPVIESQSIKLNRNHQNGSGNSLNFDNTN
                     HSSNTDSYHSEMTNAGHTNHNNDDKTNKVNNNSSRSSSSSCDNNTETDTIRSSHGGSG
                     FKNTDNNANIPGNENYSLLSNNNNNETNSNPNPSGEHLKSILKKKSKVEKMIGGSSYS
                     RLQHLLENRERKNSSDDYYSSPNLEPTTPIYNQKCSPIDSTSNLSNNLSFNFSNSNSN
                     STITSNKVLPMKIKSSLKNSLLNIKEKNDSNQSIGKKEKHIHFNLRVDQCIALENGDD
                     SGVEDLDNDKIPSISKYMDNEYESTKSYESDNDDSDGDDEHDDNDNGNYDNDNEDDEY
                     DYDDDDDEGFVLKPTLHSFSGTGDMTTIAPLPSTVLKFASDDEMTEPVRHSSSQDRLF
                     TTSHNTKTNRGYDYYYDYNTVYSNNSNPLVYSTPNADVEMVDVPKDFQLGAEPEFSQS
                     VSPSTSTTVNNSPDQQMYDVPLALQQTRSDSSSYDNSSFPNSDSDGYFYYDYDRFNEG
                     LSLKRSASIGSHHGSSQSVSSIKVGLSGLDLTSTGLRASTGLGSKPQLCQMAGLQTSQ
                     SNLHSKESGSSFGENQAPKDMKRKFIFDDSEDSFSDNNRMDVDEIVSAVKSNSSIGSL
                     ADINRQFSGLTRRNFGLNNQAKSGFSFGSDSDSESSQ"
     gene            complement(<183734..>184600)
                     /locus_tag="C5L36_0D01030"
                     /db_xref="GeneID:40385193"
     mRNA            complement(<183734..>184600)
                     /locus_tag="C5L36_0D01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466981.1"
                     /db_xref="GeneID:40385193"
     CDS             complement(183734..184600)
                     /locus_tag="C5L36_0D01030"
                     /inference="similar to AA sequence:RefSeq:NP_012142.3"
                     /note="PKUD0D01030; similar to Saccharomyces cerevisiae
                     YIL124W (AYR1); ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322841.1"
                     /db_xref="GeneID:40385193"
                     /translation="MKTVLITGCSSGIGYQLALEFAKRGYLVFACARSIGPLQELASK
                     YPENIIPFTLDISSLDSINRGYEFVKFQLEERKLDGLDVLYNNAGSSCTFPAIDVPDQ
                     ALVQCLEVNIAGHVRMTHAFSRLVIARKGTIAFTGSAAGYCPFPWGSVYGASKAAIGQ
                     YASILAFELEPFDVKVKHFITGGVKTNIADKRPLPEDSIYNIESMRVAFEERQKFAER
                     NNPLPADVYAKQAVDAIEKGWRSTVDVYLGTWRSLPRIVAIVPRWLILAIFRVKFHLH
                     SVWRELRHLKSD"
     gene            <188986..>189990
                     /locus_tag="C5L36_0D01050"
                     /db_xref="GeneID:40385194"
     mRNA            <188986..>189990
                     /locus_tag="C5L36_0D01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466982.1"
                     /db_xref="GeneID:40385194"
     CDS             188986..189990
                     /locus_tag="C5L36_0D01050"
                     /inference="similar to AA sequence:RefSeq:NP_011317.2"
                     /note="PKUD0D01050; similar to Saccharomyces cerevisiae
                     YGL198W (YIP4); ancestral locus Anc_8.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322842.1"
                     /db_xref="GeneID:40385194"
                     /translation="MSYNKLETTDNVDFGSSPTDVHGDDYEDIFIEPDVPTNSNKPNE
                     PKLTPVEPAPINEPQSGSTPFFNFSNFIQPQLPSFVQIETRERPFTGGNTLDESVLTT
                     LHRDLSTIGDKLMSVLWPVRLRNALLSVKKIVGNDVEDAIVSEDYSTETMKKIRDWDL
                     WGPLVINLAFSVIITYLQSRNLDNDRKNDTSSAIFSGAFTLIWGSLSILSLNIQLLSP
                     VQQRLENGAMTDGVVGLSFFQCISLLSYALFPVVLGGLISIFVPFKFIRMIVCALMLA
                     WSLLCTWLIVAIVSNCKKRGSLTIVAESDDSEGDKRIFLMVYPVFLVFALFSWFCVIV
                     "
     gene            complement(<190009..>190548)
                     /locus_tag="C5L36_0D01060"
                     /db_xref="GeneID:40385195"
     mRNA            complement(<190009..>190548)
                     /locus_tag="C5L36_0D01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466983.1"
                     /db_xref="GeneID:40385195"
     CDS             complement(190009..190548)
                     /locus_tag="C5L36_0D01060"
                     /inference="similar to AA sequence:RefSeq:NP_011332.2"
                     /note="PKUD0D01060; similar to Saccharomyces cerevisiae
                     YGL183C (MND1); ancestral locus Anc_8.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322843.1"
                     /db_xref="GeneID:40385195"
                     /translation="MYNIREVETIASKKTGICPMQIKDVLRNLVDEGLVNCEKCGTCN
                     IYWSFQYTVVKKIKQEHERMMERKEQLQDIIRNYQCELEILQRDRLLKDAERDNLLRQ
                     LSELSSVNSLLVSKLASTMANNPIQLTSRERHIQEVQEAVDMMVDNIEILISFIYEWN
                     PCGLSKSEIRKYFRVPEDL"
     gene            complement(<190859..>192121)
                     /locus_tag="C5L36_0D01070"
                     /db_xref="GeneID:40385196"
     mRNA            complement(<190859..>192121)
                     /locus_tag="C5L36_0D01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466984.1"
                     /db_xref="GeneID:40385196"
     CDS             complement(190859..192121)
                     /locus_tag="C5L36_0D01070"
                     /note="PKUD0D01070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322844.1"
                     /db_xref="GeneID:40385196"
                     /translation="MEELNREPMSLVDVSTNLVAVCDFIIKNQHENLTKGNQNEYSKN
                     GKKYKMTSRGNFIRVQDEDKHLVLSESYEDFKYNYSILSCYHILKQCGNLLKDYRQLA
                     LAIIFTSREIELNKWHDDTSKVSSPENANYEIFSNEDESLNYISDIDSNTRSHLILLG
                     TMILTATKINFFQTDHNVTSPSLEGYALKRIMSENFGEQSLTSLDVYNALRAFSHWCS
                     IRGIFYKLDLPNVAVDSMLIHKFQSFPEIPHWIKESTTGRYPAGCSKIALIKKSLVTI
                     SNSIYGHFIKVPENLKVKDLLKLCQDIENDPLKYHIRSSSLMITTNQSLEVSKLFPNS
                     SQWIEFVSCVLQAIGNYRLHHENKLLISNKILKVHKIKDKPVYKNTLQLVNKIKEMER
                     SNSDISDEKIIQLLGGSVTNSISQICKM"
     gene            <193304..>194089
                     /locus_tag="C5L36_0D01075"
                     /db_xref="GeneID:40385197"
     mRNA            <193304..>194089
                     /locus_tag="C5L36_0D01075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466985.1"
                     /db_xref="GeneID:40385197"
     CDS             193304..194089
                     /locus_tag="C5L36_0D01075"
                     /note="PKUD0D01075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322845.1"
                     /db_xref="GeneID:40385197"
                     /translation="MRYSNNNTMVLLFTMVVSFILGAAAVDPAETTTTPLTTDVAATT
                     PLTTDTAAATTPLTTDTAATTPVTTDTAATTPVTTDTAATTPVTTDTAATTPVTTDTA
                     ATTPVTTDTAATTPLTTDTAATTPLTTGTTAPTTKTTATPKTTTGTATTRTTTPGAVT
                     TTTPAAATDTGDYYVPVITPTTTLPVTPKTTDLTTSTSDPATIVWKTKTIGTITSVYS
                     VAWVQTFTSMYSTVSTPPRGTIGLGTLKGTVGTKRSYRTVNYN"
     gene            complement(<194339..>195499)
                     /locus_tag="C5L36_0D01080"
                     /db_xref="GeneID:40385198"
     mRNA            complement(<194339..>195499)
                     /locus_tag="C5L36_0D01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466986.1"
                     /db_xref="GeneID:40385198"
     CDS             complement(194339..195499)
                     /locus_tag="C5L36_0D01080"
                     /inference="similar to AA sequence:RefSeq:NP_009838.1"
                     /note="PKUD0D01080; similar to Saccharomyces cerevisiae
                     YBR279W (PAF1); ancestral locus Anc_1.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322846.1"
                     /db_xref="GeneID:40385198"
                     /translation="MSGKNGGRTTKSNIQYVAKVRYSNNLPPPSCPPKLLKEDSTDED
                     GNDLNTLVSSFFRKENFRNLIRLNDDLGMPINLVSLPDRETMYGLKNNGVNLELHPMD
                     QLILSDPNRTIKTQSQSVGFLRRTQYISSDIQGLPNKVSAPLKVKKEDDLDPRTQLKQ
                     VEETFNQSDDISTIKHPTKKNLKAKRVWNFLPDTSMLDQTYYDVKFMSSASISKNKHD
                     KSKDAIKSIRDPRLLTSIMREIDVNKNTKLMSFYLTDEESSKIVKEKIEDETENAPID
                     DNELEEVLKDESKKLVYRKQREYDGQVKPLEELRQLAITFDEKTKQAYYIPISGKIEL
                     KKCRIDPVLLPTIKELSYDQINMYIREPTNSEIERRDALRSEFDPMEFGTDE"
     gene            <195583..>197544
                     /locus_tag="C5L36_0D01090"
                     /db_xref="GeneID:40385199"
     mRNA            <195583..>197544
                     /locus_tag="C5L36_0D01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466987.1"
                     /db_xref="GeneID:40385199"
     CDS             195583..197544
                     /locus_tag="C5L36_0D01090"
                     /inference="similar to AA sequence:RefSeq:NP_012445.1"
                     /note="PKUD0D01090; similar to Saccharomyces cerevisiae
                     YJL090C (DPB11); ancestral locus Anc_1.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322847.1"
                     /db_xref="GeneID:40385199"
                     /translation="MSKNINISSRAQLNIYLFDDFFFFVHVNYAYIKTPDILDWDATS
                     HMQGQRPQRSNSLLFEGLTFTTTNLTSKEKSHVAEIVSFMGGKLDNNLTSETKVLVVG
                     SLETAKTRYCLTNRTDVTLLYPDDLYEIYKRFKEKNIPEPALQILDDYPWPIFDATLF
                     CLSRLRDVSNPCFEKNYITKLIHHFGGKAISSLTPKVKYLITEKKEGKRYESAVEWNI
                     PAIHPRWIIDCCNCQRILDPRLYDISKVKLENIGKNAYVSHRNVVDYGTLVNNPIYKQ
                     VSTLNKSGSNETHLAVNPSISNSTLFSGFIFTYFGFNEQQTKKLSDVLKENGAEIQEE
                     YDLTVMYVIVPSTCVFDNIPEHIKMSQGTSDTRIVNEWFIERCLHYGKIMYDSWSSPP
                     RYLNLNYQLKIHITGFSEMEHLHITKLIRNLNLTFSMELTEDCDFLVANLTSLGLTKS
                     NSPQLFKYKCPDILTSKSNMSTSNITLTKKKINSAKNWDIPVVSLAFIWEISQTGILP
                     HILDTKWCIFAPRSMRPASNFLSYARSLSGGTFRTQNPNTQEESLGSTKYQNTQNSDI
                     QSKNQPDSTSRVPVPLPSPRKSSPKKWPKLIGTASESQLKSISMPMDDDYDFRSARRT
                     LFSEDKERKVIEFEDDFGDDLPVFKKRRL"
     gene            complement(197654..197735)
                     /locus_tag="C5L36_0Dtrna14L"
                     /db_xref="GeneID:40385774"
     tRNA            complement(197654..197735)
                     /locus_tag="C5L36_0Dtrna14L"
                     /product="tRNA-Leu"
                     /note="PKUD0Dtrna14L; codon recognized: CUU"
                     /db_xref="GeneID:40385774"
     gene            complement(<199583..>201559)
                     /locus_tag="C5L36_0D01100"
                     /db_xref="GeneID:40385200"
     mRNA            complement(<199583..>201559)
                     /locus_tag="C5L36_0D01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466988.1"
                     /db_xref="GeneID:40385200"
     CDS             complement(199583..201559)
                     /locus_tag="C5L36_0D01100"
                     /inference="similar to AA sequence:RefSeq:NP_011855.1"
                     /note="PKUD0D01100; similar to Saccharomyces cerevisiae
                     YHL008C; ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322848.1"
                     /db_xref="GeneID:40385200"
                     /translation="MVDDTYYITPHEAALAVVATAMKKSRLPFYILFINSIMGGFLFS
                     SGGMLHVMCQAGSSGLIPGEYIFVSVAQGAVYSIGLFYVIICGMELFNSNILYFSVGV
                     VRGAVTLMDLIISWFVSFWVNLASSIFVVYVICYCSGVFKEESFVFGTIAIGEVKNSF
                     TFAENILKGVAGNFFVCLAVYLQIMVKPLHVKFLMIFLPIFTFVSMGFSHAVADMFMV
                     PAAIFNNVGYGFGHYFWKMMLPVAIGNIIGGSFFGIVITWYLHLHVIEQDMKKLKLPA
                     YEETDEQPMLNMDSRVVRNPGSHVIPSEEFNSDQSSELKGYEPDETSSISKMTSRRSM
                     NTAQSLRSTRTRTSGYRPGLSRVGTLSSIRSRNSRQIRSPRGVFPVTDMGPPLEKERT
                     IAGPYTPVSPTQSNDIDDIIDDDNSNEKVDETHDRNLNETQGGIETIPDPLANEDAQS
                     AISGDGDDDNIEGEDFSNLEGVSSYVGSNDDDQPLDNPYNPELEKVSSKLMRAITRTV
                     TKDKTQDVEKGAVPKPRDDKSQRNSRDNQYNRFKDNRLFRQFTFGGGGDDQQEIHRRL
                     SDARITRKAAYMSDDIAGTHVNSVDTRVHRQKRPSTASSVNIKPLKPPKPALISKNSK
                     TSGSSASDRWKHFTHDSELDAERPVSFISEKSDH"
     gene            <202577..>203719
                     /locus_tag="C5L36_0D01105"
                     /db_xref="GeneID:40385201"
     mRNA            <202577..>203719
                     /locus_tag="C5L36_0D01105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466989.1"
                     /db_xref="GeneID:40385201"
     CDS             202577..203719
                     /locus_tag="C5L36_0D01105"
                     /note="PKUD0D01105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322849.1"
                     /db_xref="GeneID:40385201"
                     /translation="MVDFEHKTGGHGKPEITINTDFSEVGATLPLKTKQATTPIVEHL
                     LSPMKSIMSDDVLDGREAEKVKASAVQRENYLQTPLQHSSGGLFSKCFSFYRTMFTDV
                     DSHCEKLYYLFAVEIFIIFVTYTHYSTLDKRNKFLTPIVMGGVTTMIGETIIQIYKWN
                     LRRHTYRKNQGIYSKMGNDEEMQIESESSSLSAIKQKKGMSATKMNMHHRNLSNVSNI
                     DQIETEKEQLPQDLTTFSDLESLENSFIPEHCKILAWGSLNGLLSSYWIELVISLFPD
                     QPLYCVLMDQTIGVLINQTLYSLFLCLWDGEMEVCSGYSHKEDLTWEVFIENYAVMLW
                     KYMKLAWMVWPFISFFSFMILPQQWIFPLNCVCTTLFTLVLAGSRG"
     gene            complement(<204182..>206083)
                     /locus_tag="C5L36_0D01110"
                     /db_xref="GeneID:40385202"
     mRNA            complement(<204182..>206083)
                     /locus_tag="C5L36_0D01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466990.1"
                     /db_xref="GeneID:40385202"
     CDS             complement(204182..206083)
                     /locus_tag="C5L36_0D01110"
                     /note="PKUD0D01110; Pfam Domains: PSP1(4.9e-31)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322850.1"
                     /db_xref="GeneID:40385202"
                     /translation="MLMNDNKKNPNMGRHGDHPAISMTPNINNGLASDMDRRWSSQEY
                     SSMRNSAKIATIGSNNTRKGSFDATPVFSVNYNMGSINASLGSPRLMEPSADFSVPPT
                     SQTSMNAFNAFTNANTSPSKDLGGNYVFPQLSASSVTNPIGANYKATRNSIPQYTPKS
                     GSFPEHGLPQLTQEGMSFSTSPFHDHLDLSPTRLSHNSTNSIGLQQDLEVLKAGSGSP
                     PHPQRSVFEDIWKETGLKEEDAKIMDHELDQREREMEKLLQGDDDIGPPPQTNHSSFS
                     WTSPPNADMPSARRFSYDIAAGANFVPFASPTTNSDDLNMNRFNMNALQGVNNMNQIN
                     QLNNLNTNSMNALGMNDYNINQMHTLMNNMIYYKNQMQLPPQSHPSEQESLKSYSKPS
                     LGMNVYQSVEPTKEQVSQATSHVSQYLGNPSPDVLNIEKRYSYLNTSNLPHLTYPSDT
                     SYDINSYPIIACCFKNARIDVFYINPQTKKSLENLKVGDLVIVEADRGRDLGKVVKLN
                     VSVQEARLLRYAQYMNRKAAMSRDDDFHKKPILNYPKPVLRFARPEELLTIDAKINDE
                     LRAVNVCTTKVREYNLNMTIVDAEYQWDMKKLTFYYQSEVRIDFRDLVKELFRIYKIR
                     IWMSKQGDI"
     gene            complement(<206604..>208625)
                     /locus_tag="C5L36_0D01120"
                     /db_xref="GeneID:40385203"
     mRNA            complement(<206604..>208625)
                     /locus_tag="C5L36_0D01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466991.1"
                     /db_xref="GeneID:40385203"
     CDS             complement(206604..208625)
                     /locus_tag="C5L36_0D01120"
                     /inference="similar to AA sequence:RefSeq:NP_014790.4"
                     /note="PKUD0D01120; similar to Saccharomyces cerevisiae
                     YOR147W (MDM32); ancestral locus Anc_5.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322851.1"
                     /db_xref="GeneID:40385203"
                     /translation="MLLSRICTLSTWTRPCMSSLANYSHLRGLLKSTSTRRLLMCGIP
                     VGNAVDTFQRRQQVPRAYASTLLHLRTYTTKKGGPAKKRESLYTRLKYFLLRQNRPFN
                     IDEVSAFFSWILMGNVLWILVGTTTFAGVLIYVVNWIGDGEIERMVLRKLITFDNNLK
                     VDLSDKNFRVLWQDGKIKIRNLKVSNEKQGIPKHHSEYRLEISEVNLTLSLRQWLDGT
                     GLIDGIEIDGLHGNIDIVEGDQLILDNSFHDNYELSYLKIKHSQIRFNSEYFNKPLEL
                     VIFNCDLKKFRRKWMVYDFLNANSVFGSLGGSLFTLHKRQHRFAHFQGMDTHQHSDDS
                     NNVEIYKNQTVLKNNDYNFNNNDNDDNNDNGNTSEDLWKKMTRIRIDMLDLSYLNNDN
                     SKLNWINSGKAELIFDIMLPNEDDDDEIDKLKDDLNFEFSVDGFKKTCETVWRKLNDD
                     DTNEPKPSIEKNKYVVIDLKINYFDLSARFPQTIPCSSVTGKPYISSQQLQSLVTFIN
                     DEKFGLSSKNMSRINNIDNEDDQDEDNLTTITLNNTPDSTERDEDFEDTDFEDQDHIR
                     HVLPPIKFRLIQNLNDFEYVDLPSLLTFTSRGKPEEGSDEKIVKSFINTNKFIDNSMN
                     EVFSLLLLYEEEIQTKLINMYSRRSGFEILFNNFILGNLILVGLGSFVI"
     gene            <209456..>210640
                     /locus_tag="C5L36_0D01130"
                     /db_xref="GeneID:40385204"
     mRNA            <209456..>210640
                     /locus_tag="C5L36_0D01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466992.1"
                     /db_xref="GeneID:40385204"
     CDS             209456..210640
                     /locus_tag="C5L36_0D01130"
                     /inference="similar to AA sequence:RefSeq:NP_012609.3"
                     /note="PKUD0D01130; similar to Saccharomyces cerevisiae
                     YJR075W (HOC1); ancestral locus Anc_1.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322852.1"
                     /db_xref="GeneID:40385204"
                     /translation="MSSVSVRKIVIYVLSALVVVSVVSRGVHHLRAPDVKEAAQKDTL
                     FGLIGEPGRIEKKLDDLAENVLAKQENRLEKLERENQRLEKQLVEMKKPSDNLSVREK
                     LSFMYSYDVNSKFPAYIWQSWRYGLNDDRFGKELKEGEEQWSYLNPGFVHDFFNDETS
                     IAVIRYLYMNIPEVVQAYTILPHLALKADFFKYLILFAKGGVYADVDTLPLQPIPNWI
                     PENVNPNELGMIIGIESDTSRRDEWKKHYTRKLQFGNWIIQAKPGHPILREIIADITE
                     TTLRKSKEGGLLIRSDQDPEFALDVMGWTGTGRFTDVILSYFNNYMLSGIFSQITWKE
                     FTRMEVPKLVSDVLVLPANSFNADANDKMPKNVVSSDRDHPLAFVVHYRNALYATEWV
                     DN"
     gene            <211535..>212890
                     /locus_tag="C5L36_0D01140"
                     /db_xref="GeneID:40385205"
     mRNA            <211535..>212890
                     /locus_tag="C5L36_0D01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466993.1"
                     /db_xref="GeneID:40385205"
     CDS             211535..212890
                     /locus_tag="C5L36_0D01140"
                     /inference="similar to AA sequence:RefSeq:NP_009720.1"
                     /note="PKUD0D01140; similar to Saccharomyces cerevisiae
                     YBR162C (TOS1); ancestral locus Anc_8.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322853.1"
                     /db_xref="GeneID:40385205"
                     /translation="MKFSTSILYTIATALFSASTVTAGCDYIGGNYYCNSVSAIQYQN
                     LGFQGSYNDVTNMDETSCECSSEVFSFSGTMAPLDEELSVHFRGPIKLAQFGVYYPAS
                     SVQKRENNEDDGDCTTTKHVHHKHKRAAAVEYKYVTETVYQNADGNAVTSSVEQTTVG
                     GPGGATTLETQMVATPAASNDDSDAVTTSSSLSSSTSNAASSTSSSASSESSASVQGD
                     WTRSSYFTPGSADNCVFMNNMGGTSGSGTWSSCFGNSISFAASDGVSGASSAQALGDV
                     TLSSNKEFMIFSGSSCDASGGDCGYYRDGIPAYHGFGGQNKIFVFEFQMPKATDDATF
                     NYDMPAIWLLNAKIPRTLQYGNSACSCWSTGCGEFDVWEILSSGSDKLISHLHDGQGT
                     GSSDYIPRPYDSTMKGAVIFKDGDVTIVTLEDSVTFDGSLSNDDIENWISGTKTTVQV
                     S"
     gene            <213299..>213928
                     /locus_tag="C5L36_0D01150"
                     /db_xref="GeneID:40385206"
     mRNA            <213299..>213928
                     /locus_tag="C5L36_0D01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466994.1"
                     /db_xref="GeneID:40385206"
     CDS             213299..213928
                     /locus_tag="C5L36_0D01150"
                     /note="PKUD0D01150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322854.1"
                     /db_xref="GeneID:40385206"
                     /translation="MNPLELSGIPTSFKPPPVPYFLCEYCQKISDTCYFCLNQTSNFE
                     RKLYQFQLYNEPNNLPIEEVVKHCDKSFIYEENIDNADKIYEPYITRCKVEDEYDVEG
                     KRKKKDHPGFCKYCIIEGAQWDSNFYERNNSRYRGHMINTHGIHPNGTRCKLPETGVF
                     CYKWIRNHWFETSGFFCPYIGCNEPLTLGEKGHGFHEYLRHWSKCHADG"
     gene            complement(<216555..>216914)
                     /locus_tag="C5L36_0D01160"
                     /db_xref="GeneID:40385207"
     mRNA            complement(<216555..>216914)
                     /locus_tag="C5L36_0D01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466995.1"
                     /db_xref="GeneID:40385207"
     CDS             complement(216555..216914)
                     /locus_tag="C5L36_0D01160"
                     /inference="similar to AA sequence:RefSeq:NP_010572.3"
                     /note="PKUD0D01160; similar to Saccharomyces cerevisiae
                     YDR286C; ancestral locus Anc_5.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322855.1"
                     /db_xref="GeneID:40385207"
                     /translation="MFRQVLRHSTQFSNRASLNRTCTRDITTKLRFFTKPDCMLCYEA
                     NVVLENALDDVKPEMRKTIKDVEYVDISKPENRGWFDCYRYDIPVLHVERDEYKKVVF
                     MHKFDHEELVEELGQEL"
     gene            complement(<217146..>220172)
                     /locus_tag="C5L36_0D01170"
                     /db_xref="GeneID:40385208"
     mRNA            complement(<217146..>220172)
                     /locus_tag="C5L36_0D01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466996.1"
                     /db_xref="GeneID:40385208"
     CDS             complement(217146..220172)
                     /locus_tag="C5L36_0D01170"
                     /note="PKUD0D01170; Pfam Domains: SH3_1(1.5e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322856.1"
                     /db_xref="GeneID:40385208"
                     /translation="MSVPYTAIVRFPYEPDQENAADDLPLAMDEKITVTEIVDDDWLF
                     GSNMEGTRSGYFPRTFVEKLEAPVEEEKSNYEVSKEPPTEQESTESLNGAETQEEVRQ
                     NTSEPSERLREIEANIVHEPENFKNKLQTFNTATVPVIPSQKLHDDYAVKKQFPVTEH
                     HSSYIPPSFGDSKPIKKDEKIPDVVSGEVVKSSSVTEAIEEPRMTLKERLQLLQKQQE
                     EERKALEAALKRKEEKKRARHNVEPSPAEVHSEAEEVDVGAAHDENEDGVSLRTTKSP
                     DRRSSIMTAKEGEVLQDQGNALDETEEGDSNESEEDDLEDTEEEDEEELRKRRLAERM
                     AKLSGGMGMMGMMGMPMMPPSAKAKKSSQHKKEKAIVSEEEVPAPVPILPVVPGGAPP
                     IMGMPMPNSQTESHAPKSDTSEENHEENMHTNDILSSPTESAEQEDKPLREKIELTKS
                     RIGSIKSSKTNGSVTAGSSDDNGSEFEDTVEHRDQPPAPPATVHPYRPSFVSASPSPV
                     ISNSLPEKREVLPTTSTKDAPPPVPSSPPPISQHGQEELETGATTVPHIPVPSVPVTH
                     APPVPISAIATATPTAVPVMTHVPPPPPAVSQRPPPPPVPSSVPQEIPATVPPAERPP
                     ILPPLCTTDLGSPPSVTMSSPPPIPGAVPNVASPTQTRGAPPPMPPQIPAPTPGHLTR
                     ADAISRHSSVSSRPPIPPVPPTSAAPPIPKSASSVFSESSTRKHSTLHSHPEPTPGSE
                     PPCQSIETAPPAPFIQRQATRTSLESSASTPCIAPHIESNNTELWWTTESLPPQLNAL
                     ETYFEVEATEIPKRGGRLTKYLVYYILDAQLGCTTLELAYDVSEPERIMFFHESKHKV
                     KADRKKLIEEYTKYGPLAYNIAVGSLKKSFSGEYVDYIFSQLPDSVLLPIANKTYGAV
                     VYRNNNGDTKFYDDIRPGDVLVVVNATFEGSTTKHVGVLKPQVSIVTSFDAEKNKIKV
                     IEQSEGMVQQARYKLKNLASGKLRVFRIVGRDYIGW"
     gene            <220509..>225089
                     /locus_tag="C5L36_0D01180"
                     /db_xref="GeneID:40385209"
     mRNA            <220509..>225089
                     /locus_tag="C5L36_0D01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466997.1"
                     /db_xref="GeneID:40385209"
     CDS             220509..225089
                     /locus_tag="C5L36_0D01180"
                     /inference="similar to AA sequence:RefSeq:NP_012034.1"
                     /note="PKUD0D01180; similar to Saccharomyces cerevisiae
                     YHR164C (DNA2); ancestral locus Anc_5.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322857.1"
                     /db_xref="GeneID:40385209"
                     /translation="MDDSYGHPTKKAKIDSAAGPKKRLPGKSLDYSMELNENTNSPNT
                     HIPNPKNKRRGAPQILNTIEEIDLGRRKKAISISDLNTMKKQSKKAGVQTRYDSVIEL
                     RDESDVSINSSSPLKLLRSSQDFNFESPKAGKPESLQRKSGSDDNGIYWETTPQSANG
                     PTDATFKNDETITNELKLPSSPLRNVAKRNQSTDLVDSLVDPEVKSLMEKYRGNERLK
                     IRPQPYKRYKSVESNEKSDTQVPEKKLCIKSKNDLIKETHNDQIDFSDMLAQIGSKLM
                     TSGYLKVDESENKESLHEEITTSSNTHVLPGVSHEDVLGTTSAHTDCSSSDAFSDEID
                     VSEVFAQATQVPATQPPIGNIDKMSSDDPFSDDDEDLMDKIELGLTQRPVEGCRPITD
                     QTEVEVFETDSSKLMKDMGAVSLTEAKTNKYKGMISSRLQSFRSNDSAESLLRSFQLF
                     DENENRAKSSIHCDYMKRFQIKQVQQGSFKRGALSQRQIILTCLDDDENLIKIMVRDH
                     WTELDFQINDIIHVVLTHEGSSFQLVDKDRNLLIWHPDILISATRVSDAVECSRRSLI
                     SHKFNGPGEVSIPFIIGNITHNLFQKCLLHRCTEKEFVENIIEKELEVNILDIFAARK
                     SKQDIKEIIEEHFLYIREWIDEYMGNGCKHPPLGGYRPKPEYKATNILDIEENIMSPI
                     FGIRGLIDVVIEAQLKDGRKIVVPLEIKTGREYSSNRAQASLYTLLVKQKYNVNSFYA
                     SLAYTKIHQCYLVSVSRNDYIGLVNIRNQLSKYLVYAVTQLPPIESDAPCERCYSKEP
                     CFILNQLAENGILPENNNIDKAQYDIVTLGLDNERYRSFYHHWDKLITKEEGLVNFSK
                     TDLWKKSSQFRETNGGNCVGNLSVAGCEYNYANGQYVYIFERDPTIYPAIVSSHLARN
                     DRVILSDDQANFAIANGYVKHISADAIAIVTNRNWAHSALRLPGFNKEANQTFKSVLV
                     PKGTEHFVELPESVKARTYRLDKDQIAQGMSLARFNLLNLFLPDGDIRTRELLIENDS
                     PKFSNIPQFDYSAIKETLNADQLKAVDAVSKINDYCLILGMPGTGKTTVISSLIDCIV
                     KSGYSVLISAYTHSAVDNICEKLIKNSRNRGEPLNMLRTGVLSKIRPLVQQYCIYSEN
                     YRHEIKNSDEFQKTIDQCPIVATTCLGISDIVFGMGKKFDYCIIDEASQVTLPIVLGP
                     IAMADKFVLVGDHFQLPPLVLHPEAKAEGLDLSLFQILNDSHPENVIELTNQYRMCAD
                     IMSLSNELIYDGRLKCGSEVVAAQKLIIPNITELPIAGTYVERLLEPERRVIFVNEDE
                     VPTIHEISSNDKIENPGEAKVINTLIKTMLAGGINQEDIGVMSFYKAQMRHFFTALSK
                     FKDLEILTADRFQGRDKDVIIISLVRTEVIGELLKEWRRVNVAITRARCKLIIFGSKK
                     LLDGFEQFEGFMEMIENNGWSYNLTKEDVQGISMLDHKLDVILTSIYGTQNESSTHAF
                     ADESQQNSVRRLDLSSRAIRRTKILKYVIDSL"
     gene            complement(<225212..>226846)
                     /locus_tag="C5L36_0D01190"
                     /db_xref="GeneID:40385210"
     mRNA            complement(<225212..>226846)
                     /locus_tag="C5L36_0D01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466998.1"
                     /db_xref="GeneID:40385210"
     CDS             complement(225212..226846)
                     /locus_tag="C5L36_0D01190"
                     /note="PKUD0D01190; Pfam Domains: Choline_kinase(5.8e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322858.1"
                     /db_xref="GeneID:40385210"
                     /translation="MSSIPPRIATPDCTLTDNESNSSYCLLTDGDLHFLPYELGNANS
                     KNHSNASTNGRSSPRPVPNIGNLGHDYPIYSSFLNNKTVSSFDSPNPSSTHLSSMATN
                     SNVTDHISIQNADNNKHFDTIHKLLDNYKSHAIYLPNDFIPLVDNAAQNDKIKSLLLN
                     IFTHWTATDKVSIKKLTGGITNMLLKCCYSNPNTDMAETVLVRTYGNGTDLIIDRDRE
                     FVSHLVLNSLNLAPPIHARFGNGLVYGFIEGSSLEYDQLSNNTIYPLIASKLACLHKI
                     TDVNKIDESLNKLRHKFNCEAGEASQDDIWSVLLDWIEKLPMIKPMLDLCLRNMDIAT
                     EQSAMELKAILYNEVRWLQNEIGSTSINVISHNDLLSGNIIIPEIAASAREYEKYEKN
                     PVSFIDYEYMMPAPRAFDIANHFMEWQGFDCDKSRIPQFTYNKASRSYENPIVWNWCE
                     NYLNSFHSSDPTLNPYSKHFTSGNVKEVSIQHLVNEVAYHYGMPGLYWGIWACIQSEI
                     SYIDFDYASYSCERLIEYWNWKRAYLLNKAQNSATI"
     gene            complement(227097..227178)
                     /locus_tag="C5L36_0Dtrna9S"
                     /db_xref="GeneID:40385796"
     tRNA            complement(227097..227178)
                     /locus_tag="C5L36_0Dtrna9S"
                     /product="tRNA-Ser"
                     /note="PKUD0Dtrna9S; codon recognized: UCU"
                     /db_xref="GeneID:40385796"
     gene            <228882..>232151
                     /locus_tag="C5L36_0D01200"
                     /db_xref="GeneID:40385211"
     mRNA            <228882..>232151
                     /locus_tag="C5L36_0D01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029466999.1"
                     /db_xref="GeneID:40385211"
     CDS             228882..232151
                     /locus_tag="C5L36_0D01200"
                     /inference="similar to AA sequence:RefSeq:NP_014554.1"
                     /note="PKUD0D01200; similar to Saccharomyces cerevisiae
                     YOL087C (DUF1); ancestral locus Anc_3.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322859.1"
                     /db_xref="GeneID:40385211"
                     /translation="MSFFRSFSSNSSSTTVNYPNLSGNKSKYTPTASTPPTKKSLTYI
                     LNTDTDSYANGNHSIGVNSLIYNKNDQCLISGGRDGQISVWSFDEANGDDENRTDYGY
                     SQLKSRDDVKNFINSNLENDSEIANIEESIKEGLTSFRIRESTLRPKHLCHSELHHFG
                     WINDLKLLDNTTTVASCSNDLSIKLWDYQNDIKHTLGTHDDYIKKIAFTNYYKNQLVS
                     GGLDKIIKIWDVQKGEVINSHYFTEVSHSVYSLDTHNDLIIASGPSNIVTLFDRRDFT
                     KPIKQFIGHTDNVRSLILKDQCFLSGSSDTTVKLWDLRTTRVLRNFDIHDTPVWSLHV
                     SPDDNDISTFYSADKTGILMKTDLRSSDLTNSAQSGYLQYKLNEQSGITTVVADVNLN
                     HTIDEPANSSSCGINDIVEIPQLGTVWTATSSSIHNTNTNFINSWCIPDTTKFIIHQS
                     LLLNKKIAKLYGHGENEGNGESKSIASIHDTDDLVSQLSGDDLDHIDNALFSNTPGLD
                     NIFDDAKMANDLDGGVDYSGIREGDDDTSSLETSNLSGQSYLPATCFMGLLGNLNTQY
                     LMYDDSIIEEKDEINQYDPFTEVDTEWVSSKTRRISINNHFIAEEEMILVPFNEKSIS
                     NIAGTSGLVKCKVLNNRRHVAAMDQSGCVYVFDILLNRMIQRVDSTLSVNSIPSVEHV
                     WKQEQDEIIEDPDFSLSERFEAICEKIQTQETLPPWCTAQVKSGKLFITIKENDFSNC
                     EIYGDDFQNYYGDVMGSGNPPRRVNLGKVLVKSMFGGFVNTTLSNHNIELEPVESYSS
                     LSSKDSTQISVIQPPPPPNHVKIPQPAPQTRNNALEKSSKRGLFGRLKGKKDNSTSSV
                     NLNTSSNSGTSTPNSSRPSTPINTPSNIRLNKYLERIQQCQKSNELIRYLEINPDMMS
                     YMKMQEGWDEREREDNRIPRVDYHNDKSTLVIINDEVTHESRPAFRIHLEKIVNGTLS
                     DKETEKLLENLPVWVLKGLVFHIYPIASMPPQKIGFTVAPEEGSGLDQIDGEKLRLNS
                     VGLLRISGIAEFIKNKLPGNDTVELTCKGHQLSPKDTLGTIRARVWRQGGDVEFIYRK
                     Q"
     gene            <232413..>233192
                     /locus_tag="C5L36_0D01210"
                     /db_xref="GeneID:40385212"
     mRNA            <232413..>233192
                     /locus_tag="C5L36_0D01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467000.1"
                     /db_xref="GeneID:40385212"
     CDS             232413..233192
                     /locus_tag="C5L36_0D01210"
                     /note="PKUD0D01210; Pfam Domains: DLH(2.3e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322860.1"
                     /db_xref="GeneID:40385212"
                     /translation="MQYIVFFVRVIEKKMTSLPPSECCAKVAYQQGTPSGHIEIISTL
                     KCYVSSNYTTNSDKYLLIFTDVFGIELLNNKLLGDHFAQQLGYPVIIPDILFDDPLSE
                     GSTDFQRFFANHPVDKTKKCVFNFLSSFKDTFPHATFIAGIGYCFGAKYLCHHLTESG
                     IIDVGAFAHPSYIEEDEFSMIKKPLLISAAENDPVFTRESRVKSEEILKCLNIPYQID
                     LFGGVYHGFAVRGDLSKKQVKYASEKAFSDAVYWFKYHAEN"
     gene            <233817..>234461
                     /locus_tag="C5L36_0D01220"
                     /db_xref="GeneID:40385213"
     mRNA            <233817..>234461
                     /locus_tag="C5L36_0D01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467001.1"
                     /db_xref="GeneID:40385213"
     CDS             233817..234461
                     /locus_tag="C5L36_0D01220"
                     /inference="similar to AA sequence:RefSeq:NP_009712.1"
                     /note="PKUD0D01220; similar to Saccharomyces cerevisiae
                     YBR154C (RPB5); ancestral locus Anc_3.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322861.1"
                     /db_xref="GeneID:40385213"
                     /translation="MEDADRVTSRLWRAYRTIKEMVSDRGYFISQEELEMSLEEFREK
                     ICDSMGMPQRKLMSFQANPRQEAQEKYGDLGPLWVEFCDEPSVGIQTMKNFCAHITDK
                     NFSTGLFIYQKNLTPSATKAIAAAEPAVIEIFQETDIIVNITHHELVPKHIRLSNEEK
                     KDLLTRYRLKESQLPRIQSEDPIAKYLGLKRGQVVKIIRRSETSGRYASYRICL"
     gene            complement(<234512..>235216)
                     /locus_tag="C5L36_0D01230"
                     /db_xref="GeneID:40385214"
     mRNA            complement(<234512..>235216)
                     /locus_tag="C5L36_0D01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467002.1"
                     /db_xref="GeneID:40385214"
     CDS             complement(234512..235216)
                     /locus_tag="C5L36_0D01230"
                     /inference="similar to AA sequence:RefSeq:NP_009711.3"
                     /note="PKUD0D01230; similar to Saccharomyces cerevisiae
                     YBR153W (RIB7); ancestral locus Anc_3.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322862.1"
                     /db_xref="GeneID:40385214"
                     /translation="MSALLPLPEDIKHLLEEYLPGEKPFLTLTYAQSLDSRVSAGPGL
                     RTVISHEQTKTMTHYIRAHHDAIVIGISTFLADNPSLNCRYNLNKHKIRPVIIDPHFK
                     SSSKLAGSKIVENYTDGTGLKPLIVVSRDVNSSSTEEFDVVHLKCVNGRFPWEIIVKK
                     LHELGLPRIMVEGGAYIINSLLTEPKLVDSLIITIGPVFLGENGVSVSPGQNVTLENI
                     KWWTGIQDSVICATLK"
     gene            <235514..>237442
                     /locus_tag="C5L36_0D01240"
                     /db_xref="GeneID:40385215"
     mRNA            <235514..>237442
                     /locus_tag="C5L36_0D01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467003.1"
                     /db_xref="GeneID:40385215"
     CDS             235514..237442
                     /locus_tag="C5L36_0D01240"
                     /note="PKUD0D01240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322863.1"
                     /db_xref="GeneID:40385215"
                     /translation="MPFPHISHSAMIRTVPHITVAPKLSLQNCLTRGNVFQHPESRSN
                     SNNGNGIHSIKKENRSKRSTQRRFYSTSSSNSATTSAPDFQKLTEGIPKHQLPYYNQL
                     LSFDECLAHNSFFDPKTGDVPGGTAQFWDAVERIMPLYEDLLITGELNQRRVDELISL
                     LRNGLRMHRFELSKLRKNVDRDLNSPLQQMQEYLKKSLVRISNDLLSQEKNGIYEKRM
                     AISSRGLTNLFKAFTDMGLIDEATLIWNRGKKDPKLHSLFTSESVLGSVLTLLIENKE
                     FDFSEIWSIYKTIKDHKSKNDIIHSELQVAMIRACLMKGKTDVALDIFKEITSDVLNY
                     YQRKNMVLPVAVKNYMTMAHLSFIGYCQDYETANIFFQDSFENEMPYLTPIQINYVKK
                     FMYNTWVNTGDFEKVTKIWIKTWDYFEKLGKSTTAISSSLNDSYLEIFFSKYSVFNDD
                     AAIALKDLLKQYNEIKFMDEPFFNCLITKSQKWGNVNVFRSTVKVAELYNFPKTNVYH
                     RCVLKASGSVKLPIEETFGLFRKLLQSNVQLGSRSIGNADWFAFRDATIHSKEVTNDK
                     IDLYFKVLKLCCKHFLNARNFRLYMNLDVGLDKRYASVYEEMDRVNVDGVAIPELEWF
                     SECGDIVRYWQDRGVSLY"
     gene            <237841..>238788
                     /locus_tag="C5L36_0D01245"
                     /db_xref="GeneID:40385216"
     mRNA            <237841..>238788
                     /locus_tag="C5L36_0D01245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467004.1"
                     /db_xref="GeneID:40385216"
     CDS             237841..238788
                     /locus_tag="C5L36_0D01245"
                     /note="PKUD0D01245; Pfam Domains: AT_hook(5.6e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322864.1"
                     /db_xref="GeneID:40385216"
                     /translation="MSMESTMNAMDTMDAMGPINGRAETNTSANANANVNANANANAN
                     ANLNTTTAANVNDGANTNGNNNVGANTHTATNTAVNAHTAATASTGASANMNVHSSTT
                     FANTLQTTVESGIPIKRGRGRPRKYTLEERPSRPKLPPLYDAEGNIIKRKRGRPRKQV
                     DDTGVQKVKRGRGRPRKDGSILGVGVVGGITHIGHGHEGEQSHNHNHNLTHNPEHTDA
                     STVANAVNAVNAVNAVSEANKGGVGVEVDVDVGLHGEHQHQHQHQHQHHQEHTHEHQH
                     DEHEHEHENLKKDEQSENVDDDDLNLNLNLNFMGLYPGN"
     gene            complement(<239274..>240605)
                     /locus_tag="C5L36_0D01250"
                     /db_xref="GeneID:40385217"
     mRNA            complement(<239274..>240605)
                     /locus_tag="C5L36_0D01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467005.1"
                     /db_xref="GeneID:40385217"
     CDS             complement(239274..240605)
                     /locus_tag="C5L36_0D01250"
                     /inference="similar to AA sequence:RefSeq:NP_014522.1"
                     /note="PKUD0D01250; similar to Saccharomyces cerevisiae
                     YOL119C (MCH4); ancestral locus Anc_3.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322865.1"
                     /db_xref="GeneID:40385217"
                     /translation="MDSDVSSVDSRLEKDDCEQQSLIAYHKETASFPDGGRKAWLTVL
                     GAFFGLMTVFGIMDTMASIQLYIAKHQLANEKMSSISWVFSLYMFTNLSMGVITGPIF
                     DVYGFKWVLVAGTLLNCGGLYATAFCKELWQFVLAFGLCTGIGGGILMTPLLGVVSHW
                     FWKRRGLALGLANCGNVSSVYFPIMLRSLYPKLGYTKTMVIMASICVFLLMLAFVLIE
                     DRSEELNVDKEGTKWERLMDSYKHMINLKSFKEKNYTLLVIGLFLEEFSIIIAITYIA
                     TYGSVRGVSESTTYIIVTVMNASGIPAKVILNYMSDKIGRYNTMLGILAVMTISFYAI
                     WLPYYNLGGYFAFAVVYGIVFGSAYSITPVVISQISKTNEFGQRYATAYFFVAFGNLI
                     AMPIGSQFINEETVTNYNHMIIFAGATCACATVFAFASRTTMVGWKLKVWV"
     gene            <241434..>242291
                     /locus_tag="C5L36_0D01260"
                     /db_xref="GeneID:40385218"
     mRNA            <241434..>242291
                     /locus_tag="C5L36_0D01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467006.1"
                     /db_xref="GeneID:40385218"
     CDS             241434..242291
                     /locus_tag="C5L36_0D01260"
                     /inference="similar to AA sequence:RefSeq:NP_010570.1"
                     /note="PKUD0D01260; similar to Saccharomyces cerevisiae
                     YDR284C (DPP1); ancestral locus Anc_5.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322866.1"
                     /db_xref="GeneID:40385218"
                     /translation="MLEEYGQAILRWKVMDVVYVCILIVADTFFFEQISPFQRQFMIN
                     DPTIQHPFTVRERVPAMTLLALMVSVPPLIIVAVTFFTVPKRFRIQVVYISILSLFLS
                     MSTCVMVTDIFKNWIGRLRPDFLARCQPKQGLLNNVYYSAVDACTTDNWQRLLDGFRT
                     TPSGHSSMVWSSFGFISLWTYSQLSIYSHAFTSSIALTPLLYCFYVAFSRVQDYRHHF
                     VDVCLGSLLGATIAYWSYTRYFPYPWRHESHVPLMLLQDSPKKDFYSELEFNNGYLPP
                     PAHDFQLPV"
     gene            <243002..>243868
                     /locus_tag="C5L36_0D01270"
                     /db_xref="GeneID:40385219"
     mRNA            <243002..>243868
                     /locus_tag="C5L36_0D01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467007.1"
                     /db_xref="GeneID:40385219"
     CDS             243002..243868
                     /locus_tag="C5L36_0D01270"
                     /inference="similar to AA sequence:RefSeq:NP_014565.2"
                     /note="PKUD0D01270; similar to Saccharomyces cerevisiae
                     YOL077C (BRX1); ancestral locus Anc_3.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322867.1"
                     /db_xref="GeneID:40385219"
                     /translation="MSAIYKALRPSKEEKDSKVGKSTRANRQRVLLISSRGITYRHRH
                     LISDLQALLPHARKEPKLDTKKTLYELNEIAELYNCNNIMYFECRKHEDLYMWLSKPP
                     NGPTVKFHVMNLHTLDELNFTGNCLKGSRPILSFDRSFDMEPHWQLTKELFIHQFGVP
                     PQARKSKPFIDHVMTFSIVDGKVWVRNYQINEPAKVQEDVGDVDELTLVEIGPRFVLT
                     PIVILEGSFGGPKIYENKEYVSPNVVRAQAKFVAAQHARERQNQALDRKARKSAQVLE
                     HDPLSNEVLFNE"
     gene            complement(<244087..>244278)
                     /locus_tag="C5L36_0D01280"
                     /db_xref="GeneID:40385220"
     mRNA            complement(<244087..>244278)
                     /locus_tag="C5L36_0D01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467008.1"
                     /db_xref="GeneID:40385220"
     CDS             complement(244087..244278)
                     /locus_tag="C5L36_0D01280"
                     /inference="similar to AA sequence:RefSeq:NP_014564.1"
                     /note="PKUD0D01280; similar to Saccharomyces cerevisiae
                     YOL077W-A (ATP19); ancestral locus Anc_3.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322868.1"
                     /db_xref="GeneID:40385220"
                     /translation="MGANYNLLGRSIPPHYLSLATIGAVVLLAAPKPWAPAVKKEAEI
                     NASSKEEEAFVKAYLEKHL"
     gene            <244641..>244994
                     /locus_tag="C5L36_0D01290"
                     /db_xref="GeneID:40385221"
     mRNA            <244641..>244994
                     /locus_tag="C5L36_0D01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467009.1"
                     /db_xref="GeneID:40385221"
     CDS             244641..244994
                     /locus_tag="C5L36_0D01290"
                     /note="PKUD0D01290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322869.1"
                     /db_xref="GeneID:40385221"
                     /translation="MRGYTTLANTGRAFRKTRKLRDGGGLEEFLFRGQVMQVYRDMMR
                     EVYLIKDSQVRNEVRRYVKDEYRSTSHVSDLETRRSLLIGGIRNWRSVANNLGLSRTG
                     GGVAIRDGMDRDKNV"
     gene            complement(<245263..>246102)
                     /locus_tag="C5L36_0D01300"
                     /db_xref="GeneID:40385222"
     mRNA            complement(<245263..>246102)
                     /locus_tag="C5L36_0D01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467010.1"
                     /db_xref="GeneID:40385222"
     CDS             complement(245263..246102)
                     /locus_tag="C5L36_0D01300"
                     /inference="similar to AA sequence:RefSeq:NP_009704.1"
                     /note="PKUD0D01300; similar to Saccharomyces cerevisiae
                     YBR146W (MRPS9); ancestral locus Anc_3.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322870.1"
                     /db_xref="GeneID:40385222"
                     /translation="MRVTPLQMQRTRVFATIWKPQLPLHNNPLTSRFIPELERTRIVP
                     SMPTFYARNPYHEQNMARLQEVLNKHATLPFDRKSASTTWLKFKQYKEKAGGELLKES
                     EYLQLVTILKRLDAIDVELRSDEMNSLLMEYSKKTTSINESRQEAKLDDKGRAVAVGR
                     RKSSSAKVYLVRGTGEVMVNGKALNEVFPKLQDRLKVVLPLQLVEQEGNFNIHALVRG
                     GGSTGQVDALKLALSKALLIHNPLWKQRLSGAGVLSRDPRSVERKKPGKKKARKMPTW
                     VKR"
     gene            complement(<246742..>247446)
                     /locus_tag="C5L36_0D01310"
                     /db_xref="GeneID:40385223"
     mRNA            complement(<246742..>247446)
                     /locus_tag="C5L36_0D01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467011.1"
                     /db_xref="GeneID:40385223"
     CDS             complement(246742..247446)
                     /locus_tag="C5L36_0D01310"
                     /inference="similar to AA sequence:RefSeq:NP_010623.3"
                     /note="PKUD0D01310; similar to Saccharomyces cerevisiae
                     YDR336W; ancestral locus Anc_5.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322871.1"
                     /db_xref="GeneID:40385223"
                     /translation="MMETINKLLWRGMKISRRDLQRAEGFFLKAHVRHEASIYTVDQM
                     KGLDLKVPEWMFVGRCNTGKSTLINSLLGEDLARVKAVAGYTPCINVYNVGGVLRIVD
                     TPGYGVKGRAWQGELVEQWLQRGEVLGANVIVDSRRGPLECDEAVVSMLERSGVGWDG
                     VLSKGDVINDQRVREVIKEVDEFPSKFGKWLCLDGRDGKLGGGVSRLRYRVLETCFGD
                     VLLHPKVIKKGGFNCR"
     gene            complement(<247443..>248666)
                     /locus_tag="C5L36_0D01315"
                     /db_xref="GeneID:40385224"
     mRNA            complement(<247443..>248666)
                     /locus_tag="C5L36_0D01315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467012.1"
                     /db_xref="GeneID:40385224"
     CDS             complement(247443..248666)
                     /locus_tag="C5L36_0D01315"
                     /note="PKUD0D01315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322872.1"
                     /db_xref="GeneID:40385224"
                     /translation="MRESSLQTLECLYNATKVYPSTTIPLPESNEKISLLETPESSLS
                     ESLSSVTSLSTPLNEDEFVDDERISLAGSPDGVYIDSDEYLTTDSESDMEAKNVFAGE
                     HGADETQQQQQQQQQQLQQQQLQQQQQHEVVEDGMKFNKVPLGPHLQDGVSSLTMLMK
                     HKVDSYHNVITKRDPGDTLVPLCIHFCQEKTDIKVSSRATVGEVTSYLVHRFHGDPKQ
                     YHYVVYMGDDGEIEDDLGALDKNRDIGGYGIDELFIVAEPRLSRDSGDADANANSDGN
                     SDGDASVVMRQTRQTRPQRQPRQPRPSPPVLVWTVQRRVSTALKVRAFKVRGMVVTLG
                     DGVLKLESVGDGRVRVFGLGSIIRVKVVEGPLLKIKVVRPGREGYKRYLLEADSALEA
                     QSIVQEISERVEQYK"
     gene            <249034..>250470
                     /locus_tag="C5L36_0D01320"
                     /db_xref="GeneID:40385225"
     mRNA            <249034..>250470
                     /locus_tag="C5L36_0D01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467013.1"
                     /db_xref="GeneID:40385225"
     CDS             249034..250470
                     /locus_tag="C5L36_0D01320"
                     /inference="similar to AA sequence:RefSeq:NP_010967.3"
                     /note="PKUD0D01320; similar to Saccharomyces cerevisiae
                     YER048C (CAJ1); ancestral locus Anc_7.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322873.1"
                     /db_xref="GeneID:40385225"
                     /translation="MVVDTEYYDILGTTPTATPLEIKKAYRKAALKWHPDKNPSPEAE
                     SKFQQIAQAYQVLSDEEKRKLYDEIGKEEMEKAPGGVAQEDIDPREFFTMIFGGEKVK
                     EWVGELAFLEMLFNQETETEMSDSTHMTLHGGKKSRDVADGSNAGAGGDGVGNKPQMN
                     AETIKRQRELEEKKVHELAEKLITKMKPVIAVGNDKDSEDYHLYIKDITNEIEEIKLE
                     SFGLEICHLIGRIYIFKATAFLKSKKMFGGIRKIGSNFKQSKETVKGMLDMISQATEA
                     QNTLEALQALELTEEEEDPYKRAQYEQAITGKVISVAWASSKFEITQTLYAVCNLVLN
                     DKSVPLHERKLRAELLAITGAYFANAQRDADEDGDAMVFEKLMKDANLMKARDLKREA
                     ALKARQRMRQGQDTKGQETKSQPTLEHTTHGAAGSATPTVSTGDTVPGGNATTTSSGS
                     MEHASPPGSHAHSRSGSGFFKKFKVKFK"
     gene            <251364..>253424
                     /locus_tag="C5L36_0D01330"
                     /db_xref="GeneID:40385226"
     mRNA            <251364..>253424
                     /locus_tag="C5L36_0D01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467014.1"
                     /db_xref="GeneID:40385226"
     CDS             251364..253424
                     /locus_tag="C5L36_0D01330"
                     /inference="similar to AA sequence:RefSeq:NP_010966.1"
                     /note="PKUD0D01330; similar to Saccharomyces cerevisiae
                     YER047C (SAP1); ancestral locus Anc_7.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322874.1"
                     /db_xref="GeneID:40385226"
                     /translation="MSILSKKQVVFFTCPLAIVDNMFRQKKERARDRLGTMQDLYRGV
                     TNANWAALSLQQNGHLKHALQSWLDLNSYADECVQRLNEELIGVQLAPEEKLILDELN
                     KLRAEVEDNYQSCRKLVQEQQNLQQIQQQQNLQQIQQQQHLQQIQQHHQQNHVQHTLR
                     SGNGVVHPMRRGNRMIKSLRPGGATNYSTTSTPTSSTPSATSPTHSATHLSASTSNIH
                     QNSASARHAANLIWSPSNSLTPRDEFADFSSTSTISDRSKAALKAAAKVKPPRRPYKP
                     KPEQTRSFENKSPPTTNASRSNSPASQSAPPELDPEFDHNYSGGLPPSRRGKQPQIRG
                     KDSQQPPLEAVEPSKDELNDDDALLKKIKGVDIRFTRSILMESNRDQDKVYWSDIAGL
                     EQAKESLMETVVYPFLRPDLFRGLREPVTGMLLFGPPGTGKTMLARAAATESNSTFFS
                     IQSSSLASKWYGESEQLVRALFEVAKAKAPSIIFVDEIDSILGQRSGDGEDNAASRVK
                     NEFLVQWSDLSKAAAGRVDDEGDNGNGDSNGDGNVGNSNSPARVLVLAATNLPWAIDD
                     AARRRFVRRQYIPLPEPETRRAHFQKLLSSTPNDLSEEDMDELVALTEGYSGSDITSL
                     AKDAAIWPIRELGPRMLGLKEVEIRPINLSDFKKSVQNIKPSVNQEGLRKFEEWAHEF
                     GSRG"
     gene            <254287..>255318
                     /locus_tag="C5L36_0D01340"
                     /db_xref="GeneID:40385227"
     mRNA            <254287..>255318
                     /locus_tag="C5L36_0D01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467015.1"
                     /db_xref="GeneID:40385227"
     CDS             254287..255318
                     /locus_tag="C5L36_0D01340"
                     /inference="similar to AA sequence:RefSeq:NP_012284.3"
                     /note="PKUD0D01340; similar to Saccharomyces cerevisiae
                     YIR019C (MUC1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322875.1"
                     /db_xref="GeneID:40385227"
                     /translation="MNSKLIIAVASALFGTVNAVPTTYSNSSITPVDFVSGTYPDATP
                     VDVHPRCPNLNFNWKNQGTVYPPAAGEVTSAESLGNGDYEIVFQFHAADCPPISNLDQ
                     LAIIGVDSPEKQTYLLHDSNQKINRIVDSCSWAAKFVVYGEKENNKVCVPGFQIHYSW
                     FSGLASSEYASSFKYNEAYEYSMGCVHDNNNNAQTDFPQYCFDADILPSTPSNSSSIP
                     ATSAPASTSSAPQTCLPAWSQCGGQDWLGISECCGDFVCEKSNDYYSQCVPKQTTLSS
                     SAPCTITLTRSSSSSTATASEVTLPASQAELYYQCGGKSWSGPTACVEGATCSSMNPW
                     YYQCVQTAY"
     gene            <255579..>256793
                     /locus_tag="C5L36_0D01350"
                     /db_xref="GeneID:40385228"
     mRNA            <255579..>256793
                     /locus_tag="C5L36_0D01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467016.1"
                     /db_xref="GeneID:40385228"
     CDS             255579..256793
                     /locus_tag="C5L36_0D01350"
                     /note="PKUD0D01350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322876.1"
                     /db_xref="GeneID:40385228"
                     /translation="MTIVQRRYPTPQSCNGHVERYRDNAPDHKVPRQTRDVEIASLLS
                     KIESKPNFNPHLDFDPSVHLVFDPEYFKKTLSLDDLKIKKTHVPRVSNFGAALPFPLL
                     SEEAVDMILYEAFQDEVIDDFARLPNLAVNSTRLDFHIGGHARDHAPFTKAVVESPQI
                     SNIVSEFAGLSMSPIYNSETAHLNVSLATQDPTEQLDFPSTREQVEAKLKEQDLGDAS
                     QIPSSLGLHYDSTTLALVIMLELPEDAIGGQTTIVTGDEETVRIPEPKIGYATLIQGR
                     ILKHLASKPVTNHNRITFVNGYAVTGPDMLDNTALTSTKPSVLPRARFDLFYRDWVEY
                     RFSKLEAHLAYLKKKVVEDYHAGRGFNDAVFVEKCLDIERYVRQTYDEMECVNNPPYP
                     PPLFNTPYNDLP"
     gene            complement(<256844..>258379)
                     /locus_tag="C5L36_0D01360"
                     /db_xref="GeneID:40385229"
     mRNA            complement(<256844..>258379)
                     /locus_tag="C5L36_0D01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467017.1"
                     /db_xref="GeneID:40385229"
     CDS             complement(256844..258379)
                     /locus_tag="C5L36_0D01360"
                     /inference="similar to AA sequence:RefSeq:NP_012225.1"
                     /note="PKUD0D01360; similar to Saccharomyces cerevisiae
                     YIL039W (TED1); ancestral locus Anc_7.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322877.1"
                     /db_xref="GeneID:40385229"
                     /translation="MDRVQILHALFLLASPMCLVSRLNSSVGAWRMGIIGRLALLATL
                     LAIALQTYIYTYPSLNASQCYWSHEYRGDLTPMQEQLISIPYIGDLYKQYFMVDQGTK
                     PGLELEEGQPRDIRMMTVGDPQLNGNWPSTPYMKRLDNLGNDYYMRHIYQVMKKRLDP
                     TFVTMMGDLLSSQWIGDSEFFNRTRRIVNRSFPRPERQVLTQLEICDKHEDLDWMGYF
                     YEFYDNLNKGFFKDPNFYHFENVYDWDSEGSFLDKETGLNKEPLFLNVTGNHDIGYGD
                     TTFQHMCRWSTLFGKSNYWIEYDNDTSHPWRIVMLNSLAIDGPMLEPVFKDYVWQFIE
                     TLERRKYNGSTILLTHVPMYKRTGLCNDGPRFEYYEAEGCHGCSPSRVGLLKSQNHLS
                     EEATQRILNAVFREGKSGIILTGHDHYGCDNYYNYQEETNQWVASKTIDSMKWIREVT
                     VRSIMGDYHGTMGIMTGHFDKNSDAWEFDYSECRFTIQHVWWAAHICTLIALLLTSIS
                     IFV"
     gene            complement(<258599..>263251)
                     /locus_tag="C5L36_0D01370"
                     /db_xref="GeneID:40385230"
     mRNA            complement(<258599..>263251)
                     /locus_tag="C5L36_0D01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467018.1"
                     /db_xref="GeneID:40385230"
     CDS             complement(258599..263251)
                     /locus_tag="C5L36_0D01370"
                     /inference="similar to AA sequence:RefSeq:NP_011631.1"
                     /note="PKUD0D01370; similar to Saccharomyces cerevisiae
                     YGR116W (SPT6); ancestral locus Anc_3.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322878.1"
                     /db_xref="GeneID:40385230"
                     /translation="MALEDERDTRDIRSTLIDDAAALSEDEQDQSDENISTAKRSGNK
                     NAEFDSSEEEEEEDEDEDEIRKVADGFIVDDEEEDEEGNAEDDEEAGEEGRAKHRRKR
                     HRESKARIEDELDEDDLDLLRENAGELPANISKKSQFKRLKRGADESVQGDSGAGLTS
                     MFSDEEEDDDEDIRTRPSRHESDEGDRQGEDEDEDEDDLNDAIKERQEKMNQHNLVGE
                     FDDFIEDDEFSEEDEDRDERLARMRSARAKQSQFAQQSKIDQDKLDELYEIFGDGEEY
                     AWALEAEEVEDDNSESVNDNDADEVEYDEDGNVIYKQKPSEADALKNIFEYEELKGHL
                     LTDQDQKIRETDIPERYQVLREGIENYDLNDSDFKDKQRWVAQTLFSEKLAYFQDESR
                     KHLIEPFKEAVAKMVEFISRDNFEVPTIWNSRKDYTLYTSTTDDNQIRVEKLLNENDL
                     WRIVRLDIDYHAIYEKRKTVESFFKSLDTVDLVFDECFNSATTITDLQDLFDYLQFTY
                     SAESRKNEDNKTEQELGTAGKKRKQHSRFRLYERIKNDKIYNVIKEMGIDAEKIGENI
                     VSNSKIYLTDDSEKSPTELITQYLPESYFSTPESALNAIKQMFSQQLVYNPKIRSHLR
                     TTFEQYSNIDIELTEKGRAKINDSSPYADFKYAINRNPGSFYFKPDLFLRMLEAESLG
                     YVIIKIGMKTSLSSYVDHLFTFMSSGGETENSIAWNKLRRECLDLAIQKLIPNITMTV
                     KEKIKNVCERLLYFQIRDSFIDKVDQSPYIPFSNRKGMVSKVLALTNGDGKRDSAVIA
                     IAMDFDGTISHHIKFDESIREPEFERKLVSLIDRFKPEVVAISGYNVNTSHLKKRVEE
                     IVRTNDKKAIAEEEDEYSKKEENDQDEETEVNLPVIYVPNETARLFEYSDSANAEFSD
                     KPVIAKFCIGIARYVQNPLLEYISLGDSITSIPIHKHQGLLPEHMLKEAIDSILVDIT
                     CLVGIKINEAVRNTHYSQCLQYIAGLGPRKANNLIKSIESNGGALIRRDDLILKEFVA
                     RVVFMNCAPFIEIPVPNRYDKEIDLLDATRIHPEDYDLARKMASDALDLEEEDRAEIE
                     NESGGIIGKLYDEGVEKLDELLLEGYAKQLEEHGHLKRATLEMIKEELQNNYEELRKP
                     FHIMTDVEVFEMLTNETKDSFTRGVIVPVIIQKVDNRYLLCVTQNGILGNIARANAVP
                     YGDASSLLVKFNQGQAVQAVVSNVNYAEFKADFSLLKEDIVRAKNARNGDRIKELWNM
                     EAETRDLKREREAELRENKGNKRILKHPYFRNFDARQAEDYLASRDNGEFVIRPSSKG
                     NDHLTITWKVDNQIFQHIDVVEHDKPNEYSLGRTLQVGEFKYHDLDELIVSHVNELHS
                     KVEAMKNHEKFRNEPTAEARDWLLRYSKANNNRSCYCFCFNRKAPGYFFLLFKLADTS
                     EKTYTWNVKVLPNGYMLNKNIYPDMVHLCNGFKKTVQNKMSNPHGSSNQSLQQSYAAS
                     SSQYNNGYKSGGYGGYGGYDGGQQGGNYGGYGGYENGNSHGNYGGYNAGHNYGSYY"
     gene            complement(<263522..>265066)
                     /locus_tag="C5L36_0D01380"
                     /db_xref="GeneID:40385231"
     mRNA            complement(<263522..>265066)
                     /locus_tag="C5L36_0D01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467019.1"
                     /db_xref="GeneID:40385231"
     CDS             complement(263522..265066)
                     /locus_tag="C5L36_0D01380"
                     /note="PKUD0D01380; Pfam Domains: DUF2414(3e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322879.1"
                     /db_xref="GeneID:40385231"
                     /translation="MDNHSEMATATAVEVAHEGVVAPPHEQGIEQTAEALNQELSQDA
                     QDVQEEQGQDLSTVVVPNSLHLSGVDDLSTEQIKEYIDLHIRPGYSFTNRSKYAYLEY
                     RINWINDHEVNIVFDHNENTERRRGRISEIERRRNQRNTRRGDTGDRGADLMDIINGV
                     DSNGQGESDEPSIPPHLQEKETEAAMDVEMGASANEMFAGINNEEIRGASDAILLLTD
                     YTNIRREHPQFAALTMEEQFTTVDEAPKLQNRKCWNLVLDNNGKVIKTEEATKLYNYF
                     ELIALQDLEEGQEMSEEARSAHEIVDSSTDTQSFPEEYRVIHLEVRYSTPLDKKVKNS
                     RQYSRYYLLHGEPDEIHRQPEAREDFSGRNRRVHEPDLITGEKPETQGLLGYSGDRRE
                     EDVRDIREDFEDYDSEYTDKWNSNLYYQQHSNYKDQYRDSYGPEDRDRARHRGRGRGR
                     GRGRGRGGDGYRDGYMAAGRGRGRGRGRDRYGGVQKSTHASRNNHRNMNGNMEDLFPD
                     FVPKHQ"
     gene            complement(<265574..>266617)
                     /locus_tag="C5L36_0D01390"
                     /db_xref="GeneID:40385232"
     mRNA            complement(<265574..>266617)
                     /locus_tag="C5L36_0D01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467020.1"
                     /db_xref="GeneID:40385232"
     CDS             complement(265574..266617)
                     /locus_tag="C5L36_0D01390"
                     /inference="similar to AA sequence:RefSeq:NP_009382.2"
                     /note="PKUD0D01390; similar to Saccharomyces cerevisiae
                     YAL020C (ATS1); ancestral locus Anc_7.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322880.1"
                     /db_xref="GeneID:40385232"
                     /translation="MYLVYSCGSNGNGQLGLEHENDVATPEIAFQSSLPLKSISCGGN
                     HTALLMENGDVYQTGLVNGRKTHKFELTHKDISGVVAGWDCTLKITRTGAVYNNDDTK
                     IWQGPSDVKFTIANLDSFIVGYDSGQVVCSGNNKKGQLLGDDVGGKTVEGFQELTFNE
                     LPFSNVTLVKCCLGRDFSLFVLSDGTSQYLAMRGKSDRYGLLEKLQTMVGSGALRGEL
                     GVNKTRWFKIAPDVTVVALKSMWSSVHLQYTRGNETRFCSVGNNVYRQLLQRAEHVWD
                     FQVGTEHGVTVSENRKEAHAWGWGEHGNCGVQGIDNCGELTLLYTCAADETIQQVYAG
                     YASTWIVVYKEDQ"
     gene            <266864..>271306
                     /locus_tag="C5L36_0D01400"
                     /db_xref="GeneID:40385233"
     mRNA            <266864..>271306
                     /locus_tag="C5L36_0D01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467021.1"
                     /db_xref="GeneID:40385233"
     CDS             266864..271306
                     /locus_tag="C5L36_0D01400"
                     /inference="similar to AA sequence:RefSeq:NP_009383.1"
                     /note="PKUD0D01400; similar to Saccharomyces cerevisiae
                     YAL019W (FUN30); ancestral locus Anc_7.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322881.1"
                     /db_xref="GeneID:40385233"
                     /translation="MQRRSRKIRADDVIELLSSSQENSAGDSSNNESDSESDVESAFQ
                     SRMDRRSTVRQTRQERAKVSGKQRHVSESAEESADSEDGVEDSKFSKVDIIPRLQRPT
                     TKKQNVKKSAREEVVEVSDEDSESDSPIQVPDSSPHRNPRNVHSMELDSSPIGKPTTR
                     LTSLRETFSYNPKKESPKPSISSDYRELKRTFPDIPATTIMSALKSEKTLRDAMRYLR
                     KLEPSFRSKSSNSIKSQRLASLSDANKRGRLILSSPVRADVPISNRKGLPKLRDARLE
                     RESRLREKARLIEEKKSKQIEYERALARQRAERESIKSSKVQLDNTKKSLRAQYVGNR
                     LSKHRNTKTLKGETSEEEEEKEGHDDDDRSDESLVELVESDDSHDEVAPPNRRGSKRR
                     YEDDDDYDPYSRPRTGIGRQDRQQKRRQVVEYNDEFNLPEFMADEDKYLNIDQKIIKL
                     FNNADVRDIIDLSNMTPEQATVYVQNRPYTSISSILKVDVSMGRKLSKFAKSPNERHI
                     ELIGEKLTAYSAIDTLLKQCFDYSKSITSEIRKWGVNLKGKNLNGELAITNVDIATDE
                     SDEENGGDDSGSASDNIDQDDDDVVVIKKKYKKFKLDGSEHDDDFGTSGFRPRYKSNI
                     DNSKVPDKIGYFKRKPVLLSDEISLKDYQQVGINWIHLLFQKGLSCILADEMGLGKTA
                     QVIAFLSHLKKKKYRGPHLIVVPSSTLENWLREFEKFSPTLKVIPYYGSLDEREELRN
                     VLYEDDDYDVVITTYNLTVGKIDGPFLQTLNFNVIVYDEGHMLKNATSDRYKKLTKLR
                     ANFRLLLTGTPLQNNLKELVSLLDFILPEVFGSKMSKLQLLFDKRASTKVENEQIQGK
                     NYNPLMSEQAISKAKVMMSPFVLRRTKAQVMTELPKKHTAIEYCELVPAQVKIYQEEL
                     DEVNTYRIERDRRKLLSDEELKKLPHLAKKNVNMLMALRKACMHPLLFRRLYTDKMLK
                     LMARLIMKNEDYMDANETYIFEDMQVMSDFELSQLCHQYPNELGKFVLKQQVYSNSGK
                     TKVLVDMLSKIIEKGEKVLVFSLFTQMLDILEKVLSLHGWKFLRLDGATAVDSRQTII
                     DTFYEDKTIPVMLLSTKAGGFGINLVCATNVIIYDQSLNPHDDKQAEDRAHRVGQTKD
                     VQVTRLVVKNSIEENILHMAFNKLQLDNSIMAQNTEDVLLKTVEDLIAVKKEQKDSKQ
                     EEKVITEETDNTDAFESPVTLELAAAEEEEKDEPVEIIVPELKSVKGRTRRNRRSVNY
                     FDGNDPNEFIEKDTNARTDECELVDINSVPNSPISTTEEAKNNRISNMNLQPVFQSIS
                     EPISSPSKVTESGEKTKDAEQVGDKVNEKTTANSLSCISSLTKDLVKQIKNEFIVSNL
                     TQNENAPKNTSDYGRMKLPQTGESENIAQSKVEEDSRSNPSGKENSQVIAEKNGDSKH
                     ADDEHSNSYKDSLPENNHPISCIKNEASVKVSSNSPSELSKANT"
     gene            complement(<271410..>272999)
                     /locus_tag="C5L36_0D01410"
                     /db_xref="GeneID:40385234"
     mRNA            complement(<271410..>272999)
                     /locus_tag="C5L36_0D01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467022.1"
                     /db_xref="GeneID:40385234"
     CDS             complement(271410..272999)
                     /locus_tag="C5L36_0D01410"
                     /inference="similar to AA sequence:RefSeq:NP_009392.2"
                     /note="PKUD0D01410; similar to Saccharomyces cerevisiae
                     YAL010C (MDM10); ancestral locus Anc_7.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322882.1"
                     /db_xref="GeneID:40385234"
                     /translation="MLTYMDLVQQCFYSKTGWSWDNTYEHILSTPNNLLNFPIPNGFN
                     VFVSSRNTDFNFSSISISQVDRLSGSLSYLSSSVNLDEHYRNSKALPINSVVQGYRDL
                     DSRDIKGNIYTEKPFMIYGKMYFPSKLLEGMIIKRFRPDLQLIVKFINTPKLNKLTNP
                     TTIFTIYLQRQTENSSHDFIYSTREHLFGFRCLYHFDILNSSPKLSVVGTPYSTQTDV
                     KPTENKCPSKLSAGCELWYSAGSVSPGISIAARYTTYIDTMRYLIDNLPTYTPAFINS
                     NFHPYLNPYSNGSKQVILSIPYAISTIHPLTFTMAINPLLGTLESTYAIKSEAKYTRD
                     TYHGNKDISYMGKMGFVFSSKYQFNIYSYESDLILGAQLLRSKILTWNNKEKNLKDGD
                     YKETHLIPQNKGLEHSSDIQVPKQKNALDITKISQHNVVYKVSEQEFNENNTAPATLD
                     DVNIIVEDRTDLHPQMSEADEDYISSLKLSGSIGKKNLRLSWEGKFHDWIVSSGVSMD
                     MKGQSASPRVLKYGIEFCYNS"
     gene            <273252..>274757
                     /locus_tag="C5L36_0D01420"
                     /db_xref="GeneID:40385235"
     mRNA            <273252..>274757
                     /locus_tag="C5L36_0D01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467023.1"
                     /db_xref="GeneID:40385235"
     CDS             273252..274757
                     /locus_tag="C5L36_0D01420"
                     /inference="similar to AA sequence:RefSeq:NP_009393.1"
                     /note="PKUD0D01420; similar to Saccharomyces cerevisiae
                     YAL009W (SPO7); ancestral locus Anc_7.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322883.1"
                     /db_xref="GeneID:40385235"
                     /translation="MDTRGQTRDNENCPIEIGMGMEIGQDQIDDIEDLQSPPNSPGLV
                     LPVMVPTTNEKIDFFALDGTLHKEQENENSKNEDPNPKLPVTPVAQNKSKESLDLSIF
                     RSSDSYFSRSRSHSSKPTPRLRRTSDVSNRSEGYESYASGASYDSGSVFSESDTDITA
                     SPTLKYSKKLRNQRLDNGMNIGELQNGKSVEDGIVYKTKSSGFSSDTGSQYTPVSRHR
                     SRSGSRSDSRDRGGMRSESKDKKNDDTTSQIFKNLLILEESLRQQYIEQQNLRLKYSI
                     FVVILVVVFSLSTYHGIFNSIYVQHENTTNWPTGFGTNDGDTSVSVLPTPSPCDASFV
                     CVGFPKFPTQLNGEEEGNHGLGSTTTICNTKLDSTSISPMDNEESSEGYVLINIVYRV
                     VSIITGMTLLLFYLTGEYTHKISRPRKFFVTANKGIRQLNVRLVKVKVPFKERVLNYL
                     RLRVKKNPRKGVDHIRLVLNPRVFSTANREQWELYRNQFWNLEKRKHTSIS"
     gene            <275010..>276578
                     /locus_tag="C5L36_0D01430"
                     /db_xref="GeneID:40385236"
     mRNA            <275010..>276578
                     /locus_tag="C5L36_0D01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467024.1"
                     /db_xref="GeneID:40385236"
     CDS             275010..276578
                     /locus_tag="C5L36_0D01430"
                     /note="PKUD0D01430; Pfam Domains: zf-BED(2.7e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322884.1"
                     /db_xref="GeneID:40385236"
                     /translation="MARPPNSWVWEHFQEDTSQPPNPAYTNVRCQICSKSLRYSSRNG
                     PTNLARHLTRGHNMNQPDSTPTRRPFESNRKDGSTNTSNSINSNSNSINSVSGLNGAN
                     NTNNNSNNTNNNNSNNKNGKSNLLSNARDHHKGFHNSESTSENERESSQEASNEQELS
                     MSYTTISAPKANRKMPISYSTKSIPEYQVPQQLQSDLLFQSSLNGQSERLKVQNRQTN
                     GDLGMQSSSLTTNQNDYDQFMKNVNLLPIYRMDLNKQREKRGFKPKQPLSPMNKRQSL
                     PTQISPTTLKLSNMTPGVVTSLNNSPPKQYMTIDQQFFNQQTSYMDNTDKEVDRDNGM
                     LPTIQDIPDFNSMPTMIGSPNNETLNQKHQRNELGILDGSPNKRDFRVANFDNVGGFN
                     SADNNSSLTGLVKDMSTTIEVMRKTLQQQQDKINQLEQRLSREINSHRGSGLETAYEV
                     IPAFRNDVGDLPELQNVYVLLSLPIQQLRRIANAYGLKLSDDRKELIFGIADFIGCRN
                     IKNFWDEYTRQIMH"
     gene            complement(<276760..>277026)
                     /locus_tag="C5L36_0D01440"
                     /db_xref="GeneID:40385237"
     mRNA            complement(<276760..>277026)
                     /locus_tag="C5L36_0D01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467025.1"
                     /db_xref="GeneID:40385237"
     CDS             complement(276760..277026)
                     /locus_tag="C5L36_0D01440"
                     /inference="similar to AA sequence:RefSeq:NP_015508.1"
                     /note="PKUD0D01440; similar to Saccharomyces cerevisiae
                     YPR182W (SMX3); ancestral locus Anc_7.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322885.1"
                     /db_xref="GeneID:40385237"
                     /translation="MSFQPVNPKPYLNSLIGLKVCVRLKFSGTEYHGTLVSVDNYMNV
                     LLDKDVCEIEQQEPGQSPDLTKGTPLNNQVFVRCNNVMWIGKDV"
     gene            complement(<277453..>278517)
                     /locus_tag="C5L36_0D01450"
                     /db_xref="GeneID:40385238"
     mRNA            complement(<277453..>278517)
                     /locus_tag="C5L36_0D01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467026.1"
                     /db_xref="GeneID:40385238"
     CDS             complement(277453..278517)
                     /locus_tag="C5L36_0D01450"
                     /inference="similar to AA sequence:RefSeq:NP_015517.1"
                     /note="PKUD0D01450; similar to Saccharomyces cerevisiae
                     YPR191W (QCR2); ancestral locus Anc_7.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322886.1"
                     /db_xref="GeneID:40385238"
                     /translation="MFSKSVRHFSTSAARAVSIKTVPGSAESVSTLRVSIKNAGSKSA
                     PAGLAHLLATSTFLDTPEKSALRLKREAELVGGEYSAEVTRDALVLKATFLKESLPFF
                     VNSLASTVAQSSFKPHQLAEIAAPFASFVHQTKTACPKFKALEELHAVTYRSGLGLPL
                     YFDGSKTFEVSDIATFAKSAFQSENVEIVGENVESADLEKFVSESAFATLPTGNTVVA
                     QKQQTFSGAESRIRQAGKTSAVIGFAVEDADAFELVAAGLLSNLPESITASVESKVLS
                     YEGSNLFYFAVTSTNAAEVAQFITTAAKDLKSVDFSKYSKLASALAEKEVASKQVSVP
                     NDYNLVVVGDIDAVPLKSEL"
     gene            complement(<278840..>280951)
                     /locus_tag="C5L36_0D01460"
                     /db_xref="GeneID:40385239"
     mRNA            complement(<278840..>280951)
                     /locus_tag="C5L36_0D01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467027.1"
                     /db_xref="GeneID:40385239"
     CDS             complement(278840..280951)
                     /locus_tag="C5L36_0D01460"
                     /inference="similar to AA sequence:RefSeq:NP_015516.1"
                     /note="PKUD0D01460; similar to Saccharomyces cerevisiae
                     YPR190C (RPC82); ancestral locus Anc_7.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322887.1"
                     /db_xref="GeneID:40385239"
                     /translation="MSTTKKAVKIPSELPITAKTQSPLCFLHSEILRAYIGEQGAYVY
                     SVLHSRRKQTIGELSKKTGLSIGSLKKLLTVLIQLGCAVYIKNERTGAVSYAHNEEGC
                     WKLTFADDIVRHIREKFGDNHAGVMQNVLLGGHVTIGSYVKEIELKSEIEMVEQSFLD
                     LIEDGWLIHVKGMDFTTLSENFANCVRLANREFMENSSQYTRSDDMGMGGGGGNPRFK
                     SAGLSQLKKTMIIKDIAKEKFLKLYYDNSGKEQLYRVGISNNKRSEGSSMTTLFSDDE
                     DADEQVDDGSKKLKRINGNIPLSVSFERYLKYSRDTHLVSISRHRIGNVSAMVYEVVL
                     DRIEKSTRDMRNVEHIVDRLVADASVGAGSAGSSTSGYDPSTAQDLKKRLELADQQKG
                     MNFGAADILKALSLTKRYELTKDDLLGTIMDNEEDDDVQNSRKRKLEESEANGYKKSK
                     LSKLAAQIKTFDEDEDEEEDADGKNNQDNGFDINGSSSETAELLKLILHHLKLLTTDT
                     KLSFLIETTPGQFYVPFTVLQQQLSTYHKKQLIKCILGNASLRVYNCIESKRLAEEKT
                     IAKSVLMKEGDVRRVIATLTRFGLIEIQEIPRTTDRSAMRSIFAFKLNRTLRSSRMLA
                     NCLLFNAGEVLSGVEERKDENKILLAKLSRTDVKGHESELLLPSELEQLNMISSANRA
                     DMARLQRLRHMGVLFWFTETV"
     gene            complement(<281309..>284026)
                     /locus_tag="C5L36_0D01470"
                     /db_xref="GeneID:40385240"
     mRNA            complement(<281309..>284026)
                     /locus_tag="C5L36_0D01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467028.1"
                     /db_xref="GeneID:40385240"
     CDS             complement(281309..284026)
                     /locus_tag="C5L36_0D01470"
                     /inference="similar to AA sequence:RefSeq:NP_015511.1"
                     /note="PKUD0D01470; similar to Saccharomyces cerevisiae
                     YPR185W (ATG13); ancestral locus Anc_7.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322888.1"
                     /db_xref="GeneID:40385240"
                     /translation="MASQPGVKQRWLTDREADGLARIIRNFFMKASSVIVNVRSQNAY
                     THQLEKEKELSPYLSDVEHNNSFDVNHDIKFKSNVFANPKSTVSSAEKTSYSSSHVRT
                     QSQKDMWFNLETSASDVLLNFDFHPWEIRDITLLPPMIIETVLDLTGISEFIQLYLED
                     NIITTKKKSEIVLERWLIKLDLNNYDNELIDLPLIYKNLIVLFRCLYTLIGLLPASKL
                     TESNLQDRVKLKILNGSKAITSKGRFGLSRPLVSNKPEVDIVESKDLLPVLTPIGSLD
                     LSVSYRKNCNFRLYENINIDAIDKSETHNYESQKAALVNSKFKASNTSINSLNMKRRS
                     SARPGVGFRSRSMTSSISISPPVAPLASNLILGTYPIPVKRNDSSSSVHFYHNNSGDK
                     IEQLQHGLMTSPIPGKAPSSVGSKLRNSGSRNNSLEGKLTTTANNVAAPYNPILHHFK
                     TKNKNIMSSSSDIEINNSISLNDDLNNFMKLLESKPDLRISNNSSSIYEDSLSNFKDL
                     KKNNDLFIDSSLKDSFAYSRSISSSTSPSKPPPLVGDQNTLDSTVKLLLDSKHSQNQT
                     QSFQQSQSELHQQTQKQQMGNSGQSHKIRTYSRSSRGSKGSHGSRDSRGSIGLIHHPS
                     SPKSGGITIAGIGATPNQSVHSVLKASATSESFDTVAQAPYSLQMERGVSLPSFSPPI
                     DYDKNFKVASNAASSVSPTTSHLTQHMALSSSMGRAQSLLRNLSGQSQTSFNSGLRGR
                     AGSGSSVTGSQLRSILQNSLNNDAISSRSSRKYSSSDASGKMTPQQLKDISYKQDVFT
                     SDDDGDGIDDMTDDSKSRKGSTARTRSKRAESLSNVLNNLKNMQRRQSMVVKGTVCDV
                     EEEDEEGGHLLYLDDEGGNNQEGKEEEEEEEEDDGLLFEMSDMPLSRDL"
     gene            complement(<284406..>288773)
                     /locus_tag="C5L36_0D01480"
                     /db_xref="GeneID:40385241"
     mRNA            complement(<284406..>288773)
                     /locus_tag="C5L36_0D01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467029.1"
                     /db_xref="GeneID:40385241"
     CDS             complement(284406..288773)
                     /locus_tag="C5L36_0D01480"
                     /inference="similar to AA sequence:RefSeq:NP_015515.1"
                     /note="PKUD0D01480; similar to Saccharomyces cerevisiae
                     YPR189W (SKI3); ancestral locus Anc_7.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322889.1"
                     /db_xref="GeneID:40385241"
                     /translation="MSEKREKIKKQVQSLLKGAKKELVDKDYDGCIETCKSILKLDKT
                     NFFCYLFLGKSFEAKKRPGDALKAYQKATEIEPDQALGWKGQLSIKVEDPDFKSFFET
                     VFLFTKLLISKKDPLTEAVNYIKDYVGKHGLDFQPLKVYYLRQITPGLSELGDLIGYQ
                     IENPSTSIEALIKLYNNENSTEIKKIKDSVKLSFSINMTESAKNEKYNEKIWPLLSES
                     ELPKLYELWIDLEQIDEKRYKIQNEYLEFKYNLLFIAPVVEKPRLRAEIKDLVEGMVL
                     IKCPSELAWKIHFDWLDPQSLAGLDIVQVVDYINLFGKKRGFGAILYLYLISDISPFE
                     KSKVAEYLAPGKEKAKGKTQVSKLETEHPGKLLEDVPKTGANNQSYDIFDVTPQEIFT
                     KMLSNLSQVKSSVLCCRIVLSYAIHLKDYAYALDVSTDFTNALVLLQNSRGIVLSNSK
                     MEQTLALAIIYTYYEAPKNFPKALSLYDSIWRKDPNNTKVKIGKALILVETKKYDEAA
                     EIFKSLITSDPTDVDATQEYGWCQIQLGNFELGREYIERAISTLQSEAYSKKSLNFME
                     VVSTLKYRLAMSYYMQFDGTSASLHNEATLKEYIGKCSKLLIECLKISPNHAPSFTAL
                     GLLHYNYLGKKERAIKLFYKAFELDPSQIEASYKLAEHFTSIGDWEMADLICKSVTEN
                     SKAKRQLSSSYSNIKDKAWPYRVLGCASMEFKEDVKAIEYFQSALRMDSSDISSWIGL
                     GEAYMSRGRLEASVKVFTHVIKLQSGVLEKDVEITPEMEKKADWHVVYLLAVALTNML
                     EFENSIRILTNLLDTNEEQRNNSCILTLLIETLILRCDAEIERGAILRASDTLLSTFS
                     YLFHAFDLENKSTKLWKALGDLLRIALTVRSSISRVPFSKVHNLVSNFMTEKDEMWEL
                     VNFEEFQIDDLMKKEKFPEVCHIYYSLSCIGGYLCTKEGAVKTLRSSLLFNIAISFIS
                     WYRDSLRERYVDTSIRLLNKCVKLEPENSEYWNCLGIVSMGKNPKVSQHCYIKAISIE
                     SKSPIYWFNLGMLYIKYGDYELAKNCFTRAQSIGATNCVPWAGHALICKKAGDIENAR
                     NLFTHSYVLSRGTNPSMTILYAISVLEEIVSEGDDERNLEAVEKLTSVNYGMINYLKL
                     FPSDTFALELTVKIIERLYSFNSGIEYSKNLCQLYEQEYEETESERILINYCMAKCQY
                     SRFLLAKQEYVKASEVCDDVGSLLDTISDITMQVQRCMLSCFTVFGLSLYFQGDYERS
                     LEEFRKLVDAFPENERIVVLISQVLFASGDEAAKQEAMDELLNNIATQGTSLIVAMTI
                     AAISLVEDLTEYIDAVKEVLDQLPLDTLIRDSHREIPKLLIMISKRITAKQPGTRVNR
                     TWQRNAVLFPGDISVWSHVDSEVALELSIHTKKDCAMDVSDAYAKVKRLREAQRSILL
                     SGGVNEKALAELFSLVGKA"
     gene            <288996..>289457
                     /locus_tag="C5L36_0D01490"
                     /db_xref="GeneID:40385242"
     mRNA            <288996..>289457
                     /locus_tag="C5L36_0D01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467030.1"
                     /db_xref="GeneID:40385242"
     CDS             288996..289457
                     /locus_tag="C5L36_0D01490"
                     /inference="similar to AA sequence:RefSeq:NP_015514.1"
                     /note="PKUD0D01490; similar to Saccharomyces cerevisiae
                     YPR188C (MLC2); ancestral locus Anc_7.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322890.1"
                     /db_xref="GeneID:40385242"
                     /translation="MSNEDFEFSKSTIQKYKTMFQIIDKDGDNHISVSDLHDAFNGIG
                     HRIEEAEVKNNLLGEFEDNKIDFNAFLRIVGSKFGGFSSEEELKDAFSTFVDSSGNIE
                     GKAFKEDVASVTEAQEDKQPIEEVIDEFTKENRITSYKKVDSEKFIDNVKI"
     gene            complement(<289599..>290036)
                     /locus_tag="C5L36_0D01500"
                     /db_xref="GeneID:40385243"
     mRNA            complement(<289599..>290036)
                     /locus_tag="C5L36_0D01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467031.1"
                     /db_xref="GeneID:40385243"
     CDS             complement(289599..290036)
                     /locus_tag="C5L36_0D01500"
                     /inference="similar to AA sequence:RefSeq:NP_015513.1"
                     /note="PKUD0D01500; similar to Saccharomyces cerevisiae
                     YPR187W (RPO26); ancestral locus Anc_7.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322891.1"
                     /db_xref="GeneID:40385243"
                     /translation="MADFNENYPEEYEERFSDDERFQNDENANGVDVDQDGKTIIASG
                     AGHEEGFEMLEVGKRARPRAIPRDQRITTPFMTKYERARILGTRALQISMNAPVLVDI
                     EGETDPLQIAMKELSAKKIPLVVRRYLPDGSYEDWSVEELIID"
     gene            <290321..>291808
                     /locus_tag="C5L36_0D01510"
                     /db_xref="GeneID:40385244"
     mRNA            <290321..>291808
                     /locus_tag="C5L36_0D01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467032.1"
                     /db_xref="GeneID:40385244"
     CDS             290321..291808
                     /locus_tag="C5L36_0D01510"
                     /inference="similar to AA sequence:RefSeq:NP_015512.1"
                     /note="PKUD0D01510; similar to Saccharomyces cerevisiae
                     YPR186C (PZF1); ancestral locus Anc_7.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322892.1"
                     /db_xref="GeneID:40385244"
                     /translation="MKGASIIDVSGGESDEKCIDVPIQNLERVSKESTTKSKSQDTSS
                     HNEHSPNITRAGRSTEKKTAGVRARSSSGSYSVRSVSPRPKNHICDFPGCTKAYSRPS
                     LLEQHMRSHYGYRPFKCEFEGCNDSFTRKDHLARHMLKHTEEKDKPFHCTVCGKGVNS
                     MQHLKRHEKTHFKSFHCTFEGCNESFHKHQSLKAHIRSVHEQNSSNKCEICGKQFSRP
                     GRLADHMDKHHSDSSKLICDFPNCYKTFRMWSALQLHIKTEHPKLECDICGKKCIGSS
                     GLANHMKMHVDDSLIKLWNCMECGEKFHKKEHAVRHYAEKHPLIELPEALRYEPRLEV
                     KTKHKQSVQEIEYFMKKKEEEKKAKRRRIEPDDEHNTDVANDCDYDTNGKCVKGSHVN
                     KEDLKKENTFNLSDCGMFVAKPTINNFKKHQKNKANTSFDVLDLLVDNVDQRLSCPYS
                     NCHRLFRKQYDLDRHLAWHQRQDKLLDQKVELVLTEIEQAEHNAD"
     gene            complement(<291901..>292611)
                     /locus_tag="C5L36_0D01520"
                     /db_xref="GeneID:40385245"
     mRNA            complement(<291901..>292611)
                     /locus_tag="C5L36_0D01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467033.1"
                     /db_xref="GeneID:40385245"
     CDS             complement(291901..292611)
                     /locus_tag="C5L36_0D01520"
                     /note="PKUD0D01520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322893.1"
                     /db_xref="GeneID:40385245"
                     /translation="MVIKGNFSFPVFLRASIFNFIECFLFFSFPIHTQRTMTDQRTSQ
                     GILEKIKALKSARVEAIQANKRAVYDEASGGKKKNREKQKVKDAFNDEAEQISEHDIE
                     GKERTKRPKKTHGKCKGESQLALQNYKKLAERTYAKNVKEMDDHGLKKTRTEYLEEKE
                     LVKKLKAEGLGEEEIRSKLTSRTKLDKYVQKVTSWEKKVYEHRHKSNAIEGADGAIHE
                     KNLHFNNKLKRHYNSIDQ"
     gene            complement(<292676..>295429)
                     /locus_tag="C5L36_0D01530"
                     /db_xref="GeneID:40385246"
     mRNA            complement(<292676..>295429)
                     /locus_tag="C5L36_0D01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467034.1"
                     /db_xref="GeneID:40385246"
     CDS             complement(292676..295429)
                     /locus_tag="C5L36_0D01530"
                     /inference="similar to AA sequence:RefSeq:NP_015430.1"
                     /note="PKUD0D01530; similar to Saccharomyces cerevisiae
                     YPR105C (COG4); ancestral locus Anc_3.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322894.1"
                     /db_xref="GeneID:40385246"
                     /translation="MTSNGKQRKHDENSDNVLVRDQLNSLENTLRTATNLQQLSKLLN
                     DIAQEKAAIDEDLEKIESKSVMHHQSAVRSAELARVDLSSTLNQSRSLKSIMENANSL
                     SYKITERVRVLDSAKSQLKTVKDYIDNVKALKSELSRASDAIERKDWLIASRSISVML
                     QLPEGLIDDPYVEFKVPTSQLEDLPSDILQRWINELEHIFINEFNCAASNRDVDKLTY
                     FFQLFPLIGRAKVGLKCYSKFICGIISEQSRTIIRNVHNQQPKPELYSQLLFRLYQTI
                     SGILVQHSKVIKSYYGKNVVNSILKDIQIECDLQSNLIIETYCDSKQLDRLLSDVRNY
                     DYPILIKEIYKNAAESESDQEDMDVEDSESVELIEISQVTDELSTMMNHWSMYSKFFV
                     VLWNEFLDTDKDKVVYPTPLILSSFGIRIHNDIVNQFDTACTYIIRRTLEKACKLETI
                     SSFIPHLSNCLKFLTLVYKKVEHSSSHDLYALIPEEPPISSLADDIIVVLNTIMMEVL
                     ATGELSSVKNMISNIKRVLLNDFMNIIQQRLGSVNLKSNSSLLSKETLQKIHQQQNPL
                     AEKLFSDSVASSPRSRSGTPVAGGSLNVSASDIANTGAMFMRSLNAAISYTMTGEDDV
                     QSYLIGDDTDIKKVVVYLNTIEVLSDYLKKMVESCMGNFQGRSLLIVEDQELQSVRKS
                     LDPHTNNYDTDFNIEVPTTESISLKIEGILQSIPTGFIERKDSIVNKNLKVMFDKVIK
                     ARIVRLLNKALMNNYYMTVEDGQYFVVELDKDNANEGEQVYTNKPANEENLVNTFIKN
                     WNSIIIPFVTTLANPICSILIEKIVDLASELLEARIWQLEKKVNHIGAYKLEQDVNTI
                     ISEFSKFNYGLRAKFVKVQQIVMVVATIEEEEVIALDDPDSGIEWALTPSERQRAKSI
                     RVP"
     gene            <295758..>296864
                     /locus_tag="C5L36_0D01540"
                     /db_xref="GeneID:40385247"
     mRNA            <295758..>296864
                     /locus_tag="C5L36_0D01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467035.1"
                     /db_xref="GeneID:40385247"
     CDS             295758..296864
                     /locus_tag="C5L36_0D01540"
                     /inference="similar to AA sequence:RefSeq:NP_011416.3"
                     /note="PKUD0D01540; similar to Saccharomyces cerevisiae
                     YGL099W (LSG1); ancestral locus Anc_6.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322895.1"
                     /db_xref="GeneID:40385247"
                     /translation="MTTVEKIKAIEDEMARTQKNKATEKHLGMLKAKLAKLRADLLKD
                     AAAGSGGGAGIGFDVKKSGAASIGFVGFPSVGKSTLLTKLTGTTSEAAAYEFTTLTTV
                     PGVIRYRGAKIQMLDLPGIIEGAKDGRGRGRQVIAVARSCDLIFIVLDVNKPLRHKQI
                     IEHELEGFGIRLNKTPPDIIIKKKEKGGISITSTVALTKIDEDEVKAVLNEYRINSCE
                     VSFRQDATVDDLIDVLEAHNRKYIPAVYVLNKIDSFSIEELELLYRIPNAVPISSGNE
                     WNLDELLEVMWDRLNLVRVYTKPKGRLPDFSDPVVLKGDKCSVEDFCMKIHKSLVDDF
                     KSALVYGTSVKHQNQYVGLSHKLQDEDVITILKK"
     gene            complement(<297017..>297988)
                     /locus_tag="C5L36_0D01550"
                     /db_xref="GeneID:40385248"
     mRNA            complement(<297017..>297988)
                     /locus_tag="C5L36_0D01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467036.1"
                     /db_xref="GeneID:40385248"
     CDS             complement(297017..297988)
                     /locus_tag="C5L36_0D01550"
                     /inference="similar to AA sequence:RefSeq:NP_011415.1"
                     /note="PKUD0D01550; similar to Saccharomyces cerevisiae
                     YGL100W (SEH1); ancestral locus Anc_6.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322896.1"
                     /db_xref="GeneID:40385248"
                     /translation="MNIVKPFPTSHQDLILDVCYDFYGRQLATCSADQHVKVFDLDSS
                     TSFWELNDSWKAHDSVVVKVDFAHPEFGHLLLSASYDRTVKIWEEQFEEPINSGRRWA
                     KVATIADSHGPIYDACFLPAHLGLRIGAIGSDGKLRLYESTDPNDLSQWVAIEEIPVL
                     KNPVANHLQSDFSLSWCPSRFSVEKFIVSALDQAYIYYKNEGSNKYVQGLVLPEHKGL
                     IRSVSWAPTMGRSYHLIATASKDGFVRIFKLEERQKNDKTDELDLEIALLSSFNDHAG
                     EVWKVSWNLTGTILSSCGDDGLIRLYKANYANKFQCMSVISTEHNSK"
     gene            <298303..>298917
                     /locus_tag="C5L36_0D01560"
                     /db_xref="GeneID:40385249"
     mRNA            <298303..>298917
                     /locus_tag="C5L36_0D01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467037.1"
                     /db_xref="GeneID:40385249"
     CDS             298303..298917
                     /locus_tag="C5L36_0D01560"
                     /inference="similar to AA sequence:RefSeq:NP_009394.1"
                     /note="PKUD0D01560; similar to Saccharomyces cerevisiae
                     YAL008W (FUN14); ancestral locus Anc_7.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322897.1"
                     /db_xref="GeneID:40385249"
                     /translation="MFRLASPSNFIKKFDTLRFTKQAIQSQSKRFVSYNKANSNYTNF
                     ARVRTATRETPNMALTFLGVLGVSSLYLAAHKPILNETGFANGPVLIDTKKGAVNLDQ
                     EIKQSQYDGAFDGKLNYRQVAIGSIAGLVLGYALSRLSSILFVVSIGLYCLNVYLRRQ
                     GIVAVDTKKVFKGAVDSVSWDELVFEKASFSVPFVLSFFTAASL"
     gene            complement(<299074..>299655)
                     /locus_tag="C5L36_0D01570"
                     /db_xref="GeneID:40385250"
     mRNA            complement(<299074..>299655)
                     /locus_tag="C5L36_0D01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467038.1"
                     /db_xref="GeneID:40385250"
     CDS             complement(299074..299655)
                     /locus_tag="C5L36_0D01570"
                     /inference="similar to AA sequence:RefSeq:NP_012646.3"
                     /note="PKUD0D01570; similar to Saccharomyces cerevisiae
                     YJR112W (NNF1); ancestral locus Anc_7.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322898.1"
                     /db_xref="GeneID:40385250"
                     /translation="MAETNRHIRFEALHSALSYALQKTLSKITLKAFVSCYPQIDVSS
                     LEYVRKQVVSSWQSKAESEFQKIFMERQLQLHLNELDKVIEKAEQRKCNGEKVQIDVS
                     DLSPTELVKAHMITMKREVVKNLDEQLSALRESNEKLQKRLNEYKLDKTLDMHEYPKL
                     LDDLKIIDELDEQEEDSKLKSIVEWAVDEMQFS"
     gene            <300007..>301410
                     /locus_tag="C5L36_0D01580"
                     /db_xref="GeneID:40385251"
     mRNA            <300007..>301410
                     /locus_tag="C5L36_0D01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467039.1"
                     /db_xref="GeneID:40385251"
     CDS             300007..301410
                     /locus_tag="C5L36_0D01580"
                     /inference="similar to AA sequence:RefSeq:NP_011404.1"
                     /note="PKUD0D01580; similar to Saccharomyces cerevisiae
                     YGL111W (NSA1); ancestral locus Anc_6.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322899.1"
                     /db_xref="GeneID:40385251"
                     /translation="MIFSFHFKKKILFTDSLCRFHSKELLQNRLSGKTSTNMKLIVSC
                     EDTGALKVVTAQHGVDTSRPAPKDDPNAVAPPTITTHATGYSRKSRVVHMVKSPKTGN
                     IAVTRSDGSVQVYDTAKLRNNEVCNDDSELLPLLSEHKNVIPESTNKDNEVFVDLAVD
                     DIGRLLTATNKGTLFIWSSEEKLSDNPANYQLPLKPNEVVETFQLHPGKTDDTLYIAY
                     GGKETDLRIVKLPTSSGHSETPEIVFAAKNVSNSKLELRVPIHIKKILFDKSSTPENF
                     KLYTFTQWGDLRFYDSSQGRKPRYSKLILPSKGPVTNAIWMNDDFVVTNTSGIVEKVN
                     STSGSQVCQFKDHIGSIQSLFNFNDSILVTAGTDRYVRAYNNKTRDCIVKVFVGTQSN
                     AVILLEDSETLGRHKANIIGDRALESIRKQEEYMARKASAAAEDSGEESDEDELWSKL
                     DSSSVTQRRKRRKITLA"
     gene            complement(301537..301608)
                     /locus_tag="C5L36_0Dtrna5D"
                     /db_xref="GeneID:40385780"
     tRNA            complement(301537..301608)
                     /locus_tag="C5L36_0Dtrna5D"
                     /product="tRNA-Asp"
                     /note="PKUD0Dtrna5D; codon recognized: GAC"
                     /db_xref="GeneID:40385780"
     gene            complement(301613..301683)
                     /locus_tag="C5L36_0Dtrna9G"
                     /db_xref="GeneID:40385793"
     tRNA            complement(301613..301683)
                     /locus_tag="C5L36_0Dtrna9G"
                     /product="tRNA-Gly"
                     /note="PKUD0Dtrna9G; codon recognized: GGC"
