GenomeNet

Database: RefSeq
Entry: NC_042510
LinkDB: NC_042510
Original site: NC_042510 
LOCUS       NC_042510            1289138 bp    DNA     linear   CON 16-JUN-2019
DEFINITION  Pichia kudriavzevii chromosome 5, complete sequence.
ACCESSION   NC_042510
VERSION     NC_042510.1
DBLINK      BioProject: PRJNA545694
            BioSample: SAMN08558011
            Assembly: GCF_003054445.1
KEYWORDS    RefSeq.
SOURCE      Pichia kudriavzevii (Candida krusei)
  ORGANISM  Pichia kudriavzevii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
REFERENCE   1  (bases 1 to 1289138)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Population genomics shows no distinction between pathogenic Candida
            krusei and environmental Pichia kudriavzevii: One species, four
            names
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1289138)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1289138)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
  REMARK    Annotation added by submitter
REFERENCE   4  (bases 1 to 1289138)
  AUTHORS   Douglass,A.P., Offei,B., Braun-Galleani,S., Coughlan,A.Y.,
            Martos,A., Ortiz-Merino,R.A., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2018) Conway Institute, University College
            Dublin, Belfield, Dublin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP028777.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 01-DEC-2017
            Assembly Method        :: HGAP v. 3
            Assembly Name          :: UCD_Pkud_6
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 93.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1289138
                     /organism="Pichia kudriavzevii"
                     /mol_type="genomic DNA"
                     /strain="CBS573"
                     /isolation_source="lab strain"
                     /type_material="type material of Candida krusei"
                     /db_xref="taxon:4909"
                     /chromosome="5"
     telomere        complement(1..561)
     gene            complement(<712..>1590)
                     /locus_tag="C5L36_0E00100"
                     /db_xref="GeneID:40385798"
     mRNA            complement(<712..>1590)
                     /locus_tag="C5L36_0E00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467555.1"
                     /db_xref="GeneID:40385798"
     CDS             complement(712..1590)
                     /locus_tag="C5L36_0E00100"
                     /note="PKUD0E00100; Pfam Domains: Mito_carr(4.4e-61)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323415.1"
                     /db_xref="GeneID:40385798"
                     /translation="MGVPVKKPDPFHSFIAGGVAGAIECVATYPLEYAKTRLQLVEKS
                     NKMPRNPLVLISTVARTQGVSAVYVGCPAIVVGNTAKVSVRFLGFGCVKRALVDKDGK
                     LSGPGGVIAGLSAGLLGSVAVTPAEAIKTAKIDDKQSLKPKYQDGVCGTFRLIKDIGV
                     KGLYSGLLPVAMRLGADSAVRFGSYLKMKGALQDWSNTPRDKPLSSGMTFLLGAFAGV
                     VTVYTTMPIDTVKTRMQSLDASKQYSSTLDCFVKIFKNEGVMTFWRGATPRLGRFILS
                     SGIIITSYEKMLVILA"
     gene            complement(<10440..>10973)
                     /locus_tag="C5L36_0E00110"
                     /db_xref="GeneID:40385799"
     mRNA            complement(<10440..>10973)
                     /locus_tag="C5L36_0E00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467556.1"
                     /db_xref="GeneID:40385799"
     CDS             complement(10440..10973)
                     /locus_tag="C5L36_0E00110"
                     /inference="similar to AA sequence:RefSeq:NP_010990.1"
                     /note="PKUD0E00110; similar to Saccharomyces cerevisiae
                     YER067W (RGI1) and YIL057C (RGI2); ancestral locus
                     Anc_7.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323416.1"
                     /db_xref="GeneID:40385799"
                     /translation="MKKDNNKVALEPRELTHLTSEPKVRNAKEVEFDSLDKFEEYIKN
                     ESWDDEYDRLKVHLEYLPPFIEHEIHGDEENIKPQMNALNKKFRRHLHQHLTKHLLPQ
                     INKMSGIKYNFKEIDEGLVPEHNGLDSVYRWHYNDDGNHGFDEQDYKCRSHWKAQLDV
                     ICNSNGPYVHVDFVCHP"
     gene            <11711..>13621
                     /locus_tag="C5L36_0E00120"
                     /db_xref="GeneID:40385800"
     mRNA            <11711..>13621
                     /locus_tag="C5L36_0E00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467557.1"
                     /db_xref="GeneID:40385800"
     CDS             11711..13621
                     /locus_tag="C5L36_0E00120"