                     /db_xref="GeneID:40385793"
     gene            <302537..>306990
                     /locus_tag="C5L36_0D01600"
                     /db_xref="GeneID:40385252"
     mRNA            join(<302537..303263,303263..>306990)
                     /locus_tag="C5L36_0D01600"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_029467040.1"
                     /db_xref="GeneID:40385252"
     CDS             join(302537..303263,303263..306990)
                     /locus_tag="C5L36_0D01600"
                     /artificial_location="low-quality sequence region"
                     /note="PKUD0D01600; Pfam Domains:
                     RVT_1(4.7e-52)|rve(9e-26)|Retrotrans_gag(1.7e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322900.1"
                     /db_xref="GeneID:40385252"
                     /translation="MNSEVNAMHAGSNPSQVNLNMVFKGNEKNSVRLAQQFLFKLDMA
                     FKLQESMGKDVSELFKVATAMLNLDGSALAWFTNRYGNSELPLWHQFVEEFTLEFCPT
                     DEFELRQVAAKYNGCHQGKNSVEQFIQEFEGYRTLLPGEYENEWATRDRFVQGLRAEI
                     RGRVFQHRPNSLAEAKFLARDFEKDSAPRARDFRFSHQDRWRGEPMEIDSIKNKNYRG
                     RNFDSYKRNKNYNRNYNGGYAGRKPRQRKFKLVRNQKVVGSDIAINPPTIENANLQLK
                     NEIQHSTKFDKYILDNKDIENLSVSNVYMDRKELPLLKVKNELFKECVALVDSGASRN
                     FLDYEFVKSHQLENYLEPTEFEDVVAANKKTISVKGELTLELQFKLRDEWQNENIRFL
                     VLENINHKMILGFPFVKDHGNKVDWENIEKETETPEIPDIEEQIESSDENDLEETQEN
                     ELIGINSMRAVRRNLKNVDNYPLLLFVQSVEEKENNNVLEEPYDGVDGIRKKIHEEFR
                     DVVTNDQPTSLPPQRDLTHRIILIEPTKSTYRRQYKLSYSEKQELNKQVDELLKQGFI
                     KPSSSPFNSPVLFVKKKDGSMRMCVDYRLLNNNTVKDKFPIPRIDELITCFGGASVFS
                     KLDLMSGYFQVRIAENDMEKTAFSTDYGHYEWVVMPFGLTNAPSTFQRMMNRILAPYL
                     NQFVQVYLDDIIIYSKTVEEHYSHIEKILELLRRNKLIAKKKKCSFYFKTLGFLGHLI
                     SSRGIQTDPAKIDKIKSWPIPKNAKDAQSFLGLAGYYRRFIKDYSKIASPIMEFANKK
                     CVWKEPQDKAFEELKGKLINAPILVHPIWEDGYTFVVHTDACGTALGYVLEQLDSDGK
                     LRGVIAYGSRKLIGSELNYSIYDREFLAVVEALKNWRYYLLNRHFVLKTDHRSLVYLK
                     RQNAIDSHRVARWLDYLADYDFTIQYVKGPTNSVADALSRYPYEEKEVGINTIESVLT
                     PNQELLERIIKSYDEDNEINEIYDILKENLPIPKSIHNHIKHYSIEDNLLYFSVVKGG
                     NDRRIVVSPKSKLVQEIIGNAHDGNSAGHFGYFKTYMRLHPMFYWPNMLKSVKRYCQR
                     CTVCQKTKPETTGQRGLFSPLPIPEGRWTDISLDFVTGVPRCKNGHDMILVVVDRFTK
                     MAHFIPTRKTATAEQCAKLMVDNCFKLHGIPKRMVSDKDIRFMNKFWFTVYKIFGTSL
                     LFSTTNHPQTDGQTERTNRILNQLLRNYASNDLYSWDKWLSMAEFAYNSSHQVSIGSS
                     PFEVCYGYLPDSPMFISSSRVSSRRYSNKAEEFALEMKVIMENVKENMIEAQRSQETQ
                     HNKSRVYETFEVGDWILLHKDAYGSDRLYYKIQPVYYGPYKVVKKISDNAYEVDLPKT
                     NKKDRVINVRWLRRFLQTDKQFPKVPPRTIAEARSRLTEIIGIAGIDETNDTLDVYWK
                     DCDPCHSSSIPFSLFLEIPEDLQRTLWDNAKAIDKDNKLRDEVSKAAG"
     gene            307262..307335
                     /locus_tag="C5L36_0Dtrna3N"
                     /db_xref="GeneID:40385775"
     tRNA            307262..307335
                     /locus_tag="C5L36_0Dtrna3N"
                     /product="tRNA-Asn"
                     /note="PKUD0Dtrna3N; codon recognized: AAC"
                     /db_xref="GeneID:40385775"
     gene            307345..307416
                     /locus_tag="C5L36_0Dtrna5P"
                     /db_xref="GeneID:40385781"
     tRNA            307345..307416
                     /locus_tag="C5L36_0Dtrna5P"
                     /product="tRNA-Pro"
                     /note="PKUD0Dtrna5P; codon recognized: CCA"
                     /db_xref="GeneID:40385781"
     gene            complement(310500..310571)
                     /locus_tag="C5L36_0Dtrna4W"
                     /db_xref="GeneID:40385778"
     tRNA            complement(310500..310571)
                     /locus_tag="C5L36_0Dtrna4W"
                     /product="tRNA-Trp"
                     /note="PKUD0Dtrna4W; codon recognized: UGG"
                     /db_xref="GeneID:40385778"
     gene            311516..311586
                     /locus_tag="C5L36_0Dtrna10G"
                     /db_xref="GeneID:40385768"
     tRNA            311516..311586
                     /locus_tag="C5L36_0Dtrna10G"
                     /product="tRNA-Gly"
                     /note="PKUD0Dtrna10G; codon recognized: GGC"
                     /db_xref="GeneID:40385768"
     gene            complement(313108..313204)
                     /locus_tag="C5L36_0Dtrna7K"
                     /db_xref="GeneID:40385786"
     tRNA            complement(join(313108..313144,313167..313204))
                     /locus_tag="C5L36_0Dtrna7K"
                     /product="tRNA-Lys"
                     /note="PKUD0Dtrna7K; codon recognized: AAG"
                     /db_xref="GeneID:40385786"
     gene            complement(313213..313284)
                     /locus_tag="C5L36_0Dtrna8E"
                     /db_xref="GeneID:40385789"
     tRNA            complement(313213..313284)
                     /locus_tag="C5L36_0Dtrna8E"
                     /product="tRNA-Glu"
                     /note="PKUD0Dtrna8E; codon recognized: GAA"
                     /db_xref="GeneID:40385789"
     gene            <314665..>319118
                     /locus_tag="C5L36_0D01620"
                     /db_xref="GeneID:40385253"
     mRNA            join(<314665..315391,315391..>319118)
                     /locus_tag="C5L36_0D01620"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_029467041.1"
                     /db_xref="GeneID:40385253"
     CDS             join(314665..315391,315391..319118)
                     /locus_tag="C5L36_0D01620"
                     /artificial_location="low-quality sequence region"
                     /note="PKUD0D01620; Pfam Domains:
                     RVT_1(4.7e-52)|rve(9e-26)|Retrotrans_gag(1.7e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322901.1"
                     /db_xref="GeneID:40385253"
                     /translation="MNSEVNAMHAGSNPSQVNLNMVFKGNEKNSVRLAQQFLFKLDMA
                     FKLQESMGKDVSELFKVATAMLNLDGSALAWFTNRYGNSELPLWHQFVEEFTLEFCPT
                     DEFELRQVAAKYNGCHQGKNSVEQFIQEFEGYRTLLPGEYENEWATRDRFVQGLRAEI
                     RGRVFQHRPNSLAEAKFLARDFEKDSAPRARDFRFSHQDRWRGEPMEIDSIKNKNYRG
                     RNFDSYKRNKNYNRNYNGGYAGRKPRQRKFKLVRNQKVVGSDIAINPPTIENANLQLK
                     NEIQHSTKFDKYILDNKDIENLSVSNVYMDRKELPLLKVKNELFKECVALVDSGASRN
                     FLDYEFVKSHQLENYLEPTEFEDVVAANKKTISVKGELTLELQFKLRDEWQNENIRFL
                     VLENINHKMILGFPFVKDHGNKVDWENIEKETETPEIPDIEEQIESSDENDLEETQEN
                     ELIGINSMRAVRRNLKNVDNYPLLLFVQSVEEKENNNVLEEPYDGVDGIRKKIHEEFR
                     DVVTNDQPTSLPPQRDLTHRIILIEPTKSTYRRQYKLSYSEKQELNKQVDELLKQGFI
                     KPSSSPFNSPVLFVKKKDGSMRMCVDYRLLNNNTVKDKFPIPRIDELITCFGGASVFS
                     KLDLMSGYFQVRIAENDMEKTAFSTDYGHYEWVVMPFGLTNAPSTFQRMMNRILAPYL
                     NQFVQVYLDDIIIYSKTVEEHYSHIEKILELLRRNKLIAKKKKCSFYFKTLGFLGHLI
                     SSRGIQTDPAKIDKIKSWPIPKNAKDAQSFLGLAGYYRRFIKDYSKIASPIMEFANKK
                     CVWKEPQDKAFEELKGKLINAPILVHPIWEDGYTFVVHTDACGTALGYVLEQLDSDGK
                     LRGVIAYGSRKLIGSELNYSIYDREFLAVVEALKNWRYYLLNRHFVLKTDHRSLVYLK
                     RQNAIDSHRVARWLDYLADYDFTIQYVKGPTNSVADALSRYPYEEKEVGINTIESVLT
                     PNQELLERIIKSYDEDNEINEIYDILKENLPIPKSIHNHIKHYSIEDNLLYFSVVKGG
                     NDRRIVVSPKSKLVQEIIGNAHDGNSAGHFGYFKTYMRLHPMFYWPNMLKSVKRYCQR
                     CTVCQKTKPETTGQRGLFSPLPIPEGRWTDISLDFVTGVPRCKNGHDMILVVVDRFTK
                     MAHFIPTRKTATAEQCAKLMVDNCFKLHGIPKRMVSDKDIRFMNKFWFTVYKIFGTSL
                     LFSTTNHPQTDGQTERTNRILNQLLRNYASNDLYSWDKWLSMAEFAYNSSHQVSIGSS
                     PFEVCYGYLPDSPMFISSSRVSSRRYSNKAEEFALEMKVIMENVKENMIEAQRSQETQ
                     HNKSRVYETFEVGDWILLHKDAYGSDRLYYKIQPVYYGPYKVVKKISDNAYEVDLPKT
                     NKKDRVINVRWLRRFLQTDKQFPKVPPRTIAEARSRLTEIIGIAGIDETNDTLDVYWK
                     DCDPCHSSSIPFSLFLEIPEDLQRTLWDNAKAIDKDNKLRDEVSKAAG"
     gene            319389..319485
                     /locus_tag="C5L36_0Dtrna8K"
                     /db_xref="GeneID:40385790"
     tRNA            join(319389..319426,319449..319485)
                     /locus_tag="C5L36_0Dtrna8K"
                     /product="tRNA-Lys"
                     /note="PKUD0Dtrna8K; codon recognized: AAG"
                     /db_xref="GeneID:40385790"
     gene            complement(<319624..>321585)
                     /locus_tag="C5L36_0D01630"
                     /db_xref="GeneID:40385254"
     mRNA            complement(<319624..>321585)
                     /locus_tag="C5L36_0D01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467042.1"
                     /db_xref="GeneID:40385254"
     CDS             complement(319624..321585)
                     /locus_tag="C5L36_0D01630"
                     /inference="similar to AA sequence:RefSeq:NP_011405.1"
                     /note="PKUD0D01630; similar to Saccharomyces cerevisiae
                     YGL110C (CUE3); ancestral locus Anc_6.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322902.1"
                     /db_xref="GeneID:40385254"
                     /translation="MAEPSTPTQLSIPIPVFPPFKLRSSLIDKDPVIWEYLLADYIDL
                     FKKLIALSKSSKNQSPPYTLSKKTVNQLHQFLKSFIHESSYETKQVFSLGAINPNIRE
                     NQHILKIVVFVYIKSINLVNLKLTGESTWEFCKVYITLANKYTSQRVNQALVTIPNIR
                     KLVEGTIKSNYSSKSDDISLIRSLQDYLGKVMAGGKWSQEDTTVLYSLLGQRTKSVAS
                     TSDKKNRNFKINSKRKNNGNDSSIEFASTFVDKHWIEILEEVYSNGEGMNSKVSVQLM
                     ILSLCSLSSARILRLLKDQLEIDGLTRIRTLYPLVSCVVLSKKFNDMYPDLKDILSSL
                     FVQKKQMQAKPTRVFDDVKVSHVMDMFPQLSTGQIKTLLVENNDDVETVIDYLLSHDM
                     ADLTIDDFDVIEKGKDKKLPKDAKKASNVFEFEDEDKTYMVQMGKKEESDNIENPEED
                     FRKKNLQRALSILYNADEDEPDDTYIDYESITGKPESDEANSSTSNVKLDAKLLQIES
                     TLFGIYRTSPEKLTRNDRNTQFRQSLKKETAWTDEQIEGWARVLQKSPTKYRMLEERL
                     VFVDGSLNKSGKKSSKWVAKKPANSEDGNDGNTDSRGKHLLDKRKGGYLAKVDANGTD
                     KIAPKNKSNFNHYMAKKKAQKAAKTQKTK"
     gene            complement(<321837..>322145)
                     /locus_tag="C5L36_0D01640"
                     /db_xref="GeneID:40385255"
     mRNA            complement(join(<321837..322034,322143..>322145))
                     /locus_tag="C5L36_0D01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467043.1"
                     /db_xref="GeneID:40385255"
     CDS             complement(join(321837..322034,322143..322145))
                     /locus_tag="C5L36_0D01640"
                     /inference="similar to AA sequence:RefSeq:NP_009721.1"
                     /note="PKUD0D01640; similar to Saccharomyces cerevisiae
                     YBR162W-A (YSY6); ancestral locus Anc_8.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322903.1"
                     /db_xref="GeneID:40385255"
                     /translation="MAVQTFKQRRANEKFANEVKKVRTGEKQKVKKEPTQRSINLPKW
                     MIVLLVFLLVGGGVLELLRIFF"
     gene            <322394..>323578
                     /locus_tag="C5L36_0D01650"
                     /db_xref="GeneID:40385256"
     mRNA            <322394..>323578
                     /locus_tag="C5L36_0D01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467044.1"
                     /db_xref="GeneID:40385256"
     CDS             322394..323578
                     /locus_tag="C5L36_0D01650"
                     /note="PKUD0D01650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322904.1"
                     /db_xref="GeneID:40385256"
                     /translation="MVNGSHLLVTTKGKNIIGHYDPTNETLSIIRLDHKGSQVYASRT
                     LMPIVNLSLNTKEPVAAGILQKSVPSNTSSITIMLYSYFTKTLVPSPLTIETKTDESV
                     QLSPWSLSYSPEGDLLAVHTRSSNSQYIFVCDVSEHYKVVSCIKTTSIEEMIWCETPR
                     GKFIVSTCNDGRLCVFKVNTESIEFVKDYNISSSAISSIQVDHLGKGFYIGTRDGNTF
                     YMDKSTMIVTRSEIVSVDLPVVSISSTKTTLAISHNNGTAQILRTSPISEKREADTVT
                     IDNLSNCGVKSTPNGTFVYVQNDTLVYEKDDHLFSKTNRKRKLEGDSDEKGARQHVSD
                     STKSRDMNRGGHNKDNSRANRGRENRDNRDSRRYGETARDNGRDRRERERDYWRGKER
                     RK"
     gene            complement(<323662..>325824)
                     /locus_tag="C5L36_0D01660"
                     /db_xref="GeneID:40385257"
     mRNA            complement(<323662..>325824)
                     /locus_tag="C5L36_0D01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467045.1"
                     /db_xref="GeneID:40385257"
     CDS             complement(323662..325824)
                     /locus_tag="C5L36_0D01660"
                     /inference="similar to AA sequence:RefSeq:NP_014967.3"
                     /note="PKUD0D01660; similar to Saccharomyces cerevisiae
                     YOR322C (LDB19); ancestral locus Anc_7.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322905.1"
                     /db_xref="GeneID:40385257"
                     /translation="MRKLFSSLSSHGSSSSSTLRQPIEPSATNTVYGHNDKYHTTQCN
                     KASKNAPLVASISIESPPIILYGPPSTSCGAFFSGTFKVDILKGTQLNKSDDENEAKL
                     EHSVSLSRVSKMQLLRNYIVINDVSIYFLQIVRYGKPFQAQSNTLSDCSECSTKITEL
                     AKWDVLSKKTAFAKGSSHLCPFGYVLPGNLPPTSVLSNASSYIQYELVTIVKYMDPVT
                     KTEKAINLAQPINVQRSILREQDRNSTRIFPPTDVTATAVIPNVAFPRSAFPVEIRMD
                     HVSTPRRRWRMRKLSWRMEECTAVKINHCKNHKEKFNSVVESTKKQNKSAKISKNSGG
                     AGHSVINTYFQKPKRQINNSNNSITPDNVLPDLHPSDDRNIQNIQNAQQRGQGNPNAQ
                     IISTQTHPENSLAPMASNWSVDSSRGQSNNQVVLPDRNNTPTPVTSNGQNDNESSTVP
                     KEPELYIEEIKTIASGELKSGWKSDFSGNGRIELVVNISLMDLVSMGINHISRYSPII
                     NSSEANNFNIDKSDCNCAIDIDDPKLGISVTHNLIIEIVIGEELMQPKTTVNVPQRGR
                     SSATHVSANSTAAIVTGNISQTRMRPTSRTAQQAPSSVPDSESQSRRTALSAEDFPDD
                     RVGPDPINGNKSDAYNNLQGVATGVARVLRMQFKVILSERSGLGVSFDDEVPPTYHSV
                     GALSPPAYTESEICQSDELHPTSTNLVIPLDTLANLQI"
     gene            complement(<326053..>326859)
                     /locus_tag="C5L36_0D01670"
                     /db_xref="GeneID:40385258"
     mRNA            complement(<326053..>326859)
                     /locus_tag="C5L36_0D01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467046.1"
                     /db_xref="GeneID:40385258"
     CDS             complement(326053..326859)
                     /locus_tag="C5L36_0D01670"
                     /inference="similar to AA sequence:RefSeq:NP_009942.2"
                     /note="PKUD0D01670; similar to Saccharomyces cerevisiae
                     YCR016W; ancestral locus Anc_1.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322906.1"
                     /db_xref="GeneID:40385258"
                     /translation="MSSVPAWKRLGLKVKSVVKNDPLAVAARGDDVVEKLSQQKKEKK
                     QSKEEDKSSKEKVASKKRKAEDSGSEGKKKPPKRVKVPKSERPVNNVIKDQLHYMRQF
                     SQDRESWKFSKQKQNWIIKNIRNIPEDYEEDMVAYLKSIQGGSRERVIREMENVVSTW
                     NEQVKIAEEKLAQDLQENDVAQEENVSKDNSDSEKTSKKEKKNKKGDKSPQKLTVATV
                     DYDYAARARTIVQELAEKKLQLLGVDSVDEESLEKRPAKVNLVEEYVDVE"
     gene            <327395..>327823
                     /locus_tag="C5L36_0D01680"
                     /db_xref="GeneID:40385259"
     mRNA            <327395..>327823
                     /locus_tag="C5L36_0D01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467047.1"
                     /db_xref="GeneID:40385259"
     CDS             327395..327823
                     /locus_tag="C5L36_0D01680"
                     /inference="similar to AA sequence:RefSeq:NP_011409.1"
                     /note="PKUD0D01680; similar to Saccharomyces cerevisiae
                     YGL106W (MLC1); ancestral locus Anc_6.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322907.1"
                     /db_xref="GeneID:40385259"
                     /translation="MADESTLHDAFALFDKSASGKVSTSSLGDLLRAVGQNPSLKEIS
                     DLQDSITGSEFSFAQFKEIVEREGGFKPLGKPEDYIKAFQIFDKNLTGFISIGDLKYI
                     LTSIGEKLSEEEFNELLKNVTITDENSVDYAEFVKSILSQ"
     gene            complement(<327907..>329637)
                     /locus_tag="C5L36_0D01690"
                     /db_xref="GeneID:40385260"
     mRNA            complement(<327907..>329637)
                     /locus_tag="C5L36_0D01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467048.1"
                     /db_xref="GeneID:40385260"
     CDS             complement(327907..329637)
                     /locus_tag="C5L36_0D01690"
                     /inference="similar to AA sequence:RefSeq:NP_009798.3"
                     /note="PKUD0D01690; similar to Saccharomyces cerevisiae
                     YBR239C (ERT1); ancestral locus Anc_6.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322908.1"
                     /db_xref="GeneID:40385260"
                     /translation="MPPKRSRRVPARKVSRACIHCRNAHITCDEGRPCKRCVKKGLAD
                     TCVDAPRKTRKYLLPGEDEIASVSMMTTQSLPAIPSTSSFNVGVPQFNMMTSMTNVPI
                     NGDGAKFSQRGIVNFNSASSNLNNTNISDNNNNSKNNSIVSNNEYNLLRIPSMSDGFM
                     KPMRNEERRKSSHTAPSVTSEDINFLSSAADSEYAILGNIIDQDPNGPTLLNSKFVSP
                     ALSAANSEELEYLNYQPLMQESRSRTASPFVKPLQPIDMNFDSNKNDNVSGNGNSAND
                     TQQGEDSKLTNLYPDMPHCDANTNQYYIGTMATIDGVKTHTFPDVVKQISKFKREHPQ
                     KFRERNKRSAISFSIGVLEDSNYTPELEAEITANVKIEEDGEKVSKCGLLYQEPSEIY
                     EKVKSPFAYVKPYHELNMYLKKRFSKENLVQVSKSIAEYRPSFIAGMIKLKEDDLIFA
                     EQCFQRTLLEYESYIGISGTPILVWRRTSQIAYVGDEFCILTGWSKEDLLSKSTFAVE
                     IMDDKSCVEYFKIFSKIAFGDLSGDIMTECTLLTPKGESIRTSSTWTLKRDVFGIPMM
                     IIATFLPILT"
     gene            <329896..>330936
                     /locus_tag="C5L36_0D01700"
                     /db_xref="GeneID:40385261"
     mRNA            <329896..>330936
                     /locus_tag="C5L36_0D01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467049.1"
                     /db_xref="GeneID:40385261"
     CDS             329896..330936
                     /locus_tag="C5L36_0D01700"
                     /inference="similar to AA sequence:RefSeq:NP_011410.1"
                     /note="PKUD0D01700; similar to Saccharomyces cerevisiae
                     YGL105W (ARC1); ancestral locus Anc_6.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322909.1"
                     /db_xref="GeneID:40385261"
                     /translation="MAEVKALQAQWTSLAPHVADHVSELNETLKTSTYISGNSIADVD
                     ITVYKSVLPLAKEWTSVDAIAKHRHILRWMDLLQNTVEGLEKISIDLTVELPREIKEK
                     PKKDAGKEAAKDGANKGKGKDTKGDASKKATPPKGKPTTPEEIAAAKAAKEAKKAAKA
                     KANAEAQAKAAAAAVPPNPSMIDIRVGYIEKAIKHPDADALYVSTIQMGDEEGPRTVC
                     SGLVKHFALEEMQQRYVIVIANLKPVTMRGIKSSAMVLCAANADGKVEFVNPPAGSVA
                     GDKIFFEGFDGTPEKVLNPKKKIWETVQAHFTTTEDYTVVYKQEGKPDAKLVNKKGEV
                     CRCSTIVNAEVR"
     gene            <331203..>332378
                     /locus_tag="C5L36_0D01710"
                     /db_xref="GeneID:40385262"
     mRNA            <331203..>332378
                     /locus_tag="C5L36_0D01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467050.1"
                     /db_xref="GeneID:40385262"
     CDS             331203..332378
                     /locus_tag="C5L36_0D01710"
                     /inference="similar to AA sequence:RefSeq:NP_014397.1"
                     /note="PKUD0D01710; similar to Saccharomyces cerevisiae
                     YNL001W (DOM34) and YCL001W-B (YCL001W-B); ancestral locus
                     Anc_1.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322910.1"
                     /db_xref="GeneID:40385262"
                     /translation="MKLVSKTVTKNGGDIVLIPEDADDLWTLYNLITKNDEISLKTYR
                     NIKPLGASGIPIPGAPAQRKLVKLTLNVIDSTFVASERELRVKGVTTNALAEVPLGSH
                     HTATVMIKEPVKVHKDIWDSHDDELVDNACTLEAKAEVGAVVLEEGVSHICLISDSMT
                     ILRNKIEKSIPKKRRGDSSAHDKALNTFLQNTALGTMRHLDLLKLKAIIVASPGTLNK
                     QLIEKIFLEIDKTSNKDLIRCKSKFMTANSSTGYLQALEEVLKDPSVKKQLTDTKVQK
                     NVALFDEFTKNLNLDNYKSFYGESEVMKAIAIPGAVKTLLITDTLFKNDDVEKRKKYI
                     NIVESVKNNGGEVSVFSSLHDSGIQLDQLTGLAVILNYPIPDLEDSDDDDESIYQSD"
     gene            complement(<332456..>333139)
                     /locus_tag="C5L36_0D01720"
                     /db_xref="GeneID:40385263"
     mRNA            complement(<332456..>333139)
                     /locus_tag="C5L36_0D01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467051.1"
                     /db_xref="GeneID:40385263"
     CDS             complement(332456..333139)
                     /locus_tag="C5L36_0D01720"
                     /note="PKUD0D01720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322911.1"
                     /db_xref="GeneID:40385263"
                     /translation="MNAGTINPDDLDTGNLNRDTTLEHKQGILEDIQKIHEESYQARL
                     GLPSVARITLFSIGGVMVGGLGGMLGGWTDASLRYLAANSHRLPTSYNGWFFYHKRKT
                     YYCTKNAMANAFKTGFKVGGFVGTMFTIEALLDKIRGQVDFVNTIMAVSLPGFAYTWY
                     YQLSKVQAKEVIHKGGKVGLLLGLSQDAFQFFRGIDVWYLNQWFGIKPMKLSDRLRKY
                     AGEERKGKN"
     gene            <333306..>334736
                     /locus_tag="C5L36_0D01730"
                     /db_xref="GeneID:40385264"
     mRNA            <333306..>334736
                     /locus_tag="C5L36_0D01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467052.1"
                     /db_xref="GeneID:40385264"
     CDS             333306..334736
                     /locus_tag="C5L36_0D01730"
                     /inference="similar to AA sequence:RefSeq:NP_009800.1"
                     /note="PKUD0D01730; similar to Saccharomyces cerevisiae
                     YBR241C (YBR241C) and YGL104C (VPS73); ancestral locus
                     Anc_6.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322912.1"
                     /db_xref="GeneID:40385264"
                     /translation="MRTNISNPNMVRDSSLSPLIDVRGKSGWSVPLTLAVAISCLASV
                     QYGFHMSELNAPSKYIRLALGLTPSQLGLVTSIFSIGGLVSTTTASYISTGYGLRSSF
                     TITSICYIIGSFIESHSSSYFELLVGRFISGLGAGFAIVYVPVYVNDISPVELRGILG
                     SMTQISVNFGILLAQLLAIRWNNLQQWKNILEIGWIIGILQLFSVYFWLLESPKWLII
                     RAESANEELGVHNLIQLRNSPDVRDEVDTWKMEKNAHLALAAANPSLKNIGFWNYLSD
                     RHYYNSRVIATFMMVGQQLAGINSVIFYGVDILNKVFPTYSLLANILISLGNMVITAV
                     SSLFLDRAGRKPLLLISLTAMMVSLIILSIGILLNSSSFSVAAIFTYVGSFAIGCGPI
                     PFLIVSEVSQVEVKDVAQSWATDCNWASVFIVGSMFPILNTMIGGWVYLIFAFVCLIF
                     LAFVYLFVPETKGCHTYEEVWGHRQD"
     gene            <335227..>336076
                     /locus_tag="C5L36_0D01740"
                     /db_xref="GeneID:40385265"
     mRNA            join(<335227..335275,335682..>336076)
                     /locus_tag="C5L36_0D01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467053.1"
                     /db_xref="GeneID:40385265"
     CDS             join(335227..335275,335682..336076)
                     /locus_tag="C5L36_0D01740"
                     /inference="similar to AA sequence:RefSeq:NP_011412.1"
                     /note="PKUD0D01740; similar to Saccharomyces cerevisiae
                     YGL103W (RPL28); ancestral locus Anc_6.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322913.1"
                     /db_xref="GeneID:40385265"
                     /translation="MPTRFTKTRKHRGHVSAGNGRVGKHRKHPGGRGMAGGQHHHRTN
                     LDKFHPGYFGKVGMRYFHKQRNHFWKPVINLDKLWSLVENKDEKIASSTKDAAVVIDT
                     LASGYGKVLGKGRIPNVPVIVKARYVSKLAEEKIRAAGGVVELIA"
     gene            <336362..>337126
                     /locus_tag="C5L36_0D01750"
                     /db_xref="GeneID:40385266"
     mRNA            <336362..>337126
                     /locus_tag="C5L36_0D01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467054.1"
                     /db_xref="GeneID:40385266"
     CDS             336362..337126
                     /locus_tag="C5L36_0D01750"
                     /inference="similar to AA sequence:RefSeq:NP_009801.1"
                     /note="PKUD0D01750; similar to Saccharomyces cerevisiae
                     YBR242W (YBR242W) and YGL101W (YGL101W); ancestral locus
                     Anc_6.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322914.1"
                     /db_xref="GeneID:40385266"
                     /translation="MFRFMFLLRSVTLKTFCTLKSYPSRMTSSLSAQTSWDPESNIPA
                     NVLNYLKNDQPLNSKYSQINFFFQLISLLKQQERTGWINMGIPKPESIADHMYRMSII
                     SLVLDSNAWEAENIKPDLNKCCKMALVHDIAETLVGDIVPNDVHIDKFEKSKREYKAI
                     LYLCDIISKYNQQSANEIKELWIDYECQRNIESTIVKDIDKFELLIQTFEYERMHKRR
                     MDEFYSCKKVIKNPEIQKMADELFQQREKFLSANQL"
     gene            complement(<337225..>338544)
                     /locus_tag="C5L36_0D01760"
                     /db_xref="GeneID:40385267"
     mRNA            complement(<337225..>338544)
                     /locus_tag="C5L36_0D01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467055.1"
                     /db_xref="GeneID:40385267"
     CDS             complement(337225..338544)
                     /locus_tag="C5L36_0D01760"
                     /inference="similar to AA sequence:RefSeq:NP_009802.3"
                     /note="PKUD0D01760; similar to Saccharomyces cerevisiae
                     YBR243C (ALG7); ancestral locus Anc_6.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322915.1"
                     /db_xref="GeneID:40385267"
                     /translation="MHRGMIFATAVALMAVPSEFQPVQTTTGLALFGYAAVDYLIPLV
                     GKHFVKRGLFGKDLSKIGRPIIPESIGVIPAVTYLFVMFFSIPFLFPSKGSNSLLFFL
                     GSMLSLESMILLGLMDDLFDIRWRHKFFLPAIASIPLLIVYRHEFSETSILLPKFMAS
                     YFETSPSFNLGIFYYFYMAAVSIFCPNSINILAGINGLEVGQTIIITILLLLNDIYYI
                     IGYYNDVQYRPAYEIHLFSMCMLIPFLGIACSLFKYNKFPARVFVGDTWCYFSGMVFA
                     VTGISGHFAKTLMLFFLPQIFNFLYSSPQLFGVVPCPRHRLPKFNEKDGLMYNSFTEY
                     REEQAGDTKLPKLRKGLIPFFNLLEKLKLIKLVRNNKGEIIKSSNLTIINLVILWFGP
                     KKEGDLCSLIMKLQFLIGFICLILRHTCAPIIFGFDNSWSMLNRFYT"
     gene            <338830..>340050
                     /locus_tag="C5L36_0D01770"
                     /db_xref="GeneID:40385268"
     mRNA            <338830..>340050
                     /locus_tag="C5L36_0D01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467056.1"
                     /db_xref="GeneID:40385268"
     CDS             338830..340050
                     /locus_tag="C5L36_0D01770"
                     /note="PKUD0D01770; Pfam Domains: Epimerase(2.9e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322916.1"
                     /db_xref="GeneID:40385268"
                     /translation="MLSVNKSKLALNASRAVQQVQQSRNVYRFPLESDINITKSGKVK
                     IAQGLGGRHSRTGYQVSVFGGSGFLGKILVSKLAKHGTLTIAPFRNGRSKRHLKVNGD
                     LGVVNFHEFDIRNLKSIEESVAHSDVVVNLLGSHLNTKNFSMADANIEGSNRIAKIAK
                     DYGVDRFVQVSSYNADPNSPSEFFATKGIAEQVVREHYPDATIVRPAPMYGRNSRFLN
                     EMLSLKVFGGNILYRQEVYPTHVEQVAQALEKIVYDDSTSGKTYELYGNERYSKAELR
                     EMIKYMIHLNQYGFFPAASGYNMPAPEIVVQGWCLLNEYLNPSLEAWNYDNYRRSTLH
                     QVHDPSALTYKDLGIVPDELADWLYKYVKPHILASSQAKNRTVYGKEEVLKLRDYVNS
                     PKNRLDLFGYGSKN"
     gene            complement(<340396..>343425)
                     /locus_tag="C5L36_0D01780"
                     /db_xref="GeneID:40385269"
     mRNA            complement(<340396..>343425)
                     /locus_tag="C5L36_0D01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467057.1"
                     /db_xref="GeneID:40385269"
     CDS             complement(340396..343425)
                     /locus_tag="C5L36_0D01780"
                     /note="PKUD0D01780; Pfam Domains: Pkinase(3.9e-37)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322917.1"
                     /db_xref="GeneID:40385269"
                     /translation="MSVHNLSSWGHHTDTPHSKRKGSFLARSFKSTSSSTMSPETHLQ
                     GAVSTQAVPPATSESHGGSPKGLGKKLLSKFSFAKQSTQHQRAPPSSILSSLLESDNA
                     PHRPSTPATVTPVTSVSPRLPNGSSSKFLDDDNTPRSCNEMSITSGSPHSNSKNELSY
                     TIHPTLQNIIDGGVQEHGRFIESEFQKNTHLDSINNTAIINTTATTNKNENNTNVIDN
                     NNNGNDDDDDADEIKEYSCDCYPVTTANRDGCGEEIVQDADEVLEGRDNAEDVQDEDE
                     DEDEEEDENEVDESKLKTEESIKDYCPGGYHPTFVGETYGRNNEYRIVRKLGWGHFST
                     VWLAWDSANDRHVAIKIVRSSLNYTEAALDEIKILETIQSGNPNHEGKKHIVQLFDHF
                     IHKGPNGEHVCMIFEVLGENMLNLLVRYKDFQVKRQRQIDESLKCKSNNEDLNLHLSN
                     LSDLHILSESYGGLPLKLVKQISKQILLALDYLHRECGIIHTDIKPENVLVEIHDVEQ
                     LVQLLEFERKSKKLKKLIHKRKHDASLSFSLHSKSCETNQPFHHNTRSSSQISSEVNG
                     GISFPSRKKSIPVIPSRPLTSPVETSSSVNNFFRSFSFSQRRTSSFESYMGNSVNTRM
                     TTPLSAQSLRNDRNNSVISSSIIEHDECNSISDLSPKDDCTDNDNSGCHVSSNSRTND
                     YEEEEEEEEDDVFVDAAPIMSFLPEIENPPNCLSSNRKISIDSSDTLQSSALKSLNTK
                     EANKPTLEPFPIPPSVSEKFTKRPSLTIDTNLNSNSNSNSNPNSNENFIPSKATDDSA
                     INSFVSHSPSMFDDFEELISVKIADLGNACWYNKHYTSDIQTRQYRAPEVILGGDWGC
                     STDLWSTACLIFELITNDYLFDPKSTSSYSRDDDHLAQMVELLQTWPSKEYLRTCKYA
                     RDFFDRKGQNFKKIHKLKIWPLCSVLQEEYGMPENLAKEVSDFLLPMLELNPAKRVDA
                     GSMCAHPWIKDIPIGEGLGREYGLRGDDIKGYREEWD"
     gene            <344005..>345141
                     /locus_tag="C5L36_0D01790"
                     /db_xref="GeneID:40385270"
     mRNA            <344005..>345141
                     /locus_tag="C5L36_0D01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467058.1"
                     /db_xref="GeneID:40385270"
     CDS             344005..345141
                     /locus_tag="C5L36_0D01790"
                     /inference="similar to AA sequence:RefSeq:NP_012221.2"
                     /note="PKUD0D01790; similar to Saccharomyces cerevisiae
                     YIL043C (CBR1); ancestral locus Anc_7.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322918.1"
                     /db_xref="GeneID:40385270"
                     /translation="MKYNANSGCGCSNWCIFHILVYIHIYIYIYIYIHLHGYRYRLLL
                     LEHIRHFLNSLELGCCFSLLLHLSICILLLAFDYIATGSLPTSHLDCYNYLVTFNMAS
                     NNILFLLTALAGALGALVLFSKSSKGKPVLKKDEFQEFPLIQKIVLSKDSAIFRFGLP
                     KENDILGLPIGQHIQIQAEIDGKNVMHSYTPTSLDEDSTGFFELLIKVYPNGKLSTYI
                     DNLKLGETIRVKGPRGQYHYEPNMLKHICMVAGGTGITPMYQIIKAVLRNPNDYTKIT
                     LLYGSQTEADILLRSELDEFASKHENFNVVYFLDKASDEWTGKTGFINKDALEEFFPK
                     PSSDVQLLLCGPPGLCASMKKASLELGFQKAKPVSKAGDQVFLF"
     gene            complement(<345373..>346980)
                     /locus_tag="C5L36_0D01800"
                     /db_xref="GeneID:40385271"
     mRNA            complement(<345373..>346980)
                     /locus_tag="C5L36_0D01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467059.1"
                     /db_xref="GeneID:40385271"
     CDS             complement(345373..346980)
                     /locus_tag="C5L36_0D01800"
                     /inference="similar to AA sequence:RefSeq:NP_010972.1"
                     /note="PKUD0D01800; similar to Saccharomyces cerevisiae
                     YER052C (HOM3); ancestral locus Anc_7.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322919.1"
                     /db_xref="GeneID:40385271"
                     /translation="MSTTSLYNLNSGWIVQKFGGTSVGKFALEIALDIVKKYNETNQI
                     AVVCSARSTQTKSEGTTTRLILASELAIDDKEEEFKKTLKLIKDDHVANAEKLIQNVE
                     LRKQLIKDTELEVDMVEKLLDACCVIGEISTKSLDTIMSCGEKLSCLFMSALLNDNNV
                     PSKYIDLSNIVSQLDFINDDRLSNNEQSLDPFFYKALAKTIAREIQKLDNGVVPVITG
                     FFGPVPGGLLNSVGRGYTDLCAAICAVGLSANELQIWKEVDGIFTADPRKVKTARLLK
                     SVTPDEAAELTYYGSEVIHPFTMEQVINARIPIRIKNVMNPNGEGTIIYPDNIGKKGE
                     STPPHPPAALEALPSDFLNKAAKMKIPTAVTAKSDIAVVNIHSNKKTLSHGFLANVFS
                     ILDKHRTVVDLISTSEVHVSMAVNYDKEKRKYFLRVIEDLKKFGAVDVTYDLSIVSLV
                     GIHMKQLIGTAGAMFKVLADEQINIEMISQGANEINISCVISKDNVIKALNALHDNLL
                     LHPFKNNKYSLSFENESAISHLKLSSN"
     gene            complement(<347334..>347969)
                     /locus_tag="C5L36_0D01810"
                     /db_xref="GeneID:40385272"
     mRNA            complement(<347334..>347969)
                     /locus_tag="C5L36_0D01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467060.1"
                     /db_xref="GeneID:40385272"
     CDS             complement(347334..347969)
                     /locus_tag="C5L36_0D01810"
                     /inference="similar to AA sequence:RefSeq:NP_015260.1"
                     /note="PKUD0D01810; similar to Saccharomyces cerevisiae
                     YPL065W (VPS28); ancestral locus Anc_8.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322920.1"
                     /db_xref="GeneID:40385272"
                     /translation="MRDASDAYSVLCMLSAMEIMRAGGKLHHEDLSTYEATRTELINE
                     WMEVTDKMEKDTVRSFLDKVDSREWENLQAGLSCIYNDSHCTAAAATDDATAIAVTNG
                     AAEGTTTNDAVHVPVTGDKKAIAEATSSFITLLDAIKLNYDTKDTLHPLLSNVITRGD
                     KVCSDYEGRPTLVKWLIRLNKMDVLDTLDENQLKELLWDVDAAYSAFFNSL"
     gene            complement(<348466..>348915)
                     /locus_tag="C5L36_0D01820"
                     /db_xref="GeneID:40385273"
     mRNA            complement(<348466..>348915)
                     /locus_tag="C5L36_0D01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467061.1"
                     /db_xref="GeneID:40385273"
     CDS             complement(348466..348915)
                     /locus_tag="C5L36_0D01820"
                     /inference="similar to AA sequence:RefSeq:NP_012155.1"
                     /note="PKUD0D01820; similar to Saccharomyces cerevisiae
                     YIL111W (COX5B) and YNL052W (COX5A); ancestral locus
                     Anc_2.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322921.1"
                     /db_xref="GeneID:40385273"
                     /translation="MFRQLARQSASVARQQRHASTTITPAAITNLQGRWEKLPESDKQ
                     QLIASLAEKQKLPWNQLSLEEKKAAWYISFGTWGPRKPMETPEETAKIYKGIFIGFAV
                     SSALFMAYYANRNVPKTMNKEWQEKSDEYLASKNANPFSTYSQVQSK"
     gene            complement(<349820..>352618)
                     /locus_tag="C5L36_0D01830"
                     /db_xref="GeneID:40385274"
     mRNA            complement(<349820..>352618)
                     /locus_tag="C5L36_0D01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467062.1"
                     /db_xref="GeneID:40385274"
     CDS             complement(349820..352618)
                     /locus_tag="C5L36_0D01830"
                     /inference="similar to AA sequence:RefSeq:NP_012157.3"
                     /note="PKUD0D01830; similar to Saccharomyces cerevisiae
                     YIL109C (SEC24) and YNL049C (SFB2); ancestral locus
                     Anc_2.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322922.1"
                     /db_xref="GeneID:40385274"
                     /translation="MASRRRAYPQPHYNPAAPLQEQPQLYSQQPQQQQFQQPLQQAPP
                     QAPPQDQFVNQFSQLNINNQYQYQQQQQQQQQQQQQQQQHPQQQQPPFQHQTPFGYPP
                     QPYNDQRIAPGMVPQQPVQPLQPLQPMVAEQSAPMNQLYSTDLLRDLPPPIIDLQFPP
                     PPINLPPNSTLTDSLESNASSDYIRSTLNVVPRTNSILKKSKLPFALTIRPYQSLTDE
                     ESPIPIVNDGVITRCRRCRSYINPFVELRQDGLKWKCNFCALLNDLPSSLKSNSVNNR
                     YELNNGVVEFLATPEYMVRAPQALNLIFLIDVTKNTIQNGLLSTSIRTILDSLDRIPN
                     DQGRVNVGFIAVDKRLTYFSIPNDSESNSNPNKDISMMVITPDNDEDNLIIPSPDDLL
                     VNLKNSRLNIEKLLNNFTSFFLDNQSTDFDLSSGLKSGFSLLEKIGGKMIVISSTMPN
                     LGKGKLTIRDEVSVSGKAKESTTLLTSNNSFYKSFAVDCNKSQITVDMFLASSSYQDV
                     ATLSNLPKFTAGQTHFYPAWNASNLEDITKFNKELSNHLSMEINLEAVMRVRCSDGIK
                     CQSYFGNFFSRSSDLLSFPSFPRDQSYVVELNIDNDIRRNVVYFQTAVLHTSTHGDRR
                     IRVITLALPVSKELKDIYASADQLSITNYYSHLAIEKTLNNSLDSARDYLNKVIIDIL
                     LVYKKEIVAGNVGSSSPLQISTNLRMLPLLLQSLIKNISFRQGTVPSDHRSSALNKLA
                     TLPIKELIQFIYPSIYSLHDMDDECGLPYEGEDNYDEIIPKIHGEIILPECINATFQS
                     LQKFGLYLIQTINELFLYVGGDALPALAQDVFGVNSVNEIQPGKFELPELDNDMNIRV
                     RNIINKARQGKGSIRYENIYIVIGPSSNERGVGGMEMNRDLIALRMWCMSALVEDRTA
                     NMLGYREFLSQLKDKINA"
     gene            <353276..>353542
                     /locus_tag="C5L36_0D01840"
                     /db_xref="GeneID:40385275"
     mRNA            <353276..>353542
                     /locus_tag="C5L36_0D01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467063.1"
                     /db_xref="GeneID:40385275"
     CDS             353276..353542
                     /locus_tag="C5L36_0D01840"
                     /inference="similar to AA sequence:RefSeq:NP_010968.1"
                     /note="PKUD0D01840; similar to Saccharomyces cerevisiae
                     YER048W-A (ISD11); ancestral locus Anc_7.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322923.1"
                     /db_xref="GeneID:40385275"
                     /translation="MSAAHTQRALALYRGLLRTARRFDYYNFRHYFLRRTRESFRANQ
                     KLDANDTNVTSLLADAEENLAVLRRQAAISQMYHFDKLVVERVK"
     gene            <354175..>355575
                     /locus_tag="C5L36_0D01850"
                     /db_xref="GeneID:40385276"
     mRNA            <354175..>355575
                     /locus_tag="C5L36_0D01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467064.1"
                     /db_xref="GeneID:40385276"
     CDS             354175..355575
                     /locus_tag="C5L36_0D01850"
                     /note="PKUD0D01850; Pfam Domains:
                     Pkinase(3.1e-89)|Pkinase_Tyr(2.5e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322924.1"
                     /db_xref="GeneID:40385276"
                     /translation="MHPSSINNSPSANCNSNQGLPILPNSVSSSINNSHRNSTIDADG
                     NRNGQATTKTQTGASTSTGTSADTTTDADTGIGTSTNTSTNTDANTKSKTETKTSTLS
                     NIDTSTTAIPAVNAGASTDTPNTSSSLTAPQVQTQTQIPSTPITKGKYSLADFNIIQT
                     LGTGSFGRVHLVRSVHNGRFYAMKVFRKSHVVKAKQIEHTNDERKILSICKHPFITRM
                     WGTFQDCKSIFLIMDYIEGGELFSLLRKSKVFPNQVAKFYSAEVLLALEYLHSHNIIY
                     RDLKPENILISKSGHIKLADFGFAKYVETTTYTLCGTPDYIAPEIIAVQPYTKAVDYW
                     SFGILIYEMIAGTTPFYDPSPMKTYENITKCEISYPNHFQLDVINLLQGLITKDVTYR
                     LGNLKNGILDIKNHRWFNEVIWDNLLKGNIETPYEPNIASGTGDASQFERYPEVAYDY
                     GISGIKDEYGYLFPDF"
     gene            complement(<355654..>356796)
                     /locus_tag="C5L36_0D01860"
                     /db_xref="GeneID:40385277"
     mRNA            complement(<355654..>356796)
                     /locus_tag="C5L36_0D01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467065.1"
                     /db_xref="GeneID:40385277"
     CDS             complement(355654..356796)
                     /locus_tag="C5L36_0D01860"
                     /note="PKUD0D01860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322925.1"
                     /db_xref="GeneID:40385277"
                     /translation="MQRHIILGDRRILSLGIRQFHVLNWAGIRDKGSSSDLLNLLSID
                     KDIERNVNDRINTLESVHDAHVRDIQRLESKLGYIEKNIGFLMGKRDNKKLQIEELLR
                     LPTWKVYEIVKVKCHGENVNEDEIIMLIAHMIFRNSFTVDMFSRVIMRLSYSNVKKVH
                     EKLVNDPAGIIKGWNEGYRCRVLSGLALTARYKMLKDYDSARRIVISEFREVWIKGLI
                     AKPNEFKGNDLKNFVNVVNGMVEYAYVVTNIVKVNDVRLVYTFWEENWNDMIINEWLE
                     KNVDKLNEFQRFIIRAFNNPVISTNSEFKGILLDISKKLKLGIYSGDDINREKFQVYL
                     ELLINDIIEGINGDPERVGYVRDLRKEFEGFKSDEHEEELKEVFNV"
     gene            complement(356970..357040)
                     /locus_tag="C5L36_0Dtrna11G"
                     /db_xref="GeneID:40385772"
     tRNA            complement(356970..357040)
                     /locus_tag="C5L36_0Dtrna11G"
                     /product="tRNA-Gly"
                     /note="PKUD0Dtrna11G; codon recognized: GGC"
                     /db_xref="GeneID:40385772"
     gene            complement(<358827..>360476)
                     /locus_tag="C5L36_0D01870"
                     /db_xref="GeneID:40385278"
     mRNA            complement(<358827..>360476)
                     /locus_tag="C5L36_0D01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467066.1"
                     /db_xref="GeneID:40385278"
     CDS             complement(358827..360476)
                     /locus_tag="C5L36_0D01870"
                     /inference="similar to AA sequence:RefSeq:NP_010630.1"
                     /note="PKUD0D01870; similar to Saccharomyces cerevisiae
                     YDR343C (HXT6) and YHR094C (HXT1); ancestral locus
                     Anc_5.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322926.1"
                     /db_xref="GeneID:40385278"
                     /translation="MSSISSAEKINASHDDVNAPVGSGDGLLEEENTANIVPTAPKTT
                     YLFAAFTCILIAFGGFVFGWDTGTISGFVNMPDFVNRYGQISSEGQKYLSKTRTGLML
                     SIFNIGCAIGGVTLGKTGDMYGRKKGLMMTMVVYIVGIIIQIAAVKSWVQYFIGRIIA
                     GIAVGSIAVLAPMFISETSPKAIRGTLVSCYQLMITGGIFLGYCTTYGTYHHYGDSRQ
                     WRIPLGLSFAWALFMILGMTFTPESPRFLVENDRIEEAKQSIAKSNKQDVNSEFVINE
                     VNVIAEAIEFEKSVGNASWGELFTGKPKIFYRLMVGVILQSLQQLTGDNYFFYYGTTI
                     FKAIGLDDSFETSIIFGVINFASTFLALWVVDRFGRRMTLMAGSFGMLVTLVIFASIG
                     VKDLYLDGYGSEARKPVGNAMIFLVCLFIFFFAQTWGPCVFVVVSETYPLRIRAKGMA
                     IATGANWIWGFLIGFFTPFITGAIHFAYGYVFFGCVVFSLVFVFAFVPETKGLSLEDV
                     DELYRNYTPGLAFMKKFSNAAAEKAALEQEAEAELAMSKNA"
     gene            complement(364246..364319)
                     /locus_tag="C5L36_0Dtrna8V"
                     /db_xref="GeneID:40385791"
     tRNA            complement(364246..364319)
                     /locus_tag="C5L36_0Dtrna8V"
                     /product="tRNA-Val"
                     /note="PKUD0Dtrna8V; codon recognized: GUU"
                     /db_xref="GeneID:40385791"
     repeat_region   368840..376776
                     /note="IRL4"
                     /rpt_type=inverted
     gene            complement(383190..383261)
                     /locus_tag="C5L36_0Dtrna6D"
                     /db_xref="GeneID:40385783"
     tRNA            complement(383190..383261)
                     /locus_tag="C5L36_0Dtrna6D"
                     /product="tRNA-Asp"
                     /note="PKUD0Dtrna6D; codon recognized: GAC"
                     /db_xref="GeneID:40385783"
     gene            complement(383266..383336)
                     /locus_tag="C5L36_0Dtrna12G"
                     /db_xref="GeneID:40385773"
     tRNA            complement(383266..383336)
                     /locus_tag="C5L36_0Dtrna12G"
                     /product="tRNA-Gly"
                     /note="PKUD0Dtrna12G; codon recognized: GGC"
                     /db_xref="GeneID:40385773"
     repeat_region   complement(395063..402999)
                     /note="IRR4"
                     /rpt_type=inverted
     gene            403010..403082
                     /locus_tag="C5L36_0Dtrna10R"
                     /db_xref="GeneID:40385769"
     tRNA            403010..403082
                     /locus_tag="C5L36_0Dtrna10R"
                     /product="tRNA-Arg"
                     /note="PKUD0Dtrna10R; codon recognized: AGA"
                     /db_xref="GeneID:40385769"
     gene            <403219..>403953
                     /locus_tag="C5L36_0D01940"
                     /db_xref="GeneID:40385279"
     mRNA            <403219..>403953
                     /locus_tag="C5L36_0D01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467067.1"
                     /db_xref="GeneID:40385279"
     CDS             403219..403953
                     /locus_tag="C5L36_0D01940"
                     /inference="similar to AA sequence:RefSeq:NP_011547.3"
                     /note="PKUD0D01940; similar to Saccharomyces cerevisiae
                     YGR033C (TIM21); ancestral locus Anc_4.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322927.1"
                     /db_xref="GeneID:40385279"
                     /translation="MFRLIYKRNQLISANGVLPFSRAISKRLLSSTVPLLQTSSTSST
                     ENKSTQKRTAQEKVNRFIYHVKAGTRLLLSSWLIIIAGGATVVTTYLVATELFSPSGE
                     TSTFNRVVNLIEKDEKALKLLGYSDSEIQEGGIRLKAYGGISPDEWTRNKSIQATKFT
                     GKDEKEHMIMRFFVESSKTIGVVNLEAIEENFMEQQLVYVSVEVKGKGKCYLIGGPQL
                     SYAQRNLNVFSSNGFLGVKWGNSKKD"
     gene            complement(<405541..>406552)
                     /locus_tag="C5L36_0D01950"
                     /db_xref="GeneID:40385280"
     mRNA            complement(join(<405541..406435,406524..>406552))
                     /locus_tag="C5L36_0D01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467068.1"
                     /db_xref="GeneID:40385280"
     CDS             complement(join(405541..406435,406524..406552))
                     /locus_tag="C5L36_0D01950"
                     /inference="similar to AA sequence:RefSeq:NP_015118.1"
                     /note="PKUD0D01950; similar to Saccharomyces cerevisiae
                     YPL206C (PGC1); ancestral locus Anc_6.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322928.1"
                     /db_xref="GeneID:40385280"
                     /translation="MSTTLAAHRGYKAEYPENTIRAFQTAVEAGCDVIETDLHISADD
                     HIIIAHDIDTSRVFGESYDVTKTNYVGTLDQLLTLREPRSKMPLFRDVLLWCIETNEQ
                     HKDRNIKLMLDIKGDNDPVQLYNLMWELLHDLKGIDFWKNKLIFGLWSPQFYIPEKLN
                     GFKVINISFDFHSAKAFYEKVVDLHSGATIHGISMIKFILYREKDLNDMMDWLHENNL
                     KLWLWTINNNLELKQAIEKTVKNKEILLDGIVTDDPIKVYERFPENKISWNYNFKLWL
                     QNSLFGILLFLYRRNFNLKPAFNMLKRLGLI"
     gene            complement(<406927..>409905)
                     /locus_tag="C5L36_0D01960"
                     /db_xref="GeneID:40385281"
     mRNA            complement(<406927..>409905)
                     /locus_tag="C5L36_0D01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467069.1"
                     /db_xref="GeneID:40385281"
     CDS             complement(406927..409905)
                     /locus_tag="C5L36_0D01960"
                     /inference="similar to AA sequence:RefSeq:NP_009555.1"
                     /note="PKUD0D01960; similar to Saccharomyces cerevisiae
                     YBR001C (NTH2) and YDR001C (NTH1); ancestral locus
                     Anc_3.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322929.1"
                     /db_xref="GeneID:40385281"
                     /translation="MDSNEEVMSPTQLHPPIEEKIPSSGTVSDSPRHRRKSSLEVDPY
                     EPSDLYYSAATDPSNKSSKFSRFRTRSVVAPKRSHRLQSFTLNPELLGIHDKNNQFGL
                     FSSHTEGSNTKDSKFSHGLTLQQLKSLNLSTSGTNTPVISDSDDDDDDDGINSDLESD
                     VENDEESLTKSHSTGSLIADVDQRVANYQIEMSSPNVTSEELNENLKDIPNDADLMRE
                     VTGLEDPFDDDDDDNNNNNNNNKKNKNKNKKKNKNKNKNDNNESNNDNDNENQTKAKT
                     NKVKPSTTNLEIPFPSSSPMNKLKDGNVKKILPEKHLFPSPSTPTVRRRGSADLSSSL
                     SNSKRFFISDIDATLKELLRNEDTDKDCQITIDDTGPKVLKLGTANSGGFRQYDIRGT
                     YMLSNLLQELTIAKRFGRKQMILDEARLNENPVSRLHRLITTSFWKNLTRKVDEDSIL
                     EMAQDTKIRSKEAKYPRIYVPYDEEEQYYYYSKIAKKNKDYKLDVVYLPKDITADYVE
                     SINNIPGLLALAVRRKSDTFGDLEGYPYVVPGGRFNEQYGWDSYFETLGLLASDYLEP
                     CIGMCENFIFEINHYGKILNANRSYYLCRSQPPFLTDMALRIFNYIKEKQGREDLSLL
                     KRAFMAAIKEYNEVWCSPPRLDPFTGLSTYHPDGKGIPPETEESHFHAVLQPFVEKYK
                     LTYKEFETRYNKGLIKEPDLDEYFLHDRAVRESGHDTSYRLEGVCANLATVDLNSLLY
                     KYEVDIAFVIKTYFNNELTLPDGTIETSEKWIALAEKRKELIETYMWNEKESLYFDYN
                     IKKQKQSRYESVTAFYTLWAGLCSKERAEVMIRNSLYKFEEFGGLVSGTKKSRGELGI
                     DKPVRQWDYPFAWAPHQMLVWEGLKRYGKKNIAQRLSYRWLYLMTLAFVDFNGIVVEK
                     YDATSERQPHKVEAEYGNQGAGFKGVATEGFGWVNASFIVGLQNLDTLGKRALGLVTS
                     PNDFFEKMSATEKEKYGLRL"
     gene            <410314..>411006
                     /locus_tag="C5L36_0D01970"
                     /db_xref="GeneID:40385282"
     mRNA            <410314..>411006
                     /locus_tag="C5L36_0D01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467070.1"
                     /db_xref="GeneID:40385282"
     CDS             410314..411006
                     /locus_tag="C5L36_0D01970"
                     /inference="similar to AA sequence:RefSeq:NP_010285.1"
                     /note="PKUD0D01970; similar to Saccharomyces cerevisiae
                     YDR002W (YRB1); ancestral locus Anc_3.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322930.1"
                     /db_xref="GeneID:40385282"
                     /translation="MVQEQHDTAMSADEASKSTPTSTTPTSTTTAAAATAAAAPKPPT
                     SNVFSMFGGASTKKDADKKPEDDEAKSGESEQDKKQEEEAADEEEPDVHFEPLVKLEK
                     VEVKTNEENEDVIFKIRAKLFKFHPDAKEWKERGTGDVKFLKHKETNKVRLLMRRDKT
                     LKVCANHIIAPEYVLKPNVGSDRSWVYSVTADVSEGAPEAQTLAIRFGNKENAEKFKQ
                     EFEAAQEVNKKN"
     gene            complement(<411362..>412264)
                     /locus_tag="C5L36_0D01980"
                     /db_xref="GeneID:40385283"
     mRNA            complement(<411362..>412264)
                     /locus_tag="C5L36_0D01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467071.1"
                     /db_xref="GeneID:40385283"
     CDS             complement(411362..412264)
                     /locus_tag="C5L36_0D01980"
                     /inference="similar to AA sequence:RefSeq:NP_009556.1"
                     /note="PKUD0D01980; similar to Saccharomyces cerevisiae
                     YBR002C (RER2); ancestral locus Anc_3.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322931.1"
                     /db_xref="GeneID:40385283"
                     /translation="MEWLTQFPITQHLLEVTKKKVCSALRSGPVPQHVGFIMDGNRTY
                     AKRKHIELKEGHNAGFESMARILEVCYDCGVKSATVFAFSIENFKRPSYEVQWLMELA
                     KAKFTQVVGNGEMCEQFGIQIRILGDLDLLPDDVRTALLKAEEITKHNKRAVLNVCWS
                     YTSRHDMTQAIQKTIEQFAKNRIGLNDIDEDRISANLYTGPSPPLDLLIRTSGVYRLS
                     DFMLWEATSERCDIEIVEELWPQFNALKMIWLLIKWSFNKTYNSKQISTPVTSSSFNR
                     IDTDGGGCKKSLDETKMETIQVKE"
     gene            <412586..>414052
                     /locus_tag="C5L36_0D01990"
                     /db_xref="GeneID:40385284"
     mRNA            <412586..>414052
                     /locus_tag="C5L36_0D01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467072.1"
                     /db_xref="GeneID:40385284"
     CDS             412586..414052
                     /locus_tag="C5L36_0D01990"
                     /inference="similar to AA sequence:RefSeq:NP_009557.1"
                     /note="PKUD0D01990; similar to Saccharomyces cerevisiae
                     YBR003W (COQ1); ancestral locus Anc_3.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322932.1"
                     /db_xref="GeneID:40385284"
                     /translation="MLRIAKTVRGRVQISNIKSFNHLLTTRRHGSSFGAAIETAEKMV
                     QPNVSSRFDPFSMVSAEMGVLAKHIAQLIGSGHPVLNRVTSYYFEAEGKNVRPLIVLL
                     LSKALAAIPEGERTRIHIDQYDVNTQTEFKGTPKAFSFAGANPLDSISPLRVLHGINP
                     NIILNPLSRPMLDQDDYEKLDKVNGILPKQRRLAEITEMIHTASLLHDDVIDFADSRR
                     GRDSGNVAFSNKMAILAGDFLLGRASVCLGRLRNSEVVELMSTAIANLVEGEFMQLKN
                     TVLQPDVKSIENGGEVKRIPDATGKVPVQVHEYSVNLSEQYKITHKDNVHAAFEYYLH
                     KTYLKTASLMSKSSRSTAILAGCDEKIIENAYQFGRNLGLCFQIVDDMLDYTTTAELL
                     GKPAGADLKLGLATAPVLYAWEAKPELGEMIARKFSQPGDVEIAKVAVDETKGVEKTR
                     QLAEKYRDEALFNLRQLPESDARSALELLTNSVLTRSK"
     gene            <414302..>415792
                     /locus_tag="C5L36_0D02000"
                     /db_xref="GeneID:40385285"
     mRNA            <414302..>415792
                     /locus_tag="C5L36_0D02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467073.1"
                     /db_xref="GeneID:40385285"
     CDS             414302..415792
                     /locus_tag="C5L36_0D02000"
                     /inference="similar to AA sequence:RefSeq:NP_009894.1"
                     /note="PKUD0D02000; similar to Saccharomyces cerevisiae
                     YCL036W (GFD2) and YDR514C (YDR514C); ancestral locus
                     Anc_1.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322933.1"
                     /db_xref="GeneID:40385285"
                     /translation="MVQPSLNLQLLKKPVGPVTRFRILGFFFRHNSTMNNIKLSSTKM
                     GKKEKNINSKRFKEDFVQPNIKRTFLNHESFPQHNTDKFKNLDEYINDGDENTRKPAT
                     TTSGKLSDYLIEDARSHPSSDFESINEQLKYELDRCFNSLPPNHRVPTLSKNPAKTTT
                     KKKSSDATSGNPYLSAEEAIKFVNERKFNLVSIDNEFFERSPSKVTEIGVSIYNPKYQ
                     QFALFPHFLHFHFIVKEFINLRNGVYVPDSKMSNITGQSIIISLKDVPYAMSTIFDFL
                     GPETFIVGHNVSGDVKSFQYLNYKIPVTIPIIDTTTLWYSLIGSKNAKSSLHYILDKL
                     NVPHAYLHNGANDAYYTLIVCLMLTSPELRNNMIFHKKKPKTSEEETCENSEKVEDPV
                     LKPQMPDFSEFSPEVAKTKMDRWLRKQTKATEKAKKKKLQARVDTDVSSQKIRCAIDD
                     DSILRKHKGPNIRGQNKPLNPPANVFFKPRNFEKDILIDKLEELNV"
     gene            complement(<415857..>419873)
                     /locus_tag="C5L36_0D02010"
                     /db_xref="GeneID:40385286"
     mRNA            complement(<415857..>419873)
                     /locus_tag="C5L36_0D02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467074.1"
                     /db_xref="GeneID:40385286"
     CDS             complement(415857..419873)
                     /locus_tag="C5L36_0D02010"
                     /inference="similar to AA sequence:RefSeq:NP_013187.1"
                     /note="PKUD0D02010; similar to Saccharomyces cerevisiae
                     YLR086W (SMC4); ancestral locus Anc_8.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322934.1"
                     /db_xref="GeneID:40385286"
                     /translation="MDMHSTLSHLDELDPSIDPLANSSFHSHSHSPSESPSQKPVSDP
                     PQNQLLKTPPLAASEPNVPLIGNAPKLLDQHDSTNVSVFGLDPVPSPRKLAEKLLFQP
                     TDSSPRLVIDKLVLTNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSLLFVFGFR
                     ANKMRQSKLCELIHNSESFPNLDFCQVDIHFAKVVDNYDSNGNPLSPTYIPNSNLLVS
                     RRAEKNNASTYFINNKKSNYTEVTTLLKKEGIDLDHKRFLILQGEVEMIAQMKPKAET
                     ENDDGLLEYLEDIIGTSNYKQEIEEITRETETLQEKLTEKERIFKITEKQHNDLISRK
                     EQAIEYLILEKKLKQETARYWYLTHYSETLQLEKYSSKLQELNHRIKGDNSFIEEAKR
                     KIENLKKKKSKLSESLNSKTDEIITLRKKFKSVEREQVSARESLRITTKKSENLEKTL
                     ENNKKSLNTNENELKDLNSKIKDLEESISEVNRNLVTEVSKLDELKAKLSSHTKTYSD
                     QIDKLQQKLEPWKTKLDKNKSEYNIKKAETELLENQLEQILNESNNLKAIIVNKEDQL
                     KLNSSKIEALVDKKSVTQENIQRHTPNFEVAGKELKRLEFEIKELGDKIEDARNKASS
                     SESQNKVLNALNKLQQSGRITGFYGRLGDLGSIDDKYDIAVSTGGGSLNDFVVETVED
                     AQTCIQYLRQNRLGFGKFIVLQKLRKFNLNKINTPENTPRLFDLIKPIDAKFAPAFYS
                     SMYDTLVAPNLTVANRVAFGGSRRWRVVTLDGKLVDVSGTMSGGGNRVNRGGMKLSSN
                     ASQFVNLVSAQQLKEWKDELEDKEKRYNVAEDQYRKMDQLLRKSQEDIPRMSAEIQTL
                     KMENTTLKDEIEDTKARMNDWTSKSSQITLLQEKIEKNSKSMQKINKDRAKLEETSTL
                     LQSQIDELQQKIIDTGGIRLKTQTNKVQSLKDEIQLKSEIKQNDELRVTKLQNQNQKL
                     VKLIEQSGLQLEEISQTITQLTHELETKTKEAKTLGTDIEKLDGEKDRISFEINETND
                     QLEVEDSTLREKSDLIASKIKEIEKIETVIRKIQIEIDHARESFNNIEYRDVHPLISW
                     MAEDDPLFSQLIQEKPSFDEEYAGREIKSKGCDLKKLGEDVDNLKKELSDLTVNLDIL
                     PSFGSKEQEFQTFKSELEEAATKLHEIKERGEELNERRHSEFSEGFNQISSTLKSMYH
                     LITAGGMAELEYSDSHDAFSEGIVFSVMPPKKSWRTISNLSGGEKTLASLALVFALHH
                     YKPTPLYVMDEIDAALDFKNVSIVANYIKSRTKNAQFIVISLRNNMFELAESLIGIYK
                     VNNMTKSATLINRDLIGK"
     gene            <420656..>421149
                     /locus_tag="C5L36_0D02015"
                     /db_xref="GeneID:40385287"
     mRNA            join(<420656..420683,420932..>421149)
                     /locus_tag="C5L36_0D02015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467075.1"
                     /db_xref="GeneID:40385287"
     CDS             join(420656..420683,420932..421149)
                     /locus_tag="C5L36_0D02015"
                     /note="PKUD0D02015; Pfam Domains: NDUF_B7(2.7e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322935.1"
                     /db_xref="GeneID:40385287"
                     /translation="MAIHELPELLSHEEMKKHQIPIPFRDRCASLLIPLNKCRKQGGY
                     LPWTCVEERHDYEHCQYLDFKRRIKELEDYKKARDSA"
     gene            <421729..>422499
                     /locus_tag="C5L36_0D02020"
                     /db_xref="GeneID:40385288"
     mRNA            <421729..>422499
                     /locus_tag="C5L36_0D02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467076.1"
                     /db_xref="GeneID:40385288"
     CDS             421729..422499
                     /locus_tag="C5L36_0D02020"
                     /note="PKUD0D02020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322936.1"
                     /db_xref="GeneID:40385288"
                     /translation="MVKITHGVHLREALYRHVSRSNSICVGSGEFALSPRNLHRNHGK
                     TCEGQLNSTLTSSPVKKIVIRTRTTGGVVSGDGGDTSLGRSSGVSNAPELPSSSPYRK
                     RFRVSPPRVYRVDHELNVFLRKYHEEGVVSLGLQDVSFRSPCRGEQDENEYNQSELRA
                     KILYYDTHVEALIEIPKTLNVKRSILILQLRHKLNDKQGGQRRCKVTTFTPRSEAAWF
                     RRKLAEAKLPLYDSYKYIIVKTRKSLVGPLKESLDELL"
     gene            complement(<422587..>423870)
                     /locus_tag="C5L36_0D02030"
                     /db_xref="GeneID:40385289"
     mRNA            complement(<422587..>423870)
                     /locus_tag="C5L36_0D02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467077.1"
                     /db_xref="GeneID:40385289"
     CDS             complement(422587..423870)
                     /locus_tag="C5L36_0D02030"
                     /inference="similar to AA sequence:RefSeq:NP_011319.2"
                     /note="PKUD0D02030; similar to Saccharomyces cerevisiae
                     YGL196W (DSD1); ancestral locus Anc_8.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322937.1"
                     /db_xref="GeneID:40385289"
                     /translation="MPFPYQLTPLADKSELLKQYKGKKKSELPTPSFIVNQKTASENC
                     GNMLRNARAIKAKFRAHVKTHKTLEGALLQLGEGEFSTDRLVVSTLMELWNLLPLVEQ
                     GLVSDILLSLPVVESRLDELKDLVTKYPQLKLRLMVDNYRQLEILTKYTEKTGLAYKW
                     SVFVKVNMGTNRAGLTKSDPELEEMIKQLATSQSQISKYISLYGFYCHAGHAYGSRSS
                     DQARSYLIDEISNGNEACKKAKEINQSLELVVSFGSTPTAHSSSLSEAVLKEIESIGE
                     LHGELELHAGNYPFCDLQQVGTGCVSPNGVSCRILADVVSSYPDRGSKLPGEQLINAG
                     VIAMSRESGPIPGYGQITSPSGYGDWIIGRLSQEHGILVPSSEDCKLFPLSTRVEIIP
                     QHSCITAASYPWYFVFDSDDDDATVTDIWVPFRGW"
     gene            complement(424129..424202)
                     /locus_tag="C5L36_0Dtrna9V"
                     /db_xref="GeneID:40385797"
     tRNA            complement(424129..424202)
                     /locus_tag="C5L36_0Dtrna9V"
                     /product="tRNA-Val"
                     /note="PKUD0Dtrna9V; codon recognized: GUU"
                     /db_xref="GeneID:40385797"
     gene            425258..425329
                     /locus_tag="C5L36_0Dtrna4H"
                     /db_xref="GeneID:40385776"
     tRNA            425258..425329
                     /locus_tag="C5L36_0Dtrna4H"
                     /product="tRNA-His"
                     /note="PKUD0Dtrna4H; codon recognized: CAC"
                     /db_xref="GeneID:40385776"
     gene            <425455..>426366
                     /locus_tag="C5L36_0D02040"
                     /db_xref="GeneID:40385290"
     mRNA            <425455..>426366
                     /locus_tag="C5L36_0D02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467078.1"
                     /db_xref="GeneID:40385290"
     CDS             425455..426366
                     /locus_tag="C5L36_0D02040"
                     /inference="similar to AA sequence:RefSeq:NP_013391.1"
                     /note="PKUD0D02040; similar to Saccharomyces cerevisiae
                     YLR288C (MEC3); ancestral locus Anc_6.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322938.1"
                     /db_xref="GeneID:40385290"
                     /translation="MKLALRLDDVGNFRRILGFIVSVRKHCYFKFGQEELTILSLDSD
                     GPLISSTLTKANFTRYDVVSKSDVIMLELNIEPFYQVLRNYEKTPSTSELVVKLQRKD
                     ENPNANGNDSTNKRRSVFLSLSYNEDITVSTEIVHSFTIPINLVRGQLVEHLVIPEIT
                     KLHLVVDIPHDLGLLFSRIERYKATDSLNIVLNKLGEIKVELQDEAKRMSIKWKGYLT
                     TFSPDDVDSQATGVNKQDRDNGDLNMIKETTVKVRSKWWINASKLIELGDALQMYIHE
                     GGCILDCKLEHDRSASIIYCIPGKLLE"
     gene            complement(<426435..>427604)
                     /locus_tag="C5L36_0D02050"
                     /db_xref="GeneID:40385291"
     mRNA            complement(<426435..>427604)
                     /locus_tag="C5L36_0D02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467079.1"
                     /db_xref="GeneID:40385291"
     CDS             complement(426435..427604)
                     /locus_tag="C5L36_0D02050"
                     /inference="similar to AA sequence:RefSeq:NP_014827.3"
                     /note="PKUD0D02050; similar to Saccharomyces cerevisiae
                     YOR184W (SER1); ancestral locus Anc_6.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322939.1"
                     /db_xref="GeneID:40385291"
                     /translation="MSLEREEPNYFGAGPALLPTPVLQQAAKDLLNYENIGLGAGEIS
                     HRSKAGASIIDETKESLKSLLNIPDTHEVFFLQGGGTTGFSSVAANLTAAFVKKTGKP
                     GTPYYVIDGTWSKKSYEEAERMGVHPKVAVNSKEVDGKFGTIPPTDKWNIPENLEDVS
                     YVYYCDNETVNGVEFRQFPFEKFPGVEIVADMSSNFLSKPVDVSKYGLIFAGAQKNVG
                     IAGITIYIIKKSLLDQATPDTLKDMGLSVVPIAFDYPTAVKNDSAYNTIPTFTVHIVN
                     LVLKHLIAKGGLLKQEEENIKKAESVYAVLDKYPNVYNLPVEKSARSRMNVVFTIKDG
                     SLDSEFLEGAEKQKLSGLKGHRSVGGMRASLYNAVTLKSTQLLCEYIENFAQKHQ"
     gene            complement(<427936..>429786)
                     /locus_tag="C5L36_0D02060"
                     /db_xref="GeneID:40385292"
     mRNA            complement(<427936..>429786)
                     /locus_tag="C5L36_0D02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467080.1"
                     /db_xref="GeneID:40385292"
     CDS             complement(427936..429786)
                     /locus_tag="C5L36_0D02060"
                     /inference="similar to AA sequence:RefSeq:NP_012710.1"
                     /note="PKUD0D02060; similar to Saccharomyces cerevisiae
                     YKL212W (SAC1); ancestral locus Anc_1.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322940.1"
                     /db_xref="GeneID:40385292"
                     /translation="MVASTSLRYAETEEGYVFELAGQEPSQALLLISSSGEVSTVSLE
                     KQTFKRSFQPIAGLLGTIQLHSNQYIVIAETASNSGIIYDDKKVYKVQSTDIISLNPK
                     FKPDEDEQKYIELLKSHLNNATLYFSYSYDLTRPFGDQKVEEPLGFNPEFMWNHFISS
                     SLIKASYSNPFVSNFILPVIYGVSEFIRTTINGKPVTFGMVTRRSTARAGTRYFRRGI
                     DIDGNVANFNETEQFLIVHKLDNTTQVYTYLQIRGSVPVYWAEMNNLKYKPNLLIGPS
                     DYLPARKHFDKCISKYGTNYLVNLVNQSGYEKPVKLSYENAVTALNDSNIKYTYFDFH
                     HECRKMRWDRVKLLLDHLTQIGLSPNDYSQYTIDSNFVAEKTQSHVVRTNCMDCLDRT
                     NVVQSMLGRWYLQQQLIDACIIDGYLDWKDLDPAFNLVFQNIWADNADYVSNAYSGTG
                     ALKTDYTRTGKRTKKGALNDLVNSITRYIKNNYFDGSRQDGFDLFLGKSLPYEIVSSP
                     FKDTRPPLYQAAPYVCMVSIFIIIATLVYPKGALTDAKNIFFLSVMSFSTGLSLWFIL
                     KNGIQFVNWPVLKKLDFLRKKEVYNNGRVEGFLFEKEASYNKFDEQHKKQ"
     gene            complement(<430033..>433989)
                     /locus_tag="C5L36_0D02070"
                     /db_xref="GeneID:40385293"
     mRNA            complement(<430033..>433989)
                     /locus_tag="C5L36_0D02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467081.1"
                     /db_xref="GeneID:40385293"
     CDS             complement(430033..433989)
                     /locus_tag="C5L36_0D02070"
                     /inference="similar to AA sequence:RefSeq:NP_013488.3"
                     /note="PKUD0D02070; similar to Saccharomyces cerevisiae
                     YLR384C (IKI3); ancestral locus Anc_4.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322941.1"
                     /db_xref="GeneID:40385293"
                     /translation="MKNVTVLNRSRIHADSYTVPDLPLEDARFDLISDSLTIVLKSQN
                     SLEIQQFQKNGDRKILACIPINESDKLLNFIHFEDSNSIVCVFANGDLMIANYDSISN
                     DYEQTFIEIVGTIDCGIKSAKWSHDEEILTLVTNEHNLLLFSRNLDLVLEKKIDANDL
                     NIQNQVSLGWGKEETQFKGRGAKQIERQRNLLRNAGLNIDSDNAILCDPTIKEIQSGK
                     ISSFDINDYEISWRGDCQYFAITCIEIVNGKERRVIRVYSREGELISCSEPIDGQEHT
                     LSWKPQGSLIASTQRRFEPEINGHVLDVIFFEKNGLRHGEFDSRLNAKNDNIFKIGWS
                     SNSEILLLQLYNSVQLWYMKNYHWYCKQEIKTYSNDPIKFTKFHPEKPFKLMIGTKET
                     LEIIDLSYALTHGNTIQPYDQGLNMVVDGKTCLLTPFAKANVPPPMSFRELDIDENIN
                     CIASSMDNMYIALLSNKHVHVFKGDEDNWNYELISSFPIEDGLYPRQVQIVGKENKIY
                     ILMDDLLNNLSRILVLEIIDEQVEFQDIIETPNNLKVIKLSSNSSFDYAAFETIDSSI
                     YIVNTDNSVEKLSQFPQLVNDFQVVEVPSELNTPESPDFIKLPIGLMNTGKLYIDSKL
                     ISQGVTSMLITDGFLLYTTAQHQLKFFHLHNPNILDDNEIKEEFFEHDERIRNIERGS
                     TLVNSIPSKSSVILQAPRGNLETIYPRIMVLNDVRRAIKNVNYKSAFMTCRVHRIALD
                     ILHDYDPQLFFSNIENFIHQLDKVEYLDLFLSCLLEEDVCQTKYKESKLTNDDVSNAG
                     IVDAIKDLKISKKEQGTLKVRNICDAILNVLINKSSLKEKYLQSIITAYASQKPPRTE
                     EALQLISTFTNDQEIEKSVQHLCFLLDVNKLYLQALGIYNIPLALIVAQQSQKDPKEY
                     LPFLQSLFEETELRRRFMVDNYLKKYEKALDSLVKIPREENKDIKDEIIDFIIDHDLY
                     KHALTLYENDSENFNVVLGYFADYLNSKQNYTQAAIIYEKLLDYPKALENYISAKRWR
                     EAISITLKPEFNYKHEEACSTLVDSLTLIHDYKSAAYISHKYLGDLKRALELYGKEYE
                     YSTAIQLCLEEGKPELISEIVDPSINEGFGTIVELLADCKGQLESQLKRLRELREKKQ
                     SDPFAFYGEMGENENTPDNVSIAPSETSTKESFFTRYTGKTAGTAKTGASRRTAKNKR
                     REERKRARGKKGTIYEEEYLISSVGRLIDRLEITKPDTIKLLEAMIRREMIQQAHIVQ
                     SNYVALLNQLKENVVEIYTVDKRDRERIDENGMVYYVDEIPIPTIKDFPVLDILDY"
     gene            complement(<434355..>435341)
                     /locus_tag="C5L36_0D02080"
                     /db_xref="GeneID:40385294"
     mRNA            complement(<434355..>435341)
                     /locus_tag="C5L36_0D02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467082.1"
                     /db_xref="GeneID:40385294"
     CDS             complement(434355..435341)
                     /locus_tag="C5L36_0D02080"
                     /inference="similar to AA sequence:RefSeq:NP_010634.3"
                     /note="PKUD0D02080; similar to Saccharomyces cerevisiae
                     YDR347W (MRP1); ancestral locus Anc_5.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322942.1"
                     /db_xref="GeneID:40385294"
                     /translation="MLARRFTRFISTSSSLRQQLSVSSESDFNILLGKIQLPQVDRLN
                     EFNTQNKGLPGIFSQSTLNDIWYDQLNHKLEDIKYIFQSLSHHDYSHCFNDSSLNENT
                     SNKVINQYKNLLYDIAKRFDPNESYLFDSTASIYNLYYFLSSLKSSTSPIPTLAKPDS
                     LITFKPSFKSSPLNSDLVKLINKSFGSIEEFQTLLFHSAASIKGNGYTWLTYNHIDAS
                     TNDFNKLSHLSILNTYNSGIPLNFTNRRISNGREHDKRVSGESETNSSIPNLEDAKFN
                     NVNEFQITPLFAIGSNPSFWLRDYGVFGKKQYVNNVINAIDWEIVENRLPSK"
     gene            <436132..>437073
                     /locus_tag="C5L36_0D02090"
                     /db_xref="GeneID:40385295"
     mRNA            <436132..>437073
                     /locus_tag="C5L36_0D02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467083.1"
                     /db_xref="GeneID:40385295"
     CDS             436132..437073
                     /locus_tag="C5L36_0D02090"
                     /inference="similar to AA sequence:RefSeq:NP_011059.3"
                     /note="PKUD0D02090; similar to Saccharomyces cerevisiae
                     YER133W (GLC7); ancestral locus Anc_8.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322943.1"
                     /db_xref="GeneID:40385295"
                     /translation="MTDIEADVDSIIDRLLDVRGSRPGKQVQLLEHEIKYLCTKAREI
                     FIQQPILLELEAPIKICGDIHGQYYDLLRLFEYGAFPPEANYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
                     AAIIDEKIFTMHGGLSPDLNTMEQIRRIMRPTDIPDVGLLCDLLWSDPDKDIMGWSEN
                     DRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTIFSAPNYCGEFD
                     NAGAMMSVDESLLCSFQILKPAEKKKYPIKKKGGRIY"
     gene            complement(<437433..>438140)
                     /locus_tag="C5L36_0D02100"
                     /db_xref="GeneID:40385296"
     mRNA            complement(<437433..>438140)
                     /locus_tag="C5L36_0D02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467084.1"
                     /db_xref="GeneID:40385296"
     CDS             complement(437433..438140)
                     /locus_tag="C5L36_0D02100"
                     /inference="similar to AA sequence:RefSeq:NP_011652.1"
                     /note="PKUD0D02100; similar to Saccharomyces cerevisiae
                     YGR136W (LSB1) and YPR154W (PIN3); ancestral locus
                     Anc_3.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322944.1"
                     /db_xref="GeneID:40385296"
                     /translation="MNKTAVSVDTIKREIDSLVREGALSTDKALEIKRLLPRVDKVVA
                     LYDFTPQQDDDLQLSQGDIIAVLEKPSDNWWKGTNTTTGTTGVFPANYVKPYVDSEDR
                     DFDKEKLKERDRVLPQVPNNNKASSPTVEPPQGPPPYQQSYQQQPPQQYYQQQPPQQY
                     YQQPPPQQYPPAAPYQQPVVQPVGQPYVQPYVQQPVQVQGQEQQSTMSKIGHQLGSAA
                     IFGAGATIGSDLVNSIF"
     gene            complement(<438510..>439046)
                     /locus_tag="C5L36_0D02110"
                     /db_xref="GeneID:40385297"
     mRNA            complement(<438510..>439046)
                     /locus_tag="C5L36_0D02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467085.1"
                     /db_xref="GeneID:40385297"
     CDS             complement(438510..439046)
                     /locus_tag="C5L36_0D02110"
                     /inference="similar to AA sequence:RefSeq:NP_010692.3"
                     /note="PKUD0D02110; similar to Saccharomyces cerevisiae
                     YDR404C (RPB7); ancestral locus Anc_5.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322945.1"
                     /db_xref="GeneID:40385297"
                     /translation="MFFIKDLTLTLTLHPSHFGPDMKTHLRHRLLQDVEGTCTGEHGY
                     IVCVLDILNSTTTHGKVVPFDPCAHFNVQYKALVWKPIRGEVVDAQVSSVSPMGFFAH
                     AGPLAVFISRHLMPTGFEHRPQHTPPAYVSTGGTTGGGNTVISVGVPIRVKIVGTRAD
                     VGSISAIGSIKEDYLGPL"
     gene            <439795..>440325
                     /locus_tag="C5L36_0D02120"
                     /db_xref="GeneID:40385298"
     mRNA            <439795..>440325
                     /locus_tag="C5L36_0D02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467086.1"
                     /db_xref="GeneID:40385298"
     CDS             439795..440325
                     /locus_tag="C5L36_0D02120"
                     /inference="similar to AA sequence:RefSeq:NP_014793.1"
                     /note="PKUD0D02120; similar to Saccharomyces cerevisiae
                     YOR150W (MRPL23); ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322946.1"
                     /db_xref="GeneID:40385298"
                     /translation="MSNIIGKAGLGLVRAWHHVDLSKDERTLGRLASSIAIALIGKHK
                     PIVHETEDAGDYVVVSNCQHLKVTGRKLVEKTYWSHTTRPGSGKATPMEKVIDDYGYG
                     EVVRRAVSRMLPKDRHRKARLQRLKVFDGSTHPYRGNIIAWADETPLVEKAILEAKVR
                     NEQLSKFNELLKEKKL"
     gene            complement(<440747..>444595)
                     /locus_tag="C5L36_0D02130"
                     /db_xref="GeneID:40385299"
     mRNA            complement(<440747..>444595)
                     /locus_tag="C5L36_0D02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467087.1"
                     /db_xref="GeneID:40385299"
     CDS             complement(440747..444595)
                     /locus_tag="C5L36_0D02130"
                     /inference="similar to AA sequence:RefSeq:NP_014794.3"
                     /note="PKUD0D02130; similar to Saccharomyces cerevisiae
                     YOR151C (RPB2); ancestral locus Anc_5.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322947.1"
                     /db_xref="GeneID:40385299"
                     /translation="MDENDSHYAFDNLITTEDCWTVITSFFETKGLVSQQLDSFEEFI
                     ETSIQQLVLEDRKLILDQPAQHISEDDDINRRYEITFGDIFLSKPSQTEADGTTSTLL
                     PQEARLRNLTYSAPLYVEMKKMVKESIDDENSNQSSNQIQWYKEGDIFKYRTRQLDEL
                     EPIPQDFNDDEDEIVEERHNTKIHRSGAETQTIFIGKVPIMLKSKFCTLYGLSEEELY
                     QIRECPFDMGGYFIINGSEKVLIAQERSSANIVQVFKKSGVSPISHVAEIRSALEKGS
                     RLISSIQVKLSTGGASSFKAGGVGRSIKTTLPYIKTDVPIVIVFRALGVIEDGDILQH
                     ICYDDDDWQMLEMLKPCIEEGFLIQSQEVALDYIGRRGNAVGIKRERRIQFAKDILQR
                     EFLPHISQDGGHETNKAYFFGYIINRLLLCALERKEQDDRDHFGKKRLDLAGPLLANL
                     FRILFRKLSRDIYRYMQRCIEHGEDFNIVSAVKSTTITSGLKYSLATGNWGEQKKAMS
                     SKAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQA
                     CGLVKNLSLMSCISVGSASEPITYLLEEWGLEPISDYDPQEHKLSTRVFLNGNWVGTH
                     RDPGMLVDTMRQLRRSGTISSEVSLIRDIREREFKIFTDAGRVYRPLFIVDDDPDSEN
                     KGGLKLTKEHCRKILDREVEEIPQDDEFDENGEPLEPLQRIYGWESLLSEGIVEYLDA
                     EEEETVLIAMSSEDLSFNNQNGEDDEHMNQDHDENGNLIQSDKRIKSHINSHSFTHCE
                     IHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
                     KPLAKTQSMEFLKFRELPAGQNAIVAICCYSGYNQEDSMIMNQSSIDRGLFRSLFFRS
                     YMDQERRNGISVVEEFEKPMRSNTLGFKAGTYEKLDDDGLISPGVRVSGDDIIIGKTV
                     PIPPDTEELGQRTKYHTKRDASTPLRATESGIVDQVLLTTNSEGLRFVKVRMRTTKVP
                     QIGDKFASRHGQKGTIGITYRNEDMPFTSEGIVPDLIINPHAIPSRMTVAHLIECLLS
                     KVASLRGYEGDATPFTDLTVDAVSKLLRENGYQSRGFEVMYNGHTGKKLMAQVFFGPT
                     YYQRLRHMVDDKIHARARGPYQNLTRQPMEGRARDGGLRFGEMERDCMIAHGAAGFLK
                     ERLMDSSDAFRVHVCGICGLMSVVANLKKGQFECKSCKNKTNIFQIHIPYAAKLLFQE
                     LMAMNITPRLYTQKSSYTVR"
     gene            <445180..>446025
                     /locus_tag="C5L36_0D02140"
                     /db_xref="GeneID:40385300"
     mRNA            <445180..>446025
                     /locus_tag="C5L36_0D02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467088.1"
                     /db_xref="GeneID:40385300"
     CDS             445180..446025
                     /locus_tag="C5L36_0D02140"
                     /inference="similar to AA sequence:RefSeq:NP_010693.3"
                     /note="PKUD0D02140; similar to Saccharomyces cerevisiae
                     YDR405W (MRP20); ancestral locus Anc_5.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322948.1"
                     /db_xref="GeneID:40385300"
                     /translation="MELVIYTATPLLPTPSIYISTPLHRVHRGRRPFTPVSYRTMFPA
                     VRFNLPFGARSIIMGRLKPFAPKPKPKVNREERAKQSKKIVQLVRSALENDETNFTPG
                     SKAIYLPFATVKLLRPNAKHTPYQAKFIVPKSFNKLDLRDYLYHIYGLRVLNVTSALM
                     PGKFVRSMPAPYGTRYRDAQVKKMTVDLVDPFVWPAESQEFIAERELTRELNKYREEK
                     ANAINSDLEKPSKAFGGIIDPKPQPMNFIPKLVEKQMRNKKNKDSERVKKLENEKFIT
                     SYLNI"
     gene            complement(<446257..>447108)
                     /locus_tag="C5L36_0D02150"
                     /db_xref="GeneID:40385301"
     mRNA            complement(<446257..>447108)
                     /locus_tag="C5L36_0D02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467089.1"
                     /db_xref="GeneID:40385301"
     CDS             complement(446257..447108)
                     /locus_tag="C5L36_0D02150"
                     /note="PKUD0D02150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322949.1"
                     /db_xref="GeneID:40385301"
                     /translation="MISLLSLLTLVYPLYTTFVTLRSLHDAAGTNIASLTDTVPISTK
                     LATKVAELMVFWILMTLWLSVLKMKVVSFIISIIPLSWIPILYIQLWLGHDIVPTTTL
                     NCYTSGSSIIYHYYFDNNMRCWNLLNKEVWRLLGIVGLKLISLVEYTPIALLINLNDY
                     RTMFKQGQDGESLYDVFANWMTTGEDTTIGETIICGLLAPMGYKYKGSKIPQSTGMTC
                     VNQQSSTAQQTHTQSKTPSPAGSFDDFTLVSENDIVINKRRDGSSLLHSIRRVSGEMS
                     KRFSKQE"
     gene            <447619..>449067
                     /locus_tag="C5L36_0D02160"
                     /db_xref="GeneID:40385302"
     mRNA            <447619..>449067
                     /locus_tag="C5L36_0D02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467090.1"
                     /db_xref="GeneID:40385302"
     CDS             447619..449067
                     /locus_tag="C5L36_0D02160"
                     /inference="similar to AA sequence:RefSeq:NP_012711.1"
                     /note="PKUD0D02160; similar to Saccharomyces cerevisiae
                     YKL211C (TRP3); ancestral locus Anc_1.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322950.1"
                     /db_xref="GeneID:40385302"
                     /translation="MPVDTSKNVIMIDNYDSFTWNLYEYLSQAGANVSVYRNDAITLS
                     EIESMNPDTLVISPGPGHPQTDSGISRDVIEYFKGKIPIFGVCMGQQCIFEVFGGSVQ
                     YAGEIVHGKTSTIKHDNKGMFRNVPQDVAVTRYHSLAGTKDSLPDCLEVTATTDNGII
                     MGVRHKEYVIEGVQFHPESILTEEGHMMMKNILNYRGGYWKDNVNVSMAKLGETILDR
                     IYKQRRMDVEELSKIPGKTFRDLEIYYELGIAPKVKDFHKHIANNGKVSIVSEIKRAS
                     PSKGDIQIEANAGKQALMYAKAGVRAISVLTEPHWFKGSIEDLQVVRKVVDSIEDRPC
                     VLRKEFIFSKYQILEARLSGADTVLLIVKMLTEDELAELVQYSRSLGMEPLVEVNTEE
                     ELQTALKYNSRVIGVNNRNLHTFDVDLKTTTNVLSELPQGSDVYVLALSGISTVEDVQ
                     NYTKQGVTGFLIGEALMRRGESVGSFISELQA"
     gene            <449440..>450273
                     /locus_tag="C5L36_0D02170"
                     /db_xref="GeneID:40385303"
     mRNA            <449440..>450273
                     /locus_tag="C5L36_0D02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467091.1"
                     /db_xref="GeneID:40385303"
     CDS             449440..450273
                     /locus_tag="C5L36_0D02170"
                     /inference="similar to AA sequence:RefSeq:NP_012361.1"
                     /note="PKUD0D02170; similar to Saccharomyces cerevisiae
                     YJL174W (KRE9); ancestral locus Anc_1.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322951.1"
                     /db_xref="GeneID:40385303"
                     /translation="MKLAQVFTLLALITQAVSILVVTGPEMGATYKASDGEIAIPITW
                     QDDGTDPTDDEIKSYTFVLCTGPNNAIHGLEKIAPIDAAKITVGGYTPIFDADIAASG
                     YFYVQIYCQLKNGGYFLRYTPRVQLQGMTGSYPASGIGETPWGDQQFDSDGQNANPTK
                     SRTIPYTLQTGKTRYAPMQMQPGSQITVSTWSRRFPTSAVTYYSAISGTPVVKSTVTA
                     GWSYTMSSLVNMASPAPFPKEVGWYPASQRLASASLDSRIVTAVGDSKKRKLKKRRWV
                     D"
     gene            complement(<450595..>450894)
                     /locus_tag="C5L36_0D02175"
                     /db_xref="GeneID:40385304"
     mRNA            complement(<450595..>450894)
                     /locus_tag="C5L36_0D02175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467092.1"
                     /db_xref="GeneID:40385304"
     CDS             complement(450595..450894)
                     /locus_tag="C5L36_0D02175"
                     /note="PKUD0D02175; Pfam Domains: Rep_fac-A_3(2.6e-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322952.1"
                     /db_xref="GeneID:40385304"
                     /translation="MQSIRIDAPLLASHTSKTVRLMGRLSAPTTLDANGEIALQNADS
                     YNLIVDNYYEIIGLVQKDLSVSVLQAFDLGHDFNMKAATKLVEIVHKFPEIYHDV"
     gene            <451948..>452346
                     /locus_tag="C5L36_0D02180"
                     /db_xref="GeneID:40385305"
     mRNA            <451948..>452346
                     /locus_tag="C5L36_0D02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467093.1"
                     /db_xref="GeneID:40385305"
     CDS             451948..452346
                     /locus_tag="C5L36_0D02180"
                     /inference="similar to AA sequence:RefSeq:NP_012751.1"
                     /note="PKUD0D02180; similar to Saccharomyces cerevisiae
                     YKL170W (MRPL38); ancestral locus Anc_1.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322953.1"
                     /db_xref="GeneID:40385305"
                     /translation="MIYLKTLLKVIDNSGAELVECIKVLRKSPMNCAHVGDKIVVVVQ
                     EAKPLASQITGASASNRVKRGDICRAVVVRTKYPIQREDGSVIRFDDNACVLINQKDE
                     PIGTRVGSVVARELRKKNFGKIISLAPRVV"
     gene            <452758..>453228
                     /locus_tag="C5L36_0D02190"
                     /db_xref="GeneID:40385306"
     mRNA            <452758..>453228
                     /locus_tag="C5L36_0D02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467094.1"
                     /db_xref="GeneID:40385306"
     CDS             452758..453228
                     /locus_tag="C5L36_0D02190"
                     /inference="similar to AA sequence:RefSeq:NP_012754.1"
                     /note="PKUD0D02190; similar to Saccharomyces cerevisiae
                     YKL167C (MRP49); ancestral locus Anc_1.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322954.1"
                     /db_xref="GeneID:40385306"
                     /translation="MPYQKIPKALRPLYLKGLPSSRTLKQASHLDLIANYPNSAYVLP
                     KEVAKIEVLFKKHNAYGHMGMRQFWKYNLKTLCFHNPTVPIEVMRIECGTRDEQLKCP
                     ALIRTHFRDGTMATINGKDKHSSAIMEELVKVTSAQRVPESEIPLVAPSVTARG"
     gene            <454100..>455686
                     /locus_tag="C5L36_0D02200"
                     /db_xref="GeneID:40385307"
     mRNA            <454100..>455686
                     /locus_tag="C5L36_0D02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467095.1"
                     /db_xref="GeneID:40385307"
     CDS             454100..455686
                     /locus_tag="C5L36_0D02200"
                     /inference="similar to AA sequence:RefSeq:NP_011871.1"
                     /note="PKUD0D02200; similar to Saccharomyces cerevisiae
                     YHR007C (ERG11); ancestral locus Anc_5.588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322955.1"
                     /db_xref="GeneID:40385307"
                     /translation="MSVIKAIAADVQRYALLAYSHFQTFSLLQQTLLVISIPFLYSAL
                     WQLLYSFRKDRVPMVHYWIPWVGSAVVYGMQPYEFFENCRKQHGDVFSFLLLGKVMTV
                     YLGPKGHEFVLNAKLSDVSAEDAYTHLTTPVFGKGVIYDCPNWKLMEQKKFAKVALTK
                     ESFIRYVPLIKDEMLKYFNANFRGDSGKTDVLKSQSEMTLFTASRSLFGDALRNRLDA
                     SYAEMYSDLDKGFTPLNFVFSYLPLPNYWKRDAAHKNISNTYLDLINTKRAGGEIKNE
                     DLVDALLKNSVYKDGTRMTDEELAHLMIGVLMGGQHTSSATSAWFLLHLGEKPQLQEE
                     IYREIQSVLGENFERELTYDDLQKLDLVNATIKETLRLHMPLHSIFRKVTRDLPVPNT
                     SYIVPKGHYVLISPGYTMLSERYFPNASEFQPHRWDEIKSIDGGISLPAEGENAKETV
                     DYGFGKISKGVASPYLPFGGGRHRCIGEPFAYTQLGTLLVHYIQNFKWTAKVPPIDYT
                     SMVTLPTQPAEIKWERRQKN"
     gene            complement(<456023..>457255)
                     /locus_tag="C5L36_0D02210"
                     /db_xref="GeneID:40385308"
     mRNA            complement(<456023..>457255)
                     /locus_tag="C5L36_0D02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467096.1"
                     /db_xref="GeneID:40385308"
     CDS             complement(456023..457255)
                     /locus_tag="C5L36_0D02210"
                     /inference="similar to AA sequence:RefSeq:NP_010566.1"
                     /note="PKUD0D02210; similar to Saccharomyces cerevisiae
                     YDR280W (RRP45); ancestral locus Anc_5.289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322956.1"
                     /db_xref="GeneID:40385308"
                     /translation="MTHTDNTLPIPNILTLHSLLSGHPPLRPSLRALDEPRNLEINIV
                     SSSESASQRSVEVKLGETYVSCKVSAQITQPYEDRPFEGTFAISTEITAMCSPAFSNS
                     NNTDFSTAAPAIVPATSVNVPSNGESNNNNNSNNGSGSGNQENQLSMGGGAVMGLAAD
                     QGATEILLGRLIEKGVRRSNALDLESLCIIAGQKCWAVRADVRFLNYDGNLVDAASIA
                     VITALLHFRKPDVELVGSGEGTELIIYDEKQREMVPLSILHIPICVTFQFFSTESVER
                     NIKGESLDSRSRSRQVKSNNGDEGDDDLMDVDYEANDGPRASNEVVIVDATSEEELLS
                     QGSMTVTLNSNKELCQISKSGGLNVDSKKVLECCQIASKIVDKWTKQIKQVLADDEKK
                     RRNPLIEKTLSTVNDRSS"
     gene            complement(<459892..>460929)
                     /locus_tag="C5L36_0D02230"
                     /db_xref="GeneID:40385309"
     mRNA            complement(<459892..>460929)
                     /locus_tag="C5L36_0D02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467097.1"
                     /db_xref="GeneID:40385309"
     CDS             complement(459892..460929)
                     /locus_tag="C5L36_0D02230"
                     /note="PKUD0D02230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322957.1"
                     /db_xref="GeneID:40385309"
                     /translation="MEDPLVPLEKDTIRVVITPQEHSENNSSWVYTSKELIHPVSQER
                     NTFVIARDGCNPITELYAMDKINWRNQTIKNNSSTPDGKPYSCLFITYPLSTATSVPA
                     TVLGKHPDIYVMSSFSPLFFLIAYFKSAMVKAQNDGENKRLLSYEDLIENICNDDETI
                     SMFVNEFQMDLRPYLECICELVSLPSMDSDDESTDPFYKPSLDKILNIIDERINSLVH
                     LFQTENGIASLKWRMDTMYPKRLTDELRSLLWKRQAISIMSLFVDEWYINEACKKFNY
                     KFTELDQFISASKVDQQAQQAMDESLEMMHEGMIKSNNKRFKPTPKKINTTEKKKTGA
                     LDMFFKRKESN"
     gene            <461270..>463273
                     /locus_tag="C5L36_0D02240"
                     /db_xref="GeneID:40385310"
     mRNA            <461270..>463273
                     /locus_tag="C5L36_0D02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467098.1"
                     /db_xref="GeneID:40385310"
     CDS             461270..463273
                     /locus_tag="C5L36_0D02240"
                     /inference="similar to AA sequence:RefSeq:NP_013742.1"
                     /note="PKUD0D02240; similar to Saccharomyces cerevisiae
                     YMR029C (FAR8); ancestral locus Anc_2.583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322958.1"
                     /db_xref="GeneID:40385310"
                     /translation="MQNGQGRKESLLDPASGVTANYTLPGIMQYLQSQFTQVERNRLQ
                     GELERSSLKMKIIELENDRNMLIRKNERLEGTIEQLKLEISQLKGTNPSSSAVSEKDL
                     DVLEGIHSVDVSKLVEAKKFLKDATNEILYLLQTPNVELENSISDFNSMSGVSDLLSG
                     KENQNNSFYNYCNASNYGDSQKAHNLQRSEDSPFNNEQTNSSNTISGTELEQHLNDII
                     TGNDTSDISVAESDAETIVEGLTSESNNVANTVDLDSGDDDDDDDDDDDDDDDDDDDD
                     DEFDDDDDDDDEDDNEDEDDDEGDDNERKAGHVRDHATDDTSPVHKKMNNQVVDSELS
                     KNQKNKQVKLLRKSPKIINDGSMKLPALSIQLNENLSEMELKNGKLFTYYDKENLIRV
                     YDDLLDSHEPVCEVKLPESGSIVDIVTNELYILVATPDSIIVHRLTENPPLVKSGIAA
                     KSIDLDQNKIVLVSNDKIEVLEIKHDSIETVQSIDYKTAGILKKVKFVKNSLTFNVSL
                     LTSTSLYLYNITLGNSREHLKKVIPLNDFHEWLVTSRNIIIKFNHGLYVFDFSECSEF
                     KCVPLPSGEISARTNPDSMSDVINSCADDESMFYITRYDNNGTTGNGELRLFKINELG
                     IITELTVLKNIKHSERYCIGKLSGRFAICVAKGQYIEVHSLSR"
     gene            <467532..>469841
                     /locus_tag="C5L36_0D02250"
                     /db_xref="GeneID:40385311"
     mRNA            <467532..>469841
                     /locus_tag="C5L36_0D02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467099.1"
                     /db_xref="GeneID:40385311"
     CDS             467532..469841
                     /locus_tag="C5L36_0D02250"
                     /inference="similar to AA sequence:RefSeq:NP_013170.1"
                     /note="PKUD0D02250; similar to Saccharomyces cerevisiae
                     YLR069C (MEF1); ancestral locus Anc_8.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322959.1"
                     /db_xref="GeneID:40385311"
                     /translation="MFGKIASTGWRSVTAALRGPVPFQRGFQVSAMRKSYEEEKIVID
                     ELSAKLTDEDVARLGRMRNIGISAHIDSGKTTFTERVLFYTGRIKAIHDVRGRDGVGA
                     KMDHMDLEREKGITIQSAATYCSWERAPGKNLHFNLIDTPGHIDFTIEVERALRVLDG
                     AVLVVCAVSGVQSQTVTVDRQMKRYNVPRITFINKMDRMGANPWKAIEQIRTKLKIPA
                     AAVQVPIGSEKDLIGAVDIINRKSIYYEGSQGEKLRITEEIPADLQDLVEEKRSELIE
                     TLADVDDEIAECFIDEVEPSVEQIQGAIRRATIARKFTPVFMGSALANKGIQPVLDGV
                     CDYLPDPSEILNTALDLGNEETPVNLVPSSTSPAVALAFKLEEGKYGQLTYLRVYQGK
                     LRKGSMITHVKTGKKIKLARLVRMHSEEMEDVDEIHAGEICATFGIDCASGDTFTDGS
                     VDYSMSSMFVPDAVVSLSISPKTKDAANFSKAVNRFQKEDPTFRVHFDKDSKETIISG
                     MGELHLEIYVERMKREYNVECTVGRPRVSYRESILGSAPFDYTHKKQSGGAGQFAKVM
                     GKMEATANVDPEEIGATLGDDIKFRNHFQTKVVGGKISEKFLLACQKGFEDCCEKGPL
                     TGSRVLGVHMVVDDGATHVVDSSEMAFRTATQFAFKQAFLNSQPVVLEPIMNVVITAP
                     NEFQGAVIGLVNKLGGLINDTENAADDFNLTSDCSLNNLFGFASKLRAVTQGKGEFTM
                     EFKEYQPAPPQLQKQLIEDYTKKNKGGDN"
     gene            complement(<470109..>471134)
                     /locus_tag="C5L36_0D02260"
                     /db_xref="GeneID:40385312"
     mRNA            complement(<470109..>471134)
                     /locus_tag="C5L36_0D02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467100.1"
                     /db_xref="GeneID:40385312"
     CDS             complement(470109..471134)
                     /locus_tag="C5L36_0D02260"
                     /inference="similar to AA sequence:RefSeq:NP_015411.1"
                     /note="PKUD0D02260; similar to Saccharomyces cerevisiae
                     YPR086W (SUA7); ancestral locus Anc_3.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322960.1"
                     /db_xref="GeneID:40385312"
                     /translation="MSTAAPERRNPRGVNLNVTLSCPECKVFPPELIERHAEGDIVCG
                     LCGLVLCSRIIDNRSEWRTFNNDDQKGDDPSRVGEATNSILDGDQLNTVISAGIDATR
                     TARDLNRTQSKSFADKRSHTLQAAFSKITQMCDGYQLPKVVQDGAKEVYKLVYDDPSL
                     KGKSQESIMAGAIFLGCRKASVPRSFKEIWALTNVPRKEIGRVFKQINNIIQRKNEEQ
                     GGIITYQNDSINTRHTNPEDLVGRFCSHLGLSPQIASSAQTIAKNLKTVGVLEGRSPT
                     TIAATVIYFTSVAFDQNLTLAKISEKTGVSEGTIKSSYKLMHAERSKLIDPSWIESGK
                     VSASKVE"
     gene            complement(<471641..>472261)
                     /locus_tag="C5L36_0D02270"
                     /db_xref="GeneID:40385313"
     mRNA            complement(<471641..>472261)
                     /locus_tag="C5L36_0D02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467101.1"
                     /db_xref="GeneID:40385313"
     CDS             complement(471641..472261)
                     /locus_tag="C5L36_0D02270"
                     /inference="similar to AA sequence:RefSeq:NP_013713.1"
                     /note="PKUD0D02270; similar to Saccharomyces cerevisiae
                     YML001W (YPT7); ancestral locus Anc_6.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322961.1"
                     /db_xref="GeneID:40385313"
                     /translation="MPPPKKTLLKVIILGDTGVGKTSLMQRFINGKFSQQYKATIGAD
                     FLPKDMKIDDKNVTLQIWDTAGQERFQSLGVAFYRGSDCCVLVYDVTNAKSFENLQSW
                     RDEFLIQANIRDPDNFPFVIIGNKIDVQESKRVVSSKKAQLMAQNLGNLPYFETSAKE
                     AVNVEQAFDVVARNALQQEESMMFNDDYTDAVNIHVDGDSYGNCSC"
     gene            <472800..>473525
                     /locus_tag="C5L36_0D02280"
                     /db_xref="GeneID:40385314"
     mRNA            <472800..>473525
                     /locus_tag="C5L36_0D02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467102.1"
                     /db_xref="GeneID:40385314"
     CDS             472800..473525
                     /locus_tag="C5L36_0D02280"
                     /note="PKUD0D02280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322962.1"
                     /db_xref="GeneID:40385314"
                     /translation="MHTLLSETLQRHEQPQQQQQQQQQQQQQQQQQQQQQQQQQQQQK
                     VQNVIDETARTLGLAQTLLLLVLVALDRLHHRSSLSLLLIHLRTQLDSLIDNPPAHSG
                     RVFQLTEKNWQLVFEHASYFHIEDLAAIYNDLLEHPLELTFTSFKIRILASSESIQDY
                     LHFNGVFDEESIIAYNESKIAGHIHRTAFSRESGLGDNPSRASSHDVCRIIQSENFTD
                     FHLKRWKVLRLLDRHIFKPATTE"
     gene            complement(<473643..>475127)
                     /locus_tag="C5L36_0D02290"
                     /db_xref="GeneID:40385315"
     mRNA            complement(<473643..>475127)
                     /locus_tag="C5L36_0D02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467103.1"
                     /db_xref="GeneID:40385315"
     CDS             complement(473643..475127)
                     /locus_tag="C5L36_0D02290"
                     /note="PKUD0D02290; Pfam Domains: La(7.2e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322963.1"
                     /db_xref="GeneID:40385315"
                     /translation="MQDVPKVLVPAPVPKMNAWIDASSLIESAKEAKIEIDTSVDFTH
                     GSIKVNKQGHPNNKNTLGNKRNILGKPMNKYKNSEVENININTVPKRLDVKEATEEVE
                     HFHISNGKKKQTWRENKFDNKNYKAKFHKSSRSHAYRNNYSRCLNAQENRSRQQHAQQ
                     EPHVLEKDILVPTSNIMNDYGQYRTLVLSDPSLQQPVNEKFPAIPLLSPAAAVSGDSF
                     ANTNHALFSGPQTTPTLFPKTPLTLETPETLKENHFKPFKGSKMPSETMKQRNSFNAE
                     HNSYEQSTRFRTREPAFIIGGHCYGAPPNFNHPIGVPVLQPFPPPFPPPLPPPSTVSC
                     SLPLPHPFPLPLPVPMQLPPSLPLHPPGKLPSRFEIPGYLPSATLDSQNVTSKIIPLD
                     AAVKKLDSESTNDKFERVAEQILYYFSTDNLCRDLYLRGNMSKEGYVPISLLNGFKRI
                     KLICGDDERFVDYVLDHIPELEKRGDSVRLRQNWERWLLPGTKR"
     gene            <475555..>477690
                     /locus_tag="C5L36_0D02300"
                     /db_xref="GeneID:40385316"
     mRNA            <475555..>477690
                     /locus_tag="C5L36_0D02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467104.1"
                     /db_xref="GeneID:40385316"
     CDS             475555..477690
                     /locus_tag="C5L36_0D02300"
                     /note="PKUD0D02300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322964.1"
                     /db_xref="GeneID:40385316"
                     /translation="MKKFTCVRPNFSSSLEFFSKKLEIQVEILSTVNSSAWYANLSRG
                     KDLGIIRLKVDKETNEYLDGMLDSATTFGFFVKLNTNLLSYGFMYRITASKQWIIKPF
                     KDKPLLVDRPPHKYLEDIDYLSVKVSNDVLRGKSTSLRINETFPDLVKHSRKYMQLQQ
                     KKAHESKDVLKSIDPIEFLLDQYFTILYDDSFVIERFVKFSVSKMHLLKHNNSQLGKE
                     CLTKLLVHSLHKFDKRYDIAVSEGTEVSELITKWLSPEILLDPLESKFRENIFNKLGI
                     DKQAKVTFTDNGKIAECFNNLKIRDAKLQILIDMELLKVIKTEDPGTRLTPIHVPSTA
                     KPARPKGKRTQLISKRYSNKPTDKKRRLIPTLLGSVIPEDFDVDVDLRGQSEPEVEIT
                     RETLEKLIEGLFEKLCVCDAIYGWDYKDDKSSWGFVLSCILPYYERIHRRIISNLAIK
                     SRGPAYLLKLKTRKEKKEKEAKRQRKGVEKSHKSTERRSTNIDLSKIKLTRQNSSFSS
                     SKIDLSRKIISMNESVSNSTGLVDDAPFSIERVDSSNGFMNNKKRKLQAPDAKSNQHP
                     DDLLGTNVTKPKQVVQPSQEPIDLFYHNQIIEATPRKQELEKKQTIPELSYINGNTPH
                     QDSGIIAGSSPFRMVSSPSKIITQITETSNLERIQVMPGVFEFGSSPAKTIIESPIIK
                     SSKQTQDSEPNSSVKLNPIKSTKRKLSFK"
     gene            complement(<477778..>479340)
                     /locus_tag="C5L36_0D02310"
                     /db_xref="GeneID:40385317"
     mRNA            complement(<477778..>479340)
                     /locus_tag="C5L36_0D02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467105.1"
                     /db_xref="GeneID:40385317"
     CDS             complement(477778..479340)
                     /locus_tag="C5L36_0D02310"
                     /inference="similar to AA sequence:RefSeq:NP_011403.1"
                     /note="PKUD0D02310; similar to Saccharomyces cerevisiae
                     YGL112C (TAF6); ancestral locus Anc_6.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322965.1"
                     /db_xref="GeneID:40385317"
                     /translation="MSKKTATNKSGSTSASAPGTNSSQKPLSHTLWSPYDTVRDVSDS
                     LGISWQLTDEVAKNLAMDVEYRIHEIIEQALKFMRHGKRKTLTTQDIDRGMKVLNLEP
                     LYGYDTSKPLVFKEAMIGPGQTLYYIDEDEVDFETLVNQPLPKVPRHATYTAHWLAVE
                     GVQPAIPQNPNLSDIKQLPISQRGTLENMLSLNNEEITLVTNPKTGVTSVESKQDKKE
                     LEVRPLVKHVLSKEMQLYFNKIIEVLADENNDALKTAALESVKNDTGLHQLLPYLVQY
                     VAETITHNLKNLNLLTTMLMLIYSLISNTSLYLDPYVHALMPCILTLLLAKNIGPIHA
                     ETDEERNGHFQVRTLASSLLQKIIDNYGSSYHTLKPRVTRTLLRAFLSNTTRSSIGTQ
                     FGAIMGMKSLGSEVIRIILVGNLRTWSTVVLENFEPDSENRRILLKQVIECLSLLTDD
                     GNLIVGRTKKHSREGENVASEEMDACKEENVITDSMKEKLVERVGGLVANAVCEQTNA
                     VAIYHGIFFGEV"
     gene            complement(<480155..>481921)
                     /locus_tag="C5L36_0D02320"
                     /db_xref="GeneID:40385318"
     mRNA            complement(<480155..>481921)
                     /locus_tag="C5L36_0D02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467106.1"
                     /db_xref="GeneID:40385318"
     CDS             complement(480155..481921)
                     /locus_tag="C5L36_0D02320"
                     /inference="similar to AA sequence:RefSeq:NP_011824.1"
                     /note="PKUD0D02320; similar to Saccharomyces cerevisiae
                     YHL039W (EFM1); ancestral locus Anc_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322966.1"
                     /db_xref="GeneID:40385318"
                     /translation="MENVDRLVQWARSKGCYINEKLSFEYSNNHGISCIIKESLSEDD
                     KKGLIRVPKSLIISPELADSFAKDYLSEVQTSSPEINTNLIFLLAKLKFDSSGKTIVE
                     NTNLHTEYQPYIDYLPNDGKSTGNPYFWTMEEKELLDGTDAHVLMKRNFLKDLENWKV
                     VASQLDVAKHPQLKDELLEYEAFKMGPLGGVSVDYLLNVKEISWTSFTAYLWASCIIS
                     SRAFPYLLFDASAKYKNHAFLLPIVDLLNNEDSNSSKCRWTIENNVFIFDSLDDLSKL
                     TQSCELYNNYGAKSNVEFLLNYGFCLKGNRDNTTTLSLKVDESVIEGAKNYGVVIPND
                     SSVNGINFILRQGDKIPENLIDFFSYLCKLTSERKGFNLRMKLEGLTQLKAIIKTKLR
                     TLKKLEVEVSDKVSSHHANIIKTYRKSQKDIFQQTLEQVEKMEKQLLTEFKPFSFKKA
                     MMVDTRFFNSFLVVFGTKSYNDLIEKGILDHAVLLWIMRISNKEVYEDIHDKTIFPDF
                     IYNEFQKVKRNMKIDNDDIAEFMPMYQSLFPALCGKVPSVYNRGDWTLNSLIYAGTVA
                     DRLTYKRETNGEVFFIDPAKSK"
     gene            complement(482085..482158)
                     /locus_tag="C5L36_0Dtrna10V"
                     /db_xref="GeneID:40385771"
     tRNA            complement(482085..482158)
                     /locus_tag="C5L36_0Dtrna10V"
                     /product="tRNA-Val"
                     /note="PKUD0Dtrna10V; codon recognized: GUU"
                     /db_xref="GeneID:40385771"
     gene            <483917..>485233
                     /locus_tag="C5L36_0D02330"
                     /db_xref="GeneID:40385319"
     mRNA            <483917..>485233
                     /locus_tag="C5L36_0D02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467107.1"
                     /db_xref="GeneID:40385319"
     CDS             483917..485233
                     /locus_tag="C5L36_0D02330"
                     /inference="similar to AA sequence:RefSeq:NP_013542.1"
                     /note="PKUD0D02330; similar to Saccharomyces cerevisiae
                     YLR438W (CAR2); ancestral locus Anc_4.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322967.1"
                     /db_xref="GeneID:40385319"
                     /translation="MTAPTPEFNLSSAKATEYEHKYAAHNYHPLPVVFHKAKGAHVWD
                     PEGNEYLDFLSAYSAVNQGHCHPRIVDALVDQAQKLTLSSRAFSCDIFGTYAKYITEF
                     FGYENVLPMNTGAEAVETALKIARRWGYVKKGINPDDAIILSCEDNFHGRSIAIVSMS
                     TDPDARVNFGPYLKNVGPVIPGTEDKLLRYGNIEDVELAFKNAGDKIAAILIEPIQGE
                     AGIVVPPMDYFVKVKALCKKYNVLLIADEIQTGIARTGKMLCWEHYLPREDKPDMVLL
                     GKAISGGVLPVSAVLSSREIMSVLEPGSHGSTYGGNALASRVAIEALEVVKDEKLVER
                     AEELGKFFQDELQKLADESNGMIKEVRGLGLLTAIVVDNSKTNGRSAWDLCLLMKKNG
                     VLAKPTHEHIIRLAPPLVISKEDLLKGVDSIRKALVELPTVEIAAH"
     gene            complement(<485553..>485830)
                     /locus_tag="C5L36_0D02335"
                     /db_xref="GeneID:40385320"
     mRNA            complement(join(<485553..485602,485677..>485830))
                     /locus_tag="C5L36_0D02335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467108.1"
                     /db_xref="GeneID:40385320"
     CDS             complement(join(485553..485602,485677..485830))
                     /locus_tag="C5L36_0D02335"
                     /note="PKUD0D02335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322968.1"
                     /db_xref="GeneID:40385320"
                     /translation="MLLNELRQSLMRQPITAPTMAVGFMGGVVLPLLITNAIAQRPAN
                     ALSHDANGAADTEADYYFNDILF"
     gene            complement(<486119..>487402)
                     /locus_tag="C5L36_0D02340"
                     /db_xref="GeneID:40385321"
     mRNA            complement(<486119..>487402)
                     /locus_tag="C5L36_0D02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467109.1"
                     /db_xref="GeneID:40385321"
     CDS             complement(486119..487402)
                     /locus_tag="C5L36_0D02340"
                     /inference="similar to AA sequence:RefSeq:NP_010703.1"
                     /note="PKUD0D02340; similar to Saccharomyces cerevisiae
                     YDR415C; ancestral locus Anc_5.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322969.1"
                     /db_xref="GeneID:40385321"
                     /translation="MTQGKNIGLLVLLILLFVALLYTCEYSKLLSQIRVDTYAYPTSL
                     HKDLLSNTLENIKTTALETDIDQLILDLPSDRYYNSDNGYKSSIYIEEYLKNLTNNIE
                     SKPVRELFRTELFHHEWKQPSVILRVGQFPQSIVLGCHVDSINFKSTHNAPGVDDNLS
                     GVVVVLQTVKHLTKLLESGMNLKNTIEFHFYAAEEVGSAGSTEVFQNYRLEEREIVAM
                     LQQDMTGFIQKSLDQGEDEHFGLIRDYQSPTLSSFIKLIIEEYCHIPVLETECGKVCS
                     DHISALMYGYPSVYVLESKVELSNPYIHSIHDTVEKIDFNHMREHLRMTIAFVVELAI
                     TPIKRTEVVEKISFRYIDLIILMTVHHTRRFVYLVIVFAAIVCTLYIISDDMAKSTNN
                     ASSTPLGIDPMDEVPLIERRGVRPGSNKKTKGKKN"
     gene            complement(<487643..>488590)
                     /locus_tag="C5L36_0D02350"
                     /db_xref="GeneID:40385322"
     mRNA            complement(join(<487643..488474,488571..>488590))
                     /locus_tag="C5L36_0D02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467110.1"
                     /db_xref="GeneID:40385322"
     CDS             complement(join(487643..488474,488571..488590))
                     /locus_tag="C5L36_0D02350"
                     /inference="similar to AA sequence:RefSeq:NP_010863.1"
                     /note="PKUD0D02350; similar to Saccharomyces cerevisiae
                     YEL051W (VMA8); ancestral locus Anc_5.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322970.1"
                     /db_xref="GeneID:40385322"
                     /translation="MSGAANREQVFPTRMTLGVMKTKLKGAQTGHSLLKRKSEALTKR
                     FRDITKRIDDAKRKMGRVMQTAAFSLAEVSYATGGNIGFQVQESISNNARFKVKAKQE
                     NVSGVYLPQFEADINENINDFKMTGLGRGGQQVQRAREVYSKAVETLVDLASLQTAFV
                     ILDDVIKVTNRRVNAIEHVIIPRTENTISYINSELDELDREEFYRLKKVQEKKQIAVA
                     AADAEVAAKKAALQAKELAEKEDDTEKLVVKDETIKNEQEALENGDKEGTSANTLVTE
                     NEEDVIF"
     gene            <488855..>491401
                     /locus_tag="C5L36_0D02360"
                     /db_xref="GeneID:40385323"
     mRNA            <488855..>491401
                     /locus_tag="C5L36_0D02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467111.1"
                     /db_xref="GeneID:40385323"
     CDS             488855..491401
                     /locus_tag="C5L36_0D02360"
                     /inference="similar to AA sequence:RefSeq:NP_010704.1"
                     /note="PKUD0D02360; similar to Saccharomyces cerevisiae
                     YDR416W (SYF1); ancestral locus Anc_5.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322971.1"
                     /db_xref="GeneID:40385323"
                     /translation="MEKNWLVEGINENDLHFELQLLKEPKNEDVWNQYIDHKYQELVE
                     ASPGDADHHVLNSLKGALLKLYYRKYHIFDTFNSWCDFIELYIKFLNHLKAEELTSEL
                     MKIIRVFEVAAVTYAHNVEFWRKYIEFLFKYDRFIGLDYILRVCETSLREVDKMQHIQ
                     IWGLLFKYIKDPGFHIYYNLFTYISNCYKFDVNIPVIKEGSIPDIDATFKGLIKTLTS
                     IEDLAKFDRVFNRICEPQLLLKVSDSELELHRKYLDAIINLSLKQQDGNEYNQKIETT
                     YNKIVQKFPDQRGVFTVKYAKYLIKSNLFEDAMLIAKKTLDSTLTIKDFTLSFNFLTD
                     ALEKKVTELSEHEDDPKLKEYLNELESLLNNRELLMNDVKLRQNRNSPITWLERLSIF
                     EKIGRQDQLFVCYSKAVLEIDPRKILNDEKLDMPQIWINYSKLYASNGDIETCRKLFE
                     TATKYPWTDVSQLEKIWIEWIRFEIDNNNAEHAKFICSKAISIPEQITSGKVDFEDDD
                     LSVQMKLFKSLKLRSLYIDLVANFETIDDVCKAYEDCIELQVADERLIVHYCVYLLIH
                     NRFEQGYYVFERNLNGLNGDVQCQLYDVFMERLLKDWNNLAMGKEKVREIFENGLRTF
                     TDMGNYESLRDTYIRYSEFERKYGSQTRSLRILREGILTMDTHGDKFKLYRVLIQNTM
                     KLLGIEATADVIKDALEELSVNLPGYTTELVKELIDIEVLLGHTERARKVLEYAAQEI
                     MEFGKTKTAKSDIWELFKTFEIKNGSESTYKEMLRRKRYLENKYGSSRDAGDELNKPK
                     YSSTNTEVAKQLNDRVGFVPSSSSSKLETEAALPKKTTVQNNDAIELDMD"
     gene            <491558..>493114
                     /locus_tag="C5L36_0D02370"
                     /db_xref="GeneID:40385324"
     mRNA            <491558..>493114
                     /locus_tag="C5L36_0D02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467112.1"
                     /db_xref="GeneID:40385324"
     CDS             491558..493114
                     /locus_tag="C5L36_0D02370"
                     /inference="similar to AA sequence:RefSeq:NP_010862.1"
                     /note="PKUD0D02370; similar to Saccharomyces cerevisiae
                     YEL052W (AFG1); ancestral locus Anc_5.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322972.1"
                     /db_xref="GeneID:40385324"
                     /translation="MTKLLLVKTFSQFPVLRLATETHLRQSSYYYFRRFASTPASFDT
                     DTSQQSNSQGSVTHEQQYSPLDLYDKKVSEGKLKNDQFQRGILTSMEHLYHDLQAYTP
                     PDVKEPDITATSSSSSFSFNRLMTSLFSPRKMGFQDSESSKVPHGIYLYGDVGCGKTM
                     LMDLFYDTVPSHLTKRRLHFHQFMQNIHKRAHELKVQHNHREDIDVMPYIAWELSKES
                     TVLCFDEFQVTDVADAMLLRRLMDYVLRSDHGLVLFATSNRAPDDLYINGIQRESFIP
                     CIELIKNCTHVIYLNSPTDYRKIPRPVSSAFYFPKPGVGYLSKACKRERREHIQNWYS
                     FFSQGHPAEDNIKLKIWGRDLNIPKASPPYVAQFTFKELCGNALAAGDYLTLANSFES
                     IIVTDIPYLTINMRDEVRRFITFLDAVYDHHTRIAVTAAAPFSDIFVEPENLGDNLYE
                     LSNKTDEEIDYKLENDALVTKHGFDKNIARKAFMFAHLDEERFAFARALSRLTQMGTQ
                     HWIDEVKPKA"
     gene            complement(<494724..>499177)
                     /locus_tag="C5L36_0D02390"
                     /db_xref="GeneID:40385325"
     mRNA            complement(join(<494724..498451,498451..>499177))
                     /locus_tag="C5L36_0D02390"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_029467113.1"
                     /db_xref="GeneID:40385325"
     CDS             complement(join(494724..498451,498451..499177))
                     /locus_tag="C5L36_0D02390"
                     /artificial_location="low-quality sequence region"
                     /note="PKUD0D02390; Pfam Domains:
                     RVT_1(1.8e-52)|rve(9e-26)|Retrotrans_gag(1.7e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322973.1"
                     /db_xref="GeneID:40385325"
                     /translation="MNSEVNAMHAGSNPSQVNLNMVFKGNEKNSVRLAQQFLFKLDMA
                     FKLQESMGKDVSELFKVATAMLNLDGSALAWFTNRYGNSELPLWHQFVEEFTLEFCPT
                     DEFELRQVAAKYNGCHQGKNSVEQFIQEFEGYRTLLPGEYENEWATRDRFVQGLRAEI
                     RGRVFQHRPNSLAEAKFLARDFEKDSAPRARDFRFSHQDRWRGEPMEIDSIKNKNYRG
                     RNFDSYKRNKNYNRNYNGGYAGRKPRQRKFKLVRNQKVVGSDIAINPPTIENANLQLK
                     NEIQHSTKFDKYILDNKDIENLSVSNVYMDRKELPLLKVKNELFKECVALVDSGASRN
                     FLDYEFVKSHQLENYLEPTEFEDVVAANKKTISVKGELTLELQFKLRDEWQNENIRFL
                     VLENINHKMILGFPFVKDHGNKVDWENIEKETETPEIPDIEEQIESSDENDLEETQEN
                     ELIGINSMRAVRRNLKNVDNYPLLLFVQSVEEKENNNVLEEPYDGVDGIRKKIHEEFR
                     DVVTNDQPTSLPPQRDLTHRIILIEPTRSTYRRQYKLSYSEKQELNKQVDELLKQGFI
                     KPSSSPFNSPVLFVKKKDGSMRMCVDYRLLNNNTVKDKFPIPRIDELITCFGGASVFS
                     KLDLMSGYFQVRIAEDDMEKTAFSTDYGHYEWVVMPFGLTNAPSTFQRMMNRILAPYL
                     NQFVQVYLDDIIIYSKTVEEHYSHIEKILELLRRNKLIAKKKKCSFYFKTLGFLGHLI
                     SSRGIQTDPAKIDKIKSWPIPKNAKDAQSFLGLAGYYRRFIKDYSKIASPIMEFANKK
                     CVWKEPQDKAFEELKGKLINAPILVHPIWEDGYTFVVHTDACGTALGYVLEQLDPDGK
                     LRGVIAYGSRKLIGSELNYSIYDREFLAVVEALKNWRYYLLNRHFVLKTDHRSLVYLK
                     RQNAIDSHRVARWLDYLADYDFTIQYVKGPTNSVADALSRYPYEEKEVGINTIESVLT
                     PNQELLERIIKSYDEDNEIKEIYDILKENLPIPKSIHNHIKHYSIEDNLLYFSVVKGG
                     NDRRIVVSPKSKLVQEIIGNAHDGNSAGHFGYFKTYMRLHPMFYWPIMLKSVKRYCQR
                     CTVCQKTKPETTGQRGLFSPLPIPEGRWTDISLDFVTGVPRCKNGHDMILVVVDRFTK
                     MAHFIPTRKTATAEQCAKLMVDNCFKLHGIPKRMVSDKDIRFMNKFWFTVYKIFGTSL
                     LFSTTNHPQTDGQTERTNRILNQLLRNYASNDLYSWDKWLSMAEFAYNSSHQVSIGSS
                     PFEVCYGYLPDSPMFISSSRVSSRRYSNKAEEFALEMKVIMENVKENMIEAQRSQETQ
                     HNKSRVYETFEVGDWILLHKDAYGSDRLYYKIQPVYYGPYKVVKKISDNAYEVDLPKT
                     NKKDRVINVRWLRRFLQTDKQFPKVPPRTIAEARSRLTEIIGIAGIDETNDTLDVYWK
                     DCDPCHSSSIPFSLFLEIPEDLQRTLWDNAKAIDKDNKLRDEVSKAAG"
     gene            499497..499582
                     /locus_tag="C5L36_0Dtrna4Y"
                     /db_xref="GeneID:40385779"
     tRNA            join(499497..499534,499546..499582)
                     /locus_tag="C5L36_0Dtrna4Y"
                     /product="tRNA-Tyr"
                     /note="PKUD0Dtrna4Y; codon recognized: UAC"
                     /db_xref="GeneID:40385779"
     gene            499595..499666
                     /locus_tag="C5L36_0Dtrna6P"
                     /db_xref="GeneID:40385784"
     tRNA            499595..499666
                     /locus_tag="C5L36_0Dtrna6P"
                     /product="tRNA-Pro"
                     /note="PKUD0Dtrna6P; codon recognized: CCA"
                     /db_xref="GeneID:40385784"
     gene            <499998..>502106
                     /locus_tag="C5L36_0D02400"
                     /db_xref="GeneID:40385326"
     mRNA            <499998..>502106
                     /locus_tag="C5L36_0D02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467114.1"
                     /db_xref="GeneID:40385326"
     CDS             499998..502106
                     /locus_tag="C5L36_0D02400"
                     /inference="similar to AA sequence:RefSeq:NP_012900.1"
                     /note="PKUD0D02400; similar to Saccharomyces cerevisiae
                     YKL025C (PAN3); ancestral locus Anc_2.669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322974.1"
                     /db_xref="GeneID:40385326"
                     /translation="MSSTPYDWAKNIPCRNIQIHGFCKFEHKGCSYNHDLASKESSIE
                     APPSASTSESMSDNHKSKGLNGPKLNTSITSSNNTFAEQNSISSPVTSAQHFKPTLLK
                     QSSSFSNEIGPNGVSSSARKFNVASPAFTPISANKFSAMSPSLDTIPTFTPSNIPVPN
                     YDQTHPQQEEPSAVASTLRSPTNDLNVSSGKPHTSNESPLNDMNSLKSSISTATSFNP
                     VTAPIFTPDSNLPSNPTTDAHFHSQPLGEQLFYQNTNPYPVNFLLYAPPPPPHIELNK
                     RSNERTVNDLFIDNKLREYLQMKNEESLKSISHTELDLPRNVGVYHSLYPIDKNFDYS
                     TKSFGYTSIVYKCMSNTDGRLYAMRRLQNVPISSASVLNSVKKWKKLNCSNVVKIHEV
                     FTSRAFNDNSLVLIYDYYPMSLNLMENHFMSLPGKNPELITEDCLWNYTIQLLNAITE
                     ASKLSLTIGELNPSKIIITNKGRIRLSAVAIKDIIKDVKNSLNNTGAVAKKEEPPESS
                     DLLELGKLIFFLAKSTTLIQEPSDDPAKIVAQLKYSSAFKDALLYLLSGSPTIEEFQR
                     LVAPMILKLADGLQNSCDAMESTLMGELENARLVRLFAKLDFISERPEMVKDGSWSET
                     GERYPIKLFKDYVFHQVDDNGNPVVDLTHVINCLNKLDAGVDENLLLVSPDEMTCLIM
                     SYKELKELINKTFLTLLGKE"
     gene            <502518..>504116
                     /locus_tag="C5L36_0D02410"
                     /db_xref="GeneID:40385327"
     mRNA            <502518..>504116
                     /locus_tag="C5L36_0D02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467115.1"
                     /db_xref="GeneID:40385327"
     CDS             502518..504116
                     /locus_tag="C5L36_0D02410"
                     /note="PKUD0D02410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322975.1"
                     /db_xref="GeneID:40385327"
                     /translation="MLTTKTSHSRKKCHIQNKLRRFGIKLNRWWIYYWYTGNPEDDPT
                     LLTSRPRNTPLISLRNDEYCRYISQNVFVQVRGNNFWKSPSNFNIGGVRNPLQQINVG
                     VPILSPKRHSKRKQNLHIIRNPEIYQDEDKENIAVKCILIPEEPTERYKEEINIVDTE
                     ETNSLDSFERILRGSIDSTYGKLFSLHFCKPIVGKERKKPFCEESYTSEKRVQSNLLP
                     LIISEPSDGVNDPTSGKTIDNMILQKWDRHIIQQTEAVVFGFDEDQIDMQGGLKVQKS
                     SDGVANNNPKLEEGGDLGNLLPLEVNSILSEDEIALIPLIQKAEFFTKDTTLRDNHTQ
                     PLLTVRCSFESCDEIKEYQAKHGVGKYIVETTNSIPMKKRADKSFYRNAIFKIPYSKS
                     KESDEITLGFQLLGKIRHCFHQILGGRGTVKVTKIEQHNEEQKIKNGHVSHLHQWESC
                     HDVGAHKYNDSESSVFGAGAGAGTVAGAKGENMVTNKSPDPGLIYKTESLFFGDYNID
                     FFCKENGDNLTQRFACIQNITSQK"
     gene            <504511..>505908
                     /locus_tag="C5L36_0D02420"
                     /db_xref="GeneID:40385328"
     mRNA            <504511..>505908
                     /locus_tag="C5L36_0D02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467116.1"
                     /db_xref="GeneID:40385328"
     CDS             504511..505908
                     /locus_tag="C5L36_0D02420"
                     /inference="similar to AA sequence:RefSeq:NP_011868.1"
                     /note="PKUD0D02420; similar to Saccharomyces cerevisiae
                     YHR005C (GPA1); ancestral locus Anc_2.643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322976.1"
                     /db_xref="GeneID:40385328"
                     /translation="MGCTTSKIEPNKTSSEDSNFPNSSIQHRQPDIDQLQKWQDNRLE
                     KMMQQGKANKKNQIKMLLLGAGESGKSTVLKQMRLLHLGGFTVQEKIQYKNIIWADTV
                     ASMQTLIIQARNLGLELESDDPTSELYSSKQMILHYKPLESIDTPAAGGVAFLKDYLV
                     KYSEKSATDRRNKSSGRADVGWMEHSNPTDGSLVSDDILNDYKETDELLKDYAGNDSH
                     SPIEDKSGNSVSKRDVADAIAKLWSYDRGIRRCFQKSNLFQLEGSSPYFFDNVQNYAD
                     EEYMCTEDDILKGRIKTTGITETNFNINGIKFKLLDAGGQRSERKKWIHCFQDITCAC
                     FVLAVSEYDQMLFEDERVNRMYEAIMLFDSLVNSKWFANTPFILFLNKVDLLHDKVRK
                     SPLRKYFPDFDGKSNDAEDALRYFENLFLSLNKSKRPIYVHRTCATDTQSMKFILTAV
                     TDMVIQHNLKKSGLF"
     gene            <506276..>506578
                     /locus_tag="C5L36_0D02430"
                     /db_xref="GeneID:40385329"
     mRNA            <506276..>506578
                     /locus_tag="C5L36_0D02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467117.1"
                     /db_xref="GeneID:40385329"
     CDS             506276..506578
                     /locus_tag="C5L36_0D02430"
                     /inference="similar to AA sequence:RefSeq:NP_010801.1"
                     /note="PKUD0D02430; similar to Saccharomyces cerevisiae
                     YDR513W (GRX2) and YCL035C (GRX1); ancestral locus
                     Anc_1.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322977.1"
                     /db_xref="GeneID:40385329"
                     /translation="MSQQTVAQVQDLIKSHKVFVASKTYCPYCSATKKFLEDVYPDAY
                     VLELDTIDNGSEIQQVLAEITGQRTVPNIFINEKHIGGNSDLQALGKEKVKQLIGA"
     gene            <506832..>508469
                     /locus_tag="C5L36_0D02440"
                     /db_xref="GeneID:40385330"
     mRNA            <506832..>508469
                     /locus_tag="C5L36_0D02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467118.1"
                     /db_xref="GeneID:40385330"
     CDS             506832..508469
                     /locus_tag="C5L36_0D02440"
                     /note="PKUD0D02440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322978.1"
                     /db_xref="GeneID:40385330"
                     /translation="MVNGDMRNIQTEIELATTLVQSSIIKPRYRDEDILFSTIGVYED
                     DNLLQHMNSNLAYVLPGSNNILFVRSNYTSALFYTLMRRILAIFFSMYRFFLLSLSIS
                     LDLIDKGESLFWCLLSFLPFPEDVSEVGPAAVYSSTSVDKVSLGGEEAASHSINVTSL
                     REDMGNHLKSYGLLPTRIGNRILEKSLMASVPRNRLHIRRVTASWCVPYHMCFIFEMS
                     PLVVPQPPEVPTPYLDFDKKMVVPDKKDIAKVLSKRAEWSSLHHTHKAAEKFRLVYEA
                     SKCIAWAACSGVRIVTVFESNGYAWLDMPKIATVVYEEINSLTDSSYSVFDNIKLVNL
                     QTAETYDVFPKESKIRQLDSNQFGNNKEFDPNLDGSQETYKEVLEEVVPAPEPIVSYT
                     CKTEAKIPLDARHMFRTNLTVFFQSNKDSDTKQVLAHKVKRKICDILNKKPSLNSKSL
                     KHSPLNPVYIDLEQYVDPEIIYRFHSSSQNPNSLTGYPLVPLVTGTKVSDTVATKSLG
                     TLHRDTRVPIFISQGRPVNFAQFVKGIMTFHEMLKRG"
     gene            <509201..>510301
                     /locus_tag="C5L36_0D02445"
                     /db_xref="GeneID:40385331"
     mRNA            <509201..>510301
                     /locus_tag="C5L36_0D02445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467119.1"
                     /db_xref="GeneID:40385331"
     CDS             509201..510301
                     /locus_tag="C5L36_0D02445"
                     /note="PKUD0D02445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322979.1"
                     /db_xref="GeneID:40385331"
                     /translation="MGRKVAKKIPPTFKYLGFEEVGYLSVGRASSKDQTRSLNSKGGI
                     YMFHPNVSASHLKFHYNFDSSTFILENLSRYVVFVCKDKTVIRCAPKKRILTNNGDTI
                     AITFHREIIDNWRSMVYDEFLKKCEIRIQVFGDFSKEIYAFINYNLPKREISNEVEMF
                     DYVCESTPKALLPHDTRETSTKILAIISDKEKYVIDETTEEENDVYEAEEQNGDRIKH
                     KDQKEGEEKEDRFEETRYDEDEDFFYWKTLSDEEVLSDSISAASTIELAENYADNLDL
                     IAFDVCSSNEIELGGQTFGKRTFDKIDYADDEDDNRLKALEMKLEEKEREIKKLKGNT
                     PCSRTIKPFLAGALTATVATVSALYHIGSRMT"
     gene            complement(<510552..>512063)
                     /locus_tag="C5L36_0D02450"
                     /db_xref="GeneID:40385332"
     mRNA            complement(<510552..>512063)
                     /locus_tag="C5L36_0D02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467120.1"
                     /db_xref="GeneID:40385332"
     CDS             complement(510552..512063)
                     /locus_tag="C5L36_0D02450"
                     /note="PKUD0D02450; Pfam Domains: MatE(5.4e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322980.1"
                     /db_xref="GeneID:40385332"
                     /translation="MSDSESLVLDIPEPYTGPIDINTTCDEEDHLLLEELDFVPLHPV
                     TTTTSHELYYLLTNSVPLFFTFFFQYSIQILIPTYFSSRIGPLEMSSCTLSITTWYLT
                     GPVMVNGFTSALDTLCSTAFGAQHYHRVGQYYVKCTIVLLILLIPSMYFWSHAGSFFQ
                     RITSFKGSQNQELAALCASFISVFTYVAPAIGIFECTKRFLQSQCKFSVPTRIVIGGI
                     PISILFNMTIPKFLDSNSLHKAPAISFVFTYWIMTIALVSYMFFVDGYQCLPTIEGIK
                     AWTVKSFVKSSFVFFQLGVPGVIMILSEAFAFQIITFLSTSFPKSQLAAQSIISTLAS
                     LAFQPPFAVGICCSTRIANIIGAKSENYKPAMKAIYILMIGLSIFNFSWFFFLRNRIT
                     SLFTNDPEILDIAQRLAIIIAINQFLDCFNILCAAVLRGQGRQRIGSLLSLTTYYLIG
                     IPLELFFAFKLDWKIYGLWIGLAIGVNFLSLLEMVIVNHSNWNNIIKESRKRS"
     gene            <514007..>518663
                     /locus_tag="C5L36_0D02470"
                     /db_xref="GeneID:40385333"
     mRNA            join(<514007..514894,514983..>518663)
                     /locus_tag="C5L36_0D02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467121.1"
                     /db_xref="GeneID:40385333"
     CDS             join(514007..514894,514983..518663)
                     /locus_tag="C5L36_0D02470"
                     /note="PKUD0D02470; Pfam Domains:
                     ABC2_membrane(9.2e-99)|PDR_CDR(9.2e-58)|ABC_tran(1e-42)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322981.1"
                     /db_xref="GeneID:40385333"
                     /translation="METISVGKESDVSSDGNVAYGGFNEGTNKQIRDLAREFTRQTSV
                     GDGVQDSDDATDSNEVEKFGVDHASPNSPPKSNQYDLLRTLTSMSQVPGVNPVDQTID
                     PRLDPNSDEFESKFWVKNMRKLLDSDPDYYRPTSLGFAAKNLIAKGISSDADYQANFL
                     NYPFKVVRDTYMDLFRGNDESRYFEILKSMDVLIKPGTLTVVLGRPGAGCSTFLKTVA
                     AQTYGFKVDDSSIISYDGLTPKEINKNYRGEVIFSAEMDNHFPHLSVGQTLEFAAKMR
                     TPQNRFPGVSRNEYAKHMSEVYMATYGLSHTVNTKVGDNFIRGVSGGERKRVSIAEAS
                     LCGANLQCWDNATRGLDAATALEFVRALKTSAHILDTTPLIAIYQCSQDAYDLFDNVV
                     LLYEGYQIYFGPGDRAKDFFERMGYECPDRQTTADFLTSITSPAERVAKKGWENKVPQ
                     TPKEFSDYWRASAEYKELVADIDEYLSHCHNNNTREEFAEAHAIKQANHARPSSSFRV
                     SYWMQIKLIAQRNIWRTKGDPSIMMFSVIANIIMGLIISSLFYNLSATTGTFYYRSAA
                     MFFAVLFNAFSSLLEIMSLFESRPIVEKHKMFALYHPSADAFASIFTELVPKILTSIG
                     FNLIYYFMVNFRRNPGRFFFYFLMNFMATLVMSHIFRSIGACFKTLSESMPPATVFLT
                     AMVIYTGFALPTPSMHGWSRWINYLDPVAYVFEALMANEFDGRRFECSQFIPSYPNAD
                     LANQVCSVVASVPGFSYVNGTDYIYESYRYKITHKWRNFGIVVGFIIFFLFVYVALVE
                     LNKGAMQKGEIILFQQSKLREMRKEKKSKQISDIEGGSEKPAGVYDHGNEDSEDGVNN
                     LTVGSDIFHWRDVCYEVQIKDETRRILNHVDGWVKPGTLTALMGASGAGKTTLLDVLA
                     NRVTMGVVSGSMFVNGRLRDQSFQRSTGYVQQQDLHLQTSTVREALRFSAYLRQSRTI
                     SKKEKDEYVESIIDILEMRSYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLD
                     EPTSGLDSQTAWSVCQLMRKLADHGQAILCTIHQPSALLLKEFDRLLFLAKGGRTVYF
                     GDLGENCQTLINYFESHGAHPCPAEANPAEWMLEVIGAAPGSHANQDYHEVWMSSDER
                     RAVQEELHRMETELLQIPVDDSAEAKRSFASSYLIQYICVTKRVIEQYYRTPQYVWSK
                     VFLAVTNSLFNGFSFYRAGTSLQGLQNQMLSIFMLSVMLNTLVQQMLPLYITQRSIYE
                     VRERPSKTFSWWVFLAAQVTAEFPWNLICGTISYFCWYYPIGLQNNASVTHTTAERGA
                     LTWLLIVGFFNYASSLGLMCIAGVEQEQNGANISSLLFTMCLNFCGILKYPTGFWKFM
                     YRANPFTFWIASVLGAGVGDTPLVCSSKEIVYFAPPKGETCTTYIQPYIDEAGGYLVD
                     SEREGYCGFCTASNTNAYLKSVHVEYSKRWQNWGIFICFIAINNIFMFLFYWLARVPK
                     KDNRVEDASALKSDEKAPLGPQHSMTMQ"
     gene            <519326..>523979
                     /locus_tag="C5L36_0D02490"
                     /db_xref="GeneID:40385334"
     mRNA            join(<519326..520213,520302..>523979)
                     /locus_tag="C5L36_0D02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467122.1"
                     /db_xref="GeneID:40385334"
     CDS             join(519326..520213,520302..523979)
                     /locus_tag="C5L36_0D02490"
                     /note="PKUD0D02490; Pfam Domains:
                     ABC2_membrane(2.4e-99)|PDR_CDR(8.8e-58)|ABC_tran(1e-42)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322982.1"
                     /db_xref="GeneID:40385334"
                     /translation="METISVGKESDVSSDGNVAYGGFNEGTNKQIRDLAREFTRQTSV
                     GDGVQDSDDATDSNEVEKFGVDHASPNSPPKSNQYDLLRTLTSMSQVPGVNPVDQTID
                     PRLDPNSDEFESKFWVKNMRKLLDSDPDYYRPTSLGFAAKNLIAKGISSDADYQANFL
                     NYPFKVVRDTYMDLFRGNDESRYFEILKSMDVLIKPGTLTVVLGRPGAGCSTFLKTVA
                     AQTYGFKVDDSSIISYDGLTPKEINKNYRGEVIFSAEMDNHFPHLSVGQTLEFAAKMR
                     TPQNRFPGVSRNEYAKHMSEVYMATYGLSHTVNTKVGDNFIRGVSGGERKRVSIAEAS
                     LCGANLQCWDNATRGLDAATALEFVRALKTSAHILDTTPLIAIYQCSQDAYDLFDNVV
                     LLYEGYQIYFGPGDRAKDFFERMGYECPDRQTTADFLTSITSPAERVAKKGWENKVPQ
                     TPKEFSDYWRASAEYKELVADIDEYLSHCHNNNTREEFAEAHAIKQANHARPSSSFRV
                     SYWMQIKLIAQRNIWRTKGDPSIMMFSVIANIIMGLIISSLFYNLSATTGTFYYRSAA
                     MFFAVLFNAFSSLLEIMSLFESRPIVEKHKMFALYHPSADAFASIFTELVPKILTSIG
                     FNLIYYFMVNFRRNPGRFFFYFLMNFMATLVMSHIFRSIGACFKTLSESMPPATVFLT
                     AMVIYTGFALPTPSMHGWSRWINYLDPVAYVFEALMANEFDGRRFECSQFIPSYPNAD
                     LANQVCSVVASVPGFSYVNGTDYIYESYRYKITHKWRNFGIVVGFIIFFLFVYVTLVE
                     LNKGAMQKGEIILFQQSKLREMRKEKKSKQISDIEGGSEKPAGVYDHGNEDSEDGVNN
                     LTVGSDIFHWRDVCYEVQIKDETRRILNHVDGWVKPGTLTALMGASGAGKTTLLDVLA
                     NRVTMGVVSGSMFVNGRLRDQSFQRSTGYVQQQDLHLQTSTVREALRFSAYLRQSRTI
                     SKKEKDEYVESIIDILEMRSYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLD
                     EPTSGLDSQTAWSVCQLMRKLADHGQAILCTIHQPSALLLKEFDRLLFLAKGGRTVYF
                     GDLGENCQTLINYFESHGAHPCPAEANPAEWMLEVIGAAPGSHANQDYHEVWMSSDER
                     RAVQEELHRMETELLQIPVDDSAEAKRSFASSYLIQYICVTKRVLQQYYRTPQYIWSK
                     LFLAGANSIFNGFSFYRAGTSLQGLQNQMLSIFMLSVMLNTLVQQMLPLYITQRSIYE
                     VRERPSKTFSWWVFLAAQVTAEFPWNLICGTISYFCWYYPIGLQNNASVTHTTAERGA
                     LTWLLIVGFFNYASSLGLMCIAGVEQEQNGANISNLLFTMCLNFCGILKYPTGFWKFM
                     YRANPFTFWIASVLGAGVGDTPLVCSSKEIVYFAPPKGETCTTYIQPYIDEAGGYLVD
                     SEREGYCGFCTASNTNAYLKSVHVEYSKRWQNWGIFICFIAINNIFMFLFYWLARVPK
                     KDNRVKDASALKSDEKATLGPQTTSEA"
     gene            complement(<524704..>526725)
                     /locus_tag="C5L36_0D02500"
                     /db_xref="GeneID:40385335"
     mRNA            complement(<524704..>526725)
                     /locus_tag="C5L36_0D02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467123.1"
                     /db_xref="GeneID:40385335"
     CDS             complement(524704..526725)
                     /locus_tag="C5L36_0D02500"
                     /note="PKUD0D02500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322983.1"
                     /db_xref="GeneID:40385335"
                     /translation="MSQDDREVWFLINHAERELKNAHDLLKTHISNNQEREGVLPISN
                     YNTFIKSALNSYFKVLRNYTGILDASIQSSLYYKTAHTLFKESMSLDLASDYCTRGIQ
                     ICNKNEPTLTLTKLKLLYLHFQIKLQLKPINEQVGYLNNIIENEIPENSSFGILKLFF
                     RFVKFKHFSSLYTVEKNVKEVQLILDGVERFSFANSTTFLQLVLVNLIEYQLMNSQPL
                     SDIEKCLHKLKLINERSSDHLRIQFTSMHHLLDMYLSLYSMDLKAFQEKSLKCEEFRK
                     TLKERKIQLGSNLQFVLICGDSHFVFYSKWMTTLEYFYTTTLYSAVGFSFFSWKNKIA
                     DTLFKRLSNNAYDKIQISGKIETLEDFQHEVVRFNYLKSITLLQKILCDFTNDKYPNA
                     DEPLIETGLEELVENFNSKRFTGYELLFFSTLIPYIKFILAMVYQRNGHYLKSLYYYS
                     QLIQKKPVSKPSVTGMPLMVSFDALSLYSVLNSVPILQFLIESEKDINKNLSEFDLNY
                     DQSMKRFSNLLRIKDILKQKIETLSYIPENTDNLYVKASINTIQYFYFSNPWIASNTE
                     PFKDSPLLLAILEMIYGYTYKTDPGLSEIDNINNKINHFTRACKYSIVTVDSDSHSNR
                     LAMLGYWEIWNVMNKNKNLFPSEQIEKVWGKYSYFASESSPNPKRVKFN"
     gene            <527050..>527943
                     /locus_tag="C5L36_0D02510"
                     /db_xref="GeneID:40385336"
     mRNA            <527050..>527943
                     /locus_tag="C5L36_0D02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467124.1"
                     /db_xref="GeneID:40385336"
     CDS             527050..527943
                     /locus_tag="C5L36_0D02510"
                     /inference="similar to AA sequence:RefSeq:NP_011075.3"
                     /note="PKUD0D02510; similar to Saccharomyces cerevisiae
                     YER148W (SPT15); ancestral locus Anc_8.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322984.1"
                     /db_xref="GeneID:40385336"
                     /translation="MDSLKLPTTAARANAFMGQGSLSFPTSQGQGQGQGHSQEQAQTQ
                     VEAKFPVDDVHSVDAMVNNDGSLVNNVKIENPSASTISKFESSADLQLNADGTISKNV
                     ANDTSNAISTEDGSASGIVPTLQNIVATVNLDCRLELKTIALHARNAEYNPKRFAAVI
                     MRIREPKTTALIFASGKMVVTGAKSEDDSKLAARKYARIIQKLGFNAKFTDFKIQNIV
                     GSCDVKFPIRLEGLAYAHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQ
                     REEIYKAFEAIYPVLSEFRKN"
     gene            <528456..>530513
                     /locus_tag="C5L36_0D02520"
                     /db_xref="GeneID:40385337"
     mRNA            <528456..>530513
                     /locus_tag="C5L36_0D02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467125.1"
                     /db_xref="GeneID:40385337"
     CDS             528456..530513
                     /locus_tag="C5L36_0D02520"
                     /inference="similar to AA sequence:RefSeq:NP_013762.1"
                     /note="PKUD0D02520; similar to Saccharomyces cerevisiae
                     YMR047C (NUP116) and YKL068W (NUP100); ancestral locus
                     Anc_2.610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322985.1"
                     /db_xref="GeneID:40385337"
                     /translation="MSISDIALKKDAETLYGGQNATPSPTSQPLATPPNQQQTQKLEQ
                     IRPIFRKTSSQNSYKLSQLPQLETRSISNDSNVQVPVNTEPQTQKRVINVNESLLHNT
                     RNGVHKIPGTHSVPVTPQSILSPQVKSVNVPASILSSQSNLPSSTSTMQCPTPITPQL
                     KSSTSTISFQVPNQKHRGSISARPSVTKFPSDASGSVQSSAMAGGQTPLAQRQTLNLH
                     TSTGNPLSFMVNPITKQKIPATTTSAANTSRMESVRSPIYSEGGCITPVGYISNNNVI
                     PSSNTLIDQNSFGGSRHSMSPDEPAPMTPTLNLNNSSYPNSRKTSIPTDHHTPVYELK
                     SGISSTSSVAGMVPTGNSTPGSSKKKTTKAIVSPPIGPVVPFTQYLSKEDDDKIHILI
                     GATGSVATIKIPMIIDKLFKIYGTDKVSIQLVVTRSAEHFLRGLKISTEVKIWREQEE
                     WSSPVNKIKPGDPILHVELRKWADIFLIAPLSANTLAKIANGLADNLLTTIVRIWNPL
                     VPIIAAPAMNTFMYSHPMTKIHMNILKEDLPFVEILKPVEKVLVCGDIGMGGMREWSE
                     VVHITVKKLKEIQKKKLSGEETMVGVSKNPVNGEGISYKEKGEAKEEEDDEEEDDEEE
                     DDEDDEEEEEEEEDDEEEDDDDEEEEEEDEEDDEEEEEDDEEDDEEEEDEVSVAGDDA
                     AKR"
     gene            <530870..>533317
                     /locus_tag="C5L36_0D02530"
                     /db_xref="GeneID:40385338"
     mRNA            <530870..>533317
                     /locus_tag="C5L36_0D02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467126.1"
                     /db_xref="GeneID:40385338"
     CDS             530870..533317
                     /locus_tag="C5L36_0D02530"
                     /inference="similar to AA sequence:RefSeq:NP_013764.1"
                     /note="PKUD0D02530; similar to Saccharomyces cerevisiae
                     YMR049C (ERB1); ancestral locus Anc_2.613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322986.1"
                     /db_xref="GeneID:40385338"
                     /translation="MARRPTKVQSEEKSFQNAAKKRTHEEQNESSDEEFELNGKINPD
                     DSDDESASEPEAGEPSEEDSEAELNAMLEQEEGEASEGESDSDLSFSDEDDTKSLTDR
                     LSDVKLRTLSSESLKKLDEVHTTFVDGRPRIIKPEIEPVYDSDDSDQEEFNTIGNIPL
                     SAYEEYPHIGYDINGKRIMRPAKGSALDQLLENIDLPEGWTGLLDKNSGSALNISEEE
                     LELIRKIEKNENTDESINMYEPTIEWFTSKTEIMPLSAAPEPKSRFTPSKHEARRIMK
                     IVKAIREGKIIPPDQRKKIQEEEEENHYDLWEGVDDEITKDHIMTLRAPKLPPPTNEE
                     SYNPPEEYLLTPEEQKQWEEMDPSERERNFIPQKYGSLRKVPGYGENIRERFERCLDL
                     YLAPRVRKNKLNIDPESLVPELPSPKDLRPFPIRTSTTYEGHEGKIRTLSVDPTGNWL
                     ATGSDDGTVRIWEVLTGRQVHKFNIIDTEENSEDHIESVQWNPDPDCGILAIAAGENI
                     YICIPPIFGYEIENEGHTRIEDGFGFAKMKNNSSDMKGVASDNEEEERDEEGGANQTE
                     NDKKNAAEWFKPTKAQLENGISLVITTSRGSSACTIKKLNWHRRGDYLLSVAPDGGNK
                     ASILIHQLSKHASQSPFSKSRGILMDAKFHPTKPILIVMSQRYIRIYNLQLQQLVKKL
                     LPGARWLSCLDIHPRGGDHLIAGSYDKRVLWHDLDLAATPYKTLRYHEKAVRSVAFHK
                     GTLPLFCSASDDGAIHVFHATVYDDLITNPLLVPLKKLEGHKVVNSLGVLDVCWHPRE
                     AWLFSAGADHVARLWTT"
     gene            <533456..>534592
                     /locus_tag="C5L36_0D02540"
                     /db_xref="GeneID:40385339"
     mRNA            <533456..>534592
                     /locus_tag="C5L36_0D02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467127.1"
                     /db_xref="GeneID:40385339"
     CDS             533456..534592
                     /locus_tag="C5L36_0D02540"
                     /inference="similar to AA sequence:RefSeq:NP_015222.1"
                     /note="PKUD0D02540; similar to Saccharomyces cerevisiae
                     YPL103C (FMP30); ancestral locus Anc_8.582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322987.1"
                     /db_xref="GeneID:40385339"
                     /translation="MGLKVRSIVYTLLTYTAYTAYSYRLTQHVIVEREKLHEYGIDKR
                     FDTLEILGRFENPFKEYRPQTIYEFFVMRLIELTEIGKKRGNVPDDMDDRKKSLGWMK
                     ASVDKIKELGETCNDKVGYTWLGQSCGILQSGNKMFLMDPLFEDWIVNKWVGPRRIVP
                     SPLNIDEMMELSPDYVVVSHDHPDHLGDETTRKFSQLDLKWIVPFGVKDFLLDHNVKE
                     ESIIEMKWWEKQQLDSEFEIVCLPAMHWSGRKLYDANQSLWSSFMILKKGRSIFYHGG
                     DTGYVDGLFKKIGDKYGPITLAALPIGQYCPEWHQKPRHISPLESIKMMKEMKVENMV
                     GVHWGTFTLSSEDYLEPADKLTEINAEGATVPQPGFTNIYNISK"
     gene            complement(<534619..>535527)
                     /locus_tag="C5L36_0D02550"
                     /db_xref="GeneID:40385340"
     mRNA            complement(<534619..>535527)
                     /locus_tag="C5L36_0D02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467128.1"
                     /db_xref="GeneID:40385340"
     CDS             complement(534619..535527)
                     /locus_tag="C5L36_0D02550"
                     /inference="similar to AA sequence:RefSeq:NP_009735.3"
                     /note="PKUD0D02550; similar to Saccharomyces cerevisiae
                     YBR176W (ECM31); ancestral locus Anc_8.583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322988.1"
                     /db_xref="GeneID:40385340"
                     /translation="MVKKYMFSALRRYSTHSVVRQSTLSDMYKLYAKNQPISVITAHD
                     FITGRIADAAASVDAVLVGDSLAMVAKGHPSTLELDLDDFYHSTKSVVRGIDSKFIIA
                     DIPFGSFESSTEKCVETAIKLMKIGKIGSIKIEGSYELTDRIKTLTSFGIPVTGHLGL
                     TPQRFNALGGFKAQGKSAENALDIYRQALHLQEIGCKMLVLECIPEKLAQFITEHLRI
                     PTIGIGAGNKTSGQVLVMADALGMLDAKNAKFVKQYMNFHQLAVDSLNTFGNEVKSQT
                     FPETVKHTYPMKEEEFTEFLELTKSL"
     gene            complement(<536051..>536506)
                     /locus_tag="C5L36_0D02555"
                     /db_xref="GeneID:40385341"
     mRNA            complement(<536051..>536506)
                     /locus_tag="C5L36_0D02555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467129.1"
                     /db_xref="GeneID:40385341"
     CDS             complement(536051..536506)
                     /locus_tag="C5L36_0D02555"
                     /note="PKUD0D02555; Pfam Domains: zf-CHCC(2.2e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322989.1"
                     /db_xref="GeneID:40385341"
                     /translation="MFARFTSSARRHVATATKTATSTTAASAAAGETGSTVIPQDPLD
                     VIPSSTYKQAPNRATTWSVSQRNRDELVKTDPRFVGKDLSMQPQPLAAIELIKKQPVS
                     FVHGNIAVCHGTDFVQGHPKVYINLDKDKVATCGYCGARYARKDLEGKL"
     gene            <538247..>539071
                     /locus_tag="C5L36_0D02570"
                     /db_xref="GeneID:40385342"
     mRNA            <538247..>539071
                     /locus_tag="C5L36_0D02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467130.1"
                     /db_xref="GeneID:40385342"
     CDS             538247..539071
                     /locus_tag="C5L36_0D02570"
                     /inference="similar to AA sequence:RefSeq:NP_009999.2"
                     /note="PKUD0D02570; similar to Saccharomyces cerevisiae
                     YCR073W-A (SOL2) and YNR034W (SOL1); ancestral locus
                     Anc_6.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322990.1"
                     /db_xref="GeneID:40385342"
                     /translation="MTTAVPLIYSFPEFSGVAEAVADLVITAQNKALTKDDDASLRKQ
                     LKESSKRFKISISGGSLINVLVEGLLNRDDIQWNKWDIYFSDERLVPFDSPESNYGQA
                     KRKLFDKLKTKPNIYHIDESLLHDPQECADKYEKTLIKGFASKDSVKLPMFDLILLGC
                     APDGHVASLFPNHESLRENYAWCVPVTEAPVPPRERISLSIPVICHSHLVAFVVEGST
                     KAPVLRTIMERPDKGLPASILMEKAAGKVAWFVDDDAIKDVVGITKKRYKFTALNK"
     gene            <539074..>540822
                     /locus_tag="C5L36_0D02580"
                     /db_xref="GeneID:40385343"
     mRNA            <539074..>540822
                     /locus_tag="C5L36_0D02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467131.1"
                     /db_xref="GeneID:40385343"
     CDS             539074..540822
                     /locus_tag="C5L36_0D02580"
                     /note="PKUD0D02580; Pfam Domains: LMBR1(6.4e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322991.1"
                     /db_xref="GeneID:40385343"
                     /translation="MCTLFYFNLFFFFLSFPFQYYIVLLLPPSPSFFRLSSLALFSNS
                     IYIQYSKMSTIIVICSIVTLCVSYAILRSLTDTSRLSVPLSITLIVSLFLPLSVTFLI
                     PIDINHSIPILWRANYWTTFMLTWFILPFWQYYLTSGEFNTVLRVKSSLLQLCKFLGL
                     LIILSIVGLFWLIIRGMFQLSYISATIVTASHCYSLLMVVWLMMHGLIHIPKRFFTWS
                     YPGKLELLYRKVNTLETERNDALFEYKEICGYINGLEVGNDVERRDAVLKLKSKVPPE
                     FEHIRDVTFHEELTLVKAHELIKKAEWNYLHNDTVFRDTLADIQYYEKAVMDEGIFYK
                     YIMPSFNSILFVLFTVIAFIVLESEIMHGTRFSILGWIIYGQYTAIIMSFVLVLMMIC
                     SLKTLSLIKLFDIYRVEFNGKSDPVSTIFFISYACRLTIPLGYNFMIMLNEKVVGDSS
                     FLAFVNGNLKLIPIGVILNDIIPRLSIVPVLLSIFGIWGKLKRWMDGWIDIDLDIGND
                     DGIGGVQSGKVIAHRYINDGFLNDENTKLSIWRQITFTLQNGVYRLRNMLVRNRGTQL
                     ELDLDYDDYDLDNRIV"
     gene            <541014..>542444
                     /locus_tag="C5L36_0D02590"
                     /db_xref="GeneID:40385344"
     mRNA            <541014..>542444
                     /locus_tag="C5L36_0D02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467132.1"
                     /db_xref="GeneID:40385344"
     CDS             541014..542444
                     /locus_tag="C5L36_0D02590"
                     /inference="similar to AA sequence:RefSeq:NP_010003.2"
                     /note="PKUD0D02590; similar to Saccharomyces cerevisiae
                     YCR079W (PTC6); ancestral locus Anc_6.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322992.1"
                     /db_xref="GeneID:40385344"
                     /translation="MRLFQRGNVRRLSQHLVIHSRDASSPISFNVNLLKVPSNFGYSS
                     SRINRMYNEDRWQTSILDMDVGQLVTDTSYSELMKNVDRVEEPKYGPCPKVENCVFAF
                     GVFDGHGGDECSNYLKNHLFENVERLAITRESVDLMREFYKLKISGYWKRWNRRFGQV
                     VIQECGLRNVEKWCKEYGVKFNDFVSGSKFWDVLDKMIASGNLTHWEIFRLRVWVSYL
                     FTDLQFLTYENEFNSIQDKKGKVINSGSTCTSAFIYGIDWQDGDLNHYFYDEKVVSRL
                     VVAHVGDTRAILCDKDGVARTLTKDHHPSNPIEAQRLRKLSAGLIMTDSFGEERYLNF
                     ANTRSFGDISAKNVGITAEPEISEWLIGDPSMVQSYKKRESLEIPDFGGDECFLVLTS
                     DGVTNTLSDQEIVDIIMTNYNNKGHKWGNPSKCANEVVEFVQCIDGDDNATCLVVRLA
                     GWGKWPILDRTGKLREERMMGSRYRL"
     gene            complement(<542681..>542956)
                     /locus_tag="C5L36_0D02600"
                     /db_xref="GeneID:40385345"
     mRNA            complement(<542681..>542956)
                     /locus_tag="C5L36_0D02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467133.1"
                     /db_xref="GeneID:40385345"
     CDS             complement(542681..542956)
                     /locus_tag="C5L36_0D02600"
                     /inference="similar to AA sequence:RefSeq:NP_014435.3"
                     /note="PKUD0D02600; similar to Saccharomyces cerevisiae
                     YNR037C (RSM19); ancestral locus Anc_6.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322993.1"
                     /db_xref="GeneID:40385345"
                     /translation="MRVSIVALGRSSWKGPFVVPLPIAQAKKNGTPIRTNARSCTILP
                     QFVGLKFQIHNGRDYVQVEISEDMVGSKLGEFAHTRKRWSYTQTKNK"
     gene            <543243..>543848
                     /locus_tag="C5L36_0D02610"
                     /db_xref="GeneID:40385346"
     mRNA            <543243..>543848
                     /locus_tag="C5L36_0D02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467134.1"
                     /db_xref="GeneID:40385346"
     CDS             543243..543848
                     /locus_tag="C5L36_0D02610"
                     /inference="similar to AA sequence:RefSeq:NP_015274.1"
                     /note="PKUD0D02610; similar to Saccharomyces cerevisiae
                     YPL051W (ARL3); ancestral locus Anc_8.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322994.1"
                     /db_xref="GeneID:40385346"
                     /translation="MFHLAQSLYTHLMEWPEYSVLILGLDNAGKTTLLEELKERYIKG
                     YKKIPSGRIIPTVGQNMTTLAVDNEVRLKFWDVGGQDALRELWEDYYSDSHGIVFVID
                     SCDAERLNECKNTLEKIINDDKVEGLPILMLANKQDMPQALEIANIKEVFNKMAEHLN
                     ANDSSVLAISARTGEGVSEAVKWIKDRVVLNKDARPPKFRK"
     gene            <544032..>544823
                     /locus_tag="C5L36_0D02620"
                     /db_xref="GeneID:40385347"
     mRNA            <544032..>544823
                     /locus_tag="C5L36_0D02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467135.1"
                     /db_xref="GeneID:40385347"
     CDS             544032..544823
                     /locus_tag="C5L36_0D02620"
                     /note="PKUD0D02620; Pfam Domains:
                     Nfu_N(7e-33)|NifU(1.6e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322995.1"
                     /db_xref="GeneID:40385347"
                     /translation="MINMLARHQRQFQGFARVLRRTLFIQTQTTPNENALKFVPNGAQ
                     ILPSKETRTIEISNIKDAIHKSDLALKLFSLNDKGISSILFGHDFITVVKQEGDWNVL
                     KPQIFALLTEHLTMGKPVLSENFLNELASEREEYKEELTEEEEVVELIKELLSTRIQP
                     AIQEDGGDIEYVGFDHSTGTVSIKLIGACKSCSSSEITLKSGIEDMLKYYIDEVKEVI
                     KIEEPIIKSEDVDVNAAKTADGVNGMGVQDMRRMSGSDDELPPSL"
     gene            complement(<544895..>545509)
                     /locus_tag="C5L36_0D02630"
                     /db_xref="GeneID:40385348"
     mRNA            complement(<544895..>545509)
                     /locus_tag="C5L36_0D02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467136.1"
                     /db_xref="GeneID:40385348"
     CDS             complement(544895..545509)
                     /locus_tag="C5L36_0D02630"
                     /inference="similar to AA sequence:RefSeq:NP_015198.1"
                     /note="PKUD0D02630; similar to Saccharomyces cerevisiae
                     YPL127C (HHO1); ancestral locus Anc_8.629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322996.1"
                     /db_xref="GeneID:40385348"
                     /translation="MSSKPAYKDMIIDAVLTAKERLGSSRQSIKKFILAKYALNSTTF
                     DTHFNTAIRNGVKEGLFIQPKGPIGPIKLNKEMLKKTVKPKKVKSKSKTPSKAPKSVK
                     SAQSSKTTTAVKISKPAKKSSKTLKDEKTKSSKSKTAKASTKKTPTKKTPAKKTSSAK
                     SKTAKASVKKTASKKTASKKTNSPPKKATATTKSKSAKATKAKK"
     gene            <546441..>546896
                     /locus_tag="C5L36_0D02640"
                     /db_xref="GeneID:40385349"
     mRNA            <546441..>546896
                     /locus_tag="C5L36_0D02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467137.1"
                     /db_xref="GeneID:40385349"
     CDS             546441..546896
                     /locus_tag="C5L36_0D02640"
                     /note="PKUD0D02640; Pfam Domains: SCP2(1.1e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322997.1"
                     /db_xref="GeneID:40385349"
                     /translation="MAQKYKYKSEPFLNGIGALLGSDASLQAEVKKSLRGGCALIEVR
                     LRDGNVQKWILDSNRATFTKIGDLNDGKADAGSSANAEAVNTTNTLNTRNADVVLTLD
                     DAQLVRLGRGKVSAQRLFLMGKLKVKGDVARAAIVERLLKAGAARQPKL"
     gene            <547457..>548842
                     /locus_tag="C5L36_0D02650"
                     /db_xref="GeneID:40385350"
     mRNA            <547457..>548842
                     /locus_tag="C5L36_0D02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467138.1"
                     /db_xref="GeneID:40385350"
     CDS             547457..548842
                     /locus_tag="C5L36_0D02650"
                     /inference="similar to AA sequence:RefSeq:NP_009339.1"
                     /note="PKUD0D02650; similar to Saccharomyces cerevisiae
                     YAL062W (GDH3) and YOR375C (GDH1); ancestral locus
                     Anc_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322998.1"
                     /db_xref="GeneID:40385350"
                     /translation="MVHPHEPEFLQAHNELLSTLNDSSLFEKHPEYKKVIPVVSIPER
                     IIQFRVTWEDDNGELHVNNGYRVQFNSALGPYKGGLRLHPSVNLSILKFLGFEQIFKN
                     ALTGLPMGGGKGGSDFNPKGRSDNEIRRFCVAFMRQLSRYIGQFTDVPAGDIGTGGRE
                     IGYMFGAYKQMQNQWEGVLTGKGLSWGGSLIRPEATGYGVIYYVEKMIEKATNGKESF
                     QGKRVAISGSGNVAQYAALKAIELGATVISLSDSQGTIINQRGISAEQIYAIQEAKVQ
                     FKSLKDIIQSYEAFTTQSTKCEYLPGERPWVHVGAIDIALPCATQNEVSGDEAKALVA
                     AGCKYLAEGSNMGSTQEAIDIFEAERKSASSIGSAIWYAPGKAANCGGVAVSGLEMAQ
                     NSQRESWTREEVDQKLKDIMVNCFDNCYKTSLEYSTEKNTGALPSLVMGANIAGFVKV
                     ADAMKDQGDWW"
     gene            <549572..>550813
                     /locus_tag="C5L36_0D02660"
                     /db_xref="GeneID:40385351"
     mRNA            <549572..>550813
                     /locus_tag="C5L36_0D02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467139.1"
                     /db_xref="GeneID:40385351"
     CDS             549572..550813
                     /locus_tag="C5L36_0D02660"
                     /inference="similar to AA sequence:RefSeq:NP_014880.3"
                     /note="PKUD0D02660; similar to Saccharomyces cerevisiae
                     YOR237W (HES1) and YPL145C (KES1); ancestral locus
                     Anc_8.658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029322999.1"
                     /db_xref="GeneID:40385351"
                     /translation="MSAATWTSFIKSIASYNGDISSLTAPPFILSPTSLVEYSQYWSE
                     HVDLLLEPNFVTARGDEPIELTRAIGVLRWFISTLKSQYCSRNESLGGEKKPLNPFLG
                     EIFVGKWPHEEYGETILLSEQVSHHPPITAYAVSNKKNNTVLEGYNGIRASMSTTALN
                     VKQYGHAMLEFRNLNENYLITLPPLHIEGMLAFSPFVELEQKSYIQSSAGYFIVIEYS
                     GKGYFSGKKNSFKARIFKSFKDSKKKENALYTVAGQWSDKSTIIKGSSTPSSKDELFF
                     DANATKAQHLQVKPIEEQHDLESRKAWLDVANAIKDGDYDEIHNAKSKLENAQRDLRK
                     SELEENKSWERRWFDEVDYQNGGISDDDLYVKLSKMANLSIKNVPSGVDADSSKNNEV
                     DTMSHWRFIPSKFENEKEIKI"
     gene            complement(<550962..>555839)
                     /locus_tag="C5L36_0D02670"
                     /db_xref="GeneID:40385352"
     mRNA            complement(<550962..>555839)
                     /locus_tag="C5L36_0D02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467140.1"
                     /db_xref="GeneID:40385352"
     CDS             complement(550962..555839)
                     /locus_tag="C5L36_0D02670"
                     /inference="similar to AA sequence:RefSeq:NP_009998.2"
                     /note="PKUD0D02670; similar to Saccharomyces cerevisiae
                     YCR073C (SSK22) and YNR031C (SSK2); ancestral locus
                     Anc_6.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323000.1"
                     /db_xref="GeneID:40385352"
                     /translation="MNNNDKDPHGMPPPSGSRSRSGSELTASTSNVEETTSLRARLSR
                     HPSTNSISEKTKMKLKLQLSQAGGYQMTTPLLLSPRGTPNQSPEYNKDGFFNNFETQL
                     HTNKSHLDTLLDEGNEPQDSNVTPEPPIPIIHTENDSHPVLKNNSNNSNNISNNNSNN
                     NNNNNNNASSSIKQSKTKPNLYPLQTKIRMPSSSSSNPQSGTPSSVSASQTPRSPLNK
                     YKSRNIAYQALPEPVRPQTSILKSNFNTKFSQQYQQQEKKYLTGITKYRNRYKNVDDY
                     YDKSVVPDDVTESAGSTSELSDISKFTSVDSEIEDNSDYLGDKNREYEALKALGQQIG
                     SELLDKELKSLSEYSLDSNLLLDLLNQNDEIQLKNTNDNQTISERLEWQTMLQTVMTG
                     DVVKGEKTKLIKPLTELEGGENLLRVGYKEDFWLGLRAKLYGRTEEEQKKLVLYHRGL
                     VDEKFDEILNFKLEFTPEQLDMSYKDKVKFASVKVNHLLDIYEKCKELWRTEKEMETD
                     KPQCATPEFINRINCLNAWTSVTDAIERESDVLKKWVGNDDLDILRPSLSSANTHDST
                     TEGSGERNSQRGHIFKDDRPFVERIMKEKDIENLFNKKLFNTFSHLTIKAKNAYLEYH
                     QIFKELGLPSYLDNLFVLTNFSSKLMKEIIRTRLAYAEKLKNPTMMMIDQILEDLKMY
                     LRLAIEIKISMLEYCAPVEGWVSFPDYQDTEFDNTIIECVTHYMDLLNRKLLFSPKGH
                     KSFRTFKEPEELESEWTLLRNLGFYINGISVDFSSQISSLFVKLITRLYTFVQNQIQG
                     PPSDGYRLDSQRLIRWYTSTLENLGQLRRKFIRFEVHLFQYFQNSVSFKLIPHKAQRF
                     FTLLKESNHALYQNQKIAEDGVYIFVSESLVYRPYDVECILRNKYLGVNFNEIPKRHI
                     EVIEKYHPTIQFYVSREDDENETTAGHENGHDDKQSLNMDYVIVVVPPKALMWDGIIV
                     PFNDIDSLLINELRRGNAMFMTAGSPNDNVSEIFSVFKQFVGDTIGTSTNICCSVPKI
                     ESNIQASLKVFNRITCLTIDCTPTIRNQCRGVGNCQELVNNIFIFARDIGRDSIRNSG
                     YNFNLRSGRGPIILRLIKLAIEWLSFIVDDCSPTDPKTFRWCVSALEFAMDITRGFNI
                     LILDSEKFYRLKDKVAGCMSLLISHFDIMGARAKELQRTRMQKYGFETQKDIYTLDDE
                     SLGSLRAHIMYQIKQIEENRRKLQVEQRSVGRVLDDTDMENQLLTYLASSFSSVSIRW
                     QKGKFLGGGTFGSVYASVNLDTGGPMAVKEIRFQDRQSIKTVVPAIKGEMSVLELLSH
                     PNIVQFFGVEVHRDRVYIFMEYCSGGSLASLLEYGRIEDEIVIQLYTLQMLEALAYLH
                     QFGIVHRDVKPDNILLDHMGVIKFVDFGSAKVIAIPSTGTTPATTATSGSTNTNAEEV
                     GTAPPSNTNSANNTISEYMGSTTSTMSSTMSMQDGSDKSYISSQLHMTSSSQSDLNVA
                     MTNSSAVIESLMESKKSHALTGTPMYMSPETIKGEKTGRFGAMDIWSLGCCIIEMATG
                     RRPWSNLDNEFAVMYHIAAGHLPQFPNANELSEQGREFLAKCMVIDPTKRASAVELLQ
                     DPWIMSIRNEAFSEE"
     gene            <556112..>557125
                     /locus_tag="C5L36_0D02680"
                     /db_xref="GeneID:40385353"
     mRNA            <556112..>557125
                     /locus_tag="C5L36_0D02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467141.1"
                     /db_xref="GeneID:40385353"
     CDS             556112..557125
                     /locus_tag="C5L36_0D02680"
                     /inference="similar to AA sequence:RefSeq:NP_014429.3"
                     /note="PKUD0D02680; similar to Saccharomyces cerevisiae
                     YNR032W (PPG1); ancestral locus Anc_6.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323001.1"
                     /db_xref="GeneID:40385353"
                     /translation="MTVWEKGVMDLDECLESLYAGKLLSEPVIEMLAFKAKELMIRDG
                     NIVHLSSPVTMVGDIHGQFYDLLEIFKIGGYPPDTNYLFLGDYVDRGYHSIETISLLI
                     VLKLKYPNRITLIRGNHESRQITTNYGFYTECVTKYGGDSKVWSIFTDLFDFLVLSAI
                     VDNQLFCVHGGLSPNVQTIDSIQVIDRFKEIPHDGPMADLMWSDPDIELLNFRISSRG
                     AGYQFGINVVNKFLKVNGVEKIFRAHQLCNDGFQVFWKGKVNTVWSAPNYCYRCGNKA
                     SILEVYDDSGDPDSLRFNVFDASPDSEKEFLRIESDNMDLELDIDEGRQMNKKAPYVE
                     YFM"
     gene            complement(<557186..>557407)
                     /locus_tag="C5L36_0D02690"
                     /db_xref="GeneID:40385354"
     mRNA            complement(<557186..>557407)
                     /locus_tag="C5L36_0D02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467142.1"
                     /db_xref="GeneID:40385354"
     CDS             complement(557186..557407)
                     /locus_tag="C5L36_0D02690"
                     /inference="similar to AA sequence:RefSeq:NP_014430.1"
                     /note="PKUD0D02690; similar to Saccharomyces cerevisiae
                     YNR032C-A (HUB1); ancestral locus Anc_6.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323002.1"
                     /db_xref="GeneID:40385354"
                     /translation="MIQIWCNDRLGRKIAVKCLPEDTISDFKKVLALQIGTPAQKIVL
                     KKGYLVFKDHITLQDYEINDGTNLELYYA"
     gene            <557645..>559243
                     /locus_tag="C5L36_0D02700"
                     /db_xref="GeneID:40385355"
     mRNA            <557645..>559243
                     /locus_tag="C5L36_0D02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467143.1"
                     /db_xref="GeneID:40385355"
     CDS             557645..559243
                     /locus_tag="C5L36_0D02700"
                     /inference="similar to AA sequence:RefSeq:NP_014437.1"
                     /note="PKUD0D02700; similar to Saccharomyces cerevisiae
                     YNR039C (ZRG17); ancestral locus Anc_6.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323003.1"
                     /db_xref="GeneID:40385355"
                     /translation="MSRTPVTPSIPSFSPSSYKRRSLQSPFLTESADTDSDGQLSENN
                     KKSNNNNNNGDTYEDNLEGELRNDVDSNFKMPLGPSLHVNKRQHKRNTSTASMNYTPQ
                     VIDKPPTPGNGPFNFSPMMLNNNSNEALSVPTDRKTSYRRGHRYKHSSVSMNMFQDPQ
                     RIASMQKPHNLPKTYTVPAFQEVKGTITRQQKVKLVVCIFQSCVVMCAYIGGMQYGNG
                     LDTLAHILFYDVISNFSEVAIKIMSNFEVWRVSSLRYPFGLARIEVLFDFALAVSLLF
                     VGLDLFSHVVEEMLIDLVGTNGEAHPHSHGVTKENPHSHPEGMNGWLYVGILGLAIIT
                     TILTSYVVHGDTSTSKRPNDEVETEDNAVPAVKRISSITLKEPIRVSTFKRVTLYLKK
                     HGYMLTGVHLKTTSILSLGYALLVIITSGISSTFVIIATAIVVTVVAWRQLSKKGKVL
                     LLGGVDIAKVVDAIEGMECFKSGYRVSDVKIARVHGECDVCLLRVEMKGASSDDEAKL
                     RFYAARTIKESMGDVEVTVDITRL"
     gene            complement(<560033..>560797)
                     /locus_tag="C5L36_0D02710"
                     /db_xref="GeneID:40385356"
     mRNA            complement(<560033..>560797)
                     /locus_tag="C5L36_0D02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467144.1"
                     /db_xref="GeneID:40385356"
     CDS             complement(560033..560797)
                     /locus_tag="C5L36_0D02710"
                     /inference="similar to AA sequence:RefSeq:NP_010196.1"
                     /note="PKUD0D02710; similar to Saccharomyces cerevisiae
                     YDL087C (LUC7); ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323004.1"
                     /db_xref="GeneID:40385356"
                     /translation="MTYLTPRQEQRKLLSNLLGSSMYHLPAGFDPNKPNVSLTREDID
                     VRILESPSVCKPFLLGVCPYEVFDGTKENVGRCRRSHNLQHRLIYERAVELGIPMPRS
                     NYELDALKELERFVGDCDERVRIAEQRLDYSESDKLILNELARNVEISEMKLAILKEE
                     ILHVEDMKKKLELSILVRQSWNEWEAVNSQYNVTLEKLNSVGQQQMQVCSVCGAYMSK
                     VDTDRRLVDHFTGKIHQSYVLLREKLKELREKHEED"
     gene            <561052..>561510
                     /locus_tag="C5L36_0D02720"
                     /db_xref="GeneID:40385357"
     mRNA            <561052..>561510
                     /locus_tag="C5L36_0D02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467145.1"
                     /db_xref="GeneID:40385357"
     CDS             561052..561510
                     /locus_tag="C5L36_0D02720"
                     /inference="similar to AA sequence:RefSeq:NP_015398.1"
                     /note="PKUD0D02720; similar to Saccharomyces cerevisiae
                     YPR073C (LTP1); ancestral locus Anc_3.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323005.1"
                     /db_xref="GeneID:40385357"
                     /translation="MKVAFVCLGNICRSPMAEAVFQHIINEKGLGDSVHVESFGTANY
                     HVGDKPDYRTIATCKRHGIPINHRGQQIKPKHFKEFDFILCMDESNLYNLKRIQPNDS
                     KAKVMLFGEYSTDGKYDKIVDDPYYGGEDGFEACYNQCVHFTENFIKQEL"
     gene            complement(<561491..>562483)
                     /locus_tag="C5L36_0D02730"
                     /db_xref="GeneID:40385358"
     mRNA            complement(<561491..>562483)
                     /locus_tag="C5L36_0D02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467146.1"
                     /db_xref="GeneID:40385358"
     CDS             complement(561491..562483)
                     /locus_tag="C5L36_0D02730"
                     /inference="similar to AA sequence:RefSeq:NP_010748.3"
                     /note="PKUD0D02730; similar to Saccharomyces cerevisiae
                     YDR460W (TFB3); ancestral locus Anc_5.580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323006.1"
                     /db_xref="GeneID:40385358"
                     /translation="MVELDWDNVPADLCPVCKTDKYLSPEIQFKINPECYHKICDACV
                     DRIFALGPHPCPYPNCEKVLRRNKFKAQVFDDLLVEKECDIRRRVLSVYNKKEDDFQT
                     SVMYDQYLEEIEEIVYNLLHRVDIERTEERLKQYSIENKQSIELNNAQREQEYEKFIK
                     IQKLERQHKSERRKLTSEIAEEEKKLKDLEKQQILDQLQNAASDKDPQLILEQIRANM
                     LEKTNRLRDQLQKLNEKFDALKDAVRNNLNPDENMNKNKSKIPFTPFNGDRLVNLPFK
                     VSEYKDPFHESIVSDVEYTAAGYNIQDFYIRSLNEAFTGLECFVEVEKSTVPAL"
     gene            complement(<562947..>564032)
                     /locus_tag="C5L36_0D02740"
                     /db_xref="GeneID:40385359"
     mRNA            complement(<562947..>564032)
                     /locus_tag="C5L36_0D02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467147.1"
                     /db_xref="GeneID:40385359"
     CDS             complement(562947..564032)
                     /locus_tag="C5L36_0D02740"
                     /note="PKUD0D02740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323007.1"
                     /db_xref="GeneID:40385359"
                     /translation="MDAYITKRLADELPVTTQHISRKYFVPVQEASDALREYATRNSN
                     VCVKYSLCGIEKAGNGRRADILINIVSGDELEKARGRFERVVSEQVFSVAIGHAELSN
                     IIEMSRVSFTYSEDDMSKCRLIQTETSDYEISSTGAGVVQPEEKVPIKRESDKPKEIL
                     KDKEPSRPVYTSRKAASTPVVNKKPVYVSRKRKEDVIDKETNVKRSKVDAEEEEKKKK
                     QREELERMIADDDGFSDDDFDGVIVDGGKEEETAEIYTGDDIDVSLEEEEITVHSQDE
                     VDKVKEEPAPPSTSNEYSESKIDAKEVPEVETYTDADGFIVRKVNRNANTVPPPRTPR
                     THTVELKKPGNTGPKKQANLMSFFKKK"
     gene            <564231..>565061
                     /locus_tag="C5L36_0D02750"
                     /db_xref="GeneID:40385360"
     mRNA            <564231..>565061
                     /locus_tag="C5L36_0D02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467148.1"
                     /db_xref="GeneID:40385360"
     CDS             564231..565061
                     /locus_tag="C5L36_0D02750"
                     /inference="similar to AA sequence:RefSeq:NP_009772.1"
                     /note="PKUD0D02750; similar to Saccharomyces cerevisiae
                     YBR213W (MET8); ancestral locus Anc_6.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323008.1"
                     /db_xref="GeneID:40385360"
                     /translation="MSSVVPPVGGGSMMLAWQVRGKHVLVVGAGDVALSRIDHLLVAD
                     AKITVVTGCDVHPTIKSYHELGLLEDLIERDFQPSDLKMYEKKGMRDEIKSFDEGNDG
                     ESFSNLSAEQIEKIEAFEEMKFKMVLTCINNYPLSLRIWQQCKILGLDVNLADKPKNC
                     DFYFGSVYRQGPLQIMISTNGKSPRLCNRIKNKKLAPMFDGLDLNTAVENLGYLRSQL
                     RNIYHPGEDVGVIKERMDWNKKITDAYSIEEWCIMDKTMIDNIVKGYPELPDLSKLSI
                     "
     gene            complement(<565279..>567213)
                     /locus_tag="C5L36_0D02760"
                     /db_xref="GeneID:40385361"
     mRNA            complement(<565279..>567213)
                     /locus_tag="C5L36_0D02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467149.1"
                     /db_xref="GeneID:40385361"
     CDS             complement(565279..567213)
                     /locus_tag="C5L36_0D02760"
                     /inference="similar to AA sequence:RefSeq:NP_009771.3"
                     /note="PKUD0D02760; similar to Saccharomyces cerevisiae
                     YBR212W (NGR1); ancestral locus Anc_6.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323009.1"
                     /db_xref="GeneID:40385361"
                     /translation="MSQGNKEVNPQFQNQEQESENEQKRSSADSPEFKPSSPLLTDST
                     SLNQVESNSSLPNPEGTSSASLPSDFLTSVVPLPQPPENPANTVPPKTLWMGDLEPWW
                     DEGFIKNVWAKLGKHVEVKVIKPKHNLLMHQLAKTNGQGTVNHSGYCFIEFDSPALAT
                     EALSLNGTIIPDTNNKSFRLNWAPAATLDSQIALTPEYSLFVGDLSANTTEAHLLALF
                     QSHFNSVKTVRVMTDPSSGLSRCFGFVRFSNEDERQRALVEMNGKWLGGRQIRVALAS
                     PKHQNNQSGMRNFRQQQQQEQQNHQQLQQGYSPSVSPQFIRGNLSVPPNNDFNDPTNT
                     TVFVGGLANGLNEDTLLALFEPFGSIVNIKVPPGKGCGFVKFSKRGDAEHAIESMQGF
                     VIGGSRVRLSWGRPSNKNMRRMSQLTLQQQPIHQMYMPNMVDMSNMNNPNIRYGNLTG
                     IPAQDMGFPNIAPPPLHPHSHHHGHPHVPQPIPMPSHHGGELADSKDGNLSNQIPNMT
                     MFSPLPSSTSQGQPMIPAPMYELSPHGNMGAMFPGDQVPQSMGESAMPHGMAGMPTNM
                     PPPFIYDPYLGGMVPQNSETQYHHQPPPPPPASITGGHTTGQYMYVPQQVIMPNHEKV
                     EIVDERNREDSNTNGSTGGD"
     gene            <567790..>569016
                     /locus_tag="C5L36_0D02770"
                     /db_xref="GeneID:40385362"
     mRNA            <567790..>569016
                     /locus_tag="C5L36_0D02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467150.1"
                     /db_xref="GeneID:40385362"
     CDS             567790..569016
                     /locus_tag="C5L36_0D02770"
                     /note="PKUD0D02770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323010.1"
                     /db_xref="GeneID:40385362"
                     /translation="MNIGVVYLEHSYIIFTCLSREKGQTPRMNVNRDVKRIQRRRGVS
                     QRNLDLDDLVLSLPPPNLSEVTLSESDGEQEARGDAISDFDQHSESDNEDDNIQDSSG
                     SERENWNNKDGYRNGRNGHNGIKDYENKTDDQSLHANNIPNLVPPPAAISAIMESESR
                     IIQQHQVIARERSRMRQEERKLARQKAKVGKHTSKRALIQSKSIKIKYRRIPSNKNKL
                     IYVDVIAQMLKDYIKDKNVLQKYTERVKELKKTLKKRGRRESDKTIESNCREILNDYY
                     QRTDEYFGSLIDLRLSNSLIKNDLNKINQEKNMLRLQIFDLRQERNLIGVEMKQVRNE
                     FKTIRASYSENEKLYKDLISLKEKGTIGGESNNVMDSVRHKLNKLESMVDSKLQLLQN
                     LKTVNELLREKVDKTE"
     gene            complement(<569204..>569617)
                     /locus_tag="C5L36_0D02780"
                     /db_xref="GeneID:40385363"
     mRNA            complement(<569204..>569617)
                     /locus_tag="C5L36_0D02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467151.1"
                     /db_xref="GeneID:40385363"
     CDS             complement(569204..569617)
                     /locus_tag="C5L36_0D02780"
                     /inference="similar to AA sequence:RefSeq:NP_009769.1"
                     /note="PKUD0D02780; similar to Saccharomyces cerevisiae
                     YBR210W (ERV15) and YGL054C (ERV14); ancestral locus
                     Anc_6.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323011.1"
                     /db_xref="GeneID:40385363"
                     /translation="MFGEIFLFILAVIVNALSLFCEVYFSISYSDLECDYINPIELCN
                     KLNKFMIPKAAVHGVLSILFILHGYWFVFLLNLPLLAYNANKIYTKNYLLDATEIFRT
                     LSKHKKESFIKLAFFLLMFFFYLYRMIAALIADDL"
     gene            571626..571723
                     /locus_tag="C5L36_0Dtrna9K"
                     /db_xref="GeneID:40385794"
     tRNA            join(571626..571663,571687..571723)
                     /locus_tag="C5L36_0Dtrna9K"
                     /product="tRNA-Lys"
                     /note="PKUD0Dtrna9K; codon recognized: AAG"
                     /db_xref="GeneID:40385794"
     gene            <572085..>572510
                     /locus_tag="C5L36_0D02785"
                     /db_xref="GeneID:40385364"
     mRNA            <572085..>572510
                     /locus_tag="C5L36_0D02785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467152.1"
                     /db_xref="GeneID:40385364"
     CDS             572085..572510
                     /locus_tag="C5L36_0D02785"
                     /note="PKUD0D02785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323012.1"
                     /db_xref="GeneID:40385364"
                     /translation="MRVQQLINDDKVLEYANKAAGTFNMFNYQNEIRSRDDFLEIWYQ
                     AMALQQFKEVKTVVILGVKLCGDFFYNMVDWIAETRALMEGFRVEIVVVPCCLHKSIR
                     SINLDPVQEMARYAHTLSDRVDVLPTTSSSYKIIRFKLR"
     gene            <573064..>575025
                     /locus_tag="C5L36_0D02790"
                     /db_xref="GeneID:40385365"
     mRNA            <573064..>575025
                     /locus_tag="C5L36_0D02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467153.1"
                     /db_xref="GeneID:40385365"
     CDS             573064..575025
                     /locus_tag="C5L36_0D02790"
                     /note="PKUD0D02790; Pfam Domains: PLA2_B(2e-107)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323013.1"
                     /db_xref="GeneID:40385365"
                     /translation="MFPITTLFALAATASAAIFNDTDITYAPYEGYCPSYNSSAIYNT
                     TTHEGYIRSNYLISQDEYSYISARKVKTTDKLISFLDNLEIPDYNGTSFANYFNDLNQ
                     TGINIGLSFSGGGFRALFNGAGEIMALDSRTTGNSTLKGLLDASTYISGISGGSIMVN
                     TLVFNNWTSVEDIVYSNETSIWNTTAPPVSTEISFWLNLISQVEPKKEAGYEITLADL
                     YGRILSKYMFEKDYDDYGINTLYSDVPYIEAFQDYDMPFPIIAASGNVNNNMSAYTPN
                     LFEITPYEFGSFSPLVGGFIPIDILGTQFDAGMPNSSYDCTYEFDNVGWLTAASSNIL
                     VAFQESLVAALSGNSTASTIDVVGTNVSVSYVETLVGLVNKNVNDTLFAVVDNPFFNS
                     SLSSNDSDIPYGDLLKLIDGGYSEVIPLDPVLVPSREVDVVFAFDNSGSDETDNYPDG
                     DSLFATEERWAEAFPDDVFYALPNSTEEFVELGLNKRPVFFGCNGSSLVTDQYNPNAT
                     VEFNVMKPLLVYIPNYNASANSNITGFQLTYEERNAIVENGFDIVQNDDDEDFAQCVG
                     CAIIRRSEERAGIEISPFCAKCFNRYCFESLSDEQYDNSTISEVIPTSIYSSSALPSK
                     LSSLLTRSTNSVSFPTTFSKPTHTSTTSV"
     gene            complement(<575178..>576245)
                     /locus_tag="C5L36_0D02800"
                     /db_xref="GeneID:40385366"
     mRNA            complement(<575178..>576245)
                     /locus_tag="C5L36_0D02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467154.1"
                     /db_xref="GeneID:40385366"
     CDS             complement(575178..576245)
                     /locus_tag="C5L36_0D02800"
                     /inference="similar to AA sequence:RefSeq:NP_013389.1"
                     /note="PKUD0D02800; similar to Saccharomyces cerevisiae
                     YLR287C; ancestral locus Anc_6.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323014.1"
                     /db_xref="GeneID:40385366"
                     /translation="MPTSEELKEHIASISSTLQQLQSTLNNLNSTSGLLQPANVKDPL
                     LEISKLSSLISAHATKLGLVFKPPIAATTYNTCFQELDSFFKYIKFLISILNQLKNST
                     ESYSNLFINELSYNTASIIESAFYLVEELGKLIDTEDVLKDDKTDERLIGVGIVWEKC
                     ENISKNAKIGSSGILRGKLKSSSSLVLDASEELKEWLLDPMVGDAFNLDDFSDNFDGD
                     DDKIQTSNNGDEDESGDEDEDEDVPEAIIKYGETWSPKIQLVKLLLSLLDRSIPASKY
                     TKKFSKNIDLFHEKQLKVNEYVDDLVASIVYDMDLENAKKASDKLTKEINQIFEIVKI
                     LNNNDEKKVKWLESWKIKYSN"
     gene            complement(<576300..>577412)
                     /locus_tag="C5L36_0D02810"
                     /db_xref="GeneID:40385367"
     mRNA            complement(<576300..>577412)
                     /locus_tag="C5L36_0D02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467155.1"
                     /db_xref="GeneID:40385367"
     CDS             complement(576300..577412)
                     /locus_tag="C5L36_0D02810"
                     /note="PKUD0D02810; Pfam Domains:
                     PseudoU_synth_2(6.9e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323015.1"
                     /db_xref="GeneID:40385367"
                     /translation="MVKLPEFKHAAGELYSPAPYFRHFLIRSSGQYRRSVFDVLNSKP
                     YRFNLSKLQISHLLDKRLLRIYTPTTTSLLSPSTPSTLPLPNFSVVSYNQHVHETAVP
                     RPARLDVVYYQDNIIVVDKPTGIPVHPVQKYYHNTIQHMLANQIGVAPESLYPIHRLD
                     KLTSGILIFATTQQTAATLKTCSKEKLYLARIKGRLVRNQCHDDLVYIYPTRHMLNVY
                     TNAKTEFRELAHDFSRNESIVLAKLFSGYPHQIRIHLRNLGTPIIDDPLYGSRGKYRE
                     IIKSKDQVTEQYWRVLLSRSELVKSTLQTGATCDQCGQEKYSDPQILGICLHAWRYTL
                     QFDADKKIQLQTRNLPIWMPKNFDFLDNLEENFIEI"
     gene            complement(<577585..>579654)
                     /locus_tag="C5L36_0D02820"
                     /db_xref="GeneID:40385368"
     mRNA            complement(<577585..>579654)
                     /locus_tag="C5L36_0D02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467156.1"
                     /db_xref="GeneID:40385368"
     CDS             complement(577585..579654)
                     /locus_tag="C5L36_0D02820"
                     /inference="similar to AA sequence:RefSeq:NP_014824.1"
                     /note="PKUD0D02820; similar to Saccharomyces cerevisiae
                     YOR181W (LAS17); ancestral locus Anc_6.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323016.1"
                     /db_xref="GeneID:40385368"
                     /translation="MMKLKMELHTEAYLFVNCCCYYYCYYYYCYSMTLTSQDKNIVRA
                     SVSKANNKIIDAAIVRLYVATTSSDRWVWSGLMGALVLVEDTIGHTFFFKLIDITERR
                     GILWDQEIYVDFQYTQDRKFFHSFEIDNAQIGFLFDSISNAQHFYKRVTTREKHASTT
                     TLNNYAQVKSRKHPEQTPHFDQLTSGSINHRIRRSRGLLYYEKEPPPEWRPLYNELEK
                     MGITEDMIAENRDFIKDYINKQGGPLVGLEPPIPRRYQHRQQQRQQENNINDNSPPIS
                     SSSSMRKKKAPPPPPPQPQPQPQPQPQPQPQPQPQPSASLSPSPSSPHLAPATQQHLS
                     EESIANVGGSHLQQDQQPALQPLSAQHSSNSISPPFKHAVPPPLATQNLHRFIEQTTS
                     PAFPPRNPVPPPLIIQNTPLPNQSASPAPPPRGPVPLPRGPSTPLTSRGPVPPPPSRG
                     PVPPPPSRGPVPPPPPRNQPQRAAVPPPPPSRRGAAPPPPPPSRQLHNGQAAPSHPPP
                     QQAPSTQQQPLHQQPLHQQPLQPSHPPPQQAALTPPHQQQQSLAPPPPPPPPLQTQTA
                     PPAAGSSAAPPPPPPPGMPVFTPPPAAGPAQTTPAISDDRDALLASIRNAGGVGALRK
                     VDKSQLDKPSVLLQEAKGEAPTMSSAGANTSNSGAPASLADALAAALSSRKAKVANSD
                     NESDGDW"
     gene            <579905..>580096
                     /locus_tag="C5L36_0D02825"
                     /db_xref="GeneID:40385369"
     mRNA            <579905..>580096
                     /locus_tag="C5L36_0D02825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467157.1"
                     /db_xref="GeneID:40385369"
     CDS             579905..580096
                     /locus_tag="C5L36_0D02825"
                     /inference="similar to AA sequence:RefSeq:NP_013364.1"
                     /note="PKUD0D02825; similar to Saccharomyces cerevisiae