                     /inference="similar to AA sequence:RefSeq:NP_013178.1"
                     /note="PKUD0E00120; similar to Saccharomyces cerevisiae
                     YLR077W (FMP25); ancestral locus Anc_8.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323417.1"
                     /db_xref="GeneID:40385800"
                     /translation="MFPMRTFKATYADKAVSLRLLNRRILHTTAVRLAEEDAKNAPKS
                     TTDIEDDDTLKHLYKRKYQFVQKQNLEDPYNVLHESQHQSNSYGEHQNSSQSDDEKTF
                     QLTQRLKFIAGGVAALVITLGSLEVYNNWSFLKSKYFGNGELESFDEMYERIKNKKQK
                     KKQELELFAKTITNPNDSSVPGVYVCGDNRSQLVSDEKDYQLIPVFKRIDAFDNMIVK
                     DVAIGDKSGALIDERGSLYQWGAGFGGDPRIPSIKGKNLKKVQISNDTVYVLSEKGDV
                     FYLPESHELQNQHVHKQRGWFGSYDVKFQKLDTLKRKIVDIRAGSQHLVLLDDKGKVA
                     TTATGYDNGIEQSYGQFGLPEFSQFDAPPRINEIHDVVLLNRYLKNGKVAERKITQIA
                     AGDFFTLCLDQAGSVWAFGKNTYGAIGSTINFDTEIIPYPTQVKFISSHFKRSEFPRC
                     VSIAAGGESAYATFSSSNMYELFERSLKDGAGGQPTFEPLGEVEESKLHLSWGHGLKG
                     ELGLGHFIHGSSEPKKIKVLNDIKEYNEITNKLEKIGIKSWSAGKNHVVVTLQNNDVY
                     VWGDNEFGQLGNGKRIRAGAPINIPSLLEPSDREVKYSRFNDRLQLIDNGKVHQEIVA
                     GNYTTAIVYKKD"
     gene            <13781..>15625
                     /locus_tag="C5L36_0E00130"
                     /db_xref="GeneID:40385801"
     mRNA            <13781..>15625
                     /locus_tag="C5L36_0E00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467558.1"
                     /db_xref="GeneID:40385801"
     CDS             13781..15625
                     /locus_tag="C5L36_0E00130"
                     /note="PKUD0E00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323418.1"
                     /db_xref="GeneID:40385801"
                     /translation="MNSLFLFSQAFFLNFTMDCAFPLYPTSSDLPHKVERSLLMNNVG
                     RNTVAVFSCVSGKENRSEVLQRQKRELFQDDSRSRFDGQPLNFKDIVSDVCNAHMDDV
                     SFLVYSKANGNFDHEYKLQILLDTYFIYEIEVEAAELNDVLDVFQDEARLLSSKYKSA
                     MDEFKQLLAPFKRVIFRENTSESKNDTLIPDLRQYGLLIPIRLENKWTLIWVKFTKFR
                     SLFEMYQLSSSIGKSDKISRFSQELIKKLVAYLLGIEDTESLVYNFTFVQTNRERNPQ
                     LDAVLIRDMIRIIGGYQEVGFNVTVDFSYHANNQYDELTSKPRTRTLPFMSLEDIKEM
                     NGKKSKKRQPEILPTPPQTQESKRKTIDSKVKSNPSTTLNSTKRGKNSSNDREHKTKG
                     KSASSETGTNKGSSGTSSAASSSSSSGPMKVVVTLDNLESVKNTLPYDAVKMNELVSL
                     YTRIYDSVEASLLDKWSRVNFFSKNFPMEYQEPPFSIYGPSQIEYEILKSGGIIATNT
                     LKEKIKKYDVTLNTKTMRYLTSSRRWINQRFKLDPKLNQVFYTRDEALIIPDYRDIPY
                     IVMATHLAYNCLGPDETFDITHQNWYISRKMVSFVIEHCEKCHGKKNA"
     gene            complement(<15714..>16472)
                     /locus_tag="C5L36_0E00135"
                     /db_xref="GeneID:40385802"
     mRNA            complement(<15714..>16472)
                     /locus_tag="C5L36_0E00135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467559.1"
                     /db_xref="GeneID:40385802"
     CDS             complement(15714..16472)
                     /locus_tag="C5L36_0E00135"
                     /note="PKUD0E00135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323419.1"
                     /db_xref="GeneID:40385802"
                     /translation="MVSDSCFSYLHMDGHASVLFVESWDTKKLRWDDIDIATEIDQHE
                     NLLEQFLSPNEGNEDELGTMGANGPIFNSSYANRMKQKNMKLNWKDVNLEGFQPSLPN
                     EYHDYTILKRPNLDNVDYDEQLDSFLGQGNRNDDSLRILEGLDRPVRAGENLNTEMEM
                     GMEMEMEMEMDIDGNPDLEHSTYPILRNVPTGDLSRSFSQQIHTPVINNRVYFHEFPG
                     GSVRKVSSQQRRQTTDTSNTSNINYHTPRHDNIR"
     gene            <16817..>18121
                     /locus_tag="C5L36_0E00140"
                     /db_xref="GeneID:40385803"
     mRNA            <16817..>18121
                     /locus_tag="C5L36_0E00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467560.1"
                     /db_xref="GeneID:40385803"
     CDS             16817..18121
                     /locus_tag="C5L36_0E00140"
                     /inference="similar to AA sequence:RefSeq:NP_010548.3"
                     /note="PKUD0E00140; similar to Saccharomyces cerevisiae
                     YDR262W; ancestral locus Anc_5.623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323420.1"
                     /db_xref="GeneID:40385803"
                     /translation="MKLQRAVIASIFALLSGVVIAKNVFNPQFTNEQLQQAQLELEDK
                     EFHFGKREAKNVIDLNAIVTKGQDFEKRESKNVFLASLIVDERSLFKRDAKNVFDFDL
                     VINDANLGKRDGKNVFDINMVLDDDKPFEKRDAFAKNVVNVHLIIDDESSLVKRGIEN