                     YLR262C-A (TMA7); ancestral locus Anc_6.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323017.1"
                     /db_xref="GeneID:40385369"
                     /translation="MSGRQGGKAKPLKKAKKPQRELDEEDKAHLEKLKSQKKAAQDMA
                     SKLGKGPLAGGGIKKSGKK"
     gene            <580566..>581234
                     /locus_tag="C5L36_0D02830"
                     /db_xref="GeneID:40385370"
     mRNA            <580566..>581234
                     /locus_tag="C5L36_0D02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467158.1"
                     /db_xref="GeneID:40385370"
     CDS             580566..581234
                     /locus_tag="C5L36_0D02830"
                     /inference="similar to AA sequence:RefSeq:NP_013363.1"
                     /note="PKUD0D02830; similar to Saccharomyces cerevisiae
                     YLR262C (YPT6); ancestral locus Anc_6.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323018.1"
                     /db_xref="GeneID:40385370"
                     /translation="MLTKHKIVFLGDQSVGKTSLITRFMYNTFDTHYSATVGIDFLSK
                     TMYLDGGNSGEDGPRTVRLQLWDTAGQERFRALIPSYIRDSHVAIIVYDVSNRGSFES
                     VRRWCQYVHEERGDDAVLVVVGNKRDLPSTQRCVTSDEGAALCEELGCALFFETSSRS
                     GQGVVPLFKKLSLLLTERDDSDGHGNGNGSGNGGACAGGGQAATTIDVGVNEGSAAGE
                     QCSC"
     gene            complement(<581464..>582780)
                     /locus_tag="C5L36_0D02840"
                     /db_xref="GeneID:40385371"
     mRNA            complement(<581464..>582780)
                     /locus_tag="C5L36_0D02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467159.1"
                     /db_xref="GeneID:40385371"
     CDS             complement(581464..582780)
                     /locus_tag="C5L36_0D02840"
                     /inference="similar to AA sequence:RefSeq:NP_012475.3"
                     /note="PKUD0D02840; similar to Saccharomyces cerevisiae
                     YJL060W (BNA3); ancestral locus Anc_1.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323019.1"
                     /db_xref="GeneID:40385371"
                     /translation="MKLSRTTRSFFRTMSTLPTHNQYFQVGGKDIWSFINETAAAKAA
                     KSGDGVANLGQGFFSYSPPQFAIDSAKEAFEVAADNQYAPAQGKPVLIESLVKHYSGE
                     LGYQLSKDQVLVTTGANEGMFAAFFGLLNRGDEVIVFEPFFDQYIPNIEMAGGVVKYV
                     KLHAPKDFDTRIVDANEYYIDWEELENAITSKTKMVVLNTPHNPIGKVFSKEELTRIG
                     NLAIKHNFVILSDEVYENLYFNIDSFPRIASFEDEELRRRVLFVGSAGKSFAATGWRI
                     GWVIGSLELMPYVRAAHTRICFSSPAPIQVAVSKSIEIADSGDYFSQMREEYAVKYQI
                     LENAFKELQIPYTRADGGYFLLVNFKKVKLPDSYKWPDSIEGKPRDFKLAYFLIEEFG
                     VVAIPPTEFYRSGELELQDCLRFAVCKDDRVLQDAARRLKGLAQYL"
     gene            <583122..>584780
                     /locus_tag="C5L36_0D02850"
                     /db_xref="GeneID:40385372"
     mRNA            <583122..>584780
                     /locus_tag="C5L36_0D02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467160.1"
                     /db_xref="GeneID:40385372"
     CDS             583122..584780
                     /locus_tag="C5L36_0D02850"
                     /inference="similar to AA sequence:RefSeq:NP_013669.1"
                     /note="PKUD0D02850; similar to Saccharomyces cerevisiae
                     YML043C (RRN11); ancestral locus Anc_6.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323020.1"
                     /db_xref="GeneID:40385372"
                     /translation="METPYEQIHTVLEKSVDRRGRILNVYVPHLARHTADRTFQISTR
                     ATLDEETLETWTDEHIPYETDRHEGVFHSGEIVGLREQLYLSLKRSYRKTWGSINPTR
                     KDLRKCLISLSGLEESIPPVYYNISPKVDVERVSYIKYNSRIIDNLFYISLYKQDFDL
                     CYELFRILVSTFDTDILQIWPIGVHILVQLNVGDFVQKLQDIYDGELPDDEVLEDLAF
                     LQNRKMIKLMAGTSNRLLLEALEQIVGKRPLQEKVLRFLELILRSSRNQHPLKGLYPE
                     QTLYKREEDRRTRNGDVDNGDNGDEDDSEDEESSSGYEEDDEVEKEKRRIFEGKQEDE
                     EEDEEDEEDDEDEEDSDSSSGEGEGGKAASDAEERDVRISMSSLRKRYPPALHRHSAP
                     LHRHGTRRKTPTFLLSYLWMLARTGDFKKLQDVIEPLLLVIPTSSDARVVLADIMSHV
                     IEIVSSDGNTQEKMDAMLDSWERWKLEYTSKRRSKRGIKQYVQWEKIETALEEFQKLM
                     QEEERYHQESANAHPETPTDHDNYIPISEFMDKFDSFGSDSDSS"
     gene            complement(<584782..>585189)
                     /locus_tag="C5L36_0D02860"
                     /db_xref="GeneID:40385373"
     mRNA            complement(<584782..>585189)
                     /locus_tag="C5L36_0D02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467161.1"
                     /db_xref="GeneID:40385373"
     CDS             complement(584782..585189)
                     /locus_tag="C5L36_0D02860"
                     /note="PKUD0D02860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323021.1"
                     /db_xref="GeneID:40385373"
                     /translation="MEKTTIDIKSSRSERTTLCLDMGLPLRLLTLFVRRLTWPVSVGI
                     AAVARRDAHFRNMCLKAAQVDDRVRFRHKDDVHHGAALISEFLLYVIVTVFMAVESLR
                     NRQQREEMKYRIQRLEELIYKGSNDSRDSLLKR"
     gene            <585335..>587059
                     /locus_tag="C5L36_0D02870"
                     /db_xref="GeneID:40385374"
     mRNA            <585335..>587059
                     /locus_tag="C5L36_0D02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467162.1"
                     /db_xref="GeneID:40385374"
     CDS             585335..587059
                     /locus_tag="C5L36_0D02870"
                     /inference="similar to AA sequence:RefSeq:NP_014630.1"
                     /note="PKUD0D02870; similar to Saccharomyces cerevisiae
                     YOL013C (HRD1); ancestral locus Anc_6.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323022.1"
                     /db_xref="GeneID:40385374"
                     /translation="MDNGRQRFGLLGYILASTLIAIHKLAALYDESPNFYVLGAKVSH
                     GDAVIIFGNLLVSMFFGAGILLQNLVFGELRLIEVEHLYERLWPTIISLVVSANIYKS
                     SENSFLLIISSLGLVTSKVFHCIVVDRLDFLIQQHYQRNDQKIWKILVNRVILLLIAL
                     LRMDIFMIVSCIDESFIHKSPLLLVLSFEFFLLCIDLSYATVKFSLDVFELYYLQKYP
                     EEEVWAWKKWIDSITKVIISLIKTIMIPTLLLFFAMLESFPFNLFGELFTTILQLFKS
                     VSNLFRLIKSAKRLNDCLGYPTEEELNDCDICIICRDDLTMGGTGTSRSVPRKLNCGH
                     ILHDGCIRSWLEMSNACPTCRKDVIPGKDSERGGRRNQQEAEQIELQARVEGPEREEQ
                     VPQVEEAAEEPLGGHVDHVVTPAVPTPTMPPSPSPPTVPAEEEEYSRYFEGVPMEAPT
                     TVDRYGDTYTGTVGNSSGISNKLGQVMSRIGGLELNDGQRRQFEHAQALLEGEGEGVV
                     DDEECDFVHELPPGSEVPGDWTIFPVEKGSKEDEFRVRVGRSTRLRVRRVRNGRLVDE
                     ETFNKYTR"
     gene            complement(<587309..>587704)
                     /locus_tag="C5L36_0D02880"
                     /db_xref="GeneID:40385375"
     mRNA            complement(<587309..>587704)
                     /locus_tag="C5L36_0D02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467163.1"
                     /db_xref="GeneID:40385375"
     CDS             complement(587309..587704)
                     /locus_tag="C5L36_0D02880"
                     /inference="similar to AA sequence:RefSeq:NP_014631.1"
                     /note="PKUD0D02880; similar to Saccharomyces cerevisiae
                     YOL012C (HTZ1); ancestral locus Anc_6.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323023.1"
                     /db_xref="GeneID:40385375"
                     /translation="MSGKVHGGKGKSGAKDGHLKTQSHSARAGLQFPVGRIKRYLKKT
                     AQSKIRVGSKSAIYLAAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELD
                     TLIKATIAYGGVLPHINKALLLKVERNKK"
     gene            complement(<588324..>590018)
                     /locus_tag="C5L36_0D02890"
                     /db_xref="GeneID:40385376"
     mRNA            complement(<588324..>590018)
                     /locus_tag="C5L36_0D02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467164.1"
                     /db_xref="GeneID:40385376"
     CDS             complement(588324..590018)
                     /locus_tag="C5L36_0D02890"
                     /inference="similar to AA sequence:RefSeq:NP_015094.1"
                     /note="PKUD0D02890; similar to Saccharomyces cerevisiae
                     YPL230W (USV1) and YMR182C (RGM1); ancestral locus
                     Anc_6.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323024.1"
                     /db_xref="GeneID:40385376"
                     /translation="MQTMAQVKKVSSPKELLEDKAPLSGESEASNQDSTLSKDKKNGR
                     VQVEEGVPLKRPKGKVFQCTGYPGCSMVFTRSEHLARHIRKHTGERPFQCNLCMKKFS
                     RLDNLRQHKQTVHHHQLQHQNFSHSDLKTAKYGNHGTTLNNSKRRSCKNELTNLRNSI
                     DKLYKVNANNNNNNNNNTNDNNENENDNYENKLRDNENRKEHSATNSNAYAPITPSIQ
                     TFGDKVTNPLKTPPDSISPSVRKSMLPPPRRNRFLQKHDGFSEIRPTYSKKPVPIIIS
                     NDIKNEVKVLTPATGQNSITEASPIPERISQIRQGDTQGSHLVILQPQKSLSLSPSLA
                     SFPSKYSSPQVSPSVNAFSDIPAPYPQSQQQHQHQYQPLQPPQSQHRYPPPGYAFPNI
                     TPTNTHFDFANPYMSPMYYQPPSAGYGQPMIAETFRHRSHPPYGNQPQVHTPLYPPGY
                     DYGVYAQCQPSLPPPLPQQVQYPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     LYLRRPVERDTVKDSPVTSNGSMAIAVGSGDDKAVEKEKEVVNDEKKLRISSLLNE"
     gene            <590547..>591755
                     /locus_tag="C5L36_0D02900"
                     /db_xref="GeneID:40385377"
     mRNA            <590547..>591755
                     /locus_tag="C5L36_0D02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467165.1"
                     /db_xref="GeneID:40385377"
     CDS             590547..591755
                     /locus_tag="C5L36_0D02900"
                     /note="PKUD0D02900; Pfam Domains: zf-UBR(7.5e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323025.1"
                     /db_xref="GeneID:40385377"
                     /translation="MDTRDAISAPEYLQQQEELETAARESFPHDPRECTYAKGPLRQE
                     LYACQTCLKRTGVLNAVCYACSIRCHTSHELVELFTKRNRTCDCGTERIGTPCLVRNP
                     QWSNLMLDKSFGGKFSPDIPDFGNKYGHNFRGRFCSCDEPYNPLEDSNMIQCILGVEC
                     DEDWYHEECLMGLKPGIIKRSPAHCDSDQGGNRLDDLDQLKPGDDAANTLQVNDNSIS
                     GDEILPLPGFPPLETFETIICWKCSSKFPEAMDDLVQLLHCDTLEYIPSESLDERIKT
                     LKPGNNKKRTKRSYPTTIFLRENYKEILKENVRNHPEGTLARFLKKYPFMYEEDPIYS
                     PPEDDDSSSVFELGIKELNTLPPEQTIQGLEAYQKIKSKLTEFLTPFAREGRIVTKDE
                     VKNFFNNIKK"
     gene            complement(<591893..>594205)
                     /locus_tag="C5L36_0D02910"
                     /db_xref="GeneID:40385378"
     mRNA            complement(<591893..>594205)
                     /locus_tag="C5L36_0D02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467166.1"
                     /db_xref="GeneID:40385378"
     CDS             complement(591893..594205)
                     /locus_tag="C5L36_0D02910"
                     /inference="similar to AA sequence:RefSeq:NP_010581.3"
                     /note="PKUD0D02910; similar to Saccharomyces cerevisiae
                     YDR295C (HDA2); ancestral locus Anc_5.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323026.1"
                     /db_xref="GeneID:40385378"
                     /translation="MLHLPIMSQPSVYYLPLQYTIYQKCLVDVLIQLHRSNIKAYLKR
                     QEGEVDDEEMDDDAKTMSNESMFEAFIFNYKQITNHPSLLVDYYIPRDLLLLNTKENI
                     VGLSNKYRQVSEILDRLVEKDARKTIVLSVSDAKEMDLVESFLLGKFGLQYYRFSGSS
                     LYYDNHGSFDFHQSSKTNDQVSSEVRKAQNPQDIDEQKRRKPGRQKKSHGSAATSSSN
                     ENNNGNGSGPNDGQQRRKKSGRPSTAEKRAREQRAQMSAALANDGTVNGSVESDLSAG
                     NNRRENKEEYIPKLSKNNREFCERLLEKKNKKLNVYLILSSQLKYLLQFEDLKSDLII
                     SLDSKYTDFEEVSKILNYEIPILKPIVVESLEHYEYQMNETMNSIIFDDKKPLKRQQR
                     LMNSKSNEDMRDSFDFRRLLVMLSLAAWSGISVYSAESDSPVSNSLIDWLIDPSNKEY
                     PYPQTLETRIPLIYNQSLIDNVRDTLEAKYDLANNLGVKNLDNYVFFNEKLDNRAPEK
                     TEHNDKKIKLNPEHCEVPERLSYSQYQFYLRELIKETLRQMDEWMEKSGDILHFVHLD
                     ETERQYIMDCGNADCGELFKKNRDLKVVVEAREKVLARMDQELEKVSQLNEMLKSRFQ
                     EYSELKSGEISDKKTKQNNEMEKLKLRLEELKMSISRAEAESNGVRSKYQETSTKAAE
                     SSMLLKKYESLGKLLQEESKGVFRKVQLKCVKDQQAYVTKKIETLTNDQRTWRGYLEI
                     LNREFEKRSNGVHQGNATRSGRNARTQTPY"
     gene            complement(<595496..>597100)
                     /locus_tag="C5L36_0D02920"
                     /db_xref="GeneID:40385379"
     mRNA            complement(<595496..>597100)
                     /locus_tag="C5L36_0D02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467167.1"
                     /db_xref="GeneID:40385379"
     CDS             complement(595496..597100)
                     /locus_tag="C5L36_0D02920"
                     /note="PKUD0D02920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323027.1"
                     /db_xref="GeneID:40385379"
                     /translation="MPEFHSTSQQEVSEKLHYREISLEGASNFDPAASDSFDEFTDSF
                     SYFEQVLTEANSLPFLRSYDGMGTQIATMISPTKTDDTCWKNWQYHSSSTTISTNEAF
                     ENNTPNNTIHNYNLQQYDLSNDNKHLPKNELSVIRQSLNILSQLNNEYVETANPTDLT
                     CNSLDLNHYKTKCIARNNESTRTGSEEIGSKLLSLKSEPLITCLFESKYDYSSREDQM
                     SSQQGQESITNYALLEDSNKLYTMSSQYYVSRGEEEKIVNANVIENEHPGQYFVSNTN
                     QAIGVSLSSPNLETPLKSAELAPAVSVNIINPRDTYELLQKNVFLNCLPTVFEDAFHL
                     RKIEHSSHICDGCFKITKTSYGCSKQLVPTLPNLKTFENYNSPNGYTLEFAQKHGSDA
                     YIYISTEMKNDYDPKIKRYYKKQQYTESGKRLKRDYPSLCPFCKVSDVRSFDQLFYER
                     NNSCYRGHLINTHGISSSGEVAKLPQSGFVCYKLGKNIWSETVGFRCPYEGCNVCFLK
                     GDKTHGFHEYIRHWNRSHISHKQNRI"
     gene            <597701..>598645
                     /locus_tag="C5L36_0D02925"
                     /db_xref="GeneID:40385380"
     mRNA            <597701..>598645
                     /locus_tag="C5L36_0D02925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467168.1"
                     /db_xref="GeneID:40385380"
     CDS             597701..598645
                     /locus_tag="C5L36_0D02925"
                     /note="PKUD0D02925; Pfam Domains: HATPase_c(3.4e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323028.1"
                     /db_xref="GeneID:40385380"
                     /translation="MLKAFTSLFKNSGGKVTPKIVLTPEILSSREGVTNKLKDLYSTQ
                     IKLLSSKRDAKIPVVNHYVELLEQYEKQNEELHKLNPLDEGLSQESFIELLDNQLSVK
                     VEELAKINSKLSFEDLSNLNAVYSDSIDRFFWDFHTNRITSTYTLKEYIDPEPLMKVH
                     DARSIVEQSIQTTSQILSLNDYPVPTFEIDSIPLKVKCVAPHLIHIMFELFKNSTLPS
                     ISRKKPIIVRVTDEDGFVMFEIADRGGGMPDSSLDKIWQFHYTTSKISERDPIHGFGM
                     GLPLCKVFADFNSGKLSMVNHEHFGVSVFLKIPRAFKD"
     gene            complement(<598680..>600830)
                     /locus_tag="C5L36_0D02930"
                     /db_xref="GeneID:40385381"
     mRNA            complement(<598680..>600830)
                     /locus_tag="C5L36_0D02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467169.1"
                     /db_xref="GeneID:40385381"
     CDS             complement(598680..600830)
                     /locus_tag="C5L36_0D02930"
                     /inference="similar to AA sequence:RefSeq:NP_013016.4"
                     /note="PKUD0D02930; similar to Saccharomyces cerevisiae
                     YKR090W (PXL1); ancestral locus Anc_5.691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323029.1"
                     /db_xref="GeneID:40385381"
                     /translation="MSYSASDQKLELNSLPDFLKTKSPQVKFHSAFPPLTTKVRVRGV
                     MERAGFDVYKPPHNTRSVSVPLNSLNAPKGYRVSGNDNVSTNSLPRPPKMRNFTTAPL
                     NTSTPDLLKNHSPTNSKSPVHYAREKLKIESQSSTGSFTTMPQIPDIAPPSLDMNLGN
                     ISNETIVQPLVVHDMVGEFVPSNHNQNQEQQQQQQQHIIQSQWQKQSEPIIEIPPRRS
                     LPKIAGPRPYHSEPDSDSDAADELEPQPTELETPQLEVTNISSITDSENSSIAHKSTD
                     SQDSLGGLANLRDSFKHDSLESKFQNYHPLPNDAHIKRISTLHTEDMKIYNLESLDDE
                     PEYEQEYKHDSKSGANEMSIIQEGEIEDSRIETTKIPALVINDNDEDQDTYDETIPFE
                     NAVDYQQLSAFHNTDDEITNNYEQSSQTESVNPFAKVEEIESGGEDYEDYEDEHEPGL
                     NLKTADFETPHNSSDINGITFGLNSLDIQVPPRHFKTPSPSALFSDVNDYQNDVRSTT
                     TSPEDTHYDKITHDITQVPQHDELQHRHAIEVTNDSKQTQDLTSTSQFEEAELYYPPG
                     EGPCRKCGHNILESEKKIWSKDHQLSGQWHRKCFGCYKCGAKFSKGSSCYVFNNQPYC
                     EEHFHELNGSLCQICNKGVEGECLQNDINEAFHIDCLKCVICGLNVQGDYFLFRGEVM
                     CEADANELMYQIEEAEKEEQMSKMIKRRTRILYL"
     gene            complement(<601106..>601600)
                     /locus_tag="C5L36_0D02940"
                     /db_xref="GeneID:40385382"
     mRNA            complement(<601106..>601600)
                     /locus_tag="C5L36_0D02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467170.1"
                     /db_xref="GeneID:40385382"
     CDS             complement(601106..601600)
                     /locus_tag="C5L36_0D02940"
                     /note="PKUD0D02940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323030.1"
                     /db_xref="GeneID:40385382"
                     /translation="MNNEETYMPECSSTVPLIPHSIGSIGSGFSDGLSDAEDDGVSAL
                     SAYSAIVSTPATTTLADSIIGNPTEEVVKEKGEGKICSKSVHVREISNPLQSGILHLL
                     EYFKFLFDGLLNLSFLSLGTIFFVDVYIACALITLLIECAYALTAKNPLKFHEKNALL
                     ERSD"
     gene            complement(<601707..>602522)
                     /locus_tag="C5L36_0D02950"
                     /db_xref="GeneID:40385383"
     mRNA            complement(<601707..>602522)
                     /locus_tag="C5L36_0D02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467171.1"
                     /db_xref="GeneID:40385383"
     CDS             complement(601707..602522)
                     /locus_tag="C5L36_0D02950"
                     /inference="similar to AA sequence:RefSeq:NP_013014.3"
                     /note="PKUD0D02950; similar to Saccharomyces cerevisiae
                     YKR088C (TVP38); ancestral locus Anc_5.686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323031.1"
                     /db_xref="GeneID:40385383"
                     /translation="MNNIRYKEALTTAREWYSGLSTKGKIALGCLAVVNLACAFVVVI
                     FHGRITALVLDYAETLRQSGWRGRALFGVLLSVVSFPPLAGFSTLAILVGAVYGWNGI
                     FLVGTVASVMSTLSMVTCRVFLQEKAKRLVALHPSLQVAVSAITNESTSFLEETFALL
                     LVKLSPLPYSLTNGALACVPGLNTWTFLIACIISSPKYLLHIFMGIQLASIGEGTPGS
                     IPTSVRLLFLIGTGAAFAALSALIYKRLTTMAAQRGEGEDQFRDTHEPSAIPL"
     gene            <602731..>604590
                     /locus_tag="C5L36_0D02960"
                     /db_xref="GeneID:40385384"
     mRNA            <602731..>604590
                     /locus_tag="C5L36_0D02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467172.1"
                     /db_xref="GeneID:40385384"
     CDS             602731..604590
                     /locus_tag="C5L36_0D02960"
                     /note="PKUD0D02960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323032.1"
                     /db_xref="GeneID:40385384"
                     /translation="MMRLFRALQHRYTRMKRFRVPKWITTLINVILIYFSYKALVITY
                     ESYSLDEPLWHVTKHHLNKPFYPPNDYFAGGSKKPLKHSNIRVMLQNEHYKSLVASEL
                     NYTSYFEDLEETVYSLEPLQYTGDFQSFMESYTSRCRNLSLSFSHPERSITNNGKPVI
                     WDTIFLDNPYETLSRNDLLIMSFDEIFLHDLSLKHEGIIQSLPSGNQKYFSNSGYVVI
                     GGGIYSWYALLTIQTLRNSGSSLPVEVMIPSNNEIDEEYCQLLTRWNAKCISFEDIYG
                     PTVLSLGVRGYQLKAMAIIGSSFSNVLYLDSDILILKNPDKLFTSTVFEKFGFITWPD
                     FWRRTTSPLLYETIGHVGGSVRFLNDFWSGRKGENYHDRQGTLAEWSTEAGLLLINKA
                     THFSMLLLALYYNLNGPAGYYPLLSQGGAGEGDKETWALSALVLNSTHWQVNKYPGKT
                     YGTWMKNVNWFVDSGIVQFDAEDDFYGISHLNEYHNEWESEINYNYDYMFGKHAYQMQ
                     EVIPPKSGVPIKEPRKMFYHLHSPKLDPWDYVLDNLFVDRSNRPLRNFGTIEDLGWDL
                     ERWIWEYIEQVLCHESEVNHALQNMQCFNGRDFKRVCTEDGRLKSRIEWLKKN"
     gene            complement(<604635..>605777)
                     /locus_tag="C5L36_0D02970"
                     /db_xref="GeneID:40385385"
     mRNA            complement(<604635..>605777)
                     /locus_tag="C5L36_0D02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467173.1"
                     /db_xref="GeneID:40385385"
     CDS             complement(604635..605777)
                     /locus_tag="C5L36_0D02970"
                     /note="PKUD0D02970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323033.1"
                     /db_xref="GeneID:40385385"
                     /translation="MFSALNSYFKKDSTCNPPTTASVNESLTVEVLSIKNYKKAARTL
                     QIAFQDDLYVNYLTSGLSDTTTKEQLDLALFEATAYSTIMNGLLVAVRDREAEESDPQ
                     APFLAVACFQKPEKDEKSSTSRSLFSHLWTMYQTGYLKFVYLANKETRRRVFDEQWKL
                     LDQLKEEVLGDQLNKSWYLSDIGAIPKGRGKGLARKLVEFVCHNYIDRYIVEKDTNGD
                     DDDDDEEIINSGDDRYIGSSDENSRLDSEINSFHFQFDLDSDNITDYSGYSSFSDTES
                     AHSSWYNKEHSNSNTDNEDGDDDILSKYDRQQSMKYRNRRGAPLYLESSHPRNRKIYQ
                     KLGFTYVKTVPVAEVQLGKENKKVLTMDLMVRGVKGTKWKVENVFN"
     gene            complement(<605959..>607026)
                     /locus_tag="C5L36_0D02980"
                     /db_xref="GeneID:40385386"
     mRNA            complement(<605959..>607026)
                     /locus_tag="C5L36_0D02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467174.1"
                     /db_xref="GeneID:40385386"
     CDS             complement(605959..607026)
                     /locus_tag="C5L36_0D02980"
                     /inference="similar to AA sequence:RefSeq:NP_015409.1"
                     /note="PKUD0D02980; similar to Saccharomyces cerevisiae
                     YPR084W; ancestral locus Anc_3.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323034.1"
                     /db_xref="GeneID:40385386"
                     /translation="MHTKRDLGKPLRFALLGPHGSSKSSLVSILSNNMTLENYYPTLY
                     NSPILVEFQPPNKRAGVLLDPVSTLNDLSKVGVTNDKKSSIMLPEYMLRKLERKQIDK
                     LKRKDIMAQPNGHPGPTTVSPKEREPIVVELIDTPGVEADDLIPFLEKSLDCRLSKDV
                     LNNLANGYNTNYRSRVKPLIIGSGISDMNGYMDGYILTYSCVPQDPLPPAYEASQSTP
                     TRKTATQLDIVRAVHDSIEDAWKEWTVYNEGWKTGGETEVKHSFSSRFKREADATVPG
                     VVAMMSSSGMPPIVLVCTHIDSPLASPRLIEEGRELARKWNAAFVECSCSPIKREWEN
                     VYETIAVAIRLAEEKYPRASK"
     gene            complement(<607178..>607804)
                     /locus_tag="C5L36_0D02985"
                     /db_xref="GeneID:40385387"
     mRNA            complement(<607178..>607804)
                     /locus_tag="C5L36_0D02985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467175.1"
                     /db_xref="GeneID:40385387"
     CDS             complement(607178..607804)
                     /locus_tag="C5L36_0D02985"
                     /note="PKUD0D02985; Pfam Domains: Pmp24(3.2e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323035.1"
                     /db_xref="GeneID:40385387"
                     /translation="MDNELLEAILRAVQNALIYGYRIRFLHSLAYNVATLPRPHELLK
                     GVWKSMRLGVDHGKILAVFAIVFRVVKTVLKRRVDKPVADFIAGFLGGCLVYGGLVNR
                     RRRMLNDAILEQITMYTLSRLVLALGRDVVNAAVPDRYRKKARDMSWTLGCGLVWGGI
                     MLYYRRDGGKDEYLPRAMRVSLDFIYGSVPHAWREAFQYGREDKKRTS"
     gene            <608016..>609287
                     /locus_tag="C5L36_0D02990"
                     /db_xref="GeneID:40385388"
     mRNA            <608016..>609287
                     /locus_tag="C5L36_0D02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467176.1"
                     /db_xref="GeneID:40385388"
     CDS             608016..609287
                     /locus_tag="C5L36_0D02990"
                     /note="PKUD0D02990; Pfam Domains: Abhydrolase_1(5e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323036.1"
                     /db_xref="GeneID:40385388"
                     /translation="MLWDTYTDCPVVVESRLFSVPLVHDTPNDETITVGAKLVSRQYT
                     PHSKDKYILYLQGGPGYSCPFPSKTSPVFLEPMLRRGYTVVLLDQRGTGLSEPVDVGS
                     LVDGKTPEEQLEYILNFRADSIVRDAEMIRKILLGETQWLLLGQSYGSFCSLCYLSMF
                     PKSIKCVFLTGGVPPLLSTRAEVVNSQVENMRKRCQAYFSKYKEDRERLDGIHRYLDN
                     NKVYLPNGSQLTVARFKGVGSCFGVTGGALYIHSLITTMALEIQALNSLTYNTKNSIM
                     QCFGSETNILYFLFQQVIYMNGPGHLERFSQEMFDELPFTIEMFHSEMLTDPVFQPLA
                     PLVDELYRFSNWKQIWDLESLKSIRWDDIPVVAASFVGDIYVDFNLGQRLHSLFEFKD
                     LITNIHCHDGVKADPNIVEQLFHLLENGNYM"
     gene            <609468..>611180
                     /locus_tag="C5L36_0D03000"
                     /db_xref="GeneID:40385389"
     mRNA            <609468..>611180
                     /locus_tag="C5L36_0D03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467177.1"
                     /db_xref="GeneID:40385389"
     CDS             609468..611180
                     /locus_tag="C5L36_0D03000"
                     /inference="similar to AA sequence:RefSeq:NP_013806.1"
                     /note="PKUD0D03000; similar to Saccharomyces cerevisiae
                     YMR088C (VBA1); ancestral locus Anc_2.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323037.1"
                     /db_xref="GeneID:40385389"
                     /translation="MLITETTPLVGVQKPYTLSEPRDVENANIVPNKGPFHDVVKPAN
                     LYMIIASLWLGTFLSAADTTIVSTTANTIASSMNGSEKLSWIATSYLLTNTIFQPLVG
                     RISDVFGRRTVLIFAQFWFALGCLCCSLSQSVTQFAVARALAGIGGGGMSALSSIIAT
                     DIIPLGERGMFQGYANLLYGLGQFTGPILGSAFVAYDEESGWRWMFAIQVPFVVLAGI
                     LVFANVHEYRQDQMKDVDMKNRFALENLKKIDLPGSFLLSCTIVSLLMIFNAQSLEQV
                     LLYLAFLFISATAFALVEKYIMTVRIIPPSAFQGVLRISAFIVFFAGGSIAGIGYITP
                     LYLQIVHDFSQFQLGIFNSISIFAAPLGSLSAGWYLKQDPNVSTATIIERSIKLSMLS
                     CLALFTGFSLILFQTVTLKPTISRSNLTFGTYAELSVILLGSCISAVGYGAFLVAILI
                     LVVGIVGVKTQATVTGMNYMFRSMGQSSGVGISLGLYNLNVVRSLAKYFQKDVENGHS
                     ILNKLTSSTAYLRKGMPSQYLSDVLLIYKQAIYYSVAVVFGAGSIAFLFSLMLHSFHS
                     NQGK"
     gene            <611347..>612282
                     /locus_tag="C5L36_0D03005"
                     /db_xref="GeneID:40385390"
     mRNA            <611347..>612282
                     /locus_tag="C5L36_0D03005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467178.1"
                     /db_xref="GeneID:40385390"
     CDS             611347..612282
                     /locus_tag="C5L36_0D03005"
                     /note="PKUD0D03005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323038.1"
                     /db_xref="GeneID:40385390"
                     /translation="MPESLLQKVTVYTCTCTYTHTLLSWTYSSTTNPGMSECSVYELP
                     PLRGFVLSIGLGVLIFGTYVPQHIRILKRRTSEGLSPSYILLGSAASVASLINIFIFT
                     MPARRCCPILTRYECMSSLSGFCQILIQTSGSLIIFLLCIFATRESLIESRADLLQIR
                     RNFKILIGYVLANVVTYEYIMLSSLSDDNLNRMFQLANLNGVASMLMALMQYIPQLFT
                     TYSLKHPGSLSIPMLCLQAPGGMLWSYSLWVKTNSQWSSWLPYLVSAVMQTFLLCMCL
                     YFKHVYPTELLETIEEQLIAEENLHAGYNTLSKNI"
     gene            <612558..>613805
                     /locus_tag="C5L36_0D03010"
                     /db_xref="GeneID:40385391"
     mRNA            <612558..>613805
                     /locus_tag="C5L36_0D03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467179.1"
                     /db_xref="GeneID:40385391"
     CDS             612558..613805
                     /locus_tag="C5L36_0D03010"
                     /note="PKUD0D03010; Pfam Domains: DUF1680(4.5e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323039.1"
                     /db_xref="GeneID:40385391"
                     /translation="MSFDNNLEGFNTCQTMWYTFWNPDTESFTCQTPCHESRGNYFSC
                     YSQGVALHAIADSVSVYKDLTLPIVEPAVKATLKFRNPKYGAYSVSSHGKENSGDDDI
                     NYDDNAHLLRAFIELYEATGNKKYLQMSKEIQRFMLGGIKEHETWKVKGCMWHVSRKY
                     MATISNSVGATGAMKMIKYAESKEEEQQLYQFAKTCLNFIFELMLDKSDDVIMDGVGI
                     DSTTIDKSKYSYNQGSTLSALCLMYTYDKNPYWKEMADRVVDGCINPHKTLFDRDYKD
                     MNKRFLHGVSYFNQLLIEGVVDYALTFQKEAKPEVLEQCKFQIARHLSYFRKYCYDPK
                     DKLYFMNFDIYKIDHDTYKMYKEIFGGDKPYNPDPRERAKNMDDTPVDQRPAVKTLIG
                     AAAAAHIFFQGGRLLPKMDPVEV"
     gene            complement(<613977..>616163)
                     /locus_tag="C5L36_0D03020"
                     /db_xref="GeneID:40385392"
     mRNA            complement(<613977..>616163)
                     /locus_tag="C5L36_0D03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467180.1"
                     /db_xref="GeneID:40385392"
     CDS             complement(613977..616163)
                     /locus_tag="C5L36_0D03020"
                     /inference="similar to AA sequence:RefSeq:NP_010611.3"
                     /note="PKUD0D03020; similar to Saccharomyces cerevisiae
                     YDR324C (UTP4); ancestral locus Anc_5.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323040.1"
                     /db_xref="GeneID:40385392"
                     /translation="MDIHRCSFLDYTPESITCCAFTHESNLEQVTPNNFRLAIGRADG
                     SIEIWNPNNSKYRWVLENVIPGSKGTSIEGLVWSTHNDPSLPPRLFSIGGSTILTEWD
                     LDTGVPLKNFDCNAGVIWSIAINKSHDKIALGCEDGSVVVVDVNGGPGVIEHETILQR
                     QKYRVLSLCWVENKMILGGCADGRIRVWSYMNTEIGGDGENTENGIKGRLVQTLRTDK
                     SKSEPSLIWCLLHLPKSNQFVSGDSTGSIKIWDLKHLVLQQSFQVHEADVLCLAKDAT
                     GEKFFSAGVDRKIYNFNHTKISKHNNKWINTSSRLLHGNDVRTMASYHSKNLDFLVSG
                     GIERIMHVNSIKNFQSSVTYKLPINPITENVIVHEDKRLILMYQRNEIKIWKLKEDHT
                     KTLMAKLTLSDPENITDISLSGNGEYLLVSRLSVLKLFRLEEVSENKMSIKRIHSDLL
                     ATLGAKKAKFINSAEIFLVYTSENDLQSYKFDQLSPSSPIDDFQEPTDYDLPIADSMT
                     NSKANFTYLDHYSHIAIDETNQLVALSTYSGVIDILNLSTGKIKTLVKLSSVATCINF
                     TSSSTLLAVTLDHKIHEFNVLNDKKNGQIYTAWSMTNSNSMPAQFIALPGYAYGVFET
                     LGRFGIYGSNWLVFFDSHYDLPNSHSAATENGKKRKRNGDVQASSSKNASSNISKGEN
                     KCFFLTKNYTDILFTGKLNDSELVVVERHLEDMANPPAFKLNRIAV"
     gene            complement(616377..616448)
                     /locus_tag="C5L36_0Dtrna7P"
                     /db_xref="GeneID:40385787"
     tRNA            complement(616377..616448)
                     /locus_tag="C5L36_0Dtrna7P"
                     /product="tRNA-Pro"
                     /note="PKUD0Dtrna7P; codon recognized: CCA"
                     /db_xref="GeneID:40385787"
     gene            complement(616461..616546)
                     /locus_tag="C5L36_0Dtrna5Y"
                     /db_xref="GeneID:40385782"
     tRNA            complement(join(616461..616497,616509..616546))
                     /locus_tag="C5L36_0Dtrna5Y"
                     /product="tRNA-Tyr"
                     /note="PKUD0Dtrna5Y; codon recognized: UAC"
                     /db_xref="GeneID:40385782"
     gene            <618232..>619413
                     /locus_tag="C5L36_0D03030"
                     /db_xref="GeneID:40385393"
     mRNA            <618232..>619413
                     /locus_tag="C5L36_0D03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467181.1"
                     /db_xref="GeneID:40385393"
     CDS             618232..619413
                     /locus_tag="C5L36_0D03030"
                     /note="PKUD0D03030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323041.1"
                     /db_xref="GeneID:40385393"
                     /translation="MEALDNTHRELLTRFRHFINNGKLKLPERLRHEEIAKDDVYERA
                     RKLYEVRPQQREEDEAILKLIGYSNCMYSKYISLMSEVTYRELPGCCKFSAEVIIQYS
                     DQIVLHGYDINSSMYSDYFRTHGLVIGTHKFNAMYSVERFDYNLYAEYLRSTYYWGEN
                     PPVCYANKKNPYCFYLLDEPETIVEIDWFLYPVQQLWQKFKEVLVLYSNLMFRRADYV
                     ARQIETGISYCLSFGQFAQVLPFLPHMKFSKELGSSNFRPKRPKKWNNLIHNAIMVCH
                     TNYSEEQMRRSRRKTESKGLRNRTLLNTDCPVKYDVTIDLLHGVVFIKKLEEHSSECH
                     SIQQQKGYLITRRLKTEKNIRDRFDRDLLDYYGIDKIIMKNHDRFFKGVEHVSKRQRT
                     S"
     gene            <619966..>620769
                     /locus_tag="C5L36_0D03040"
                     /db_xref="GeneID:40385394"
     mRNA            <619966..>620769
                     /locus_tag="C5L36_0D03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467182.1"
                     /db_xref="GeneID:40385394"
     CDS             619966..620769
                     /locus_tag="C5L36_0D03040"
                     /inference="similar to AA sequence:RefSeq:NP_012301.3"
                     /note="PKUD0D03040; similar to Saccharomyces cerevisiae
                     YIR035C; ancestral locus Anc_2.668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323042.1"
                     /db_xref="GeneID:40385394"
                     /translation="MSPKVIIITGASRGMGKTMAEVLIKESPDVRLTLVARSGDKLKE
                     FYDSLDKKDQERVHYVAGDLSDEATMDRLISETVSKFGKINSIIFNAAVLDPIGHIDH
                     LDTKAMRKLFEVNFFSLVELTQKLIPELRKAAKEDGIPSACVYVSSSAAHMAYDGWLA
                     YGASKAAVNHLALDLASEEGGHIRSISIDPGVVDTNMQTNIRNVLGKNMNSEAHEMFI
                     GLHESGKLLKPEVPGGVCALLALKGVAQNLNGKFLEHCDKELAEYQYVK"
     gene            <620941..>621750
                     /locus_tag="C5L36_0D03050"
                     /db_xref="GeneID:40385395"
     mRNA            <620941..>621750
                     /locus_tag="C5L36_0D03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467183.1"
                     /db_xref="GeneID:40385395"
     CDS             620941..621750
                     /locus_tag="C5L36_0D03050"
                     /inference="similar to AA sequence:RefSeq:NP_012302.3"
                     /note="PKUD0D03050; similar to Saccharomyces cerevisiae
                     YIR036C (IRC24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323043.1"
                     /db_xref="GeneID:40385395"
                     /translation="MSVTNVKQPGQATMLFKKTIIVTGASRGLGKSIASSILARYQDS
                     QVVLVARNKLLLDEFVNSQNEEDRNRILVINGDITKTDTIEKCISQTLNRFGRIDGVV
                     FNAGVLGPVGHLHENNIDIKEVRNCFEINFFSIIAFLEKLLSTSDVKLLDIIFVSSGA
                     SCRGIDGWLAYGTSKAALNQLCVQLHSEYSGRVRCTSMAPGVVDTAMQELIRSDHISN
                     GMTDSAHKMFVDLYSNGKLLNPDTVGSLYAKMVVEGIPENVQGRYCRWDEL"
     gene            complement(<621946..>623184)
                     /locus_tag="C5L36_0D03055"
                     /db_xref="GeneID:40385396"
     mRNA            complement(<621946..>623184)
                     /locus_tag="C5L36_0D03055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467184.1"
                     /db_xref="GeneID:40385396"
     CDS             complement(621946..623184)
                     /locus_tag="C5L36_0D03055"
                     /note="PKUD0D03055; Pfam Domains:
                     Amidohydro_1(2.6e-08)|Amidohydro_3(8.3e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323044.1"
                     /db_xref="GeneID:40385396"
                     /translation="MPRILRFTNCLLADNAKLIQADLYVDTDSGVIIETPLIPVHASE
                     VQVIDLQGGILSPGFIDIQINGCFGFDYSSAFNDKQDKQSFLKAYNESMGQLLEYGVT
                     SICPTVTSSQQHVYHDVIPILGLKTRSSNKADSLGVHLEGPFISPIKKGCHPPEAITD
                     MKHGYISLQERYGQGFEQYAAIVTAAPEVQGCSEIIPQLTSNSPTVFSIGHTMADFDL
                     ALSAVHSGATMITHLYNAMPAHTARDVGVLGLISATKDTLPSDKIPFYGIIADGVHVH
                     PSAVRAAYMANPSKTILVTDALYLIGLEDGHYQRGNQSVQKKGSLLLLQGTDTIAGSA
                     THLIDCVHNLIKWTGIPLAEALATITNNPATSLNIAHRKGFLRPGCDADLNILSADGT
                     LKEVYKLGQKIHGFKSKAAN"
     gene            <623579..>626809
                     /locus_tag="C5L36_0D03060"
                     /db_xref="GeneID:40385397"
     mRNA            <623579..>626809
                     /locus_tag="C5L36_0D03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467185.1"
                     /db_xref="GeneID:40385397"
     CDS             623579..626809
                     /locus_tag="C5L36_0D03060"
                     /note="PKUD0D03060; Pfam Domains: Glyco_hydro_3(1.6e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323045.1"
                     /db_xref="GeneID:40385397"
                     /translation="MLALNRKRAISSDEDCTYKQEKKQTIDQTKEVDESDQEHDERES
                     YYRRLVGNFFMVGFEGTSVNEEIASLISKYYIGSIILSGRNFIDATQTKKLITDLQAI
                     AKNSGYKYPIIFVIDEEGGMLNSLFDREFVTQFPGAMAMGAAGSVDLTYKVYRSIAKE
                     LKSIGFSMYLGPVLDILKYRVATFIQQMIGVRAYGYNAQSVVEMGRVAAKAFKDEQLF
                     NCGKHFPGYGSATINSNFELPMILESTEQLFESSLIPYMELIKEDLLDSILVGGCAVP
                     GVNNNDLHACLSPTIVTNILRDQLNFKGVVVSECLLLEALDRNFGVVQGCISAFSVGC
                     DLIMLCSNYRIQREAIVALKSVIEDCSIDQKIVENSLDRIHHLHKKLPSWTEVLADRS
                     MLSPDVIAHHKSLSMKAYEKSITVIRDAGLPINKYLNENVENENTILILTPLITPLYE
                     TIDKSGHKSHINSIDKTEFSKLNLNYGEDVFIKFGQYLSKYRSGYNILHSSYNSNGIT
                     SFHEELILKSKVILFFCAETSNNLYQVGVSKHVSMLCNSVPNRSKVVDTTNSKKMIII
                     SVASPTDFLYDINLGGSPTGYVCTYDYTFDALYHLPKILFGERKATGKIPGLIVQSTS
                     KTANVEKNNHRKHSWLVETFNFKRDWNNLVTLLKNNNYLAYSEKDSVLTSLKLLMYDT
                     ENHCCFVVRNTSLNIILGFSSAWVYPNHTKNTIGGKTNIGNFMFLLVDRNKRDISIGN
                     YLYTKTVKYLFEDRDCFKVYLGRNFPKFTTINDLLLNPTEGNNRTLEFFKSYGCDLSD
                     EASVSAISSHLGRAHTGAGKSKLQNLQGSCNLGFGINQSIEVITDENILDKSTGVQNG
                     PKSQLDVNILKKKVKCLMKLDNILSWKVSENLVRQLQVVGIMFDICRNPADILSSQNS
                     TSNDIERQLDLSSHEIYSELLKDFNSCGKDKQYFDGSSNLQIIVAIEPLRKSIVGSLV
                     VFNDKSKFSKFYPSLQFSTELQLSQLQRYACIAGLFVDPSYTALSEVFELGLICTALM
                     FVKGQHKDCPRVFITDVNENQVKSLNDNGFDIVDRYYNYYGVIIED"
     gene            complement(<626871..>627617)
                     /locus_tag="C5L36_0D03063"
                     /db_xref="GeneID:40385398"
     mRNA            complement(<626871..>627617)
                     /locus_tag="C5L36_0D03063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467186.1"
                     /db_xref="GeneID:40385398"
     CDS             complement(626871..627617)
                     /locus_tag="C5L36_0D03063"
                     /note="PKUD0D03063; Pfam Domains:
                     Glucosamine_iso(1.2e-125)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323046.1"
                     /db_xref="GeneID:40385398"
                     /translation="MFELRKYDTREAAADFVARHIVDSINNFKPTSSKPYVLGLPTGS
                     SPEPVYSRLVQLYRDGKVSFANVVTFNMDEYCGLAPSDRQSYHYFMFDKFFSHIDIKE
                     ENIHILDGLADNYEQECAAYERLIKEYGPFQIFMGGIGPNGHIAFNESGSVRNSITRK
                     VKLQESTIIANSRFFGNQAEKVPKYALSVGISTVLDQSNEVIFLVFGENKREILRKTL
                     TSPVTSDIPSTFIKEHKNCLLVCDDDAFTN"
     gene            complement(<627936..>629615)
                     /locus_tag="C5L36_0D03066"
                     /db_xref="GeneID:40385399"
     mRNA            complement(<627936..>629615)
                     /locus_tag="C5L36_0D03066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467187.1"
                     /db_xref="GeneID:40385399"
     CDS             complement(627936..629615)
                     /locus_tag="C5L36_0D03066"
                     /note="PKUD0D03066; Pfam Domains: NDT80_PhoG(1.1e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323047.1"
                     /db_xref="GeneID:40385399"
                     /translation="MEMTNSSGIPTDKLGGTNTIDDEFAMLFLRELQNTRLEPIREGE
                     GSLETAPENAKIFSPAHTQGTELDFLGAMENTDSDHKSGMKGAASYAMYLPQETILNS
                     NFPDLNDLYPYDRSQNLSNISLDTLMKNTEAVFSRPALPEQRPNTLSIPATSPLPVQL
                     QAGAPGSMTNVNSLQFSTVREEPVSMHTGLSGEDPALDERFTVTQMISEKVLTLYEKK
                     SESPPDACSPNIMDTLGKSIVLKGGITGKIYIDRESYGKLSSNISQMSLEKNENLALL
                     FCYRRNSTTISLPMDLRYIKELQQRGLESAFDQVTLCLHTSLRKFDGKDKSKISVITG
                     FEEFSFNGSSSGLNGNIISINSTKTLVSFSDLLRLSNSYNEVIFLWDQIKFKSATANN
                     RHDAANKHYNVILDVSFEKTRWGKVQTLLTKTLESQKIIVRGRNPSFYSQKGDILIGK
                     IKKIASTRGPRANKMDLKEKLTSLEGNSCKENIVPAIEPANGSNVCRFGPNPDSTGHG
                     NGSQDASPSSVASSYKYYRASDNYYLPPVDVGYFPHYVHHSNSVLKAGGNR"
     gene            complement(<629955..>631544)
                     /locus_tag="C5L36_0D03070"
                     /db_xref="GeneID:40385400"
     mRNA            complement(<629955..>631544)
                     /locus_tag="C5L36_0D03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467188.1"
                     /db_xref="GeneID:40385400"
     CDS             complement(629955..631544)
                     /locus_tag="C5L36_0D03070"
                     /inference="similar to AA sequence:RefSeq:NP_013551.1"
                     /note="PKUD0D03070; similar to Saccharomyces cerevisiae
                     YLR446W; ancestral locus Anc_4.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323048.1"
                     /db_xref="GeneID:40385400"
                     /translation="MISQLQMSYLVSQLRTDTEEDSRAPVSGLEILKGGPLLISTDNF
                     SDSSTDSLALQKNNTNSAEVKQAIMSYLKIHEIEKNFDTITREFENSIHESLQKSQNC
                     MLPCFNVVCDSNCLPDEYYAVIDIGGSTLRISVIKFLEENKAECIINKSWVIFDDNKH
                     LDQQFFEWIAGNFKSLIANDMKVLLENSRGSMKVGITWSFPLLQIEAPNRAVVSDLGK
                     GFSVCLEFKGKDLKDIFEESFTRFGLDIEIYAIINDSVSGFVAGSYLINSKLGLVQGT
                     GVNSCFFVDKEKLSYGKIGFLKPNFGEEKILVNAEASFLGYHLFPHISEADKEMNPLW
                     DVISEQELPYPHMTTGDYGVFQPLEVITSGRYIPEIIRRILMKTMDMEKHSEGGAEYS
                     LSAELLGELCLSDDDDDDDEVRGKLCTALQLEYISKDEIGILKIITEVVIHRASIVLA
                     SYIIAMLRVSGHIDTDILTISVVGSMLQHFPRYKETVLEILGNKKHIYKLPNITFGFV
                     EDSSIYGAAIAACATQRSLCL"
     gene            complement(<632330..>633259)
                     /locus_tag="C5L36_0D03075"
                     /db_xref="GeneID:40385401"
     mRNA            complement(<632330..>633259)
                     /locus_tag="C5L36_0D03075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467189.1"
                     /db_xref="GeneID:40385401"
     CDS             complement(632330..633259)
                     /locus_tag="C5L36_0D03075"
                     /note="PKUD0D03075; Pfam Domains:
                     Amidohydro_3(5.6e-08)|Amidohydro_1(1.7e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323049.1"
                     /db_xref="GeneID:40385401"
                     /translation="MGQLLEYGVTSICPTVTSSQQHVYHDVIPILGLKTRSSNKADSL
                     GVHLEGPFISPIKKGCHPPEAITDMKHGYISLQERYGQGFEQYAAIVTAAPEVQGCSE
                     IIPQLTSNSPTVFSIGHTMADFDLALSAVHSGATMITHLYNAMPAHTARDVGVLGLIS
                     ATKDTLPSDKIPFYGIIADGVHVHPSAVRAAYMANPSKTILVTDALYLIGLEDGHYQR
                     GNQSVQKKGSLLLLQGTDTIAGSATHLIDCVHNLIKWTGIPLAEALATITNNPATSLN
                     IAHRKGFLRPGCDADLNILSADGTLKDTYKLYH"
     gene            <634024..>635541
                     /locus_tag="C5L36_0D03080"
                     /db_xref="GeneID:40385402"
     mRNA            <634024..>635541
                     /locus_tag="C5L36_0D03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467190.1"
                     /db_xref="GeneID:40385402"
     CDS             634024..635541
                     /locus_tag="C5L36_0D03080"
                     /note="PKUD0D03080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323050.1"
                     /db_xref="GeneID:40385402"
                     /translation="MSSNEKVPDVNIETDKNSSYDELDHRVTKESTSVHVYDKKYISF
                     LPPYSNAMIQIVMLAFVVFMTPGMYNALSGIGASISGPDGVKTQDNSNVALYCTFAGV
                     GFFAGTLCNLIGPRYCLMLGGTGYLVYAGSLLSYNHNQNSGFVIFAGAYLGICAASLW
                     AAQGSIIMSYPTEDKKGRAIMIFWVIFNLGAVIGAIIPLANNMHSNSSTVNDGTYIAF
                     MVLMGTGSVIAYFMLPKEKVWRDNGTRVVVKDYPNWKTEIFGSFRLLIKEPKIFLLFP
                     MFFASNWFYTYQFNDFNAGRFNIRTRSLNSLLYWLFQMLGAVIMGTILDLNMFRRSVR
                     AKIGWTFLFCIAFAIWGGGYKFQTGFTRADVKPDAEGVYKLTPMDFKDSSYIGPMFLY
                     IFYGIFDAMFQSYCLWVMGALSNDSETTSYYAGFYKGIQSAGAAVAWRLDAYGTPYMS
                     MFASSWALVQGSMVLAVPLIFFMISDHTEELPEEDIDDDGINAVVSLVSGEGRIV"
     gene            <636170..>638617
                     /locus_tag="C5L36_0D03090"
                     /db_xref="GeneID:40385403"
     mRNA            <636170..>638617
                     /locus_tag="C5L36_0D03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467191.1"
                     /db_xref="GeneID:40385403"
     CDS             636170..638617
                     /locus_tag="C5L36_0D03090"
                     /inference="similar to AA sequence:RefSeq:NP_014357.1"
                     /note="PKUD0D03090; similar to Saccharomyces cerevisiae
                     YNL041C (COG6); ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323051.1"
                     /db_xref="GeneID:40385403"
                     /translation="MDFAYEVDTYDNSTLQGTNNKYVTGKTNILSSISTTDFTKKLQS
                     LSILDIGRTPKNMKQDTDTNTSKSLERARTSIELLNTLGLDHIPLYNNEAKEWDDYNQ
                     FFIESNLDGKDLISKLNRLLEGTDGSDLSTRTSLELLQKRVDYEISLKDSSANEMKSL
                     TSADQESSLARRNLRGLIESDLVQQYAQQLRPFTKVVKSIESFKPTVEAIINDYNGIL
                     DSLVGAINDTDSLKSKICGYEKEKELVDMKKNLLLAFKNTYTISQYEEYLIRFGDLND
                     PIAGTEFFEVIGRVTKIISDCDVLLGMENETIGLTIMKKMNEYLSSINEKVQSYIQNN
                     IEDVYTGKYQYETKKINVKVFQKCLVYMYHHDRDNFDSTLSGMVEHRSRSISTEFINQ
                     LKGYNSEINTSSIQKSKSNLFMSSYDTAKFISDTLAYIHGLLVNEIENARSFFTFDNE
                     SDENVISKDELDAMINDIVMKIVAGLNNPLKGAIESILRQEVRLSSLVSSYELIELYS
                     NMFMKLLYHDNEDIRKEGLLYTMKYLESETQDRIFSLIELKFKNLQVETINENLNTSD
                     SDYIPDWMVDWCAVIDELFNDYTSGKNLDDNEKYILGLDDTKWDSLLELLIMKPVELV
                     RKFQKDSKVDKKESLIWGLNCLDYFYDKVDINPFLSSKAPALRSEIEDDTERLTELEF
                     NGLLESSGLYDIFNLVNMIFRIDDEYFDVAYYQPILENRLFNIDTFISANAKLEHFLS
                     TYINQNELNGLISPTIFNKVFLDSATKYIDFYKKLCLIIKEYLRDENGNEVNVFQWNE
                     MTIATLLGVEDHYQGKE"
     gene            complement(<638660..>639916)
                     /locus_tag="C5L36_0D03100"
                     /db_xref="GeneID:40385404"
     mRNA            complement(<638660..>639916)
                     /locus_tag="C5L36_0D03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467192.1"
                     /db_xref="GeneID:40385404"
     CDS             complement(638660..639916)
                     /locus_tag="C5L36_0D03100"
                     /inference="similar to AA sequence:RefSeq:NP_012163.1"
                     /note="PKUD0D03100; similar to Saccharomyces cerevisiae
                     YIL103W (DPH1); ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323052.1"
                     /db_xref="GeneID:40385404"
                     /translation="MSKEEVVVPRRSKFGGAKKAGSSSASEPSSSVVRARKSKVVSRL
                     MNQIPDEILNNEQLNDAIKLLPSNYNFEIHKTVFNIKKINAKRVCLQMPEGLLIYAPI
                     IADILAEFCDCETLIMGDVSYGACCIDDYTARALDCDFIVHYAHSCLVPIDVTLIKVL
                     YVFVTIAIDETHLLNTIRLNFEHGARIALFGTIQFNPSLHSVRAKLSDASDSEKLIYC
                     YTPQIKPLSKGEVLGCTSARLDHEQFDAMVYIGDGRFHLESAMIHNPKIPAFRYDPYS
                     RKFTREGYDKKQMVEIRRDAIEVSRNAKKFGLILGALGRQGNPATISRLEEKLKENGK
                     SVVKIILSEIFPQKVAMFDDVDAFVQVACPRLSIDWGYAFSKPLLTPYEAMVLMGEDK
                     EFTEEFYPMDYYESKGYGRGEKPLRT"
     gene            <640127..>641611
                     /locus_tag="C5L36_0D03110"
                     /db_xref="GeneID:40385405"
     mRNA            <640127..>641611
                     /locus_tag="C5L36_0D03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467193.1"
                     /db_xref="GeneID:40385405"
     CDS             640127..641611
                     /locus_tag="C5L36_0D03110"
                     /inference="similar to AA sequence:RefSeq:NP_012162.3"
                     /note="PKUD0D03110; similar to Saccharomyces cerevisiae
                     YIL104C (SHQ1); ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323053.1"
                     /db_xref="GeneID:40385405"
                     /translation="MLTPRFELNQDEEFVYIKIHISNIRFSAAAIEMVVNENVFVFSL
                     PPYYLRLRFPKQLVENEDATSEFVPNEECIKVRVPKLNKGEFFPDLDLGAKLLARLNE
                     PSNPCEKSELKGGLIEEVDIEGSKDAFQRSRSELEREALTYDWEVPQTMPDPLTDLKV
                     SVKYGFNNQYSDYLTPSLANGNDINELSDPDHLQPDDRIMERLIKENIKFDMEYYAND
                     YITVRYLSEQEGDVNGIIGALTYASPYWKLFNDSKSKSTVQVEFTQEEQDRMTDLPRK
                     TYLIDDPRPLYYTLLCLLFSYSYEVRSFQGETTIESAWSIGKLTPQISCLDSQLIQSN
                     NQTEKNMIRVITLTMARRALGYPLFRHFDLVKKSWMDVYWTLRCGKRAVLKSLLAIRE
                     LFRKHDIYYVYCKILLDDLCAWVLRDDGCNDVVLRNLAHALRKEIDVLDKKDVVFEKL
                     ISTNTEEIPNDAQIEMDVEKEDQFEFLNLVEVEELADEAYESSL"
     gene            complement(<641661..>643028)
                     /locus_tag="C5L36_0D03120"
                     /db_xref="GeneID:40385406"
     mRNA            complement(<641661..>643028)
                     /locus_tag="C5L36_0D03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467194.1"
                     /db_xref="GeneID:40385406"
     CDS             complement(641661..643028)
                     /locus_tag="C5L36_0D03120"
                     /inference="similar to AA sequence:RefSeq:NP_014356.1"
                     /note="PKUD0D03120; similar to Saccharomyces cerevisiae
                     YNL042W (BOP3); ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323054.1"
                     /db_xref="GeneID:40385406"
                     /translation="MTFTPPHGACTNQQAKMYRHCRPINTQLGSPIDQAQTLSTPTAT
                     PSPNLPFNPKQSPEQVRITHNKRDSSCIEGNGPYWDKQQAYYGSQSNNFQAAVDQYDR
                     ASSQNQIFKSLFGPDASQWPFSEDCLKRALAVRLAQEATKQEYYKVERLNRTMELMKM
                     AVLAKVPGHLIPGLLGTPPCIQGESHNPHPNEQHPQCVTPLRESSSCCNSSNSPSPVR
                     SSKHSRSRTISSTAELFNSQSNVSDDSQSNPMKNFKFGTGSSNSFRSTLVRNRTSLPP
                     RHQLSPSRIGAHAISSLNGSSDKNRVDIRKFQHGKTHMKTLSLPNNVTIPETKPLSFS
                     RNHSKLPSIPNLREIYIPELDKQPPQSYEPGKVGKSCLAEQPSVEPPKDLPTSSATES
                     SHWKRRRVNGGSPLKELSMVYENGESMTQTEQNVSISSFYEDSNKTLTSSSPKSVLPF
                     EPKTP"
     gene            <643778..>644797
                     /locus_tag="C5L36_0D03130"
                     /db_xref="GeneID:40385407"
     mRNA            <643778..>644797
                     /locus_tag="C5L36_0D03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467195.1"
                     /db_xref="GeneID:40385407"
     CDS             643778..644797
                     /locus_tag="C5L36_0D03130"
                     /inference="similar to AA sequence:RefSeq:NP_012420.1"
                     /note="PKUD0D03130; similar to Saccharomyces cerevisiae
                     YJL115W (ASF1); ancestral locus Anc_1.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323055.1"
                     /db_xref="GeneID:40385407"
                     /translation="MSIVSLLGIKVLNNPAKFTDPYEFEITFECLEQLKDDLEWKLTY
                     VGSSRSLEHDQELDSLLVGPVPVGINKFILTADPPSPELIPASELVSVTVILLSCSYK
                     EREFVRVGYYVNNEYDSEELRENPPAKVQVDHIVRNILAEKPRVTRFNIAWDNEGDLD
                     EYPPEQDTEELDDEDAIIDMGVDSEEEAEDMVEVDDEDDDAEDEEVGVEGQEKVSGEV
                     LEVDAESAKRQNTLNDDDIPELKRRKIELEKTETTNTENEASNVVVDKEDEEEDEEED
                     EEDEEEDLDELAADDEEELVAEEVEEVDAAEEDDGENTENAEEAQVAPMEDSERTLKS
                     RQDSV"
     gene            complement(<644940..>645617)
                     /locus_tag="C5L36_0D03140"
                     /db_xref="GeneID:40385408"
     mRNA            complement(<644940..>645617)
                     /locus_tag="C5L36_0D03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467196.1"
                     /db_xref="GeneID:40385408"
     CDS             complement(644940..645617)
                     /locus_tag="C5L36_0D03140"
                     /inference="similar to AA sequence:RefSeq:NP_012967.1"
                     /note="PKUD0D03140; similar to Saccharomyces cerevisiae
                     YKR041W; ancestral locus Anc_1.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323056.1"
                     /db_xref="GeneID:40385408"
                     /translation="MDHDHTYTNYFTNGEHEAVVTKPQRRWKRLRFKKRIKPKLFLKK
                     VATNTHDVATSGHVSTVKAEKERSELFDRHTNVIEYGPSVHGYNFIAFSESDIPQERS
                     DENPPLVSEKESSDSETSSNRSNFQETSSEYNYNVYLNAWADIENGIKYYKTPFPTKT
                     DEFGDISVSSIINFLETKANVRQERIRWHPDRMKQILLNSDMWDDHQEKDVTHVFQVI
                     NEAYDRV"
     gene            <645801..>648023
                     /locus_tag="C5L36_0D03150"
                     /db_xref="GeneID:40385409"
     mRNA            <645801..>648023
                     /locus_tag="C5L36_0D03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467197.1"
                     /db_xref="GeneID:40385409"
     CDS             645801..648023
                     /locus_tag="C5L36_0D03150"
                     /inference="similar to AA sequence:RefSeq:NP_012767.1"
                     /note="PKUD0D03150; similar to Saccharomyces cerevisiae
                     YKL155C (RSM22); ancestral locus Anc_5.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323057.1"
                     /db_xref="GeneID:40385409"
                     /translation="MLRQFPLRIRITQKHSLVPKCKFRFLSSESRAKISIEDPELFYE
                     SENQLSNDATQLKFAHRASGQTFGQLVEEANNDRDPLHNTRVITPEEALEGVDPRYRD
                     PETGELLEGATSRDARLHPETLWGRVNQKQVHVPSMFADVIQNNLLFQYEPKVLKEHV
                     VNWYTTINEKGVRETVNSELEADVTIAASFAQDYAVSYQVLDEFVKRVGKQNVEKEIH
                     SVLDVGLGPSTGMLALNEIMGDEWNPKRKDSVVFGDFNMARRSKIFLSRQVNENLPRI
                     DGMDSYEDEYTYENNNEIEDENPLIEEDKPYVGKVKTKLLKVKTVILDKLRPVQTKYD
                     LIIVSYQLLKDLENFPFEVDAKLDQYVRRLNPGGHLVIIERGNPLGAEIIARARQIIL
                     RPENYPGQTEKIPRPYKSSAKKLSAKEQLRLSRLSPEEKALAMKNLEPELLENFDIIE
                     QETEAEDLDKLDEPIDLSVIAPCSHHGKCPLQFFDPQVYLYGKIGKKLKFCSYSVNVH
                     RPKYLLELKRGKKLAVKWTAPNSGVGIDGLAKPGRGREGGNDYETASYSYLMVTRSRE
                     DADKLEQLRQKITEVGVLERPVGYQPQSREEYPRLLSQPLKKKGFVIMDVCAPSGHVE
                     KWHVSKSLGKSEYHDARKSNMGDLWALGKKSANQSTKENTFYFDKIEEKRENIRKHKK
                     RDSTRLKRKIKKEYKEALEADADDLEGNLVRMAKIDVYEFLQKPKEEEKMKDKRKFRY
                     "
     gene            <648325..>650218
                     /locus_tag="C5L36_0D03160"
                     /db_xref="GeneID:40385410"
     mRNA            join(<648325..648349,648429..>650218)
                     /locus_tag="C5L36_0D03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467198.1"
                     /db_xref="GeneID:40385410"
     CDS             join(648325..648349,648429..650218)
                     /locus_tag="C5L36_0D03160"
                     /inference="similar to AA sequence:RefSeq:NP_013155.2"
                     /note="PKUD0D03160; similar to Saccharomyces cerevisiae
                     YLR054C (OSW2); ancestral locus Anc_8.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323058.1"
                     /db_xref="GeneID:40385410"
                     /translation="MPPNTVLCIGNSPTCVFLTWRLSVGGCQVVILESYLSPEKCNTI
                     YWKSEKYPNHSYRPINSCRKASDCTTKCEFILIGVANITKLKEIGESLRNYITDKTII
                     FLDASHAVGLEYLVREWYPDNAVVSIICEAVTKIIEYNDKYEFCHLGNKVATAIGSTV
                     PDNSKLVQDTLAGSGNEKLVEFTDLLLTNGVHPCIIIPEKVKPTLNYYVWKQILTLVP
                     FGVLSLIYGQLSLENRKHYRLLNKTFHDILRLAVKQCPTEFPNIADEKGTQKLFDYLL
                     NQFNQTHSQYKIKDFTGKLLPSSQDELLEIPLCVYNYKKNFTTQTSLCLSQMINFAGK
                     RNIDIPYIECIESFYMELEELSKQGVFNWVEKMPHRSLVAQVSQASHAKYDISASSLV
                     SSVGGSIQSGIQTPTSVIDITNRSSLKNTYSSDPELISQAYQYVPAPLPQRFLVTGKP
                     HVEHPRFRNVPEKGTNGREISYHQIKDLTYPGTKGSTAGNSLVQAQKHIYQYTNLNRT
                     FENVNNRYGHYDSLNPFKQFSGFTDEIKFDGNEMHTVQKTKKSVVHTVDMVHTGEYHS
                     IPGKKTLGAKKDEDRDNSNGMGNRNLDYINMEDDNNGE"
     gene            <650536..>650850
                     /locus_tag="C5L36_0D03170"
                     /db_xref="GeneID:40385411"
     mRNA            <650536..>650850
                     /locus_tag="C5L36_0D03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467199.1"
                     /db_xref="GeneID:40385411"
     CDS             650536..650850
                     /locus_tag="C5L36_0D03170"
                     /inference="similar to AA sequence:RefSeq:NP_014908.1"
                     /note="PKUD0D03170; similar to Saccharomyces cerevisiae
                     YOR265W (RBL2); ancestral locus Anc_8.714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323059.1"
                     /db_xref="GeneID:40385411"
                     /translation="MGPTEREIKLLSLKGILKLRAEYVSEVSKIEDLVKELKIKSENH
                     EIKEQEYTDAVIILKETKELIPLATEKVKEMAEDLRSIVNGDHTEALDRLLSEADEVC
                     SL"
     gene            complement(<650938..>652134)
                     /locus_tag="C5L36_0D03180"
                     /db_xref="GeneID:40385412"
     mRNA            complement(<650938..>652134)
                     /locus_tag="C5L36_0D03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467200.1"
                     /db_xref="GeneID:40385412"
     CDS             complement(650938..652134)
                     /locus_tag="C5L36_0D03180"
                     /inference="similar to AA sequence:RefSeq:NP_014905.1"
                     /note="PKUD0D03180; similar to Saccharomyces cerevisiae
                     YOR262W; ancestral locus Anc_8.712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323060.1"
                     /db_xref="GeneID:40385412"
                     /translation="MAPYGQIVIGPPGAGKSTFCNGMNQFLNSIGRNSLIINLDPAND
                     RLPYDCTLDIRDVITLEEIMNDEELRLGPNGGLMHALEVFQESIDFFIDRIRELIKLS
                     RDGNSTYVIFDSPGQTELFTNSPVFKEIFLKLIKELDFRLVVVSLVDSMNLTIPSHWI
                     SSLLLTLRSMLQLDLPQINVISKIDLLKGYVDSDKISKMEQAKRELSLNDEEKEESER
                     NREKQCEEDTFQGGLPFKLQYYTEVEDLHYLLPYVETENNQRSHRWFNKKYSRLTEAI
                     VELIEDFGLLSFNVLSIEDKTSMINLLSLIDKANGYCFGSNELGGDSIWTDAVRQGGM
                     GFMEDIDIQERWIDEKESWDALEEEKHKELLEYYKKQGKPLDEETEWEEALKEWEANN
                     KKTISN"
     gene            <652384..>655311
                     /locus_tag="C5L36_0D03190"
                     /db_xref="GeneID:40385413"
     mRNA            <652384..>655311
                     /locus_tag="C5L36_0D03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467201.1"
                     /db_xref="GeneID:40385413"
     CDS             652384..655311
                     /locus_tag="C5L36_0D03190"
                     /inference="similar to AA sequence:RefSeq:NP_683715.1"
                     /note="PKUD0D03190; similar to Saccharomyces cerevisiae
                     YFL023W (BUD27); ancestral locus Anc_8.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323061.1"
                     /db_xref="GeneID:40385413"
                     /translation="MEKELSVIDGILANLAGIQSFYEFEYTHLSTFLQMLNHFQSESL
                     TTKELSKANEVFKNKSGAEISEFKVKLQGVEKKIRQIKNEISSRTESRKKLIDLFNAL
                     KSVDFCDTSSSSAHLVQPDNFDQVADGGISLPIMEIREDLNDDGEVIGSEVKPYQSHE
                     NQLKKLLESKVDFKTGNSAYEKDGSNQTKEEEHKIEEIVDEDGVVVKSSFRFLGKKDG
                     KPKKPENTVSEKETKGELESNTKNLETDVTSSNSKLTENHQRNYRPFMIREEIDEDGN
                     IINSSMSQIPEIEDKNSDEIKRTESNEEVNEDQLAELFEDMGLEVPSEKKEEKIEEKI
                     EELNEETSNEAADINNNVEENHADTGIPSIPQELAIQPNELYTLEMIADQLNQTECED
                     ENDVVEDGKDFVNDDNVEDFEWPKINDVEDDDEVDMDSEEIQKRTLSNMFGSRGQNLF
                     TQKLMDLRRTQSGNNSSNIETNSETVNQVTSSSNVVKPKKSTKKSVKFNSEIDVKNVP
                     DIWDDIRKSNADNELLDKERKNVSLFKRSVSEKAELVENEHIAKENTRVIEKKLKENI
                     PVISDIVERPIVETTLKTNKSNGIFKMFDSTSVRKQVDHQMPDVIEKQNLTKLAGKKS
                     PSRFKLARVAEMGKKYQRTHVPVEGRKSLSDATKESLTHDGKHKDSEKLRDEDKDNAI
                     RTPNAVLKKNLNSLTVQENKSSGSVQIQVPKDTNPLLANPSLDDEDYEVVRNEATETL
                     FDDDDDMIEEEFVASDRTIAEKYIAETAKQDAVLDLGESDKESTFFPEYKNKEKNMNG
                     GNTGQKVVESTLDYKSLSEDLDTMAKAYVLGLYDDDLETQGQVIEELKDFERHNEIVE
                     QRSESKLHGRVQEINKNVEGYNEKLKGIAENDDTMVVNDIVENDMKEVLETNAIPDDD
                     LDIELNDETMATQVALDYTKMRASMIHKYKGGFKETDKEKEFVRPEGSERVSRFKAAR
                     LGI"
     gene            complement(<655407..>656660)
                     /locus_tag="C5L36_0D03200"
                     /db_xref="GeneID:40385414"
     mRNA            complement(<655407..>656660)
                     /locus_tag="C5L36_0D03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467202.1"
                     /db_xref="GeneID:40385414"
     CDS             complement(655407..656660)
                     /locus_tag="C5L36_0D03200"
                     /note="PKUD0D03200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323062.1"
                     /db_xref="GeneID:40385414"
                     /translation="MYPHKLRGDKIDPQFDFVGSVANRSSLSVYSKVPSIHHANINAS
                     QGRVFSNELFKNKVKRESVLYPKPEELNERTVPLPMPKKRGSKHKTGLLSKLGKRIST
                     FGSIIEREHKPQKRSVSANDIATFNEFVHSNCIHPEPVEDKISIIEDMENLEIKGENE
                     MEEQDKEKTVYTKDNQIFVNFSNNSASSFISEIINTYSQMDAQSIREFTMEECFRSPK
                     ISLPESIVKRQSTLSGYGSSKITEQDELFSKAPSSSFSRSSEELVETEGHNFNEYQPL
                     VTKNYNKELPLTPSRRIDQFQIRDYSSNKNSVITDTSVPPRVPKHEILMKSQYPTPPE
                     TPYFDCRESFSDTPPSPKKKSIEIPTDTDVFTRKSKAYKGLIDRPLSKEKARISSSQY
                     LQNVGISPFMLTGYQESSTLKVMNP"
     gene            <656968..>657936
                     /locus_tag="C5L36_0D03210"
                     /db_xref="GeneID:40385415"
     mRNA            <656968..>657936
                     /locus_tag="C5L36_0D03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467203.1"
                     /db_xref="GeneID:40385415"
     CDS             656968..657936
                     /locus_tag="C5L36_0D03210"
                     /inference="similar to AA sequence:RefSeq:NP_014882.4"
                     /note="PKUD0D03210; similar to Saccharomyces cerevisiae
                     YOR239W (ABP140); ancestral locus Anc_8.665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323063.1"
                     /db_xref="GeneID:40385415"
                     /translation="MTAKSDEGAEHMKKPALDSRIGRDLPFAFGQRFLDSEEDVFKHN
                     AWDNVDWDAEQLEQFQLSIEKQKEEPVNEFYRNEYNSKPKKYWDIFYKNNRENFFKDR
                     KWLEIEFPSIFECTKADSGPKTILEIGCGAGNTMYPILSKNENPELRVFGCDYSDVAV
                     NLVRSNENFESLNAAGNAYSSVWDLANEEGKIPDDLEENSVDIAVMIFVFSALSPEQW
                     EQGIANLKKCLKPGGIILFRDYGRYDLAQIRFKKNRLLDDNFYVRGDGTRVYFFTEEE
                     LREIFCTKGELIEEKIGTDKRLLVNRKKQLKMYRCWLQAVFKMPEA"
     gene            complement(<657904..>658689)
                     /locus_tag="C5L36_0D03220"
                     /db_xref="GeneID:40385416"
     mRNA            complement(<657904..>658689)
                     /locus_tag="C5L36_0D03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467204.1"
                     /db_xref="GeneID:40385416"
     CDS             complement(657904..658689)
                     /locus_tag="C5L36_0D03220"
                     /inference="similar to AA sequence:RefSeq:NP_015176.1"
                     /note="PKUD0D03220; similar to Saccharomyces cerevisiae
                     YPL149W (ATG5); ancestral locus Anc_8.666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323064.1"
                     /db_xref="GeneID:40385416"
                     /translation="MEITNHLWNALIPVEISYTNSNSTAQNRRIFTTLLPRNSYLYLH
                     LPQVLAFFQIPLSKLSQAWFESGDEIVGWSIPLDVHYNSQNSRTYFLTLQLGICKSSS
                     IRMYHSQLSDSFWEKHWRNTIKEACYVLNRSCNVVLAMSLQDGKDWWNSVISQRVTIF
                     EKHFKKLVPKNITKVPVKIYRVSGCKMVDYEQINAIGGDLKDLTEVGDNRTIFIVHGV
                     EIPPDTGIIELYKIMKHFDGFLHVVIKDIYISESRFGHLENSL"
     gene            complement(<659051..>660157)
                     /locus_tag="C5L36_0D03230"
                     /db_xref="GeneID:40385417"
     mRNA            complement(<659051..>660157)
                     /locus_tag="C5L36_0D03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467205.1"
                     /db_xref="GeneID:40385417"
     CDS             complement(659051..660157)
                     /locus_tag="C5L36_0D03230"
                     /inference="similar to AA sequence:RefSeq:NP_014779.1"
                     /note="PKUD0D03230; similar to Saccharomyces cerevisiae
                     YOR136W (IDH2); ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323065.1"
                     /db_xref="GeneID:40385417"
                     /translation="MFKNIQLPKNILMSAQRQYSSKVAGQYQGAPNANGRYNVTLIKG
                     DGIGEEISDSVVKIYEAAKVPIDWEPVDVTPSLINGVTTIPKPAVDSINKNQIALKGP
                     LATPIGKGHQSMNLTLRRTFGLFANVRPCKSIVGYETPYKNVDTVLIRENTEGEYSGI
                     EHIIVPGVVQSIKLITKKASERVIRYAFEHARETGRHEVIVVHKASIMKLSDGLFVQC
                     AKEIAKNYPEIKVSFELIDNTSLKLASDPTLYSKSVMVMPNLYGDILSDLSSGLIGGL
                     GLTPSGNMGEKVSIFEAVHGSAPDIAGKGLANPTALLLSSCMMLRHMGLNQHADKIES
                     AVLKTIASGPENRTGDLKGTASTSSFTDAIIANL"
     gene            <661536..>662294
                     /locus_tag="C5L36_0D03240"
                     /db_xref="GeneID:40385418"
     mRNA            <661536..>662294
                     /locus_tag="C5L36_0D03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467206.1"
                     /db_xref="GeneID:40385418"
     CDS             661536..662294
                     /locus_tag="C5L36_0D03240"
                     /inference="similar to AA sequence:RefSeq:NP_010698.1"
                     /note="PKUD0D03240; similar to Saccharomyces cerevisiae
                     YDR410C (STE14); ancestral locus Anc_5.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323066.1"
                     /db_xref="GeneID:40385418"
                     /translation="MTVPDAAFKVVTPYKPNPSLNSLPKISKLSYLLGIASGISLTIT
                     LQNWHSFPAFPIYVLFISAFHFLEFYITASYQPGRVTDDSFVLDNPGYHVAHGIAILE
                     YGIENYMFPSLKSSFNGVKLVGLSVVLTCQSIRTLAMVTAGINFSHVIKNVKENDHTL
                     IQHGIYSIFRHPSYFGFFYWALGTQILLLNPVSFVLFMFLLYAFFSSRIPYEEAYLLK
                     FFGEQYKEYMAKSWIGIPFIYSSFGFKEKMKIDH"
     gene            complement(<662394..>668750)
                     /locus_tag="C5L36_0D03250"
                     /db_xref="GeneID:40385419"
     mRNA            complement(<662394..>668750)
                     /locus_tag="C5L36_0D03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467207.1"
                     /db_xref="GeneID:40385419"
     CDS             complement(662394..668750)
                     /locus_tag="C5L36_0D03250"
                     /inference="similar to AA sequence:RefSeq:NP_010697.3"
                     /note="PKUD0D03250; similar to Saccharomyces cerevisiae
                     YDR409W (SIZ1) and YOR156C (NFI1); ancestral locus
                     Anc_5.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323067.1"
                     /db_xref="GeneID:40385419"
                     /translation="MAHSIEKYLENIKSKNNVALFFAVKKLIDLSVNNDEIPLLFPVL
                     LEVEAEIKKTLNTPEVDISKVTFKKSLFYDLLHRVGNSEIFLESHERPTPKVKTFKFK
                     LDEKAIKLLTENPNCRVVFMSIKVDAFTTDKYIEFPSPCKFTVNDKDVIGNYKGIKGK
                     KSSVIPFDITPRVKLREENKVSVTYNFTKEDHLVAVYIIQGGKIEPLIQRVKHSPHIS
                     AETTLKMIKDDDMDEVSASKETLSILCPCSYVRMETPVRSIRCNHIQCFDLDSYIYLQ
                     SKAPTWLCPVCNHKIKYSHLAIDDYFDSIIKKIDSKYEFVEIQSDGSWAPQIDLDSRL
                     KPSKLPSSVKITKVNNQDVNIKEEEDVITNDIGKLIILDDKYGNQVEIVEDLVSNRGT
                     DHEFHAPIIEAPQKTLASTDTKVTIKPNIGITSPQNKPDPLVPVDASNIIEILSDDED
                     LSTQPVPFIHGNVAPQTQLSPDKETVTRSPTLPQNSNKQTHHHTGDAQDVPLIVPSIP
                     TSSSHNLLIESNHYLPQIAFNATTNHNVQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQCVPPHTRSGPLQAQTEKRSQDQPSLAKRNS
                     HIQEHVNSFHINCQGTPTPAQPVRSQNTRISTQIPTNTHSTKTSTPNPQDNDSTRTNK
                     TVINEEYEMISHTVNSLNAIMCRYMASDIKSRESILKSVYNDRQNNKPISEVTVSQYG
                     SLTRSIASYMAFAFEMSCSLLRQLSLREQSFCKSLDIDLREHLLALEKHSQVYNDYCT
                     RLLYNDISYRVQSAFLKCIDDLKTRFVKDTVSNRRKALAGIFLQLCGYLKDELMNKPY
                     SFFYKLAILRFSSLVSVDGIKFQISLDINNEEANKINNLAKKLREFDVNSYLKDHNLP
                     NNLETYETFTFTSNQSSTNTGSSNASSLYRDSSNKSNMFSNEPLATPPLSTKNQTVPG
                     PEIPCTPAISTTSDSHLTLNTVSESFLGLHQQQQMRVSENPNGLEQHHFRYTTHQQPT
                     RNHAQPRIQAPKITPEQIIEQQKKMAKTREFEATHRAGIEAKALEERKRAAEARRKAE
                     AEAKALEERKRAAEAEAEARRKAEAEAKALEERKRAAEAEAEAKALEERKRAAEARRK
                     AEAEAKALEERKRAAEAEAEAKALEERKRAAEARRKAEAEAKALEERKRAAEVEAEAR
                     RKAEAEAKALEERKRAAEAEAEARRKAEAEAKALEERKRAAEVEAEARRKAEAEAKAL
                     EERKKAAEVEAEARRKAEAEAKALEERKRAAEAEAEARRKAEAEAKALEERKRAAEAE
                     AEARRKAEAEAKALEERKRAAEARRKAEAEAKALEERKRAAEAEVEARRKAETETINK
                     AGSAESNIENQLKVQEELDKAKLVMPRARERKDNPYSTKDNVQSSVTIVDNSTASSLT
                     SGTTSNFKPIVASSSYSAVRADQIPFISDGEIVKQAINNKDSPVASLSKAFPNKRNQQ
                     QVRNDDKSNVAGLVSENRTMAVNAAQHTDQGIGSEQNEELRPAYSTKKTVDTNQSTST
                     IKLPVTVNGQPGTIIKPDQKMVSLHTENSSTIPQVKVSSNPIKPTKSSLSIKPVFGAP
                     VSNADQTSSLSSIPKDRQPNNHTKSLNVSSKRVSELAASLPYLANDENSSSLVALKKT
                     HMPAQSSEGTTERNIESISLKSSPIKNDAISFRHGTPPLKSNEEISFKSASVVLPAEH
                     RHSCPIAFKDAAHKQVSTQKSVQTIKPTGDNSTLYGEGAKTAEKNALPDDNIKPRQQG
                     NGHSAKKVNENASDKTNNTAKEKSTENGHEKSKNSVNANAEISGKIDKQSLLPIVNSK
                     ISSSSTSPPPKSIPDLSTKRIMKAKESSIIKKQQKHNELMSKIKGLEQVRGSHTYFKS
                     ENPIKKTETSDRVNRLIEKAKAEYAGRTTKLGVNNAEAKTMPTGGLLGFSLPKSMRSL
                     FREKIDSQKDTKKKGDDETHVTKRELRSGEKKSKSNKKQGEVPYGEAREDVTKAAAAS
                     AAEKEHLRKEKKRLKKERKMEKLKKEQKRLKRERSESSSNINKKRKLGLQPTVNFNNN
                     KESTDLLRMFRQSENYVKFTNKKQHANNKVSKVDTEFIDLTADD"
     gene            <669247..>670395
                     /locus_tag="C5L36_0D03260"
                     /db_xref="GeneID:40385420"
     mRNA            <669247..>670395
                     /locus_tag="C5L36_0D03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467208.1"
                     /db_xref="GeneID:40385420"
     CDS             669247..670395
                     /locus_tag="C5L36_0D03260"
                     /inference="similar to AA sequence:RefSeq:NP_013394.1"
                     /note="PKUD0D03260; similar to Saccharomyces cerevisiae
                     YLR291C (GCD7); ancestral locus Anc_6.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323068.1"
                     /db_xref="GeneID:40385420"
                     /translation="MASSASSASHVNNNTGGGASVAVANAIAAANKLEVLIESFVSKL
                     RRKQVSGSYNTAIATCKFLMRVTSISRWGTAAEFITLIHGIGKRINDSQPREFAVSNI
                     VRRVLAIVRDEVNVKEDGNPSAPVNTSMFQLLVTNKNDKDVEKNGGGKVNEKSDLRSV
                     IIQGIRDLMDEIQAVHENIAEMTLDLIHDNEILLTPTPGSSTVLNFLLKASTKRKFTV
                     LVAEAYPNDIEVCHGFAKKLAQAGIETVIIPDSTVFAVMSRVGKVLVGTRNVFVNGGC
                     VTAAGVATVCECAKEHRTPVFAVAGLYKFSPCYPFDRNSLIEVGNSGKVLSYDDSDLV
                     GKCEVTNPLYDYVIPDNIDIYITNIGGFSPNFIYRIILDNYSQEDTEL"
     gene            <670942..>671430
                     /locus_tag="C5L36_0D03270"
                     /db_xref="GeneID:40385421"
     mRNA            <670942..>671430
                     /locus_tag="C5L36_0D03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467209.1"
                     /db_xref="GeneID:40385421"
     CDS             670942..671430
                     /locus_tag="C5L36_0D03270"
                     /inference="similar to AA sequence:RefSeq:NP_015155.1"
                     /note="PKUD0D03270; similar to Saccharomyces cerevisiae
                     YPL170W (DAP1); ancestral locus Anc_8.701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323069.1"
                     /db_xref="GeneID:40385421"
                     /translation="METYVIIAVLSILVLVTLKNLLFSTVTQIELEKEIDPNAEPEET
                     TVIREFTPRELSNFNGFDLEKIYIAVKGNVYDVSKGRQFYGPSGPYSNFAGHDASRGL
                     ALNSFEMENIRRWDEPIDDLQGLNESELKSLDNWEGMFRGKYPCVGTLVPDPQFENKK
                     DV"
     gene            <671770..>672231
                     /locus_tag="C5L36_0D03280"
                     /db_xref="GeneID:40385422"
     mRNA            <671770..>672231
                     /locus_tag="C5L36_0D03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467210.1"
                     /db_xref="GeneID:40385422"
     CDS             671770..672231
                     /locus_tag="C5L36_0D03280"
                     /note="PKUD0D03280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323070.1"
                     /db_xref="GeneID:40385422"
                     /translation="MSVQTVALTANNLALLDRITAHPHSAEYLQSALNSGPLARYGYY
                     GEAPVGVLLLEPVEGKRGKNSTPVALKVALLCVLPAYRSTFGVEKTLLEYALETAKAR
                     HLSTIVFPVVKNNVDEIAEILADLKFSQCATCAGVNVTAHENEILFVRELE"
     gene            <672467..>673441
                     /locus_tag="C5L36_0D03290"
                     /db_xref="GeneID:40385423"
     mRNA            <672467..>673441
                     /locus_tag="C5L36_0D03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467211.1"
                     /db_xref="GeneID:40385423"
     CDS             672467..673441
                     /locus_tag="C5L36_0D03290"
                     /note="PKUD0D03290; Pfam Domains: PI-PLC-X(3.3e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323071.1"
                     /db_xref="GeneID:40385423"
                     /translation="MNCSSWMQKIPDDVNISSLSIPGTHNSAACFKFAPLSVQCQGKS
                     IKQQLLNGVRFLDMTLSKNFISRGAKVDDLIVVHGKFPVKLSGPYKFKSVLNDVYHFL
                     DKFPTETVLMSIRFENTMLHWDPKIDEFAKVLFERYIAHNRRRWYLSSKIPSLKYSRG
                     KIVLLRRFPVIENGVYQTFGISCTSECENSTSCIQECSSIKSQDDIQEKVSLIKGMIS
                     KASDYHSPSRRGSENSTFSNINSNSSHSLFDDLSNEKLPSPPPKLFINYCTGANYLKK
                     NYWPSKVDKRIREFNIEADFQKNCGIVIFDFADRDDWKLVRKLILSNF"
     gene            complement(673587..673668)
                     /locus_tag="C5L36_0Dtrna10S"
                     /db_xref="GeneID:40385770"
     tRNA            complement(673587..673668)
                     /locus_tag="C5L36_0Dtrna10S"
                     /product="tRNA-Ser"
                     /note="PKUD0Dtrna10S; codon recognized: AGC"
                     /db_xref="GeneID:40385770"
     gene            complement(<675327..>677207)
                     /locus_tag="C5L36_0D03300"
                     /db_xref="GeneID:40385424"
     mRNA            complement(<675327..>677207)
                     /locus_tag="C5L36_0D03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467212.1"
                     /db_xref="GeneID:40385424"
     CDS             complement(675327..677207)
                     /locus_tag="C5L36_0D03300"
                     /note="PKUD0D03300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323072.1"
                     /db_xref="GeneID:40385424"
                     /translation="MGNGRYYFHKNYLSVLNEPSNYKKDILRNFEKTSDDLITVNQFY
                     ILTYLTVSSLVDSKEKSAPVGQKESIIFMPSGVDKELSNYILQRDTYMTSTKTQLGFL
                     SDTVTSSILSLWAKLKIRNEGPIYLFIPIVEKVGGEDMCANVLFVDVTHGKSFLWDPF
                     SFFTDVADIKDLFNSDDELLAIGDLKKNIAVNYLLGNYLYEYQRENPVGIDYMDCSIF
                     SKEDFKVLLLKQSDLGSRFLIFPFVISSFIENVIEANKTMQGVIHTIRSKSERDELVK
                     FSHQLTQAYENLESKNKVVQHSDAIIFYPVDNDSTVDQNIVGPIVPTEVEVPGDSTPR
                     YLTCGPDGYFHLGFKFKIPENGNSKTYKTIPSEEGTPDHSIQSQSVPLLPIGNTAVVG
                     DNGDQIEDSVSPVNALLIEALNTVDRRTKESAKLKHHKIEDIFPVNINTTKEKLTEYY
                     ESTFKGSELENKALFSAIIDFDIGKFFEAYECAYNNKIVKEQYVMLYEVELMKSCRTS
                     AGYRKQYEHWLCDTLKIKPIDSKLFCKKRFNYLRGKLGAFKVEPVGQNFIHLVFKPNI
                     VKRIHTLHGLFYAWELLEPKFTDDSEPLMTIKEFLKMYENGKQILNLTCELLSCVRKT
                     LQ"
     gene            complement(<677484..>678788)
                     /locus_tag="C5L36_0D03305"
                     /db_xref="GeneID:40385425"
     mRNA            complement(<677484..>678788)
                     /locus_tag="C5L36_0D03305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467213.1"
                     /db_xref="GeneID:40385425"
     CDS             complement(677484..678788)
                     /locus_tag="C5L36_0D03305"
                     /note="PKUD0D03305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323073.1"
                     /db_xref="GeneID:40385425"
                     /translation="MKPALNPLHVKFSLTGDAVPNLIKSRSKDYNKKAHRNSILENNR
                     NDIRSQLMKFGARYTSVVKEAAHPKDTIVGIYEHLKIPKHGKGGEEEVPKSILLQDES
                     LRCKKTKENYKSIQWKSEFATSNLSKTSLQAKINFDNIIKDWISTNWLDPKPLIQQKP
                     CHILVHDKLLFQKISLFETVHELLMKRLVGLKIDDHVVKLSWNKEIAKAVSDKELLNH
                     QLGRILKDIIRSTYFPFAKVSDKYEKILNKITKDPNFIRLIISKLYKKVRYNDVIFDK
                     LKNVENLNERNDITIIKDKELNLLPPNEYMGLLKNINEKTQDPLKSYGILKYKSTTNK
                     LDDYENLKIMKNRLKSDSLHQNERFMFITNDRSTSLEYFRLLKLFNKTYASLGFKGCV
                     IYIDSQHAQKYKESVGTTEYTGKELYYVIENFQDIYSIIEVL"
     gene            complement(<679098..>681275)
                     /locus_tag="C5L36_0D03310"
                     /db_xref="GeneID:40385426"
     mRNA            complement(<679098..>681275)
                     /locus_tag="C5L36_0D03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467214.1"
                     /db_xref="GeneID:40385426"
     CDS             complement(679098..681275)
                     /locus_tag="C5L36_0D03310"
                     /inference="similar to AA sequence:RefSeq:NP_116578.3"
                     /note="PKUD0D03310; similar to Saccharomyces cerevisiae
                     YIL078W (THS1); ancestral locus Anc_7.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323074.1"
                     /db_xref="GeneID:40385426"
                     /translation="MSTEEVQKKVENLSVNEEKPAPAAAKPKKEKKEKKAKEGESSRP
                     VFLNPQPEFIDHRIKIFEQIKAKREAEIAAKERKPIKITLKDGTVKEGVSWETSPADI
                     AKEIGKSFSERQVISKVDGELWDLERPLEKDSQLEFLDFEHPEGKAVFWHSSAHVLGE
                     GCECHFGAHLCFGPPTEDGFFYDMAIDEGKTVVSQADFKNIEAACQKAIKDKQKFERL
                     VMTKEELLEMFNYNKYKQELIKSKIPDGTSSTVYRCGPLIDLCRGPHVPHTGRIKTFK
                     VLKNSASYFLGDANNDSLQRVYGVSFPDKQQMKDYLKFLEEAAARDHRKIGREQDLFF
                     FNEMSPGSCFWLPHGTRIYNTLVDMMREQYQIRGYQEVITPNMYNAKLWETSGHWANY
                     KENMFTFEVEKETFGLKPMNCPGHCLMFKSRERSYRELPWRVADFGVIHRNEYSGALS
                     GLTRVRRFQQDDAHIFCTQDQIGDEITGIFDFLKHVYGIFGFDFKMELSTRPEKYVGD
                     LETWNGAEAKLEEALNKWGGDWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQ
                     LPNRFELEFKGKEETNAVRPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVV
                     PVGVKYFEYAEEVQQKLHNAGFFADVDVTGNTLQKKVRNGQVQKYNFIFIVGEQESTE
                     KSVNIRNRDIQDLQGKNEAVSLDTVIAQLLKLKESKRADNKLE"
     gene            <681536..>682693
                     /locus_tag="C5L36_0D03320"
                     /db_xref="GeneID:40385427"
     mRNA            <681536..>682693
                     /locus_tag="C5L36_0D03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467215.1"
                     /db_xref="GeneID:40385427"
     CDS             681536..682693
                     /locus_tag="C5L36_0D03320"
                     /inference="similar to AA sequence:RefSeq:NP_010106.1"
                     /note="PKUD0D03320; similar to Saccharomyces cerevisiae
                     YDL175C (AIR2) and YIL079C (AIR1); ancestral locus
                     Anc_7.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323075.1"
                     /db_xref="GeneID:40385427"
                     /translation="MSTNNGTLVIEDDGDGIAEVSPARVIGDAEKLERLEKNLARAEE
                     MRKVGMNDQADIETEHSDATNHGDSNTKKKRSKGKSAKEGETVFAPSIDEVTTDNDHL
                     ASLRGEGRYFGVVDPDVSQPVCSNCHRRGHRRAQCKVVVCHACGKVDDHYETQCPNSM
                     VCSNCGQKGHFRNNCPSKRMQTYCVECDSRNHSSDRCPYIWRSYLVKPKDRKTKMAYP
                     TNQIFCYNCAEKGHYGDDCKQLRVSKTPNINGSAFSGANLPKELISQYNDTQNRNSGN
                     NNNRKRNYDTANNVNYNYAPPPYPRYNNYNNNNGNRSGNNNNYKNRNYNNNKYKNSNL
                     PSGPTKSGYLANKNNYGNQGRNNNYSNSNYNNQRNSNSYNSRSSYFNSRRY"
     gene            complement(<683208..>684878)
                     /locus_tag="C5L36_0D03330"
                     /db_xref="GeneID:40385428"
     mRNA            complement(<683208..>684878)
                     /locus_tag="C5L36_0D03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467216.1"
                     /db_xref="GeneID:40385428"
     CDS             complement(683208..684878)
                     /locus_tag="C5L36_0D03330"
                     /inference="similar to AA sequence:RefSeq:NP_011343.1"
                     /note="PKUD0D03330; similar to Saccharomyces cerevisiae
                     YGL172W (NUP49); ancestral locus Anc_8.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323076.1"
                     /db_xref="GeneID:40385428"
                     /translation="MFGGTSGGTGFSFGQNKPATGGFSFGNNNNNTANNTPSTGFSFG
                     NNNNNNSASNTGNNNSSGGFGFGGSNVGNNNSAGGFGTKPLGSTNTVGFGSTNTNTPN
                     SGGLFANANNNTNTTNLSNNSAGGTGFSFGGNSSVNNNALSGGLFGAKPSGTAATGST
                     NFSFGNNNAGTNTNTSISGGNFGFGNPSTSAATGGNVASGGLFGNKPSNSSAPASGGL
                     FGGANSNSATTNSATGSLFGGTSNTSNTNGGSLFGAKPSAPTGSTGVSLFGNNNASSS
                     FGFGSKPTVTNGTFGANGGTSLFGQQQQQNMSLQQPQAPQITAMTKVSDLPPALQEEL
                     KQLDAHIQTQVAIAEYLKDQEADHQELIVSVPRDISYLEKNYASTSQALTSDLKFVET
                     FKSKTLESFNDWVEKLIKVFLQLTNPMSNSGNDQNQDPGSLKVIIGVSSNRTASPQDQ
                     QQQQQQQKQQSSKETSINITSVLNSFFINKIEDFKENISRYELILQEVENCISDLENS
                     NSNNNQKAGLQMIVQTLQEEFKLYVELANEFAEIHHNISKLGDANQKF"
     gene            <685074..>689786
                     /locus_tag="C5L36_0D03340"
                     /db_xref="GeneID:40385429"
     mRNA            <685074..>689786
                     /locus_tag="C5L36_0D03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467217.1"
                     /db_xref="GeneID:40385429"
     CDS             685074..689786
                     /locus_tag="C5L36_0D03340"
                     /inference="similar to AA sequence:RefSeq:NP_011342.1"
                     /note="PKUD0D03340; similar to Saccharomyces cerevisiae
                     YGL173C (XRN1); ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323077.1"
                     /db_xref="GeneID:40385429"
                     /translation="MNNNCISPAISTGVPRVKDLVISSNFLAKRTSTASLLNMGIPKF
                     FRLISERWPLISQKISVPEEIEYDNLYLDMNSILHNCSHSNDGEISRLTDEQIFGAIF
                     AYIDYLFNLIKPKKVFYMAIDGVAPRAKMNQQRARRFRSAVEAEEALKKAIASGEPIP
                     KEPAFDTNAITPGTEFMARVTENLKFYINQKVSNDKQWQDIEIILSGHEVPGEGEHKI
                     MEYIRVQKAQENYNPNTRHCVYGLDADLIMLGLVAHEPHFSLLREEVTFGRNKQSSTD
                     VSKQTFFLLHISLVRDYLKEEFKNLSDEISFEYNFERVLDDLILILYVIGNDFLPNLP
                     DLHLNKGAFPLLLHSFKEAMRRSDGYLNEYGKINLKRLAIWLDILSVFELENFEEGDI
                     DVEWFNKQLDNVSRRGERRRERQGKELLIKQQKKVVGLIAAWLMKVYHENYNIKEFHL
                     DESKIPEIELPSDFFESEFNIQFIKKFAYDIGLFIVHSRSTNQYTAKLDIDGISPDET
                     EEELNKRLIDIKQTIRKYQSSVIVEDEETLQSEEALYNEKFENWKDNYYKEKLHFSIK
                     DTEELTKITENYIEGLQWVLNYYYTGICSWPWYYRYHYAPRISDLRYGLNVKFNFELG
                     KPFTPFEQLMSVLPERSKELIPITYRHLMTDDDSPIKDFYPDDCEIDKNGKSASWEAV
                     VLLSFVDEKRLKEAMAPLNDRLTKEEKKRNSFGLNLIFHFNPQVKTLIKSPLPSAFPD
                     FESHAIESVYRLPSMDGKSFIIGLSKNVKTGTHMIAGFPTIETIPHTSNLQKDELLIF
                     QQPARSESMILTLENEFESINPEQFAHLYCGKNIYANWPYLREYSVVYVTDGMMRYEL
                     AKVGGSFKVISSPLEKFEISEYESQIADINYAMHKKLGLRFSSGELSSEIIVESSNKE
                     QKFPKEPIEGLVYAKRVIGVTPNNKGKLVKVFSDKIDCFPIQIVVPTIENADPRFQEK
                     EMLPLEEEYPKGSPIIFLGKSAYGTPATVISTEKNTLAIQFARQETPEPTFGIAAAKV
                     EEENIKYRSAFDAAKILGLNTYFLSKITSTYMIYDTKEKKINVGLSLKFEGKGIKTLG
                     FTRKNGRGWEYSDLAINLIREYMSKFPDLITGLLRYKGHNIPLVTDIFPQKNIEELSS
                     LLREVKDYLLNKHESLNQVSLSSDSLSKFSIAKIEEQVINYMQTPQPVKTANVKNIPR
                     FAVLNPSVPVLKLKQQQFRLGDRVIYVLDSGKVPLFSKGTVIGYRSSDTSVSVHVLFD
                     LPILTGNSFDGRLKTQRGLSVDSSALLNLTLKQFIYVSKAATSKSKTNVTSRSQNGGS
                     NVPKKTPKPANKGKIPERQDGEAERLKAEKKNQSKKELLTIIKNTKEKGKFSPNAAHE
                     VKPDEKQEDALPATNGNAKKLLNKIVNNAIHSSNGNGQSAASPMPNYPMPIYPQMGPN
                     GMPFLPPFPMPMIPQQMMYPYMTQAPPMAVPGMPFSPSLQGQPAPDTAPQHQPRVDTD
                     TSEDVLNALKGNSKEIGDNYNAKTNSDHSSRGHKGGSKGGNRGSTRGHRGRNRGGHRG
                     GQRGCGSSAGDSQQKVTA"
     gene            complement(<689947..>690834)
                     /locus_tag="C5L36_0D03350"
                     /db_xref="GeneID:40385430"
     mRNA            complement(<689947..>690834)
                     /locus_tag="C5L36_0D03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467218.1"
                     /db_xref="GeneID:40385430"
     CDS             complement(689947..690834)
                     /locus_tag="C5L36_0D03350"
                     /inference="similar to AA sequence:RefSeq:NP_011341.3"
                     /note="PKUD0D03350; similar to Saccharomyces cerevisiae
                     YGL174W (BUD13); ancestral locus Anc_8.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323078.1"
                     /db_xref="GeneID:40385430"
                     /translation="MLQARFFFFFFEALLIPVSPEAEITEEKTKMRTPNSLEEYMKKK
                     YATRTMSEKRSLDIDQHETDDPNSKKKRLNQENKSSASRKIQSGETEVLDANDTTIQE
                     NTVARKPIGGLRSHEELVKEQELKEKKTKDELDLLKRQEVQRQAIERDPKSHKLTEYE
                     IKDLDKAKQKKLIEDEIKHRNRNEAGILEERKLQEKINEMKSVGLNNYENDEKLLSKQ
                     KEDIKSEDPALLFNKNVIQKHKKKLESKYVSISGRKLYKDESRYPPNRFNIKPGWRWD
                     GIIRGNGFEQKWFDRHTTK"
     gene            <690955..>691416
                     /locus_tag="C5L36_0D03360"
                     /db_xref="GeneID:40385431"
     mRNA            <690955..>691416
                     /locus_tag="C5L36_0D03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467219.1"
                     /db_xref="GeneID:40385431"
     CDS             690955..691416
                     /locus_tag="C5L36_0D03360"
                     /inference="similar to AA sequence:RefSeq:NP_012202.1"
                     /note="PKUD0D03360; similar to Saccharomyces cerevisiae
                     YIL062C (ARC15); ancestral locus Anc_7.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323079.1"
                     /db_xref="GeneID:40385431"
                     /translation="MSLEDWRRIDIDQYDADAQYVADELPEGNSTATVSDMQALSTKL
                     RGLIQRMDIGEAFKTSIEFAPYGAGEDVCDAFLRGVFEIFTNVKMNDIPNIVTSLDLD
                     VLDVVVKYIYTLMGKEFALKQSGLLLVWLDRIVDKVGEGPIIRYLSDPYKL"
     gene            <691686..>694523
                     /locus_tag="C5L36_0D03370"
                     /db_xref="GeneID:40385432"
     mRNA            <691686..>694523
                     /locus_tag="C5L36_0D03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467220.1"
                     /db_xref="GeneID:40385432"
     CDS             691686..694523
                     /locus_tag="C5L36_0D03370"
                     /inference="similar to AA sequence:RefSeq:NP_013215.1"
                     /note="PKUD0D03370; similar to Saccharomyces cerevisiae
                     YLR114C (AVL9); ancestral locus Anc_8.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323080.1"
                     /db_xref="GeneID:40385432"
                     /translation="MDTTGSPDPNSSSLDRQAENDVEEKVDPTSVDEASNTNTMFVVG
                     DSDGDADSNGNDTNEEGAKTVTETALSINTEDDHANNLAKVEDSTNGKSTDELSKDCR
                     VEESEVNKSIETAVNGEAEIVIEEEVTEPEIPEDNESSRHVDLVTNKTHETGNCVLEE
                     VEMKDSDIVEERPEKQILDSKAGELDMIQITETPQPEEKAEHLLTGPEEVQNSEMPKS
                     DNAWKDEEDIETNTDTEDQKEDILTQGPEAQKLFKESAGQIDENFERQEDIKEEDQTS
                     NAGMPNDSREEKHDIPLPPIYRYHRPASVESKLSALTKNFVFALAVVDFHHIHGPELT
                     HWLDKDGTLTNDEKVAKWREVWPFLAFQGLPDGVHMYDETFTHFTLRYDQLLERGVEL
                     SDEKIDIYKEGITSYASSGDNEEGKRSILEMEDPNQGTVTLFGCACIRQIESKKLNNE
                     EDIKRSIVQKSVLLITRAPLPIQMKEQLSIVTQAWFEQFNFKDIEILTSFYDTLDATY
                     NLNGYIIEHDEDEKLHLEGKKVIKESDFYMGLNFQACVEKLRRNLLLIFKALITGEKR
                     ILIFSKQLNDLSNIQYCLIGLVTNLLLNLGDCGFPFLDSTLFREIKKCQSMKSSDRCS
                     VMNFLGLPLNIFGLNNFFQPYMTLQQLEEIYNCNVKSFLIGTSNDIVLENKRELFDIV
                     VYLDERENGIFGSGGCKIEIFDNELKECGLTWDDKKFIDFIVESVIARKNGEDLNTRE
                     GDDDAFNGKTVNANTSIENGEYKGGNEFIRSQFEDYLIGFLSCIKYDNFLSNYKKHNQ
                     LNLDIYENDIARFGVKYVDMFTKSNVYKYWNLTTEDEFFNLFEPMHACRNIDVKKFKG
                     GEVIKGWFEKLKKQGELNKKEKEVEMVRDNGSSESNDIDDTGKIVEIVRDGEVVRDGE
                     VVRDGEVLHQDNNVIQGSAIQKKFRGFFGWK"
     gene            <694914..>696242
                     /locus_tag="C5L36_0D03380"
                     /db_xref="GeneID:40385433"
     mRNA            <694914..>696242
                     /locus_tag="C5L36_0D03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467221.1"
                     /db_xref="GeneID:40385433"
     CDS             694914..696242
                     /locus_tag="C5L36_0D03380"
                     /inference="similar to AA sequence:RefSeq:NP_009846.1"
                     /note="PKUD0D03380; similar to Saccharomyces cerevisiae
                     YBR287W; ancestral locus Anc_1.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323081.1"
                     /db_xref="GeneID:40385433"
                     /translation="MQPLNLPQLVLSTFNEARNGLSFQQISFLTFQAVVQVFIICLAG
                     YWAASSKLLTNEGTKVISKLNVDLFTPALIFSKLASSLSLKKLLEVILIPLLYAITTL
                     ISYLSSLLVSKWLELTEPESNFVTAMSVFGNSNSLPVSLTLALAYSLPDLEWDDIEDD
                     NPDKIASRGLIYLLIFQQLGQMLRWSWGYNKLLQRQPDHVIFYDTHRDVEDVEDSNLV
                     TDEDYLESGDINSHDDVVLSNEDGLLIANNEDKLDLEPLYKRIAQKVYGWMNPPLWSM
                     LLAIIVASIPKLKGEFYEYNGFIQHTLSSSIQQLGLVSIPLILVVLGANLAPSSDIPP
                     ACPHYKRMIIGSLLGRMVLPSFILLPIIVLCVKFIGLSIMQDPIFLITSFLLITSPPA
                     IQLSQICQLNELYQKEMAGVLFYGYAVLTLPVTIIVVVTSIEAMKWAQQT"
     gene            <696675..>697415
                     /locus_tag="C5L36_0D03390"
                     /db_xref="GeneID:40385434"
     mRNA            <696675..>697415
                     /locus_tag="C5L36_0D03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467222.1"
                     /db_xref="GeneID:40385434"
     CDS             696675..697415
                     /locus_tag="C5L36_0D03390"
                     /inference="similar to AA sequence:RefSeq:NP_012016.1"
                     /note="PKUD0D03390; similar to Saccharomyces cerevisiae
                     YHR146W (CRP1) and YNL173C (MDG1); ancestral locus
                     Anc_2.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323082.1"
                     /db_xref="GeneID:40385434"
                     /translation="MSSYTFTYPAKEGIEDVVVTGTFDNWSQSLPMIKRGKQWEIEVP
                     LSPKDGKIEFKFILNNGEWVISDEYWTVVDDSGNVNNYIELNRETNSWDGNKGGKTTK
                     TTKTEGVNSAYIPESGGLSAKIQSKETDNNASATVMPSTEGIQSTPLGEPGIVVPDTK
                     DPSVNAAFTEVSNVDAKALNAEMKAKEKSKSQSKSQSQNSDPEKVKYVKKVKKSTSPS
                     PRSPTEETPSTGTAKKQGLFSRMKNKLK"
     gene            <698309..>699265
                     /locus_tag="C5L36_0D03400"
                     /db_xref="GeneID:40385435"
     mRNA            <698309..>699265
                     /locus_tag="C5L36_0D03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467223.1"
                     /db_xref="GeneID:40385435"
     CDS             698309..699265
                     /locus_tag="C5L36_0D03400"
                     /inference="similar to AA sequence:RefSeq:NP_015347.1"
                     /note="PKUD0D03400; similar to Saccharomyces cerevisiae
                     YPR022C; ancestral locus Anc_8.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323083.1"
                     /db_xref="GeneID:40385435"
                     /translation="MGEKRFRLRNSPIASMVDVKDEDVIADTNESSSREPIRSAAAGK
                     LLKCEWNGCHLVFSDANLLYHHLCDDHIGRKCHKNLTLRCHWGDCQVSTVKRDHITSH
                     VRVHVPLKPYSCLHCTKRFKRPQDLKKHLKTHSNARLRHVHQQYLIDDINLGKCSGIR
                     LVPVSTSSLQHRHYPSSQQRSFSPQYPQYLQLDSPESHAQVLVPPHIPSQLQVQMDLQ
                     SQLHPPVQSQLQHQVHPQIQHQIHTQLQQQLQTQLHPPLQPQIQIQPYYSLQHIPVFY
                     HPPGQPPVQHINNFPALIQDRIVQQHQYTQLHTSHNPYATHM"
     gene            <699466..>699831
                     /locus_tag="C5L36_0D03410"
                     /db_xref="GeneID:40385436"
     mRNA            <699466..>699831
                     /locus_tag="C5L36_0D03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467224.1"
                     /db_xref="GeneID:40385436"
     CDS             699466..699831
                     /locus_tag="C5L36_0D03410"
                     /inference="similar to AA sequence:RefSeq:NP_116658.1"
                     /note="PKUD0D03410; similar to Saccharomyces cerevisiae
                     YFR003C (YPI1); ancestral locus Anc_8.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323084.1"
                     /db_xref="GeneID:40385436"
                     /translation="MPSHSTQGSSTQTQTQQDDEVPTLHLKVVHDKNKKKNKKKVEWS
                     DDVIDNEFLNKKKSKICCIFHPQNPEEYELQPSSDSDSSSESDSESDEDLGEGNAYER
                     QPKYSKKHTHNHDCHEHTH"
     gene            complement(<699867..>702680)
                     /locus_tag="C5L36_0D03420"
                     /db_xref="GeneID:40385437"
     mRNA            complement(<699867..>702680)
                     /locus_tag="C5L36_0D03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467225.1"
                     /db_xref="GeneID:40385437"
     CDS             complement(699867..702680)
                     /locus_tag="C5L36_0D03420"
                     /inference="similar to AA sequence:RefSeq:NP_116657.1"
                     /note="PKUD0D03420; similar to Saccharomyces cerevisiae
                     YFR002W (NIC96); ancestral locus Anc_8.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323085.1"
                     /db_xref="GeneID:40385437"
                     /translation="MASLVPLSAGNKGDGTTSTEKKKSSKLNDLVQTSRNLPKRLDDI
                     ETLHLSLNEIQKRAYNLRHYNKPNTETNLFTKAHYLLIGKGITIEDIEDDLNSLDSLI
                     KSNEYNKSLHKKSKYSDKDDLLKPSNLVNYMNRQKDEDVISTIENSLTAAAKDFDNFV
                     NNNIDLDWKHKKKELYEKLHTVIKREPSGAITTSSPEKKIKKYSQKELLERQLTWGVK
                     HSKSLISSIFNFDDISNTTSESAINPNVSYSLRKKFEIFAEVIYELNEARQSNSWYKL
                     ATVISSIYKSEINGNKSDQLHEAYVILREFCEAPEDSNDEGDQVDDNDRPSRFRKATN
                     SKLTDIESIKLRERIVLKSREYLETQFRDYINELYIMNKSTNLNEISAKNEDKFLIPN
                     VDRVINYIELTMRNKQKQWKIPNMTFINGLPLWAILFYLLRSGCYNEAIILISKYEDS
                     FQKLEKSFPYYLKSYCESKDKKLSEELQGRLQNEFNQYFKNSNQDIDPFRYAVYKIIG
                     KCDTAKKNLDNIQLSIEDWLWLHLTLIKEHEEDDIMNDNYRLVDLQKTVVEFGSESFN
                     ISSKNPMYLQTLLLVGLFEDAIKYWMQINEIDAIHLAVVLNYYGLIRISDVSKTSLLN
                     INSYGFKSINFGRMIGNYVKKFKFSDPRVASEYLFLLSINEDQLQICQDSIRELVLET
                     REYILLLGKITSDGVRIPGVIEERKSLLGLKDEKSYLYNITEKAAQIANEEGRLFDCI
                     LLYQLSEEYDIVLKIINKLLGDFLNSIDLVNHRGDLLNDDNVGDINIVRLSENILKIY
                     NSSPEILSQVAIQSRLNCEKLLDIYRIFRVFNEGKDYNKLLNEIKALELIPISADISL
                     SEIRRYLTEFEKLDENLMKNVPNLLIVEMMSLRELLSISDNSAKDEELKKIAKNSMIF
                     AGLIKYKMPREIYTILINFEISL"
     gene            complement(<702895..>704772)
                     /locus_tag="C5L36_0D03430"
                     /db_xref="GeneID:40385438"
     mRNA            complement(<702895..>704772)
                     /locus_tag="C5L36_0D03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467226.1"
                     /db_xref="GeneID:40385438"
     CDS             complement(702895..704772)
                     /locus_tag="C5L36_0D03430"
                     /inference="similar to AA sequence:RefSeq:NP_014848.1"
                     /note="PKUD0D03430; similar to Saccharomyces cerevisiae
                     YOR205C (GEP3); ancestral locus Anc_8.616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323086.1"
                     /db_xref="GeneID:40385438"
                     /translation="MISKTCISTSFIVRSSLSRYFASCLRLNSTKVTSTESELKNSAF
                     NYFKYDGLDNKAIPTLQSDLLEKQDDLREAYEEYQKIFSGFEKKELLHCKNCGIGPLQ
                     SHDPSKDTYFKKKNLDLTLKKSEDYGLPVKNQSELIDLLEIDTEGLEFENASKIEFDR
                     KVKQMREFCNYQVECERCAKLLHHGILDINGYKIEKIMEKIPKDATIVNVVSILDFPL
                     SCDREILKGRNPKDIIYVVTKSDIFYEKKVQADRTGEQYVKDTLSEYMDADPSKVFLV
                     SSQKAWNNKKLYTAFTKGDVYMVGRANAGKSRLLKSLLSISQDLKPTASMRKSKVETI
                     GGFSPSTYHIPGFTREFQKFKMRNGVTVYDTPGFFPEHLGIYGHLTEKTIRGKTEYPN
                     LTEPKRRTVTSLQIKNKKIFDGKNLYSYAGLFYLQPPEGVVFKRLIATNKRKLYGEHK
                     FSSMERAKELNVQRPKEFKEFYATTPEAMEDMDRYVIPPFYGKIDIVIQDLGFITIAP
                     TSSPKNTKSLFQIWVPKGVRVIIRESIFQFIYKVHDYKDETGNTLKKENVVKRGKPVL
                     RSIFDTEKLHFSELFPVDTKLKDEDAFSMVCPSGDAVPPQDRFMNHTKYKNQYWRRLQ
                     L"
     gene            complement(<705107..>709692)
                     /locus_tag="C5L36_0D03440"
                     /db_xref="GeneID:40385439"
     mRNA            complement(join(<705107..708960,709065..>709692))
                     /locus_tag="C5L36_0D03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467227.1"
                     /db_xref="GeneID:40385439"
     CDS             complement(join(705107..708960,709065..709692))
                     /locus_tag="C5L36_0D03440"
                     /inference="similar to AA sequence:RefSeq:NP_015267.1"
                     /note="PKUD0D03440; similar to Saccharomyces cerevisiae
                     YPL058C (PDR12); ancestral locus Anc_8.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323087.1"
                     /db_xref="GeneID:40385439"
                     /translation="MSDTHSIGSDSVDSVTNDIKQFNPNEDLEAQDNEERLSQHLSRI
                     LSTPEGISKVASLARVLSTKTKADLDHFEINPEDFDLKLLLKYLHERAYEQGIESAHS
                     GIAFKDLTCWGIDASAAYGPSVPEMCRDAFKWPSKFFKKDSSPQRQIIRNFMGTIEPG
                     ELVLALGKPGAGCSSLLKACAGEIENFTHVEGTFSYDGLDQEEMMQKYKGYIIYNPEL
                     DFHFPYITVKETIQFALRTKTPKKRVDNMKREEYVDNMLKLWCTVFGLTHTYSTRVGN
                     DFVRGVSGGERKRVSIVEALSMNASFYCFDNATRGLDASTALEFTQCLRTATNMLRCG
                     ALVAIYQAGQNIYELFDKVTVIYKGKQIYWGPAKDGVAYFEKMGYQKPNRMTAPEFLT
                     AVTSPSSRQIKPGYEDKVPDSAEDFEEYWQNSPEYAKLLAQYENFVSNHNAEETRARL
                     ALATSQRKQSGQRDKSIFVINYFQQLKYLVIRGFQRTKGDITYTLVYLSSFVTKGFVV
                     GSMYYHIPRSTVGAYSRGAMLFYCLLFCALTSLAEIANSFANRRILVKQKSYSMYHLS
                     AEALQEMITELPTKAIAVIILSLTAYWMPNMKHEAGAFFMFFLFLLTIQQCMSFIFKL
                     VATLTKDGTTAHAIGGLWVLMLCVYSGFMLPLPKMHHWIKWIHYLNPMFYCYNSLVGN
                     EFHGKTLECSKFVPSGPGYENLSLAHQICDLPGAIAGQDFVSGDAYILRHFDFRWHNV
                     WKYWGVNLCWTVGFIGLNVFMAEFVKNVEGGGDMLLFKRGHMPDTSGGEEWDGKVATR
                     EEMMLALNGPNADLDKIIAEADIFSWKNLDYIIPYEGATRQLLCSVQGYVKPGTMTAL
                     MGESGAGKTTLLNVLAQRINFGTITGDMLVNGRPLDSSFKRRTGYVQQQDLHMAEFSV
                     RESLKFAADLRQPKDVPQSEKYDYVEKIINCLGMDKYAEAMVGKIGRGLNVEQRKKLS
                     IATELVAKPSLLLFLDEPTSGLDSESSWSIVQFMRALADSGQAILCTIHQPSATLFEV
                     FDRLLLLKKGGKTVYFGDIGPNSSIMLDYFEKHSGVKCGVSENPAEYILNCIGAGATA
                     SAAQDWSELWNNSPECEKVTAEIEQLHRELPSRPVNNQVGDLTAKYATTYDQQFWFVL
                     KRTYLQFWRSPVYIRAKFLECVCCALFVGLSYVGFDHTVAGAQGAFSSVFMLLLISLA
                     MINQSHVYAIDSRELFEVRESLSNTFHWSCLLISHTFIEIFWSVLCQFVCYICYYWPA
                     QYSGNADKAGFFFFIYVLIFPIYFISYGLAILYFSPDVPSASMINSNLFASMLLFCGI
                     LNPKRWSPKFWSFMYVASPFTYFVQAFVGTILHDRELICAFDEYNIMDPPENQTCGDF
                     LSAYVEHNGGYIANPTEDTQCKYCPYTKQEQVVLQYGIKWNQHWRNFGIAWIYIIFNF
                     FAMCAGYYILRVRNFSISELFNVKKWFEKARVDRHEKDTTIFAPQAGDNKVLVAKKK"
     gene            complement(<710802..>711623)
                     /locus_tag="C5L36_0D03450"
                     /db_xref="GeneID:40385440"
     mRNA            complement(<710802..>711623)
                     /locus_tag="C5L36_0D03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467228.1"
                     /db_xref="GeneID:40385440"
     CDS             complement(710802..711623)
                     /locus_tag="C5L36_0D03450"
                     /inference="similar to AA sequence:RefSeq:NP_012803.1"
                     /note="PKUD0D03450; similar to Saccharomyces cerevisiae
                     YKL119C (VPH2); ancestral locus Anc_2.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323088.1"
                     /db_xref="GeneID:40385440"
                     /translation="MLEYKYGEKVELLIRESGIEKTKKDILLTSGKVTFKELLDVLAL
                     CDGESRNIMHYMAELTPLIGVHEERPPIPKSEEYKKLMKRLRMQDEEKKYRRYLSRNE
                     STLPTSVDSIGKYVFIPESERVHSSSAASMAKEVKHQLTTILNVFITCVSSGYAMWYW
                     SGSSLGLASDYAIRMLLSLVVAIIVLIAEVVVFGGYVRKVDEARERERASVERKTVVE
                     TVVIKSGESKRQRPKEKPAQNGKRESKTKTKTTTKINTKINTKINTKINTKTKPE"
     gene            <711843..>714353
                     /locus_tag="C5L36_0D03460"
                     /db_xref="GeneID:40385441"
     mRNA            <711843..>714353
                     /locus_tag="C5L36_0D03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467229.1"
                     /db_xref="GeneID:40385441"
     CDS             711843..714353
                     /locus_tag="C5L36_0D03460"
                     /inference="similar to AA sequence:RefSeq:NP_015317.1"
                     /note="PKUD0D03460; similar to Saccharomyces cerevisiae
                     YPL008W (CHL1); ancestral locus Anc_8.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323089.1"
                     /db_xref="GeneID:40385441"
                     /translation="MAQINTFNHPFEHPYQVQLDLMQEIYDTLKNGYKVGIFESPTGT
                     GKTLSLICSTMTWLREYKKMHNEGLIKDKLKSAEEDDDEEDEPEWVRQSFIDKIMSEY
                     VGEAKKYEEHLARVHDQGTSVIIDGNIGKKGNVKIYKKRKTEKLQNDETIDDLAPDDF
                     DILDDTTSKSGISRDVEFLLERFENKSKKYENKIHSTQINESKVKIFFVSRTHSQLSQ
                     FSSQLKLTTFPSSIDQLPGERIKYLPLGSRKQLCINESVSKLVDSQAINKACQNLQQS
                     TDENKKCQYMPNPFNEEHLHLKDKMNDLVMSDIRDIEDIHELGEQLRICPYYSTRADI
                     PIAEIISMPYQLLLHKDTRHILGLDLQNSVVVIDEAHNLLDTISRIYSTSVSLNDLKM
                     VRKALKLYTRKFMLKMSAGNRINIAKLNKIISKLYKFIEASNEKGIVTSGKTVDRDDI
                     FGDDVSELLNIYELETYLIKSKLAFKLESYMEKVVKVDGDELYKSSGQPILFGIKSFL
                     YSLSNPLKSGKFFWDKSENDLSLKYLLLDPSEDFKEIVEEAKCVILAGGTMEPVSEFT
                     DFLVPYLEKDKIHQFSCDHVIPDENLIVFPIGRYRNTEFEFSFQRRNNDFMITKLGES
                     FCELLREIPAGCVAFFPSYSYLSQVLESWRKSGVYETLDTVKKIFTESKDKSVDETLS
                     EFKQTIELDDNRKGAFLLSVVGGKLSEGINFSDDLARAVFMIGLPYPNAFSSDLIAKR
                     EYIEQKYLTNGKTESYAKRKSQEFYENLCMKAVNQSVGRAIRNINDYATIYLFDSRYG
                     NPRIVNKLSQWVKKRVLPMNTTNPVLETRAFFEKHAQR"
     gene            <714443..>715477
                     /locus_tag="C5L36_0D03470"
                     /db_xref="GeneID:40385442"
     mRNA            <714443..>715477
                     /locus_tag="C5L36_0D03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467230.1"
                     /db_xref="GeneID:40385442"
     CDS             714443..715477
                     /locus_tag="C5L36_0D03470"
                     /inference="similar to AA sequence:RefSeq:NP_010183.1"
                     /note="PKUD0D03470; similar to Saccharomyces cerevisiae
                     YDL100C (GET3); ancestral locus Anc_2.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323090.1"
                     /db_xref="GeneID:40385442"
                     /translation="MADLEVEPTLGDIVSHDTLKWVFVGGKGGVGKTTSSSSIAIQLA
                     LNNPQKNYLLISTDPAHNLSDAFDQKFGKDARVVEGLSNLSCMEIDPSSSMEEFNASN
                     KMGMDQNDPLNSVLSEVTSSIPGIDEAFSFMEVLKHIKNQKASENDTSIIKYDTIIFD
                     TAPTGHTLRFLQLPSTLEKLLGKFNEITGRMGSLLSMMGGDQKQEMFNKLGEIKEQVT
                     EVNKQFQDPELTTFVCVCISEFLSLYETERLIQDLMKYNMDVNTIIVNQLLFADEDEC
                     KRCQARWKMQKKYLDQMDELYEDYHLIKMPLLGNEIRGLPNLKKFSKFLLTPYNPATD
                     KDLVFSIEER"
     gene            <715700..>717229
                     /locus_tag="C5L36_0D03480"
                     /db_xref="GeneID:40385443"
     mRNA            <715700..>717229
                     /locus_tag="C5L36_0D03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467231.1"
                     /db_xref="GeneID:40385443"
     CDS             715700..717229
                     /locus_tag="C5L36_0D03480"
                     /inference="similar to AA sequence:RefSeq:NP_015205.1"
                     /note="PKUD0D03480; similar to Saccharomyces cerevisiae
                     YPL120W (VPS30); ancestral locus Anc_8.615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323091.1"
                     /db_xref="GeneID:40385443"
                     /translation="MGTPLHYCRSCNLPLELDDSLKSLTPAKENLLTLNYAEQPSPIR
                     IEKGEESSKSPIHDIPKIPQERVDLFKEAVQSNSGRRQAEETKYDISKYNPSTSTESV
                     EINSSSNKHSFVYLDDKQYNHSDFDHYSDEMLQNGNNSPNVVRPFRSEEIKDLVNKKS
                     NISERVESLEKIFNIISMKYEIDYPVCSDCANTLVQQMKHHYDTLNKEKDVYMKFLKK
                     LTSQNGPNVEKTNQSLNDLKKLGEEEEAILNKISEEDEKHLALNKEIEELELELQELN
                     TKEQIFVLEKNKFELEMQEKLDELDRVQNQYTHNMNIMDLIRSTDVFGTIFEISHSGK
                     FGTINGLRLGCLDDIKVTWHEINAALGQLALLIATCIHILNTELDGYRLIPMGSTSRI
                     EKFTKDLKSGKVVKSTIKLYSTGDFSIGGFFAHNNLDVGMVCLVAVMQQVADHIAKID
                     KTCKIPYMMAEDKVGGYCVRPSSRSGWESWTNSCRCLLTNARWILLFCITYYNEKLGC
                     A"
     gene            <717372..>719804
                     /locus_tag="C5L36_0D03490"
                     /db_xref="GeneID:40385444"
     mRNA            <717372..>719804
                     /locus_tag="C5L36_0D03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467232.1"
                     /db_xref="GeneID:40385444"
     CDS             717372..719804
                     /locus_tag="C5L36_0D03490"
                     /note="PKUD0D03490; Pfam Domains:
                     Ribonuc_red_lgC(6.3e-304)|Ribonuc_red_lgN(1.4e-26)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323092.1"
                     /db_xref="GeneID:40385444"
                     /translation="MTMEDVVTVLDHKGKNSVFKPDVLETFLISLSEGLATEFINIKE
                     IVEKVYLGLPNRITTDELVNLVAETLASLTTKHYHYSTLASRVLSTHMQKRLPAKFSE
                     NFKQLYEYKPINQQGKDSIISEKILNIVLENKDIIDGAIVKERDYDIDYFGFRTLENS
                     YFLRIDNTVSETPQFLFMRVALGIHGTDIDSAIETYELISKKYFIHASPTLFNASLRT
                     PFLSSCFLLAMKDDSIDGIYKTLYDTAMISRSAGGIGLHVSNIRASGTYINGSNGISS
                     GLIPMLKVFNSTAQYVDQGGNKRPGAFCIYLEPWHGDVFDFLNIRKNHGKEEMRARDL
                     FIALWIPDMFMEKVERDEDWCLFSQDSSPGLTECYGDEFNKLYVKYENDERFLRKVKA
                     RELWSAILIAQTETGNPFLLYKDRCNSLSNQKNLGVIKSSNLCCEIVEYSSPEETAVC
                     NLASIALPMFVNGNQFDFKKLHDMTKIVIRNLDRVIDVNAYPLENCKVSNIKNRPVGL
                     GVQGLADTFFKLRIPFGSPESRQLNIQIFETIYHGALEQSCKLAQEHGTYGTYDGSPM
                     SQGKLQYDLWGAKPTDLWDWKTLKRKIAKHGVRNSLLVALMPTASTSQIFGFTECFEP
                     ITSNIYLRRVLSGEHQVVNRYLVDDLVKLGLWNTDLKNQILLNRGSIQAIEGIPKEIK
                     SLYKTVWEISQKVVIDLAADRAPFIDQSQSMNLFIQDVSFSKLTSMHFYAWKKGLKTG
                     MYYLRTRAAANAIQFSLDLSTIKKRERELESDEAQKKQRGESNDLIHDIYNTDIVSCN
                     LKDPENCESCSA"
     gene            complement(<720798..>722129)
                     /locus_tag="C5L36_0D03500"
                     /db_xref="GeneID:40385445"
     mRNA            complement(<720798..>722129)
                     /locus_tag="C5L36_0D03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467233.1"
                     /db_xref="GeneID:40385445"
     CDS             complement(720798..722129)
                     /locus_tag="C5L36_0D03500"
                     /inference="similar to AA sequence:RefSeq:NP_015202.1"
                     /note="PKUD0D03500; similar to Saccharomyces cerevisiae
                     YPL123C (RNY1); ancestral locus Anc_8.621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323093.1"
                     /db_xref="GeneID:40385445"
                     /translation="MGHCCLLYYISPCLFLFLSYFFLAKTQLEKQRLTMNILRLLAFL
                     VASEAWVIPSQFKLETFMDTTPAVPFEIKECPLNLPFSCTNQTQIEDTCCFEYPGGVL
                     LQTQFWDYYPPVGPDDMFTLHGLWPDRCDGQYDQFCDSSMEISNVRKILTEHGQDGLL
                     EKMSKVWKNFNGNDESLWIHEFNKHGTCMSTIKSSCYSDDSKPNQNVVDFFQKSVELF
                     EELPTYQWLSENGIVPSLEQTYSKRQIEETLSARFGQPVFIKCNRYQALQEVWYFHHL
                     RGSIVTGDYQPIPALLGSQCPEDGIKFIPKKGFEPPKPTHTQPDGPKPTGKILRGVLK
                     PESSNGCLISNGNWYSSGTCARFTLLKAEFGGYNIKSSKGFCKIGNEGYLVCGRNVTP
                     MQFAYDKDKKWVTFGGKNKWSAEKEPTRFKQVPISPGYDGPIQFDLKLQAN"
     gene            complement(<722273..>724360)
                     /locus_tag="C5L36_0D03510"
                     /db_xref="GeneID:40385446"
     mRNA            complement(<722273..>724360)
                     /locus_tag="C5L36_0D03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467234.1"
                     /db_xref="GeneID:40385446"
     CDS             complement(722273..724360)
                     /locus_tag="C5L36_0D03510"
                     /inference="similar to AA sequence:RefSeq:NP_014849.3"
                     /note="PKUD0D03510; similar to Saccharomyces cerevisiae
                     YOR206W (NOC2); ancestral locus Anc_8.617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323094.1"
                     /db_xref="GeneID:40385446"
                     /translation="MAKVGKSTKKFQAKHLKHTIKERKRVQDHNKKIAQRKGGKKGST
                     PSVPVDKNQKNAEVFDDVNVEEFFDKEEKIPEMKKKAAVAEESEEESSGEEEDKDLDM
                     DALAKEDPEFYKYLKDNDKDLLEFKAVNPLDAISDEEDDDEEGDEDENQDAEASASKQ
                     ASESVEARKAIVVDTKLVKKWQEDLKSDTPSIKTLKNVVIAYKAAIKPDSRDEHKYAV
                     TDEKVFKNLMFVVLQDFPLAVQKYTPFKVSSNGIRNISGNKKKIAQVSSIIKVHIPSL
                     LTLLSDASNTETCALVLQSVQELLPYLISFRKLLKAIVNSIVDIWSSSSSLETQISAF
                     AWMNNACKEYPKSVLEIVLRATYSYFLKNCGKTNAHTVPLLNFQKNSAAELYSLNPTL
                     GYQVGFEFIRQLALHLRGSVNNPTKDSYKAIYNWKFTHGLDFWSRVISVQSTLEEKEN
                     PLKQLIYPLVQVTIGTIKLIPTAQFFPLRFYLVRSLIRLSQHTGVYIPLFPLLSEVLH
                     SSMFSRGPKRENLPAVDFECNIKVNKQYLNTRVFVDGVCEELVELLGEYFVLYAKSVA
                     FPELTTPPLIFLRRFIKKNSAAKHNVKFNRQLTTLIDKLTANAKYIEKHRATIEYGPK
                     NKVAVSKFLQEISWDKTPLGAYVATQRLVKEEKLKLLRESMEEDGKNSKNMKTAFDSD
                     KDIEMSDASQDDD"
     gene            <724662..>725777
                     /locus_tag="C5L36_0D03520"
                     /db_xref="GeneID:40385447"
     mRNA            <724662..>725777
                     /locus_tag="C5L36_0D03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467235.1"
                     /db_xref="GeneID:40385447"
     CDS             724662..725777
                     /locus_tag="C5L36_0D03520"
                     /inference="similar to AA sequence:RefSeq:NP_015204.1"
                     /note="PKUD0D03520; similar to Saccharomyces cerevisiae
                     YPL121C (MEI5); ancestral locus Anc_8.618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323095.1"
                     /db_xref="GeneID:40385447"
                     /translation="MPTHDLSDTCCGGSNEKTKEPLSPSRTTVSEHESSYAAQQELYG
                     EIRSAPTKHTVDTQLPKISEKLVFPKQRKRPNSMDTIRTPKYSPKLKRPSTCGKEGVR
                     NFSTPTPLKVKLIDTQIPLLSPNAESGHDEHTDVNTSLDSVNLSFDSSLDTPTVNRNR
                     VTSPLSVRSFSTPLLDLRSNDEKKTQVQIKLNQISAKENLEEKERQLRRDILKYQNEV
                     NTMKQVKKYRASQESDKLEDLIVKWRDIAERASNYMLNEAKLKIDRMGGVDEFRKRQK
                     KSKLRKMKFEFDENLLYRIEEYMESEEYKNLDTYDQEEIKSKRREMQAMSEKLERGEI
                     PLGDEDQESEDDNESNEFTMKDLYKQLKLDYRLVYGK"
     gene            complement(<725942..>729409)
                     /locus_tag="C5L36_0D03530"
                     /db_xref="GeneID:40385448"
     mRNA            complement(<725942..>729409)
                     /locus_tag="C5L36_0D03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467236.1"
                     /db_xref="GeneID:40385448"
     CDS             complement(725942..729409)
                     /locus_tag="C5L36_0D03530"
                     /inference="similar to AA sequence:RefSeq:NP_014850.1"
                     /note="PKUD0D03530; similar to Saccharomyces cerevisiae
                     YOR207C (RET1); ancestral locus Anc_8.619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323096.1"
                     /db_xref="GeneID:40385448"
                     /translation="MTISVKREREEGIDNDAFDELLEPMYKGKSLTDPINTAEDKWNL
                     LPAFLKVKGLVKQHLDSYNYFVDVDLKKIIRANEKVLSDVDPDFYLKYLDIRVGYKSK
                     ADPKQIEVQFPPHECRLRDMTYGAPIYVDVEYTRGRKIIIHRDLEIGRMPIMLRSNKC
                     VLNGRTENEMAYLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADDKKSIVQAS
                     VTSSTHERKSKTYVVTKNDKIYLKHNSISEEVPIVIVLKAAGIVSDLEILQLVCGDDS
                     VYQDIFAINFEEASKLGVYTQREALEYIGRKVKTIRRLNAPKLSVLQEGIEAIASTLI
                     AHLSVENLDFREKALYIAIMTRRVVMTMHNPKLVDDRDYVGNKRLELAGQLMSLLFED
                     LFKKFNNDFKMNLDKILKKPSRASEFDALLHINIHSNNITTGLNRAISTGNWSLKRFK
                     MERAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGE
                     ACGLVKNLALMTHITTDDEETPIRKLCYILGAENINIADSSTLHRNGTFGVYLNGTLI
                     ATTRFPNKFVKTFRFLRRTGKVSAFVSIYTNVHQNAVHIAADGGRICRPLIIVENGES
                     KVKEDHLRKLKNGDWEFDDFLVNGLVEYLDVNEENDSLIALYENDIIMATTHLEIEPF
                     TVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFRRIDTLLYTMCYPQQPMV
                     KSKTIELIQYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCQVFRKNTAI
                     LKRYPNQSKDILAGMRVNEDGEPIWQHTPLGPDGLGEVGMRIQSGQIYVNKCVPTNAS
                     ESVLGGPQQQQQQPQQTHRDQPMTYRAPEPSYIDQVMMSVSDNDQALIKVLLRQTRRP
                     ELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGVCPDIIMNPHGFPSRMTVGKMLELVSG
                     KAGVLDGSLQYGTCFGGSKLEDMSKILVDKGFNYSGKDMLYSGITGECLQAYIFFGPI
                     YYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLL
                     ERLMLSSDAFDVDVCNSCGLMGYNGWCPTCKTSENIIKMTIPYAAKLLFQELISMNIA
                     PRLKLGDVF"
     gene            <729685..>731478
                     /locus_tag="C5L36_0D03540"
                     /db_xref="GeneID:40385449"
     mRNA            <729685..>731478
                     /locus_tag="C5L36_0D03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467237.1"
                     /db_xref="GeneID:40385449"
     CDS             729685..731478
                     /locus_tag="C5L36_0D03540"
                     /inference="similar to AA sequence:RefSeq:NP_015203.1"
                     /note="PKUD0D03540; similar to Saccharomyces cerevisiae
                     YPL122C (TFB2); ancestral locus Anc_8.620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323097.1"
                     /db_xref="GeneID:40385449"
                     /translation="MVRNEDNGTADLFKSTINEYLDNLPESVHQQLFQSRETCLAIFR
                     LLPSLSKFYIMSLLFHDGNVPYSDLNRWIKANKSDVKGYQNPTKIYQNDSIKRLKSLH
                     ILKEIKRQMIHPITKQPTMITFVQLNETFRQSFRDSLTGFLPGSNKENQDQIMLASET
                     TTINEGDKEGSDIKTLFDDDADSGGKITIDYLDKYCFAKWENILHFMVGTEIKDIPSV
                     EVLTLLRYSGLMELPSDRERRELANGDIDEDDDLTYEDVKSSMNINTLRELKITKNGF
                     QFLLQEISSQIWTLLIQYLILAEKRDMNPVEVLNFIFLMGSLQLGQGYDIKMLSRTQL
                     IMLDELHNYGLIYHRAKSNVFYPTRLATSLTSENSTFKSASNAIDQEIQQRQQEQQQQ
                     QQQRGEKISNSNKGSIIIETNFKLYCYTNSPLQIAILNLFVNLRTRFSNMVTGVITRE
                     SIRHALSNGITANQIINYLETHAHSGMVELAETEYNKKYEFESSIGNTTAIEQLRLEI
                     LPPTVVDQIKLWQLEMDRVEPFKGFLYKDFNNEFEFEKLLNYGEEIGVIIWKDRNKRK
                     FFVSEDGNPQLIDYANKIVRNGTASRNATPL"
     gene            complement(<731557..>733593)
                     /locus_tag="C5L36_0D03550"
                     /db_xref="GeneID:40385450"
     mRNA            complement(<731557..>733593)
                     /locus_tag="C5L36_0D03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467238.1"
                     /db_xref="GeneID:40385450"
     CDS             complement(731557..733593)
                     /locus_tag="C5L36_0D03550"
                     /inference="similar to AA sequence:RefSeq:NP_014897.1"
                     /note="PKUD0D03550; similar to Saccharomyces cerevisiae
                     YOR254C (SEC63); ancestral locus Anc_8.698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323098.1"
                     /db_xref="GeneID:40385450"
                     /translation="MSQSHYEYDTNNETWPVFLLTAIAVPLLPYTYSCLRDGLFSSRH
                     QPLKDAKSTSESSFNPYNSTHLLKFRSSQRKSRFWKWSTLFLLASWIVVLSLIYKIRS
                     THYTVSESNFDPWKILGISESDSEKVIKTAYRKLSLKFHPDKIDTSNMSPEEIDLVDS
                     SYVLINKAYKALTDESVRENFLKYGNPDGPNEIKHGIALPEFLINGKASPLLVLVYIL
                     LISIILPLIVGNWWYGVKSKTKNDIHVNTAHHFMKIMMNASPTKLLLVDDILHFISHA
                     VEFKQLDDSFTPNDVYNYLKSFIDRTPSKNEKLRLKVVSLAPKLLVAFIEISAAFKNT
                     DYTLKLVDAHRCIIQALNIEKNAVHYKFKEILQLPGVENLNINKNDPLNSNVLTLGKL
                     LKKPNCDLNTYLQKSKDTDLDQILDYASKIPLIEPLETSFKVPGEKVISPNSSTNLSL
                     KFLIKSPRHSSKPSVDKLSKFVIDNELHELETLENLKDPLEFVNKQPLISLPSIPPFF
                     PDLEYIESNSGWLALLVSQRDNKIVEIPKLLNKADLSNLYLSNDDFLSSKAHVSTFKI
                     QLQSPAPKEPGVYHFRLIIRNLIYFGSDIDIPVSMEVKENPTVDSDVYGIEDPNEDSI
                     AGAMATLRGEPVKRFENEYESSDDEDDDDHSDTDSVDLWTDLDTDTEVEEDTLK"
     gene            <734109..>734648
                     /locus_tag="C5L36_0D03560"
                     /db_xref="GeneID:40385451"
     mRNA            <734109..>734648
                     /locus_tag="C5L36_0D03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467239.1"
                     /db_xref="GeneID:40385451"
     CDS             734109..734648
                     /locus_tag="C5L36_0D03560"
                     /inference="similar to AA sequence:RefSeq:NP_010866.1"
                     /note="PKUD0D03560; similar to Saccharomyces cerevisiae
                     YEL048C (TCA17); ancestral locus Anc_1.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323099.1"
                     /db_xref="GeneID:40385451"
                     /translation="MEKQDGLEMQIKFIALISRDNQPVCIETCLGNDNDNGNGNGNGN
                     GSDCLNEELKYNFLSHMALDALECAESPTTTTTTTTSTPAGAGSTSPRTMPALLFIED
                     GVSVYGNVSAAGFKVVIGATNTTCTGTTSSSHLRRLSDAAARARRVYIDWASNPFSLY
                     EPTEGAVLSEKLRAIIREC"
     gene            complement(<734807..>735172)
                     /locus_tag="C5L36_0D03570"
                     /db_xref="GeneID:40385452"
     mRNA            complement(<734807..>735172)
                     /locus_tag="C5L36_0D03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467240.1"
                     /db_xref="GeneID:40385452"
     CDS             complement(734807..735172)
                     /locus_tag="C5L36_0D03570"
                     /inference="similar to AA sequence:RefSeq:NP_010870.1"
                     /note="PKUD0D03570; similar to Saccharomyces cerevisiae
                     YEL044W (IES6); ancestral locus Anc_1.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323100.1"
                     /db_xref="GeneID:40385452"
                     /translation="MDTTLEEYMTVYATASGFKRPHPQRRHRYKGARLIINDEMRRVN
                     SLPAATRPSTTYMSIAAPPSLRPPRKYCDITGLPAHYTAPHNQIRYFDSECYQLVKNM
                     PPGVDQQYLSLRGANVILK"
     gene            complement(<735397..>736221)
                     /locus_tag="C5L36_0D03580"
                     /db_xref="GeneID:40385453"
     mRNA            complement(<735397..>736221)
                     /locus_tag="C5L36_0D03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467241.1"
                     /db_xref="GeneID:40385453"
     CDS             complement(735397..736221)
                     /locus_tag="C5L36_0D03580"
                     /note="PKUD0D03580; Pfam Domains: adh_short(9.6e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323101.1"
                     /db_xref="GeneID:40385453"
                     /translation="MSVPTFRLTNELTVVTGASGGIAHALVETLLVYGAPLALVDRNM
                     EALHRTRDAMVRFCVEEANIKEEDVPKMECFTCNIGDAGEVETLFGEIYNVFQRYPLH
                     MVNCAGYCENFAAVDYPAQNAHDLMGVNLLGAFYLSQCFAKPLIEHNISGGSIVLIAS
                     MSGKIVNTPQNQCIYNASKAGVIHLAKSLAAEWGALMHPIRVNTLSPGYTATPLTRNV
                     VSGDASLAAEWTRRVPLGRMAHPREMAGAVLFLLANDASSYTTGEDVLVDGGYSVW"
     gene            <737089..>737715
                     /locus_tag="C5L36_0D03590"
                     /db_xref="GeneID:40385454"
     mRNA            <737089..>737715
                     /locus_tag="C5L36_0D03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467242.1"
                     /db_xref="GeneID:40385454"
     CDS             737089..737715
                     /locus_tag="C5L36_0D03590"
                     /inference="similar to AA sequence:RefSeq:NP_012009.1"
                     /note="PKUD0D03590; similar to Saccharomyces cerevisiae
                     YHR140W; ancestral locus Anc_2.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323102.1"
                     /db_xref="GeneID:40385454"
                     /translation="MAVSALILSISFLVSSISALNTLAALPLPDELKHAGQYQFLTNI
                     ALSLSTAYAAINIYHSLTGKASTLKEYSSATVLPLNFIVSLVYWSLRICFTNLIIADN
                     VEKYIPLSLDLKIHLLPLLYTALDYFLLMDPWSIDSKTAYIIVSSLAILYWAWLHLLM
                     DESSSYPYPFLNVSTGNRILIFVLISLIAFATFLSAKRLHPARKLKNF"
     gene            <738067..>739527
                     /locus_tag="C5L36_0D03600"
                     /db_xref="GeneID:40385455"
     mRNA            <738067..>739527
                     /locus_tag="C5L36_0D03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467243.1"
                     /db_xref="GeneID:40385455"
     CDS             738067..739527
                     /locus_tag="C5L36_0D03600"
                     /inference="similar to AA sequence:RefSeq:NP_012000.1"
                     /note="PKUD0D03600; similar to Saccharomyces cerevisiae
                     YHR132C (ECM14); ancestral locus Anc_2.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323103.1"
                     /db_xref="GeneID:40385455"
                     /translation="MRFSNLLTLFSLSGPQSPLSNNGNTYNHISSFIQEIETFESTKF
                     TASPANNDSLYWLKTPTEPPISLSQYEFQYVLRLSDWNDQPDFLLTAMEYAKALNTSI
                     WATSLSNNFIDIQLSKDQGVQLLSLLSEYSFKSKISIIDLPQTIFETYPQSSLVDDSH
                     SDFGTNTELFFKTYRDLDSIYSWYELLVATYPEILKLEYIGNTFEGRPMIALRLSTHS
                     NLDPSDSIKTVVITGGIHSREWISVSTSCYILYSLLKDYDNGSPLVREYLNNLDFLFL
                     PLMNPDGYAFTWKSERLWRKNKQQTYNPRCRGIDIDHSFDFHFTSDLESPCSDDYSGN
                     APFEALESLNWDRYLNETKHSHPIYAYIDLHSYAQEVLYPYAYSCDILPRDEENLLEL
                     AYGLSQAIRLKSGKYYNVLKACQDKGADFLPNMGAGSALDYMYHNKAYWAFILKLRDS
                     GTHGFLLPPKYIVPTGEEIYSSIKYFASFLLKDDGN"
     gene            complement(<739589..>740791)
                     /locus_tag="C5L36_0D03610"
                     /db_xref="GeneID:40385456"
     mRNA            complement(<739589..>740791)
                     /locus_tag="C5L36_0D03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467244.1"
                     /db_xref="GeneID:40385456"
     CDS             complement(739589..740791)
                     /locus_tag="C5L36_0D03610"
                     /note="PKUD0D03610; Pfam Domains: Arginase(4.7e-91)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323104.1"
                     /db_xref="GeneID:40385456"
                     /translation="MKFVTLFSIVNAISVECASLQFFDYQGEFIPYQQDILKSGSYDS
                     DGFKDATLEEKWGQEWAFDGIPTFAHLNHTRCLLDDQVSFDIGIIGIPFDTATTYRSG
                     ARFGPRAIRDASQRQSSMRSFNQRAGLNPYLDWAKFLDCGDMPITPMDNTIALKQMTF
                     GFEELILKRENVDKFNGHKTPKLIALGGDHSITLPHLRSLKQVYGQIAVIHFDAHIDT
                     WSPKAFPNYWSSNQSDFNHGSMLWMAHNEGLISNNSNVHIGLRTKLMGTDWNDYEDDT
                     RQGWTRYSGDDVWINGREGLDNMIEEIHHRIGDLPTFISLDVDCMDPAFTPGTGTIEP
                     GGMLPREVIYLLRRFDLNIVGADVVEVAPVYDNAEVTSTNAAQVVYEIATNMVLRGKR
                     EKKEEEVA"
     gene            <741312..>742397
                     /locus_tag="C5L36_0D03620"
                     /db_xref="GeneID:40385457"
     mRNA            join(<741312..741315,741634..>742397)
                     /locus_tag="C5L36_0D03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467245.1"
                     /db_xref="GeneID:40385457"
     CDS             join(741312..741315,741634..742397)
                     /locus_tag="C5L36_0D03620"
                     /inference="similar to AA sequence:RefSeq:NP_012246.1"
                     /note="PKUD0D03620; similar to Saccharomyces cerevisiae
                     YIL018W (RPL2B) and YFR031C-A (RPL2A); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323105.1"
                     /db_xref="GeneID:40385457"
                     /translation="MGRVIRNQRKGAGSIFTAHTRLRKGAAKLRTLDYAERHGYIRGV
                     VKQIIHDPGRGAPLAKVAFRDPYRFKQREETFIANEGVYTGQFIYCGKSASLNIGNVL
                     PLGSLPEGTIVSNVEEKVGDRGALGRTSGNYVIIIGHNPEENKTRVKLPSGAKKIISS
                     DARGVIGVVAGGGRIDKPLLKAGRAFHKFKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSNNKNDD"
     gene            complement(<742566..>743647)
                     /locus_tag="C5L36_0D03625"
                     /db_xref="GeneID:40385458"
     mRNA            complement(join(<742566..743465,743555..>743647))
                     /locus_tag="C5L36_0D03625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467246.1"
                     /db_xref="GeneID:40385458"
     CDS             complement(join(742566..743465,743555..743647))
                     /locus_tag="C5L36_0D03625"
                     /note="PKUD0D03625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323106.1"
                     /db_xref="GeneID:40385458"
                     /translation="MSSQSVAISEDCIRVVNEDLVGNLAGDLDSMTIKEEQLETARDE
                     SKSVCPSANGKGVENLRDNKGVAPSANEDVYKKSKRKFSRKKHLKKKRTISINLTNSN
                     DTNEAPAKVNVSNKIQEDKGKVDQKVLSLVEDSVEDEETVKDAATSKKITKEKKSKGK
                     KRFNWKKQTIFPYNGRIINGIIYPDNSPILLSRSFSGSTFTRKNSNFIPVNSNHMALP
                     YESALDVVPEHSYRNNINVRLPSFNGVFHYKPKEKNPTNPNYSLGMNECYYGRNPFPN
                     VQNYESIKPRDAEGEKVLEKLQIDATEKNKIDSITLSLTQDNTSSTSINTITAN"
     gene            complement(<743900..>744091)
                     /locus_tag="C5L36_0D03630"
                     /db_xref="GeneID:40385459"
     mRNA            complement(<743900..>744091)
                     /locus_tag="C5L36_0D03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467247.1"
                     /db_xref="GeneID:40385459"
     CDS             complement(743900..744091)
                     /locus_tag="C5L36_0D03630"
                     /inference="similar to AA sequence:RefSeq:NP_116690.3"
                     /note="PKUD0D03630; similar to Saccharomyces cerevisiae
                     YFR032C-A (RPL29); ancestral locus Anc_7.189; intron in 5'
                     UTR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323107.1"
                     /db_xref="GeneID:40385459"
                     /translation="MSKSKNHTAHNQTKKAHKNGIKKPKTHRYPSLKGVDAKFRRNHR
                     WALHGTAKALAAKKAAAAN"
     gene            complement(<744988..>746389)
                     /locus_tag="C5L36_0D03640"
                     /db_xref="GeneID:40385460"
     mRNA            complement(join(<744988..745764,746387..>746389))
                     /locus_tag="C5L36_0D03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467248.1"
                     /db_xref="GeneID:40385460"
     CDS             complement(join(744988..745764,746387..746389))
                     /locus_tag="C5L36_0D03640"
                     /inference="similar to AA sequence:RefSeq:NP_011830.1"
                     /note="PKUD0D03640; similar to Saccharomyces cerevisiae
                     YHL033C (RPL8A) and YLL045C (RPL8B); ancestral locus
                     Anc_4.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323108.1"
                     /db_xref="GeneID:40385460"
                     /translation="MPAKKVAPAPLATKNSKKVVSKNPLFESTPKNFGLGQAVQPKRN
                     LSRFVKWPEYVRLQRQKKILNLRLKVPPAIAQFSNVLDKNTAAATFKLLNKYRPETTA
                     EKKERLTKEAAAIAEGKKKEDVSEKPYVVKYGLNHVVGLIENKKAKLVLIANDVDPIE
                     LVVFLPALCHKMGVPYAIVKGKARLGTLVHQKTATVAALVDVKSEDEAELAKLVSTIN
                     ANYTEKYDESKRHWGGGIMGAKAQAKMAKRAKAAAASASTK"
     gene            <746741..>748018
                     /locus_tag="C5L36_0D03650"
                     /db_xref="GeneID:40385461"
     mRNA            <746741..>748018
                     /locus_tag="C5L36_0D03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467249.1"
                     /db_xref="GeneID:40385461"
     CDS             746741..748018
                     /locus_tag="C5L36_0D03650"
                     /inference="similar to AA sequence:RefSeq:NP_009896.2"
                     /note="PKUD0D03650; similar to Saccharomyces cerevisiae
                     YCL034W (LSB5); ancestral locus Anc_1.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323109.1"
                     /db_xref="GeneID:40385461"
                     /translation="MGLFKSHPSTAVTEIINGCCSRGEIDDDFLLESQLSSLIDAIKS
                     QKDFVEPGAVEAARALRKKMKYGDVKEQIIALKLLDLLVINGVRAKFMQPLFNDEKLL
                     DRLEFYVNDKQNFSSGTTASYGRAGEPNFQIKHRAVCKLAKNLMAQWYDEFNDFESMR
                     NFNQIFERNIKKKSLAYNDFEEGTTSYRSRINDEVPDYMNDEADMDFEFDTFESNKPK
                     TNAELDRKFKIPKINYEKEAPKILQLIAEANIMATNLMNILNSLEKDELSIHSIRAND
                     AFDQCRSIRRKVLRYLQLVQKEELLGPLLKCNDDLVASLQKYEAKSIPGGAKVQQSED
                     DDDDYDSLADYESDNEPSDRYVREEPPSVTHSESTSSTSTFTKRAPPPVPRKSNNLRS
                     SYQDPQEQIHARPKLSDFDPFSDDNEVAPSPAW"
     gene            <748262..>748756
                     /locus_tag="C5L36_0D03655"
                     /db_xref="GeneID:40385462"
     mRNA            <748262..>748756
                     /locus_tag="C5L36_0D03655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467250.1"
                     /db_xref="GeneID:40385462"
     CDS             748262..748756
                     /locus_tag="C5L36_0D03655"
                     /inference="similar to AA sequence:RefSeq:NP_014940.4"
                     /note="PKUD0D03655; similar to Saccharomyces cerevisiae
                     YOR297C (TIM18); ancestral locus Anc_8.767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323110.1"
                     /db_xref="GeneID:40385462"
                     /translation="MFARLVRPSVISQPSWSCTRNLSLKPRLPKLPSFKLTPDPPGNI
                     IGTVNDAHVPPKFDISHGSYHWMYERIITVGMAPLVVFPFVAGVDYPLIDAGLCTLVL
                     LHSRYGLQSCIIDYIPLRKFGFWHKLAMFLLNIGSFVSLYGIYIIETENNGLADLISK
                     LWHT"
     gene            complement(<748847..>751225)
                     /locus_tag="C5L36_0D03660"
                     /db_xref="GeneID:40385463"
     mRNA            complement(<748847..>751225)
                     /locus_tag="C5L36_0D03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467251.1"
                     /db_xref="GeneID:40385463"
     CDS             complement(748847..751225)
                     /locus_tag="C5L36_0D03660"
                     /inference="similar to AA sequence:RefSeq:NP_012647.1"
                     /note="PKUD0D03660; similar to Saccharomyces cerevisiae
                     YJR113C (RSM7); ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323111.1"
                     /db_xref="GeneID:40385463"
                     /translation="MPLVTKREGCCLYITIQGSNMLSRSSTAAIRARVCRPGAVRLNS
                     TAGKPSKKSEKPFYNTFAEFVRTSKLNSEGAFIHEIPTEQQYEHSELAKYLKKVDSEK
                     ESLIDAKLKELAQESGIPFEQVKEKFERKLKEKQELLKSRNQEVVSKIENFMTQLSLP
                     MSGPQSIIIDLIDTLGESVDELNSFAAFEYIYELDPDFAKALSNVLRVTPTEESVKAM
                     SDAFKEGPMSKLSDEQYNELKQLLDTKAKVTKSTENEAEVAEKETVEEEEEGEIDANS
                     VVEVIFAHLNSYENIANSPLLKVIESIDSDFATMLKSYETIDPSDSDALENKFEEIVK
                     YCSNTDSSIYKAFGDSTSPNFTRVQEVLEGPIPIDLAEIYEVFEFYPDYFKSELYKQI
                     STIDPQFAQLLEKLESLPEGKELDEVNDEVDAHLINKESPIYKAMNDVESEDYAKLKS
                     TLESEWNVIETTVTPDKLVEYVISNGLESDGFKLIQKIDPGFADVLAKIYQEDNEEGA
                     LKAYTALQNYLENENEIMGALQDKDSLNYKLLADYVFPEAPEANEQEDDVAEIETSQR
                     ADVIQRDEVLSQLANEDKSKLTPEVVKINEAYDLTLEIMKEIEDELKDNTFIPVSRQV
                     SAKLDKMLGFQPSVEQVTASENLRSIPQPKQTDEVLELAVNIIMKDGKKEIARKNLNR
                     ALYLLFLETRSNPVEKLKEALDIVAPLVITKTVKTGFAKNYTVPVPLTQRQRNRMALL
                     WILKASDSKASNDFSVRLCDEVLHVLSGKSALMEKRVLNHKMAIANRSYLSI"
     gene            complement(<751411..>752967)
                     /locus_tag="C5L36_0D03670"
                     /db_xref="GeneID:40385464"
     mRNA            complement(<751411..>752967)
                     /locus_tag="C5L36_0D03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467252.1"
                     /db_xref="GeneID:40385464"
     CDS             complement(751411..752967)
                     /locus_tag="C5L36_0D03670"
                     /note="PKUD0D03670; Pfam Domains: Ammonium_transp(1e-95)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323112.1"
                     /db_xref="GeneID:40385464"
                     /translation="MVHVYLTEACMCVDIDIDIDIYNVHLPQLSPQDSCQGSHSRLEL
                     IVIHLPSNTSSIMAANALANDTSTLNMVDTAYELFCTVGVMILTPAIGMFYGGTLKRK
                     NIIQILMQSYLVTAVISLQWFFLGYSLAVSTSSSHVMGNLSLGAIPNLGMGPYFEGGT
                     IPSIVYFTFSAFFPIATVQIFVGAIAERSRLLPSLILGFLWTTVVYCPLAYSTWNGNG
                     WLLNLGALDFAGGGPVHIASGITSLTYSYFIGPRKVWKNKGAEHEPENTIITFIGVSF
                     IWFSWLCFNSGTLGAVNVRTGYILTNTQLAASAAMVSFVAVDYAFTRKWSLIAACEGA
                     VSGLVNITPSCGFYTPYWAVITSIFVGAVCRLCYNFNEASHIDDTTRSFVIHGIGGIL
                     GSICLGVFASPTIAATDGATVIEGGWIYHHWKQMGYQFAGWVSISVWSAGATYILCFI
                     IDKIPGCQMRADDEIENIGTDIFEMAERDPLCFLSLDRNTNNDIEVGSSGELKNNEEK
                     GKLGVAVYEV"
     gene            complement(<753145..>753567)
                     /locus_tag="C5L36_0D03680"
                     /db_xref="GeneID:40385465"
     mRNA            complement(<753145..>753567)
                     /locus_tag="C5L36_0D03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467253.1"
                     /db_xref="GeneID:40385465"
     CDS             complement(753145..753567)
                     /locus_tag="C5L36_0D03680"
                     /inference="similar to AA sequence:RefSeq:NP_015494.1"
                     /note="PKUD0D03680; similar to Saccharomyces cerevisiae
                     YPR168W (NUT2); ancestral locus Anc_7.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323113.1"
                     /db_xref="GeneID:40385465"
                     /translation="MSTEHGFQPSEPQHAVQTALAELIETFAHMGVQVHDFQGTPDAL
                     KGLAHNINGALTKIAQLQGQVDPTVLIPADVVQYVVDGRNPDVYTREFVEAVRRLTQH
                     LRGKRAAFHHFQHVLRDKMESEFPELKVDLDNLVENGV"
     gene            <753922..>755034
                     /locus_tag="C5L36_0D03690"
                     /db_xref="GeneID:40385466"
     mRNA            <753922..>755034
                     /locus_tag="C5L36_0D03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467254.1"
                     /db_xref="GeneID:40385466"
     CDS             753922..755034
                     /locus_tag="C5L36_0D03690"
                     /inference="similar to AA sequence:RefSeq:NP_015493.1"
                     /note="PKUD0D03690; similar to Saccharomyces cerevisiae
                     YPR167C (MET16); ancestral locus Anc_7.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323114.1"
                     /db_xref="GeneID:40385466"
                     /translation="MDNRDTLRCRDSGEPSDKGKLMSTVADNCSMRRRGKISVANESE
                     KSNGNGNGNGNGNGNGNGNGNGNGNGNGNTSENEDSVYVQFSNFVPVLLLIAVLLLII
                     NVWFVKDSVDKSDMTRKTLSIDPELLAHWNSTLANLKPEEIINWAVLTFPGLYQTTAF
                     GLSGLCIIDMISKLPHATENVDLVFIDTLYHFPQTLELVEKVKNKYPEFKLHVYKPFG
                     CDSEEEFVAKHGDSLWERDELKYDYLVKVEPLKRAYEDLQIKAVFTGRRQSQGANRST
                     LPIIEIDDTLHIIKINPLATWTFDDVYCYIQENNVPYNELLDLGYKSVGDWHSTSPVA
                     EGEDERAGRWKGRAKTECGIHVVGEYKEYMDKKIVG"
     gene            <755661..>756254
                     /locus_tag="C5L36_0D03700"
                     /db_xref="GeneID:40385467"
     mRNA            <755661..>756254
                     /locus_tag="C5L36_0D03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467255.1"
                     /db_xref="GeneID:40385467"
     CDS             755661..756254
                     /locus_tag="C5L36_0D03700"
                     /inference="similar to AA sequence:RefSeq:NP_015491.1"
                     /note="PKUD0D03700; similar to Saccharomyces cerevisiae
                     YPR165W (RHO1); ancestral locus Anc_7.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323115.1"
                     /db_xref="GeneID:40385467"
                     /translation="MVGIADVRKKLVIVGDGACGKTCLLIVFSKGAFPEMYVPTVFEN
                     YVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNIILICFSVDSPDTLDNVQEKW
                     ISEVLHFCQGVPIILVGCKIDLRNDPETINRLSAAGQQPVSTSEGQEVADKIRAITYM
                     ECSAKLNQGVREVFEAATRAALETKEKETKKKKCTIL"
     gene            <756737..>758023
                     /locus_tag="C5L36_0D03710"
                     /db_xref="GeneID:40385468"
     mRNA            <756737..>758023
                     /locus_tag="C5L36_0D03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467256.1"
                     /db_xref="GeneID:40385468"
     CDS             756737..758023
                     /locus_tag="C5L36_0D03710"
                     /inference="similar to AA sequence:RefSeq:NP_012974.1"
                     /note="PKUD0D03710; similar to Saccharomyces cerevisiae
                     YKR048C (NAP1); ancestral locus Anc_1.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323116.1"
                     /db_xref="GeneID:40385468"
                     /translation="MPSFNDAPTPQNTPASAAGSYMPKNASLDIPSTISENSELLKGM
                     LANNPALLASIQAKLGELVGVDSGYFSSLPKKAKEGVYVLKTLQEKQYVIEAEFQADL
                     LELERKYADKYKAIYEDRKKIVNGEVELKKEDIEHGKAVLEEELGDEEEEDGDENGNG
                     NGNGNGNGNEDEDDAKENANVKGVPFFWLTAMQNLPPVADMISDRDVPVLEHLVDLRM
                     EYMDKPGFKLIFEFSPNEYFKNKQIVKTYYYQKELGYTGEFVYDHAEGNEIQWTDNKH
                     NVTVEIELRKQRNKHTKQVRTIEKTTPTYSFFNFFSPPSLPGNAANGDEGDEDDEFEE
                     VDEELEAALQNDYSVGELIKEKLIPRAVDWFTGHALQFEPDFQQEEEEEGFDDEYDDD
                     DDDEGVSDGGAGHDEDGDDDDDGDDEPEQKPECKQQ"
     gene            complement(<758070..>759128)
                     /locus_tag="C5L36_0D03720"
                     /db_xref="GeneID:40385469"
     mRNA            complement(<758070..>759128)
                     /locus_tag="C5L36_0D03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467257.1"
                     /db_xref="GeneID:40385469"
     CDS             complement(758070..759128)
                     /locus_tag="C5L36_0D03720"
                     /note="PKUD0D03720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323117.1"
                     /db_xref="GeneID:40385469"
                     /translation="MISAIFILDNELETIVSRVYREDVSRTIISVFASKIHKETHLRN
                     PILTIGSTSFIHWKSNQLWYVVVTRHNSDAAYILTFLESFVSNLESLVGPGNDSIIIN
                     KFPIYQILDKIIDHGFVVTLDLKKVVEELDLRITKSLEGGYKKGYTFTEVCDIGRAEV
                     DISNVGEGWILLEVVEHLCNDGDGIFGEIMAISKKPAVIKLHIETEKYASVISNFNLD
                     NIELEEDVTPVLNYQIPDFGEFVLLTGARERLDKDTSRVRVRVSTKAPLQNVVLKIPS
                     SDGCKEIAREQIDKSWAVEETINDSDNVTKLPVILEFMLDKGISGFKVNFDDRDSSSM
                     KGVRYKTKGKFELFLNEN"
     gene            <760146..>760343
                     /locus_tag="C5L36_0D03730"
                     /db_xref="GeneID:40385470"
     mRNA            <760146..>760343
                     /locus_tag="C5L36_0D03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467258.1"
                     /db_xref="GeneID:40385470"
     CDS             760146..760343
                     /locus_tag="C5L36_0D03730"
                     /inference="similar to AA sequence:RefSeq:NP_075208.1"
                     /note="PKUD0D03730; similar to Saccharomyces cerevisiae
                     YDL085C-A; ancestral locus Anc_2.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323118.1"
                     /db_xref="GeneID:40385470"
                     /translation="MARGNQRELARQKNLKKQQEQSKGKKTDYLKRKETDAEISRQKQ
                     KLADERKAAEAAAALAAKMKK"
     gene            complement(<760526..>761752)
                     /locus_tag="C5L36_0D03740"
                     /db_xref="GeneID:40385471"
     mRNA            complement(<760526..>761752)
                     /locus_tag="C5L36_0D03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467259.1"
                     /db_xref="GeneID:40385471"
     CDS             complement(760526..761752)
                     /locus_tag="C5L36_0D03740"
                     /inference="similar to AA sequence:RefSeq:NP_013866.1"
                     /note="PKUD0D03740; similar to Saccharomyces cerevisiae
                     YMR146C (TIF34); ancestral locus Anc_2.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323119.1"
                     /db_xref="GeneID:40385471"
                     /translation="MVHGRDSKIFQFGDSNSIQYRLDEECKKVKTLFRRAVEKRETYR
                     HTESRKESDMSNKLMRPIQLKGHERPITQVKYNREGDLIFSTAKDHHICVWYSANGER
                     LGTYHGHRGTVWSVEVDNTTTYILTASADLSGKLWSAETGECIQTWNFESPVKRVELS
                     PDNKKLFFLTDNVMGQMGKIQIFNIDLSKGGNQETEPVLSIVNQGDASTKVTIATWSY
                     DGKYILAGHADGSISKYDSQTGEELAHSTPFKNQVTDLQTSSDKTYFVASSKDQTAKL
                     FDVESWKQLKEYSSGSPVNAALITPVKDFIILGGGQDARDVTTTSGSEGGFDAKIFHK
                     IFEDEIGRIKGHFGPLNCLSIHPDGTSYVSGGEDGFIRLHHLPKSYFEFQYEVEKTAE
                     ALQHQSANAENVEASA"
     gene            <761855..>764749
                     /locus_tag="C5L36_0D03750"
                     /db_xref="GeneID:40385472"
     mRNA            <761855..>764749
                     /locus_tag="C5L36_0D03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467260.1"
                     /db_xref="GeneID:40385472"
     CDS             761855..764749
                     /locus_tag="C5L36_0D03750"
                     /inference="similar to AA sequence:RefSeq:NP_015309.1"
                     /note="PKUD0D03750; similar to Saccharomyces cerevisiae
                     YPL016W (SWI1); ancestral locus Anc_8.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323120.1"
                     /db_xref="GeneID:40385472"
                     /translation="MQQGNGGNQLWNMQAQLQESYPGTNNGTPNSVTNSHHGSVTSTG
                     TNTGLGMGMSIMNGYSTPDMSSQMQDTNNQVRQQQIFQQLQMQKQSQQQQQQQQQLHQ
                     VHATSQIPQQQQQQQQQQKPVPQMNLQNTEKFLDLVEHYMKKINRPFERYPVVNGVRI
                     NLFVYYYMVSYVGGFVKAYQEQKFPLIAKQLGIPANNQPVFNEFLQCYYVNLRPFEQY
                     AKTSESLNDPQRRVMLQQQQQQQQQFQAQAQPRPQIPQKTQVPQNTGRPPIPGQVPQA
                     PQIKNTSSHQEQLHQHQIHLQQKFQEAQHKTLLQQQQLLQKKATKNSPTQYSQASTPH
                     DVPQSPHVPINKANKITKPPLKTAKSRVSSINEEKIVTVFVKGNRKPDVIKNYTPYTT
                     THDRPGGLDILNIERVGEQLDDMKPVFLYFPELGKVDIKALSLGLLSGISAEINVALN
                     VLLIISSDPNTHIPFEHCKILLDSLSLLGKKVIGKLWNFKYKSHLSESTKKLGKNMDY
                     VKPKSRIDKIFEKYSRQFGDEDYTIEVNAFTSQEISSTKPDPPHLHPNRYDDKMNDKM
                     NDNSSPPTSLNQSIINVESVKGFKIPSYLSMLHKCRKQADSISMNIYQKSYFDQEVVL
                     VEELSTISLIFRNFSFVSNNNLYLARNPKYMEFLYTVIFATITKPEIFKFERKRLSLM
                     KDALIVLSNIIHAIDIESELEVWLVFSLAYSFSSESSELRKPTNMTTSKYIPSVHRYH
                     PHSVDIMSKLLCTSYANREKVADLLTGKVRDEHIIKMVGLNFGDDYLETGSLFKAVFS
                     LFVSILPTDQMYQGVEIFNEMYQTCLQSLLGCLVLTEFLDEAPGFKRNIALDFLLSEE
                     RFGPILQHLSFVYTAVNLNLRAQASEENSLISAYAAELANSLTECAIQHAVANENVNE
                     DLQKLRNIPRLFGALENQCGILVSPSAACNVTEQIIKTLKIKHKLETLLK"
     gene            complement(<764807..>767659)
                     /locus_tag="C5L36_0D03760"
                     /db_xref="GeneID:40385473"
     mRNA            complement(<764807..>767659)
                     /locus_tag="C5L36_0D03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467261.1"
                     /db_xref="GeneID:40385473"
     CDS             complement(764807..767659)
                     /locus_tag="C5L36_0D03760"
                     /inference="similar to AA sequence:RefSeq:NP_015303.1"
                     /note="PKUD0D03760; similar to Saccharomyces cerevisiae
                     YPL022W (RAD1); ancestral locus Anc_8.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323121.1"
                     /db_xref="GeneID:40385473"
                     /translation="MAGETALIGKTLEINLSLLLKFQENIVIDFVEHDGLLILGKGLG
                     VNHIVANLLHVLMHSVGGNSKKRSLIMLINATEQENNTIEEELLELSWNSSTGNLNSI
                     PNPVDNKSIDIFSSILGDAGTVDKRRKLYANGGIISVSNRVLVTDILSHVIEPENITG
                     LVILHAENISQYSMDRFVVNLYRRTNKWGFVKAISDNPEKCCRDFQPLATKMKYFKVD
                     KSYLWPRFHVRVTESIQRLSKKKGATSEKITVTEVRIKMTDYMQKIQNSLMASIETLL
                     GELRRNNPDIASDRWSMEYALDQNFVQSIVAAMNPVWHRVSITTKKLISEITTLKQFL
                     EDLYKLDSVSFYHNIKNYIDEHRMSLNQKESLWLMIPESTATIACSTDRVFRKIGTKE
                     GNTQKKYLLEELPKWEQLLFILDEINDEKRLKDSSDDGPIVIGCSSRRICCQLEKVMH
                     SYRIQQLKKTRCYSFKRIMESELKYQQWKKSSGSIMRRMNEELKKVKSNSNIADEVTV
                     SKTFTRASTRNSDRRRTRGGSVMARHNRLLNLTTEVVDEGDKDLENSDVDKLNSYGEE
                     LNDTADFKGMKLDAIEDSPVHLEVEKMSCAFIERADEIIISTFDTIDLEEIMPSYIIC
                     YEPDLTFVRNIELYQVSLKPSKCFFMYYGESVEEQMYLNSIKYEKDAFTKLIREKANM
                     PKFFNTADDEKIRFDGNSRNLNSQTRIAGGSTVTVKSNKIIVDSREFNSQLPFVCFLA
                     DIEIIPAMLTVGDYILSDEICVERKAVRDLIESLENGRLMKQCENMFKWYKKPVLLIE
                     FEEGKSFSFDPFTTGYLTRNSSKSVSNYELEQLQLRIAALIASFPKLSIIWSSSPFET
                     AKIFKELKAVSKEPNLDYSLAAGTGDLISGSRFNEDALNFLRSIPGITEANSLLIINK
                     VQSLYEFCQMSEEDIGAIIGRENAKKVFDFLDAKYN"
     gene            <767852..>769867
                     /locus_tag="C5L36_0D03770"
                     /db_xref="GeneID:40385474"
     mRNA            <767852..>769867
                     /locus_tag="C5L36_0D03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467262.1"
                     /db_xref="GeneID:40385474"
     CDS             767852..769867
                     /locus_tag="C5L36_0D03770"
                     /inference="similar to AA sequence:RefSeq:NP_015302.1"
                     /note="PKUD0D03770; similar to Saccharomyces cerevisiae
                     YPL023C (MET12); ancestral locus Anc_8.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323122.1"
                     /db_xref="GeneID:40385474"
                     /translation="MNISSISVGKWAYPVCFFSFLFSGVISTKLKAMSVKITDKIASL
                     GKDEPFFSLEFFPPKTESGMRNLYARLGRMSLLGPLFVTVTWGAGGTTAEKTTDLAVT
                     CQEELGLTTCMHLTCTNTPKSVIDDALKKAKASGIRNILALRGDPARDTSISHGIGEF
                     KYAVDLVRYIREQYGDYFCIGVAGYPEGHADGSFEELTQDPRKDMPFLVEKIKAGADF
                     IITQLFFDVDKFADFEALVRSQPELRDTVIIPGLLPINGYNIFQRASKLSHASIPSKL
                     LAKFPTEVQNDDDVVKDIGVDVLVDIIDQIYKKTDNRVKGIHFYTLNLEKSIAQIVNK
                     SDHLYKVVAKKESEIEADESSSDDDIDDAITTAKRAAYANRFNTTNKVISDIKASTSL
                     KMQHSNSSSSQLKKLISISAGHGVLGKDATWDDFPNGRFGDSRSPAYGEIDGYGPSLK
                     VTSTKAYELWGYPKTKKDISKLFVNYLLKKLNCLPWSELSLSPETALIQEELINLNEL
                     YYFTVASQPAVNCASSQDKIIGWGPSNGYIYQKAFVEMFVSKKDWNEKLLPKISKCGS
                     SVSYYYADSKNYFDTNLPPNASNCVTWGVFPNREIVQTTIIEEESFKAWTEEAFEIWK
                     EWKLLYKKDSDSAKLIDTILNEYYLVTIIHHEYPNESALWELLLDDE"
     gene            complement(<769945..>770589)
                     /locus_tag="C5L36_0D03780"
                     /db_xref="GeneID:40385475"
     mRNA            complement(<769945..>770589)
                     /locus_tag="C5L36_0D03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467263.1"
                     /db_xref="GeneID:40385475"
     CDS             complement(769945..770589)
                     /locus_tag="C5L36_0D03780"
                     /inference="similar to AA sequence:RefSeq:NP_015301.1"
                     /note="PKUD0D03780; similar to Saccharomyces cerevisiae
                     YPL024W (RMI1); ancestral locus Anc_8.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323123.1"
                     /db_xref="GeneID:40385475"
                     /translation="MSNFIFQDIHKERELLIFHSSQLVFKNALVPYRHCLAEPTPSEK
                     LQQDTLFQIVDVRDTSVSVLSLIEDLTVIVNANESFQDHSKFATKAPRVPRVAVTEVD
                     VNETEDDSLMNDDSAVSSNHIYRLTLQDCFGNTCYAYENEPLGFLRGERSKGIFRVQL
                     GSKLFVRKNARVSFNALHLKNEDVKFLNGFIKELNYKLYERKLKELKEEINYEG"
     gene            complement(770710..770782)
                     /locus_tag="C5L36_0Dtrna9A"
                     /db_xref="GeneID:40385792"
     tRNA            complement(770710..770782)
                     /locus_tag="C5L36_0Dtrna9A"
                     /product="tRNA-Ala"
                     /note="PKUD0Dtrna9A; codon recognized: GCA"
                     /db_xref="GeneID:40385792"
     gene            complement(770795..770868)
                     /locus_tag="C5L36_0Dtrna7I"
                     /db_xref="GeneID:40385785"
     tRNA            complement(770795..770868)
                     /locus_tag="C5L36_0Dtrna7I"
                     /product="tRNA-Ile"
                     /note="PKUD0Dtrna7I; codon recognized: AUU"
                     /db_xref="GeneID:40385785"
     gene            complement(<772518..>773603)
                     /locus_tag="C5L36_0D03790"
                     /db_xref="GeneID:40385476"
     mRNA            complement(<772518..>773603)
                     /locus_tag="C5L36_0D03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467264.1"
                     /db_xref="GeneID:40385476"
     CDS             complement(772518..773603)
                     /locus_tag="C5L36_0D03790"
                     /inference="similar to AA sequence:RefSeq:NP_010531.1"
                     /note="PKUD0D03790; similar to Saccharomyces cerevisiae
                     YDR245W (MNN10); ancestral locus Anc_8.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323124.1"
                     /db_xref="GeneID:40385476"
                     /translation="MQSSSSLSGDSGIMDIEKEYNYNDATSLTPNKTFKSKYHTSFLG
                     RTKHKISNAFRNKSLGCLSLTLFVLGIIVCGTILTCNAFRGPKNSKIVIILAVNDGGG
                     VERWKTPEEWSVERSSIANKKAYADKHGYQLTLKDTKLKRRYSHEWREGWEKADILKQ
                     TMREYPHAEWFWYLDLYTFIMEPELKLEDYILKNIEKNAYRNVEHFNPLKIEVDSPYV
                     NTKNEPVNLIVAQDCGGFNLGSFFIKRSPWSDFFLDAWWDPVLYEQMHMIWEHKEQDC
                     LEVLYDYQPWIRERLAFVPLKAINAFPNGACWEQRDDPRFFYNQNDRDFLVNMAGCNY
                     GDRSCWGEYEHFKALKEKLHRPWYKFW"
     gene            complement(<773822..>775516)
                     /locus_tag="C5L36_0D03800"
                     /db_xref="GeneID:40385477"
     mRNA            complement(<773822..>775516)
                     /locus_tag="C5L36_0D03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467265.1"
                     /db_xref="GeneID:40385477"
     CDS             complement(773822..775516)
                     /locus_tag="C5L36_0D03800"
                     /inference="similar to AA sequence:RefSeq:NP_010530.1"
                     /note="PKUD0D03800; similar to Saccharomyces cerevisiae
                     YDR244W (PEX5); ancestral locus Anc_8.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323125.1"
                     /db_xref="GeneID:40385477"
                     /translation="MSFLGGSDCAAGANPLAQLSKRADFDTSLENSIRNSSAQIGGIP
                     RQNGVHNDIMMNQQNLQMLNSFMDQGSSLDRADAFNFRPLAHEISQMGHYQQGRQQEQ
                     QQQHHQSQSLDHAMSGSSSWTAEFAKGNAQMGLPQQFIQGVSVEQNASNGIAHTLQRN
                     HHVPMVTARMPAQLFQMGDPVQRWRLEQSGDQVNINTQNQSQEQNVHVDWENQFKELE
                     QEVQNDIIVEDDFKSPLDVNSDIKNPFLGFNEKYHDDYHFEENNEFLHNPNAYQIGCK
                     LMEGGAKLSEAALAFEAAVQEDPKHVDAWLKLGQVQIQNEKELHGITALENCLLLDNK
                     NLTALMSLAISYVNEGYDNAAYKTFENWIETKYPDVVAKARLENPNDTSDDRYSLNKR
                     ITDLFLKAAQLSPSGVNVDADVQTGLGVLFYSMEEYDKTLDCFQAAIRCNPNDALSWN
                     RLGASYANSNRSEQAIEAYSKALQLNPNFVRARYNLGVSFINMGMHKDAVEHLLTGLS
                     MHEVEGPDGMMVSDTEQSSNLIETLKRAFLAMDRRELIDKVRPGMNIQQFRKEYNV"
     gene            <775859..>776212
                     /locus_tag="C5L36_0D03810"
                     /db_xref="GeneID:40385478"
     mRNA            <775859..>776212
                     /locus_tag="C5L36_0D03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467266.1"
                     /db_xref="GeneID:40385478"
     CDS             775859..776212
                     /locus_tag="C5L36_0D03810"
                     /inference="similar to AA sequence:RefSeq:NP_011435.1"
                     /note="PKUD0D03810; similar to Saccharomyces cerevisiae
                     YGL080W (FMP37); ancestral locus Anc_6.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323126.1"
                     /db_xref="GeneID:40385478"
                     /translation="MSSSATNTAAQKLSQKIFNKQTLKYVFTTHFWGPASNFGIPVAA
                     VLDLRNKPEDTISGPMTVSLIAYSLVFMKYALAVTPKNYLLFGCHAINTVAQTGQGLR
                     YLHYHYFSENKKDDA"
     gene            complement(<776443..>778182)
                     /locus_tag="C5L36_0D03820"
                     /db_xref="GeneID:40385479"
     mRNA            complement(<776443..>778182)
                     /locus_tag="C5L36_0D03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467267.1"
                     /db_xref="GeneID:40385479"
     CDS             complement(776443..778182)
                     /locus_tag="C5L36_0D03820"
                     /inference="similar to AA sequence:RefSeq:NP_015130.1"
                     /note="PKUD0D03820; similar to Saccharomyces cerevisiae
                     YPL194W (DDC1); ancestral locus Anc_6.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323127.1"
                     /db_xref="GeneID:40385479"
                     /translation="MPFRFELELKAKSSRALWTRAIGALHTISDSLKIDIRQGTETGH
                     DEQGRRCYSELVFSSMNKTKTSVMKISFKECFFRMFRIEGEITDNVTRTMTNVENYAK
                     NYSLIINSRDMNTLFKDCADDAESWKIFLIAGNEISQMIYSNRLFVEFETKAGLKKKY
                     SVSYRPSMFGCDSKISFIYLKTLENQRLSDEQEERGVLEDDGFDLLEEEEDERVHRIA
                     INTLILKRFIQVFPQQIEDFRLEIRPKEKSLVLIGYNRQNIIGRGDSVVNKPMNLSIQ
                     IQLNQIAYNNVREYKEDRDIKDIQVSFRLRNFKMFIQLISTGFTGFNSDDDNTKSNKR
                     SRTISSYDRGFSNDYEDNICDIIFSKSGYPIIFEKKYFTDGDNEILECCSISLTEVTD
                     GESSRIILEAMNAAVNQKIRDLTSASGHRQSLSALEALPTVKGNIWKQFTNAELAMPL
                     SNRQDDHPVAVKEPLFVPDDDLHAVEYPQDLVVPESVDNDVLSDASRGGDVGDYQQIF
                     WEDERFHQTRVVEKPGFKKDRIDATVEHDMVHGKNKRRLLTEEEPVGDDGVACQENYL
                     GPTQKLQIKGLFD"
     gene            <778435..>781947
                     /locus_tag="C5L36_0D03830"
                     /db_xref="GeneID:40385480"
     mRNA            <778435..>781947
                     /locus_tag="C5L36_0D03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467268.1"
                     /db_xref="GeneID:40385480"
     CDS             778435..781947
                     /locus_tag="C5L36_0D03830"
                     /inference="similar to AA sequence:RefSeq:NP_116687.1"
                     /note="PKUD0D03830; similar to Saccharomyces cerevisiae
                     YFR031C (SMC2); ancestral locus Anc_7.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323128.1"
                     /db_xref="GeneID:40385480"
                     /translation="MKVEELVIDGFKSYSVRTVITNWDPQFNAITGLNGSGKSNILDA
                     ICFVLGITKTSSLRASNLQDLIYKKGQAGITKASVTITFDNSDKEHSPVIYKNDPKIS
                     ITRKISVDGPSTVNTKYLINGRKATQKEVANMLESVQLNINNPNFLIMQGKITKMLNM
                     NPKQILSLIEEATGTKAYEKQREKSEEIMKKKDMKLASIKEIRDLKVKPRLNELKKQT
                     EVLIEYKNEKEKLEKLSLIMNAFEYQDSIDVVRNISKPLDESTQKVVNLDLKIKEIQK
                     QIDTLNEELQKIRANNSKSESKYLKELELKEQETQNNLTRLKTLRKSHSDNLNELKRL
                     CKSKEKEVERIQNSIDNRHANYTQLQQSFKREEEELRHFIESLQRKEDLLSTLSTGIS
                     SKGSDAGFAAQLRDANQRLSEIKTAIEQDKLKIRHLDGQIDESTLENHKHEIEKYKAE
                     IKRRKAEFDSIKEQLKQSGFDKLEYDKLKVEEQKLLEQLNYKNRSLQEFVRRDTRFDF
                     TYDKPTPDFNYNSVKGLCGELFNLPEKHRKTATALEVCAGFKLFNVVVDTDKTGSLLL
                     EKGRLRKRVTIVPLNKITSKVVRESIVNEAKRQAPNKVELALNLVECDPSVKKAIEYV
                     FGNKLICDDPETAKKVTFSEKIRTGSITLDGDNYDPEGRLSGGSRNTSASLLSHFEKY
                     KDLKNEVMSIRKRLDQISETLRRMNIAAEKNYDTQQKLVAEEYHISLLNKKLNESNSA
                     VYIQNYERSMHEIDSLKEMIRSNESKIELLNQEIGKINKDMDEFNSDGSKKLRQLKEE
                     IGRLLVERSQKEKNLAARRMLFNEETVRNEDALLDIENLKTEILKAKEEIPRMEEALK
                     EEDHVIDEVQYELDQICENIQIERDRSANALAEFDQLSQHLQNKKNELSETTRAHEAE
                     VERKGKLLGSFKEAKKVISMLKNDTRIIDDTRRAQLISGCEDFDYEEYANRVNEIQKK
                     IDELKSKGADDNVQLESEILLQNCASLEGKILKIEKDRKKIETTIEKLDQYLKTELNK
                     TYRKVSDEFGETLAMLLPGAYAKLVKTSGEEGNIFEGLEIRVRLGSVWKESLVELSGG
                     QRSLVALALIMALLRYSPAPMYILDEVDAALDLSHTQSIGHLIKTKFKGSQFIVVSLK
                     EGMFTNANKLFKVRFQDGTSIVST"
     gene            complement(<782020..>782694)
                     /locus_tag="C5L36_0D03840"
                     /db_xref="GeneID:40385481"
     mRNA            complement(<782020..>782694)
                     /locus_tag="C5L36_0D03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467269.1"
                     /db_xref="GeneID:40385481"
     CDS             complement(782020..782694)
                     /locus_tag="C5L36_0D03840"
                     /note="PKUD0D03840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323129.1"
                     /db_xref="GeneID:40385481"
                     /translation="MVLVYFQEEGLKDKRIVQVVNPTMDELEGKAIVHLQKCKYAEYK
                     KAISQFRLFYPELFKRSCSKPVLNYRIKDLLITETEVELFIFNGSVVADDAVDWTDRI
                     MDVLEIPRESRHERSKRPKMIKYKENEKSMADISQSVVEENNNMDLVSNRKPLESNST
                     GIGDFGDEFHQNKQYGYVFSEIKKSHVDGDHFLYKCQKPKRLPVPLKELKATRFDEWE
                     CPTFNM"
     gene            <783121..>784824
                     /locus_tag="C5L36_0D03850"
                     /db_xref="GeneID:40385482"
     mRNA            <783121..>784824
                     /locus_tag="C5L36_0D03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467270.1"
                     /db_xref="GeneID:40385482"
     CDS             783121..784824
                     /locus_tag="C5L36_0D03850"
                     /inference="similar to AA sequence:RefSeq:NP_009333.1"
                     /note="PKUD0D03850; similar to Saccharomyces cerevisiae
                     YAL067C (SEO1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323130.1"
                     /db_xref="GeneID:40385482"
                     /translation="MPVVHEFSLWLKNLFLAVYVIWSRLKWGVLPVERQVEDAAEESF
                     VHSDLETSTVDGEDDEKEAKKPYEEVKEKIDELPIIDASNRPWYKFFDEYEFRQTKEQ
                     RSSHKWYHWFNENDTPAEKKLILKLDILLTLYSMMAYWVKYLDQTNLNNAYVSGMKES
                     LNMRGNELVHTQAVFTVGTIVFQLPFMWALYKVPLSYVLPSLDLCWSLFTLGAYKSTS
                     VAHLQAMRFFIGVFEAPGYLAYQYLFGSWYKVDEMVRRSMFYYIGQYLGVLTSGLLQA
                     SIYKTLNGVNGLEGWRWMFIIDAIISFAVGIIGFYVLPGTPAHCYSIFLSDDEILLAR
                     KRLQKNNTAIEVEGGRRFFDKALWKKVFTSWHVYILSIWNIFCWNNNNGTSGAYLLWL
                     KSLHRYSISKVNQLGAATPAVGVLWLILTGCYADLFHSRWQAIIWSQILNVTGNTILA
                     VWHVPEGAKWFAFMLQYTGWAMAPVLYSWMNDICREDPQYRAIVLVIMNIMAQTSVAW
                     ISVLVWKTVEAPRYLKGFSFTAASAFSLMLWTFVVLYFYKRQERTNFAKKGLIVRSGE
                     I"
     gene            complement(<785105..>787021)
                     /locus_tag="C5L36_0D03860"
                     /db_xref="GeneID:40385483"
     mRNA            complement(<785105..>787021)
                     /locus_tag="C5L36_0D03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467271.1"
                     /db_xref="GeneID:40385483"
     CDS             complement(785105..787021)
                     /locus_tag="C5L36_0D03860"
                     /inference="similar to AA sequence:RefSeq:NP_014581.1"
                     /note="PKUD0D03860; similar to Saccharomyces cerevisiae
                     YOL060C (MAM3); ancestral locus Anc_3.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323131.1"
                     /db_xref="GeneID:40385483"
                     /translation="MLPTRSHHSTIAKLVLSLAPILSQAIPIEVHPIKRLLASDILDI
                     PSVPTEEPLSRSQFYIYAITSSTLVILGGVFAGLTIGLMGQDEVYLKVISSSGTESEK
                     KCSKKVLQLLDRGKHWLLVTLLLSNVITNETLPVILDRLFGGGLVAVFSSTVAIVIFG
                     EIIPQSICVRYGLELGAFFAPYVLVLMYIMYPVAYPIAKLLDHILGQDHGTLYRKSGL
                     KSLVTLHHTMGTERLNIDEVTIISAVLDLKAKPVSEIMTPIQKVYTLPSDRILDEETI
                     DEIFNAGFSRIPIHFPGEPYNFVGMLLVRILISYDPEDSLPISSFPLATLPETSLNTS
                     CLNILNYFQEGKSHMVVVSETPGKDTGAKGILTLEDVIEELIGEEIVDETDVYIDVNK
                     KIKREIPGPLSKRNINSYLHHLYKSSSKRSSIDNEERRSLNNGHPTYITKDSYKNGLA
                     AVKPAMKPSNLAADPLKTSNTHIKIKKLPDLLTPQGMSPNIPSAIASHSKPNERDSLS
                     PGKTLSHEYGTSSVGPLVNNGEVPKVLNSEAAALVHGIYDNASRHTDKCESRENCEFN
                     GSPATDAAKRLALNASYGIPVPKNVDPRDDHSDDNNSRSGSTGGILVEDNIVSLKGVN
                     KTIIHDGTWNMENV"
     gene            <787791..>789035
                     /locus_tag="C5L36_0D03870"
                     /db_xref="GeneID:40385484"
     mRNA            <787791..>789035
                     /locus_tag="C5L36_0D03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467272.1"
                     /db_xref="GeneID:40385484"
     CDS             787791..789035
                     /locus_tag="C5L36_0D03870"
                     /note="PKUD0D03870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323132.1"
                     /db_xref="GeneID:40385484"
                     /translation="MTTHAVRTSKIYHQVQQLLANPSCTPVFCHDELNAIIGKFETQL
                     SQYEELPTVTQFVDIGLSRLIPQYSHIFDTTEDGESLAWHLGRFIKSKQDSERGKIDH
                     LKAYIIKYELNREYTEIRELREKLLSRIEDTQVSLERVVPTYTSISLIEFVKLLHDDV
                     FLHSGQTKYYLRLCKMFTSFSQVGGITGKLRPADVEKLIQRILYAEINFTEQQKNQVK
                     LEHVKQLLMADLGKSGMKLSNKELFTLFDLNDNVGAESMNLVYEKFLHSDHVAKTSSF
                     FKAYLRKVVSMNGEETSIAKRVIEDAIEHEVVFDREFFELVVKHAQETGNIALQDVVS
                     YCLLKEYTLCNHTLSIMQGTKYTSLSSPLVTLLRRLSIPTNGTTASTMSPLNIPSIQI
                     QLADRVGEFPSLGEFPGFCFRS"
     gene            <789316..>791028
                     /locus_tag="C5L36_0D03880"
                     /db_xref="GeneID:40385485"
     mRNA            <789316..>791028
                     /locus_tag="C5L36_0D03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467273.1"
                     /db_xref="GeneID:40385485"
     CDS             789316..791028
                     /locus_tag="C5L36_0D03880"
                     /note="PKUD0D03880; Pfam Domains:
                     Pkinase(9.5e-58)|Pkinase_Tyr(4.9e-06)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323133.1"
                     /db_xref="GeneID:40385485"
                     /translation="MANGILSKLFKSSKDKKDAHHQKHTPLVQSSVSPISSTSGHPND
                     AHSSYPGSSPTLKTDSASTKLEAPHSVKMRSSGSSTSSIHPIDSNPSPHLKLARFLEK
                     RHLKHQEFLDSLQGKHKNNKSKTDSPKKSYFFQSKKAENHAHHKEKPLQKTQNLPSKF
                     NDFNALTQLVAPYGIIPDRSVDLMALLEHTNIENQPLDAQLGSLALNAIDVPKSGSSS
                     NALIIGKGAGGSVYPLYDSTRNHLYAIKKLRLQMNKEDWFTYQSKLKNEFNIAKKLHH
                     QNLIRTYDLLQDNDLFIIVMDYAPYDFFTMVMAGKFTKYECYCYLRQLCEGVCYMHSI
                     GLAHRDLKLDNCVVDQNGVLKIVDFGSSVIFDQKLYDGKGKSRDIEQASGILGSDPYL
                     APEVVQYPFYDPSLADVWSVAIIYCCMVLRRFPWRIPKTSDTAYDYFTRPTGEITDSN
                     GQVKQVGPEKLFKMLPHSSRPVIAQMLKIRPSERASMKQVLDTEFMQNIEYCHYEEYD
                     AERNTGIIIKAQNHTHHLITNKQFEDENPEEAAKEKEREEMARKKREQEEEEKSKTIK
                     VPVA"
     gene            complement(<791197..>792204)
                     /locus_tag="C5L36_0D03890"
                     /db_xref="GeneID:40385486"
     mRNA            complement(<791197..>792204)
                     /locus_tag="C5L36_0D03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467274.1"
                     /db_xref="GeneID:40385486"
     CDS             complement(791197..792204)
                     /locus_tag="C5L36_0D03890"
                     /note="PKUD0D03890; Pfam Domains: Pribosyltran(2.4e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323134.1"
                     /db_xref="GeneID:40385486"
                     /translation="MRDIVIFSGSSNEPLCKRICDNLSLPLGKVLLKKFANGETSVQL
                     ETSVREKDVFILQTGAGSVNDYLMELLLMISACKMASAKRINIIMPLFFYSRQLDMPA
                     IKYGEYLSNKIKVVGNVKPWVSQNGTLIANLLTSAGANHIITMDLHDSQYQGFFDIPV
                     DNLYSKQLVQYYITNYIPCFKDSVIVSPDAGGAKRATAIADSMGLSFALVHKERRIET
                     NEDMSMLVGDVEGKTCVIIDDLVDTAGTLIKCAKLLQSNGATKIYAIVTHGLFSGDAL
                     PKIKECGLFTKVITTNSVNQSKRLETEKTDVLDVSRMFAEAIRRINNGESVSIIYNSM
                     I"
     gene            complement(<792503..>793882)
                     /locus_tag="C5L36_0D03900"
                     /db_xref="GeneID:40385487"
     mRNA            complement(<792503..>793882)
                     /locus_tag="C5L36_0D03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467275.1"
                     /db_xref="GeneID:40385487"
     CDS             complement(792503..793882)
                     /locus_tag="C5L36_0D03900"
                     /inference="similar to AA sequence:RefSeq:NP_012970.3"
                     /note="PKUD0D03900; similar to Saccharomyces cerevisiae
                     YKR044W (UIP5); ancestral locus Anc_1.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323135.1"
                     /db_xref="GeneID:40385487"
                     /translation="MDLGGGYSKPTLVQKARRIYGRLTFKGKVFFGILSLLILYMIFP
                     SWRSSSSKDPQLEHDLRYFENYSNSASTTISSKQLNSLSDLLNYSPHVSKVDLKYMSL
                     PPLLDSNNKFPHYRNGGNMLLSRNSDHVRLVRDSARQTGYLFSDMTISNDDLSAFEID
                     VGFKIHGQQDRANMIGDGMAIWLTTEQLKGGDVFGIQSNFNGLGLFLDTYKNYNGKHN
                     RHAFPYLSIQRNKGYDGYYDKGKDGINTQIGGCSLHKIYNTGSDKPTKLKITYVRQAG
                     VFEVLLDEKGQGEWRTCYRKENVDLDGLFPVGRPLYLGVSAETGELHHNVDLYSIDVK
                     TFRKTDGEQIAEIDSLAQGLTIVDSIDDTDQNQQNAERGESLQSRRRKNRKSLNRLRR
                     QEKVLKQRDREKYQSEHGFVGWFFSIVWSIIKIIFYIVLLLVAAYAGVIAFRVYRENQ
                     RKKNIGGIL"
     gene            complement(<794128..>796680)
                     /locus_tag="C5L36_0D03910"
                     /db_xref="GeneID:40385488"
     mRNA            complement(<794128..>796680)
                     /locus_tag="C5L36_0D03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467276.1"
                     /db_xref="GeneID:40385488"
     CDS             complement(794128..796680)
                     /locus_tag="C5L36_0D03910"
                     /inference="similar to AA sequence:RefSeq:NP_015299.1"
                     /note="PKUD0D03910; similar to Saccharomyces cerevisiae
                     YPL026C (SKS1) and YDR247W (VHS1); ancestral locus
                     Anc_8.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323136.1"
                     /db_xref="GeneID:40385488"
                     /translation="MSMKDLSNIILNNKYQLISRIGSGSYGIVYSAIHLYTGIQYAVK
                     IILKNNSPNTSNNKQLLVELEKSLIYQSLLNNGCLDATLLSLDSIEKHGTDCKFLREI
                     SLQLKVHKHPNVLSIYKVYDFQTSIFVVMDFYPDGDLFTTIVDKQRYKNDPFLIKSVF
                     CQLVDALNYCHAKSVYHCDLKPENILVSDNGKKLILADFGLALQDKYIDSNISCGSSY
                     YMSPERIQNFSQAFNTLESHSIHIERLLDPKHTKANVPAHGNVKFPTSAGDVWSLSII
                     LINLISIRNPWLKASLHDTTFKAFVQNPKILMKILPISEEVFHILLKYLALNPWDRGN
                     LFDFRSDVLHCRKLTETGPLSIDSSIQSLDIITTASQISMMDRSLSAQFEICPIPVDH
                     VAIDRLRSGELDVARTEPENDYIPKPIINPLSTPIGRQPIKATGECKSCAECGFGTDS
                     SCSSASSSSVIQRQASLTSSDYVLSTSQQIQDTKIPSHPYELQQQQEISQPPAQQVVT
                     PTQPEHKHENMFKKFFKFGPGGYNANNLYTKASTPRKHHRHHLSPFKSSEKKLLSDQN
                     NGQNENNMLLEQQQLQQQQQLHQRQQLQQLQLQKQQQQLQQLQQYQQQLLQLQQSNKG
                     QKSGIVTEPQQGEHQHHHHHHHYHHHHYPSDQHKAPEAIPPVAVPAPVPDYTSIFPMP
                     GMGLNKPILGQDRPKKKLITKRRQKRVGAPADKSTLAKRSANSKEQKIVDETKQQQRQ
                     SQQYLDQENGDESEMNSQLDYRTASPESRTYSQSTGESAQSQESEGPPSGEQPTVSTK
                     LQHAQSNQYVNRIKASEIKNVSQTLSAMSIISNDSNTTMATVATRGSTMDQS"
     gene            complement(<797915..>799156)
                     /locus_tag="C5L36_0D03920"
                     /db_xref="GeneID:40385489"
     mRNA            complement(<797915..>799156)
                     /locus_tag="C5L36_0D03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467277.1"
                     /db_xref="GeneID:40385489"
     CDS             complement(797915..799156)
                     /locus_tag="C5L36_0D03920"
                     /note="PKUD0D03920; Pfam Domains: RTA1(3.4e-50)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323137.1"
                     /db_xref="GeneID:40385489"
                     /translation="MDKILSYTEHIPAGYVTRARHLTETLQLSVAVPTTITEPYASIT
                     SVISSAAAYQSSVYNALSAASNLASSTSLFNEVVAAQATINYYEILREAVTETNAASR
                     ASLMTRAAEASEVMFKVVNEYPFYGGNFPSLGGNIALLVVFAVFLSMQVFSGIFFHQY
                     WFLVCWTAGLILEVIGYAGRIWSSQNITNLSAYIMQSVCITVAPCFLMAGIYYIIAQI
                     TLIYGEEYSLMKPMRYSQIFIVCDIISIFTQGAGGGMASVQSLQDTGRYIMIGGLAFQ
                     VLTMLIFQFLWYHLLFNIYKAYKESGENVFNPEFDFVRRRKLHIPFIIGVSFVVLLIF
                     IRSVYRLAEISEGWSSKATTDEIYFMILEGLMVSLASCVISVLSPGLAYGRGAHLQMT
                     RRKKNEEEFDMDDSFRKRDEL"
     gene            <800585..>801856
                     /locus_tag="C5L36_0D03930"
                     /db_xref="GeneID:40385490"
     mRNA            <800585..>801856
                     /locus_tag="C5L36_0D03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467278.1"
                     /db_xref="GeneID:40385490"
     CDS             800585..801856
                     /locus_tag="C5L36_0D03930"
                     /note="PKUD0D03930; Pfam Domains: RTA1(1.4e-47)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323138.1"