                     VINIDLALPEYNEYLKMLKDTANVGFIIGSDEYVSGKVEKVDNTLNISLKHDPKGCHG
                     KKKKLNLESLSEVIDTFKDKMFDPTLEAKDKFVIPEGMEDDSENLRNTVLEPVGGDIA
                     TALVTKSELGLFAKYLRDSPSLYRKCETVTTEGEATPKPNARVIIFAPSNDAITQLPK
                     KPWQFPEDIANAKSEDEQDTMIERNIADFVESHFVETEDAMPSLDSKSAAFKTFNNKE
                     IVLRNVDGDFKVKMKDSEIWVNVVDVEILSNGALLTIDHTLV"
     gene            complement(<18447..>22847)
                     /locus_tag="C5L36_0E00150"
                     /db_xref="GeneID:40385804"
     mRNA            complement(<18447..>22847)
                     /locus_tag="C5L36_0E00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467561.1"
                     /db_xref="GeneID:40385804"
     CDS             complement(18447..22847)
                     /locus_tag="C5L36_0E00150"
                     /inference="similar to AA sequence:RefSeq:NP_014759.1"
                     /note="PKUD0E00150; similar to Saccharomyces cerevisiae
                     YOR116C (RPO31); ancestral locus Anc_5.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323421.1"
                     /db_xref="GeneID:40385804"
                     /translation="MKQTVVDVAPKCITGLEFGALSDAEIVAQSETEVFTRNLYDLEH
                     GRKPVANGALDTHLGVSTNTGECQTCHGNLATCHGHFGHIKLALPVFHVGYFKATIQV
                     LQTICKSCSAVLLEDAMKEKFLADLKRPGLDNLRRMRILKKIQDQAKKQRRCLKCGAV
                     NGVVKKAAAGGGPAALKILHDTFRWIGKKGAPEKEDWDDDFDKLFDENPELEKFGKRC
                     FDDLNPLKVLNLFKQIEPADCELLGMDPARGGRPEMYIWRYLPAPPVCIRPSVIMADA
                     SNEDDLTVKLTEIVWTSSMIRAGIQKGISINSLMEQWDYLQLAVGVYINSDIATPSML
                     QNGGTKAAKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPEL
                     VAKVLTYPEKCTRYNRKKLQKLIINGPEKHPGANYLQKQDEELKRNLRYGDRHKLAKN
                     LNIGDVVERHIEDGDIVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFD
                     GDEMNLHVPQTEEARAEAMNLMGVKNNLLTPKSGEPIIAATQDFITGSYLISKKDSFF
                     DKATLTQMLASMSDGALDFDLPPPAIFKPVYLWTGKQIFSLLIKPNRKSNVVINLDAK
                     CKTFVAPDKGYPNEMSPNDGFVIIRNSQILSGVMDKSLLGDGKKHSVFYTILRDYGAV
                     EAATAMNRMAKMCARFMGNRGFSIGISDVTPKDDLKAKKEQLVEIAYAKCDELIELFK
                     TGKLETQPGCDEEQTLEAKIGGLLSKVREEVGEVCIRELEKSNAPLIMATCGSKGSTL
                     NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLNPPEFL
                     FHAISGREGLVDTAVKTAETGYMSRRLMKSLEDFSASYDDTVRNSSNGVVQFIYGGDG
                     LDPLDMEGDGVPVNFNRTWTHSYFVSLDHQDKSLKPYDVRNLIKSILGPMKEALIRVD
                     NVGNIVSKEDFDKIEYVDIYDAERDFYDSISNFIEGKLKLLCQYRVSRGLPACNEESE
                     DYEMTPDSLSKETSVDQVMKITEKMIKQFLDLCCTKYRKARVEPGTAVGAIGAHSIGE
                     PGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDRDERAARVV
                     KGRVEKTLLEDVSMYIEDVYKENQAFLQVKIDLKTIDKLQLELNIEQIANAIVLSKLK
                     IARGDVSIIGKNKIQVLVNDAGDFKPTGRSSASKEIAMLAYKDADERERLEKNALFFK
                     MQHLKRLLTKVVVKGLPDIARAVINVNDDDTKGLLIEGYGLKDVMATDGIIPTKTKTN
                     HILEIYQVLGIEAARSSIINEIDYTMGSHGMAVDHRHIQLLGDVMTFKGEVLGITRFG
                     LAKMRDSVLQLASFEKTTDHLFDAAFYMKTDEVEGVSERIILGQTMGIGTGAFKLASK
                     EDGTPVTTKTKETLFDSLCRGIVPKSLQVA"
     gene            complement(<23155..>24060)
                     /locus_tag="C5L36_0E00160"
                     /db_xref="GeneID:40385805"
     mRNA            complement(<23155..>24060)
                     /locus_tag="C5L36_0E00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467562.1"
                     /db_xref="GeneID:40385805"
     CDS             complement(23155..24060)
                     /locus_tag="C5L36_0E00160"
                     /inference="similar to AA sequence:RefSeq:NP_010648.3"
                     /note="PKUD0E00160; similar to Saccharomyces cerevisiae
                     YDR361C (BCP1); ancestral locus Anc_5.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323422.1"
                     /db_xref="GeneID:40385805"
                     /translation="MAKRTKEELDSQDSDIDVSSSEDEELQEEGIDEGDEMVNIDFDF
                     FNLNPDIDFHATKNFLRQLFQDDSILFPLSELADLILEEGHIGTTIKTDGIEGDPFSI
                     LSVINISNNLKTKAIQEITKYYIEKTKKSTEFNILLRQLFSPSSKHKIGLIFSERLIN
                     MPVETMPPMYTILLEEMEESRKKDSEYEFDYYLIPSRVVKLVSSVADKELEDEDETTS
                     RKKVKKSSGLPSEFDYIHYEDEILEKNALHYGYFDFTHKNVEPDARRVFNDYGIEPKI
                     NLILINKNALQTAVTQMKEAYPYEG"
     gene            <24123..>25769
                     /locus_tag="C5L36_0E00170"
                     /db_xref="GeneID:40385806"