                     /db_xref="GeneID:40385490"
                     /translation="MSELGDLVEYTSNVPSGYITKALDLTRTLALTTTVTPQFTLPLA
                     TISSIITVAQNNQDSAFSALKTISNTANVTSLFNAAVNAQATLNYYSLLQEQATQTSL
                     ATETSFISKVAQASAVMNKVVYETPFYGGNPPNISSNGALVAIFLIFCILHLILGIFY
                     RQTWFLVCWVIGLFLEVIGYIGRVLSSRDIMGLGPYIMQSTCITIAPTLMMAGIYYIV
                     GQVTVIYGQQYSLLKATRYSKIFIFCDVVSFLTQSAGGGLAATASNGEMGRHLLLAGL
                     AFQTVSMVFFQFLWFYLIINIVKAWRSDRVPPFNPEYLHIRERGVLPYFIVSVSIAVM
                     LIFVRSIYRLAELAEGWDSKLTIDERYFMVLEALMIVLATFCMTVLHPGLAYGRNANL
                     VVKNQTATIHEDAPYIYPTNKDYDYYGRKFL"
     gene            <802333..>804789
                     /locus_tag="C5L36_0D03940"
                     /db_xref="GeneID:40385491"
     mRNA            <802333..>804789
                     /locus_tag="C5L36_0D03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467279.1"
                     /db_xref="GeneID:40385491"
     CDS             802333..804789
                     /locus_tag="C5L36_0D03940"
                     /inference="similar to AA sequence:RefSeq:NP_014860.1"
                     /note="PKUD0D03940; similar to Saccharomyces cerevisiae
                     YOR217W (RFC1); ancestral locus Anc_8.637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323139.1"
                     /db_xref="GeneID:40385491"
                     /translation="MAVIDDFFGKNKVQQNKVKRRATQPKPSARAAAATSVTGGDERV
                     IKKPKLELDENSNDATQKLSAEDVLKTIPDLDLDSVDIGSGKFSFANKQDDPSSSHND
                     FQVEALANGRENCLNGLTIVFTGNLPTIDRDHAVQLAKRYGAKVTSSISKNTSLVVIG
                     TGAGPSKISKIKSLGTKCVNEDGFVELISKMPADGGAGEKAQKELAKKREEERKVEME
                     IEEEIAKEKKQQQEEKRKRLDVAMNSPGLSSSGSAYVKPPVDRSTQLWTDRYAPTDMK
                     QICGNKGNVEMLYNWLATWFDKPHDMKGSSIDAFKAVLISGPPGIGKTTAATLLSKKL
                     GYDVIEKNASDFRSKKVLNDSLKVSLDNTSVAGFFKHEDHTATTNNKKIVLLMDEVDG
                     MSSGDNGGVAQLAAFCRETKTPMILICNDKSLPKMRTLDRCCFDLVWRRPSAREMKSR
                     LMTIAHREGLKLDPNIIDKLVSITHNDIRQIINIMSTVARTQKSLNFDNLNDMQDSWE
                     KEVSLKPFDVIPRLLSVSNLSINEKIGLYFNDMDIIPLMVHENYKLTKPIKAGNNNLK
                     HLKQLSIASDLISESDHVNSLIRSGEQQWSLLPFHAIMSTVYPAFEVAGQIAGRINFT
                     SWLGQNSKRMKFDRIVQNLQYHSCIKTGTNNIDLRLDYVPFLREKLIKPLVDEGLDGI
                     STVLELMDEYYLTKEDFDNILELSVHGSMKVDDKYKKVPTKVKSAFTRKYNSYLHPTV
                     IYKTGDSVSKGRGKKSSTHLGEFGEEEGDGLEADADADADTANGEDDENGNQDISKDS
                     LIKTVIPKSTKKVASKKAKK"
     gene            <805053..>806396
                     /locus_tag="C5L36_0D03950"
                     /db_xref="GeneID:40385492"
     mRNA            <805053..>806396
                     /locus_tag="C5L36_0D03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467280.1"
                     /db_xref="GeneID:40385492"
     CDS             805053..806396
                     /locus_tag="C5L36_0D03950"
                     /inference="similar to AA sequence:RefSeq:NP_014692.1"
                     /note="PKUD0D03950; similar to Saccharomyces cerevisiae
                     YOR049C (RSB1); ancestral locus Anc_5.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323140.1"
                     /db_xref="GeneID:40385492"
                     /translation="MGNLSLLLEQTSGIPTGLQSYIVELTQSLPLSTTVPSTISQPYE
                     TITSVIAHAEQRQLSAYSVLNVVTASASSVSLINDIIQAQATLNFYELLEKAATETNT
                     ASKAGIMTQAAEASQIMLKMFNEQAYYSGNYPSLGGNTALLVVFSLFLCMQVISGVFF
                     HQYWFLVCWTLGLILEIIGYAGRIWSSQNIMNFNAFVMQLVCITLAPCFMMAGIYYVI
                     AQLTLIYGEKYSVLKPMQYSLIFIVCDIISIVLQAIGGGVAASALSVYESTDAGSHIM
                     VGGLAFQVFTILVFQLMWYYLIFNIYIAHKTNGDDAFNPRFAHVRQRKWLIPFMGVVS
                     ITVLLVFVRSIYRLAELSEGWSSAPATKEIYFMILEALMMSLGTCIISFLPPGLAYGR
                     EAHLYIDKSLKQTFSFKRNPDADNEFGKEEKNDVGNMFDCSDSANSSFHDQPRFL"
     gene            <806741..>808795
                     /locus_tag="C5L36_0D03960"
                     /db_xref="GeneID:40385493"
     mRNA            <806741..>808795
                     /locus_tag="C5L36_0D03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467281.1"
                     /db_xref="GeneID:40385493"
     CDS             806741..808795
                     /locus_tag="C5L36_0D03960"
                     /inference="similar to AA sequence:RefSeq:NP_009722.3"
                     /note="PKUD0D03960; similar to Saccharomyces cerevisiae
                     YBR163W (EXO5); ancestral locus Anc_8.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323141.1"
                     /db_xref="GeneID:40385493"
                     /translation="MLKKKLQTIKVRIPVPHNIQNLKAKSVEVSEYKKSPQHSDAEVI
                     RQIKRLCQTTNNENNNNIDIDPKIQAKTLNRDKKEDLSYQIDALADRLNNLKHSKYLP
                     LEFTTTVKDSTPYDYLAKASIGQEKKRLSVTKIIPYRYCELKSMYEVYLGFEMHRSEA
                     MKHGVEIHRTMEINDHPQRPILVESANQESRSLVDVDAEELQPADRSTRQTRKKMVDQ
                     TLKRMSRLNNQNVVTLQDPELSDDISVKNPETSFIKDEGKYNQEKDRESWINTTLKDA
                     KTNGERGEAVDKNSIFADIEKAQMVAGTSRRTDELNSKMTLITEAIDKGFQIIPKIRL
                     KGEKEPSGSDAFKLTQTLIRYLQLFRKGTCHEVLVHGFYNPHIEDLIIPSNKKQLIED
                     DKITISGVIDQLKLQSVQEGAFPLFQKEISEKLEGTETFEQLIKTIEDVTRSWVSEQD
                     PMIELVINDDKTRMFNARPTRIVQQQNLVQVGMYAKLLGLLTNNVDFTYHSWLCNMKD
                     RGNEVFEPLSNDVVSFCSICSDLLFNDFLRLKNGEMIDYSDIVDGPYSASGMTKFIYE
                     NTTDDTSLDILAGEWIYPPTLAHITARLSQVQLLVKPFFHKKIEVTYLFADPKNSGKL
                     KVIDVSQSQYDEEFINEQIHLGMDLWMGRREPAGPLMPQACKNCEFNHKCQIPLKRQG
                     LL"
     gene            complement(<809205..>810956)
                     /locus_tag="C5L36_0D03970"
                     /db_xref="GeneID:40385494"
     mRNA            complement(<809205..>810956)
                     /locus_tag="C5L36_0D03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467282.1"
                     /db_xref="GeneID:40385494"
     CDS             complement(809205..810956)
                     /locus_tag="C5L36_0D03970"
                     /note="PKUD0D03970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323142.1"
                     /db_xref="GeneID:40385494"
                     /translation="MGSPILLLSFPFPLFVPILLTSFFSSFYLFSSCSFEFLFLSTPN
                     PPQSLFPNQFLEMVKINTLLTGFLSLASASAAFVKRYDNSTSSCVPTTISSTSIVSVY
                     GPQFTGVPSNKYVVPTVVGDLVSNDAPEFTVYIPQSLYNLTGLELELTSAVGFDVSPE
                     SYTLYSGDIGDFVYPGQIYETSNTGLVFDGRTQDPLLKITIIGIPEANQPVFIADFVL
                     TLDVISSSGLQKRDTLTFNLSFSIKNSAYISSSSVASTSESSQATTGATTGATTGATT
                     GETTGETTGATTGATTGATTGATTGETTGATTGATGETTGATTGATGETTGATTGATT
                     GATTGAITSELTNGEASTIYVSSTTVKTITSCSDDKCTEQTQNGFDAVVVTKSNDIIT
                     SYTTFCPAGVDTPSAKTMVSLEKTVTIGATVTVINTVCEASEGVVATTLTGSENDTTF
                     TTVVTLTQITPKSKTSSSSLSPAVATSASAPVEQTNAPQQTTVATATGEATAATYGST
                     SVTVPAHTGESQSAEGAVFDSTSVTIPEQTGTSSDSISVTVPVQTGDSQVYEGVAASN
                     KATSGALFGVIGLMMFL"
     gene            complement(<811806..>813170)
                     /locus_tag="C5L36_0D03980"
                     /db_xref="GeneID:40385495"
     mRNA            complement(<811806..>813170)
                     /locus_tag="C5L36_0D03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467283.1"
                     /db_xref="GeneID:40385495"
     CDS             complement(811806..813170)
                     /locus_tag="C5L36_0D03980"
                     /inference="similar to AA sequence:RefSeq:NP_014903.1"
                     /note="PKUD0D03980; similar to Saccharomyces cerevisiae
                     YOR260W (GCD1); ancestral locus Anc_8.709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323143.1"
                     /db_xref="GeneID:40385495"
                     /translation="MEFNAVIFCGDGQNLVPLTSPGESRIPKALLPVANKPLIEYVLE
                     WCDQAPFKSVNLVTDMKNEKMIAEVITAYNSKRNLELRNSSPVKLFTSELKSTGAILN
                     DIFPVKEEDEYEEENYIILPCDFITDVPPQVFIEVYRGNSDENMGLSVFYYNCLENID
                     KKVLKSNYTVYSNQENGNSVLLDMYSKDFVTIDKFLKIRTQLLWRYPTTSISTKLLDS
                     FIFFMNGKCRTTNKNNEDIETSRSINKVKRDLARNSWKHSSGKSTIGMFALPRNAFFV
                     RVNNLPVYMEVNRHYLKEFAKSGNRTNATKGSANIGVDCLVEEDAEIGERTTVKRSVI
                     GKDVKIGKKCRISASVILDGVTIEDEVQLENCIIGKNVKIEYRGKLVNCNVEGSYTVG
                     KNVNLKGETLKNLNLDELSDGGVFYEGSEDETTDESGSEGGVSEYDDEGFEEEEYEDD
                     IFAR"
     gene            <813445..>814788
                     /locus_tag="C5L36_0D03990"
                     /db_xref="GeneID:40385496"
     mRNA            <813445..>814788
                     /locus_tag="C5L36_0D03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467284.1"
                     /db_xref="GeneID:40385496"
     CDS             813445..814788
                     /locus_tag="C5L36_0D03990"
                     /inference="similar to AA sequence:RefSeq:NP_014902.3"
                     /note="PKUD0D03990; similar to Saccharomyces cerevisiae
                     YOR259C (RPT4); ancestral locus Anc_8.708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323144.1"
                     /db_xref="GeneID:40385496"
                     /translation="MSEENDPLLAALNDDQSNDQNEQTQSQSQSNGETPRLDADGDTE
                     IPNATVENVEDIDPAEKERHDALTALKNKLIEHLHYETKLKEMRKSLIDLDKEYNKTE
                     DDIKALQSIGQIIGEVLKQLDNDRYIVKASSGPRYIVGCRTTLNKEKLVKGVRVSLDM
                     TTLTIMRILPREVDPSVYNMTTFEPGEISFTGIGGLNEQVRELREVIELPLKNPELFQ
                     RVGIKQPKGVLLYGPPGTGKTLLAKAAAATIGANFIFSPASAIVDKYIGESARLVREM
                     FSYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQTKII
                     MATNRPDTLDPALLRPGRLDRKIEIPLPNEAGRLEIFKIHIAKVQKRGDIDFEPLVKM
                     SDGFNGADIRNVITEAGFFAIREDRDYIIQGDLMKAVRKMVENKKLEGKLDYQKL"
     gene            complement(<814950..>816005)
                     /locus_tag="C5L36_0D04000"
                     /db_xref="GeneID:40385497"
     mRNA            complement(<814950..>816005)
                     /locus_tag="C5L36_0D04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467285.1"
                     /db_xref="GeneID:40385497"
     CDS             complement(814950..816005)
                     /locus_tag="C5L36_0D04000"
                     /inference="similar to AA sequence:RefSeq:NP_015152.1"
                     /note="PKUD0D04000; similar to Saccharomyces cerevisiae
                     YPL173W (MRPL40); ancestral locus Anc_8.706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323145.1"
                     /db_xref="GeneID:40385497"
                     /translation="MSSLAKSNSKRYGRELSRYPHYIRKMFEQMQERSQLPAFRSPFR
                     QVDSKQRYIKPQQWGVQPGDTVLITKGKYAGSTSKVVALQNETNRVFIEHSETKRVVV
                     PKEFWQPGQTSHIIDYPLPVHPKDLKVVGTIVNEDGTEKKIAADKLVFKGEYWDEDYK
                     KMMPYRRVKYNENIIIPWPRPEPVEDCEYSTSEELVEERTFFPNSIVFSDSPVDLLKS
                     MRHPLMKRPYKWNKQYLTKSDVKRLVPPSPILSEAKLAGRAEREQIRESLPTSPSPET
                     INLVGDKVAQYLNNMNDERLAKYINKMDPTYIKPSVAIKEAQKKLYDEKVRENQEMNK
                     IKSYVIAKYKTRRITKN"
     gene            <816536..>817354
                     /locus_tag="C5L36_0D04005"
                     /db_xref="GeneID:40385498"
     mRNA            <816536..>817354
                     /locus_tag="C5L36_0D04005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467286.1"
                     /db_xref="GeneID:40385498"
     CDS             816536..817354
                     /locus_tag="C5L36_0D04005"
                     /note="PKUD0D04005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323146.1"
                     /db_xref="GeneID:40385498"
                     /translation="MTRSTGTFELKTYRHISNYPFVQEFSALLTSITILNSLLTIVKG
                     YINLALQNLSKYQIFTTYANSLDTTLDSWLSFFDQKLPFMSNFSFGKHYHDLQQYCYE
                     VVASLNSRYLSLRKSLESVFESSLKKLEPILRLTNNYYESILNFILPMSPTSKTEAIV
                     GKITESSEIDRMKNLSLETYKRLQLTASNVSKLPVHVSDTYKKELENEKSATKAVTST
                     TRKLSNDAYQTIKPTIEKVVSLTKSTTEEAKNPILDFSEEVIHNAATATGVEVH"
     gene            <817806..>820985
                     /locus_tag="C5L36_0D04010"
                     /db_xref="GeneID:40385499"
     mRNA            <817806..>820985
                     /locus_tag="C5L36_0D04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467287.1"
                     /db_xref="GeneID:40385499"
     CDS             817806..820985
                     /locus_tag="C5L36_0D04010"
                     /note="PKUD0D04010; Pfam Domains:
                     HATPase_c(2e-39)|HAMP(1.6e-35)|Response_reg(2e-
                     32)|HisKA(5.3e-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323147.1"
                     /db_xref="GeneID:40385499"
                     /translation="MVGGSNLEEIIETLSDPSRFNSEKEINNKKLREKILAEINLLRQ
                     ENEKYKETIRIKTLRNEEFRHSLSEIGSVITSVALGDLSKRITIKEDENEETIDADIF
                     RTKRTINFMVDQLDNFTNGVNTLANQVANGKLGGTVAYKDAKGVWNDLIINVNAMANN
                     LTNQVREISIVTSAVANGDLSQKIKVEAQGEIFTLQNTINRMVDQLRTFAFEVTRVAR
                     ETGVEGRLGGQAQIQNVSGIWEELTDNVNAMALNLTTQVRNIANVTTAVANGDLSTKV
                     TADCKGEILELKTTINGMVDRLRTFVEEVRTLATEVGTKGILGGQAKVTDVEGAWKDV
                     TQKVNIMANNLTSQVRSIATVTTSVAHGDLSKKITVEAQGEILELKNTINKMVDSLQV
                     FAKEVTKVAKEVGIDGKLGVQAEVNDVDGLWKEITTNVNTMASNLTSQVRAFAQITAA
                     ATDGDFTRFITVEASGEMDALKTKINQMVLNLRESIQRNTAAREAAELANKTKSEFLA
                     NTSHEIRTPMNGIIGMTQLTLETELTQYQREMLSIVHNLANSLLTIIDDILDISKIEA
                     NRMTIEQIEFSLRTTIFGALKTLSVKSIEKQLDLIYEVDSQCPDFLVGDSFRLKQVIL
                     NLIGNAIKFTSKGKIIVSTTKREDVGDKIKLEFCVSDTGIGIPKDKLELIFQNFCQAD
                     GSTTRKFGGTGLGLSISKQLIHLMGGDIWVTSEYGKGSNFYFTILVSPVNISLEKQLE
                     TLRPYRSQKILIATTDILESYVPQLVSDLESLLLEPHVLKIDDFNSDLKFAEEDSYDT
                     IIIDNLKTGYKLRLLPQIKYVPLVLLHPHLPQLNMRVCLDLGISSYGNIPCSISDLGS
                     VLLPALESKIIPPDNDGSVSYKILLAEDNLVNQKLAVKILEKHGHKVTVVENGQEAVD
                     AVKTDTYDVILMDVQMPVMGGFEATRLIREWEKKKYADAAICFKSPIIALTAHAMLGD
                     RERCLKSQMDEYLSKPLKPALLLQTISKCIHNMNQLREISRIGEGRDGNAEFKKFINQ
                     ELLKRGGSDSLVKTEPRSNSKRLKYNGKD"
     gene            complement(<822443..>825538)
                     /locus_tag="C5L36_0D04020"
                     /db_xref="GeneID:40385500"
     mRNA            complement(<822443..>825538)
                     /locus_tag="C5L36_0D04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467288.1"
                     /db_xref="GeneID:40385500"
     CDS             complement(822443..825538)
                     /locus_tag="C5L36_0D04020"
                     /inference="similar to AA sequence:RefSeq:NP_011374.1"
                     /note="PKUD0D04020; similar to Saccharomyces cerevisiae
                     YGL141W (HUL5); ancestral locus Anc_2.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323148.1"
                     /db_xref="GeneID:40385500"
                     /translation="MSFNFTGTTGRKRNINLGGRSLTTKNKSIFLKTAQLERERRERQ
                     RTEMQSAVFIQSACRRYLDLKRTRGALSESWGTDGSIGSFVFFFPYVVKEQDKNRSIE
                     QLRIIESIVSGLSEHDLEKLIETLALTFTKLGDPSSSPVLSLSILKVMDVIFEKLPKF
                     ELHCSLAQQFAKCLLKAYIGELKQALYYIMKFSEHLPYTSSIETLTYKFIDPLADSSK
                     NKWNIEYDKFLMYILKNPDSEQCFKTLDQTSAITLVVRLSESIHTYPELVISKEAIYP
                     YFFRNVAFLLDLVDYPILVQSEEEMAVDYKSTLVIPNRDFESLKLLYETAEFDKFQRL
                     QPSNDILLDYISSLLHFSSLIKNDRSNTLKLRVDLNWILRDKNSFLISECFNRLSVSK
                     LANDFLNFAELQKFIKVQEYNKWWNAMLIFQEYLLNLLTFSTNENFFSLLVISKEQFL
                     AYTNFLKVFVSEILLKYRDVKIENQSRKFFLSSFKKLLTLLHGLYMKDLKLKFTSDYN
                     SKSYNNKGSFWILSKFDLDINSVVNIVPIIDQLHQSLLEYDEGEQENNEENDYLREPH
                     LLSFLKSSPPKKVIDSLYLLTYAPYMIPFEKRAEIFHAFIEYDKRDNDINSWFPTKIE
                     GVISRDNILFDAYKYYGKTRGKDFKRPFAVQFINHFGEAEAGIDGGGLTKELLTSVVS
                     CAMTPSESNRQANRGLEFFRIGTDYHLYFNPEFYFKLYYEREQHSKVPYACSNEEYLH
                     MCHFLGMVIGKCLYSNILLDVSFTSFFLITCAKMGGQYFRNLVGDKVDFIGYSVSLDE
                     LKNIDEALYQSVNYILKQTEESKFKSMGIQFSVDDEFYDINGKNYHVSIPLLRNKDGS
                     VVEVTNGNKMQFARMLASFKLSKQNKLEMKSFVDGLFQVIRPHWLLLFNPIELQTLIS
                     GDDEIDIEDLRRNVVYGGGYTEEDQTIKDLFEILHEFNHENRSKFIKYVTSSSKQPLL
                     GFKELDPHFGIFNAGADTNRLPTASTCVNLLKLPNYKDKDQLRRKLLYAITSNAGFDL
                     S"
     gene            <825758..>829138
                     /locus_tag="C5L36_0D04030"
                     /db_xref="GeneID:40385501"
     mRNA            <825758..>829138
                     /locus_tag="C5L36_0D04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467289.1"
                     /db_xref="GeneID:40385501"
     CDS             825758..829138
                     /locus_tag="C5L36_0D04030"
                     /inference="similar to AA sequence:RefSeq:NP_010181.2"
                     /note="PKUD0D04030; similar to Saccharomyces cerevisiae
                     YDL102W (POL3); ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323149.1"
                     /db_xref="GeneID:40385501"
                     /translation="METRLNELNYRPRQSRSSKKKGKKPYSFYNMGTKREHDNELEVD
                     IYELENSKKQLTPDVATKEGFIVPIKNPDITTQTIHKKLNSNETDAEPSTFEKELLTM
                     TQNATNDPSTRSPMQVWTRPDLEHNFDPTTHEIIFQQLDAEETSIYVDGKEEGCVRFF
                     GITDTGHSVLCNVLGFRHYFYVPAPRGFPSEFQEFTKYLQNQYSGMIEDVKIEMKESI
                     WEYHGGQKIPFLKIILTNPRFAGKVRTGFERGEVQFRELFNPTGTISFDNLQYLLRMM
                     VDCKITGMSWLSCPANRYTVIQPNEKVSTCQLEVSINYEDLISHKPEGKYLSMAPLRV
                     LSFDIECAGRKGIFPEPEIDSVIQIANVVSKVGDSIPFIRNVFTVKSCSPIVGSEVFS
                     YEDEGEMLMKWRDFIVKCDPDVIIGYNIVNFDLPYLINRAKALKLDKFPYFGRLFNSK
                     QEIKDSVFSSRAYGTRESKVINTEGRMQLDLLQFIQREFKLRSYTLNAVSSHFLGEQK
                     EDVHHSIITILQEGDSETRRRLAVYCLKDAFLPLRLMEKLMCLVNYTEMARVTGVPFS
                     FLLSRGQQIKVISQLFRKCLDLDIVIPNMKTENVNEEYEGATVIEPVRGYYDVPIATL
                     DFASLYPSIMMAHNLCYTTLLNKKTIERLGLKEGDDYTKTPSGEYFIKSHHRKGILPI
                     ILEELLGARKQAKRDLKNETDEFKKQVLNGRQLALKISANSVYGFTGANIGKLPCLQI
                     SSSVTAFGREMIEATKNAVQEKYSIKNGYKYDAKVIYGDTDSVMVKFGFPDIETCMKF
                     GEEAAEYVSKLFIDPIKLEFEKVYFPYLLINKKRYAGLYWTNPNKFDKMDTKGIETVR
                     RDNCRLVQNVITRVLELILEDRNVEEAEEYVKRTIADLLQNKVDLSQLVISKQLSRQD
                     YANKQPHVELAERMRKRDAGSAPNVGDRVAYVIIKTAAGDKNYEKSEDPLYVLDHGLP
                     IDTKYYLDNQLSKPLTRIFEPILGDKRTRELLHGSHTRIVKVGGGAKGGGLLMKFAKK
                     SNSCKGCKANIPDNETLCKNCKSRSGEIYGAALAKMNVMEERFSKLWTECQRCQGSLY
                     QEVLCENKDCPIFYMRTKAQKDVLHQSEELQKWDSSSW"
     gene            <830035..>830973
                     /locus_tag="C5L36_0D04040"
                     /db_xref="GeneID:40385502"
     mRNA            <830035..>830973
                     /locus_tag="C5L36_0D04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467290.1"
                     /db_xref="GeneID:40385502"
     CDS             830035..830973
                     /locus_tag="C5L36_0D04040"
                     /note="PKUD0D04040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323150.1"
                     /db_xref="GeneID:40385502"
                     /translation="MLSVYPTMSYPSTKIAQAYLLASKVKAKLSQEAVKSDINLHRLV
                     CQANLLDNLIDDLNRYDKTPDPYSSSHKVSYESINTESDPYSLLDVMNDKQNFKSGAI
                     SDEDGLKYEIVYTSDDSDSDESDDDEGGDDVFYHDGEDEAITDSSHLGQTEVDICSAL
                     DNLNIKAKPGSPIYQIENRCFSNSINRTDDTTVEYTLASSDSEDDSDYSSDSEGDTYE
                     MNSMYALTREHSQDVHFPQFTEVTTEVENRSEENENCTETDSSSDEDLSSLSNCSSVA
                     SFDNFEYIENSDLKTLSDLKLSVFSSPQVDSTDEFV"
     gene            832574..832647
                     /locus_tag="C5L36_0Dtrna4N"
                     /db_xref="GeneID:40385777"
     tRNA            832574..832647
                     /locus_tag="C5L36_0Dtrna4N"
                     /product="tRNA-Asn"
                     /note="PKUD0Dtrna4N; codon recognized: AAC"
                     /db_xref="GeneID:40385777"
     gene            complement(<832755..>835466)
                     /locus_tag="C5L36_0D04050"
                     /db_xref="GeneID:40385503"
     mRNA            complement(<832755..>835466)
                     /locus_tag="C5L36_0D04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467291.1"
                     /db_xref="GeneID:40385503"
     CDS             complement(832755..835466)
                     /locus_tag="C5L36_0D04050"
                     /inference="similar to AA sequence:RefSeq:NP_014183.1"
                     /note="PKUD0D04050; similar to Saccharomyces cerevisiae
                     YNL216W (RAP1); ancestral locus Anc_2.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323151.1"
                     /db_xref="GeneID:40385503"
                     /translation="MVLKDQIPAKDTKVSQATQSGSATKEPLRKKSNHENVNVENSHI
                     RSTIAKQSKGKLADDDTNAEDNNIETQFQNQIKSQLQNQLQSELHHSFHKDNESNPQN
                     STVDNLLDSTNIDDELRNLENMGIDNLSETVVQEAAAAVVSFAQAAATANNMNESGNI
                     DVELAEIDTNINSNHDNISVSDNVDQKLTAHNQERIFKGKVFYIPYDSPDNTNIKSMI
                     LQMGGKLVDSSTPSSITLAPPNFKGPLNISNQFSYQFIYDSYIHKSLKDITKYKVNKS
                     DLIEATAVEPTIEAKDTSPLLAPTAPASSASPATPVKESGSKLLKINVGEFPLPKESA
                     IESETSFDEPTTDLKNKRRIIKNPNPQPKRKSKKFTPEEDEFILDLVRRNPHLRSTHT
                     FFARISQLAPLSDHTGNSIRYRYRKVLAPQLDYVYEIDPVSGKPKIDPKTNAPIEVTE
                     IPSLIKSQYTSEEDYQLCKHILAYKKGDLVLYGKKKHEISQIPEAVFQELNERNPRHS
                     AMSWRDRYRKFAAKFGIRRYIEYYEDCLKKNISPEPMKNMSSRTDRKDYKVDVFDNET
                     KRPSTANIKPSKRIKLGTNKNTPKGEHTSYHLKDSGQSNLGSKIEDAKILEKPNTSVL
                     ADPLTNNDESAAVGALKELAKVSFQQNGTAGDENLPKEKPSTRTNDGEENEDTNEVHG
                     SSREDADDDNANLFAHATVDEMKQYDIGMDTSGIENDEESLKKKSVVSLSRVAETSRD
                     ESRDEENETDTNSVGNDAELVNVKADDGLMDFRQLMEIDPEPLKQRSEIDLETMITNI
                     HECFRNFGDGNTPYELFKDISDNTGISMLWLNYWFDCSCGMLGTFIQAIIHYLETGEL
                     VMNNVSGFWTERDDELLRVDPENKELLKLHGKDSVTKRKAVLFSYVL"
     gene            complement(<835751..>837991)
                     /locus_tag="C5L36_0D04060"
                     /db_xref="GeneID:40385504"
     mRNA            complement(<835751..>837991)
                     /locus_tag="C5L36_0D04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467292.1"
                     /db_xref="GeneID:40385504"
     CDS             complement(835751..837991)
                     /locus_tag="C5L36_0D04060"
                     /inference="similar to AA sequence:RefSeq:NP_010047.1"
                     /note="PKUD0D04060; similar to Saccharomyces cerevisiae
                     YDL234C (GYP7); ancestral locus Anc_2.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323152.1"
                     /db_xref="GeneID:40385504"
                     /translation="MTKFPPGKGQVLYAKSKVYLHLTSSKKDNVCGFLTIIKPFPTST
                     NEELIIAFIPETDLSPTDREALVYFDLYGLDGEKFDFYSSASNDTMDSQGHNSNKPKV
                     KKFIDRPKLSSISSYAFGVSINQLYSIQVRPKTSNLWEGSIVLHPKHEGDRLPSLFFH
                     DDESPGTKREQQLKRKTFNPFSDNSINGNSLYWGGDRFLSCLRNYADLKESTLESGMF
                     LVNCTGEDALNFVPNILDQSENGANLDLRSNFNHFLNSAKWKVLTGLASITGFTKNNI
                     NKAIDNKLLPQTIQQFIERPEIRQITDEFDSANIYLAKWALNVQEEAERNRKMIIGNG
                     YYKELISAELGDGFVELTPLEVSKAARKEPINKEKWDSFFDSNGCLQYTVDEVLEQVF
                     HCGLEMGVREEAWPLLLGVYPWDTTANERKQLRKTLENNYAEYKNNWMADLTKQKNDA
                     FWKDQKARIYKDLKRTDRDIELFAASKEEQEEDDALEYDDENDTSLFYNKNLVVLRDI
                     LFSYNEINYNLGYVQGMSDLLSPLYFVFRDETMTFWAFQRFMERMERNFVRDLSGMKT
                     QMVTLTELVQFMLPDLYIHLEKYDANNLFFFFRMLLVWFKREVSFYDTMELWEVMWTD
                     YYSSQFILFFALAILQKHSKIIIQTLKGFDGILRYINDLSGSLDIGDLLTRAELLFIK
                     FKQMVELIDRNATKLQSQNTTNGSPENSNGNPLKHTVSTELRGLLSREIIIQKEETRT
                     SETPFG"
     gene            complement(<838212..>840326)
                     /locus_tag="C5L36_0D04070"
                     /db_xref="GeneID:40385505"
     mRNA            complement(<838212..>840326)
                     /locus_tag="C5L36_0D04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467293.1"
                     /db_xref="GeneID:40385505"
     CDS             complement(838212..840326)
                     /locus_tag="C5L36_0D04070"
                     /inference="similar to AA sequence:RefSeq:NP_013883.1"
                     /note="PKUD0D04070; similar to Saccharomyces cerevisiae
                     YMR160W; ancestral locus Anc_2.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323153.1"
                     /db_xref="GeneID:40385505"
                     /translation="MITLDSDTIHKQDQKNTHTTLSIQFTHRIIMSSTGNPQTVRGMY
                     NTMFLSHIDLSPYITGNSHSLNLNETATKYKEFKTMILQRPKVGHINSNNPYAKHAKK
                     FVYIQPADETRTEGDNSLISNTQPQPPQQQHSQLNESSLLPYRSTSYLNNVTKDLINI
                     HSAIASESPLNVLDKGDNGKFTTFEMERKDEMIVSNRNTIRGTESQKHFNQLQNSLNS
                     VYRLNNEQEQQLSQSSIQEEPLLQPEESKLVFPPDYDQQRKMEVQNQVYPQSSHSNHQ
                     LHKSHQIYSDQQVRGYTSPVTQAFQAPQTFSYPQLPLSQRQQPPLMHVPYEGDSTSSS
                     NRHHYYSSHYQLQSQQSSNVAQQQQQQQQQQQLQQPLYIQNNPSYQQQPENLHSVEHN
                     FYENPTHHNLPHHYQAMQSFSSPYSKNNFQLLNEPQGDYHVEKTQRNVSSDGPYGHAF
                     NDKNTNNEPFPQSHLNRSKKHYLDLLVNERTQDFKVFNQVDQEVHFEFLSSLDGKFYI
                     NEKYLKCNDATDMVPIVCYRRNFNSLLMSLEFNDMPSYALMGGTYYNVSNVKISIECT
                     SNFSSGSFDLAYFHTNSTSKESKNIINMDSSSVDLGLFKGRKKIRVKRFQFKKATPNN
                     GKYIAKDYYYIHVNLIFELTENTGNDRTKRKLPFPQKIMSLKTCSISVRGRNPSFYTE
                     RDDISVNRDTSECFKVFLEDDA"
     gene            <840427..>843201
                     /locus_tag="C5L36_0D04080"
                     /db_xref="GeneID:40385506"
     mRNA            <840427..>843201
                     /locus_tag="C5L36_0D04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467294.1"
                     /db_xref="GeneID:40385506"
     CDS             840427..843201
                     /locus_tag="C5L36_0D04080"
                     /inference="similar to AA sequence:RefSeq:NP_012443.1"
                     /note="PKUD0D04080; similar to Saccharomyces cerevisiae
                     YJL092W (SRS2); ancestral locus Anc_1.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323154.1"
                     /db_xref="GeneID:40385506"
                     /translation="MKIKTKQAYKIFVFWLENFLMAKLQEVFDNSGGESQMMPDIFSS
                     LNEKQKQALVTTKDSVLQIIAGPGTGKTKLLVARVAYLLLHFKLEPSQVIVTTFTKKA
                     ANEMKERLEILCQNRHDINLKMLHIGTFHSICYGYLNYYGHLLGINRGFKLADKKDQT
                     DLLKKAIEKINSDELKSDKSTVKAIQSYISRQKSLGRHPEDVPISDTDVDQTKLYYQV
                     YEQYHQLLIKNNLMDFDDILVYTEKLLDLRPDIATHVKHVLVDEFQDTNTIQLRLVFK
                     LTRYCNNNMTVVGDADQSIYGFRNATYENFKIMENMMKEQGRNFVKITLDQNYRSTSS
                     ILKLAEQVMAQQQDREPKKLNSNKPGGGPVFYAHLPSPKDEPAFISDMVNHHLKDEDS
                     LFTYKDIAIIVRVSRKFLSIERELFRRGIPYRIVKGFSFWELREISMTIDLLKIIGLD
                     DWLSFKRVIDWFCDGIGPKMIEKFENIIFYPGVVDARPYQTLVELAAGKRPGVPPKAR
                     ASLISLISKIKECRDVLLTESKEKFYHCVCSKFKITEIACKKKSASKDEEEVRKEVSE
                     NLVELKNQFVSYNPEQDEFLKRAQEDVFQKQDLNLRSVKVESSEDNEEIKTVQMEDEI
                     NIRNDSKTPMELKLEFLLNFLDHIYLAESVAMDDKADDETGPGRITLTTIHAAKGLEW
                     PIVFLPALINGILPSNHALTEQNDTRQQALDEERRCFYVALTRAKEYLYLSSYSTNDY
                     MPAEASQFIRSLPEDLYVNLSPNANFGIQGMNLRNFASVQYTDSLSTITNNATKYLQS
                     GTVPQTCVQDVSAMYQRSNNIASSAVLSSLPARSAAGSLKRNPTVEHTYIPISRSTSV
                     GQLPPRATPPPTRSLTQTNSTATTLRINPVTGAPLSSTVGVGKPKKRLGMRRPKLIIS
                     KPLASRKPEV"
     gene            <843373..>844893
                     /locus_tag="C5L36_0D04090"
                     /db_xref="GeneID:40385507"
     mRNA            <843373..>844893
                     /locus_tag="C5L36_0D04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467295.1"
                     /db_xref="GeneID:40385507"
     CDS             843373..844893
                     /locus_tag="C5L36_0D04090"
                     /inference="similar to AA sequence:RefSeq:NP_009997.2"
                     /note="PKUD0D04090; similar to Saccharomyces cerevisiae
                     YCR072C (RSA4); ancestral locus Anc_6.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323155.1"
                     /db_xref="GeneID:40385507"
                     /translation="MSTLVPPQSKRQKREAQQPREVDIIPSDLPNVLVKFQASDTGES
                     VGSSIRVPGAITEKQLEELLNELNGNSDDPVPYTFSLETENDLVDIKDNLYTSVLKPG
                     LKTTEDFMTLVYTPRAIFKVKPVTRSSATITGHGSTILASQFAPNTSDKLVTGAGDST
                     ARIWDCNTQTIQKTLSGHSNWVLCVQWSPRGDVIATGSMDSTIRLWDAKTGSCLATLL
                     GHTKYISYLCWEPIHLVKPGMKPRLVSGSKDGSIKIWDTGAMRCLMTMSGHASTVSCV
                     KWGGLGYIYSASHDKTIRVWDGNDGKCTQILKAHAHWVNHLALSTDSVLRLGAFDHTG
                     EEPKSEEDEKERARKNFEKVAKIGGKLVERLVTASDDFTMFLWEPTKSSKPICRMTGH
                     QKLVNHVSFSPDGRYVTSSSFDNSIKLWDGRDGKFIATFRGHVAPVYQTSWSSDCRLL
                     VSCSKDTTLKVWDVKTRKLMSDLPGHQDEIYTVDWSVDGKRVASGGKDKTVRIWTH"
     gene            <845185..>845868
                     /locus_tag="C5L36_0D04100"
                     /db_xref="GeneID:40385508"
     mRNA            <845185..>845868
                     /locus_tag="C5L36_0D04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467296.1"
                     /db_xref="GeneID:40385508"
     CDS             845185..845868
                     /locus_tag="C5L36_0D04100"
                     /inference="similar to AA sequence:RefSeq:NP_014879.1"
                     /note="PKUD0D04100; similar to Saccharomyces cerevisiae
                     YOR236W (DFR1); ancestral locus Anc_8.657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323156.1"
                     /db_xref="GeneID:40385508"
                     /translation="MSMNKSSVKYPKVSLIVATLMPELGIGYKGQLPWSLKQEMKYFR
                     KLTTTTIDPDKRNAVVMGRKTYNSIPPKFRPLKNRLNVVLTRNPKSLVEEMKEELDAN
                     KGHLQISGSLPNTLQELKKAEDNGAIEEIFIIGGAEVYNQLMRENYDLIDCIYLTEVR
                     NEETLDMDAFFELDQSKWSKCESAVLHCELEAKKLHKEFELVGNNENGFTYDFTLWKK
                     KGLTAHKVE"
     gene            <846457..>847271
                     /locus_tag="C5L36_0D04110"
                     /db_xref="GeneID:40385509"
     mRNA            join(<846457..846475,846967..>847271)
                     /locus_tag="C5L36_0D04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467297.1"
                     /db_xref="GeneID:40385509"
     CDS             join(846457..846475,846967..847271)
                     /locus_tag="C5L36_0D04110"
                     /inference="similar to AA sequence:RefSeq:NP_014877.3"
                     /note="PKUD0D04110; similar to Saccharomyces cerevisiae
                     YOR234C (RPL33B) and YPL143W (RPL33A); ancestral locus
                     Anc_8.655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323157.1"
                     /db_xref="GeneID:40385509"
                     /translation="MAESHRLYVKGKHVSYQRSKNVTNPNTSLIKIEGVADKDAAKFY
                     LGKRVAYVYKASNEVRGTKIRCMWGKITRAHGNNGLVRAQFKNNLPAKTFGASVRIML
                     YPSNI"
     gene            <847617..>848161
                     /locus_tag="C5L36_0D04115"
                     /db_xref="GeneID:40385510"
     mRNA            join(<847617..847664,847763..>848161)
                     /locus_tag="C5L36_0D04115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467298.1"
                     /db_xref="GeneID:40385510"
     CDS             join(847617..847664,847763..848161)
                     /locus_tag="C5L36_0D04115"
                     /note="PKUD0D04115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323158.1"
                     /db_xref="GeneID:40385510"
                     /translation="MAIPWEGLIPYGLILAFFSLAGGGMNAITIASLTRNAQGPTHES
                     KYAVETEDKDWVRPRTKTDQWDKYLAVRDLRLTGSFRGQKAEPEAEEAFETNSVVFAS
                     NTLKPWVLRKHLIMKNSPSKWMKKYHSEREQQWESVKENYLRSMQK"
     gene            complement(<848423..>850942)
                     /locus_tag="C5L36_0D04120"
                     /db_xref="GeneID:40385511"
     mRNA            complement(<848423..>850942)
                     /locus_tag="C5L36_0D04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467299.1"
                     /db_xref="GeneID:40385511"
     CDS             complement(848423..850942)
                     /locus_tag="C5L36_0D04120"
                     /inference="similar to AA sequence:RefSeq:NP_014876.1"
                     /note="PKUD0D04120; similar to Saccharomyces cerevisiae
                     YOR233W (KIN4) and YPL141C (FRK1); ancestral locus
                     Anc_8.654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323159.1"
                     /db_xref="GeneID:40385511"
                     /translation="MSQYATVEIPPHQKKHIDGSTGKRKPHREVRFGNYVLGSTLGEG
                     EFGKVKLGWRKDGKLPSQAAIKLIKRDSIPTGSQKEEKIYREISALKKLRHPNIVRLV
                     EVLQNDKYIGIVLEYASGGELFDYILDHRYLKESMACRLFAQLVSGVNYMHSKGIVHR
                     DLKLENLLLDKHKNIIITDFGFVNTFQNSANDLMKTSCGSPCYAAPELVVSNHPYEAR
                     KVDVWSCGVILYAMLAGYLPFDDDPENPDGSNIARLYHYITHTSLTFPEYIQPTPRDL
                     LRRILVSNPKRRISLKEVTTHRWLAPHMPFLSVSPIEWDKNYRTSKLLAHQQDNYNNR
                     RMSLMENPTSASLMLNKPTSHRPYSTQNVKSLLYSNPAAPQTSKTVAIPSDDSSPISS
                     PLKNSMTISMDSSSDQINQGITRHSRSGSAASLVLQAVVEADTEKKKRYSNGSSEILT
                     TPVKNTKQRPISFVPLLSDTANIFTVDNSNNSISSISINNSNNMNNINLNTNNKNRNF
                     ETIKESPEHSKISNVLPPPTPIFNKPSSNTHSSTTKLPSSRINKPRPTSYHPSYASNF
                     TPSDLSYLSSTNHSEGSLKLNTGTSRVKIANSSVYSSTSESLISTSLKEMVIPESVDD
                     DQTNTQTGQLESITKSFDTLSLNKPSATSPIISDKIKFFNEDVETINTKTSAANNNND
                     PDSTIIENDDSEKENLPSSSSNILPNEDIKPQPTIENPKYKRFSLLSFYQTTPGPSEP
                     LTLNKRSPLSPHPEYEAKSRNVSSSNPNASSTATAHANSNSNAKSAKTNNKYTEASTN
                     KSERRVSSVNVHDSKKADRVERETSTARKVMDFFKRRSMRI"
     gene            complement(<851443..>852501)
                     /locus_tag="C5L36_0D04130"
                     /db_xref="GeneID:40385512"
     mRNA            complement(<851443..>852501)
                     /locus_tag="C5L36_0D04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467300.1"
                     /db_xref="GeneID:40385512"
     CDS             complement(851443..852501)
                     /locus_tag="C5L36_0D04130"
                     /inference="similar to AA sequence:RefSeq:NP_013614.1"
                     /note="PKUD0D04130; similar to Saccharomyces cerevisiae
                     YML095C (RAD10); ancestral locus Anc_8.874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323160.1"
                     /db_xref="GeneID:40385512"
                     /translation="MRLLSIPSLEHWIVPTLNRRKVCLSCIVKGIMDNNDKTAKEINM
                     DSSSMASVLAAVGRMRDEFENGSSALTNQDTDMSHKRQKVGQGASLPPPVSRRPDLTT
                     NRNAQVGTIPTSTSTSTSTSTSTSTSTSTARSTFSKRTSRTILVSRSQTGNPLLEHLT
                     FYETSPLLRDVDYQLSPSCAVLFLSTKYHQLHPEYISTRLQKVRHARFEPGNTIIVLL
                     LIDTENFQAPLVELNKFAIRNSLTLLVAHSNIEGATYLNNLRAVASSSTTARASVGKL
                     IAGKEAQTALEGAIGSLKSIRAINTRDSQRLLAQFGSIRDVVLHADASALENVDGLGP
                     RKVDSLVDALRGEFMLKE"
     gene            <852714..>855368
                     /locus_tag="C5L36_0D04140"
                     /db_xref="GeneID:40385513"
     mRNA            <852714..>855368
                     /locus_tag="C5L36_0D04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467301.1"
                     /db_xref="GeneID:40385513"
     CDS             852714..855368
                     /locus_tag="C5L36_0D04140"
                     /inference="similar to AA sequence:RefSeq:NP_010882.1"
                     /note="PKUD0D04140; similar to Saccharomyces cerevisiae
                     YEL032W (MCM3); ancestral locus Anc_1.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323161.1"
                     /db_xref="GeneID:40385513"
                     /translation="MDATLTSTTDMVFDDRVRVFQNFLSTRVNDVPIYEREIQRMLRS
                     RKKRLPINIDELRRFDPRFAEGLLDTPADYFPAALKALNETVLALYNPVEMPGIDKVD
                     EDDYYLSFVGSFGAYSVSPRTINSSYLSKMVSIEGIVTRASLVRPKIVKSVHYNERKN
                     FFFSRSYQDQTTSFDPINTPAIYPTEDPEGNKLETEYGLCRYRDHQTITIQELPELAP
                     PGQLPRSLDVILDDDLADSCKPGDRIQVIGIYRSLGGGLNDNGAFKVVILANSVYQLH
                     ALSTSSRVSENLTTADIDNIVRLSRKRQIFDLLSESLAPSIYGHSYIKKAILLMLLGG
                     TSKTLDNGARLRGDINILMVGDPSTAKSQMLRFVLNTAPLAITTTGRGSSGVGLTAAV
                     TTDKETGERRLEAGAMVLADQGIVCIDEFDKMNDIDRVAIHEVMEQQTITISKAGIHT
                     SLNARCAVFAAANPIFGQYDTFKTPQQNIALPDSLLSRFDLLFIVTDDINDERDRRIS
                     EHVMNMHRYIPQGYSEGEPIRDKSNIRLAVGDHELEETGDKSSKVFLKYNPSLHAGVT
                     VKTSKGETRPLVLTIPFLKKYIQYAKTKEPIMSEHAKNLIVDIYASLRNDENTKNSRT
                     TPITARTLETLIRLATAHAKIRLSATINVKDVKIAEELLRFSLFKEVNKKSSQNSSNK
                     SPRKKRKTNVDGAELSSEEEDDDEGVHDGREEHNILSTAQPNLQPRSPSRITRSLRSN
                     ADVVIHEDKDVENVRRGLQNLETSPTSNKENIIPVEDTTPTRSTTRGIQLTESTTLQP
                     VEVEGAENEHFDGEISENRYQLFKRTLSVILRNDKRDQYLISELSELINGQLSQEDRF
                     GPAESQAALHLLEIDNVVMTSENYVYPI"
     gene            <855510..>856145
                     /locus_tag="C5L36_0D04145"
                     /db_xref="GeneID:40385514"
     mRNA            join(<855510..855607,855677..>856145)
                     /locus_tag="C5L36_0D04145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467302.1"
                     /db_xref="GeneID:40385514"
     CDS             join(855510..855607,855677..856145)
                     /locus_tag="C5L36_0D04145"
                     /inference="similar to AA sequence:RefSeq:NP_011543.4"
                     /note="PKUD0D04145; similar to Saccharomyces cerevisiae
                     YGR029W (ERV1); ancestral locus Anc_4.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323162.1"
                     /db_xref="GeneID:40385514"
                     /translation="MAEDKHEKNQVPTGMPTFGASGRKIIYDENGKPCRSCNTLLDFR
                     SVTKNSSLVTPAKAAAGVAATSAAGTTDITANDCPPDVEELGRSTWTLLHSIAATYPE
                     NPTPEQKNYLKSFITSFSHLYPCFYCADDFRENIRKDEVKVGNRDEFGQWLCDQHNIV
                     NEKLGKPKFDCKLWKERWKDGWKDGRCD"
     gene            complement(<856218..>858692)
                     /locus_tag="C5L36_0D04150"
                     /db_xref="GeneID:40385515"
     mRNA            complement(<856218..>858692)
                     /locus_tag="C5L36_0D04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467303.1"
                     /db_xref="GeneID:40385515"
     CDS             complement(856218..858692)
                     /locus_tag="C5L36_0D04150"
                     /inference="similar to AA sequence:RefSeq:NP_013441.1"
                     /note="PKUD0D04150; similar to Saccharomyces cerevisiae
                     YLR337C (VRP1); ancestral locus Anc_4.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323163.1"
                     /db_xref="GeneID:40385515"
                     /translation="MPPPPPPPPPPPPMAPAAPPASSAGGLPKVTPDRNALLGDIRKG
                     KTLKKAVTNDRSAPLVGGSSPSNAAPPMSPMVPASGPSAPAVPSMAPQLGDIFAGGIP
                     KLKHVSKPRNPTSSPGSAPSVPTGRPIGRSSKPPTTNGVPSIPSALPPSLPSASPPSI
                     PPAPPTPAPPLPSASAPSIPSFNAPSTPSLPSQRPNVPSKRPNTAFPKSSAPPQLPSL
                     SAPPLPGSTPPPLPSGNALPSASSSSSPQPPPPPPPPPLSGNAPPAPSKPSSGASAPP
                     ITAGGLPFLNEINKRRDDRFVVDDAKVSKASGGIPPSPQHKDPSLPLTSAPPVPSSHA
                     PNPPNLPSAPPPPALATNTRLPNRPFASPSPFTNSPKPRSPLPSRSSPQPPPLPSSSA
                     PPLPSSNAPPLPSSCAPSPPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAPPAISGSSS
                     SKITSSAPKTSGLGGGLPFLDEINQRRNDKFVVDDNIVAQKKKQTTSAPPAQETIEVK
                     SSVPSVPSTPQPSGNPLLDEIMKRTHQKPSSSTPPVAPSVPPQHTSPPKTIPTNAFSK
                     ETSASHSLSSAPPVPPSIPPSIPPSIPSSTGAPSPPPPQPPQVPPMSTPSPPSSLSHP
                     PPPPPQQKTAVSTLAHTPLQPDTSDSISVFSSSTVSTKKKAPPPPPPPSAPAPSSVDP
                     SLNNAPDLSCLNLNSEPVQPVVKHQEGLFGGIGSKLKLGKYHHQRGPSNTQTTDQIVQ
                     QQIAGNQIRKIDVSAYTITGSSNGAQLATSNAGSTKASGSLKIENPRFKFENQIDIPK
                     PHKYEGRIKLYPSGRGSSMPLNLSDF"
     gene            complement(<859050..>859709)
                     /locus_tag="C5L36_0D04160"
                     /db_xref="GeneID:40385516"
     mRNA            complement(<859050..>859709)
                     /locus_tag="C5L36_0D04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467304.1"
                     /db_xref="GeneID:40385516"
     CDS             complement(859050..859709)
                     /locus_tag="C5L36_0D04160"
                     /inference="similar to AA sequence:RefSeq:NP_014875.3"
                     /note="PKUD0D04160; similar to Saccharomyces cerevisiae
                     YOR232W (MGE1); ancestral locus Anc_8.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323164.1"
                     /db_xref="GeneID:40385516"
                     /translation="MYMISHKSLKGSLAAFRLQARFSARRPFSQSALMFNAKDSAGEE
                     TKPTDGEEAGAADPVEELKAKLAKKEKEYVELKDAYVRSKADFINLQETTKREIQKAR
                     DFALQKFAKDLIESIDNFGHALGAVKEDSIKTNDEIKLLYDGVKLTRDVFEKTLHRHG
                     LAKIDPIDEEFDPNRHEATFQAPHEEKKPGTVFYVQQPGYELNGRVLRPAKVGIVKGD
                     D"
     gene            <860269..>862089
                     /locus_tag="C5L36_0D04170"
                     /db_xref="GeneID:40385517"
     mRNA            <860269..>862089
                     /locus_tag="C5L36_0D04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467305.1"
                     /db_xref="GeneID:40385517"
     CDS             860269..862089
                     /locus_tag="C5L36_0D04170"
                     /inference="similar to AA sequence:RefSeq:NP_010514.3"
                     /note="PKUD0D04170; similar to Saccharomyces cerevisiae
                     YDR228C (PCF11); ancestral locus Anc_8.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323165.1"
                     /db_xref="GeneID:40385517"
                     /translation="MSMSTHSSAVSGNGASFAEPSKGHGSFGEQYAASLQELTFNSRP
                     IIEAHTLLAEENTAHALEIVVAIEERIEKAIPSQKLYSLYLLDSISKNIGLPYTNLFS
                     NNLFKTFTRTYGLVDDPTRCKLIKLFKTWKVPTAATGLPLFDQGQLDRIEEFLIKVTN
                     PLVNNNRTVADSMKNANLGSGGTFNGGPATDILNKDKFTLINETDELLRMVDARLKVM
                     SDTKTQQRYTLLNKLKTILGGKSSIPQAQLDEVAKQLHAIRTDEILKSNSIKREKEAE
                     LFKLQQQQQQQQQQQQQQQQQQPQNVQPQNVQPQNVQPQNVQPQTVQPQISSLQGLLN
                     LSNQAPVANPLGLKNLSFLENILKKTSNGGINETNTTNAPQVDFKFIKPSKKVIVEDA
                     VLDQKFINNHVPTITDISLLYEFKPIQCKECGRRFSDDEAGAVAKRQHDEWHQRVDAR
                     MRTGGSGLGGVVNRSWYLRGREWMEFEYNEDEIDKHGLSVNGDKHGSSNDGSTCLRKD
                     KEGDKDKREATDEGSSKYEHFDPSEAPKHIVRIPESSSNEVVCAICRDKLVGVFDEES
                     GDWIWRNAIMYRSRVLHWSCYMETRQRGRRSLGRERSPQR"
     gene            complement(<862484..>862651)
                     /locus_tag="C5L36_0D04175"
                     /db_xref="GeneID:40385518"
     mRNA            complement(<862484..>862651)
                     /locus_tag="C5L36_0D04175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467306.1"
                     /db_xref="GeneID:40385518"
     CDS             complement(862484..862651)
                     /locus_tag="C5L36_0D04175"
                     /note="PKUD0D04175; Pfam Domains: NDUF_B12(2.3e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323166.1"
                     /db_xref="GeneID:40385518"
                     /translation="MAFADPWKKRDAWRTQGVFAKGQRFKGAFPGLYLGFGLFVAYSL
                     YEDYIQPKPHH"
     gene            <863553..>866417
                     /locus_tag="C5L36_0D04180"
                     /db_xref="GeneID:40385519"
     mRNA            <863553..>866417
                     /locus_tag="C5L36_0D04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467307.1"
                     /db_xref="GeneID:40385519"
     CDS             863553..866417
                     /locus_tag="C5L36_0D04180"
                     /inference="similar to AA sequence:RefSeq:NP_014375.1"
                     /note="PKUD0D04180; similar to Saccharomyces cerevisiae
                     YNL023C (FAP1); ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323167.1"
                     /db_xref="GeneID:40385519"
                     /translation="MVDLRTTILSEIVSSNYTCLVCTDHITPTSKIWSCSNCYRAFDL
                     SCIQDWAKRGSSTQDDRSWRCPSCNYSHLKIPKLYTCWCGKSINPTFNYLEPHSCGNL
                     CSKSLETCHHDCTLTCHPGPHIEKCTSLGPIMKCHCGKNSRQLPCINTPYDEGWSCEE
                     ICNDILPCGIHKCQKKCHSGNCGDCHSNLEVFCYCGKSHDLIKCNERLPKKSIVSFNK
                     SWIGNFQCSNPCNIKLDCGIHTCVEGCHPLNNDSHKCPNSPLNLSFCPCGKTKINDLL
                     QHPRESCLDPIPTCDKVCGKRLPCGHKCYWNCHEGPCAPCYQVVDLDCQCGTCHYSIA
                     CGLKQDGYIPTCNTKCGAKFNCKRHYCAKRCCAFRKIALDRSKLIKKQLRNNLITTSV
                     VESLEIEKEHTCEKVCDQPLSCGKHRCKEICHPGSCPPCLESSSDDLVCHCGKTVVPA
                     PVRCGTTLPVCPYQCKRPTLCGHRPEPHHCHEDNIPCSKCTMLVTKTCQCEKQNKVTN
                     VMCYQEIVSCFKICGKLLPCGKHKCKKTCHKPGECQIKCNEKCLMPKKCGHLCQQVCH
                     QSKPCNENIPCRETLMISCDCGRRKQPMLCFSVTKMIEDNSQDDETYIPHIECDEICI
                     KQRRSKMLFEALGLDPEKNKETELSLQMRMVEALYSPFVLNLYAKQKTWCLSIENIFQ
                     KLVSETIETSFQSMSNSSLKQSYHFRPMKEIQRRFIHELAETWKLLSESHDREPKRSV
                     FIKLLKSSHIPDLSLEEAYKIQKDYKEMKKNQAVKKANSIKFSEDDKSRLATPTLDDE
                     SFIPFNAVLLKDVFFGVTVNSMDAALYDLWTSINSFGERRFSLIQNGNVEFISENIFL
                     FVCDCIGTDADKETKFELERQIKELSTLFNDKVKEKNLAMKCIPAKIDKENNVVLEIM
                     TEEEPITPTELEDTVSAVDDISKELESVSIEESTVSSEWW"
     gene            complement(<866471..>868423)
                     /locus_tag="C5L36_0D04190"
                     /db_xref="GeneID:40385520"
     mRNA            complement(<866471..>868423)
                     /locus_tag="C5L36_0D04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467308.1"
                     /db_xref="GeneID:40385520"
     CDS             complement(866471..868423)
                     /locus_tag="C5L36_0D04190"
                     /inference="similar to AA sequence:RefSeq:NP_010939.1"
                     /note="PKUD0D04190; similar to Saccharomyces cerevisiae
                     YER022W (SRB4); ancestral locus Anc_7.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323168.1"
                     /db_xref="GeneID:40385520"
                     /translation="MEPIAEDHSMEKSETSEVDSIYPLPQINYLKFNTSIIKGEHLDL
                     PNPYYRQQLEAERELNDYTHLSENTVRRIIDKYGSFNRLSEEKIQNILDGNAQVGTQL
                     NRGDGLMDDGSKFEDFNAFNDISEDVKNDQSLIDVNVRREELLNNVRTALGSSTLALD
                     FVSLLLSGAKPNAGLSSLSDHIKQNLKAGSLSADKVSLDVADPQEHEQQKESESMKIG
                     SGWKLESLKKSSELLKETVKNLNKSLDERHTYWNEVLEVLEANEVITAVTTQVAVEPG
                     RSSSSLPLSSSLKTNQNGEVKQKKVLAVKYGYGDSGSEYFDKGIAILKQGEEGHLEFE
                     KLNQNEREKTWGGEKIVSVKLFRYAQAPNEQPELVGQSDSYGTIEREVIKNSNSFVSK
                     IKNSRFFIFENELFWQLMKEAAGLVTFRIHVIGSSRIQIELYDTIIQIDSLDIDSEEL
                     QKPTPKLSQNQRADNMVKLFRILLCANNYKNVQKLFTPRVALNKDQNVMKSRHGFLLR
                     PLLMYTKHNHTIHKLEKLLFDLLLEIGMDEVDAKATFTNNMTIKKYVNDPNQLQQFQN
                     SKRCYNNDPFLRVSSKLAPISMLILKVRGLLICIKLESSYTTLHITMNVKVTKVEDKQ
                     ILLESTFNSKRDTIKCLSWILQQSGI"
     gene            <868709..>871108
                     /locus_tag="C5L36_0D04200"
                     /db_xref="GeneID:40385521"
     mRNA            <868709..>871108
                     /locus_tag="C5L36_0D04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467309.1"
                     /db_xref="GeneID:40385521"
     CDS             868709..871108
                     /locus_tag="C5L36_0D04200"
                     /note="PKUD0D04200; Pfam Domains: Patatin(6.3e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323169.1"
                     /db_xref="GeneID:40385521"
                     /translation="MEKETHLPTGFEEDYINESHIQEFEKALKYEDQEDNSYLSRDDS
                     VVSLGGVTTPKSTGIETITSQSDWMPVYNKTKRKTRRNSSFTERHPLLRRQTSNIHTS
                     GAETETEKPLSSASSQYMGAYDEYSLTFTILRYPLLAFIIGWTCVLSFLYFLVRLSIT
                     LSEKLILAKDKKRTQLLDSLKNSKNYDEYIAHAKKLDEYLGLAEWCNQDKYKYYDWRN
                     LRKTIHNLRKFRYTQRYDDLMVVLQTCVKSNFAGTENPLLYSHCYYGTKKLIERYNAE
                     VVKSLETIIKAENISLKEKRIFFKIINKNFGRTCLVLSGGASFCYNHFGVIKALIEND
                     LMPKIVSGTSGGGMIAALVGSRTNEELLKLITPKLSSKMNAFGTEPFWEGIKRWWKTG
                     ARFDSVDWARKAQWWTRGSTTFEESYKKTGKIINISTVPNDIHSPTILCNYITSPSCC
                     IWSAMLASAAVPGILNPVMLMEKTKDGTVRPFSLGSKWKDGSLRTDVPLSTLNMYFNT
                     KFSIVSQVNPHVMLWIFKNRGDIGKPVVRSKGKTYRGGFILSYLENLIKLEIIKWLKL
                     VKEFQLFPNLLESDWSNIFLQNFGGTITLFPKIVLSDYKYILSDPNEERLESKIRNGE
                     SVTYPKLLFIKHRLNIERTIEKGLEATRINIDDTADAPPNLVQNIIENNNNLKNSEDA
                     INSEVDDVIPDAANCKNTQVVDKDQDISNEEDLSHSLSSESDVPYGSDDLPSDHSEYK
                     DESDDVYGNNLDTLLNTEHIGRANLGFLGIQMGIDIENSSDFSANDGSFNEDNFFKND
                     S"
     gene            complement(<871177..>872412)
                     /locus_tag="C5L36_0D04210"
                     /db_xref="GeneID:40385522"
     mRNA            complement(<871177..>872412)
                     /locus_tag="C5L36_0D04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467310.1"
                     /db_xref="GeneID:40385522"
     CDS             complement(871177..872412)
                     /locus_tag="C5L36_0D04210"
                     /inference="similar to AA sequence:RefSeq:NP_009830.3"
                     /note="PKUD0D04210; similar to Saccharomyces cerevisiae
                     YBR271W (EFM2); ancestral locus Anc_1.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323170.1"
                     /db_xref="GeneID:40385522"
                     /translation="MSFEPLSFFEPDTKVKRVGEQDEIETFNLESQNTYEKVTEEEPK
                     DEEANFVPLEVLDLPTISTSLPTEVITTVLKLLQPEQVKNFGNQRRQIPSLFTTEELQ
                     EYLNSKHLTMVEVVKLSEYIGHNLKSTLTITQLPTCSSSEVTAYLTKIIACPFLNLTE
                     EERNTIYDLASFVMTANFAPALKGNTTRMVQIDGLEREILLYEPALTEDKVGNITWGA
                     SLELAKLIVDGCSEEWISNKETTILELGAGTGLVTIVLGILMHKVVSTDLPEIIDNLS
                     KNIMLNKLHCTLSQSFETFDDTSLINVTSLDWRDPLDFLQRTHQPEGYKTIVISDPVY
                     SSQHPYWVQKAVNATLSKDDSSRVVFMVGQRDRFQDVRDNLWRLMIESGLKVISEKVI
                     NGFDDYGELPYDYKVFGWN"
     gene            <872617..>873495
                     /locus_tag="C5L36_0D04220"
                     /db_xref="GeneID:40385523"
     mRNA            <872617..>873495
                     /locus_tag="C5L36_0D04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467311.1"
                     /db_xref="GeneID:40385523"
     CDS             872617..873495
                     /locus_tag="C5L36_0D04220"
                     /inference="similar to AA sequence:RefSeq:NP_012463.1"
                     /note="PKUD0D04220; similar to Saccharomyces cerevisiae
                     YJL072C (PSF2); ancestral locus Anc_1.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323171.1"
                     /db_xref="GeneID:40385523"
                     /translation="MVLDKRLIERSLSVKEVAFLAEQEPISILPRYTMNGIKLIGRDM
                     KKLKPLQKTDVPLWIALLLKKQHKCNIVIPPWLSVPYLKNKHAEEQRLKDRVTDLPWH
                     WIPTAKLLLEACPDDFIDSPHEIRSLIQDLREVRLLKTRQGFTQIDDDYLELTGLSLM
                     EINEIRPFLLQTMDKLHDLKKVSAEEDVNNAEKGDYSRHNSNHENLNENYNHNININS
                     SFQGNGSRYDSSDVDEELSHNVSANDATLVEQQPAPMPATKRQRVGPRANTSTEAHTN
                     NMASDSDSDSDVEYRR"
     gene            <873753..>874616
                     /locus_tag="C5L36_0D04230"
                     /db_xref="GeneID:40385524"
     mRNA            <873753..>874616
                     /locus_tag="C5L36_0D04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467312.1"
                     /db_xref="GeneID:40385524"
     CDS             873753..874616
                     /locus_tag="C5L36_0D04230"
                     /inference="similar to AA sequence:RefSeq:NP_009744.3"
                     /note="PKUD0D04230; similar to Saccharomyces cerevisiae
                     YBR185C (MBA1); ancestral locus Anc_8.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323172.1"
                     /db_xref="GeneID:40385524"
                     /translation="MLSRSLLQGARIPIAPRAFLRYASTTEIVTEKKDTSLGLGTKSR
                     KKKQQRPTINKVGVPHDPYIPVSYNHLKLSQPGKVLRALWNRVKLFAFNWVQVYQFKS
                     GMGKGYKPQFVAWKNKAITEFVRVNKAFSERRIESIRDEVSEFVYFQLGKRQAALPNA
                     LIEWELVKFNSPPKLLSFNAFPHEDGSTLLCQIIYKFDTKQKWIVKKRGEDKITETER
                     DMVEYLAFNIDPYNDNVCLAGSVFEAPLDRKLESKVVASQTKALEYMNINGDIYRTEP
                     TDEEKMLQYKD"
     gene            complement(<874775..>878566)
                     /locus_tag="C5L36_0D04240"
                     /db_xref="GeneID:40385525"
     mRNA            complement(<874775..>878566)
                     /locus_tag="C5L36_0D04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467313.1"
                     /db_xref="GeneID:40385525"
     CDS             complement(874775..878566)
                     /locus_tag="C5L36_0D04240"
                     /inference="similar to AA sequence:RefSeq:NP_009449.1"
                     /note="PKUD0D04240; similar to Saccharomyces cerevisiae
                     YBL101C (ECM21) and YPR030W (CSR2); ancestral locus
                     Anc_7.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323173.1"
                     /db_xref="GeneID:40385525"
                     /translation="MPSLRLPDSHTVPQSLSSVLLPNNTSSSQEDRKSPQIGSRNHDV
                     DKVAPHIVINGNDMDNFSALSEPTDDFSLYKDTVMRQNLTTNASIVSPVASNNILMDT
                     NLKEHNKALIAYLNQQGLNMNPLKLSPFHIKEKSIINNLGHHHHGLFHLSPSANPNIE
                     TFITGNGQILFLPYNPQKKKRRRRNRSSQDEYNDEDNDHEDMDDNEQNMEADEPYDPC
                     DYNNASCSNILNDSNTQQNIQSSELNHNITYHTFGVIVKIRKSTSLNQLIKVDYHTHL
                     SLKWSGPDYSKKEPIDERFKCSENINWDLNLSNPDCYIPMDLNADPSINTEMSTIDDS
                     SDSISMESLSNLRKYSDIEYSAKPTQNIKKYTPLSSKNLVPESTQLNNDTFVEENMFQ
                     ATIENSTKSFSAGYYIFLLPVVYPLNTPETIYLRNAALQHSFSIQIQKGAVAIPTLKA
                     PQTVFLSTSPTHNKHYDDQSNSFSSALSSQTMVNVNDSISTTNTLKSSFFKKLGIRRN
                     SVSSNTSDHINIGSPPTPMKQNPFNTHHSKNPTIYHYNYKLPAIRLPPSDATSTLNKS
                     IYVNKVWNDALNYELLLPRKFTQLSPPKNIHVGANDKFLKENNYLLQMKLVPLQKSLL
                     LKRIKINIVEKVTYISNSIPVERKNTRSEERVISMLEITTKEKQTFKGSGSQVPLKTH
                     IIKDCQNDNLLTYCYEAETSSDPKKKFTSEVPVKAHSHTTNTGFHPSSILKSPKKSSK
                     YSDSQQDTCSFFTEPDVVITNPVKLQCPLNFVANDDEKFIASVYDHLSTDVTDLNELN
                     DLPESSSKVDSMSIFSVNSANDNHDQFSDDDSFSLTSKFSPKRQRGFSFSSLKSKDKE
                     TGASPSDKSDSHTFLPDTTSPHLKIRHRLQISFRISKPDPKLKNPDGKPKMHHYEVIV
                     DTPIVLISPFCVVDALELPSYDDAVNMKTFDCTLPSNKFSISPVTSDDLAFTDLDSDP
                     TFAPCSPLMSGTLPQINHDYSHGSPIMSFPGSPITNALGASPQSQYEIASTLPSYTSS
                     EILFNRKRSNSSQHSNANPMNATSLLSAAFAKSRNRANSLNSMLASNEMSSLSLKSSE
                     SNSNITLPPNYNEIRKDDTGIPSIPPVYDTVVENSLKSKVETVLSPQYIDKSRLRVDK
                     PVNIEAELKDTLETDTGSKLSVMGSMNEQENTPFDARSSLSKASTASENLKLINEDEN
                     KDSDLLMKLHSTSSFNINLDTETRPNSLEVNSREDIESIVNMNVGKIATLNLTTSHNE
                     R"
     gene            <878800..>880224
                     /locus_tag="C5L36_0D04250"
                     /db_xref="GeneID:40385526"
     mRNA            <878800..>880224
                     /locus_tag="C5L36_0D04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467314.1"
                     /db_xref="GeneID:40385526"
     CDS             878800..880224
                     /locus_tag="C5L36_0D04250"
                     /note="PKUD0D04250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323174.1"
                     /db_xref="GeneID:40385526"
                     /translation="MSKTKPMEELTREEAFLEETPISDSGISNFHVQDPIIECDKSPR
                     LEFNQRQSLESYINPPLELYKNQDLSSTSSPNMVLLESTKDYSLSSSSNNCSENTKIN
                     HNNNYCSNDNDENNRNKNNHSSNDTARSFNPAESHANSESNLHPKKTSTVPSPLNLPK
                     RFKKNQLDQNSIQMLEPLQSLQNAMHQLFYNPSTGQIIALPVRNSMATPVQSSVVNGT
                     PCHQQLLPTVSNRQQSMIPQYQIVYMRAANGQLVPLLAPISGQQVQRQTPGTSCMKRS
                     SSSDANDSPTSFSSQHASNLYKRMKPEESQPCMQTQRNSTAISSNSNVLARLSPTQRA
                     EQIQRQQIWLQMQLHPDLIKGQGNTNVSDIYENNLPNGKVSSTSADETHDEVPVPSGN
                     NRETLSSSSGNNQLNTSAQSLDTQTLPLDTELLVDSQKVIGTVTVGSFTYKYSQTLSG
                     NIVKDRELFDRLTDNAWKTCISKH"
     gene            <880546..>882912
                     /locus_tag="C5L36_0D04260"
                     /db_xref="GeneID:40385527"
     mRNA            <880546..>882912
                     /locus_tag="C5L36_0D04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467315.1"
                     /db_xref="GeneID:40385527"
     CDS             880546..882912
                     /locus_tag="C5L36_0D04260"
                     /inference="similar to AA sequence:RefSeq:NP_012788.2"
                     /note="PKUD0D04260; similar to Saccharomyces cerevisiae
                     YKL134C (OCT1); ancestral locus Anc_2.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323175.1"
                     /db_xref="GeneID:40385527"
                     /translation="MRSSTALCNRQQVCRYGPRLFIRLLSHTKRNLIPTDLENEKIIT
                     KIFDSPEYWRSFNRPDDSRNSNPFQSTRKILSSLQSNSSNSVGLFANPYLTSPNGLKE
                     FANETLEKARALTRHMIEDQSFSAMKDYIKELDRLSDMLCRVIDLCEFVRVAHPNSSF
                     VKAAEECHYALFEHMNVLNTSKPLFEKLGKVLYDDQLGINKQLSKEEISVGKLLYADF
                     KKSGIDMDEQTGETFVQLSSYIANAGQEFNNNITIPKDTSVRILPSEWKKEDIKPEYL
                     KQMTQSFDGALAIPIYGHIPFEILRSCPNRIIREKVWIALHSVPEEQLTLLTNLLKCR
                     QYLAKLMGCENYAQYALADKMAHNPENVMRFLQGLIKDLQPEVLKELKLLSKYLPDIK
                     GNVKNEELVDMIKPWDREYLLTKYILSLKSSQNEDISQYFSLGTVVSGLSKLFNSIYG
                     IKLVPQKLQYGEVWSDDVRRLDAISDKDGKVGIMYLDLLQRNGKTPHPAHFTVCCSRK
                     IDERELDTNDPFNLTLPTTATVETIKQNGDTYQLPVISLVCNYTMNPHTKMVFLTLDQ
                     VSTLFHEMGHAMHSMLGRTELHNVSGTRCQTDFVELPSILHETFANDVRVLSSFGKHY
                     QTGEKVPETLIKRHLESEKALKHCETLGQVKMALLDQLYHGSTGFNLDDESFNIIDLY
                     HQLESNIRIFADTKSSWPGKFGHLYSYGAVYYSYLLDRAIASKIWDELFEDDPFSREA
                     GEKFKNEVLKWGGSRDPWVCISHVLNVKELEEGDANAMQFISKAQGKL"
     gene            complement(<883025..>884452)
                     /locus_tag="C5L36_0D04270"
                     /db_xref="GeneID:40385528"
     mRNA            complement(<883025..>884452)
                     /locus_tag="C5L36_0D04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467316.1"
                     /db_xref="GeneID:40385528"
     CDS             complement(883025..884452)
                     /locus_tag="C5L36_0D04270"
                     /note="PKUD0D04270; Pfam Domains: Peptidase_C48(2.2e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323176.1"
                     /db_xref="GeneID:40385528"
                     /translation="MRITFNKYKGSLEDTAGLADEYINVNTKLPLLEQTAKTRKKNHP
                     KYVTTGFDSLNIAWTILPFDPFGEADLDRSDSETFVTLQNNGRRLRDCCHVSISNETR
                     EDQLSSHTSLYGQEVLDQDEDENDLQSVNVDEGKKGSKFKNSLEEQRHIRHLAKNHKH
                     KAKMDKQLKKKQTKRQSKPNDLHAEQPVESKVSILKSLLHDCLSVAGAKSGEPLLECS
                     KIVQIEDAPIYNSDLRNLLDDEWLSDNNISWVYAFLEYGYILPLLSVKLQNSKFVQYQ
                     YEEQKHIFKSPISLLFPSFTFLIANHPDPKELVHVLPDNIKEAQFIFCPLNDNDDFAS
                     SEGGSHWSLVVFTKLLSTDHKNKNSYVQKALVFDSLYEANSLETESLVKNMAAILYNP
                     DDSKCQADWEIVHVRDTPQQTNNSDCGVYVASITASLTAQLVFLALSGENSYIDFSLS
                     NLRFSAVDSRIWILSTILNSLENDE"
     gene            <884620..>885057
                     /locus_tag="C5L36_0D04280"
                     /db_xref="GeneID:40385529"
     mRNA            <884620..>885057
                     /locus_tag="C5L36_0D04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467317.1"
                     /db_xref="GeneID:40385529"
     CDS             884620..885057
                     /locus_tag="C5L36_0D04280"
                     /inference="similar to AA sequence:RefSeq:NP_013000.3"
                     /note="PKUD0D04280; similar to Saccharomyces cerevisiae
                     YKR074W (AIM29); ancestral locus Anc_5.659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323177.1"
                     /db_xref="GeneID:40385529"
                     /translation="MSEYNIEEPLTSTARPLNDSVLTVRIIKSFPYRNIRNHVFQHVD
                     LTSTTPRQLLELVKRTIATEGSLRPYRNVDLDTLKVYTHAHGTKTMNLVINTDHDDDP
                     NWVLDLSENGRPLAEYGVSNETELSVFNLADYEAYKANPEDKW"
     gene            <885320..>887557
                     /locus_tag="C5L36_0D04290"
                     /db_xref="GeneID:40385530"
     mRNA            <885320..>887557
                     /locus_tag="C5L36_0D04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467318.1"
                     /db_xref="GeneID:40385530"
     CDS             885320..887557
                     /locus_tag="C5L36_0D04290"
                     /inference="similar to AA sequence:RefSeq:NP_012218.1"
                     /note="PKUD0D04290; similar to Saccharomyces cerevisiae
                     YIL046W (MET30); ancestral locus Anc_7.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323178.1"
                     /db_xref="GeneID:40385530"
                     /translation="MKLHFSRFSKCLPSLQQINDYFILPIGFSTKPFYLYPKMKSRMQ
                     YLQRSCLEGVFPDPSSLENQAQESVQEDQNKVPHSTQNINALEVPITELDTKTGKPLA
                     ETKSDAGIADSSCKHALDLHKHGDDNMKSPRKKSKVDSTLQVFNMDTKYCYRHNPRIR
                     CNKMADKKQLTEIQNKLETFSRSDQQTITSVWSTFANASSSQRSLILQGLIAQCCFPQ
                     LSLISHEISHLLKIDFLEMLPGELALKILCYLDCQSLCNAAQVSTKWKQLADDDRVWR
                     YMCEQHIDRKCPQCGWGLPLMAVQKLQENSKSSRRFSDGEDTASQPQFLAVSSSVPQC
                     PTLAPASTALVDGSSNGNPTCAPYKVLRKKRPWKAVYSERYTVERHWRKGYYSVRTFE
                     GHKDGVLCCQYDNKNLLLTGSYDATVKIWDANTGKLIRTLKGHTLGVKSLIFDDHKLI
                     TGSLDSTIKVWNLKTGECISTYPGHREGVISVDYICKLIVSGSADKTIKVWHVDTRTC
                     YTLRGHTDWVTCVKIHSKSRTLFSASDDSTIKLWDLDTNQCIATFGGIENGGHTAQVQ
                     CVIPFSYSDEITTDANVNEKDNSRNNHGEDGGAGDNDDDDDDDDDDDDDDDNEHDEDN
                     DDGVDETPLEKFVKTRANLPNYILTASLDNTIKLWDVKTGKCVRTQFGHIEGVWSISA
                     DTFRIVSGSHDKSIKIWDLQNGQCMHTLTNASSVTCVGLGDSRIVCGLENGEVKMYCF
                     DCPDP"
     gene            complement(<887744..>888322)
                     /locus_tag="C5L36_0D04300"
                     /db_xref="GeneID:40385531"
     mRNA            complement(<887744..>888322)
                     /locus_tag="C5L36_0D04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467319.1"
                     /db_xref="GeneID:40385531"
     CDS             complement(887744..888322)
                     /locus_tag="C5L36_0D04300"
                     /inference="similar to AA sequence:RefSeq:NP_015479.2"
                     /note="PKUD0D04300; similar to Saccharomyces cerevisiae
                     YPR153W; ancestral locus Anc_3.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323179.1"
                     /db_xref="GeneID:40385531"
                     /translation="MVSAPVGYQRPSFPSLYWPVGPKAKEFDEADLYHFKDIWLFTTA
                     WSIIFMTGLYTAAAGLLLITHYAGSYKHPTFMRSSEVLSEEGIRNRNIEMKSFNYNLI
                     DRTTSGAGYGHRFVKSLFSGNTKLLVLAVATYIFSGAFLGFFSGSMVGLLIAAVYNSA
                     QFRVTPWIPFVFSLIIMLFNIASSYSFTVSYL"
     gene            <888557..>889651
                     /locus_tag="C5L36_0D04310"
                     /db_xref="GeneID:40385532"
     mRNA            <888557..>889651
                     /locus_tag="C5L36_0D04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467320.1"
                     /db_xref="GeneID:40385532"
     CDS             888557..889651
                     /locus_tag="C5L36_0D04310"
                     /inference="similar to AA sequence:RefSeq:NP_014003.1"
                     /note="PKUD0D04310; similar to Saccharomyces cerevisiae
                     YMR276W (DSK2); ancestral locus Anc_8.837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323180.1"
                     /db_xref="GeneID:40385532"
                     /translation="MSEFTITIKMTGDKKHEVTVSPEMTVLQLKEKIASDLDISVDRQ
                     RLIFSGKVLKDNDTLDVYKIKQGHSIHLVKGAAKSTSQPPQPLSTETNTTNTTGNNPS
                     TSAVPSNIESGQGAFNPLAGLTDARYAGYNIPMPTMDQLGFGADGMQLPPENQLEQMM
                     DNPLFQESMRSMLSNPQMLDYMIQQSPQLRAMGPAARELLQSDYVKNMLTNPQAMRSM
                     MEMQRAMGGIGATGANTNFPSPGNPSDSNTANTDSPRNSTSNSSGSSVPSNPFASLFG
                     AGVPGAGLGGNPFLANPNLMNLFGGASTGTGSTAPSASDTRPPEEVYATQLRQLNDMG
                     FFDFDRNIAALKRSGGSVEGAIEMLLNGSV"
     gene            complement(<889759..>890838)
                     /locus_tag="C5L36_0D04320"
                     /db_xref="GeneID:40385533"
     mRNA            complement(<889759..>890838)
                     /locus_tag="C5L36_0D04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467321.1"
                     /db_xref="GeneID:40385533"
     CDS             complement(889759..890838)
                     /locus_tag="C5L36_0D04320"
                     /note="PKUD0D04320; Pfam Domains:
                     ADH_N(2.4e-32)|ADH_zinc_N(1.2e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323181.1"
                     /db_xref="GeneID:40385533"
                     /translation="MPQELKEIRAIGVLDFNDWTNPKEFTYKPQELRPYDVEIKVEAC
                     GICGSDIHAANGDWGQPYTPLAVGHEIVGTVVNAGPDARFKIGDRVGVGAECDSCHTC
                     TRCTEGHQNTCKKQVGTYLGVYPSGQPTQGGYASHVRVNSEFAFKIPENMKSEDVAPL
                     LCGGITGFRPLMTAGVKKGTKVGVNGIGGIGHMTILFAKALGAEVTAISRTYAKKELA
                     SSLGADHYVATSDKKAMEEHMDTLELIVNTGSSFSEGAIQDVLSLLRAYGHMTFITAP
                     PVSEKLTIDPMFFLFNNISIGGSVTGSPSDIEYMLEVASKNNIKPMIETIDISEENVK
                     TAWERMVKGDVRFRFVLTGYDKYFK"
     gene            complement(<892525..>893604)
                     /locus_tag="C5L36_0D04330"
                     /db_xref="GeneID:40385534"
     mRNA            complement(<892525..>893604)
                     /locus_tag="C5L36_0D04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467322.1"
                     /db_xref="GeneID:40385534"
     CDS             complement(892525..893604)
                     /locus_tag="C5L36_0D04330"
                     /note="PKUD0D04330; Pfam Domains:
                     ADH_N(2.4e-32)|ADH_zinc_N(1.2e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323182.1"
                     /db_xref="GeneID:40385534"
                     /translation="MPQELKEIRAIGVLDFNDWTNPKEFTYKPQELRPYDVEIKVEAC
                     GICGSDIHAANGDWGQPYTPLAVGHEIVGTVVNAGPDARFKIGDRVGVGAECDSCHTC
                     TRCTEGHQNTCKKQVGTYLGVYPSGQPTQGGYASHVRVNSEFAFKIPENMKSEDVAPL
                     LCGGITGFRPLMTAGVKKGTKVGVNGIGGIGHMTILFAKALGAEVTAISRTYAKKELA
                     SSLGADHYVATSDKKAMEEHMDTLELIVNTGSSFSEGAIQDVLSLLRAYGHMTFITAP
                     PVSEKLTIDPMFFLFNNISIGGSVTGSPSDIEYMLEVASKNNIKPMIETIDISEENVK
                     TAWERMVKGDVRFRFVLTGYDKYFK"
     gene            complement(<893922..>897158)
                     /locus_tag="C5L36_0D04340"
                     /db_xref="GeneID:40385535"
     mRNA            complement(<893922..>897158)
                     /locus_tag="C5L36_0D04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467323.1"
                     /db_xref="GeneID:40385535"
     CDS             complement(893922..897158)
                     /locus_tag="C5L36_0D04340"
                     /note="PKUD0D04340; Pfam Domains: Zn_clus(2.6e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323183.1"
                     /db_xref="GeneID:40385535"
                     /translation="MQNDRMDHITHGNMTESDAEIKKVKKQRNRSTLVCTNCKRRKTK
                     CDKKQPCTRCINSGKASTCTYNVIQPINSSNTFNDPASNQFILYPTNEEYLPLQLDSS
                     QALKSSGLPDPFSPLRSISLSNKLTASPQSHLPKYSEGFPLNYKHNEQTSYQSSQISY
                     DYKSNFQPSSKITCQSSVLNNTQPNYPANIPANYPIGYPTTYITNQHSVPFQAKYQSD
                     YQSGFPINYQSSYQAEPEILENQVISIPSCHPNHSRQSLNQTELLGKEHDGLPVMDKD
                     LIQHPGNNTSAAKSGLEDDRIKRLSEKINQLAVNPTKTNRILMLQLLEQLKLTLQTKS
                     TVPVSRLSENANVILDANVWKLSKDTGIIRNRVTTLNYASTLWNSRDFVYLATELFDP
                     LLELYFKRWEKVKCRKVLIDLNLTDRSKIDGIITKIKPFMIHNLKAIQERVEYFKTNL
                     NFFIFGKLIPVQLLESIINFDLIYGHLKYSEKYKECYFEIALIFAIINISETFDKLNN
                     TSKYEFQLDNTFENLTDVCISLINMTNYKQRTNYVGLITFLMISYTSLIYNKNAYTGL
                     NREYIYPLLREHIGMLFQLGYHLNHDPNDSENVVEKYRNFSIKKKDLWFLWNFYLQLD
                     GEYSVRLGTPLLINDEFCEKFHLVDPTDPLEMKSMNYVSLVRDLAHLLNSKSGTNYGS
                     ISTFMDRVMESYDTLECFKTRETLRYHDNNCDDNHSNGQSTNGKLYYTVEDRFNLDIK
                     IKYIKLIFFLNLLLFCCFKKENIKRNFPEMGFDSPHYIEIVEIRKLCGMRILLLICLT
                     YRLIEFLSNDNNATKEILLCLRGELIPCFGFPTLCTLDCVLTLYGDASNDERPNQIDI
                     NDIPLNELDVILRDEQLIKKYNKEIGIGYLDFPKNTQFIIRIYEAARSNPILSDNFEF
                     YIKSKIIGLAVYVLTMFSELKKHHDVKELGLYSVLSRIVTQRLYELQHSKSCKRDALL
                     SVILNDEEVEEVPYGLNPNIATLMEQTDPQRLQPGNIQLQHQTWNGKIDLGGNNRAIQ
                     LHSLKTDNSQDLLPPDQLVSMIHLFINDERFTSGITSFDIDFSRMKMP"
     gene            <899137..>900024
                     /locus_tag="C5L36_0D04350"
                     /db_xref="GeneID:40385536"
     mRNA            <899137..>900024
                     /locus_tag="C5L36_0D04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467324.1"
                     /db_xref="GeneID:40385536"
     CDS             899137..900024
                     /locus_tag="C5L36_0D04350"
                     /inference="similar to AA sequence:RefSeq:NP_011369.1"
                     /note="PKUD0D04350; similar to Saccharomyces cerevisiae
                     YGL146C (RRT6); ancestral locus Anc_2.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323184.1"
                     /db_xref="GeneID:40385536"
                     /translation="MIIFGMVFRLLAFLSIFVSEAVHVSATQLCMEIPPSRTDSQELM
                     TELNMLHQHLYSMDASKSKNQNEIQLLNDKIDKVVNDYLISNSCLRYYFKEYISFEEV
                     ENSLLLNNGIVVSLRLKLDDYHIDQRKQKLNLNIIDPMANTLRRINSIEETELRFLFD
                     YPIEEKTRDYFNEQYFDVCLENIKYDKSWSSTISIINGELELIFGMNSINKKYAESTE
                     KVNSIFEQLQLIDSELDLVYKQLVHNLRTSEPLLRDKNEDTLTKSLIWFIVIFVIYLI
                     VNFIQISWLIKYLKNKNLI"
     gene            complement(<900108..>900539)
                     /locus_tag="C5L36_0D04360"
                     /db_xref="GeneID:40385537"
     mRNA            complement(<900108..>900539)
                     /locus_tag="C5L36_0D04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467325.1"
                     /db_xref="GeneID:40385537"
     CDS             complement(900108..900539)
                     /locus_tag="C5L36_0D04360"
                     /inference="similar to AA sequence:RefSeq:NP_010173.1"
                     /note="PKUD0D04360; similar to Saccharomyces cerevisiae
                     YDL110C (TMA17); ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323185.1"
                     /db_xref="GeneID:40385537"
                     /translation="MSEYKRPISIIDFQLAIRDSSDEQLALILERLENSVARLKDSNK
                     LMESLMKKEKKQNYDGEEDDEFGPVTEDDVKIYRDSIAENMVVMNNQQERIEILREEL
                     KNRNLHRQVPLDDSASDRPFQGMSPNKYDSTTIPMSTDNDV"
     gene            <901788..>903413
                     /locus_tag="C5L36_0D04370"
                     /db_xref="GeneID:40385538"
     mRNA            <901788..>903413
                     /locus_tag="C5L36_0D04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467326.1"
                     /db_xref="GeneID:40385538"
     CDS             901788..903413
                     /locus_tag="C5L36_0D04370"
                     /note="PKUD0D04370; Pfam Domains: zf-C2H2(2.2e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323186.1"
                     /db_xref="GeneID:40385538"
                     /translation="MYSSTIPKHVHSEFRVDSPTLAEFGNRSGGVASTINNSVLNNGQ
                     PAIPNAGTPYSNLMNLNSQYASNSNIFQTDQLGKTIDEESFKFTPRCLTPLNFDINQS
                     SQQMGNLLNATASDNLGLVNESMYGSMFVTQKKDPIQRGLDYDAGLQMLGSNQQEQPE
                     LQQQEGYKEPLTGFRKNIHYTTLSSPMDSNSSLSPYQRNSLLSTEDYINAQQTIDTNQ
                     SDITYSNSGSDIYNNNATSTIGELGEIYKDRILSNLSDMDLFVGDLKDNYNAALPMPL
                     LPSQTFDFRFRDNNEDNINYANNIINNSNEGNHYSNDNNNNDTNSDNNNENNNDNNNN
                     NDNNESSNNNNNINNGQYPDGNDEGAYYDGEYTKSPIVGNKRSKSVAVSLSPNTVGEE
                     DNCLNRNPRKRRNTVVVPPSTRVMRKRTKKAAEEEELHGASGEEEGSVGFHDNHHHHS
                     HSHHSDKQFKCTQCSSSFTRKTRLTEHMNRVHLGKVYHFECEQCGTRLSSKENLTRHS
                     IVHTDKFKCHGCDRRFDRSYRYLRHIEKCSRLH"
     gene            <906058..>906957
                     /locus_tag="C5L36_0D04375"
                     /db_xref="GeneID:40385539"
     mRNA            <906058..>906957
                     /locus_tag="C5L36_0D04375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467327.1"
                     /db_xref="GeneID:40385539"
     CDS             906058..906957
                     /locus_tag="C5L36_0D04375"
                     /inference="similar to AA sequence:RefSeq:NP_009503.1"
                     /note="PKUD0D04375; similar to Saccharomyces cerevisiae
                     YBL050W (SEC17); ancestral locus Anc_7.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323187.1"
                     /db_xref="GeneID:40385539"
                     /translation="MSNPEGLISEATKKLNKSSGFLGSIFGGSSTTKYEEASELFTQA
                     ANLYKLQRRNFEAGSAFEKASECQVKAGSLDEASNTLVEAYKSYKLENPSNAAKCLEK
                     AIEMFIQRGQFRRSANFKSDLGELYENELQDIKSAIKSYEDASDWYKGDGANALSNKC
                     LLKVADLNCDEKIKDYKKAATIYEQIAKESLNNNLAKWSLKEYFLKAIICRLADNNDY
                     ASANALLTRFLSWDPSFETTKEFEFCNSLIEAVRSGNADDIAIASKKFDKFTRLDGMK
                     IKILNNIKNNIVEAPVDIEEDFT"
     gene            complement(<907193..>907780)
                     /locus_tag="C5L36_0D04380"
                     /db_xref="GeneID:40385540"
     mRNA            complement(<907193..>907780)
                     /locus_tag="C5L36_0D04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467328.1"
                     /db_xref="GeneID:40385540"
     CDS             complement(907193..907780)
                     /locus_tag="C5L36_0D04380"
                     /inference="similar to AA sequence:RefSeq:NP_011957.1"
                     /note="PKUD0D04380; similar to Saccharomyces cerevisiae
                     YHR089C (GAR1); ancestral locus Anc_5.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323188.1"
                     /db_xref="GeneID:40385540"
                     /translation="MNRGRGGFRGGRGGRSFAPQGPPDRVFEMGEFLHSCEGDIVCKS
                     INEKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKPSEGVQATSFKEGDKFYIGG
                     DKLLPLERFLPKPKSYAPKPPKKKGPKGQGASRGGFGSRGGFGASRGGRGGFGGRGGR
                     GGFGASRGGRGGFGGRGGRGGSRGGRGGFSGRGRN"
     gene            complement(<908627..>910654)
                     /locus_tag="C5L36_0D04390"
                     /db_xref="GeneID:40385541"
     mRNA            complement(<908627..>910654)
                     /locus_tag="C5L36_0D04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467329.1"
                     /db_xref="GeneID:40385541"
     CDS             complement(908627..910654)
                     /locus_tag="C5L36_0D04390"
                     /inference="similar to AA sequence:RefSeq:NP_013695.2"
                     /note="PKUD0D04390; similar to Saccharomyces cerevisiae
                     YML017W (PSP2); ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323189.1"
                     /db_xref="GeneID:40385541"
                     /translation="MSLTEFMADASLGTPSWIEDDFDITSTLSSPNSMNNLSLSNSSN
                     YRFDRFDRNSRFNTSSLSGSQYIVVFDNVPSYCTRQLLKELFESRYTRFIKCHVLIDP
                     SDESKKRKLAFVFLHNNQDLQKVCKWNGFNIERNKIFVEPIPITEFNSIMEYNRSINY
                     DEDEEDERIENAERERRERHNNKTPDVDHHERPPIRTMPKANPFGAAKPVTVPEIPVV
                     SENTREVAQILQKKKAKENPFGNAKPVTVPEIPIVSENTREVAQILQKKKIQSSKPDA
                     SGKPPSSTAIDVPNSSNGIPGEHTKQKEEGPAEQKKAQRERKINPFGNAKPVDTLKKQ
                     LEIEKTLKKAAINDTTFDISLIHHNREKSQENRKERKKENKKETKKEAKKEAKKEAKK
                     ENSKNDYKENSKDGNKESGRESDKEDNNEGHKENNQESNKVQEKDKDTVKQDVNGKTD
                     ATEKANIERRVARELSKEEYEEELKKLHLFNGTKSTRRPKHRVQKRHDKGENENKGNE
                     ASRNDKRPGSKHGETTDVSVEVREASSGIDQNIEDAAHSKSDKDVGIGEEVESVVQEV
                     NSSSGKQSSTSAKQENHRSSGVVFTDPIECEGPDVSYESISTRGRGNGKNRGRGRGRG
                     AFRGRGVVRGLRGRGGLYKNLSYHKPAEGDTTGEIQTVSSDLNGVKSQNLA"
     gene            <911399..>912505
                     /locus_tag="C5L36_0D04400"
                     /db_xref="GeneID:40385542"
     mRNA            <911399..>912505
                     /locus_tag="C5L36_0D04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467330.1"
                     /db_xref="GeneID:40385542"
     CDS             911399..912505
                     /locus_tag="C5L36_0D04400"
                     /note="PKUD0D04400; Pfam Domains:
                     ADH_N(1.8e-32)|ADH_zinc_N(7.9e-32)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323190.1"
                     /db_xref="GeneID:40385542"
                     /translation="MFMKGLTYLKPGIVSWQSIPKPVLKKPTDVIGKVVTTTICGSDL
                     HILKGDVPETTALAATTGHGVVLGHEAIIEIESVGDAVKNFSKGDVCIVSCITSCGKC
                     YYCKRNLQSHCTGHMEGTSGWVFGHEIDGTQAEYVRVPCADYGLYKVPEGVAYEKLLM
                     LSDAIPTSYEIGILNGEVKEGDSVAVVGLGPVGLSALLTAINKKPKQLIAIDMDENRL
                     DLAKQLGATHIINSTNMPNEEVAKKVQEISKDLEPGRESGVDVAIECVGVPPTFELCE
                     DLIASGGTIANVGVHGAKVDLKLQELWIKNCKITTGLVSTYSIPDLLNQVADGSLDPS
                     PIITHHFKFDEFEKAYQVFKDAKNTKAMKIILTP"
     gene            complement(<912563..>917845)
                     /locus_tag="C5L36_0D04410"
                     /db_xref="GeneID:40385543"
     mRNA            complement(<912563..>917845)
                     /locus_tag="C5L36_0D04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467331.1"
                     /db_xref="GeneID:40385543"
     CDS             complement(912563..917845)
                     /locus_tag="C5L36_0D04410"
                     /inference="similar to AA sequence:RefSeq:NP_014157.1"
                     /note="PKUD0D04410; similar to Saccharomyces cerevisiae
                     YNL242W (ATG2); ancestral locus Anc_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323191.1"
                     /db_xref="GeneID:40385543"
                     /translation="MASMFTAAIQQHVMSFILARLPLHPVDIPQQSSFAFNGDSGLSL
                     HLTDIALDIDRLQTQYLPLSMPFNVRHAFASDLKIQINTNGIKITVDGIDCIVNPKTS
                     FGKSEFANSASSIFMNGIDDPVEGLGEMMESVVGFVDAMSGVNSLCPDAPNTTNSQPW
                     GDEIDDAGDQDHHADGRNSHLSGEKNKSRNKKGNEAALSEAILNNDLDVNTDLDSALK
                     RGSNRTKSPNNLILKYAVEYILNKTSVLLTNIKFKIISDPISMMLTVALIEACGDNSK
                     RRCTIENIEVSGLGHQKGKTTFNSSHGNKKEYHVDDNQTNNDVDAESENTNGYKTDNV
                     SGSEGGDDEYDEHLMSSSFMVEHREEMEQSLMESAIYSTSGKSVYLSAIEGDFKPSPV
                     EVDRTKEDDKDILVNIDRIKISLEDRTKLSIEIGIIKVSLNPFPRVISSFIELLSHMD
                     KQKCFSKTQQNAAPNEKTSLNANSKLTLSLFSIELIQVGLQSKLNKSNNFEDKTPFIC
                     QFSKFLLQQRSSTLVQGSLEEMELFFDDQKVTYFERTSSSHADIRIETQTLEKEHITT
                     IIFSHSLHIKVDYALLETLIGLKNEFQPIWHQIQQFKAKSMKKNNTEGPMSWRTPNPR
                     TGFGLGNPNSTRRQNKPFYFVFKAGKTEGIISLSDDGKETLSFSIAPFLYDDINRIST
                     LEFINLELSTILGTAKLNLQDIRVTLPTEPTSFRTYDVNTQSVIKCYTKKTMAIDSIT
                     FNSPWKTLFQSLQILKGLKEKFSHYDKNNDPGVSFSGTPSTQRNRMMQSIMLKQRIID
                     IYLLIKNFDVKISSINEEFGDIVGTTRNISFITSSLDHQISVPEFSICRLYAENVEKI
                     VEKPNKWSSSPMLFIKVQHAINIYINNWLINYNGRWLEMFSSGENVVDTSVTHIKAES
                     IEQVKRKLMIEIFVSLTDVSIGLKPVDLDSCAVLVLNKSNLDIYKYTDSSLIFQLSSN
                     LISLFLIDDTKGNEKAPGNIIDSDDPWKIASIWTSKGYVNIGTLSTISLKIALNSKTS
                     LKTHFDHSPIDIQANLEKITLDLCSDSTQCFIQLLKNIKKPVYFSYDDKYKDKNELID
                     VFHDIDLDYFDSSKQVLSTLPQLERAISNLSQNGGDSADLSSSQSLEIVEDYVRNMNN
                     KLRQKEQEAGSSGDAHYSIPVKVHFSVSQINLNLHDGYDWKETRFQIKNALERVSKTA
                     SELNKIGVSDSNVEEGFNIEETLYKSVLVEAGPENDNNGAINEYINTIYLGKKADGTP
                     KLLTRSLKNKVQIMLEDIDVDFKLLSTNEPHPDVKPDFYSGKEGDFEVVNEIGLSIDK
                     FTIFDNVPTSSWNMFAGYMREYGEREVGKSMVKVNIELVRPIKELAAIEMRLRVQVLP
                     LRFYVDQDTLEFLTRFLEFKDKRFIPPAVDDEEMFIQRLIIDTVKLKLDYKPKKIDYA
                     DIRTGHTGEFVNIFIIDGSEITLNEVKLYGINGMSNLNSILTSYWSPDIKRNQLVGVL
                     SGLAPVRSIINVSAGMNKIVSVPVREYRKDGRVIRSLQIGALAFTKATSGEILKLGAK
                     LAAGTQTILENTEQMLGGAGSSMRVVNEGQAADSRESHERRRSSAASFGDEDENDYHR
                     YFFQNKNIINSGDRKQDVHSEECAITDEDGDSDEGNSHEGIDKESSYIKSLYSNQPSN
                     FNEGLKVAYGSIQRNLKIARNAVYEAKSKANEAETTSGVIKEYAKVTPVVLIRPAIAA
                     TEALSKGLLGGVNEINPEEKQRAEEKYKKVEEED"
     gene            complement(<918115..>919683)
                     /locus_tag="C5L36_0D04420"
                     /db_xref="GeneID:40385544"
     mRNA            complement(<918115..>919683)
                     /locus_tag="C5L36_0D04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467332.1"
                     /db_xref="GeneID:40385544"
     CDS             complement(918115..919683)
                     /locus_tag="C5L36_0D04420"
                     /note="PKUD0D04420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323192.1"
                     /db_xref="GeneID:40385544"
                     /translation="MASDENTPLLPIGSHTRVSTQQTPSLALRITQVGCAMVWCLFAA
                     GPVFGFAALKPVLISQGVYKEACEVGTGSVPSILEAACVEQDLKLNRMFTYAAVITNA
                     TALLVGPILDNYGPRVTGIIGSFILAMASLLLSNGSSIKSIDAYLFGYIALAFGGPFV
                     FISCFQLANSFPGRSGLILALLTGAFDTSSALFLFYRVVYQNNYISNLTLKTFFSYYL
                     VVPLFILLCQFFIMPHRSYKTIETLAKEAETGLDEHGLPMNPHDSRYQPDEIADRETD
                     RARRGSVVSAKSVYEEIADHQLKEASGGIFGVLHSVPLYEQFKSPWWYLMCMFTTIQM
                     LRINYFVATIASQMEYYFNPEIAIRINKFFDIALPLGGIISIPFIGLILDNLQTYKIL
                     MILLTVSTSIGLFGMTCNQVLQYIGILLLVLYRPFYYTAVSDYCVKVFGYANFGTVYG
                     AIIFISGMMNISQTLLDNATHFQFGNDPTPINTLLVTLTVLSGGSMLLYIKHQEKALI
                     RAHVIEDAIDPNFL"
     gene            complement(<919960..>920709)
                     /locus_tag="C5L36_0D04430"
                     /db_xref="GeneID:40385545"
     mRNA            complement(<919960..>920709)
                     /locus_tag="C5L36_0D04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467333.1"
                     /db_xref="GeneID:40385545"
     CDS             complement(919960..920709)
                     /locus_tag="C5L36_0D04430"
                     /inference="similar to AA sequence:RefSeq:NP_014923.1"
                     /note="PKUD0D04430; similar to Saccharomyces cerevisiae
                     YOR280C (FSH3); ancestral locus Anc_8.740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323193.1"
                     /db_xref="GeneID:40385545"
                     /translation="MSQKVMKGTILCLHGFAQNGKVFSVKASGIRKALKKAGYHTVFI
                     DGPIKLTPADLPFAASSLGADDKAEEVDFRGWVYTQPEKFDIQPSLDTIKKAWEEHGP
                     FVGIMGFSQGSGVVGALLSTFDKVVGDEKAFEHLKFAILYSGFKLENPSAQHYYEKKV
                     TLPTLHVIGELDTLVANERSLAFAEICENHTILKHPGGHYCPSTKDLLKQEVAWVESV
                     LAGEEKKEEASKDKEDDVSKLANQLDNLGKA"
     gene            <921251..>923323
                     /locus_tag="C5L36_0D04440"
                     /db_xref="GeneID:40385546"
     mRNA            <921251..>923323
                     /locus_tag="C5L36_0D04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467334.1"
                     /db_xref="GeneID:40385546"
     CDS             921251..923323
                     /locus_tag="C5L36_0D04440"
                     /inference="similar to AA sequence:RefSeq:NP_011782.1"
                     /note="PKUD0D04440; similar to Saccharomyces cerevisiae
                     YGR266W; ancestral locus Anc_5.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323194.1"
                     /db_xref="GeneID:40385546"
                     /translation="MSYSQQKILDAWFKPLPLEEYCDLVKDNIPENIPKTDSCPKDYR
                     LGRLDIACGPLVRFLASHENNSNNYRGSIMIVVRNIDDGIDVPTLQFVIGPSVSDGTK
                     EHSIAEEAPIDSKVIYKEQNFTFIRYSFMFQLKEFEQRVRYSIDGDFKPHFQFFLPSS
                     LKSMNVMSYSCNGFSLAVETESFKSSLWLDVLRKHNQTNFHYHVMVGGGDQIYADSVK
                     NSSTELAKWLKHKHLHAYEKSTPEMVESLNDFYLNHYIKWFGKGYWEGINGKTIQAAY
                     PIALSTIPQINIFDDHDIIDGYGSYKDITMRQDIFKTLGQRAFFYYMLFQHHTHPDEP
                     TEPESSWIIGKKPGPYINQLSRSVFAKLGRNIGFLGMDNRTERTKKQVVMPETYDAIF
                     NRLEDEVSKSESAGKPLKHLYVLLGVPICYPRMVFLERLASSPLARPLKFLARHGVIA
                     RGLVNEFDGEIELLDDMEDHWCSHHHKKERNALMKRLIAFGHEHSIRITILSGDVHLC
                     CISRFRDDSGRKSYKSPENDPSFIINLISSAIVNVAPPDGMAKFLSYRAKEHIFESFI
                     KEDMVPLFELEPASNKKRATNMFMNKRNYADLVPVENISTEYKSERFGVDTANKYFVP