     mRNA            <24123..>25769
                     /locus_tag="C5L36_0E00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467563.1"
                     /db_xref="GeneID:40385806"
     CDS             24123..25769
                     /locus_tag="C5L36_0E00170"
                     /inference="similar to AA sequence:RefSeq:NP_010652.3"
                     /note="PKUD0E00170; similar to Saccharomyces cerevisiae
                     YDR364C (CDC40); ancestral locus Anc_5.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323423.1"
                     /db_xref="GeneID:40385806"
                     /translation="MKNLALNQVFFFFLFLILTSRPRQILFFLNNRSFLPFHFPSASE
                     ALESCKLMSLELGYTSESDCEHENENEVIKENKEVTQPSVITLATPKVKSLSGTFQEE
                     VISTRKFELNRRKFFNGTGIGGIDGRKRKLSNDVDLATSKDKLPESKRKAKGDVSVLE
                     GQDKFVGSWGTDESSENESEGDCTAKLESENMNLALPEETPEQFTEFTESSTFYGGIP
                     NKSSIFDLPQDYQIRFATTVPGQKEYYVPKKVASSFKAHKSTVTSLQFFPNMGHLILS
                     SGSDGIIKLWSTTKQKLIRDYVAHAKAVKYVSFSEDGHYFISCSYDKTIKIWETETGN
                     MRYKHKVKSNPNMCTFVPGKEHEFMAALDNCTVVHVNWHTGELVQLYEHHERPVLWIE
                     FINNGTQFVTSSDDRTLKIWDLQINMPIKYIADPRQHAMPVVKAHPTFPFFVGQSMDN
                     QVLVYSTRQKDKFKKNNNKSFKGHNTAGYSIRLGFTPDGKTLMSGDSTGYCYFWDWKT
                     CKLVKKIKVANNVLTNIDVHPLETSMVVLAGYDGDIYILN"
     gene            complement(<25890..>27170)
                     /locus_tag="C5L36_0E00180"
                     /db_xref="GeneID:40385807"
     mRNA            complement(<25890..>27170)
                     /locus_tag="C5L36_0E00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467564.1"
                     /db_xref="GeneID:40385807"
     CDS             complement(25890..27170)
                     /locus_tag="C5L36_0E00180"
                     /inference="similar to AA sequence:RefSeq:NP_014760.3"
                     /note="PKUD0E00180; similar to Saccharomyces cerevisiae
                     YOR117W (RPT5); ancestral locus Anc_5.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323424.1"
                     /db_xref="GeneID:40385807"
                     /translation="MATLEDLENNPDLQIDDEILNSSTTDIKNRTKLLDNEIRIFKSE
                     YLRLQHDKTVSMQKIKDNKEKIKNNKQLPYLVGNVVELLDLDAEENATNEGANVDLDS
                     TRVGKSAVIKTSTRQTVFLPLIGLVEPEKLKPGDLIGVNKDSYLILDTLPSEYDSRVK
                     AMEVDEKPTESYADIGGLDKQVEELVEAVVLPMQQAEKFKNLGIKPPKGALMYGPPGT
                     GKTLLARACAAQSNATFLKLAAPQLVQMFIGDGAKLVRDAFELAKEKAPTIIFIDELD
                     AIGTKRFDSDKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGR
                     LDRKIEFPLPAEESRAQILQIHARKMTVDSSVNWKELARSTDEFNGAQLKAVTVEAGM
                     IALRNGQSVVKHEDFVEGIGEVQARKTKSVSFYA"
     gene            complement(<27493..>28026)
                     /locus_tag="C5L36_0E00185"
                     /db_xref="GeneID:40385808"
     mRNA            complement(join(<27493..27529,27644..>28026))
                     /locus_tag="C5L36_0E00185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467565.1"
                     /db_xref="GeneID:40385808"
     CDS             complement(join(27493..27529,27644..28026))
                     /locus_tag="C5L36_0E00185"
                     /inference="similar to AA sequence:RefSeq:NP_010651.3"
                     /note="PKUD0E00185; similar to Saccharomyces cerevisiae
                     YDR363W-A (SEM1); ancestral locus Anc_5.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323425.1"
                     /db_xref="GeneID:40385808"
                     /translation="MWNCRYSAAPIISMGEPSHVRDTGGNFVGFPSFRHRQTETETHR
                     YESYTSYLQRMSTAEQEKPLEQVPSKVEQDEFVKKLEEDDEFEDFPEDVWETTQSTEG
                     TKETRLWEESWEDQDDLKADFVNKLRAELAKNGSLKP"
     gene            <28227..>29264
                     /locus_tag="C5L36_0E00190"
                     /db_xref="GeneID:40385809"
     mRNA            <28227..>29264
                     /locus_tag="C5L36_0E00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467566.1"
                     /db_xref="GeneID:40385809"
     CDS             28227..29264
                     /locus_tag="C5L36_0E00190"
                     /inference="similar to AA sequence:RefSeq:NP_009727.3"
                     /note="PKUD0E00190; similar to Saccharomyces cerevisiae
                     YBR168W (PEX32); ancestral locus Anc_8.592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323426.1"
                     /db_xref="GeneID:40385809"
                     /translation="MPGGTVYAQFVSFQREYPQSLLGDTPPEVIAALIAIYPVLVTAN
                     RILGFITWTTDSCYRNFVVFCLYSLLILHWNNYFLIVLPTIMALSFCCYAWFIRKSYV
                     EFGESGHSSPTIEEVLNTLDNFTMRSSLIFDMNIKEMASKRKIRSLLTNLSVLTPLYS
                     LFMKHHVSANTWIFMVSLIMYTYYSSPFMAMRQLLWRFKPLRYVAQVLTGEHYPLEDK
                     DVEITILNLNTRESIDRNTKIAELHLVENQRRWLGVGWCSKMFLWEETPSYYSPDTKR
                     GFDTLSQYEFPLLRNYPHSTWTWVDDSWRANGGWTYFDYHWQDGQQQDSLTRYTRRRL
                     LKRKCLLSLRR"
     gene            <29886..>31640
                     /locus_tag="C5L36_0E00200"
                     /db_xref="GeneID:40385810"
     mRNA            <29886..>31640
                     /locus_tag="C5L36_0E00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467567.1"
                     /db_xref="GeneID:40385810"
     CDS             29886..31640
                     /locus_tag="C5L36_0E00200"
                     /note="PKUD0E00200; Pfam Domains: AA_permease(1e-192)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323427.1"
                     /db_xref="GeneID:40385810"
                     /translation="MSSQETHEKKNYVVTSVSVVADDKDSQIESPYSEESQSKGFFQA
                     FLDGFKPLDIGEIDPNLTDVERANLISARASLKRGLKNRHLQMIAIGGSIGTGLFVGA
                     GSALAKGGPAALIIAWVLTGSMMYCTVQALGELSVLFPVAGSFTQFNTRFISPAWGFC
                     MAWNYALGWLITLPLELVSASITIDYWNSEINSAAWVTIFYVVIVGINVFGVRGYGEA
                     EFIFSALKVLAVVGYIILGIVINCGGGPKGGYIGGRFWSDPGAFSHGFKGVCSVFVTS
                     AFSFGGTELVGLAAAETENPRKSLPTATKQVFWRITLFYIISLTLIGVNVPYNDPRLL
                     GNSGAAASPFVLSIQNAGIKGLPSVMNAVIMIAVCSVANSSVYAASRTIAALSNQGFA
                     PKLLGYIDREGRPLGGIAVSLTVGLLCYLSAYKNHSQVFDWMLSISGLSSIISWGSIN
                     ACHLRFRRALSVQGRTTDEVPFTAQTGIYGSIFGVLLNCLILAAQFWVALFPAGKPAS
                     AESFFKVYLCVPVLIVFYFGWMLYKKNYTFFIKYSNIDLDTGRRVLDVEALKQEIAEE
                     KAFIASKPFYYRVYKFWC"
     gene            <32260..>36567
                     /locus_tag="C5L36_0E00210"
                     /db_xref="GeneID:40385811"
     mRNA            <32260..>36567
                     /locus_tag="C5L36_0E00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467568.1"
                     /db_xref="GeneID:40385811"
     CDS             32260..36567
                     /locus_tag="C5L36_0E00210"
                     /inference="similar to AA sequence:RefSeq:NP_010646.4"
                     /note="PKUD0E00210; similar to Saccharomyces cerevisiae
                     YDR359C (EAF1); ancestral locus Anc_5.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323428.1"
                     /db_xref="GeneID:40385811"
                     /translation="MTPPAPNSTNKVRESSQNMHSYSMDRIRLESIEKRKQECAQIIK
                     ERKRKLSELYCVARLPFVPISSDHVQHIEDKLMAFLEKNDLENGHSFDISFLSKEKIF
                     RKSMSPQQQSTPPAINRSNSQQGNNEPPKKIRKIETPARLGSNESTPVPFPVESQKSS
                     SPEGVKQLLPKIAPKPSTTQSSDISSPISKLIPSKVDHEGQKNKPASPKDPLTDSRTS
                     SVEKTRKEEENRSRIADEAAKTADKLVSEVEKLIDTKNDEFIEKEKADDKLISERDDK
                     KVSNRQDSPKVNPKSGEPNVSNELANDEVKRTHRPNESTQEQDIVPTQKQSNLPSTTN
                     PVDASAGLRLKNVTEETHRIKHITKPLDQNDPPSLLDMVSEYAKDPKLKRADERSDRD
                     LDYKDIDIKKLLITLMPETKPHKVAEARSLTELYYQQQTLQLQKLLLRAHKTLTTDAF
                     EASLIEGKVSVLHSRIEELKRKNSWSLRQPRKLVDPFIKIGKKTHWDNLLSEAKWLAT
                     DFRQERRYKAAQCVYIAQAVLDYWTFGKVCCIKRAPINFLPEDNAVPENSGDNLSPSE
                     DVLTKDPVMSSCIEAPTEGATELEEDIEQMQVIDEPERIGVPAENTEKFPLKENAAQL
                     YAKMDLDENVITDKLETPIVKQQNIPEFTYPDYESITNSRYTPFNLYADFNQFTATEK
                     TVINNLSCYNPFDDKSPDHIVERELYGHVSAMLPPIDEEAQFEKILYRKIEDNEKRAH
                     RSQHGLFGPYRRINILKPPRPPPISQLKIRIPTIWLPQDDKYLIKYVSEFSFNWDVIS
                     AHLSAKPTRSYTSNIERRTPWQCFERYIQLNDKFQFSDMRGLHANDAKLWLEEAHKVQ
                     ATTKRRISPLGVGIDSIQRGNRRLRWASMFDAMRKLMKKRELMSKPPPQPRKVNTESK
                     KSDTPTPEDLSKLKNDRDRALQETYAQRASNQVYSRMRNDNGQEQSESRRADAKSAKV
                     PTQVNRDPRNGESSIQPSSNGNRFTPEQVQKLLQIQRQRQLLQNQKNQSKGLMKSSSQ
                     TYLPVGQHMTQQGSTKPGPNGSFNSKTSPQVQQNSRVAHSMSSSPQNQFENIRTNSQN
                     SHVPTPEQVLQGVKAGSSIPTPQSKIVRQQASSNTFKKSVKPKFALSHSQISAIVNQI
                     QMQNPNLEKSQVTQLASSYISKLQQAKQNHYEKQQAAINANSGAPAVPNGPNTNTTPQ
                     SGERRNVNSLTLEQLNMLIKNPKLNEQQRKHLMLIRQRQIEMQQKHQMQAQAQAQAQA
                     QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAEVQAEVQAQAQQHLHQQQSLHI
                     QSQVLLPAQASSPSPIVQNPNVIGVSRADPNNTRVNSSSITTRFSPQPGSSGNKMLNY