                     GAVDGPSLSITYDENKHESSKTNGKIGYPFDEDGILATLHVEVDHSDVSSKTGDYDFV
                     VPSLKLSD"
     gene            complement(<923469..>924239)
                     /locus_tag="C5L36_0D04450"
                     /db_xref="GeneID:40385547"
     mRNA            complement(<923469..>924239)
                     /locus_tag="C5L36_0D04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467335.1"
                     /db_xref="GeneID:40385547"
     CDS             complement(923469..924239)
                     /locus_tag="C5L36_0D04450"
                     /inference="similar to AA sequence:RefSeq:NP_011688.3"
                     /note="PKUD0D04450; similar to Saccharomyces cerevisiae
                     YGR172C (YIP1); ancestral locus Anc_5.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323195.1"
                     /db_xref="GeneID:40385547"
                     /translation="MSYYQQYQHTANNSTGNYGQYGGYNGGYSLNTNSTTNIPPTNFM
                     PSGSMATPSARTVDYEAPLPPGILAAFSTSGYPGEAPLFEELGVNFGHIRAKTMAVLS
                     LKSNSLGEDIIQDSDMAGPILFCLLFGTLLLLSGKTHFGYIYGVALFGTVSLHWLFKL
                     MSSATDGDLDFLRTASVIGYCLLPLVLLSAIAVLLQLNNFIGYTFSVICVAWCTWAAS
                     GFFVRVLKLSNARPLIAYPLGMFYSVFALMTVFAEKKA"
     gene            <924458..>925387
                     /locus_tag="C5L36_0D04460"
                     /db_xref="GeneID:40385548"
     mRNA            <924458..>925387
                     /locus_tag="C5L36_0D04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467336.1"
                     /db_xref="GeneID:40385548"
     CDS             924458..925387
                     /locus_tag="C5L36_0D04460"
                     /inference="similar to AA sequence:RefSeq:NP_013107.1"
                     /note="PKUD0D04460; similar to Saccharomyces cerevisiae
                     YLR007W (NSE1); ancestral locus Anc_5.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323196.1"
                     /db_xref="GeneID:40385548"
                     /translation="MSDILIENYVQQLNDPETYTDVHAAVIDLVMSVRTISKDQLMVY
                     LQKAILTVLLDSTEDSTIEEELRSSIDSTVKNQYININTLHSVLHSINVKLDVFGMEI
                     AESRDMDTSTEILYSFINKKGTGAIQLSTKYTQNDIQLVKHVVDRIFAPEHVLQSSVT
                     DAEGNILHRITYSVPYMSMIKHLRNGPEQLDDEDMPLMTKLSFDESELFLQDLELYGW
                     LELYNDCFTLSTRGLVELKDFLIKTYGSYPDGTISTCFGCKDILTRGCACPNSSCNVR
                     FHKDCKNLFRKSRNTSACPNSDCDADIEDFYSF"
     gene            complement(<925399..>926763)
                     /locus_tag="C5L36_0D04470"
                     /db_xref="GeneID:40385549"
     mRNA            complement(<925399..>926763)
                     /locus_tag="C5L36_0D04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467337.1"
                     /db_xref="GeneID:40385549"
     CDS             complement(925399..926763)
                     /locus_tag="C5L36_0D04470"
                     /inference="similar to AA sequence:RefSeq:NP_013115.1"
                     /note="PKUD0D04470; similar to Saccharomyces cerevisiae
                     YLR015W (BRE2); ancestral locus Anc_5.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323197.1"
                     /db_xref="GeneID:40385549"
                     /translation="MAKKQKVIPRLKPTPYELNDLITTLKQPQLVPSAKLYTKDCDTI
                     QLYTTPDLPNNKRGFKYTPCRPNPLLDSSLYSTTDLPPFTAHWSYFDRSPDILVDEDM
                     AIVGCQEGDGWRSVRAEYGLREKRWYIEYEIISGIPKVGGDESINNNADSRSHTPVIE
                     AGSSVAHVRVGIARREASLEAPVGFDGYGYGIRDINCEKVHLSRRGDIGTKRDLKIGD
                     IIGILIELPDIQTQKEISKAMIYEKTLEEPQKLDPALDSKNINDSFIGKGVEREMIPI
                     KYKNNLYFEEYEYTGSKQMDHLLNPVTVFGEHAMPDNKRSQPAKLPNSSMTLYINGEK
                     FGVPFTNLIAFLPPASEQRAARDQKSKKQLDDFIVDRDDGTLGYYPMVSCFRGGAVKL
                     NTSSKVWRVPQDLDSALNSGTIKPYGLRMHSSIVEQTVYDLIEDAVNKYLDRKERDFL
                     AEKL"
     gene            <926950..>928533
                     /locus_tag="C5L36_0D04480"
                     /db_xref="GeneID:40385550"
     mRNA            <926950..>928533
                     /locus_tag="C5L36_0D04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467338.1"
                     /db_xref="GeneID:40385550"
     CDS             926950..928533
                     /locus_tag="C5L36_0D04480"
                     /inference="similar to AA sequence:RefSeq:NP_014021.1"
                     /note="PKUD0D04480; similar to Saccharomyces cerevisiae
                     YMR293C (HER2); ancestral locus Anc_5.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323198.1"
                     /db_xref="GeneID:40385550"
                     /translation="MKTNLNHIKQVNKRYNIFTSLRKAPVVHEDFSYAPLVHTTYAIK
                     DNFTTREEPTTCSSKILSSYISPFDSTVVTLLKQNGTHCIGKTNMDEFAMGNSTTSGV
                     FGPTLNPLYEQNEDLVEKYEEFEFGTKDSISETDGETISREILFGKGEDISEHSYLVP
                     KLSSDFSAKISDKQRIVGGSSGGSAAAVASDLVDFSIGSDTGGSVRLPASYTGIYGFK
                     PTYGRISRWGLVAYSQSLDTVGIMSKSVDNIWKVFTCLDLPDAKDPSCLTESVREDMA
                     IERLNSKKNVGKKFKVGIPVELQLEGMSGAVKGAWKDLLIKLQKSKLIEVYSVSVPSI
                     KYALPTYYTLVTSEASSNLSRYDGIRYGYRAGESVCDLAKEPEFVTTRSRGFGEEVKS
                     RILLGNYTLSSYGYNSHFMKATGVRGMLIDEFNKVFRDRNMLVDKYFPNSAGVDMMIV
                     PTAVHEPAPINEVCGSTDAVKSYMDDVCTIPMSLAGLPSMSIPFGGKSMGFQLVGQHG
                     QDYKVLEFTRLVEEVLDAK"
     gene            complement(<928676..>929095)
                     /locus_tag="C5L36_0D04490"
                     /db_xref="GeneID:40385551"
     mRNA            complement(<928676..>929095)
                     /locus_tag="C5L36_0D04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467339.1"
                     /db_xref="GeneID:40385551"
     CDS             complement(928676..929095)
                     /locus_tag="C5L36_0D04490"
                     /inference="similar to AA sequence:RefSeq:NP_014020.1"
                     /note="PKUD0D04490; similar to Saccharomyces cerevisiae
                     YMR292W (GOT1); ancestral locus Anc_5.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323199.1"
                     /db_xref="GeneID:40385551"
                     /translation="MLWLSQTQKFGVFFTSAGALLFFLGIMSFFDAGLLSMANILFLV
                     GICLIIGPQKTLYFFTRPEKIRGTLAFAIGIILILSKRPFIGFVVETFGILALFGEFF
                     ATLVQFLRSMPVIGPFLSHPMVAPVVDRIAGVRVLPI"
     gene            <929443..>930357
                     /locus_tag="C5L36_0D04500"
                     /db_xref="GeneID:40385552"
     mRNA            <929443..>930357
                     /locus_tag="C5L36_0D04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467340.1"
                     /db_xref="GeneID:40385552"
     CDS             929443..930357
                     /locus_tag="C5L36_0D04500"
                     /inference="similar to AA sequence:RefSeq:NP_011784.3"
                     /note="PKUD0D04500; similar to Saccharomyces cerevisiae
                     YGR268C (HUA1); ancestral locus Anc_5.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323200.1"
                     /db_xref="GeneID:40385552"
                     /translation="MSFQNNRRPQRSGGSTPAASDLPVFDPNTDIPDEPPPSYDESVA
                     DPSIPDNYEAEQPPRQPLRPPEQPPRRSSSTRRPGNSEKLQPPLVHATSNTSSTHSSS
                     TSTYSMSTSVHSGGHSPYVSSSQFRPPPNPPTPTSYQASATELPPPTAINPNPYLPWR
                     YSPSYRCSKCENTGFKKKNGHPCKKCWGKFRPGVVPPKSQAELERLTNHKPAPKPLNP
                     NVFKLPPGTVSMSMPSMPMVPQMPMAPQMAMPMPPQPAIVSPGDPRIGGVLCPRCKGR
                     GMVHFFLDLERCHVCNGLGRVASNGRPL"
     gene            complement(<930533..>932203)
                     /locus_tag="C5L36_0D04510"
                     /db_xref="GeneID:40385553"
     mRNA            complement(<930533..>932203)
                     /locus_tag="C5L36_0D04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467341.1"
                     /db_xref="GeneID:40385553"
     CDS             complement(930533..932203)
                     /locus_tag="C5L36_0D04510"
                     /inference="similar to AA sequence:RefSeq:NP_011762.1"
                     /note="PKUD0D04510; similar to Saccharomyces cerevisiae
                     YGR246C (BRF1); ancestral locus Anc_5.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323201.1"
                     /db_xref="GeneID:40385553"
                     /translation="MAAKACKQCGGTSFTREYHTASGDLACTNCGAVQEENPIVSEVT
                     FSENAAGGATVQGSYVSNDQSGASFGNRGSLESREQTIQNGKRRIKNVALALGIPEHV
                     SDSAHSWFKLALTNNFVQGRRSQNVIAACLYIACRKFNTHHMLIDFSIRLQVSVYAIG
                     ATFLKMVKALHITGLPLVDPSLYIQHFAEKLNFGKKTPKVINDAKKLAKRMSNDWLYE
                     GRRPAGIAGACILLSARMNNFRRSHLEIVAVTHVSAPTIQQRLHEFKKSNASKLTVEE
                     FKAGKKVEAALPPSYVKGKDSESKLRQELKELESAGDKMMNDPVLGAMLEDADITEDE
                     IQMNIKRILDRKKRDLSRKITSKLTFKDGSTCVEIDNESGISIEPNYEYINEEDDSER
                     NTSMPKGQSEIEKMIEENKPRNLLTTLPTTEEMLKKIPDDEEELDKLIDDDELNALIL
                     SKEESELKERLWVGTNHDFLVEQERKRLKVETDKIAGHSTQTRKRRKKEESGETENKQ
                     SGLGGFAGFMRATMSGNSSATDNAKALLTSKTLSKKINYNAVNSLFDD"
     gene            complement(<932423..>934162)
                     /locus_tag="C5L36_0D04520"
                     /db_xref="GeneID:40385554"
     mRNA            complement(<932423..>934162)
                     /locus_tag="C5L36_0D04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467342.1"
                     /db_xref="GeneID:40385554"
     CDS             complement(932423..934162)
                     /locus_tag="C5L36_0D04520"
                     /note="PKUD0D04520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323202.1"
                     /db_xref="GeneID:40385554"
                     /translation="MDDFCIFNPKWALSCEDTASQLLQILCYIHTDRNDKVDNGLDML
                     DDEMVKQVGVVSAICELGNQFNNGEKADLEAIETDKSRTVFGVVGEFMWFAKFRKIHG
                     LADAVNLKKQFEDGFKLFTLVNGPLLLGDCYIKKEGLKLLSEKWWRQWITNKYEFDSS
                     CFTSRDGMLGLLEGVRYSCVEKPFGFTKNLNDAVAGLLDDYLQDIIIINSNWIPNKNW
                     GVIHDSSIYHASDLINYLKDLDIYLGLSTYSLTYGNWPSLKQYNDQLKRLDSVTPSGG
                     LFERSILSPAWYLQEQLSENVFNPVGDLIDAVESYVPVMGTMKNIGDAVVTTPWNTLY
                     SYWSRGDGEAEPDVNQENEEPITEEDSLANGQYILGLTKKGEILQTFHLQKQDGTWDN
                     PKLVVYEVNGIMFVFLYRETAEVDYQQLSNTITDMYNTYLQELILKQIDSLKKKEEFR
                     YIIYDDCKYFSSINILPPDEDSYKYQLQSQKELIEKSLGISDVPDKSTALKTLRIIAL
                     MEDKQLHHIAQGHSYEKLTKIGRNHWGLYKRFSPQQWVVVIKEATPSEPIDSIFDDTV
                     HQWLEWVQARGYL"
     gene            <934402..>935955
                     /locus_tag="C5L36_0D04530"
                     /db_xref="GeneID:40385555"
     mRNA            <934402..>935955
                     /locus_tag="C5L36_0D04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467343.1"
                     /db_xref="GeneID:40385555"
     CDS             934402..935955
                     /locus_tag="C5L36_0D04530"
                     /inference="similar to AA sequence:RefSeq:NP_015413.1"
                     /note="PKUD0D04530; similar to Saccharomyces cerevisiae
                     YPR088C (SRP54); ancestral locus Anc_3.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323203.1"
                     /db_xref="GeneID:40385555"
                     /translation="MVLADLGRRINNAVSEATKSSVVDESVVDTLLKEISNALMEADV
                     DIKLVIQMRKKLKSKIDDTPNVNKKKLIQKAVFDELCELVDVKDAKVFKPKKKQCNVI
                     MFVGLQGAGKTTTCTKVAVYYQRRGYKVGMVCADTFRAGAFDQLKQNATKARIPFYGS
                     YTESDPVKVASEGVEKFKREKFEIIIVDTSGRHRQEEELFKEMIEIGDAVKPNQTIMV
                     LDASIGQAAEAQARAFKESSNFGAIIMTKMDGHAKGGGAISAVAASKTPIIFIGTGEH
                     IHDLESFTAKQFISKLLGIGDIQGLMDHVKSLNLDQGDTIKNFQEGKFTLKDLQTQMN
                     NILKMGPLSKIAQMLPGGIGDMMNQVGEEETSKRFKRMVYIMDSMTKQELESDGSPFI
                     DQPSRIIRVARGSGTSVTEVEAVLLQRNMFASMARTTKSMAQGGGMPGMPNMPGMPSM
                     NSPQMRKAMQQMQSNPAMMENIQKMMGGMGGMGGMGGMPNQQDMMSMMQDPKIKAMAE
                     QMKKQFGLS"
     gene            <936363..>936917
                     /locus_tag="C5L36_0D04540"
                     /db_xref="GeneID:40385556"
     mRNA            <936363..>936917
                     /locus_tag="C5L36_0D04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467344.1"
                     /db_xref="GeneID:40385556"
     CDS             936363..936917
                     /locus_tag="C5L36_0D04540"
                     /inference="similar to AA sequence:RefSeq:NP_014928.1"
                     /note="PKUD0D04540; similar to Saccharomyces cerevisiae
                     YOR285W (RDL1); ancestral locus Anc_8.746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323204.1"
                     /db_xref="GeneID:40385556"
                     /translation="MSAVRAVLKGAFRTTLRSSVVLRRTRSFAIASSATRPNMSGVSV
                     NVKSSVDKTARKYSSMEGAAPVIDFSKMKEIAESKDDKYVIVDVREPDEYSAGHIPGA
                     INIPVKSSPGALGLDAEEFKDTFGFEKPDTNKTLVFYCLAGVRAGMGEELASTFGYEH
                     RLNYVGSFGDWMKNKGEVEIPKQA"
     gene            <939204..>940007
                     /locus_tag="C5L36_0D04550"
                     /db_xref="GeneID:40385557"
     mRNA            <939204..>940007
                     /locus_tag="C5L36_0D04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467345.1"
                     /db_xref="GeneID:40385557"
     CDS             939204..940007
                     /locus_tag="C5L36_0D04550"
                     /note="PKUD0D04550; Pfam Domains: DUF1774(1.7e-31)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323205.1"
                     /db_xref="GeneID:40385557"
                     /translation="MASNDGLTASKIFITISYILSVFGSLFYLLPHLNDKHFLTPFSG
                     TFIVTAIFWILTLLLQFVFITKVLFNNNVSPSNQSSAIAVIGPHFTTSNILHFFWCYF
                     FSRERFVISEVLLIVNLLNQLTLYFSHKTIAIKSLPDWLTVHLPVTGTPLAWSLYAIL
                     WNGATMFHSHNKSLLPRLLANIFIWELFVVPMALLVFYKDWSVGLATSFLALGMGFGQ
                     MFTKLVALQWIFAFVIAGANFTFSVLSMFNSAVAQSQTTTSTDQAPLLA"
     gene            complement(<940184..>940423)
                     /locus_tag="C5L36_0D04560"
                     /db_xref="GeneID:40385558"
     mRNA            complement(<940184..>940423)
                     /locus_tag="C5L36_0D04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467346.1"
                     /db_xref="GeneID:40385558"
     CDS             complement(940184..940423)
                     /locus_tag="C5L36_0D04560"
                     /inference="similar to AA sequence:RefSeq:NP_878153.1"
                     /note="PKUD0D04560; similar to Saccharomyces cerevisiae
                     YNL138W-A (YSF3); ancestral locus Anc_2.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323206.1"
                     /db_xref="GeneID:40385558"
                     /translation="MENSRERQLYQTLKTRYVGLGDADTTRGEYLENVKRDTLTSLVG
                     HDCTLTQISYATGKTKSEVRFEILNKMCGGYKDGK"
     gene            <941501..>946300
                     /locus_tag="C5L36_0D04570"
                     /db_xref="GeneID:40385559"
     mRNA            <941501..>946300
                     /locus_tag="C5L36_0D04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467347.1"
                     /db_xref="GeneID:40385559"
     CDS             941501..946300
                     /locus_tag="C5L36_0D04570"
                     /inference="similar to AA sequence:RefSeq:NP_014260.3"
                     /note="PKUD0D04570; similar to Saccharomyces cerevisiae
                     YNL139C (THO2); ancestral locus Anc_2.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323207.1"
                     /db_xref="GeneID:40385559"
                     /translation="MSAQWSYITEELLASPLSVSTLVESLKTTPESIDDVFYELILSI
                     AEYDRASTATYSSILAALFKEFPNKEEKFLVLSQAFPSTSSLNSFLKNCSIDKSLKVL
                     HLDKNILKSEGIFPDYGRYQYIDARTRIFSVDSYSSLHESSEGFAKYISEIISFMDKP
                     ENPSDLVDTLDQITVIYELDANRCTLIMLNIFANFLGDKEDVVLDICRNCSWWRTQDS
                     NSSIQSTINSYLLNVREENILELRMITLLIKHEILDFKQVYNCLGPLNVKIIDSATTE
                     ANESNEMNELLDTTLEQKQKDAAVSNVSALAMASLLPDSDDEEDNKGEKEDKVATSET
                     LAQETILDKSKYFNKVQLLDSFIHYKMFEYIDVVLGEFPEIPLIYDRIADRLNDLVES
                     FITPFYFEFVDNLNLLSADVEVEVTIQINNLDEMFDAVIPYVNLLKYKIMRNSSLVTK
                     LVRILKTAIFKNIEENEICFEFFRNYIFLYLPFSHNIPLVNESFSILSCYPLETRYNL
                     YGEYSVMVKKDPATKLNNDICEKKTKDLLKRLSVENINTSCRSLNKLISVNPIAASNT
                     FISHIESYSSLIELVCESSKFFNDFAWDVITYQLLTKLYGNRSPMQPDGINYTQWFGN
                     LTQFIGKLGSLYPESFQLSPILLSVVKSLINKNFCVLEILQALINSMTGIKPINNLSY
                     QQIMRLNAEKSLKQLAYFSIQDNREITRRSCSKLLRIMIDDGVFSKIFILLSQVQFHL
                     LNEVDNNPLKIINQRLDDVNLLLHSFITTFESNLGNKTFKENMTSISNLIKKYSVKPE
                     WCFEVWRPYIAEDLRNSDNDNNVIVSELRESIKDVLPYQWEHMNIGLYIMFWMLSLYD
                     INYQDLSYMMEYSNLKTQITGINLKLRRRNDLPMKDVVELEEKHRYLTRVSAYIKEDM
                     LTHETNNSLVMKKIEKEKDQWFETADDSGIKKTMLAFMQYCLLPRLQHSSFDAVFVSK
                     FIFMLNSLDVQNYSLAQILENFFVKDILKDLLYTNTSLQTENLASFYQLVIKKLKEWW
                     SDPEKYANEGHSFKSTQTYEEYRLLLKSWFDSLLNQVIKSLDVDDYTTRNNTILFLKV
                     ILTQFPVIEEHADKLLDRVNQIAETDDREDIKLASRALVGLVTFNKSKLLPVWEFYSM
                     PSDEKEKAMKAKAEKMKAQRERDEEERKRKLEEDRKERERLMAESGKPTSKPYGLVQL
                     KTEKKEQRTQDVRPQRSGNNPLPENSKDRESDKTTGPTIRETSPVRDSNKEVVKSSSG
                     QHEDNHGPTKNQNMVEDSSKPPNTGVNMASITTLDYASIPGGPKPVSDASSAKVGPLS
                     LESKTAVDKTTVDKTALLPVKEQLNTTTSASGQVSTPLQQKLLVKTTKEVSDRSSSGN
                     SNSRTKSASMTPHSRISNTKMDASNQNESRSADKARATSNAPRERDQRNGANQRNGAN
                     QRSYDGQMGYRNSRESRKDYSSYRDSGHPEGSNRDAYRKDGTGRNSRDDRVARDSRES
                     QRKTPSQKSQYRDERDDHGRGRGAWDRYDEGRSSRYYDSYDYQRDRRDSRDTRDYRTS
                     RDARSSRAPLPPPSAPPPPQSASTPPGGGNKRSSYDSQSGREKRRKF"
     gene            <946545..>949265
                     /locus_tag="C5L36_0D04580"
                     /db_xref="GeneID:40385560"
     mRNA            <946545..>949265
                     /locus_tag="C5L36_0D04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467348.1"
                     /db_xref="GeneID:40385560"
     CDS             946545..949265
                     /locus_tag="C5L36_0D04580"
                     /inference="similar to AA sequence:RefSeq:NP_010067.1"
                     /note="PKUD0D04580; similar to Saccharomyces cerevisiae
                     YDL214C (PRR2) and YNL183C (NPR1); ancestral locus
                     Anc_2.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323208.1"
                     /db_xref="GeneID:40385560"
                     /translation="MDFRPDNRRLAIWIGIVGAEIRYRVLLVEVSVILNNLLYTTPHL
                     ISIDNTENMSSLTKLMNEQKKASVSYDNTIHSYNGTITTAVSVETSPDDEDEAYDPRN
                     GSKSPSTASRLLPRSLKKKSALPPSTIRLNTGLDVVDAPPSVRNDEILAIDNDTSLLA
                     PGTDLTMTGVGTDRTEYTSSSAIPVQHSRAPSVVSKNPSFKNSLSSSFSQLSINIPYS
                     APGNHKPSQSLSSSNMSSSFTNMPINGQFITGNSLASPTVSSSQIDSRFIVSKQKIEA
                     RTLSASHNNKSSSTLSSFFSKSRRSTATNFDGVSASPGKAGMSTTYHPSSTSHFPSQQ
                     NPEGVPPPQSSFDSNSSSTRHSSMADLRRFFKRSSSINQSSVSSSPRVSNLSAGLTSQ
                     RKGSVSINVQGNAPSNNNGLSVNSPSAHNSSLSMANSNFPPPLSSSSSSTHLFNASNT
                     YSPIQAPPNAITINNGTPNSHLSQTPNSLYGKSPGSGLVYGSGSPEVTRHYDPSPKVN
                     SLSTSASSTSTINNISIGGNTTSIPFSKRYVKFGENLGAGAGGQVKLLRRLADNKVFA
                     VKEFRAKFTTESKRDYTKKITSEYCIGSTLKHPNVIETIEISFENDRLVQVMEYCDYD
                     LFAIVMSNKMTENEINCCFKQILNGLRYIHSIGLAHRDLKLDNCVINKDGIVKIIDFG
                     SAVVYQYPFSNKLIEATGIVGSDPYLAPEVCVFNTYDPRPVDIWSTAIMYCCMVLKKF
                     PWKIPKLSDPSFKAFASREPGVTFGELLKRLPDSLEPSPISSIPEGTEIEGHTASDKD
                     TNEAAGEPIHTSDLIGEDRLLKALKPAPRKLIGKMVRLAPACRISIDEIFETPWIKSL
                     EMCSVVNENGEPANNGKLVPGSDHTHTQVDQSVAHIACFERAKKKQAAKK"
     gene            <949654..>950109
                     /locus_tag="C5L36_0D04590"
                     /db_xref="GeneID:40385561"
     mRNA            <949654..>950109
                     /locus_tag="C5L36_0D04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467349.1"
                     /db_xref="GeneID:40385561"
     CDS             949654..950109
                     /locus_tag="C5L36_0D04590"
                     /inference="similar to AA sequence:RefSeq:NP_014214.1"
                     /note="PKUD0D04590; similar to Saccharomyces cerevisiae
                     YNL185C (MRPL19); ancestral locus Anc_2.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323209.1"
                     /db_xref="GeneID:40385561"
                     /translation="MSRAVKDISVKLIVGAGKAAPTPPVGPALGSKGVKAIDFCKEFN
                     ARTAHYTPDVPIPVKLTVRPDRTFSFAIRSPTTSWLLLQLIGKEKGADTLGKGKFQKQ
                     GYLGTISLKHVYEVAKIKKTDDTHADIPLKDICKSVISTAKTLGIQVVE"
     gene            complement(<950382..>952862)
                     /locus_tag="C5L36_0D04600"
                     /db_xref="GeneID:40385562"
     mRNA            complement(<950382..>952862)
                     /locus_tag="C5L36_0D04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467350.1"
                     /db_xref="GeneID:40385562"
     CDS             complement(950382..952862)
                     /locus_tag="C5L36_0D04600"
                     /inference="similar to AA sequence:RefSeq:NP_014213.2"
                     /note="PKUD0D04600; similar to Saccharomyces cerevisiae
                     YNL186W (UBP10); ancestral locus Anc_2.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323210.1"
                     /db_xref="GeneID:40385562"
                     /translation="MSSSLDHLNQYKNSKKKTLNPVIETLLKEPINFKIAKNPDKVTI
                     KPSSYKVFKSSLGKSKSIAQHNSNQEEKKKVQMARPKSLAEAVANYSRRKHPQAANTN
                     NDNDNDTANVTLRNIHGDSGRNTRKKQKVSSAEKREQLKKLLLQQSVESRPQTSQEQQ
                     HGSIDSAVVSMEPKDSVNDDKEEDSNDDEDDDSSNGNENVGDSQGADDDDSSDDDFHT
                     AESETGDDQATSSSSDDNGDGDVEEDSGDDNAVLEELQDNSEDEEDEEEEEEEEEEEE
                     DANDEEENVMDENHTNQLAKNLKTDVLTDQVSGSTVETPPTSNNDDDERGKSPKPSTQ
                     LIANNYSQSDFWDLNENPNDQGSNNSKRIHKSWGDFIENHIPLGLVNHGVTCYMNAAI
                     QSISHIPSLTHYLIDVSKGKYDKELKPDSVTKVLASTINKMYRIGHNKKILMINPKKL
                     CKRLEDINCMMSEWQQEDSHEYFMSLMSRIQEDSTPKGVKLNQSIIYDIFGGLLDQTV
                     TCKNCGHISTTQQEFYDLSLGLENRKKRTSLMVEPQQLNQLKDQIENCNSSSNNEKNQ
                     LSKILQQRILLAKRENSGSLSPTDENSPSTETINADSLKNPSDENGSTNYNSNKLQQS
                     PDPQESVPTKRYSLENAIRDFFTPEILRTDKRDQSGYVCEKCKKQSNAVKISTIQRAP
                     ETLPVHLKRFRFDGQQSQKVKANVSYPEILDLTPYTTSMSTPVRYKLISVIVHQGRSV
                     SSGHYITHCRQPDGTWATYDDEYINKIPRASALSDPGAYVLFYERLTSKNALKEPPFS
                     EGTSAENSNRKKRKSQPNKNNTKNKRRK"
     gene            <953778..>954176
                     /locus_tag="C5L36_0D04610"
                     /db_xref="GeneID:40385563"
     mRNA            <953778..>954176
                     /locus_tag="C5L36_0D04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467351.1"
                     /db_xref="GeneID:40385563"
     CDS             953778..954176
                     /locus_tag="C5L36_0D04610"
                     /note="PKUD0D04610; Pfam Domains: Clat_adaptor_s(6.6e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323211.1"
                     /db_xref="GeneID:40385563"
                     /translation="MGVQFILCLNRRGKVRLQRWYYPCDEERRRFTIEDVHYRVGEAL
                     AHGGGNTIPYGATLKLVFKRYNGVTFIVCVPCLENELYYLQSIPAFVRELDMELENVS
                     ELDLVYNFHKMDAILDRFYNCGELMLKGDN"
     gene            complement(<954361..>954834)
                     /locus_tag="C5L36_0D04620"
                     /db_xref="GeneID:40385564"
     mRNA            complement(<954361..>954834)
                     /locus_tag="C5L36_0D04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467352.1"
                     /db_xref="GeneID:40385564"
     CDS             complement(954361..954834)
                     /locus_tag="C5L36_0D04620"
                     /inference="similar to AA sequence:RefSeq:NP_010880.3"
                     /note="PKUD0D04620; similar to Saccharomyces cerevisiae
                     YEL034W (HYP2) and YJR047C (ANB1); ancestral locus
                     Anc_1.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323212.1"
                     /db_xref="GeneID:40385564"
                     /translation="MADEEHNFEVADAGSSLTYPMQCSALRKNGHVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTQKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGYLSL
                     MNNDGDMKEDVRAPEGELGDKLQAEFDEGKELIVTVITAMGEEACISYKEAPKGN"
     gene            complement(<955812..>959186)
                     /locus_tag="C5L36_0D04630"
                     /db_xref="GeneID:40385565"
     mRNA            complement(<955812..>959186)
                     /locus_tag="C5L36_0D04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467353.1"
                     /db_xref="GeneID:40385565"
     CDS             complement(955812..959186)
                     /locus_tag="C5L36_0D04630"
                     /note="PKUD0D04630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323213.1"
                     /db_xref="GeneID:40385565"
                     /translation="MARNTRENTMPLTGGRRERGDVSSPGSYYISQPPQQLPYQVLSG
                     YHIYMSEQHQNGNTGGANGANGANVANVANGANGANVANGAHGNVNGNSGQLQHHHQP
                     QLQQLQLPLGYEYLPYAIPAHYYTERQPQESPIPTQGRHPLSGMKSIYTGGSDLPTPT
                     QPPLNTMAGHQQLPYIYVQSNPVMSNSVDHEMTTVNTSTTSATTKGNFAGFPISHMEN
                     GEQVQTNLSTSTTTNSKGRNASLGYTPEGGSHDTQRSSPMDSPLHLDTKENYKSDIQT
                     KDGVRNPPLTNPYLSHQLNSSMLETSLNRTSPSFATNSSHQPAKSGSNGVFSTSSNVN
                     KISNLLNDDDDDNIFSQIRNNDNNGNVITKDIDEDTRANGQDLKNDINATENGINGME
                     NGYKNLDQGKHIAKHANDRNFIKATFDHVDQKHEPIYLKLKRGRPLKIMNTEGNSSTS
                     RKRDRVPRKIVKPTKTVVLRMDADKLREITNLGDGSRDTKEMKNEELMQACESNLQST
                     QLLQVTEEQIDRLNHRNNPKSPQELIQLKKALPNAIKISDNEVPIIPRGYIPLVMAPD
                     GTLIPMELVNINPKSSFVSILRPIWDRVDAKSSDTDTNSHYIGHEKKERDGVFFEFNN
                     ADKCASLSLYLLSKESACKLVYPKFTGDRKFQREIVYYNRLIEREKLEIFSIYKKERN
                     KLSRLLEKLDVNLEQTDYDIDLMEMRDYELLREELSYLYEKQTIEREYSSNVRELKSV
                     QYLDYSSRLLKFKNYLNVENERLRRHKNRLCRINHNKCQSIWNKYIKSGGMRNRHSTG
                     MALFTTTATGTNTDSNNSSSGGIASGSNCGTGGNEVTTYSNLESSFISDREFILLTNP
                     NSRSYATYVLNNSMDKGNKNQNEIVGLIDYYLDENSTLMLLYEEVKRRGYTFNEKTRN
                     VLINKNKKKDMISEYGLTKIGVNTSSRILRELQIDGMNVDLKRNERIERRSVGQRNGR
                     PRKNSVYNANSVNVSTFSSNTHHDSSSDSNNYLTTDNNDNISNDHKQVSRSTSASPGS
                     NGAVVVEDLEHPRGGTQMPMEMNLRRELNITSSLDKSLCDVDRVKMLNLNREEIGASY
                     TKVYGMPSGLTVAEINSDLSLLRWSAQQSSHKGETR"
     gene            complement(<960238..>963156)
                     /locus_tag="C5L36_0D04640"
                     /db_xref="GeneID:40385566"
     mRNA            complement(<960238..>963156)
                     /locus_tag="C5L36_0D04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467354.1"
                     /db_xref="GeneID:40385566"
     CDS             complement(960238..963156)
                     /locus_tag="C5L36_0D04640"
                     /inference="similar to AA sequence:RefSeq:NP_009762.2"
                     /note="PKUD0D04640; similar to Saccharomyces cerevisiae
                     YBR203W (COS111); ancestral locus Anc_8.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323214.1"
                     /db_xref="GeneID:40385566"
                     /translation="MEEQGVNGTRQTPNTSVGKSGEMFNTPHFRNNAEPSLSKLSLSS
                     PTPIKGPPRIHSKHNLLHHEFAREDEAEMSKSFNDVSPRENKFLALAKFGTGIPESCH
                     SENYKVSDNANNNVNLYASANICSQMQHGRASIPTSRNMGIEVKPDTVLKMDTDDNEG
                     DKSVSDPHPSKRKRNSTNEGINANDECTGSTKSDEGDLNTSGLEFKPQRLEPLNNDVA
                     SMDRSRSVATSTIDFLSVQLSTDDEYSNEQERFKSFFEMDDAFSIFTSQNSNFDLRIN
                     EVQAGIICTTTTPTKVQMKFSSSRNMSNPSLRSFCSNARSSLQDDVTGKFSIDQLVAH
                     ENNQAVAETGSILTSESRVDSPSLYSSDPPPYTPFIEKSESCSTSSLKEEDKRSGSAI
                     SLLKRNLNSPCGSGGPVSPMKRKNNLSVNVFIPPYRSLINPHRGYDYITRRVINVAEY
                     EFPIGHNSLLRKKKESKIKSLLSGTSKMIKNAAHASPDKYKSTTQFKELPSDVVKRII
                     GMVTDQRDLVNCLYVNKEFHKYSKQNLYRYPKFTSSYRFAQFVHAIMNNHELPPLVEV
                     FDLSMITTPISLTAAEKTRYQDKLVYGTTAAMDVLNDKSRVVYAGWRDWKYRNNPQYN
                     GSIDWRTRRSNSLSAISSLPRPHFELIDGRNHSFNSLVEMRRYKTNSSSSSSFSLLTG
                     KGKKEGKKRSQDCKALRKRSNSLPKIKDSSSRGDNSLFKALKKSFSREKSTKQKDEFR
                     RSSVNVVGGGCSGREGTMRRRGNRGSVGVKFGGKSVEVVSARVVPFEKPHPRMNDMLK
                     QYCFHRDVPIGYVMHVLMECRQLREINFNHVLLSTDYEMKDYSSFNHATGKGTTMYAS
                     YGKKPVRLNASRPIFWSDTDRDTNINDGKFIEGFIESVPFRDVWRCFLEQENIERLFL
                     ERLKPIEQSTINEFLFHSRFRERLQMLSCYKSGMVRREEWNVLKEAQEWREYIAGDDS
                     "
     gene            complement(<963389..>964777)
                     /locus_tag="C5L36_0D04650"
                     /db_xref="GeneID:40385567"
     mRNA            complement(<963389..>964777)
                     /locus_tag="C5L36_0D04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467355.1"
                     /db_xref="GeneID:40385567"
     CDS             complement(963389..964777)
                     /locus_tag="C5L36_0D04650"
                     /inference="similar to AA sequence:RefSeq:NP_013947.1"
                     /note="PKUD0D04650; similar to Saccharomyces cerevisiae
                     YMR220W (ERG8); ancestral locus Anc_8.737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323215.1"
                     /db_xref="GeneID:40385567"
                     /translation="MASQARAFSSTAKAFLAGGYLVLFPEYAAYVVALSARMHAVSNF
                     KRDEDGFFKITVNSPQFKNGCWSYEIDPEKIKTNGLTAELFEVEARRNPFVEATILTV
                     FSYALGKYPKMEGKDITITMFSDPEYHSQKGAVKKSSDNGSYAFLYHGEEITGVNKTG
                     LGSSAGLVTSLTASLLSCLVEEFDLSGALWKEKVHNLAQIAHCKAQGKIGSGFDVASA
                     TFGSIVYRRFNSKLVTNVIDSSDVDSLIKVVDNSDWETMHSPCVLPRGIRLLMGDVEG
                     GSETPKMVSKVLEWKRANPEKCLQVWSALNESNMKLTNALLELNALSSSSFTEYETLI
                     KNLSFYNSNEILQLEGDNVEYLQNVIESLSDIRKYLKIMTLETGVSIEPDEQSNILDA
                     VCKVKGVLGGVVPGAGGYDAICMLVASAEVANIVASTRLLPECEHVRWMSLSEQSLGL
                     IEENVADFSGLV"
     gene            <965221..>966732
                     /locus_tag="C5L36_0D04660"
                     /db_xref="GeneID:40385568"
     mRNA            <965221..>966732
                     /locus_tag="C5L36_0D04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467356.1"
                     /db_xref="GeneID:40385568"
     CDS             965221..966732
                     /locus_tag="C5L36_0D04660"
                     /inference="similar to AA sequence:RefSeq:NP_014702.1"
                     /note="PKUD0D04660; similar to Saccharomyces cerevisiae
                     YOR059C; ancestral locus Anc_5.660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323216.1"
                     /db_xref="GeneID:40385568"
                     /translation="MTEAADRHHLIVLAHGLWGSCTNLARVESVIHHTLGKSNLCTFH
                     TFAPTSFAHFKTYDGIEAIGEYLIEELFKHLEILHDEHGITITEISFIGYSLGGLVVR
                     YVIGELFGAGMFQTIKPGFFTTFATPHLGVTFYENTILNYLGSYFLGRTGYDLFISGG
                     KKAIVYKLSDPQEKYYKGLKLFKTKITIANVKFDRTVGFYSAFISQYDPFKDWNSIEP
                     EYIPGLPTALLTKSGRTIDCLIVDLKKSKRLVDGEKNSTKGPAYKHAMFLVGCIVTVL
                     FPIILGVSTFATLKSLARTALLPKTDVKSSWKYLYESIHKGEEFVHDEAENVKLLDNQ
                     DAESDDYNEDENLKEKPKGISHLTRSVVENGLNFLNDDYDDLALTPAVSGASSKANVR
                     ENYKIDLDFELDYQSKNKTLDNLLKNVLRGDLSNIPLTEKLSPLPFDCTRRQILNNLN
                     TLDWIKIPVLLQNLNSHQSVVGRRGFERTPDCIPFLFLYSFLIEESLTHYGKQ"
     gene            complement(<966980..>968962)
                     /locus_tag="C5L36_0D04670"
                     /db_xref="GeneID:40385569"
     mRNA            complement(<966980..>968962)
                     /locus_tag="C5L36_0D04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467357.1"
                     /db_xref="GeneID:40385569"
     CDS             complement(966980..968962)
                     /locus_tag="C5L36_0D04670"
                     /inference="similar to AA sequence:RefSeq:NP_012514.2"
                     /note="PKUD0D04670; similar to Saccharomyces cerevisiae
                     YJL020C (BBC1); ancestral locus Anc_5.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323217.1"
                     /db_xref="GeneID:40385569"
                     /translation="MEKLDLSTHAKEIKSNYDSVVRGESSYAIYTTLKDSSLKPTTLG
                     DGDIKDFVSEFEEGAVQFGILRVNPFGSDVQKLVLLGWCPDSAPIKSKVSFATNLSNV
                     GKVLHYHVEITARDSDDLDVDDIMKTVSNASGARYSIQSLTPSSSTGSKFKPAPKPAS
                     NLSAPELSTPKPSPSIIKPKPSLPPKKAEEDGWGDEEEIKERDFSKQPLETLPSAYKP
                     TKVDIDALRSGKPSLPVDDKVHAKEEDKPTKPVSPLPQSATISINPSGGLTSLPKPKP
                     SNSVLSRFNQEVVKPEFGTKVPTFGSNPAKDSSILVGGASRNFASSNGKTPAQLWAEK
                     KGQYVEVERDDKPVNAAEVEGDVEKEDHSVNDVKAKFEQIHLQAEKEEEEEEEVNSKK
                     SPTSSFPPPPARETPSFPPPPARETSSFPPPPAKETSSFPPPPARNDAFSKFQEKQPA
                     EEDNDGWDEEEEEKEETNKPEPVKEKSGNVNPVPLPPRDVSEPSAISAASASESAPGA
                     QPEASKASESKSNVAVAEYDYEKDEDNEIGFAEGETITAIEFVDEDWWQGTNAAGETG
                     LFPASYVSLKIETTVETSASPALPTRNDPTPPEPVKSEGPSAIAEFDYDASEDNELTF
                     KEGDIITDIDQVDDDWWLGSLNGERKLFPSNYVKLQ"
     gene            <969232..>970677
                     /locus_tag="C5L36_0D04680"
                     /db_xref="GeneID:40385570"
     mRNA            <969232..>970677
                     /locus_tag="C5L36_0D04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467358.1"
                     /db_xref="GeneID:40385570"
     CDS             969232..970677
                     /locus_tag="C5L36_0D04680"
                     /inference="similar to AA sequence:RefSeq:NP_012539.1"
                     /note="PKUD0D04680; similar to Saccharomyces cerevisiae
                     YJR006W (POL31); ancestral locus Anc_5.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323218.1"
                     /db_xref="GeneID:40385570"
                     /translation="MTSLEKVVRKTPIWSDHQDKTFENPARTRKYSSQFNSLYTYRSN
                     ELKSRVLKLANPKWKDVDVNGEKPKFIPKVLDVPFLKPVYIIGTTLADMKYKPNVLKE
                     VELSVQGHFQELNQIKGNTKTHKSGIESMRRASYSDPKTDKLWLEDESGRILLTGDLL
                     NEKIIVTGLVIGVLGIEVESGIFHVVDIVYPEAAEQKPIPAALNQDGKLLLCSGLNIS
                     HQSSLDKYEILKSWIFGDLGDQRAQTVNEMILVGNSVDVSQVEHKAKTGKDKYTDDYG
                     AQFSKFSVEYLDSFIDELTHSVPVCIVPGPGDIVELGLPKPPLHKSFFNKSSRKGNFK
                     RLTDPVFHEVNGLRILISSGETINDIMKYIIPNINDSEDIIDESVCNDSRLRVIEDSL
                     LWQIVAPTAPDTLCCYPFEDKDPFTLVETPHVYIVGNQPKFETSMVELKRKNGDVMPV
                     RIISVPAFDESRTCVLLDLKTLACELLKVDI"
     gene            complement(<970774..>972414)
                     /locus_tag="C5L36_0D04690"
                     /db_xref="GeneID:40385571"
     mRNA            complement(<970774..>972414)
                     /locus_tag="C5L36_0D04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467359.1"
                     /db_xref="GeneID:40385571"
     CDS             complement(970774..972414)
                     /locus_tag="C5L36_0D04690"
                     /inference="similar to AA sequence:RefSeq:NP_011687.1"
                     /note="PKUD0D04690; similar to Saccharomyces cerevisiae
                     YGR171C (MSM1); ancestral locus Anc_5.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323219.1"
                     /db_xref="GeneID:40385571"
                     /translation="MKPLTKLAVYTTTPIFYVNAKPHLGHFYSMTLADVRNRWCKLNN
                     RETFFTTGTDEHGLKVQNAAQAANTDPKCFCDDLADKFKELAKLGQIKFDRFIRTTDL
                     DHYNAVNQFWNTVNANGYIYKGIHSGWYCVSDETFYPENDIMESVDPKTGKKIMISKE
                     TQNEVVFQSEENYFFKLSNFQNKLLDFLKKNKNFIQPKKYHDFIINELETRELTDLSI
                     SRSSQRLEWGIPVPNDDTQKIYVWFDALINYLTSEGYPNAKEMPQPTHLIGKDIIKFH
                     CIYWPAFLMAAGIQLPKQVVVHGHWLMGGRKMSKSRGNVADPIAISNYYGSDSLRLFM
                     MKYSVLDSDGDYSEESLNNLRSEFIDKFCNLMIRSLSKNFSIERALSRLENKNFESLL
                     DANSDVSFKENLISIRDQINSLKADIDDDITNFNMHKAVQKIFNFGPIINGLFDTYEP
                     WTLKVKPSDDEEIVTAKQLKQDLIIFTALDSLRVILILLQPIIPVYSNLLLDRLKVDR
                     GRRTIEYAALGKDLCYGKDATFKKGQNVPLTKLELKDA"
     gene            complement(<972839..>973129)
                     /locus_tag="C5L36_0D04700"
                     /db_xref="GeneID:40385572"
     mRNA            complement(<972839..>973129)
                     /locus_tag="C5L36_0D04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467360.1"
                     /db_xref="GeneID:40385572"
     CDS             complement(972839..973129)
                     /locus_tag="C5L36_0D04700"
                     /inference="similar to AA sequence:RefSeq:NP_013952.1"
                     /note="PKUD0D04700; similar to Saccharomyces cerevisiae
                     YMR225C (MRPL44); ancestral locus Anc_8.749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323220.1"
                     /db_xref="GeneID:40385572"
                     /translation="MITKYFTNVTVKFNPFGKEARCARSILSQIPPSLKNTCQVKLEL
                     INGSSKKQPIVQVTFKDNTVMGGDPRKLKLADFANMFDKHSKKLLFKEEIDK"
     gene            <973498..>974424
                     /locus_tag="C5L36_0D04710"
                     /db_xref="GeneID:40385573"
     mRNA            <973498..>974424
                     /locus_tag="C5L36_0D04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467361.1"
                     /db_xref="GeneID:40385573"
     CDS             973498..974424
                     /locus_tag="C5L36_0D04710"
                     /inference="similar to AA sequence:RefSeq:NP_014931.3"
                     /note="PKUD0D04710; similar to Saccharomyces cerevisiae
                     YOR288C (MPD1); ancestral locus Anc_8.750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323221.1"
                     /db_xref="GeneID:40385573"
                     /translation="MWNLHLLYLIVLAVSVSAHRSRSNAPAFYSNNKYIMELTSSTFH
                     DYVYGSNYSTIVEFYAPWCGYCKQLKPEFETAAKKAHDYAQFAAVNCDDEKNKQFCAS
                     QNINAFPTLITYRPPKSFRETVPRDQQYAVQPFENERKANSIINIMRGTLKSHVRKVP
                     STKIESYFTRKTGKPRALLLTDKAQVSALYKSLAVDFLSVMDLNYILVKDDLVDQIRK
                     YAPDLADDVPQLLVIQEDGTVTHYSGKFSKRAISEFLSEFAVPVEGDFSDRKRAIDGI
                     KNGKFKSFLQYKKKMAKKEEKQSRDKLGKDEL"
     gene            <974628..>976361
                     /locus_tag="C5L36_0D04720"
                     /db_xref="GeneID:40385574"
     mRNA            <974628..>976361
                     /locus_tag="C5L36_0D04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467362.1"
                     /db_xref="GeneID:40385574"
     CDS             974628..976361
                     /locus_tag="C5L36_0D04720"
                     /inference="similar to AA sequence:RefSeq:NP_014181.1"
                     /note="PKUD0D04720; similar to Saccharomyces cerevisiae
                     YNL218W (MGS1); ancestral locus Anc_2.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323222.1"
                     /db_xref="GeneID:40385574"
                     /translation="MVSCPICSKHIPLAEINEHLDLCEIKNKNRKVEAENDIPSDGVA
                     KEHSDKPENVSKVETVHGSSQPMIAVNGDSHTTSLASILTGKKKSKDKPTYQYRPSQH
                     HETSPLSSVSSSNEINTPAVKSKRPISGDECRDDLKRHKKQIIDNLKISANLPLSERL
                     RPTDIGGYIGQQHLVGPRGVLRGYLKQGRVPSLIFWGKPGTGKTTLARILAKTTNMRF
                     VEMSGVINGVSDCKKVFEEAVNEMKLTRKSTIMFIDEIHRFSKSQQDIFLQYVERGII
                     ILIGATTENPSFTVNKAILSRCKVFTLEKLSNHEMREMVGRGLVEINKVRKLVHNTSV
                     LKLSEEGIDWIISVADGDGRQALGFVEMIDINFTNTTDENKPEEVTLEDIKGILKNSP
                     MLYDRVGDAHYDTISAFHKSVRGSNPDAAMYYLARMLQGGEDPLYIARRMIRIASEDI
                     GVLDDSCLPFAVAAYQAVQMVGLPEADLALVHCAVKLSRAPKSVEIYRGWNQMKAWTA
                     NPEISGAEIPLHLRNAPTKLMSDLGYKKGYKYPPDFKDGKVSTTYFPDSVGEQQFLKG
                     QHLGDAIDPDL"
     gene            <976928..>978019
                     /locus_tag="C5L36_0D04730"
                     /db_xref="GeneID:40385575"
     mRNA            <976928..>978019
                     /locus_tag="C5L36_0D04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467363.1"
                     /db_xref="GeneID:40385575"
     CDS             976928..978019
                     /locus_tag="C5L36_0D04730"
                     /note="PKUD0D04730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323223.1"
                     /db_xref="GeneID:40385575"
                     /translation="MKFATILSTALLSTLANSAALPKNDYKYFARRYYNESEPLTQPI
                     SAVQLDQTQSTAGVSLSSLNSASSQTSESSTAAPQTVATTAAPASIEETTTLPLESTS
                     IYTDKNGQEQTTTFYLTTTLYITYDSKSSTITSTPSQQHKLAGVSSVGSLDVTASSAA
                     PASTLTSNASSNSATPSITSTTTSSTSVNIDDLVNSLQGLGKQADVAAVQSVLGSSII
                     DSTCPSASTVTVTVTPSECTSSDALIAPSNLKYMKVTSFSTATATTTLTVPITATLTV
                     TDGSSVRVFTATSSVATAVEQTTVVTITATSTMTLSSETTGYATVTTTSTAYSTSDLT
                     IDPASTGVSYSNGSLDSPAVNLWAKRSFL"
     gene            <978239..>979174
                     /locus_tag="C5L36_0D04740"
                     /db_xref="GeneID:40385576"
     mRNA            <978239..>979174
                     /locus_tag="C5L36_0D04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467364.1"
                     /db_xref="GeneID:40385576"
     CDS             978239..979174
                     /locus_tag="C5L36_0D04740"
                     /inference="similar to AA sequence:RefSeq:NP_012836.1"
                     /note="PKUD0D04740; similar to Saccharomyces cerevisiae
                     YKL087C (CYT2); ancestral locus Anc_2.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323224.1"
                     /db_xref="GeneID:40385576"
                     /translation="MGLVCHFNHTHKLFESTTLHPKMSDESKCPVDPRTRDIWLQKSK
                     EAQKAQEQRLNTQQEKQLILSKETSTWTWMNLLWAPKPTSCPIPQVNASGGCPVPHSS
                     GTNIPEGHPSVNGLAITTSEPESIECNSKEIDQGLTTPPNAVSGSKLLSEQREISSIP
                     RTNVDSNWVYPSEKQFFNAMLRKNWTPEEKDMKTVVPLHNLVNEVTWKYILNWEKGQG
                     SCGCEDIKLTSFKGDSKKITPRAAIGHYIFGRDLPFDRHDWVVNRCGKEVEYVIDFYT
                     TPVKEGEEPRFFLDVRPKLNSLEGCRMRLYRALGL"
     gene            complement(<979341..>979721)
                     /locus_tag="C5L36_0D04750"
                     /db_xref="GeneID:40385577"
     mRNA            complement(<979341..>979721)
                     /locus_tag="C5L36_0D04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467365.1"
                     /db_xref="GeneID:40385577"
     CDS             complement(979341..979721)
                     /locus_tag="C5L36_0D04750"
                     /inference="similar to AA sequence:RefSeq:NP_011869.1"
                     /note="PKUD0D04750; similar to Saccharomyces cerevisiae
                     YHR005C-A (TIM10); ancestral locus Anc_2.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323225.1"
                     /db_xref="GeneID:40385577"
                     /translation="MNLNLKISLSIFIETYPLNSFLALFYPETHPTSLEMSFLGFGSQ
                     PQISSEQKIAAAEAELDMITTMFNQLLDSCYRKCFDKNITDENLSQNESLCIDRCVTK
                     YFEANVKVSESMQSVGNSGALARK"
     gene            complement(<979879..>980730)
                     /locus_tag="C5L36_0D04760"
                     /db_xref="GeneID:40385578"
     mRNA            complement(<979879..>980730)
                     /locus_tag="C5L36_0D04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467366.1"
                     /db_xref="GeneID:40385578"
     CDS             complement(979879..980730)
                     /locus_tag="C5L36_0D04760"
                     /inference="similar to AA sequence:RefSeq:NP_011109.3"
                     /note="PKUD0D04760; similar to Saccharomyces cerevisiae
                     YER182W (FMP10); ancestral locus Anc_4.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323226.1"
                     /db_xref="GeneID:40385578"
                     /translation="MFGSHARTMPRRFDIFRHPLYRQNCLYSSVKFPPPYAHYHRKRR
                     SYFKPALLFFIAGAALSYNYSLYELGERRFPLPLTSDSKSISQFNERLESRLQALPIV
                     KELRTDPNFVEYRDWNHLDSSPTGLSNFHGTLRTPGGISIPPLSFHCQETGDDIVIVH
                     VGRRMSGYPFLVHGGMLGMLVDEIFKSNLIKEFPNLTFDNVHTKSLDLKFKSPTFVNQ
                     FLIIKSNSAKLDTVNNDYIVNSHISTTDGKVLVQASAVLSTDTNSLTSSVPTRPLEKK
                     TNTGWFW"
     gene            complement(<981209..>981715)
                     /locus_tag="C5L36_0D04770"
                     /db_xref="GeneID:40385579"
     mRNA            complement(<981209..>981715)
                     /locus_tag="C5L36_0D04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467367.1"
                     /db_xref="GeneID:40385579"
     CDS             complement(981209..981715)
                     /locus_tag="C5L36_0D04770"
                     /inference="similar to AA sequence:RefSeq:NP_011110.1"
                     /note="PKUD0D04770; similar to Saccharomyces cerevisiae
                     YER183C (FAU1); ancestral locus Anc_4.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323227.1"
                     /db_xref="GeneID:40385579"
                     /translation="MNLPNGELPTLPLLELAFSQGKTVYLPRIEPLSTNNDPPRYNGQ
                     KTCLHFLRVDSLQDALNLPPRGKYSIREPPLIANRDALPTKSPLDLIVLPGVAFTSEG
                     GRLGHGAGYYDDFIKRYRSLHNLTPTLVGVGLPEQLLPVHNIQLEDHDEQLDYVVIAD
                     TTFCRFCK"
     gene            <983425..>984516
                     /locus_tag="C5L36_0D04780"
                     /db_xref="GeneID:40385580"
     mRNA            <983425..>984516
                     /locus_tag="C5L36_0D04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467368.1"
                     /db_xref="GeneID:40385580"
     CDS             983425..984516
                     /locus_tag="C5L36_0D04780"
                     /note="PKUD0D04780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323228.1"
                     /db_xref="GeneID:40385580"
                     /translation="MTLKRSLSQKFKSTLEKTKRIVSSSSLSSFDNHSPSVSDSFSFN
                     STDFSTPLTSTSTTFNDATDFGGLGIQYNKDSISLNRKSSSLDPPTLLYSRKKRSGTM
                     SRSIPNRKQSIDLIDTSTPTNITSSIPTPVSQDDLLSLSCRSNYSFTQNDENFENDTG
                     GLIILPSGPNDDDDIDDDDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNISG
                     KLNNTNSNDNNKTTIEGSHDILLSAFLSHSAELEKNSSYLDSQSQDRPSILIPSNYSS
                     TTTSYTLNSFAENSAKCNMDLLESHEIIQDDVDSIFTKSNQIDHLDKDLDTRKNDLLA
                     DQMALNILQNIDEEDVDELSKLKEEISMI"
     gene            <985230..>991286
                     /locus_tag="C5L36_0D04790"
                     /db_xref="GeneID:40385581"
     mRNA            <985230..>991286
                     /locus_tag="C5L36_0D04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467369.1"
                     /db_xref="GeneID:40385581"
     CDS             985230..991286
                     /locus_tag="C5L36_0D04790"
                     /inference="similar to AA sequence:RefSeq:NP_012674.1"
                     /note="PKUD0D04790; similar to Saccharomyces cerevisiae
                     YJR140C (HIR3); ancestral locus Anc_4.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323229.1"
                     /db_xref="GeneID:40385581"
                     /translation="MVNSTNNPTIDSLKYLCFRNRGMLRLRELIDNSIKTNNGNPSVH
                     VGGDSHKEKVNDYGDDDVGISVYGEFLGAMNDLLNAVSFGTPDDKIIIILASLFEHFG
                     YLRLSRLCYELKTFNDDILLINDAKLIDGYLKLLSNLNVHNRVYSKLKNKIERSLFWK
                     NRNEFKSYDWDELLTLEAWENERCDALKEELVIEVDVNDGIVNIDHLLGEFVGCLPKP
                     KGRGKCYDGYTLTGKTIDKVEFEFHFKNTEPIRSEDTNDSVEKPHSERKIEDLDLPEK
                     NDAVLTASDSGNQVINDTVRFRVLRTKNEDDQNDQLKNSLERLNNFASVTLPSFLKTC
                     NININFPSLVNLILYGDECGIDLMTRKFYSCIKSWDDDFTQCLSVTGDNKKKNNESVR
                     EILNINSSKVINHSKYTTADVVSLKPFLDSMNSGGMHFNEIRMHVLEYLFNSKYICFN
                     NMSKASLRNLKSIVDSVSINYFNQMEKSVNIGETIDSRMLNIAVSIFELLVDSFLEQS
                     KEQKLKITKSSNLLQDPYSSENILINRINKWSSIIEDMLITDQTIGKSEVWCRFKWFQ
                     LLYLQSCPSHIKTQILTDLLTDLIDVIRSNELYLPYVNFELVPVLSYESISTQHSKLS
                     ILQMFDSNDKSNEILENILLGLPNPTLNDDPAKSQLEKFTKLANLQMKLRLWCLLLRF
                     YRIENQIEKYKLAFEKVLNIMTNELHPDSLIKLSPEDQNFTILTIVGFFNYFSTKFIE
                     FADECNFTCFQPTHRQSSSAVLSFIGSLTYCLYSFLMYQKSVQVSRKLSLHTVSVKSY
                     EILMNAISCCLFLACAYYPSALTNRNEEYINDFMSLCHVELGLRHKCMTLNGTFLKFL
                     QLKLLDLDINISCTDFFQVIHCRFGMPVSLDKFDTFDHKCKPKSMTVEDSEQLSQYIS
                     KYCYKGKHPAVSPPKSDIKSIIDKIVQTVEPIQETDPASVQNRKIFNNFLKHTSIDME
                     FIIACFQGDFELDFKTPDGIFASVAKNGMYYLQGIVGLNLVNSRKRNAYLRSSELELI
                     QKTLEKDIQCGCNRFETWVALGQIYSYLVEYDLIWTADKLNSIERKHQTAFTQKKALL
                     CYFNAINTLNKLPNSERSKASAVLPGFWESLGKELYAAWREPMNKRAFHVKPKEDKND
                     QIIYLASNDIPHNAISKLLDLAFKNAYELNRSSWFDLMYLAKSELMLQYVDVKSKLIV
                     ESLLKACTLSLDQSNKEDPILEPHYYLFTIVGKLLKRGIITEADAIQIYKDDDLFVSI
                     FEGEESTDFPIIAKKMLEKMIDYDKKKWQHKPVYKLAKWYHDVEHNNLKAKEEMLKLV
                     NLKANVRALSTIWKPNSERPGKHYIYNSIYTQFLVDILYELGDIYSLSILVKKMRRAG
                     STMVNLTKTFDAITLRTCSLLKKSLKIEPGYLDNVISKIKFADFLKYSNEYIETLRNT
                     NIFDDNMLLHFYFLSETHNFRKLATGFGATGVIDESFHSIYMLLFMPYLTKRIIAEEF
                     KGLPAKYLLEKSKKFSVDKILKPKQSTPDATNFPEGPEIQLDPITGLLVPVTAKEQTD
                     EEIPPLEEFSKVYQDIIHLPLQDQLSIISYLSFSSLGSDTPAKDKIKVARRDVTPFAT
                     KVVNITQSFVDELKERTEDGKSINYGIEGPFTEKDLMNVNVGVSVKTTKENKEDWEFN
                     KLTSAHDRSFTAVELSNFNKILDTYGVTTLENPQTNSEVEVEKMRMEGMKQEEANQNG
                     NVVSVYGSKSAQGLSNNSVNHEQESKDSLHKNNEISSLPDHEINDTPISTTPLFPSSA
                     QESGVNTWSAQSGMDVNNPFHSPSKTNAIEGTLLAQNTSVQTTDDLPQSMSVTGNSNA
                     PITKILPEHYNKNADPANNEECSKHCEETKNIITGSPGGSEKLTPSKPVQSKITSFFK
                     LTPSRESDFSSMASDGGASPLKRKMLEENTSAAKRGRYYFDTDDISHSNAESSEHSMS
                     SSPRRNSRRSVCNPTLFELGKDGVVKEQKDIKTERAKQLAEVITSGDEEENAEQSVII
                     ID"
     gene            complement(<991354..>991938)
                     /locus_tag="C5L36_0D04800"
                     /db_xref="GeneID:40385582"
     mRNA            complement(<991354..>991938)
                     /locus_tag="C5L36_0D04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467370.1"
                     /db_xref="GeneID:40385582"
     CDS             complement(991354..991938)
                     /locus_tag="C5L36_0D04800"
                     /note="PKUD0D04800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323230.1"
                     /db_xref="GeneID:40385582"
                     /translation="MAKSDNRYTRGLKSNTTAGKDASRKSKRDTGIFYGDDPSDVWRV
                     TRLACINAMTKTLDSYRSKHPDEDLPQSSSLIAKSYEEMLHKKYNDSLSGYKLRFRKD
                     LVALKNSKTGFTHDLLFGVMKVEDFIKLEERDLVPQIQKEQDKKLLEDELKMKIGKNL
                     PSDINQIKNNKVFVGEKWGVSESAAKIDPDFDVE"
     gene            <992340..>994973
                     /locus_tag="C5L36_0D04810"
                     /db_xref="GeneID:40385583"
     mRNA            <992340..>994973
                     /locus_tag="C5L36_0D04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467371.1"
                     /db_xref="GeneID:40385583"
     CDS             992340..994973
                     /locus_tag="C5L36_0D04810"
                     /inference="similar to AA sequence:RefSeq:NP_010388.1"
                     /note="PKUD0D04810; similar to Saccharomyces cerevisiae
                     YDR103W (STE5); ancestral locus Anc_8.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323231.1"
                     /db_xref="GeneID:40385583"
                     /translation="MNSHHYSAGMRHQPSNVASDSELAYRLEPTINQNKLEPSKNPEG
                     ENHHEKSLAFNNDMNKSPPPLPNVPSSSDIYTKKIANFKRKLKTLKGISTLDIRKTSQ
                     STIKGNKQRCENNCDKHKVVTSMDDRVLANVLTIDNNVTNFPTCFSRNSFDASSPKVT
                     ALLDPKSFNFPTRKLARDTRCSICNLQLDTSYNIIKNEHIIELQCGHMTHEECLLMEI
                     ELSLTLSKTFLENQQMLKDFFPPCGSCPNNVKAAKPKEEDIMTRLFTRLITSEIIPIR
                     NSIISNQTPTTPLFSDTSKILDQSTNSILSIDHKHTDYTNHLEIENYFDMPSSVKSTG
                     KSFYGEENNENTNTSKLKKNIEEQKHSKKSYKTHRKKPSRGSYVSATSAIVTSSSSTN
                     NIKNEAAKITYNGTPTIGDQKFIEDLVKLSNKNIIESTDDANFKLTLSFVKSLGKLIL
                     VDKLNALESINGKQSTVTEKYCYLFEHMLITISSKDYIFSMFTITHTTYVYTQPRCIT
                     MQACKSSASYCNLLFDKDIVFERWAKVLTDRRKKMEMPEITLTMHENEFDSILSGHYN
                     DVTDVETIGTLQSYIGDDGYRRLPTGVCPRFYEGNIDSLVFHQKPTKAIIIINEAKHI
                     PSSVVPIKNIVKSLSLIGIDILLLLCSTSALSMDSNVHDSCELNKKDYKGKIDMIMDK
                     IDDFQNFLLDKSCNTVKPKVEDIINDQLSDDIDSTISIVISSSTLNNFGNVSTYSRIL
                     MEVGLDGRHKSKRDDVKDLASWDEIMEVICVCCGLEFDESDFYNSSSDDDDDYGDDDN
                     GNDEDNDNRCDDRYGDSSKQKNVGHQNEAGETETTHKTSSLLYPDSSKIDDDTISDIF
                     MDSLRIAKKNDQDDNSSAFTS"
     gene            <996504..>997930
                     /locus_tag="C5L36_0D04820"
                     /db_xref="GeneID:40385584"
     mRNA            join(<996504..996510,996615..>997930)
                     /locus_tag="C5L36_0D04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467372.1"
                     /db_xref="GeneID:40385584"
     CDS             join(996504..996510,996615..997930)
                     /locus_tag="C5L36_0D04820"
                     /note="PKUD0D04820; Pfam Domains:
                     Cys_Met_Meta_PP(2.9e-218)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323232.1"
                     /db_xref="GeneID:40385584"
                     /translation="MSDFSTKCVQAGQENAESSANARAVPIYATSSYVFRDSKHGADL
                     FGLREPGYIYSRIMNPTHDIFEKRMAALENGSMAVATSSGQAAQMLAVLAAAQTGDEI
                     VSTSYLYGGTYNAFKNFKKLFGINVKFANGDDLESIKSLINDNTKAVYLESIGNPKYN
                     IPDFKEICDYAHSKGACVIVDNTFGAGGYFCRPIDHGADVVTHSATKWIGGHGTTIGG
                     VVIFKDPAKDNGFKFSDWPEKFPQFSKPSEGYHGAILNDMFGDFAYIAYVRVELLRDL
                     GPCQNPFGSFLLLQGLETLALRGERHGENALKLAQWLEKHPQVSWVSYPGLVSHPYHE
                     NAKKYLQNGFGAVLSFGIKDIENPTGDQFKEAGPVFVDNLKIFSNLANVGDAKSLIIN
                     PWTTTHEQLSDEEKIAAGVTKDLLRVSVGIENIDDLIADFEQAFAKLK"
     gene            complement(<998034..>1000067)
                     /locus_tag="C5L36_0D04830"
                     /db_xref="GeneID:40385585"
     mRNA            complement(<998034..>1000067)
                     /locus_tag="C5L36_0D04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467373.1"
                     /db_xref="GeneID:40385585"
     CDS             complement(998034..1000067)
                     /locus_tag="C5L36_0D04830"
                     /inference="similar to AA sequence:RefSeq:NP_012158.1"
                     /note="PKUD0D04830; similar to Saccharomyces cerevisiae
                     YIL108W; ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323233.1"
                     /db_xref="GeneID:40385585"
                     /translation="MSIEFENLPSEKEELQVPVYILKGRSTARKGGLIGAFSDRFSDQ
                     FYEVTDGYFKAYLHLSPGINTITLKHLDGCFQSNGYAGFDTRVKPFAEIVVRINYSPI
                     PKSYVNVPQIHLCVMVGRDSPALFDCPSGKMYEGNNMNTAVKKLRVGARIMQAFTIDE
                     MNKNNVGKRCFRFVEEETVSTISYQEEMKGIRRSEVKIHVIVTDRSVAEIRDANYAQQ
                     NANAKEAGKLFDFALQALEKYGGPFSPQSTANIPALAAVMILDATWDKQAKLIRGHAA
                     LGGGNDKIKLAIFGSQGLHSWPMNWESIHRAFTDCTPLNVEEVANDCNECSQYWECLC
                     VSLGAFMHEIGHSLGCPHQENGVMLRDYTWMNRKFLTKEKNCVRTRRAEWGPVLSKDE
                     PGWNRLDVIRFLYHPAFMLPTDLEDDTFKPDYILENQGMKLPGSLTSEPTFIAVDNDT
                     LDIISDTGIYLIEGHVGEWSRVHYEYLPRLYGGHGPQKYVRLQYSLIQQQMKNEFRNK
                     AVKLEVLCMGFGQRSIDDLRKYLEEHSKTITLSNNRSAKKSDVYGLRTSNYQECVFPA
                     NKKIKFFRISHGMALDGIETFFEDGSKVNFGNLKSHYSDFKLDKDEYLTGISFRAGAW
                     VDSVQFITNKRASPNFGGNGGGLHRVPLLPRQNLLGFYGQFGDWCDQIGIFYG"
     gene            <1000286..>1001398
                     /locus_tag="C5L36_0D04840"
                     /db_xref="GeneID:40385586"
     mRNA            <1000286..>1001398
                     /locus_tag="C5L36_0D04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467374.1"
                     /db_xref="GeneID:40385586"
     CDS             1000286..1001398
                     /locus_tag="C5L36_0D04840"
                     /inference="similar to AA sequence:RefSeq:NP_013430.1"
                     /note="PKUD0D04840; similar to Saccharomyces cerevisiae
                     YLR326W; ancestral locus Anc_4.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323234.1"
                     /db_xref="GeneID:40385586"
                     /translation="MGFVSSFVEGIAQDYALDTATDKWNEFAEKKFQTKDPYTYETPE
                     GKSKKLKLPENATKEEQKMWKWVQRRAWVDDKCFMGCYPVDCGIGLGPILVILPAIGP
                     FLMYAVHARMVHKAASFYKLDAKTFSKLQANILFDLIISFPPVIGSFFTWMTGCSTRN
                     AAIIHTEVTKRLMNRKNSKIADSSGNLEKKTPPSSKGQLNPQNPHGEQRKLNPYPEIT
                     RQVPSQTKRENLTKHTPSQSKPFSNPATRSSERPLPRAPKAGSTPNNVDSPYSQQSPQ
                     PPAKFPAQYTYTDRYRQSNDVRKPPPVRRPPFENKEQLPPPVPDRDIPDELYYPVKAR
                     PLNEVEHNPHEFYPVEYEQDVNIQGQYPIYSNRKFV"
     gene            <1001786..>1003012
                     /locus_tag="C5L36_0D04850"
                     /db_xref="GeneID:40385587"
     mRNA            <1001786..>1003012
                     /locus_tag="C5L36_0D04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467375.1"
                     /db_xref="GeneID:40385587"
     CDS             1001786..1003012
                     /locus_tag="C5L36_0D04850"
                     /inference="similar to AA sequence:RefSeq:NP_014335.1"
                     /note="PKUD0D04850; similar to Saccharomyces cerevisiae
                     YNL064C (YDJ1); ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323235.1"
                     /db_xref="GeneID:40385587"
                     /translation="MVADTKLYDILGVSPDATEQQLKKAYRLGALKYHPDKNPSPEAA
                     EKFKEMTGAYEILSDPEKRELYDQYGEQGLGGGPGGPGGFGGMDAGDIFSQFFGGGSS
                     RPQGPRRGQDIKHALGVTLEELYKGKTAKLALNKTVLCKACDGKGGKNVKKCTACNGT
                     GTKFITRQMGPMIQRFQTTCDQCNGTGDIMKEADRCKVCNGKKVTKERKILEVHVTPG
                     MKAGQKVVFEGEGDQGPDIIPGDIVFIIEEKPHDLYERKGDDLIHQQKIDLLSALAGG
                     EVAFKHVSGEWLKLTIHPGEVIAPGATKVIKDKGMPIPRHGGYGNLIVKFDVEFPKNN
                     FASEEKLKQLEAILPPRPKLDIPKGAEVDDSCEFEDFDPSKHQSRTSNGQRGGYYDYD
                     EDDEEGGHPGVQCAQQ"
     gene            <1003566..>1004150
                     /locus_tag="C5L36_0D04860"
                     /db_xref="GeneID:40385588"
     mRNA            <1003566..>1004150
                     /locus_tag="C5L36_0D04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467376.1"
                     /db_xref="GeneID:40385588"
     CDS             1003566..1004150
                     /locus_tag="C5L36_0D04860"
                     /note="PKUD0D04860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323236.1"
                     /db_xref="GeneID:40385588"
                     /translation="MGIPDPRQDPVLLREHQFRSTLERELVVPEETHSFVPVREQGLG
                     LMNYDLVDPQRLTNEGALKRDTVKSAVGVLTSGTVVMIVVVVMVVIGYVVYRSIYRRA
                     VYSGRELRTVDKAQHDEEAGLYGHHLGHGGPAGERVVLYTPRESSCLNTTSSSSYVCE
                     SSASLGGSCSSMQEMDLDLGLELNMDLRIVQRQT"
     gene            <1004765..>1005334
                     /locus_tag="C5L36_0D04870"
                     /db_xref="GeneID:40385589"
     mRNA            <1004765..>1005334
                     /locus_tag="C5L36_0D04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467377.1"
                     /db_xref="GeneID:40385589"
     CDS             1004765..1005334
                     /locus_tag="C5L36_0D04870"
                     /inference="similar to AA sequence:RefSeq:NP_010799.3"
                     /note="PKUD0D04870; similar to Saccharomyces cerevisiae
                     YDR511W (ACN9); ancestral locus Anc_1.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323237.1"
                     /db_xref="GeneID:40385589"
                     /translation="MQEIGYIDELATLTNWLPCDSGGRALVTTRGPFGDQQTRRCTMR
                     ATLFMRDASKIPFKVTMKQPRREGSPLLSPLPLYRAILRAHRKLPHDQRSLGDMYVRA
                     EFRAHRDVENPLQIIGFLSSWQKYLEMVLQNTKDDWKKYHLDDHILEKMSDDQIVQLH
                     ELMKSTQKVYKDGEEEAFTIDENGQVLPR"
     gene            complement(<1005429..>1007654)
                     /locus_tag="C5L36_0D04880"
                     /db_xref="GeneID:40385590"
     mRNA            complement(<1005429..>1007654)
                     /locus_tag="C5L36_0D04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467378.1"
                     /db_xref="GeneID:40385590"
     CDS             complement(1005429..1007654)
                     /locus_tag="C5L36_0D04880"
                     /note="PKUD0D04880; Pfam Domains: Zn_clus(5.8e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323238.1"
                     /db_xref="GeneID:40385590"
                     /translation="MACDKNSNFTFVGLSSRSKSGCLACRKRKKKCDEVHPVCGYCQD
                     RNKPCEWGEQSKGKPKFQFNINSIIESQRMIGKVNSLKRKSQRSKRGKKEQAKIIKEL
                     DNKEETQLIESECMQILPKSHCTTSMDSSSHIVPSVDDLHMLLPENISGYVEDNNDNI
                     LPLVEGFMNNEPMMNSLLSNVVEHLRSPKFSPVTNFIDHNINTALAQADMLFHRNDAF
                     LLNDFDVNPMNLEDVERFEELDEPEAPIENTNNDKESEDIGKYPPMDESQMLENTYAS
                     DNDLINILKSKKLHPYLRPTVQLLLSMKNTLKFISPSSPILRQLDTTGKLFLENYVTN
                     LAMNMLDIGNKKFFLDYAITQATNEPVILYCLVAWGGMFLAGKSNEEAKKYVSKSYQL
                     ISLKRESFRKSEINEMVTTKSTKLDNDERIKILLVHILLFCAEISTGDVNNWYQKLLQ
                     CKELLDEYGGLKEFVKLNKHNKVAKWILSNIFYHDVLSTRTLGEGTLIPIEEYKIAFI
                     GENFLNVKEYGLDPFYGLSQNLYLLLGEVASYRRILKNMKMPLPLNYEMMDGLLASTN
                     ERNYREIENSWFQIFDLQIQNSQPPKEMVDLLLKSDPSGKFLEHHLTWYELTQISLRI
                     YIRISFKEIVFDDNEVQQLRERGLILFNILIGTKLQSLLGLSLLMLGITSVYDSDRSL
                     LKTSYNRLVENYHIKNVQVCWGIVRQIWNRYDWQVNLQHPHYVDWSEFVNSMGWNCCF
                     T"
     gene            complement(<1008014..>1008445)
                     /locus_tag="C5L36_0D04885"
                     /db_xref="GeneID:40385591"
     mRNA            complement(<1008014..>1008445)
                     /locus_tag="C5L36_0D04885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467379.1"
                     /db_xref="GeneID:40385591"
     CDS             complement(1008014..1008445)
                     /locus_tag="C5L36_0D04885"
                     /inference="similar to AA sequence:RefSeq:NP_012578.3"
                     /note="PKUD0D04885; similar to Saccharomyces cerevisiae
                     YJR044C (VPS55); ancestral locus Anc_1.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323239.1"
                     /db_xref="GeneID:40385591"
                     /translation="MAFTVNPLSKIIALSGMLALGFLLVVLATALYGSWMPIIDGFIF
                     AFAHIPYLLTNTTIGDDFQTGFADIDDTSRHSGADFGGWVSSFILTSGIALPIVLSRS
                     QLLSSMASTLTVVGGLCIYVTIVLFSSFFDGFSNTNDPFSM"
     gene            <1008776..>1009779
                     /locus_tag="C5L36_0D04890"
                     /db_xref="GeneID:40385592"
     mRNA            join(<1008776..1008778,1008892..>1009779)
                     /locus_tag="C5L36_0D04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467380.1"
                     /db_xref="GeneID:40385592"
     CDS             join(1008776..1008778,1008892..1009779)
                     /locus_tag="C5L36_0D04890"
                     /inference="similar to AA sequence:RefSeq:NP_014045.1"
                     /note="PKUD0D04890; similar to Saccharomyces cerevisiae
                     YMR314W (PRE5); ancestral locus Anc_5.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323240.1"
                     /db_xref="GeneID:40385592"
                     /translation="MFRNNYDNDATTFSPTGRIFQIEYAIEAIKQGSAAVGLVSKTHV
                     VLAALKRNAEELGSYQKKVIKVDNHMGVALAGLAPDARVLSNYLRQQAMTSKMVFNRP
                     LSLSKAVYSLADKAQENTQSAGGRPYGVGLLVAGYDSSGAHLHEFLPSGSVLEYLGSA
                     IGARSQAAKTYLERNINEFQDATKEELIQHALTALRDTLPQDKELNSANTTVAIVGVD
                     QDFTIYDDDHVEQWLALLDTLKNARSTGLNNDDDDEDDDDENENKNENESAQPSTGED
                     ASSGTHPSTGNDADAMDVDA"
     gene            complement(<1010035..>1010712)
                     /locus_tag="C5L36_0D04900"
                     /db_xref="GeneID:40385593"
     mRNA            complement(<1010035..>1010712)
                     /locus_tag="C5L36_0D04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467381.1"
                     /db_xref="GeneID:40385593"
     CDS             complement(1010035..1010712)
                     /locus_tag="C5L36_0D04900"
                     /inference="similar to AA sequence:RefSeq:NP_012298.1"
                     /note="PKUD0D04900; similar to Saccharomyces cerevisiae
                     YIR032C (DAL3); ancestral locus Anc_8.594a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323241.1"
                     /db_xref="GeneID:40385593"
                     /translation="MLYETWELLIWKSCDGLLPALQRMVKLLDVDTSEYNCTIKAKRS
                     YDGYERYGVAMNADHLKGTVSTDEANQGSALKLIKVAPCLNEYEKAPSGHDATTNWNI
                     FRSCVIPEKWMTDESGYKVYNLTVLEQHPYTTQTFVPMGRGADEDAYVVNVAPDKNGL
                     PDFENVEAFIFKGNTAVTYNIGVWHSPMVVLGKTTDFCVVTNENDVPRENCVEVFYNP
                     GIKIQVE"
     gene            complement(<1010861..>1016638)
                     /locus_tag="C5L36_0D04910"
                     /db_xref="GeneID:40385594"
     mRNA            complement(<1010861..>1016638)
                     /locus_tag="C5L36_0D04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467382.1"
                     /db_xref="GeneID:40385594"
     CDS             complement(1010861..1016638)
                     /locus_tag="C5L36_0D04910"
                     /inference="similar to AA sequence:RefSeq:NP_011082.3"
                     /note="PKUD0D04910; similar to Saccharomyces cerevisiae
                     YER155C (BEM2); ancestral locus Anc_8.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323242.1"
                     /db_xref="GeneID:40385594"
                     /translation="MQNHQTNPTLGSAANRNPSPMWDSKHLHRTPSTSSLRTNNSSRT
                     SNIELKKLISSDFKKLGRSIVSSSSPLSKRQSSLSHQQPSQIHQISISSLVDPDWDST
                     TLKNGWINRIHEGGEKRLVRIELKGSNLNIYRLPAELNYVKDLIVHTPAESQVNTMSE
                     SILNKEFKNNESSTSLTSSSSNTSDKVQIELSNDSFQDESVELAHLIEDYERGQVELD
                     ELQHQQMQHQQQIRLQAQSVPTSQLQRLKVGNSTHIGSQHHSFIIHNLSYESPSCPHP
                     KLTIDPMSGLIVEGNLEAICHTILFHPSESISARLIEVLPLTGSLIDPLVYFQKFLDH
                     FTNAEGLHTKNIKITNMEMNLLFQRTEHLVNYFVTHFKGSLLDDQIFQMLSKLTKDLA
                     GKSPSHTSIFELSGKIKSERMKLLNLISFQLDPTSMSSLHVQPLPIHSSQLISAEQFL
                     LLDLDSLANEIHSIDLHFFKRWSSQNDRSIFLSKNNNHSYKYWNFNPLVFNPSFNTHY
                     LGRLLAFHLFEDPVASKSPSKRAHILMKWIRLGGILCEHGDMIAWLGIALVICSLPVL
                     RLARTWGHVDKADIEMIRKKWAPVVFEIRKHELFTTKSDNECTTENVNNKETNLRIMI
                     PNKVGEVYSKNDAIPHYGELLTYNLETDEDSDYSIKSLCAYMEMVNWNFKQWDCYFDN
                     VADLPDVLPRFVFLESDDSNAIQNIKDAKIHQLLKDAITFNSSNKPCDINSFMEKSVE
                     CEPPYAGRFAKFYNISRSPLFLGSYPSILFPQILPHYTIYDRSDLIGALGSLNNNLES
                     KELRYKNRNIFVKHVRDQFDKDSEEFRLTDDSIIFRTCEPVDSTTKDHSRPSSILFEN
                     PGLMRSKHVSTLSTGGFSVEDYINSYQAYLKDSIVSDSSDSTLNNFSESDKEKTNLSS
                     GKMVKIWTSAATPERLVDLLVLTASVFGTHLKLEDIENYSKKSGVSAAFLLQMDDYSF
                     TCSFFATYRVFFTTKDLISALYKRFKGSVSASLSIMEGITANGIPVTIPIWDNVIAED
                     DETYSKINWKFVMQIQLGVIEATSILVSDYFKHFMDDLETKATFDQFVEMMDTTIITE
                     WPGIIKWIKENKTSDVNEIINIYKNLQSSYKQVRNTCIRKSYTPLSTPIELDFSDELT
                     TIPSEMMLPTSADIDEILKYVNSLDSTIRSVIAEIRVDDWVDTFEVLEMLISRSPLSM
                     FNYKYQDANTHPSLITVSNIYYWIMTLTDDENSVSEKLINQLPATVGSALKLYKRMET
                     YLLMQIIDSDINVDERTDRMRTLLKIIRISRIRMKKVVLFEEDLENKQEKSPDIPSFI
                     ESVVTNTILRPESRFFSHAWKLAASLNLQDVDLSALDKILPEFTDYEIKTVEDDSYLS
                     ICPGWILGRLVEIASFIPNMGVENTSLINFNKNRFIHNCVLRFKKLQGSAVNKHNKSP
                     YLTESSFLFEFVGQIPSLKTIYEVSVAERREEKLTSGEIFSKHVGEQIQLLKLEETKR
                     NLLIRQRELQHSKDFRNYEVDFNVGQNDERNGSTSDLMTISTKYSNGGNWSIKESTKS
                     ISEYDASTHGDTTASTVVNTVPEIRPSQQPTARRNSSTSSRPSSSSRKSHGSSSASGT
                     SSKFKFGFLKSRLTMNISSSNQASNEKKSISLSALPNVNVVANGSKSKPMTVVPLKDA
                     SIFPTYSTPNSFTVDLQQTNHEYTFQTSTEQEMSDWIYRLSFAKKHWFFSKNLNKQFG
                     NSYNRLTFGAPLAFVCERDNSNIPLFVDKIMNEIELRGLEEVGIYRKSASLLIVQKIK
                     DEVNKMGDFNMENSLVFDIHNLTGTLKAYLRELPEPLIPDGLVEQLGAVKETKDEFSR
                     FTLYRKVLSQLPTCNFSLIERLSRHMKLVEEYKEQNKMTSYNLATIMGGSLVEGCRPE
                     TIRKSFGLINYICEDFIIHYEHIFQ"
     gene            complement(<1017102..>1018094)
                     /locus_tag="C5L36_0D04920"
                     /db_xref="GeneID:40385595"
     mRNA            complement(<1017102..>1018094)
                     /locus_tag="C5L36_0D04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467383.1"
                     /db_xref="GeneID:40385595"
     CDS             complement(1017102..1018094)
                     /locus_tag="C5L36_0D04920"
                     /inference="similar to AA sequence:RefSeq:NP_011083.3"
                     /note="PKUD0D04920; similar to Saccharomyces cerevisiae
                     YER156C; ancestral locus Anc_8.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323243.1"
                     /db_xref="GeneID:40385595"
                     /translation="MSKVLQICTHSGSFHADEALAVYMLRLLPRFRYAKLVRSRNQLD
                     WEASDVVVDVSGKYDAVKYFDHHQREFSTTFNEKYKTKLSSAGLVYKHFGREIISTVI
                     ALDETNAEDKVKLDYLYDKIYSDFIEAVDANDNGIDMYENKDSLTPRFKDKNFTIAGM
                     ISNLNPSWESDATDHDFDRQFEIASNLIGDAFFKYLTYMGNSFLKAKQYVIDAFKTRY
                     EVDSSGKILLLPRFIPWKEHLFNVEEENNANGEILYVLFPDSNSNWRIAAVPLSSTSF
                     DSRKKLPEPWRGLRDEELSKATGIDGCVFIHAAGFIGGTSSKDGALQLAKMALN"
     gene            <1018572..>1018946
                     /locus_tag="C5L36_0D04930"
                     /db_xref="GeneID:40385596"
     mRNA            <1018572..>1018946
                     /locus_tag="C5L36_0D04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467384.1"
                     /db_xref="GeneID:40385596"
     CDS             1018572..1018946
                     /locus_tag="C5L36_0D04930"
                     /inference="similar to AA sequence:RefSeq:NP_010364.1"
                     /note="PKUD0D04930; similar to Saccharomyces cerevisiae
                     YDR079W (PET100); ancestral locus Anc_8.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323244.1"
                     /db_xref="GeneID:40385596"
                     /translation="MRFRFPRLSRSQFELAKFTFYLMTPITIMYYVGIDTDRKFNVPG
                     YWPDPDTLNKIPKEPHEIQAELARIRQERLEKRRRLEEKARQLGITPDSVDKDQDQDQ
                     DQDPESESERQQTQIEAVLSDE"
     gene            <1019248..>1019916
                     /locus_tag="C5L36_0D04940"
                     /db_xref="GeneID:40385597"
     mRNA            <1019248..>1019916
                     /locus_tag="C5L36_0D04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467385.1"
                     /db_xref="GeneID:40385597"
     CDS             1019248..1019916
                     /locus_tag="C5L36_0D04940"
                     /inference="similar to AA sequence:RefSeq:NP_010339.1"
                     /note="PKUD0D04940; similar to Saccharomyces cerevisiae
                     YDR054C (CDC34); ancestral locus Anc_3.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323245.1"
                     /db_xref="GeneID:40385597"
                     /translation="MSSAKILWKEFRELTHPKTGLKQVHVDVEENDVFLWKVSLMVVD
                     PESIYNGACLQGQMRFPSNYPYSPPSFRFTPAIFHPNVYPDGRLCISILHSAGQQEAS
                     DEPLNITWSPAQKVESVLLSILSLLEDPNVASPANVEAGIAYRKQRDLYNDKVKADVL
                     KSIEAMPSDIVWPTLQDVTRKQSESVDEPMEYWEDDFYDDEYGEEEDDEDDDNSGDDD
                     GGDS"
     gene            complement(<1020078..>1020743)
                     /locus_tag="C5L36_0D04950"
                     /db_xref="GeneID:40385598"
     mRNA            complement(<1020078..>1020743)
                     /locus_tag="C5L36_0D04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467386.1"
                     /db_xref="GeneID:40385598"
     CDS             complement(1020078..1020743)
                     /locus_tag="C5L36_0D04950"
                     /note="PKUD0D04950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323246.1"
                     /db_xref="GeneID:40385598"
                     /translation="MLYSKYGLKAERLEEIPTIDTKMLNALVIQPLLLQLLTPVGELT
                     PFVPLSVSLISLDLQKPLLSCLSKQGIEQERQLNSQKALGGSDDIDAPAGESVPLLQN
                     QHGMYGGSSENVAVEEGKLRIAKLQKEIDELDDNYDADYINANVNPVDNLNILSLMVI
                     RDWNNKNDNEDWKVYSFGRYRIYMYSVNVRYALMLCTNEEYPSSIAISRMQGVSKILS
                     SKL"
     gene            <1021068..>1023380
                     /locus_tag="C5L36_0D04960"
                     /db_xref="GeneID:40385599"
     mRNA            <1021068..>1023380
                     /locus_tag="C5L36_0D04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467387.1"
                     /db_xref="GeneID:40385599"
     CDS             1021068..1023380
                     /locus_tag="C5L36_0D04960"
                     /inference="similar to AA sequence:RefSeq:NP_010337.3"
                     /note="PKUD0D04960; similar to Saccharomyces cerevisiae
                     YDR052C (DBF4); ancestral locus Anc_3.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323247.1"
                     /db_xref="GeneID:40385599"
                     /translation="MTDRLPLKDTSKKFVNNIQPAPSSFNVLTKSKPTLVFVKPKDPP
                     QPALQSPIVHAHKLTSGDAIPKLMGTSTPKKDGYVPCLQPTSQLLATNKAQQLDNQQL
                     QQQQQQQQQQQVQVTTKKMTGNELYKWQQTWREILPKSFIYFEHDDSNDREKKKAMLA
                     LKKLGASIEPFFGENVTIIVSRRNFDKNSHYPNGDIFRYAIKKQLKVWTIEKVFRFLN
                     HLGEEILNTDEYEELSNISNSNSNSISISNSNSQAVNNYSNNNLNNNNNNNNNNNLTN
                     LLLKERLFGPSDCDPSVRRNDFKYFTGFYMYIWDLTHKTRPVAVREWKDKTSIPKIHH
                     STNGKSLFIPETKPQNPIGILKRHQRRIQCLEDSHNFRQEIIDSCYETARYSSIKIRI
                     PTYEEREMYKRQWEGSYYKFLEEHPVEKLKLVYNNLSNEEKKPFAKIFDPFYELENIV
                     DTQSTQIVNGGETNETNGRKLCDYEELIEDFDEENFARLGSDDKVQCLGQRAVEQNDR
                     DLQILKRIPKLIRKDTLMNPSNSGATDCKLREYGEITASGIQASGINPSGSYSHGTNV
                     TYGNGLAPSKSHVINKALTNETKRIIVLDPANHSKETKRKQQKQQAEKEQLERQDKDA
                     IEELIDQLPEEECADDTTNGKNSINDDQLAALRSVETANNPFVSDGFPNKRIKLSRGT
                     STTKTKKVKVPAKELQVEKSRINLGIFKEPKQEKNKHELKPGYCENCRVKYSDFSEHV
                     DSKKHRSFAEDASNFLQIDELIKVLRADSN"
     gene            complement(<1023956..>1024825)
                     /locus_tag="C5L36_0D04970"
                     /db_xref="GeneID:40385600"
     mRNA            complement(<1023956..>1024825)
                     /locus_tag="C5L36_0D04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467388.1"
                     /db_xref="GeneID:40385600"
     CDS             complement(1023956..1024825)
                     /locus_tag="C5L36_0D04970"
                     /note="PKUD0D04970; Pfam Domains: DJ-1_PfpI(2.3e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323248.1"
                     /db_xref="GeneID:40385600"
                     /translation="MSNKELSNKPVPDRAEENAFFPSDYSLSLYVAKKTDYDGTTYPN
                     PYKGDKKFLAILTDERYLEMANGKYFSTGNHPAETLLPMFYIDNAGFNIDIATLSGNP
                     AKLECWAMPTEDETVLKTLAKFREQLKHPLNLNEIVDQVTGPDSPYVGVFIPGGHGVM
                     AKIPESKAVSKVLNWALQNDKYIVSLCHGPAALLATAAEKPEDFSFKGYKVCVFPDSL
                     DTGANQEIGYMPGQLKWLVAEKLKKLGAEIVNDDMTGKVIKDRKLYTGDSPLASNNLG
                     KLVAKDLLADSSL"
     gene            <1025896..>1027179
                     /locus_tag="C5L36_0D04980"
                     /db_xref="GeneID:40385601"
     mRNA            <1025896..>1027179
                     /locus_tag="C5L36_0D04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467389.1"
                     /db_xref="GeneID:40385601"
     CDS             1025896..1027179
                     /locus_tag="C5L36_0D04980"
                     /inference="similar to AA sequence:RefSeq:NP_014620.1"
                     /note="PKUD0D04980; similar to Saccharomyces cerevisiae
                     YOL022C (TSR4); ancestral locus Anc_1.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323249.1"
                     /db_xref="GeneID:40385601"
                     /translation="MSYESDDESISSGPVTTNTLLGYVDVPISDSNPLYPTDSFIGGQ
                     PLPMDKNSPIPFKLVHCKNCKSPMRLLNQTRAELDGTWYDRSIYVFICIEQRCRRKPG
                     AIRAIRGIKKDQKIMKQRQEEEKRRIEQERLVEARKLAKEEENKNLVKDLFGSSKVTA
                     NPFASNPFASSLDSNPFETAKASSKAEKVQKEKTETSLEEPITDDQPLVGEVKKANYK
                     LPEFKGFILYFETEKLDPANQVVAPIPDNLKIDESGATIEDTSDTGSVQTGNLPKINP
                     NKAKEQEDLSKIFDDQTFQNFTRILSYNTTQVVRYEPNGSPILYSSKGDVARIFYTPE
                     GKFKRKEEWSIPNPAYNPGGTRRFEMQLMPKMIIDLEEDITDVNMIMKNGMEWGTIIV
                     ATDSDDFVPLNWFDKNGVAYVEEWCGVQWEDEVKQ"
     gene            <1027727..>1030819
                     /locus_tag="C5L36_0D04990"
                     /db_xref="GeneID:40385602"
     mRNA            <1027727..>1030819
                     /locus_tag="C5L36_0D04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467390.1"
                     /db_xref="GeneID:40385602"
     CDS             1027727..1030819
                     /locus_tag="C5L36_0D04990"
                     /inference="similar to AA sequence:RefSeq:NP_012455.1"
                     /note="PKUD0D04990; similar to Saccharomyces cerevisiae
                     YJL080C (SCP160); ancestral locus Anc_1.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323250.1"
                     /db_xref="GeneID:40385602"
                     /translation="MSSPAELLAAKHAQAVEDETPSSAPSATSLADSPALIDSYATAS
                     TEESSPSTTADEIAEVAPKKPIRMDDDAQFPSLGSSVASPIAWGPAVSQSTSSSWGKP
                     VKSFKPAVKSTSTQHTFIIDDEQQQNLANGEIFKIFAKINSTLNVKVESTHSSATKKR
                     FFLLNGPIDNVATAKRELIRQLTKPTKITFEIPSKLRSTVIGSGGRTLKPIIESTSVK
                     IDIAKDIKEDDEEKTLLTEDEELFGKSITVTIEGDIQGCSDAKEQILAIVNENTKNLN
                     VKIPVSEKLKPFVAAEVSKLSFAGDVEAIAPEATSRISFIMVSGSRDAVIDARNQIKS
                     LLVDLDNQIIVNEEDVPKNLHQLIGTDKVLSETNVVIEIPSKDDASTKVRFIGVKSNI
                     PKAIALAKSTTSDYFVDTLDLSKSHGGNLQHAKNLTAYFTYTKYFDALSSEHEVSVSG
                     PSYKNLADSNSKSVVVSFISSKDKKENVKKARKDLIDMVNKITPTFVRTLSDIDSFIF
                     SKIDNQVAIENNVSIVPLGSLAGVTNILILVVQINDDEFLPSIEQINQRLDNVDKSLD
                     KLRALNKELISEVIEISAEDQKHLEGNTLKNLLNKFDSNSIEIKLHQNAEGPSENEIY
                     LRGFKSEIKKAAADINQLVEDIKNYEEASKYNTTIEFPTKYLARLIGQKGSHLSELQD
                     DFDVRIDVVSQDNDKLENAEIKITGLVSNVEECIKKISALKKKWADETTKSVQVEQKY
                     FKQLIGSNGVYAKRLQDKYNVKIQFSDSKEKVGTVLIRGPSRGVAKVEEEIKQLLDYE
                     KEHGYSETFNIPAEALARVIGKNGDNINDLSIDCEVKIQFQTSQAEAKETGFAQLEIK
                     GSKSGIKDAKAKIDEIVERVVNFATETIEVDPKWYRHLIGPNGMTMRETIIKAGGSAD
                     DRDFRRFIQFPNRDSDSKLVVCEGDKAVVAKIVKSIQDTVADLESVTEETIEVPKSKH
                     RFIIGPGGSIRREIEAKNKVRLFVPKQGSESDEIRIKGKPEGIKDAIAKIQELTAEKK
                     "
     gene            <1031208..>1033928
                     /locus_tag="C5L36_0D05000"
                     /db_xref="GeneID:40385603"
     mRNA            <1031208..>1033928
                     /locus_tag="C5L36_0D05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467391.1"
                     /db_xref="GeneID:40385603"
     CDS             1031208..1033928
                     /locus_tag="C5L36_0D05000"
                     /inference="similar to AA sequence:RefSeq:NP_116671.1"
                     /note="PKUD0D05000; similar to Saccharomyces cerevisiae
                     YFR016C; ancestral locus Anc_1.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323251.1"
                     /db_xref="GeneID:40385603"
                     /translation="MDMDSEIQEFQKQHTPSLIGDSVRQSSDIPTVTSLNEKSARPLY
                     MGTDSAVDLVPVEEIRAEGALVADEDDQLKDVLDESGHVVEAAIPDNIRLKSAEPSKS
                     SLIDQDELNQYKKNKLSSDESKVTILGGDAGTFIAPASGKGSSHKYPTKQKKGSSESN
                     NHGELIESENTRSVDDIINVVGKGDFEKASTLVGDKAAETLSTRIKELSIDDMKKASV
                     SSISMSSHEQDPEYTAPAAMRDGSESRCMSEARSSSSFSRPPISRYNSSSRPNLARGD
                     SIHSGLNGENALTNTFDETSNSLVSERRPRHDPSNPRVSNQSSINYLRSISRSRSRVR
                     NDRKALGEEVLDSNSLRASGALINDDEMSNAPDIDYAVKTALDFVEDTHATKGGNKPS
                     GTGDIVRDLQQGLAEVAEEEDASNRTQVDDLLDQLANSAKELMIGEVSDKEDIEIGAT
                     KDEVPESRDESVHSNGLTKPGVQNDEQKDKLDDLMETLKSEIIDLPEWEEKGEEETKE
                     EKEEKEEEEKEEKEKSNSGAIEQEKDSNSKETMTNESVEVAGQKLKEEEDLKREITAP
                     DRLVDNIDAFGSQYEASDFDIEITEHNTASESPLEEGISLAEENAPKEGLLKPKENES
                     MHNEGNIGEIGRSTETQVENAHCEEEGTQKDDEHDEEEETQKDDELEQAEKVMCNSKS
                     LGEDSDFPESKKNLKNDEGTEENIIEEKDDDKEIESQNETPIEVDTSRTETDNFSQLP
                     VPESSEDNQEENIVQINPADKSNEETNTHPDDEDDIDALIAAAAREKAMQDSHNNPMG
                     ADGSVYVPKAAKMTFEDEPVYLLTSFAGGFHVTTRTNRLVTILTANRIKFEYRDLGTD
                     EEAKKVWRRYSGGKTLPGIVRGKDDYIGNWEDIEEANEDYRVRSMIYESY"
     gene            complement(<1035257..>1038772)
                     /locus_tag="C5L36_0D05010"
                     /db_xref="GeneID:40385604"
     mRNA            complement(<1035257..>1038772)
                     /locus_tag="C5L36_0D05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467392.1"
                     /db_xref="GeneID:40385604"
     CDS             complement(1035257..1038772)
                     /locus_tag="C5L36_0D05010"
                     /inference="similar to AA sequence:RefSeq:NP_012427.1"
                     /note="PKUD0D05010; similar to Saccharomyces cerevisiae
                     YJL108C (PRM10); ancestral locus Anc_1.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323252.1"
                     /db_xref="GeneID:40385604"
                     /translation="MFKGDSGKNKKPTSNLKKTFQKHRRNHSNISVAETFPDFGEFND
                     TQINSSDNSTTSLTRLGQTPLMGTSNKSLESLQSAPELRPHLHTRSRSFNGINSLSPK
                     FSFPNKPNLPNPAKLKSGISKKSNKNRIKSTSLIESSTILEDDETEMNFPMLPEFSFG
                     GERKDIPMPKEKTSGGDLSAESGTESLENERQDVKMMRSSIDADFDFNFSKDATVPRG
                     QQILRSRKRNPPVHKKVVMSMGSSSDDDASTENETDSENENENGNTRNPFFSKSSGDQ
                     ESVKSQESPSKSGIRSFFRKRGLSLSSKSVPRSEQTHSSNTSNDSTDNKEKSSVNDIA
                     MERLSSSPPINEHTLNDSTDIHFSDEKAGHDNTDNDSANDTTVKNEGAYEDENYQTHD
                     DTGSFQVDDDNNGIGNTNSENFFKNIFHMDGLLGQGGLIPHQNVSQNTIKRGDTIHDE
                     ENPPPDFEEEIRGEAKVLVDHMIRSPLENLKKISFKNSRKRNASQSSNNDRAAGNDTD
                     NTGDSGIYVPEGAHLPLDPFDDLQNIEQFSIDVPENVIEKPKKIRAGIQSTLFQLYNT
                     HLMGTNSTATSLSGDNASTLVNEKPMHESFFLESRPEHNNLNMNLGEEIERTGIAGHP
                     LGNVDFLDEMPDLERIKDEETENFKSFHKKTASLQEKFFHVDPKKPANSSKKKSDVKF
                     ELPNFSSKPKSAATSGSEIKTHLGNLKKRRFNKMVNKETKARITVHITDVLERQRFIL
                     TLCKAFMLYGAPTHRLEEYMSMTAQVLEIDGSFIYFPGCMLVSFGDLNARTSEMKLVR
                     CAQGLDLGKLDEVHDVYKDVVHDRLGAVEGYQVLDKILTRKPKFNKWWCILFYALSSL
                     AVAPWSFGGSWIDLPMCFAIGGIIGFLQFVVCPKNTLYSSVFEVTSSIIASFLARAFG
                     SINSGNTFCYAALVQSPLALILPGYIILCGSLELQSRNIVAGSVRMFYAFIYSLMLSF
                     GITLGAALYGWIDHNATSATTCTTNISPWYRFLFVPMFTIGIALTNQASWSQLPMMCI
                     ISGCGYVVSYFASTHFKEVTELNATLGCFIIGLVSNIYSRSIKTINHYLKLRGSFMTV
                     ALMLPAIFVQVPSGIASQGSVFTGITAANNIVHSDNQTEASQTNSLSFGMVMIQVALG
                     ISVGLYLSTIIVYPFGKKRTGLFTL"
     gene            complement(<1040221..>1042032)
                     /locus_tag="C5L36_0D05020"
                     /db_xref="GeneID:40385605"
     mRNA            complement(<1040221..>1042032)
                     /locus_tag="C5L36_0D05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467393.1"
                     /db_xref="GeneID:40385605"
     CDS             complement(1040221..1042032)
                     /locus_tag="C5L36_0D05020"
                     /inference="similar to AA sequence:RefSeq:NP_014948.1"
                     /note="PKUD0D05020; similar to Saccharomyces cerevisiae
                     YOR304W (ISW2); ancestral locus Anc_8.778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323253.1"
                     /db_xref="GeneID:40385605"
                     /translation="MAYVPPHRKGVPPIDGAPASPSSGFGSRKTSGYGSRSNSGYGSR
                     SNSGYGSRNGSGYGGRSGGFGGNSPRQQRGEGKWVDGVHVPAERDAALELSLYGEEGD
                     SKFQSSGINFDNYDDIPVEATGENVPEPVNEFTSPPIDPLLLENIKLARFTKPTPVQK
                     YSIPIVSSGRDLMACAQTGSGKTGGFLFPVLSESFKNGPAPIPEESNRFSRGKAYPTA
                     LVLAPTRELASQIYEESKKFIYRSWVKSCVAYGGADIGQQIRNLSRGCDLLVATPGRL
                     NDLLERGKISLKNIKYFVLDEADRMLDMGFENQIRYIVEDCDMPPAEERQSLLFSATF
                     PKEIQHLARDFLSDYIFLSVGKVGSTSENITQKILYVEDEDKQPTLLDILASTDEQGL