                     YHKNSGVNNANASSLLSEVASNSSSVDISGDNDLNDLNKIDELFGLGTASDTGNTQQ"
     gene            complement(<36734..>38485)
                     /locus_tag="C5L36_0E00220"
                     /db_xref="GeneID:40385812"
     mRNA            complement(<36734..>38485)
                     /locus_tag="C5L36_0E00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467569.1"
                     /db_xref="GeneID:40385812"
     CDS             complement(36734..38485)
                     /locus_tag="C5L36_0E00220"
                     /inference="similar to AA sequence:RefSeq:NP_010645.1"
                     /note="PKUD0E00220; similar to Saccharomyces cerevisiae
                     YDR358W (GGA1) and YHR108W (GGA2); ancestral locus
                     Anc_5.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323429.1"
                     /db_xref="GeneID:40385812"
                     /translation="MSSLSSLSGASGKLLRRIHRACRPTLDEPNIALNLEICDLINSK
                     QGSLPREACIAVVKLINSRDPQVSELALTLLDYLVKNCGYPVHLQISRKEFLNELVKR
                     FPERPPPAYSRTQRLILGTLAEWVQTLCKTSRYKDDLTHIKDMYRLLRSKGYDFPAVK
                     KEDAAVLNPSDNLKSIEELQQEERIAQSAKLHELIRRGRPQDLKEANDLMKIMSGFKE
                     DETFAETKQIVYDDIDKLKRKITILNEMLDNASNTGVLNKDDDTLQELISTVKVSQPR
                     VQKIIQEEGEHGDVQGLLELNDRINNTLLRAAQLKGEDTSKMPAATNSVKASVNLIDF
                     DDDEPVSPNPNSPAPNTHDAINDLLGDLGGLSFDNSSSNNSNSQFGMGAINLLGSSTA
                     ASNNSPATAAVASTSPVKPASNLDILSGFSSASPAQTPSSQSPFPLAANKPVVTAKQP
                     VSSEPDLFGFDFAATSQVTPSLNSFFKDENLTIEYVIIEEQPTLSLQFQFSNTSFNQL
                     SNIQIYLAATKAFELTLDPPSSNTLYAKTLHGIKQNISIRSKSGEAFNTVKLKYKLNY
                     NNNGSHTEKQDVVTINV"
     gene            <39228..>40784
                     /locus_tag="C5L36_0E00230"
                     /db_xref="GeneID:40385813"
     mRNA            <39228..>40784
                     /locus_tag="C5L36_0E00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467570.1"
                     /db_xref="GeneID:40385813"
     CDS             39228..40784
                     /locus_tag="C5L36_0E00230"
                     /inference="similar to AA sequence:RefSeq:NP_012946.3"
                     /note="PKUD0E00230; similar to Saccharomyces cerevisiae
                     YKR021W (ALY1) and YJL084C (ALY2); ancestral locus
                     Anc_1.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323430.1"
                     /db_xref="GeneID:40385813"
                     /translation="MHSISNTLSSTTSATSVDGALSSVASPIEITNIPQENEFLILNT
                     SRFNITYKLLDKVLYLRKDTSGSKLTLLRGYLCVYVRKPVRIKHIQLKFEGALDVRYF
                     PSNMKIDPSSTFVKNKSFPIFSQSRNWQYKQHDKVLDTDYFAKGAFSYPFQFLIPNDI
                     PETMSNVFGSTSYCLTVTVSPISNTLGLSILGSSLIAKSFPIQVVQCDTEPEGTCHVS
                     NDSFSLGNWRYLFYYKIVISNRQVAIGDKVKVYVKILPNKAFKYRIRNIKVLLDQITE
                     YDISNRLEENERDKFYHKLSSTETALLEWINVDSYDNDPQVWEFDCELSRVFEKYNLK
                     NRYKKQSFTLVPTTNELENRICHFKVFHKIKVYLSVEEIVSEDDTISEFSDNASSFII
                     RPRAHSLDKTLMNTRAEKIDNDQMRRNSPLVQESDPNKSKVDLVFDADVEILKGESVV
                     GNMPPPTYTDSQIIPHLATIDNSNTSKTDILTIIDSSKTSQNQQLNFILPPAYEEVEE
                     LTEPPLYLYK"
     gene            complement(<40893..>41912)
                     /locus_tag="C5L36_0E00240"
                     /db_xref="GeneID:40385814"
     mRNA            complement(<40893..>41912)
                     /locus_tag="C5L36_0E00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467571.1"
                     /db_xref="GeneID:40385814"
     CDS             complement(40893..41912)
                     /locus_tag="C5L36_0E00240"
                     /inference="similar to AA sequence:RefSeq:NP_014400.1"
                     /note="PKUD0E00240; similar to Saccharomyces cerevisiae
                     YNR003C (RPC34); ancestral locus Anc_1.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323431.1"
                     /db_xref="GeneID:40385814"
                     /translation="MSSNLTDDLSASAKKMHHTMVSNGKSSYTQQELIDLLKYENANE
                     LMENAQALLNKGLLKILESEPDPSSNSTEKTILFAPISEQEAQKVSSMTADEAIVYSH
                     VEAAGREGIWTKTIKAKSNLHQHIVLRCLKSLESQSYIKSVKSVKHPTRKIYMLYHLT
                     PSIDVTGGPWFTDSELDTDFIDSLLIVIWKFVAQRTYPKCFKKKGLIPDGLKQYSYPA
                     NMIMGMGSLLPSLSEVNDFLVNSGITTIELTLSDVKSLCDVLEFDEKIECINGSYKAT
                     WQSILEAGGGKIEGEDIFAPLDNQVFNINDNYRVLDSSLNEEKENSEEGKVNKTLYFD
                     SWITL"
     gene            <42162..>43013
                     /locus_tag="C5L36_0E00250"
                     /db_xref="GeneID:40385815"
     mRNA            <42162..>43013
                     /locus_tag="C5L36_0E00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467572.1"
                     /db_xref="GeneID:40385815"
     CDS             42162..43013
                     /locus_tag="C5L36_0E00250"
                     /note="PKUD0E00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323432.1"
                     /db_xref="GeneID:40385815"
                     /translation="MVRLPILLDEEEDDDIIQAQPSLKAKFKPRKIKLKSSIESKDGA
                     NTARASINDEMPEREKEKNESDGGDVLENLALPQRRFKKLNKINSGLSFLDDNSCKNE
                     SKAKANKINTQEYLNSYKEHPEVPSQTVDTTLPLNDVSIENMEGIVLTGSDMDLSDVE
                     NDGLPSKLKQSSEDSKRRREIEKAIESANDPEETESNGRMEILKIPTYNEGSVPTYIR
                     FHRPPSLDETKENIQERINLLEVKVQQESKEIESFNHRREDLSRQRAKLVEKVHKLLQ
                     EYKPRNK"
     gene            <43324..>44319
                     /locus_tag="C5L36_0E00260"
                     /db_xref="GeneID:40385816"
     mRNA            <43324..>44319
                     /locus_tag="C5L36_0E00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467573.1"
                     /db_xref="GeneID:40385816"
     CDS             43324..44319
                     /locus_tag="C5L36_0E00260"
                     /inference="similar to AA sequence:RefSeq:NP_012447.1"
                     /note="PKUD0E00260; similar to Saccharomyces cerevisiae
                     YJL088W (ARG3); ancestral locus Anc_1.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323433.1"
                     /db_xref="GeneID:40385816"
                     /translation="MLNFSSTRLFSTAMTVSNKIRHLISISDLTTNEFKSLVNRAEYH
                     KQIIKTGKKPDVWPLQGELVAMLFTKRSTRTRISTEGAAAYFGGQPMFLGKEDIQLGV
                     NESFYDTTKVISSMTSCIFARVNSHSDIQELCEHSSVPIINSLCDRYHPLQAICDLLT
                     IKENFSDLKGLKLAWIGDSNNVINDLAIAAMKFGINVSIATPNGIEIEQHVIDAAKKV
                     TQETGATLELTHDAKKAATNANILVTDTFVSMGQESETAKKLKQFEGFQINSDLVSLA
                     DKDYKFMHCLPRHKEEVSDDVFYSANSIVFPEAENRLYAAIATIEAFVVNKGQFL"
     gene            <44533..>46887
                     /locus_tag="C5L36_0E00270"
                     /db_xref="GeneID:40385817"
     mRNA            <44533..>46887
                     /locus_tag="C5L36_0E00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467574.1"
                     /db_xref="GeneID:40385817"
     CDS             44533..46887
                     /locus_tag="C5L36_0E00270"
                     /inference="similar to AA sequence:RefSeq:NP_012196.1"
                     /note="PKUD0E00270; similar to Saccharomyces cerevisiae
                     YIL068C (SEC6); ancestral locus Anc_7.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323434.1"
                     /db_xref="GeneID:40385817"
                     /translation="MESHNLSRTIDKVSDLIKDESSLSNLEQLIADITKEKYSIDSQL
                     NIEQDRHLTRIQDMITEIHNASKNLQDLKYSVGKLEDLRRENVSNNSNHNFEIFDLAA
                     LVLKNIKGVEEVYSNISTFDEKEKVINQLLDEEYAKDEKQELQFSTGDNLLVAHYELN
                     RLRDLQDQMWVMEKNSKSPETKKLVHQLSNKLNVCISRFDGLLTIIIDSILDFVESEN
                     FGFLIKVVKIIQYEEREDLKVRLWDSLLEKRDTESIEKSVTNVRRLKERGYKNRFENI
                     MKQTIEDRFSEFLESKDISIFLGEEGTFYYQTLSDYKVAIDRCFPKEWKFFPKVLEWH
                     QESIKSVINKILEDNLSNSQLSEIIELDYENKQSLKKLFKIPNKDWKKFRLLAEDKKK
                     HLLDNSLQDNIKSTTKWIETALTKAVSKFESLDEEPPDRRDGRLSFQVAQEVMLILSS
                     NTKSIRTLGDASVLVQYYGFFANEIMRTYQECWVRSLDKMTELWNLSRSSQNSKNSQS
                     KNKKVQEEQNAIINENIGYLPRYITNLANDCLILTDALERDFDLITEGLNEIHTQKLI
                     DMKQTATNHSIELGTYCLQKLSLLAAQDFGPIMVDIFNKPWYNSPTLIDSVLNIIDEE
                     YIMPFIDYSYPELLMSLFDFITDEFLLKYLSALNYKRKFEKNIVSTLERDGYKIMEVL
                     GKHDDDGSLERKMIVFDLLIELCSADNNNEQDIIEKWTFGLSEIYDLPIDLLRVILEC
                     KKVDKSNITFILGECGELCKQSLLENSDQPASIFRKFHYASIGK"
     gene            complement(<47028..>47372)
                     /locus_tag="C5L36_0E00280"
                     /db_xref="GeneID:40385818"
     mRNA            complement(<47028..>47372)
                     /locus_tag="C5L36_0E00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467575.1"
                     /db_xref="GeneID:40385818"
     CDS             complement(47028..47372)
                     /locus_tag="C5L36_0E00280"
                     /inference="similar to AA sequence:RefSeq:NP_010994.3"
                     /note="PKUD0E00280; similar to Saccharomyces cerevisiae