                     ILVFVETKRMADILSDFLYSHNLPANSIHGDRTQRERERALELFKSGRAPILVATAVA
                     ARGLDIPNVTHVINYDLPGDCDDYVHRIGRTGRAGNTGLATAFFNRGNKNIARELVEL
                     LTEANQEVPQFLSSISREGGRGGYSRGGRNNNRDVRRNYGSSGNSRGGSSWGRGGSSY
                     GGQSYGNSYGGGNSYGGSSSYGSSYGSSSNNSSSQWW"
     gene            complement(<1042477..>1043643)
                     /locus_tag="C5L36_0D05030"
                     /db_xref="GeneID:40385606"
     mRNA            complement(<1042477..>1043643)
                     /locus_tag="C5L36_0D05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467394.1"
                     /db_xref="GeneID:40385606"
     CDS             complement(1042477..1043643)
                     /locus_tag="C5L36_0D05030"
                     /inference="similar to AA sequence:RefSeq:NP_014706.1"
                     /note="PKUD0D05030; similar to Saccharomyces cerevisiae
                     YOR063W (RPL3); ancestral locus Anc_5.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323254.1"
                     /db_xref="GeneID:40385606"
                     /translation="MSHRKYEEPRHGSLGFLPRKRAAKQRGRCKSFPKDDKSKPVALT
                     AFLGYKAGMTTIVRDLDRPGSKMHKREVVEAATVVDTPELVVVGVVGYVETPRGLRSL
                     TTVWAEHLSEEVKRRFYKNWYKSKKRAFQKYSQKYSKAGEIDTELARITKYCSVVRVL
                     VHTQVRKTPLAQKKAHLAEIQLNGGSIADKVQWAKEHFEKTVSVDSVFEQNEMIDAIA
                     VTKGHGFEGVTHRWGTKKLPRKTHRGSRKVACIGAWHPAHVSWSVARAGQRGYHHRTS
                     INHKVYRVGKAGDEASGATDFDRTKKTITPMGGFVRYGEVKNDFVLLKGSIPGPVKRV
                     ITLRKSLYGPTDRRALEQVNLKWIDTASKFGKGRFQTPAEKHAFLGTLKKDLEN"
     gene            <1045239..>1048913
                     /locus_tag="C5L36_0D05040"
                     /db_xref="GeneID:40385607"
     mRNA            <1045239..>1048913
                     /locus_tag="C5L36_0D05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467395.1"
                     /db_xref="GeneID:40385607"
     CDS             1045239..1048913
                     /locus_tag="C5L36_0D05040"
                     /note="PKUD0D05040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323255.1"
                     /db_xref="GeneID:40385607"
                     /translation="MSPPNRQYMSSSASARLNSTTIDNNLPLYGNKDSSEHSNTLSIK
                     DSDMSNQILSNDLNIKTSNHVMSQNNNVPTNYNLTMQGDVVRFPVVQPTYPSVIFHEQ
                     PQPSSYHSFDHHRQKIEFKQQQMSYENIHNTQCNPLYLHHPLAQHHQILLQPQDINQY
                     QPMQPLDQFNQPQQQAQNYAFQREVIQPQQQQIYHPYQSGYVQQHVQQHQPHYINQPR
                     LHSPYQFVSNRVNKPPHTNSHNHRNHLKFLSSFPSCDQTRVIDYRYDRSLSNPQSIQW
                     FEQSVYNLNPSFDSRSYTNRSNSSIQFDNSFQDLSNAASSAPSPYMKPPMGQQQLKVF
                     QKNHFSTNITPTYTDLQDNHHLPGDSLSFIGMHVPYPDLNYLNLAREPNVESSGLALS
                     NKCSTFEPMFNEKQFKTQSDDLKIINIPNDHPSPLSGASPFDAANHATTVDTKANNND
                     DSNFGNQSLLATLFISKFNSTRFLKFAEIHFSSFLQTIEKLNISADQFPSYDIDSDKC
                     FRKSREKLLLQWNDTQSSLSLNFCTCMKFVSYDSKPSACPFKCEEPILNHKNVTFSIE
                     LFNNFIISILNNKSLRSYLKNTIRPQKDSRSNTYYLQGVHDGSIYSDEKDADLDFIFT
                     FTIVSPNLKMKNPNSDNYAPLCLVLNELPPELKYRPEFVFLICFNDLNQPEPIVNKLL
                     EPIFLYFEHLRNNPLRISLNRHEYRFKILLLFGLSNADNNKRNLLNASNVTLDYPCSL
                     CPIPSVTVENQSCVTYSLVYNSRKIERIDKNNYKETVVEPMIRFSERKREKLYKTKVL
                     DSLNFSKHVFVDPLNATLLCVFKNGILRVCIDYLKSNRLSSIEQSIKTAHELENLFKN
                     PKIVSQLTNSIFSVPTDSIDIDDLKVLQRILPFFFRFELSEMFDASSRLKENITYRLK
                     SLSVLLELNSYISVLFCSEITKSSLQLIKKGFSSLIEEIENLSKSNKFEHLNKLLNVS
                     LHYMIHLYNDWEKFGTPNVASLLEMDKAIDKYGELVGTNAKPLKEKELCDRVKLLNIQ
                     NCMKVFNYRVPKYSTFEFMEIVPIPGNQLSQRWRVKVNEFCNRFLSKKEGYFEDGNYI
                     SFENIGLFRKDHIENRPSLQPTRFNLARIRNFRRSVGWRYIYINSMNQITHMNHETNE
                     KVSAVFIEYRMTNTEKWYCQTTRDRPKFQVSESLSMDAPSREMKSVWLDDIRLVNLRV
                     VGETHWIYDPHLTLDSVFNI"
     gene            <1049650..>1050882
                     /locus_tag="C5L36_0D05050"
                     /db_xref="GeneID:40385608"
     mRNA            <1049650..>1050882
                     /locus_tag="C5L36_0D05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467396.1"
                     /db_xref="GeneID:40385608"
     CDS             1049650..1050882
                     /locus_tag="C5L36_0D05050"
                     /inference="similar to AA sequence:RefSeq:NP_014947.3"
                     /note="PKUD0D05050; similar to Saccharomyces cerevisiae
                     YOR303W (CPA1); ancestral locus Anc_8.776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323256.1"
                     /db_xref="GeneID:40385608"
                     /translation="MLAYNILKNSAIKQVRFASSSKSLSSAQLVIKNGPTFSGLSFGA
                     PKTVSGEAVFTTSLVGYPESMTDPSYRGQIICFTQPLIGNYGVPSGTKRDEFSLLKYF
                     ESPHIQCSGIVVSDVALEYSHWTAVESLSEWCQREGVAAITGVDTRELVSYLREQGSS
                     LARLQVDGDKSSDFYDPGQVNMVAKVTTKQPYHIPVANAKHHVLVVDCGAKENILRCL
                     VSRGADITVVPYNYPIQKVADKFDGIFISNGPGDPVYCFETVENLKQVIKGNPDLPLM
                     GICMGHQLLSLAAGAKTLKLKYGNRAHNIPTLDLTTGKCHITSQNHGYAVDASTLPSD
                     YQEYFINLNDQSNEGMMHKERPIFSVQFHPEAKGGPLDSSFLFDRYFQLLDQYKVSNK
                     AKNLGDLSPEKLPGARVW"
     gene            <1051251..>1053607
                     /locus_tag="C5L36_0D05060"
                     /db_xref="GeneID:40385609"
     mRNA            join(<1051251..1052194,1052389..>1053607)
                     /locus_tag="C5L36_0D05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467397.1"
                     /db_xref="GeneID:40385609"
     CDS             join(1051251..1052194,1052389..1053607)
                     /locus_tag="C5L36_0D05060"
                     /inference="similar to AA sequence:RefSeq:NP_009652.2"
                     /note="PKUD0D05060; similar to Saccharomyces cerevisiae
                     YBR094W (PBY1); ancestral locus Anc_3.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323257.1"
                     /db_xref="GeneID:40385609"
                     /translation="MRVLLTNDDGGPNDLASPYIKYLVTAILKYTDWDLTICVPFSQK
                     SWIGKAHFAGKDVTVKYIYTSISKPEDNSYHGPFPCSQPKLKDDADLKEWLLVDNGTP
                     ATCTDIGVNHMCGGRDNVDLVISGPNVGRNSSALYALSSGTVGGAMEGCHQGKRAIAL
                     SYSYEIDPNVPAEWLTEASLISVKIVQQLWDNWNEKSRVQIYTVNVPLNENVKLGKTK
                     IYHVPMLENKWGESLFHKSDEVETNKHVDIVDGSVADGIVFKWRPNFDIVHKAIDKST
                     EKTDGKVIQQGHASITALRANFLHIDEENKGEMILQADSQAKKRIANVKIVITYSEDS
                     YIYKSLVKAIQNYFPDVNILHEIPPEGGYYVFHYGDYEELDHERLMSDRRYIANAFIY
                     RKSLIRKHYLSNTIAMYQAKHPESILNTAFPESFNFELTYAEFLDDVLDEVYDLRCVL
                     VENEEKMNKTFILKPAMTDKGQGIRLFKTIDQLQTIFDSFDEDDTDDEGDETNQGMII
                     SQLRHFVVQEYLSNPLLIPAYGNRKFHIRTYVLAKGQLQVYVYDRMLMLFSAEKYIDP
                     NQANDNVDDDGIVGMSGHLTNTCLQDDTDEKVVEELGKSLLPADMKSNIIDQIHEIVG
                     DLFRAGVNIDRMNFQPLPNAFEAYGLDFLVSADLNKQTGVTLLEVNAYPDFRQTGNDL
                     KNLIDEFFCGVISKAVLPLIGNEEEESENMSKVLDISI"
     gene            complement(<1053672..>1054625)
                     /locus_tag="C5L36_0D05070"
                     /db_xref="GeneID:40385610"
     mRNA            complement(<1053672..>1054625)
                     /locus_tag="C5L36_0D05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467398.1"
                     /db_xref="GeneID:40385610"
     CDS             complement(1053672..1054625)
                     /locus_tag="C5L36_0D05070"
                     /inference="similar to AA sequence:RefSeq:NP_009653.2"
                     /note="PKUD0D05070; similar to Saccharomyces cerevisiae
                     YBR095C (RXT2); ancestral locus Anc_3.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323258.1"
                     /db_xref="GeneID:40385610"
                     /translation="MALNETETVSLREDILRLKDKLARDQSARHCSGQTTDQARVIKG
                     TEVEPNLSDSVDGVHRMSIVSNRFNYDLKRIQLYNEDTGEYEPSLVYINNSLSSHLHD
                     RIQQEVDEEFGSENGDYDHMVENSDNNEDHEFNDVLKEIRLDQILRPISKPSDVVENK
                     AIKRIFQEPFLERLSNETIKIIEREQELDNMLNKTMDIFLHDDADHYAADNLGLPDYN
                     HFLDLDANPPNGQTHQELPHGDPFFQLAKYDSDPGFEGIEKDEIEETRQLLQIALQRN
                     EEYVRSLSEIRLGFLRANNYKEEVFKWCKEMYDNEKKENST"
     gene            <1055067..>1056434
                     /locus_tag="C5L36_0D05080"
                     /db_xref="GeneID:40385611"
     mRNA            <1055067..>1056434
                     /locus_tag="C5L36_0D05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467399.1"
                     /db_xref="GeneID:40385611"
     CDS             1055067..1056434
                     /locus_tag="C5L36_0D05080"
                     /inference="similar to AA sequence:RefSeq:NP_013740.1"
                     /note="PKUD0D05080; similar to Saccharomyces cerevisiae
                     YMR027W; ancestral locus Anc_2.578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323259.1"
                     /db_xref="GeneID:40385611"
                     /translation="MSSIPPVYNLGDPKSFAFSTCRERWPKIMKRAKADVISHIEKSN
                     DKELKEQGEIIARDIDTIIASFHGNAPIKRFSSKDVSLIPSLQSYNDELDTLDSQPSW
                     LNGPWLFTECYLYRLLDLKIKQHSKWFEFDVFEDLKRSTFKSSQSGIYELAIRSKCLS
                     EELKRTSEPDIEKLKILFEEFIDISLWGNATDLSLLANATLEDIQSRQGKEARAKSAK
                     NIIDNDLPEAWERLLSVPFEQRRIDIVLDNAGFEFYTDLGLTLFLLDSKLVNNVTFHC
                     KTRPWMVSDTMVKDFDLWIQDMKNTEWFPDHREELDYFVDSIISYYKCGKFHLTDSEF
                     WTSALDYWRLSPEETKYGGAQLYEYFQDSTIVIIKGDLNYRKLTGDREWPKTTPFKTA
                     LNSLAHSNIHILALRTCKADVCVGLPDGLEEELVENWKKAGNEVGELWCSSGKWAVIS
                     YSPGN"
     gene            complement(<1056535..>1057818)
                     /locus_tag="C5L36_0D05090"
                     /db_xref="GeneID:40385612"
     mRNA            complement(<1056535..>1057818)
                     /locus_tag="C5L36_0D05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467400.1"
                     /db_xref="GeneID:40385612"
     CDS             complement(1056535..1057818)
                     /locus_tag="C5L36_0D05090"
                     /inference="similar to AA sequence:RefSeq:NP_012864.1"
                     /note="PKUD0D05090; similar to Saccharomyces cerevisiae
                     YKL059C (MPE1); ancestral locus Anc_2.579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323260.1"
                     /db_xref="GeneID:40385612"
                     /translation="MAVIYYRFRSQKPDHIATIKFDGTGLTVFELKRDIIMANNLLNS
                     ADVDIILYSSENIQDSNVFSSENDRELVDDNEVIPRSATVIVRRTNALKKGRGNVQRY
                     VTGKPRLHLTSNSASINTNNYAIPAVGGTTGNGDEDDMIQKMFNAQDQQWSEQQSVLA
                     TATRVDTYRPPTNEPVPDYYICYKCGEKGKHNIKNCPKNNDPNWEGVRIRKTTGIPKS
                     YLKTIEKPNENMGDVPPNGTTYMVNDEGKYVVAVADTKAWEQFQNIKKGEKLANTDDI
                     DVEDGELKDPETGKLWKNPVRTPCCNKVYSRKYIEDKLIEDDFTCPNCKKEQIYLDTL
                     TPDEELQKKITGYIEEKSKAKKEEGNSPKRQQLKPPGMTMPMMPMPNMMNMPALNMGM
                     PPFMPFMNPYMNSNTPNPVANSMHSQQNSPGQQPK"
     gene            <1057930..>1058413
                     /locus_tag="C5L36_0D05100"
                     /db_xref="GeneID:40385613"
     mRNA            join(<1057930..1058051,1058122..>1058413)
                     /locus_tag="C5L36_0D05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467401.1"
                     /db_xref="GeneID:40385613"
     CDS             join(1057930..1058051,1058122..1058413)
                     /locus_tag="C5L36_0D05100"
                     /inference="similar to AA sequence:RefSeq:NP_012865.1"
                     /note="PKUD0D05100; similar to Saccharomyces cerevisiae
                     YKL058W (TOA2); ancestral locus Anc_2.580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323261.1"
                     /db_xref="GeneID:40385613"
                     /translation="MFSGVCCFTSKLHKLSYRDYLWTRTYIMNGPSYYEFYRRSTVGA
                     TLADALDTLIVDQRIQPQLAMKVLENFDRVTSERLRTDVKAKMSFKGHLSTYRFCDDV
                     WTFVIKDVVMKLDGGESIDVGKFKIVACNSKKSGE"
     gene            complement(<1058620..>1061322)
                     /locus_tag="C5L36_0D05110"
                     /db_xref="GeneID:40385614"
     mRNA            complement(<1058620..>1061322)
                     /locus_tag="C5L36_0D05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467402.1"
                     /db_xref="GeneID:40385614"
     CDS             complement(1058620..1061322)
                     /locus_tag="C5L36_0D05110"
                     /inference="similar to AA sequence:RefSeq:NP_014423.1"
                     /note="PKUD0D05110; similar to Saccharomyces cerevisiae
                     YNR026C (SEC12) and YCR067C (SED4); ancestral locus
                     Anc_6.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323262.1"
                     /db_xref="GeneID:40385614"
                     /translation="MKLNNWSLNLGYPVYGAAFVNDHTVIVAGGGGDGNNGIPNKMTA
                     ILIQPGNEKKPIKRYRELTLNDNEDSVMSLDVGNGTILTGINESSPMMAKGVNKHLRK
                     FKFENEHLKFVESVQIHPNTNSTIYQKLTAVSQDGSVGVIVMSDIPSSIYIVESVGDL
                     EEKFKIVTDGDVKDITISQDGKLMCYITSNVFEVISLITGRSVFKTKLQFLMSKVRFL
                     NNNEVIISGSKNKDAFIAKFSISSSKVIQQKVIMKSMKGITSMDVNVNNNLTVLATSN
                     YSLLLVRTSDFKVVKILNKVHEFAITKVVFSENGKYIASCSAANTVNIVEVPDNFAAS
                     KSLLSTIFQYIVSIIFVVLLGIGTQYLYEHGYINVAVNKTIELYEAYKPQDSSSYFTV
                     EPIQSFDSSTTAESTTPHESLATSSALTSLERLTSSSCLANTATLSLDYTSSVTQLTS
                     SVRLADLTVSNDIVSDFTTVTPLTAKSSQSFHNNVLNASLSASDIGITSNTVSSITVS
                     HYGVVTEERVDNDRENIDSKSAVSSFEQQPLVYNSPNGIHTSDVASGRSYMTTTSERS
                     LLAATNASVEPITKEVTKEITSVLIQTETSTATETAIFTSVEKITSVETSVETSFSIT
                     TSVVVQYVTKEVIVTTTDVSTTMKEPTLKGSSSSSEIATEESAVSESNVGNTTTVTTT
                     APTSFESVPGTSRSITLSAQPVDLVEESEMVKAVVESSLHQVGSVKTTDVGIQVEPHI
                     ETFDDKDQASLREKEINYEELGSKLLGSTGARHKEDAVTTTFSTEPTVSLQIEPAKEI
                     YDNPKEAILKEEERILEELLSEKKLPTSQVSIQIEPSSEVYTDPSSGVIAEASKITRE
                     ILEKIANSTEAATVKEADSGDGILKAAGVEVTAVTDSDLVKDEL"
     gene            complement(<1061535..>1063232)
                     /locus_tag="C5L36_0D05120"
                     /db_xref="GeneID:40385615"
     mRNA            complement(<1061535..>1063232)
                     /locus_tag="C5L36_0D05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467403.1"
                     /db_xref="GeneID:40385615"
     CDS             complement(1061535..1063232)
                     /locus_tag="C5L36_0D05120"
                     /inference="similar to AA sequence:RefSeq:NP_011844.1"
                     /note="PKUD0D05120; similar to Saccharomyces cerevisiae
                     YHL019C (APM2); ancestral locus Anc_2.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323263.1"
                     /db_xref="GeneID:40385615"
                     /translation="MAAIFILDSEFNLLLQRQYQYDLDVHAIVQGFKAAVLNSHPFDS
                     PVLTNKGITYIHLKKHKVIFMIPAFSDINLILYMTYLDKFSELLTKYFLHYKMIKTPL
                     ITADLVKDNFILIYELFDECMDFGIPQLTEFSILKDYIKTMIKPEDYLDASHVTEEID
                     LMEKQVETEINSSISRTATTKVSWRPKGIFYNKNEFFINFEENLKFKYNHKIHKVVRN
                     EIIGDIKCKSYLSGMPDLKLGLNETFEDGKSIFNNIQYHQCVDLNKISGKTIQFVPPD
                     GEFDLLNYQIIDTNVLQPPILVKPIYRIYSRNGNYKLRIKVEMITTFKRKFSMSDVHI
                     RIPLIIRHPVLYIDFNKPMKFKTKLGAVIHSLDDECIVWNVEKIQGTMRGEMMAEFDL
                     LQEKLLITKYHENKDRGRQERNDLFYFELGSEFDKVGKGLISTNKRNNKNYIENDRVV
                     LVEFTLRNMLYSGLKVNFLTIKEDQLKMQSFPWIMYSVQCKNDDYSFVLGEDGFTDDI
                     DPEENKKLKENGKWTGDMPSDENQDKGPIDEEPHFDFSTALDHGPVDIEPGFDEYME"
     gene            <1063415..>1063732
                     /locus_tag="C5L36_0D05130"
                     /db_xref="GeneID:40385616"
     mRNA            <1063415..>1063732
                     /locus_tag="C5L36_0D05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467404.1"
                     /db_xref="GeneID:40385616"
     CDS             1063415..1063732
                     /locus_tag="C5L36_0D05130"
                     /inference="similar to AA sequence:RefSeq:NP_011845.1"
                     /note="PKUD0D05130; similar to Saccharomyces cerevisiae
                     YHL018W; ancestral locus Anc_2.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323264.1"
                     /db_xref="GeneID:40385616"
                     /translation="MKLNALQIKTLVAAVPKWQFVPAITDNACDKLTRKYQFRSFEES
                     WCFLTRVAMKSHKLGHHPLIKNLYNVVELELTTHDVQGLSELDFKMAKSIEKAANQLG
                     VKD"
     gene            complement(<1063824..>1064564)
                     /locus_tag="C5L36_0D05140"
                     /db_xref="GeneID:40385617"
     mRNA            complement(<1063824..>1064564)
                     /locus_tag="C5L36_0D05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467405.1"
                     /db_xref="GeneID:40385617"
     CDS             complement(1063824..1064564)
                     /locus_tag="C5L36_0D05140"
                     /inference="similar to AA sequence:RefSeq:NP_012884.3"
                     /note="PKUD0D05140; similar to Saccharomyces cerevisiae
                     YKL040C (NFU1); ancestral locus Anc_2.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323265.1"
                     /db_xref="GeneID:40385617"
                     /translation="MIMYRPKLLFTRIVGRRFLTLQTLDTPSENALKFIAKDARFLPE
                     GLSQAIDIETIGEANDISPLASSLYKINGVKSIMVGPDFITVNKVDDSLSNNPELHWN
                     CLKPKIQQAICEFADSKKPFINSNWMENYQKQLDAINENDDDIVFEIKELLNTRIRPA
                     LQDDGGDVHFRSFDESTGTVYVKLRGACKSCSLSEDTLKSGIESMLQHYVPEVEHVKA
                     VLDPEEEIAIAEFEKLENKLKQEKASSK"
     gene            complement(<1064755..>1066395)
                     /locus_tag="C5L36_0D05150"
                     /db_xref="GeneID:40385618"
     mRNA            complement(<1064755..>1066395)
                     /locus_tag="C5L36_0D05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467406.1"
                     /db_xref="GeneID:40385618"
     CDS             complement(1064755..1066395)
                     /locus_tag="C5L36_0D05150"
                     /inference="similar to AA sequence:RefSeq:NP_010930.1"
                     /note="PKUD0D05150; similar to Saccharomyces cerevisiae
                     YER014W (HEM14); ancestral locus Anc_7.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323266.1"
                     /db_xref="GeneID:40385618"
                     /translation="MSVSKLVQNAKVSVIGAGISGLSFSYFLGKLRPDVKITIFEKQT
                     RVGGYINTAQANEETIKRTKLKSGRALKMEKGPRTLRGVSPGTLIIVDLLEKMGLLNE
                     LRGVHVHSEANKKYLKIGGHNGGELLEVPGPGCSISTMTSFFTSPLGRILIFSILRNL
                     AFKPDGKQLDKMSVEEFLDRQFGKEFSSNILSALMYGIYAADVSDLNVSCVLPALVNM
                     EKESGSVIKSMFKRLKYPKKTGIDHDVKEYIDNFGTKLNLEKMAAFLKKFPMLALTNG
                     LSVLTDGLKDNMPPNVEIITGSGVQRIKEQDGKMIVVADKEYQFDHVRSTIDATSLGQ
                     MVEDKSSALLNQFQYTSVIVTNVLIPQAEAKNVKGFGFLVPKAQLNPQTRVMGVIFDS
                     DVEEHSSPLFQGSIPRPLQVEGDGNIQEAINAIVSKPNILPENEKFTKLTFMSNIPRS
                     GTYVVPSPAHMHAIVRSTLEDLLGSPSNLEFAIESGNLESSIPLYDRHYPERRELTLQ
                     NIEKTYKGKLSLGGWSFAQGVGVPDNVVTSLKAALSMF"
     gene            complement(<1066661..>1069987)
                     /locus_tag="C5L36_0D05160"
                     /db_xref="GeneID:40385619"
     mRNA            complement(<1066661..>1069987)
                     /locus_tag="C5L36_0D05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467407.1"
                     /db_xref="GeneID:40385619"
     CDS             complement(1066661..1069987)
                     /locus_tag="C5L36_0D05160"
                     /inference="similar to AA sequence:RefSeq:NP_012866.1"
                     /note="PKUD0D05160; similar to Saccharomyces cerevisiae
                     YKL057C (NUP120); ancestral locus Anc_2.582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323267.1"
                     /db_xref="GeneID:40385619"
                     /translation="MMVNKEKRSVTKSYSNFPEDSSDRQKEADMSDTPFKYSEVTVPF
                     QGANKTVPLPRTIDKAIKKTPLRRDDFIESSLSPLETHYGRFFHFKVDGAIDLNFSYS
                     IGRSSDLGASDILTISPIQINEQIDEVLNSYTFQLPANVASNCITVTQDGNVVVVDMI
                     MDTDILITLALNVNVFLGKQTLEMQNVYSWCKYSMPYSFVQRKPLLLKNLDQLNLLLS
                     TMDGGLLLLSRTSIQADFVIRPFVTDSYFNSIKSKFFFGSKKSQAMISFDNFSVASSS
                     YIDLLKITDDVFVTVSVDKKLAFWSLSHAAVLKEYQINDYLDRSLHSAVLSPLLPYSI
                     LGLSDNYITIFLSLDICYINIFKFSLDDFSIELVSQLTSPDYSNIWSPIDYIMKKNQD
                     GSLLLWISWFFSNSSFYQSCLLANDENRTAHWSNCIPSMEYSDIKNSEFLSNLKELDE
                     ASDINKFSLRFIQSHYATETIQKALSIFNQNVSPSCKLHDLMTQVRDLVEFNGKTVDG
                     LKDDWVMFAGACQDIEMKTIGKVYSISFDVSNLSDDPFLIALKGLNYYSIVKSSSSFE
                     SLYFNSINKRKACVLQNFEDINTIELLKLVDLILDYSKGYNEKVVHEMTSDLLSFRDI
                     ENIASIMSKLFDKYIINIANEQIVSQLINQLSNIDDASELFNFLSGLLTNNSTGYIPN
                     NSSSFTEICQKLIENSILQNNLVAKKIIFGLMLILLTLDYTEPIGALFSKLYGSFKYI
                     AFLERVNLLVENDLVVRYITKLVPRVYIKNNTINMLNTYILGQLCNKNFVYFVVSSLV
                     HSAQSQTGYEFLNFLPTESTITIILRGLIMLETGNGEEAEKLFGDNVAEITSYRAPEN
                     EVDSCEPISKVLSLILVDNPVDFFFNLTLIFETKKCYVQALELAIKASKSLTSHIEIG
                     SDKEYEIYLKVFELALSLGEYELSFSSLKSMKHQYRIIPLRKFIYKLFQKNKLSLIID
                     FDYSDDLDHVDELIVGLGEEVLESGSGDAKLALKYFRVCYSLRLKDGDFRGAVESLYR
                     FNSVVGCKLPNISEETYNILKTNYLVLINLLHTLPGGDQWIIRRSPQEVGERVVDLNE
                     IEIEYDNFLQKLKSGKMLTM"
     gene            complement(<1072340..>1074709)
                     /locus_tag="C5L36_0D05170"
                     /db_xref="GeneID:40385620"
     mRNA            complement(<1072340..>1074709)
                     /locus_tag="C5L36_0D05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467408.1"
                     /db_xref="GeneID:40385620"
     CDS             complement(1072340..1074709)
                     /locus_tag="C5L36_0D05170"
                     /note="PKUD0D05170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323268.1"
                     /db_xref="GeneID:40385620"
                     /translation="MADENGVQKKRRRAHTRASKACTFCRQQKTRCLRSDESVACLRC
                     LSLKLDCSLLSETGRRNEFPILNVNLNSNHNNSINPVTQLSSQPVTRQSSLSYSKLPS
                     PQPSQYQYEQSNSNHIFPSLASTLQNNPYERQPQFHPKYNDPVHHQFFYNNPIPPTST
                     HRLSQSFVSSHSPSQNYQQNNCHSTPTVNHMSSINDAEFDPRSTKIDSIDSTVKQILH
                     LLRSDNRMLTSISESDKDISSDEALLKLLPILSTPINNTNIPNQSLSFSPISFLNLST
                     EISGTEQAISLPLCIQQQLYPLHSFRPIYQDIITTKILTFNQAVQLVDIFRDRYGRWL
                     SFPPLISTRKLIIRLRKRCPLLLTLACLLSLKYGDPLLKQKIWYKLNKIVCKEIHWLN
                     STYSGSLEELQCLVILGAYCIGLSDLTTDEIENGNPILLLDGWHLSGVGLTLFEKINH
                     YGFGDQMYGPEVESQWKANNEEMKEKVSSNLNVQNLYNASGSGNKIVGRNTANDNDDD
                     DDVINRSGEGEYEEQGSDVYDDENDDDEDDEYEDNEEFNFLTLHRIWNTLVLVHLAYC
                     LFYGRRSWISIERLKPVEVSDISSATNFDFRIIGEIHIYLICYRFLFEDEPYRLLRKG
                     INLWLERWQDTFGQASNQFVEIDYHFVEILVKIKSLKLDPHTFFNMNFNNLKELTELR
                     KHALAILYLIDSVNDDSYFAFLSDQIHMMVFYATDILISTMSAINKLEKESHVSPSET
                     LDNSQVNRDILNLIFRFRTVATTKNDTFYKYYSILERNYDSKLREPAVL"
     gene            complement(<1075140..>1075325)
                     /locus_tag="C5L36_0D05180"
                     /db_xref="GeneID:40385621"
     mRNA            complement(<1075140..>1075325)
                     /locus_tag="C5L36_0D05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467409.1"
                     /db_xref="GeneID:40385621"
     CDS             complement(1075140..1075325)
                     /locus_tag="C5L36_0D05180"
                     /inference="similar to AA sequence:RefSeq:NP_013983.1"
                     /note="PKUD0D05180; similar to Saccharomyces cerevisiae
                     YMR256C (COX7); ancestral locus Anc_8.807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323269.1"
                     /db_xref="GeneID:40385621"
                     /translation="MANPQRIIELQKYYQTTTKPLWRSHPNAKLVLIPYFAAFTVSLG
                     AALFFTGRAAFGIKPQK"
     gene            complement(<1076011..>1077051)
                     /locus_tag="C5L36_0D05190"
                     /db_xref="GeneID:40385622"
     mRNA            complement(<1076011..>1077051)
                     /locus_tag="C5L36_0D05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467410.1"
                     /db_xref="GeneID:40385622"
     CDS             complement(1076011..1077051)
                     /locus_tag="C5L36_0D05190"
                     /note="PKUD0D05190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323270.1"
                     /db_xref="GeneID:40385622"
                     /translation="MSESGVDGLKPLKLATKETISSKSSPLFEWETVDTWVDDDFDAE
                     ELLKGPSNLSERLPQVDSSLLKEPKANRKSHRQRDMQNKEHHRDDKYNTSNNTSRTSR
                     KLNEQKEESRNANRRRRSKELHAPIRDFGKSISKQPEPVSFDKYRTPIPKGPAKLREK
                     GEIRRRRSLDDDISPEQLAKEMARLMPVVGWKPDISDHLDDQGKKQNISKKHTPQKTK
                     KSTNIQRIHYTEGSHASRPSSPGENKIASRWADAKVDVTNASHGTAANQGSTRDRDSY
                     RKKKIAEKLDWDQGIQRRKGEKDLDREDETTEKRADRSLDAAENHTSHEHFSYENGNG
                     LTKDSSLPSRWA"
     gene            <1077246..>1078316
                     /locus_tag="C5L36_0D05200"
                     /db_xref="GeneID:40385623"
     mRNA            <1077246..>1078316
                     /locus_tag="C5L36_0D05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467411.1"
                     /db_xref="GeneID:40385623"
     CDS             1077246..1078316
                     /locus_tag="C5L36_0D05200"
                     /inference="similar to AA sequence:RefSeq:NP_014588.1"
                     /note="PKUD0D05200; similar to Saccharomyces cerevisiae
                     YOL053W (AIM39); ancestral locus Anc_8.806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323271.1"
                     /db_xref="GeneID:40385623"
                     /translation="MDYLNILVPFKILPTKRNVILKTRSQMMRMPIKYISISERSLNA
                     GPLHFSRPFSLSRLSYNNLSKESKTHGSPKSRLNIPPSFKSTRPIPKNTLTEEERDRI
                     QKGSGILQESSSVSTPLPITYRSPWWVSFLKLGVVFIPMFVFGLGYIVYETKQDRPVF
                     FPLYVNSSVPLERAKGFENVDVDMLKEVAKTNLSRRLNMNHDIREYFGLPITLGDYEN
                     FNVTVEYNKLAVEGVELDFRKSWFHPILKYREIDVPTLPSNINKYVQPLKAKAGGEGV
                     DEDPEDDTKFIEDVDYKLHIRATIKVVNETVHRIEPGSGRITFDAEVELDHTKLMKIV
                     GCLMHYKNKNSSGSGGTLERLW"
     gene            <1078547..>1079950
                     /locus_tag="C5L36_0D05210"
                     /db_xref="GeneID:40385624"
     mRNA            <1078547..>1079950
                     /locus_tag="C5L36_0D05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467412.1"
                     /db_xref="GeneID:40385624"
     CDS             1078547..1079950
                     /locus_tag="C5L36_0D05210"
                     /note="PKUD0D05210; Pfam Domains:
                     PseudoU_synth_2(6.3e-29)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323272.1"
                     /db_xref="GeneID:40385624"
                     /translation="MVRLELHIVRTYFTSSIPLRQKAVKILNEELVQEIPAISPSPNP
                     PMFLQKDGFQYVAPYTKLTYFTIDKLKSKNTYTVLEYLQKNFIGRNVDFFKKQIEEGK
                     LWVERPIPMRVCAKTNGLKISKKAHKSLKKNSVVEFVTIKGEDLKDFKLKKSDVIANY
                     ACIHELKIPHIESFDIIHESKDLLVVNKPSGIPVHPSGMSYRFNTLQFLLSKKRCSPG
                     KSLYNPETLEIFPSLWPCHRIDKETSGIVIFAKNKVKCGEISKLIETKENITKRYLIH
                     VHGKFGNEVKTCEDPIVDVDVCKKYENGGVSRIQHAKSTFKFVYYDAKTDTSILLGEI
                     FTGRKHQIRQHLRNEGFHIVNDPLYGVMGILKDKMTGLPNRDQFNALRGEYIKKMEER
                     MSKFKKESRCLNCNHINYFDDNFRADSYMHLHAWEYTYTSEETPKLSWSFITSPPSWI
                     TNIVPPNLLESLGNRRC"
     gene            <1080167..>1082554
                     /locus_tag="C5L36_0D05220"
                     /db_xref="GeneID:40385625"
     mRNA            <1080167..>1082554
                     /locus_tag="C5L36_0D05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467413.1"
                     /db_xref="GeneID:40385625"
     CDS             1080167..1082554
                     /locus_tag="C5L36_0D05220"
                     /note="PKUD0D05220; Pfam Domains: Zn_clus(3.2e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323273.1"
                     /db_xref="GeneID:40385625"
                     /translation="MSDTRKQRNRATLVCQVCKRRKVKCDRGTPCNNCIKSHREDECI
                     YDYVSSRITKPIPRKKASVYTSKNVSPLSEANMAESYKDDETVLNYPFSIISDITVFR
                     KPSRTQARCMSHANKFRKGGSHSFQVLMSFFRLIDSERKLWKDRNWTRNTSQPVITNL
                     WTNSNEMFSSYNEMIDKLICQNYYAILERLNYFNLHLNEFLFNSYIPMGAVHLIFHTY
                     FIVKQDGITFKKPKKAFEYSLIAFITSLVALTNIFSKCDHMAFNFPLNSEKNDFNRVT
                     LLLLNASNYRRKTSIFVVYTLLNLRLSLLVFGDEQSDGMARQNSYPLFESALNISKEQ
                     GIHFDIDRIFYVDRDDVPYLKKEGSSENVSFFKAVPLDSLKALWNYLLVTDANYSYTM
                     EIPPCIDDRYSHGFYEMNTPFDKCFSSYINTARSHANLLFSQKKVTLTEALDQINILS
                     KSLSLYESFENLDVYLKDERKWGILNMKIQILDSLSRLTTHLCLILNEKNISSIFPSG
                     ILEDQRNMRIISQLRNELKEKYRLSSLLGLTTLFRIIQSNPSEKFILYIRQVFSYWVG
                     IKNLGYLDAVIEEDICKRENLGLSTTVPTSESFKLPEMPVYDISAMENALINYDPVKH
                     APILNYIEQKFNPLDLASMLTNIYQKSIMVPSLVADYNSFIVAKIFLLGIYFLYSYIK
                     SSSCVTFDITKNSENLKEMTRNIIKKHLKEGKLDHLVPAERIMKEMDENTAPGNRCHG
                     TQAPTPSGSKPLHICLNDNDGFATQEPEVDSLFFDLFEDVNLKNIFDEIEYYFDK"
     gene            <1082807..>1083973
                     /locus_tag="C5L36_0D05230"
                     /db_xref="GeneID:40385626"
     mRNA            <1082807..>1083973
                     /locus_tag="C5L36_0D05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467414.1"
                     /db_xref="GeneID:40385626"
     CDS             1082807..1083973
                     /locus_tag="C5L36_0D05230"
                     /inference="similar to AA sequence:RefSeq:NP_009992.1"
                     /note="PKUD0D05230; similar to Saccharomyces cerevisiae
                     YCR066W (RAD18); ancestral locus Anc_6.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323274.1"
                     /db_xref="GeneID:40385626"
                     /translation="MVGIVPDVWEDVSDPSDWKNTKYPDLANLDSLMRCQICKEFLQA
                     PVLTTCDHIFCSMCIRRTISNTNKCPICSEETYESGLRKVLLLDSIVRWFENKRPSLI
                     ESLQIDQIEDSVDEDGPSIKEELNRISENAEALETASSSSEQLAECPVCGTCMNVNEL
                     QEKHIEECLGNAQPSSKETKSVRNSPNNVVGYFKIKTNVTNNIPENVQLQNSKIRKKK
                     RLPNLDTSLSFNKLKEKMNSLKLPVNGNKTELENRMREYINLYNSNLDSIHPVSERLL
                     IDKLRKWEALNDRKANLKSGRDSPPINADENTIKRQKKEHVSWNRQNSGQYMELIAFA
                     KLNMQKLRNKEQAERNEKQTERNEKQTEKNKEENDSLNDDSGDAFSDLETELIS"
     gene            complement(<1084021..>1084941)
                     /locus_tag="C5L36_0D05240"
                     /db_xref="GeneID:40385627"
     mRNA            complement(<1084021..>1084941)
                     /locus_tag="C5L36_0D05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467415.1"
                     /db_xref="GeneID:40385627"
     CDS             complement(1084021..1084941)
                     /locus_tag="C5L36_0D05240"
                     /inference="similar to AA sequence:RefSeq:NP_014424.1"
                     /note="PKUD0D05240; similar to Saccharomyces cerevisiae
                     YNR027W (BUD17); ancestral locus Anc_6.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323275.1"
                     /db_xref="GeneID:40385627"
                     /translation="MNRTLEDIVPTRNVLSISSHVVHGHVGNDSIQFPLNLRNWNVDT
                     INTTNLSNHAGHGKLKGSKTDSNTISDIFQGLKDQTMLKDYDALIVGYVASESNLDVL
                     WNEILPAFNGKEIVVMDPILGDNGRVYVDPKIPARYEHFLSLNKYKIDVLTPNGFEME
                     QLTGVKIASWDSLSKSLDIFFKKYSSIRNVVVTSVDISGSLYCIGSDAKSTFYYKVDE
                     IDALFSGSGDLFLGLLTDEYFNTRKLSDALGKTVSVVESVLKLSYAIVSNESKTQKLV
                     NGKLYIPDLKLIESRKLITSKVEDISVNFI"
     gene            complement(<1085218..>1086651)
                     /locus_tag="C5L36_0D05250"
                     /db_xref="GeneID:40385628"
     mRNA            complement(<1085218..>1086651)
                     /locus_tag="C5L36_0D05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467416.1"
                     /db_xref="GeneID:40385628"
     CDS             complement(1085218..1086651)
                     /locus_tag="C5L36_0D05250"
                     /note="PKUD0D05250; Pfam Domains:
                     Hexokinase_2(2.6e-109)|Hexokinase_1(9.4e-91)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323276.1"
                     /db_xref="GeneID:40385628"
                     /translation="MTNSKLDLYTEKLHKDFHVSTVSLHKIIDYFIEELDRGLQDGTD
                     PLGIPMNVAWVMEYPTGDETGDYLALDMGGTNLRVVIVHLKGKGQMETDQAFYKLPDG
                     IRTVKDRNVLFDFMAEKLDQFLKDKHPEGIPENKVFPLGFTFSYPATQSRINSGVLQR
                     WTKGFDIPGVEGEDVVPLLTEKLKERNVPIKIVALINDTCGTLVASRYVDPLTEMGCI
                     FGTGVNGAYYEKVSNITKYKGRFPKDIPEDSPMLINCEYGSFDNAHKVIPRTRFDITI
                     DETSPRPGQQTFEKMTAGFYLGDLLRLTLLEAYTEGITFEDAPAEFVKCLNTPQCIDA
                     SFLSRIELDESDDLVTAKKLFADEFKYPNATTDEVKFAKAAAQLISNRAARLSICGVA
                     AVCKKRGYKKCHIAADGSVYLKYPNFASRAAEGLADVFGWGHEMPQSEHPIRIVTALD
                     GSGVGAAIIAALAHKREVAGLSLGLED"
     gene            complement(<1087379..>1092049)
                     /locus_tag="C5L36_0D05260"
                     /db_xref="GeneID:40385629"
     mRNA            complement(<1087379..>1092049)
                     /locus_tag="C5L36_0D05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467417.1"
                     /db_xref="GeneID:40385629"
     CDS             complement(1087379..1092049)
                     /locus_tag="C5L36_0D05260"
                     /note="PKUD0D05260; Pfam Domains:
                     ABC_tran(1.3e-73)|ABC_membrane(2.2e-57)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323277.1"
                     /db_xref="GeneID:40385629"
                     /translation="MNSTVLWGCDISSPLVSSDSNALSPCFIAFIQFVLSSSIVISGS
                     VQLLKYSKKSTYGRIGVLTPHQKLKVTLVGLLFILVSILFSKCLTNSVLLYRVSYFTS
                     LFNLIIVIFPLHILEVSKSHIPTATLLFYWPSQFLIFLAINVQQVLSKHHQIFPRLST
                     SERVIFVSLPLISGLIFILEYLHYKPNKEFYSSTDAEKVFLSEPDVFSKLSFSWMNKL
                     LQLAYDQGGLEQQDLPPPPRIVSTEYNAPRLLSNWNKELHKENPSLMLALMKTFGLGV
                     LGALTFDMAESIVSFIQPLLLRKLIQFFKTEDENPLIIKGLTISILMFLTNLASTAFY
                     NQYMIMTVEVSQGCKAALMNIIYNKAMRLAFNERNSRSTGDIINHVSVDVSRIESLAS
                     YVQTMVSAPTRLVLCLWSLYWLLGKSTFIGIITMAIMIPLNTFLVKSLRSFHKEQMKL
                     KDKRTSFVAEILQNVKSIKLYAWEEPMLEKLKILRDDKELSNLNKIGILSAGINFAWT
                     CVPFFVSCSTFAMFAYISDIPLSPEIVFPALSLFDLLSDPIFAIPSLITALIECNVSL
                     TRIVSFLRADEMDTDLVTKLPTVSTVGKQTVFIDNATFLWNKPPQQRYKDNDNCEDEE
                     ESIEGTKAPALRNINFQAKKGDLICVLGKVGSGKSTLLRCILGELYMVPSHRDVKPTI
                     EFAGSVAYCSQVPWILNATFKQNIIFGHKYDEDFYNKTISVCQLLPDLEILPDGHETL
                     VGEKGISLSGGQKARLSLARAIYARADVYLLDDVLSAVDAHVGQKLIDCVLGKNGILR
                     SKTRILCTNSIKVLDQADDIYLIKDNTLVQSGSIDKILNDKSSEIYKLIQDYGFNEES
                     NVEKGDYKSSSESPTLDDPQLTTDVLEEGEYEGVGPLGVNFDENTGEELIRFENKTSG
                     NLEEAEISTLKAASVASYKVVIDDIERRMNQTEEKKEKGHVKWSIFKEYANACSYSGI
                     IITLSFVVITVGLSICSNYWLMHWSEDNIKNGSNKNVFKYVGIYALLGIGSGFFTLIR
                     AMCMWTLCSIRASKKLHSDMAKSVLNSPLQFFETTPLGRILNRFSQDMRKIDSALPRV
                     FSALFSSIVKTIFTLIIIGYNMPFFVVIIIFLSFIYSYYQKYYINTIRDLKRIMSISK
                     SPILALIQESLNGCDTIRAYRQISRFSFINSANIDNNQVSSYCYKSTNRWLSTRLQFI
                     GSLITLSTSFLALSTLYSNHRMSSGLIGLIMSYAIRVTSSLSFIVRRSVEIESDVICC
                     ERIFEYCKLKPECDEDKYKDKLIIPPNDWPREGTIEFNDFSTKYRENLDPVLKKISFS
                     ILNREKIGIVGRTGAGKSSLVLSIFRLIEPISGNITIDGINTSYLRLHDLRKKLSIIP
                     QDAQCIEGTVRYNLDPLGEYDDTQIWEALRMSRLEEHIHKMSSDQNKMKDPLDCLITE
                     SGGNLSVGQRQLVCLARVLLKTQKGSHSKECPSKILILDEATSSIDTETDNVIQQTIR
                     TRCDHLTILTIAHRLNTIMDSDRILVLDNGEIAEFASPNELLSNPQSQFYNMCVDGGY
                     INDA"
     gene            <1092627..>1093178
                     /locus_tag="C5L36_0D05270"
                     /db_xref="GeneID:40385630"
     mRNA            <1092627..>1093178
                     /locus_tag="C5L36_0D05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467418.1"
                     /db_xref="GeneID:40385630"
     CDS             1092627..1093178
                     /locus_tag="C5L36_0D05270"
                     /note="PKUD0D05270; Pfam Domains: Redoxin(2.9e-25)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323278.1"
                     /db_xref="GeneID:40385630"
                     /translation="MSIQAGSTLPPIPLYYLQPKIGDVCPYAPETIDVTKLEHPLLTV
                     VVPGAFTPTCTENHIPPYLTTTAIDSLQNAGVKTVLILSVDSPFITRAWGDDLTRDKP
                     EVLKYVQEGYIKFVSDAGAQWLSEVGLVGEPKDSFAKGGLRGLRTAILTDKQGKVTYV
                     GTDLKRGSVEKSGIEAVLSALKK"
     gene            complement(<1093281..>1094690)
                     /locus_tag="C5L36_0D05280"
                     /db_xref="GeneID:40385631"
     mRNA            complement(<1093281..>1094690)
                     /locus_tag="C5L36_0D05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467419.1"
                     /db_xref="GeneID:40385631"
     CDS             complement(1093281..1094690)
                     /locus_tag="C5L36_0D05280"
                     /inference="similar to AA sequence:RefSeq:NP_011843.1"
                     /note="PKUD0D05280; similar to Saccharomyces cerevisiae
                     YHL020C (OPI1); ancestral locus Anc_2.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323279.1"
                     /db_xref="GeneID:40385631"
                     /translation="MSDKSTSSTRQVVTRRQTMPTTDILENRSSECAPKAHTATPTAP
                     IEDDLLIAATALEKLKHDTRPQQSTPRPSQSHKLLNKVIFHPIISNSINFVLEKAKSK
                     DLDHGGCDGSDAIVQRRRARAEDASLEEPDHSTKKQKFSKDSTPLRNQISVRSATKHK
                     SINDLRNSTLTLNIESRKKLTMLIQFLKLGNYQLNERIEKLIHSVDEKRDKLGVSKEE
                     LNIQQIKTDIVATIKKIVTVVSKVSADSLSEPARSKVKDAILNLPTNWATMLDNQDNT
                     MDIPSSDDDDLEEHEADEKRQKSEHEYNDAKQTGDGNQGEKFVKEGEKEMEEKDETKE
                     EIPTITVNHKTMFQRERKASISRRIMNSLIEYRKSKGLEFDSSKKKLNNWFKNKIRNQ
                     ILNDQSGKVLVLAQESLDMINKIIKFCDESLDKADHWNTIKQQEHQRELLERLKQSGD
                     SDQVETIIVKTKGTEKNVD"
     gene            <1095955..>1099062
                     /locus_tag="C5L36_0D05290"
                     /db_xref="GeneID:40385632"
     mRNA            <1095955..>1099062
                     /locus_tag="C5L36_0D05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467420.1"
                     /db_xref="GeneID:40385632"
     CDS             1095955..1099062
                     /locus_tag="C5L36_0D05290"
                     /note="PKUD0D05290; Pfam Domains:
                     Zn_clus(3.3e-11)|Fungal_trans(3.8e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323280.1"
                     /db_xref="GeneID:40385632"
                     /translation="MTPSDQDKAIKKRNRVPLSCSNCRRKKIKCDRGKPICKMCQAHN
                     FTDCVYYSRSSTVDVQEVVNTLVGNVHTTNNVNGDANEIAAVITGSTIITGNGIHANV
                     QKAPNEDPSAITSIQVEHAVSEQLTSMKSKIESLEKQLSEQKSMNRHNVAFHYSDYSY
                     ELIEKVRSFLTSMNLSPFDKIPVFSDCEPTIYFNSKYNNFGPFAWITIIKKDQFLLPI
                     FKKVTQARREIVTNFQKITMSLLNIPDNKNYPKPTVAFEPYTDLNTNTVSSFNHKFSL
                     NPKTLDLTRKIAQELPNKRAIWLFIQRFFKYVYPFVPYLDQETFIDDIERLIDGHSID
                     DLSKEEKVTYFNVSEHLDLAIIGTLLIVIKFAYESLLSTNREMMDPHNRSKDDQYLLQ
                     FTQGDNIVSLTNECLNEFSLIKRCSLPILQLAILFREYQKVDGCDAFQDGDSQIFTGL
                     IIQIGNTIGLNRDPLSNNELTDGKAINLRRKIWYGLISSDNYQYTQTGTPPIIHPSHY
                     DTRLPEFDENSSNVYDLKIERITIENIRKRFEIENKMRSLADLMSNMKQSPNVEHITL
                     CIIDLEAELKHQFGTLDDLLLSNHGNIHHKKLEKVLNFIIYTNTLNLLKPVHMLVYYH
                     CQQRENFEATYYIHNKILSFWMYLLSNLPELVGSSHTYFDIGFDVFLIPGLEVSLHKG
                     LCFFMSTYVKCKIFIDLLKAEGSNDSELVNVVTFFKDNVLIRILSDIYIPILRQLSPK
                     YFYSWRMLKSHQFILKCLRENSIDFSRRTHLFNFIEKLTVTDFKILIKTSDINTYKIG
                     GNSPPWLPSWRNKYRKLQSIFLNEPLFDKGPVFSDELLSIDSSVGKYTLINTVPVNEE
                     EEALEDRRWYEKLYEKMTINFNHRFDPSQVHANSMTMAPAFSPVPLPEKQLTSAPTLQ
                     SLKTKPQDLTPGDQQHYHQPQLQHQPQHHLQPLQRLVQQQFIQSSQPQLINTIPNAQS
                     HAQISTSGMPLDGVMPEIPGPVQYIPQTLNHTGPEPLSATRETEDIFYMLDNAMNMDD
                     IFILQ"
     gene            <1099257..>1100843
                     /locus_tag="C5L36_0D05300"
                     /db_xref="GeneID:40385633"
     mRNA            <1099257..>1100843
                     /locus_tag="C5L36_0D05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467421.1"
                     /db_xref="GeneID:40385633"
     CDS             1099257..1100843
                     /locus_tag="C5L36_0D05300"
                     /note="PKUD0D05300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323281.1"
                     /db_xref="GeneID:40385633"
                     /translation="MVKLCYLLPLIILSAHSGNAISTELSKPMTRKQKVLGKDHGEYI
                     RKHYAPMKLQLEKRVSYNPKQSILPQNQSLRSKDSELEGAAYSYSVIGGIGNEDKDIS
                     ENEIKLEKDAFVYSDGSNTLNPMPESSRDNNKKLEMETYRLQKLQSDLMKNDGSIGTQ
                     NGIDVGLDVDKNGYKFKEYKDYNDDNSNIANTDGNAGYDGSFHSCSTQSAQSRINTEA
                     LTETLEYYLTLGKEKWAGFLATSNCSKFLELFKRLQNKINSASQLDKIEETYSTRELT
                     CANCRDGSKADVNRVYSNFDTPKAYDRENRSSSQKHEVFFEVENHNRTTGTSFDNIAG
                     EKKDQFMSLLQNVVSYWERENAKDILQASRGVAYKDFKLGGDVYNETANVVKQNKIAK
                     TQSEKYNHSSKQREDYYDTPDENDSAATLSRLDEYHSKNSRHRDLLESIHPTDVKTKE
                     QEAWLRANAIRRAQLLQELVNGNHDEKMLQQDLTKYRDENIFLDQDENEFVSNGVKLK
                     PRCSVSYGIFFAVTMLYCLY"
     gene            complement(<1101041..>1103449)
                     /locus_tag="C5L36_0D05310"
                     /db_xref="GeneID:40385634"
     mRNA            complement(<1101041..>1103449)
                     /locus_tag="C5L36_0D05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467422.1"
                     /db_xref="GeneID:40385634"
     CDS             complement(1101041..1103449)
                     /locus_tag="C5L36_0D05310"
                     /inference="similar to AA sequence:RefSeq:NP_012453.1"
                     /note="PKUD0D05310; similar to Saccharomyces cerevisiae
                     YJL082W (IML2) and YKR018C (YKR018C); ancestral locus
                     Anc_1.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323282.1"
                     /db_xref="GeneID:40385634"
                     /translation="MLRALGFKSSPALSNEEMNQKIATQALQLEKALKAMDYVLDDRA
                     NEAYDLLNDHDTVAISQLAYGVCLFLEATLGFEQDTMKKASEILSKAESLSLKEKSFA
                     EKNQIKSSQIYPPGTEFAVAYAESNLLNALLMLLSENFMEGAKALLKLRRAYQTLDSI
                     KKNLDFDSNSPSASLADLSSYSSFQVEHNDASFVDLPLTMTDQEVKDQKIIDDLDRVY
                     HMRLSRINGSHIGNPPVSESLQSELGGDSNNNLNDKDVLKLGNPSISSVDEYIHSGVN
                     LCFGILQVVLSLIPPAIGKVLSVVGFKGSREVGLKMVWNAAMERNIHGGIGLLALLVF
                     YDGPFQFTDVDFDIPSSSELNKSNSSLMRENDDKLKKIKTNSSSFSRKEIVEEKIQLE
                     RMASMNHGETLLHPGEKLVKVLLHARALFPHSNLWLLQESRMLASRGKLNEAVKLMDT
                     AKPSQMKQVDALLGFDRCMILVFLHDFDRAGQDFLDLMKVNSYSHALYTWFAAACYLE
                     AYRMCKTGLIPKGSDVDPKKVDSYASLADRYLHEAPKLIGKKKFLSKIPPFEKFIGRK
                     YKELEEAQRRNPKIPFIDCIQTSLVHELAYFWNGYNRMSQEHLELSIKLLGYSALSSA
                     SLPSSSSAASISASAASTTGSPNDLVSSMSSMSIKSNNSLSLSSSPITLALKDSNGKP
                     FAKVPENKEQRMIRIMFQSIALRRLGYITEGMEILDKIVISQLVNSSGKTTKLSDNPY
                     LYPTALYERALFTWKLKGADGLPECMKWLTLSQNYHNDDYELSTRTGMKTKAAIDRLE
                     DLNY"
     gene            <1105749..>1109603
                     /locus_tag="C5L36_0D05320"
                     /db_xref="GeneID:40385635"
     mRNA            <1105749..>1109603
                     /locus_tag="C5L36_0D05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467423.1"
                     /db_xref="GeneID:40385635"
     CDS             1105749..1109603
                     /locus_tag="C5L36_0D05320"
                     /inference="similar to AA sequence:RefSeq:NP_012661.3"
                     /note="PKUD0D05320; similar to Saccharomyces cerevisiae
                     YJR127C (RSF2) and YML081W (TDA9); ancestral locus
                     Anc_4.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323283.1"
                     /db_xref="GeneID:40385635"
                     /translation="MENTSMTKRSISTTTDENYETDNPNTSPKSNPGTFSATTNPHKQ
                     SSAHFNENDEDHDDDFGVPMKRVASSKSSKASKPRPHVCSVCTRAFARLEHLKRHERS
                     HTNEKPFQCAACGRCFARRDLVLRHQQKLHASLPTNNRTNVPRRGKTQKLKPEDGKVV
                     RDYLNDNINIVRNNTSAKLPLTNQSNDASFKNNDDIHNHIPFDHDPVDHFSPTVEKNN
                     YYNNGGHHVFNSGANPLMQDQISFFNSNILGTNITNGGFYNSPTSLNGMMFSPNMVNT
                     KNEHSQIRQGNVSNITPESQQNKSVNSDIKLNDYHIDSDELDSDLGSDYGNDRFDHPR
                     AMYQDDSNRLQLHSENNNNGNTNSMNDNNNSNNNINNDASSSYRNHRHASFSAAASSS
                     YTGLPDTRYPHDQNMKDLENGAPQQVSFSSPQFSYKPNGELGYLDYETLENLDLNDLG
                     IDFSSVNFINGNDMHGVTSSNSPHSNTNSNTNSNTNSNSNITPASIASNHNTPHSDDS
                     KEINLQRVLSNPSNAVPLHRVLSHPRSGEALQKVLSHPNSDVALQKVLSHPEPNLVLE
                     KVLSHPSDTDWFNEFINAPIDTNFPPITNHIGFTDTPDNINSPSFTGMNNSNSGSSMN
                     NNHNETAHHFSSNSNDLKHLFRSRQIDLSKHIPHPYQNPAIPARCSESVREHIMAEYN
                     LNHQQFPKLEDLNHYLALYELEFNKYFPFVHIPSFKIDENMDQIPLMLSMAAIGALYS
                     FHARNSSTLFNFSRFLIHNFMEVQMQSKVFNDIPLHITQALVLHMFLGMFHNDAEVTK
                     LISRQLNSLVSLVKTTRLDMPLESLLLPPGINYDIVQSDNFGLIESCYKYFILAQSRI
                     RTIHVLHQITVLFGCLTNSKVELSADSIESGSPCSIEELWSCKNYNEWILILKEKHIA
                     ISSKFLLIRLSNGYQYRELWRSLQNLSLDKDVGLRGMLSLLMSMNEFIHEESMEIDKD
                     SNKSQGFKLAEWRMEQRPYIESLIKIWESCFIRNGGVLVPRGQNIHTINNSCALKLTL
                     PLLSFAKINKCVHISSVLEHVWARNWEQMNVEVKRLTLDVEALRDSINYSLDIVNLWI
                     EIISITNDAEKTSIRTPIFFLTCLFTSTLLISEYLYATELWAHKYIGDKTLINPLTTS
                     DRVLWMRAEKIFKKIEKNLLPLGSNNQSYSEFLRLQANGALDVEILDDEIAKLALGPG
                     DLQPIAEIIISGRLSTRCLSLGVRILADAPVWPIALLFAEALKARATHIHECTSSWSP
                     CENEDTKKESAEGGAVINSKAE"
     gene            <1110520..>1111269
                     /locus_tag="C5L36_0D05330"
                     /db_xref="GeneID:40385636"
     mRNA            <1110520..>1111269
                     /locus_tag="C5L36_0D05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467424.1"
                     /db_xref="GeneID:40385636"
     CDS             1110520..1111269
                     /locus_tag="C5L36_0D05330"
                     /note="PKUD0D05330; Pfam Domains: adh_short(6.7e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323284.1"
                     /db_xref="GeneID:40385636"
                     /translation="MFANKSTIITGANKNLGKETAIAFAKEGSNVLLHYHSDSSAKET
                     QELAHTISSEYGVKTALYQGDLSNEEVTIALFEKGIEAFGKVDYAINNVGMVLRKPLA
                     ETSLEEYNKMISINVTASFLFLREAERKLADEGSVVMLTTSLLGAYTDGYSLYQAAKS
                     AVYWMCKTASKETTKRITYNCVSPGPMDTPFLYGQENQQRIGFFKSQAVQQRLTEVAD
                     IVPIIKFIVKDGKWMTGQNLYANNGFTAPSA"
     gene            <1111737..>1113116
                     /locus_tag="C5L36_0D05340"
                     /db_xref="GeneID:40385637"
     mRNA            <1111737..>1113116
                     /locus_tag="C5L36_0D05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467425.1"
                     /db_xref="GeneID:40385637"
     CDS             1111737..1113116
                     /locus_tag="C5L36_0D05340"
                     /inference="similar to AA sequence:RefSeq:NP_013631.1"
                     /note="PKUD0D05340; similar to Saccharomyces cerevisiae
                     YML080W (DUS1); ancestral locus Anc_4.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323285.1"
                     /db_xref="GeneID:40385637"
                     /translation="MKIFSLLFSNLRNRLTKRASVGRMTEEHKLNEYGINLQESIKKG
                     RELFNNLGRPTRVVAPMVDGSELAWRIISRKYGAQLCYSPMLHSRLFSEDKKFRDQFL
                     CEQDGQPGLDRPLIIQFCANDPEVLLKAAKYVVGKCDAVDINFGCPQGIAKKGHYGSF
                     LMEEWDLVARLINKLAVELGEQLPVTAKIRVFEDWSKSLDYAKMCLNAGAKFLTVHGR
                     TRDMKGQKTGLANWGLVKYLRENLPEGTVFISNGNILYPDDIERCINEIKCDAVMSAE
                     ANLCNPGIFWTKSDDKEKVFPRVDKFMREYFDIVKSCKGTESKRCMKTHMFKALKTFL
                     PYHTDIRSEIARLTKNSTFEEIEKVIIMIEEVVNEIFQKEDIEQLDEIKTGAVQPWGG
                     RYREVPYWRLQPYFRKVDGVAGKDLIKDEIERISQENTKQFELVESRKRKAEEHENEP
                     VVKSAKVSV"
     gene            <1113332..>1114837
                     /locus_tag="C5L36_0D05350"
                     /db_xref="GeneID:40385638"
     mRNA            <1113332..>1114837
                     /locus_tag="C5L36_0D05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467426.1"
                     /db_xref="GeneID:40385638"
     CDS             1113332..1114837
                     /locus_tag="C5L36_0D05350"
                     /inference="similar to AA sequence:RefSeq:NP_015228.1"
                     /note="PKUD0D05350; similar to Saccharomyces cerevisiae
                     YPL097W (MSY1); ancestral locus Anc_8.577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323286.1"
                     /db_xref="GeneID:40385638"
                     /translation="MLIKKVIKCSSRRFFSIRLSRGQAHLPQHISNILKKHDIVITDD
                     EFKRDFQEPIVSHLRKRGLIETCVNEEQLFKDAEDKVLGLYCGADPTAKSLHLGNLLP
                     LMILLHFNLRGHRIFPLIGGATGEVGDPSGRSTERSAMAEEARRDHVERISNQFLDFF
                     QRAVEYGKTRNPEIASLSIGSQELKNNREWWKDMGFLHFLATYGRHIRVNQMLSRESI
                     KARLSSDQGIGFNEFTYQILQAYDFYYLNKTYKVNIEVGGNDQYGNIVAGIDLINRLK
                     KVEDSDRNDDVYGITVPLLTTSNGVKFGKSAGNALFIDKELTSAYDIYQFMYNTTDAD
                     VQTFLYKFSLLPVSVIDKIVDLHNMNKKLRIGQRVLAIEMCDLIHGDGEGLSNYIISE
                     VLFSNSNIRENFKADEVLDAFKKQNLVCEFNRDEVLKTPIYQILYSACRGEKSKSEIK
                     RMIKNGSFQIGNTKDGKVKDPDYCITENDVIEERLLVLKLGKKFYIVEVIN"
     gene            complement(<1114923..>1115294)
                     /locus_tag="C5L36_0D05360"
                     /db_xref="GeneID:40385639"
     mRNA            complement(<1114923..>1115294)
                     /locus_tag="C5L36_0D05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467427.1"
                     /db_xref="GeneID:40385639"
     CDS             complement(1114923..1115294)
                     /locus_tag="C5L36_0D05360"
                     /inference="similar to AA sequence:RefSeq:NP_690846.1"
                     /note="PKUD0D05360; similar to Saccharomyces cerevisiae
                     YPL096C-A (ERI1); ancestral locus Anc_8.576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323287.1"
                     /db_xref="GeneID:40385639"
                     /translation="MPHAGGRRAGDPQHQSYISEDEYLCSLKVYGYSIIVVTWLVFTV
                     SIGTIFNLWEWCLDVGSVKEWLLKNRWISLVYREVSLQEKPVENYYIFVFFLNFVILW
                     IWAVSSWISMKLFRHSKGGGS"
     gene            <1116407..>1117528
                     /locus_tag="C5L36_0D05370"
                     /db_xref="GeneID:40385640"
     mRNA            <1116407..>1117528
                     /locus_tag="C5L36_0D05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467428.1"
                     /db_xref="GeneID:40385640"
     CDS             1116407..1117528
                     /locus_tag="C5L36_0D05370"
                     /inference="similar to AA sequence:RefSeq:NP_015229.1"
                     /note="PKUD0D05370; similar to Saccharomyces cerevisiae
                     YPL096W (PNG1); ancestral locus Anc_8.575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323288.1"
                     /db_xref="GeneID:40385640"
                     /translation="MCIMCGSSAYTGNETGIYIDQAFVCRIKDTLYNGRVDMLHKVIQ
                     HLTRNKHLLNEAIKYPFLNQVIHLSKNFRPLTDDEQNAAIDTVLSSEVYDRVKDEEMK
                     QDPNYEYVEVLVKQLLRWFKEEFFTWVNKLDCPNCGNKEQEQIRHLPGLRPYKYEHFQ
                     GKATIIERYQCLKCLSTYEFPRYNDIRTLLKTRKGRCGEWNNCFIAILKSLDIDTRFI
                     WNAEDHVWCEYYNEREGRWIHLDSCENSYDQPYLYNEGWGKKMSYTFAIGPNYIIDVS
                     DKYLSPNRPENHLPRNKCPEVSLKGILAHHNAQSILASSKDTILRTTSQLIADLMNAR
                     GKVHPVHTETTSTNEGASLLPRQSGAGAWTRQRGEDNNE"
     gene            <1117953..>1132979
                     /locus_tag="C5L36_0D05380"
                     /db_xref="GeneID:40385641"
     mRNA            <1117953..>1132979
                     /locus_tag="C5L36_0D05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467429.1"
                     /db_xref="GeneID:40385641"
     CDS             1117953..1132979
                     /locus_tag="C5L36_0D05380"
                     /inference="similar to AA sequence:RefSeq:NP_013207.1"
                     /note="PKUD0D05380; similar to Saccharomyces cerevisiae
                     YLR106C (MDN1); ancestral locus Anc_8.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323289.1"
                     /db_xref="GeneID:40385641"
                     /translation="MSLQENRLIVDFKKSMEVHSDFKKFYSRKQIPAFCNYNTSLSKD
                     ENLSNLCLHFLNIDASTCDAFSYRPILIEIIARLIHNPQIERLYLQLNKIDHVIEGTQ
                     VLYSSSIVNTFTNEISILVEHFLILKDFFHSLKNCINTISQSELQVLLLSFYRLISTN
                     RDKFYRFIDPQVLHSLVANKSTSDINKYISILILSKYLFLSEEARSQMIKQHVDEANI
                     VGDLDGDQNVDFNLLSLLEAQRLSNLSKITPSSECFIESNSTITFTESDLSPGVSIIS
                     GIMVPNLVTLESGTTKFNENESNFVEIPKSLDSIRSFAKYTKNSEPVLLVGGAGSGKT
                     FLVDEMARRLHIEDTNSLVKIHLNQQTDSKTLIGTYTSGTKPGTFEWKNGVLTTAVRE
                     GKWVLIEDIDKAPNEVLSILMGLLEHREITLPSRGEILKAGNGFQMISTMRTNSNDKD
                     EDIHLPDMIGLRLWNILKLKDLDDQDMKTILNKKFPLLSKYTDLFIKCYITVKSICDS
                     RKFVSMNKGAQPRQISIKDLMKFCRRSEQIFKLQNIKTADELIHDDVFDTIFQEAIDC
                     FTSAIVEQEPINFLVREIGSILEIPTSRIDLHLRRHVPKLENFEDGLRVGRSYNKKQK
                     IVGVHKYTNKVAVGNTTSFATTSHSARLMEKIGVGISMCEPLLLVGETGTGKTTVVQQ
                     MAKILNKKLTVINLSQQTEVGDLLGGFKPINAKTLALPLQEDFEQLFARSFSTTKNAQ
                     FLKLLSKCFNKSQWKNVVRLWKEAFKMAKNTFEKEELEVPESNENDETATTTKKKKRK
                     LNATERTELMKEWKTINSRVFNFEKQVVDMKNSFIFKFVEGSLVNAVKKGDWLLLDEM
                     NLAAPETLDSISDLLAEYQDQRSILLSEKGDVESIKAHPDFRLFGCMNPATDVGKKDL
                     PQSIRSRFTEIYVSSPDQDIQDLLMIIDKYIGKYSLSDEWIGNDVAELYLTAKRLSDN
                     NQIVDGANQKPHFSIRTLTRTLLYAREIAPIYGLRRALYEGFCMSLLTLLDANSEKIL
                     MPIIQQHTISKLKNAKSVLSQIPADPSNSDSKYIQFKHYWMQKGPGDPEPQTHYIITP
                     FVEKNMLNLVRATSGGKFPVLIQGPTSAGKTSMINYLAKITGHKFVRINNHEHTDLQE
                     YLGTYVSDDTGKLTFKEGILVDALRKGHWIVLDELNLAPTDVLEALNRLLDDNRELFI
                     PETQETVRPHPDFMLFATQNPPGLYGGRKVLSKAFRNRFLELHFDDIPQDELEIILRE
                     RCQIAPTYAKKIVEVYKELSVTRQGGRLFEQKNSFATLRDLFRWAQREAVGYEQLAAN
                     GYMLLAERVRRPEEKVVVKQALEKVMRVKLNMEEYYSKLEVPELLEMKGPVIWTKAMR
                     RLAVLVMTSMQNNEPLLLVGETGCGKTTVCQMIAKFFNKSLIVVNAHQNTETGDLLGA
                     QRPIRNRSELQLKFVNSLRELANRLGHKIPDNLSYTEAVSFWKEFKKMHSPSDDDVKA
                     IENTKAECDALFEWSDGPLVNAMKSGSYFLLDEISLADDSVLERLNSVLEPERSLLLA
                     EKGSDDVFITADKGFQFLATMNPGGDYGKKELSPALRNRFTEIWVPSMEDFEDVRQIV
                     RAKLSETVKHLADIVVNFSRWYGLKMGGGNVSSGVISLRDIIAWISFINTASENGLSD
                     MTALLHGACMVFIDALGTHTTAYLAEDEEKLRTVKSEYVKKLSEFARHDLIQLYSLKP
                     VVSISGSKLVCGPFSVQRKENAPAVNSFNLDAPTTASNAMRVIRALQVHKPILLEGSP
                     GVGKTSLITALATATGNELTRINLSEQTDLIDLFGSDSPVEGGKAGEFVWRDAPFLRA
                     MQQGEWVLLDEMNLASQSVLEGLNACLDHRGEVYIPELDKSFMSHPNFKVFAAQNPQL
                     QGGGRKGLPKSFVNRFSVVYVDMLTEDDIKLIAHHLYPTLDAELCDKMISFMSKLEEQ
                     VVIKRQWGSYGAPWEFNLRDTLRWLSLVESPRISNEISPSDFFDLVVKQRFRTEKDKQ
                     NATTLFESIFGPLEKKDPYYSLQSNFVQCQNAIVTRNELVQYQSDTKISNLQSNVPIL
                     ETIFRCIQQSYPLILVGPSGSGKSALIKFAADIVGSKVYEFSMNSDVDSMDILGGYEQ
                     ADYARSFSKHSSSITEILLKLIAVNVQLSSDESFSVIQISTKIIKTLQDSCLSINNIK
                     FVLSDLETLNQIIQNSQLSQIIEELSALSDAISSGEISINFEWFDGLLVEAVEKGYWL
                     ILDNANLCSPSVLDRLNSLLEINGSLVINECTNDDGSPRVIQTHPDFRLFLTSDPKYG
                     ELSRAMRNRSVEVYVDLLEERATRFDRSVLGLGVTVNNEEASEQTLQMEINGLNINNL
                     EMPLACFTQVNDSTLVMTSLFLDYYTIAIKSENKFAASTILEFIPFSLIPILEKFSYT
                     TSHSSEFSNSAFFIDVERTIKTLEQSGVFDSTEKLYAKAFQKSPLLSNKMSDIKKQPV
                     SVLGNSSLVPLVKEYACFACSTENSLLFAVLFMLSDAFLFMEELQEKAKTATVSSLNK
                     LEQLAAVSLGREVKNLPKINVYKWVVDILMIIRNQTVKLIKTEKFLQVEGFGALFKLV
                     VLWQNFVTASVNYNSTAIRVYHSQLIEWTENASNLHEDAVIELGRTIKFFSDELKLTR
                     GSSMTVIWNSCRDMYPQTSVAWSNYESLLTLASKFDEVAFEQFSENMSNVNEIRKLFI
                     QLFASCLEKTQNDDFVQMLEIIEKQIESLTSITQGFLNRREHPFVGNFNQVLGFVESG
                     KTFSKQTLTLDSETLNLCLLANKPTAEMQRYEKTEIFKPYPNILSSLWDSDGYLKLNL
                     FDDEFLKSTMSMVSQIEYTHGGSIEQTLLDLKFFISQLVKKSFDILADHTKQFSLIIF
                     EWISYIHNIHVELLDEDFRVSASELFKSGSFESLKDYCAMFFKHGHHQYAEIFESFFI
                     PAIGLTQGSCTMSSLGQSYVLAACGFIMLYMPDSTYDPASVDHILYNDFMKMQKLIAQ
                     LRESFICARETYFGDQTIVSEKYLPESPKSEINELPRVYRGTESAERLFEEWHMFFSS
                     YIDRKHIDFLLETAKQVNEKADAQINNFLNNASHFVLRLKESHLRFSDLNDILIGFIY
                     SLKLGLQLMHQSSVNKTIDGPSSLWTSDASLIFSPLCLGDVLSPIQKLFKKTSVNDYN
                     VENVYSYMLLLSKVYNSKISTQSGDDPFNKIVMALYYRWSLRTLKEQEKESTESGVYK
                     FADPTIDAEADFKRLFPDSEELMDIDSANSGVSSSQDLSSVYFNIAKAYISNFKEGST
                     SSLSEISEFSIVAFNSFNKIYERTGSGVNRSSNLVFILSLLKDSYNKFVETKASTDID
                     FYNGYDFAQTRNAGKLVRNVQISVSELLKKWPEHATLSELFRICGEFLDYPASTPIFR
                     LLAKVEQIFTFIAEWEKYAHSGVSLAVHYKTISGLIVSWRKLELASWKQVFANEEKNI
                     EKNIGKWWFHLFESIIVPSMNNEIFDEEIEIKTISAINVFVSQGSFGDFKYRLDLLSA
                     FAAHVNQLVPSSTVNESLNNIVNYYKQFVPQIEESVASLKKELEKKVNEIILLASWKD
                     VNIDALKQSSRRSHHKLYSVIRKYRDCLVRPVKPLIETGIPFSRKTVVQKPEQEKVFV
                     RVPEDISRIIELCSTISKWNERIPRLRNITQVERNMDIYVKDVGHFELRSLHQYAKDI
                     YEDAERLRKETPSVYTKDNKKKIASLKNEKHKLMSDTIKQLKHMGLKINMTLEIQKAL
                     PSVTAILATSKSFDNTCFQNCDNFFFRILDLLPRLRVAVSEVHDDIPPADAHKCLAAS
                     EHLLYTLISNRNTYVKFNTLSSKFVDMVANIEQFTTKSKNMLLSASQLSLFASTKDSV
                     SAFVQQAPAVIDFAIESLRNSSQFSAKGYDYSLFTKARDFIVKCDISKNELFGSFESH
                     QFSEIMTFYRRFVDDLDSWKHSNSEVAFVADFVLTWMEKQKYQFETVSEFKEECHTME
                     DLEFAFRDLFNSILVSVQRMHKFHFENINLKENGENMVDDEDEDDDTNWLIMDNKKLK
                     KSVDLLYLPSITNKLAQCISALKSIEYNDQEHLVAAALIEHSLPIVQHYSNLVHVIEH
                     KLKTNYVDLSRGCFELSSILYNVCSKGFCQPELPNEEKEDNNLKEGTGLGDGEGAENN
                     SNDVEEDEDLSEQAQQPNEEKDRDDNESDEDDDAVDIKGDMAGELENVSDQEDKDDEE
                     NEENEDQEDELDEEIDDLDESDPNAVDDKMWDEEASPSSKEKDSEEMPDNAEANNDME
                     AMEDNSEDEKEQKKEDDKQENADNDGEEEKENDDNAEDEEDVGEQEDEVKNEENEQFD
                     NAAPEADALELPEDINLDSDGENNSDGEDENDDKFDDNIDEQDSELKDDDDQIDEKAD
                     VEMDNEEPAGDEDEQEVEGAPTEEGDDGSEQEDEDEKDGMEIDNEETNEDAGVDQSDD
                     ELKEGEEEDSKEEADKDNSKQEEIEGLEGDESGANNVDDESAVKQQSGTNTEGADADD
                     NTEKENIGASNGGADFQNEEKEDKEDEENINEQNEASRDQAAESMKQLGDSLKEFHRR
                     RQEIKETTDDDMVDQKAGERPDDFQHLDGDNAENETQALGAASKEQVQSIDDNMAIDD
                     DEDDSFENRNDETKTEEDSNNQKADEESDVEMEEGGANEDDFVGERRSGFMNERRRDD
                     NEVPANLNLDTIMDSDDELEDEYHNDNNVAVKQSADLRDYEEANELWKKADENTRDLT
                     SSLCEQLRLILEPTLSTKLRGDYKTGKRLNMKRIIPYIASQFRKDKIWMRRTKPSKRQ
                     YQIMISLDNSKSMSESHAVDIAFESVALVSKALSQLESGQLSIMKFGSDSEVVHPFEK
                     QFGGNSGVKAFREFKFDDTKTDIKKLVSKSLKVFNEARAFGDSDLWQLEIILSDGVCE
                     DHETIQRLVRRAREEKVMIVFVIIDGLNSQESILDMSQATYTTGENGKMKLQVNKYLD
                     TFPFEFYVVVHHINELPEMLSLILRQYFTELVSV"
     gene            <1133915..>1134568
                     /locus_tag="C5L36_0D05390"
                     /db_xref="GeneID:40385642"
     mRNA            <1133915..>1134568
                     /locus_tag="C5L36_0D05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467430.1"
                     /db_xref="GeneID:40385642"
     CDS             1133915..1134568
                     /locus_tag="C5L36_0D05390"
                     /inference="similar to AA sequence:RefSeq:NP_010493.1"
                     /note="PKUD0D05390; similar to Saccharomyces cerevisiae
                     YDR207C (UME6); ancestral locus Anc_8.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323290.1"
                     /db_xref="GeneID:40385642"
                     /translation="MSSYRSYQQVIRLNPRLTKSSLKQCSPDFEHSHDHPVSASESGS
                     VLSQNDPCHMAKEKKKITRTKTGCFCCRRRKKKCDEHKPACSGCLRNNLKCVYPSEEE
                     LSCVSKVKKSKRSLKLVKPSSDAFAASVLTTLKSTSVTTQTPTSPSLSQPDLDSSHST
                     NSSDAESPVTSPSLKPFQYTLTSPHELGNAKVPYLNINNIHSPNTESRLISVKSLLN"
     gene            complement(<1134836..>1137259)
                     /locus_tag="C5L36_0D05400"
                     /db_xref="GeneID:40385643"
     mRNA            complement(<1134836..>1137259)
                     /locus_tag="C5L36_0D05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467431.1"
                     /db_xref="GeneID:40385643"
     CDS             complement(1134836..1137259)
                     /locus_tag="C5L36_0D05400"
                     /inference="similar to AA sequence:RefSeq:NP_012430.1"
                     /note="PKUD0D05400; similar to Saccharomyces cerevisiae
                     YJL105W (SET4) and YKR029C (SET3); ancestral locus
                     Anc_1.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323291.1"
                     /db_xref="GeneID:40385643"
                     /translation="MTSENNDLNQQDSEAAGLLMLFSHQPTISTHHNNNSAAKPNAKL
                     ITVEKTLARSKPLYTNDIPIESTLPLPHTQPELSTQPQAQIASASTSTNSTVMDRMGS
                     FNRSESNGKIRVESITRSPGPAAAALASGKNSNKAIVAAAALAAAAATPLPVLYKEDA
                     TLQTKETSVPGKSKSDKSCNEDANRNAIDAKADVSDGETEEFERAETKKVAVIKHENK
                     LSRSSPDEVENQRDYPTDEEQGPTGEPLPSYAVDPDSGVISCICGYDHDDGVTIQCDK
                     CFRWQHLVCMGFASIEDAPDDYQCNLCNENLVVDINRAKELQQEYLKKDRSKRRKSPY
                     TSNEKKDLNLGVPQFKKRKLTGSTNNRYNENDISGSEKYKTFYYPIDYFVFKSIPIKS
                     LFNQLPEILNHSKGVIKVEKSNLHKYTINPNNLAVKNTNENNRSKFTGISKLGLFASK
                     HIEGNRCLSLLSGEIDTKQNYILEKCNQHWLLGCPKPNVFFHPTLPICIDQRGLGNST
                     RFIRKSCHPNCEIRTVLINKQEITFGVFSTEEIDTDQEITLPWEWDTDHPILEIIKGE
                     LAFENMDSKKRQVLSNSLQSILDFTDCGCSSSSSTVYSECFFYKFKKLQKSLGRNSLT
                     SYSPTPNQIHTSIDQRYAERNAFIIAKLNQLSQETFGSIDAHLHASSNNIGVVTEKES
                     RSDSSLMEEQSSPNITFKSKKSGMLYSLPQLPKQYELLKKYSGEAYTHPRTLPNVSDI
                     KADIKEMPIPIEVNAKLLHRLTVTSNDGPAAKLDPHMVGTADQKIREERPKPVKKFSL
                     ADYKRKKTG"
     gene            <1137925..>1138365
                     /locus_tag="C5L36_0D05410"
                     /db_xref="GeneID:40385644"
     mRNA            <1137925..>1138365
                     /locus_tag="C5L36_0D05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467432.1"
                     /db_xref="GeneID:40385644"
     CDS             1137925..1138365
                     /locus_tag="C5L36_0D05410"
                     /inference="similar to AA sequence:RefSeq:NP_012431.1"
                     /note="PKUD0D05410; similar to Saccharomyces cerevisiae
                     YJL104W (PAM16); ancestral locus Anc_1.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323292.1"
                     /db_xref="GeneID:40385644"
                     /translation="MAHRLLAQVAITGARVFGRAFTEAYKEAAAATTAQQATKDGKPK
                     KSSAASRDSDITLDEACKILDVDLSGLSLDKAQKKYDYLFDINSKEKGGSFYIQSKVY
                     RSMERIKNEMEYLEAFQKSKEGAGADAGADAGAGAGAGDKSKPT"
     gene            complement(<1139094..>1140659)
                     /locus_tag="C5L36_0D05420"
                     /db_xref="GeneID:40385645"
     mRNA            complement(<1139094..>1140659)
                     /locus_tag="C5L36_0D05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467433.1"
                     /db_xref="GeneID:40385645"
     CDS             complement(1139094..1140659)
                     /locus_tag="C5L36_0D05420"
                     /inference="similar to AA sequence:RefSeq:NP_012948.3"
                     /note="PKUD0D05420; similar to Saccharomyces cerevisiae
                     YKR023W; ancestral locus Anc_1.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323293.1"
                     /db_xref="GeneID:40385645"
                     /translation="MSYSLTQIKKYACDSIKNIIPLDDESVNEMINYTLSNYKTRNDI
                     SSHLLDILGPSEASFQFVNTFCNMLLGSSSKHQEEANKPEDMKAVAIGAKKAQSVPKG
                     KITGVRLVKVKQAPSTKSENKGRMANNTRKGTNISEMFDNKPSTVAKTKLKSKEVRKK
                     VESIQELDDLLLQLEISEEKRNTGDVRVCNCNATRHPLFEMYPNCLNCGKIICSKEGL
                     QPCSFCGKSLISDDDKNEMMNVIEIERKALETEADKGPPAPENMPKKKKNVIKITLNN
                     TGQNNFKVQEQLYKQIKSHQTERKELEEARKQEEEVIEQNKRELEYYKSMHKKDEELV
                     KAEERLAMLLNFQDNGAERTKIIDHASDFEVPTGGGSLWASPIERVLQFKRQQKQQKR
                     LHDKELSRSGRGETVLHLSIENGQAVLNDRLNEADGLDDDLSDDEEIRELKEKLNHEK
                     KLQFNRDIQNVYDPDKFNEKLVKPIYKGTKTSSSSDMDSQAMVSGLPPLGTVVQMGDM
                     EEQENQLFTMVGV"
     gene            <1140881..>1142101
                     /locus_tag="C5L36_0D05440"
                     /db_xref="GeneID:40385646"
     mRNA            join(<1140881..1141398,1141516..>1142101)
                     /locus_tag="C5L36_0D05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467434.1"
                     /db_xref="GeneID:40385646"
     CDS             join(1140881..1141398,1141516..1142101)
                     /locus_tag="C5L36_0D05440"
                     /note="PKUD0D05440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323294.1"
                     /db_xref="GeneID:40385646"
                     /translation="MWSQRTEEEEILGNEMQKLQNQIEQQKKLLNQMLKVKQSKMENQ
                     KMRLAQLSSLVKNQRIKETGENAKISKPQKKKTAMQRMNPTHQPLITTLMKHILKNRK
                     KYYYKNRYFFNGYKFVLIDNGTALALVSTHHELTGKPVTDAISLPLFIVYSRRTYVKT
                     PSGTFTLDGPDKIKLKKSNTIDNCIFFTRSGCCTKQVCPFKHDPQRKSLCPSLIKHGF
                     ECKNKNCHYSHTPTQFNSPSCKFYQIKQCNKENCIFTHKLENEKSPICREFAYNGYCD
                     DGISCKFTHSFQCPELKEYGRCLLGTKCSCIHHEDNKTKNSLRNKDNDKVIQIVYDKN
                     SESDDSCSGSDDNVELIVEPLDTLEGNSDYVRF"
     gene            complement(<1142236..>1144371)
                     /locus_tag="C5L36_0D05450"
                     /db_xref="GeneID:40385647"
     mRNA            complement(<1142236..>1144371)
                     /locus_tag="C5L36_0D05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467435.1"
                     /db_xref="GeneID:40385647"
     CDS             complement(1142236..1144371)
                     /locus_tag="C5L36_0D05450"
                     /inference="similar to AA sequence:RefSeq:NP_012429.1"
                     /note="PKUD0D05450; similar to Saccharomyces cerevisiae
                     YJL106W (IME2); ancestral locus Anc_1.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323295.1"
                     /db_xref="GeneID:40385647"
                     /translation="MADVKGMCFENEISVKTFSARYQKLGEMGSGSFGTVSLCRMKPG
                     VIDSQKREMATRQGTLMRPLSINIKYMNDLVAIKTMNKQLKKNSDYSRVKEIQFIFQV
                     DSHFNLVQIIDVFIDRTHLKLNIVMENLDQNLYQLMKTRRGNVFSPKTLKSVLSQLLS
                     ALLHIHKHLFFHRDVKPENILVMQNLNYFGSRHNIPSIQRDNSYIIKLADYGLARHLG
                     NGKQFTAYVSTRWYRSPEILLRQNYYSFPIDIWAFGCVAVECATFCPLFPGKNELDQC
                     CKIMEFLGNPTKSFQLAAIQNAENSIYGYNYNVNHHYKTMVPFGGFWDGANDLAAQLG
                     LKFPRHFGYRLETLVRRSDFTLKEKTDFFSMVKQCLTWDPEKRITALGLSKCEYFEDS
                     NYLMETQKENETIDPLFMNTSNKSNSDSFIRSKMLAGILPAKNYFQNSINANSFDTQT
                     GVLQKREVRQLYQPLIYPKVSLSSCLGFCQNKLNVKKDSNSLVTGVSQMRDKSLRSKK
                     ITHMVMLEEDYSDYVTFYPSNPASEADTSCYTTKPSAYLKHNSGNPVAIKKHFSNGSP
                     EIGNKVNRTDEDTLSPDTSGKKAVGGCNVDNNDSDNNEVEVDEVDEVDDDDDDDDDEV
                     DEVDDDDDDSNSCGNYNSLSQDQKLTPLEIGKISSFLQTGGIKVSEAGIQINRNKGNF
                     DMIDALNFTLDDENITEDKCICPWDEYQS"
     gene            <1144653..>1146521
                     /locus_tag="C5L36_0D05460"
                     /db_xref="GeneID:40385648"
     mRNA            <1144653..>1146521
                     /locus_tag="C5L36_0D05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467436.1"
                     /db_xref="GeneID:40385648"
     CDS             1144653..1146521
                     /locus_tag="C5L36_0D05460"
                     /inference="similar to AA sequence:RefSeq:NP_009763.2"
                     /note="PKUD0D05460; similar to Saccharomyces cerevisiae
                     YBR204C (LDH1); ancestral locus Anc_8.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323296.1"
                     /db_xref="GeneID:40385648"
                     /translation="MTKRLTVSRLKELQERDSSHHVSLRESLWKYLNDDMHTDFEKEI
                     LALKPNDCLIVQKYTSVQSFPIENRPHLKEVSVATLYSEHPLREFHKRILKGTSELDQ
                     KKLVIVKEQLLKIDTLPVLVFIHGLGGQMSQFEPILQELRNCSDMFAIDLPGFGNSKR
                     PSRNDPSKTLKFSSLSEYSKDDLLRIEKCLDDMRDEDFQTDQLVDMLYQILMYRFPSR
                     KFILLSHSMGTHISIKLVNRLSEGKVESVVMLAPPAIHQPHEHPSLIKRMGLNRRMFL
                     DLFWYMPGLFDYFRVFDRKNGLYSKSVESYIYCGQSEEDDILKRLTQLRWNLDTDSKV
                     FLKYLFGFHCASENELKKMCLRLNSRRMFLCCGEEDQTTPIKYSLHIRDMIEGFAEDG
                     VNIRVDFESITHANHSIFLDKPNLLAGSIYHFIESLHLNISCTWVLQVKALISGDKWG
                     LKNEEKWNKVVTISKPMTNKTSPEKPRSFLIAMKTLRQTDAVHNPKRFESDHPEVFAI
                     IDIGSDTPSYDPNDFVRIKYVKYKTESKVTPDNITIVKFLEIVDKLLEERANAGQFVA
                     VHCHYGQNRTGFLICCYLIEKLGWSVAESIEAFEISKPPGIKHVHFRNALYLRYES"
     gene            complement(<1146957..>1147115)
                     /locus_tag="C5L36_0D05465"
                     /db_xref="GeneID:40385649"
     mRNA            complement(<1146957..>1147115)
                     /locus_tag="C5L36_0D05465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467437.1"
                     /db_xref="GeneID:40385649"
     CDS             complement(1146957..1147115)
                     /locus_tag="C5L36_0D05465"
                     /note="PKUD0D05465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323297.1"
                     /db_xref="GeneID:40385649"
                     /translation="MLNARIQSSKRIALVYLSVAMTIPFLMPIKHTITHKDDQSIGYF
                     GVGGAFRI"
     gene            <1148207..>1148686
                     /locus_tag="C5L36_0D05470"
                     /db_xref="GeneID:40385650"
     mRNA            <1148207..>1148686
                     /locus_tag="C5L36_0D05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467438.1"
                     /db_xref="GeneID:40385650"
     CDS             1148207..1148686
                     /locus_tag="C5L36_0D05470"
                     /inference="similar to AA sequence:RefSeq:NP_012061.3"
                     /note="PKUD0D05470; similar to Saccharomyces cerevisiae
                     YHR191C (CTF8); ancestral locus Anc_4.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323298.1"
                     /db_xref="GeneID:40385650"
                     /translation="MPVTNIKVDSALSSLETQGLHQVSPSLQEKLHQKIVATPLGLTL
                     VEIQGELSLPKTKPNHLNEREQELFRKNTVPQLLKSIHSLHGDVDTVKFGHLELDTSL
                     NKATLFISTTQRLLGKIEKIDPPLGVLKIQHGPETSSQIIDVINSKVIFKQRPLPIM"
     gene            <1149238..>1151013
                     /locus_tag="C5L36_0D05480"
                     /db_xref="GeneID:40385651"
     mRNA            <1149238..>1151013
                     /locus_tag="C5L36_0D05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467439.1"
                     /db_xref="GeneID:40385651"
     CDS             1149238..1151013
                     /locus_tag="C5L36_0D05480"
                     /note="PKUD0D05480; Pfam Domains: AA_permease(1.8e-121)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323299.1"
                     /db_xref="GeneID:40385651"
                     /translation="MKSLSSYFKQKNTSLTETSSANTDTHYEIDGTTKGITHVESFSS
                     SNDQYSQEIRETKGTHGYDFHLEKETGEDGQDGNDSGSVNEEEAQDLELFDVPPEGSR
                     LKRDFKKRHVDMMAIGGAIGTGLIIGTGTALKRGGPASMFISFIFTGSLLIVVLLSLS
                     EMAAFAPMDKSFSGYAAKYVDPAYGYATGWNYFYKYSINLGAELSAIGLVIQYWRPDL
                     NAGIFISVFLVVLMTFNYFSVRYFGEVEFWGSVTKLLVLFICYVTAIVITSGGGPKHQ
                     SIGFQYWRENAFVEYLVPGATGRFLGFWACTVQSCFAYTGSETIGIYFGEAPNPRKTI
                     PGAARNVLFRICGFYIVGALLIGLIISPKDPSLASANTSNASGSPFVIAFENARIRGM
                     PDFINAMLLVFISTAANANIFINARTMYGLARDGQAPKLFMKVNKFHVPYYGAALGGI
                     ISLIAYMECGSTSAANVFGYLTSSVTVFGILNWISILISYIRYRKGIELHNIPHEAIP
                     FKMWWQPYPAYIALFFICTITFFFGYSSFVHGFHYKLFLTSYVGLFVYLGNIFLWKFW
                     KKTKKVDLLEMKEFYTTNAERNLRL"
     gene            <1152176..>1153948
                     /locus_tag="C5L36_0D05490"
                     /db_xref="GeneID:40385652"
     mRNA            <1152176..>1153948
                     /locus_tag="C5L36_0D05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467440.1"
                     /db_xref="GeneID:40385652"
     CDS             1152176..1153948
                     /locus_tag="C5L36_0D05490"
                     /inference="similar to AA sequence:RefSeq:NP_009534.1"
                     /note="PKUD0D05490; similar to Saccharomyces cerevisiae
                     YBL019W (APN2); ancestral locus Anc_8.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323300.1"
                     /db_xref="GeneID:40385652"
                     /translation="MAINVEGEIPDLPTSECIRLVSFNINGYKTLSHYHPWNTLNKLS
                     EIFTYLKADIITFQELKLQRSDISKDIASVTGFTSFITIPQTKRGYSGVAVFVKNDLH
                     GLKVTKVEEGITGYLNLYNEPTQNYRKKWDLEGESGISIGGYTDNLVDWKEGQRLDSN
                     GRCIVVELNNKMVIISVYCPANSMGSEVEEQDRCLFLETLFKRAENLQRMGKNVIIMG
                     DINVAPSLIDRDDVINEGLKEGTLRLLKNRDADFELVNKEKVIEFRNSTPARRILHDY
                     LYDYNEFDKEKNKEKILYDLGRSRNRKRLKMYTCWNTLLNNRPMNIGSRIDLFLGTKT
                     IEENIQDCNIWSFLYGSDHCPIYCDINISDTDMKDQKPKLKHFEAMSYYGLKTSKSID
                     SFFKPKPSKNATESKPPSPKANSESITKRSSTTPSYMSRKKQRGQSTLISVLNKKNRE
                     REKRNSGSLFVYSDEEFNDDLGYSNSSDCNNRNNGNTNNNNNNIGSDNPTLQTETTHE
                     EKSPKLTSLQFANMLKENSGVIPRCGHDELCVLRLAKRGSNAGKKFWCCSRPPRNATW
                     AHDHNEDNADESQFQCKFFKWATR"
     gene            <1154244..>1154621
                     /locus_tag="C5L36_0D05500"
                     /db_xref="GeneID:40385653"
     mRNA            <1154244..>1154621
                     /locus_tag="C5L36_0D05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467441.1"
                     /db_xref="GeneID:40385653"
     CDS             1154244..1154621
                     /locus_tag="C5L36_0D05500"
                     /inference="similar to AA sequence:RefSeq:NP_011486.1"
                     /note="PKUD0D05500; similar to Saccharomyces cerevisiae
                     YGL029W (CGR1); ancestral locus Anc_4.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323301.1"
                     /db_xref="GeneID:40385653"
                     /translation="MSDSVKISKEVLKEVLPVDPGKGKRVSGKNWKVEKNAFRIKSLG
                     VKSSWQKKQEQRAKEQQDKAKLKELQAEKEEERKARINKIKERRAKKAEEERYEKLAQ
                     VMHAKRVERLKRREKRNKLLKER"
     gene            <1155263..>1155928
                     /locus_tag="C5L36_0D05510"
                     /db_xref="GeneID:40385654"
     mRNA            <1155263..>1155928
                     /locus_tag="C5L36_0D05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467442.1"
                     /db_xref="GeneID:40385654"
     CDS             1155263..1155928
                     /locus_tag="C5L36_0D05510"
                     /note="PKUD0D05510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323302.1"
                     /db_xref="GeneID:40385654"
                     /translation="MPNNMESRSLLYPVIYDLNFSYKIWQTSNEGFSKYNSKSDICSV
                     DMFIDTLRIISGLLLFNAISSYVFTGTSTWGYKGKWTNTEYLYHRLRGSPLRKYTIES
                     LEASLHSTRYLLSINKQVFDVTAGGDTYNPHKKLKSKYSTFVGRDCTRMFINGCFHDM
                     EQCTWDLRNIGFDNEWVEKTVDHWVRFYENHPRYWKVGYLEADSPNEEPKQCLSGVRY
                     PGQ"
     gene            complement(<1156103..>1157860)
                     /locus_tag="C5L36_0D05520"
                     /db_xref="GeneID:40385655"
     mRNA            complement(<1156103..>1157860)
                     /locus_tag="C5L36_0D05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467443.1"
                     /db_xref="GeneID:40385655"
     CDS             complement(1156103..1157860)
                     /locus_tag="C5L36_0D05520"
                     /inference="similar to AA sequence:RefSeq:NP_014295.1"
                     /note="PKUD0D05520; similar to Saccharomyces cerevisiae
                     YNL104C (LEU4) and YOR108W (LEU9); ancestral locus
                     Anc_2.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323303.1"
                     /db_xref="GeneID:40385655"
                     /translation="MFKQTRAVLKEAVKLTYKNMLRDPSTKYSRAQRIKLPDRTWPDK
                     VIEKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLLEIGFKEIEVSFPSASQTDFDF
                     TRYAVENCPDDVALQCLVQSREHLIRRTVDSLKGAPTAIVHTYLATSDLFRDVVFKMS
                     QREALEKAVETAKLVKSLTKDDPSLQDTKWVYQFSPECFSDTPPEFALEICEAVKAAW
                     EPTVDNPIIFNLPATVEVASPNVYADQVEYFCRNISEREKVVVSLHCHNDRGCGVAAI
                     ELGLLAGADRVEGCLFGNGERTGNVDLTTVALNMYTDGISPNLDFSDIQGLIDVVERG
                     NKIPIHERAPYGGSLVVCAFSGSHQDAIKKGFIAHEARQAKGDTRWLMPYLPLDPKDI
                     GRSYEAVIRVNSQSGKGGAAWIVQKATGLDLPRQLQILFSKVVQEKADSIGQELKSEE
                     IVSLLNETYNVDSKFANSLKLEDYKYDKKSDEVTNVFAIINLNGEQYNISGTGNGPIS
                     SLLNAFGKFFKTEFEVDEYSEHSVGQGSKVKAASYIKIECAGTSQWGIGSHESITKSS
                     VNSIISVINSLLNKNVISK"
     gene            complement(<1158235..>1159755)
                     /locus_tag="C5L36_0D05530"
                     /db_xref="GeneID:40385656"
     mRNA            complement(<1158235..>1159755)
                     /locus_tag="C5L36_0D05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467444.1"
                     /db_xref="GeneID:40385656"
     CDS             complement(1158235..1159755)
                     /locus_tag="C5L36_0D05530"
                     /inference="similar to AA sequence:RefSeq:NP_010226.1"
                     /note="PKUD0D05530; similar to Saccharomyces cerevisiae
                     YDL057W; ancestral locus Anc_4.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323304.1"
                     /db_xref="GeneID:40385656"
                     /translation="MGYQYQDNEEEVILRVRDSPEINISCILSKPESSNCPDTPRAAI
                     LVHGFGSHKNAVFLSKLARKLSKEQGVYTMRIDFINCGDSTKTGENGRTLQDDIDCIN
                     VVYKYLSTGGVHGKRLFVDALVGHSRGVVDIFNWQLQHPEIYVPNLVACAGRFIGRGL
                     LDSILANNPDYEEKGGRFISGFQDGAYRPVWVPYKEDESLFTLEMDTVKHVNKDTSTL
                     LVYGTRENVIPLEDAARYNNTLAGRNTLKLIPGADHCFLGTEKLSPEQRRLGKLPVHK
                     SGVVDYNFHVADEISEWLEVANVHKRFLEKARMVHPYLSRWHDVPGLSNFRDIGGYAV
                     SNSNAYLQYSKIYRCDDLTGVSLGTVAHLKRLEIAKVYDCSSCGTRDPGSLLQENNID
                     YVCRANRTPDEMHALIYKQIRDHPMDPLVIINDSELILSLMVVAGVDPLLVAQEALLY
                     SSSSFRGVTLGTVYTCVLNAIANLSLDNVCTRVGFTCNDINTLRDNLVTKFPKEAI"
     gene            complement(<1159984..>1162686)
                     /locus_tag="C5L36_0D05540"
                     /db_xref="GeneID:40385657"
     mRNA            complement(<1159984..>1162686)
                     /locus_tag="C5L36_0D05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467445.1"
                     /db_xref="GeneID:40385657"
     CDS             complement(1159984..1162686)
                     /locus_tag="C5L36_0D05540"
                     /inference="similar to AA sequence:RefSeq:NP_010227.1"
                     /note="PKUD0D05540; similar to Saccharomyces cerevisiae
                     YDL056W (MBP1); ancestral locus Anc_4.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323305.1"
                     /db_xref="GeneID:40385657"
                     /translation="MHEKLYSATYSGVPVYEFIHPKSSVMRRKVDGWVNATHILKVAN
                     FPKAKRTRILEKDVQTGVHEKVQGGYGKYQGTWVPLERAMEIANQFEVLNELDPVFQY
                     VSNGAETPPPAPKHHHATTINGTRKPRTTKAPKPPNFGTTLPTKGRRKRKDTVLDTDT
                     NSVTKSRQKKRGKKADLSIHTPSNTFTDVNMVVTPTSTSRESFDSKRMLKAPSHSQSI
                     TNDLTMLENDLDDEFAHDDNHHHNNIIQNYNNMNNNNNNNNNNDDDNNNNNTTTTNNN
                     NNNGNRNRLNKFDYHSDLNRNSIHFGNSLVAGYHDNENKTENTRPSSSFYSQFHEPST
                     AEFMSEQDLDKALANSETYGNEVKSRFPLTMTPIQPSSQPFLAMLDRSYVKTLYKYFT
                     ELETNPNCEMPDFVTHDYDDFNIDQPIDNQGNNLLHWACSMGDVKMCEVLLKRNCNVH
                     ILNNRGEEPIIRSVMYANCYTRRTFSKLLDLLGDCLLDIDLNGRTILHHIAIATGDKN
                     NLPSSRYYTEILLIKIAEIVKSNDLFREFIDKQDIDGNTALHIFSFNNASKCIKILLG
                     YNARVDLRNRFNDQVGDYLTENFRNDTVEFHENGASLNQNYESFSLRPFKPSFNAPID
                     KSVSTNQRGTGDSYLEPFQSQYYHYHHTTPHYQQPSYTPTSLLNLKESTTLNTSHVST
                     TSMKMNQLNFEVFQKLNELSTSFDNEIIQKNDDLNELNSIVSQMDDDITNTSNEIKKL
                     LSDVFGLEANENNDQSFQQVDEQLSTISSDYEAKCKLLKRLIDRSQAMKLARIVQEYE
                     NESLSQISQTSNSEGKRSSPPADLPDAVLRSLIDLARQQIIRKKSVKIFVNVQSKCDD
                     ELKMERLGNYRRLVSKLSNMPISEVDSSLNSIEECLIRDRDATS"
     gene            <1164056..>1166137
                     /locus_tag="C5L36_0D05550"
                     /db_xref="GeneID:40385658"
     mRNA            <1164056..>1166137
                     /locus_tag="C5L36_0D05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467446.1"
                     /db_xref="GeneID:40385658"
     CDS             1164056..1166137
                     /locus_tag="C5L36_0D05550"
                     /note="PKUD0D05550; Pfam Domains: RhoGAP(2.7e-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323306.1"
                     /db_xref="GeneID:40385658"
                     /translation="MATAIKDNEPRRRSISVFSNARGSVTSSTDPLKRRSFSVNRKSF
                     SLTGGYTTTNTENSRDNALDSIENKKMRSNSTRGKQNKRFFSSPQFSSSTPNLIGNET
                     TTKYIDSELNLAHKSIFVGDTELTIPTVVYKCCDFLKYTAPVEGLFRMNGSIKQINQI
                     EMDLYRNIESYVFTINDENTNGLHSSPNTNVSTAHDIAVVLKRWISKLDDGIITADVY
                     HELAHLSKASYTHFDDELSEVEHKGDGDMSDNESLIDMDRLLESPIKNTEGIQSEHPS
                     SFTSSSKISTFTSLYSLPLSKLPIENLHLTLYLLDFLNFMSQPSISSITKMNDSNLAK
                     VFQLNFFKSVDLIVGTKSFSTEDLKSSYHTNEELLKALIKDSGTIIKDLATFIKENDY
                     QIQHILKSHSASHASKRTPNTTYVLSQQLNNSQSSFTSKGTPLYSQGNHSFDHISSYP
                     RQRDLSTYLETCVERSIPSTPLANDRPRSDVFGEYPEGVPDFLNDPTSQKTHTLPAPE
                     EEKNKEIVVMKRQNPKRRSIFGIFNKRKSSLGMELEQNSGYQQHQQPLQHHENSNHDH
                     HHRPASSRKKSHDILKAHPNSTSNSLAVLAEPVNHHTRNVDVGTAKQTLSAQSSRNHN
                     PIKENANTKTEETRRQHKFDSSTTNENPKIARNPATRKHTDDTNNVSGAPTTSTPSHK
                     RFSLFKFMKSQ"
     gene            <1166519..>1168648
                     /locus_tag="C5L36_0D05560"
                     /db_xref="GeneID:40385659"
     mRNA            <1166519..>1168648
                     /locus_tag="C5L36_0D05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467447.1"
                     /db_xref="GeneID:40385659"
     CDS             1166519..1168648
                     /locus_tag="C5L36_0D05560"
                     /inference="similar to AA sequence:RefSeq:NP_010087.1"
                     /note="PKUD0D05560; similar to Saccharomyces cerevisiae
                     YDL194W (SNF3) and YDL138W (RGT2); ancestral locus
                     Anc_7.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323307.1"
                     /db_xref="GeneID:40385659"
                     /translation="MKGSPRRSSSTGVQISGTSGRQPSPLETKESRNRIYKTIKKSIQ
                     KINPDRETKMRKIMASKPRSKNQKRKSSFMAIYVGLLTALGGFLYGYDTGIINGLLET
                     KYVMAHFTRGGKTNFDSAERAIITSILSLGTLFGSLISPIISDTHGRKFCMVVTLIIF
                     NIGTIVQIVHGSYGLILSGRFINGIGVGAISSIIPLYQAEVSPKWIRGVCISFYQLAI
                     TIGLLVSSAISQATRNINDERCFRIPIGLQFVWCAFLLGGLLTLPESPRFYVMIGDID
                     GAIISLSRFRRLTIDDNELIEELIEIKATHDYETSTGSISYLDCFKSSKGRSHQLKRM
                     VTSMALQLFQQASGINFIFYYGVNFFVATGVNESYLMSFITYAVNVVCTIPGILVVDK
                     LGRRKLLMIGALGMTISNFIIAFVGLNSNTVIVNKVMLSFVCTFIAFFAASWGPVVWV
                     VTGELFSLSVRQKAVSLSASMNWIVNFVFAYSTPYLIDQGNHTASIGAKIFFLWGSLN
                     LAGFLFTFLFVYETEGLMLEEVDELYHRCSYAFQSHKYNKEIQNGSEQRTGEEETQHD
                     EKSKTNHESVMTSVNTSGSGDCEESESIYSPMDYLNRWAEKRQRNSILNENILTRPTN
                     ELPQSLELTLSDENSGSSGAGSQEIPLDFNFSHGLYGETVEHSPQPNLDDNEPHEDEE