                     YER071C (TDA2); ancestral locus Anc_7.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323435.1"
                     /db_xref="GeneID:40385818"
                     /translation="MPSSPTIIKNAINAEKMPLSEDEVASLISHEIEQSTAVNEIITK
                     LLNKISEKSSKFKAVVNASTIKFSELDSESNEIDTKFGSLWDTGKDGLYNLKFKLHDG
                     SYLLVTIVFIYI"
     gene            <47758..>48325
                     /locus_tag="C5L36_0E00290"
                     /db_xref="GeneID:40385819"
     mRNA            join(<47758..47785,47985..>48325)
                     /locus_tag="C5L36_0E00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467576.1"
                     /db_xref="GeneID:40385819"
     CDS             join(47758..47785,47985..48325)
                     /locus_tag="C5L36_0E00290"
                     /inference="similar to AA sequence:RefSeq:NP_010995.1"
                     /note="PKUD0E00290; similar to Saccharomyces cerevisiae
                     YER072W (VTC1); ancestral locus Anc_7.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323436.1"
                     /db_xref="GeneID:40385819"
                     /translation="MSSAPLLQTTPGKRIALPTRVEPKVFFANERTFLSWLNFTVILG
                     SLAIGLLNFGDKVGRISASLFTLLAMGTMVYALVTYHWRANAIRRRGSGPYDDRFGPT
                     MLCFFLLIAVIVNFVLRMRA"
     gene            <49155..>50122
                     /locus_tag="C5L36_0E00300"
                     /db_xref="GeneID:40385820"
     mRNA            join(<49155..49157,49718..>50122)
                     /locus_tag="C5L36_0E00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467577.1"
                     /db_xref="GeneID:40385820"
     CDS             join(49155..49157,49718..50122)
                     /locus_tag="C5L36_0E00300"
                     /inference="similar to AA sequence:RefSeq:NP_010997.3"
                     /note="PKUD0E00300; similar to Saccharomyces cerevisiae
                     YER074W (RPS24A) and YIL069C (RPS24B); ancestral locus
                     Anc_7.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323437.1"
                     /db_xref="GeneID:40385820"
                     /translation="MSDAITIRTRKVLSNALLARRQFVIDVIHPNRANVSKDELREQL
                     SALYKVEKDQVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPTYRLVRYGLATKVEK
                     AARQQRKQKKNRGKKIFGTERKAAKKAAKRAQD"
     gene            complement(<50328..>51662)
                     /locus_tag="C5L36_0E00310"
                     /db_xref="GeneID:40385821"
     mRNA            complement(join(<50328..51429,51607..>51662))
                     /locus_tag="C5L36_0E00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467578.1"
                     /db_xref="GeneID:40385821"
     CDS             complement(join(50328..51429,51607..51662))
                     /locus_tag="C5L36_0E00310"
                     /inference="similar to AA sequence:RefSeq:NP_011975.1"
                     /note="PKUD0E00310; similar to Saccharomyces cerevisiae
                     YHR107C (CDC12); ancestral locus Anc_5.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323438.1"
                     /db_xref="GeneID:40385821"
                     /translation="MADTAVMEPIGIANLPNQKYKLVSSEGATFTIMLAGESGLGKTT
                     FINTLFQTSLKNHQELRNRFNKPIKKTVEIDIIRAELEEKNFKLNLNVIDTPGFGDNV
                     DNKNSWNPIIEFIDDQHHSYMKQESQPKRLKINDLRVHACLYFIRPTGHTLKPLDIET
                     MKKLGTRVNLIPIISKADTLTPNEMLEFKKRIREIIEVQGIRIYSPPMELDDQAASEH
                     AKQLIESMPFSIIGSEEQFDINGTTVIGRKYPWGVVEVENDQHCDFRKLRSLLLRTNM
                     LDLILSTNEIHYEAFRSKMINSGDDYEDLKKSSDKLAEKITNNPQFLEEEKKLKRYFA
                     EQLRNEDQRFKQWKQNIYTEKNRLNHDLAQLQAQMKKLEEEVRVLQEKRSK"
     gene            <51882..>53087
                     /locus_tag="C5L36_0E00320"
                     /db_xref="GeneID:40385822"
     mRNA            <51882..>53087
                     /locus_tag="C5L36_0E00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467579.1"
                     /db_xref="GeneID:40385822"
     CDS             51882..53087
                     /locus_tag="C5L36_0E00320"
                     /inference="similar to AA sequence:RefSeq:NP_010641.3"
                     /note="PKUD0E00320; similar to Saccharomyces cerevisiae
                     YDR354W (TRP4); ancestral locus Anc_5.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323439.1"
                     /db_xref="GeneID:40385822"
                     /translation="MSPKCAYTYKMTNNKLKIPSSSLEEQQHYRQYPYTVINTMSKPL
                     TVYIKKLVVTPPELTLQDFAAALDCIFSGNANDVEISSFLTALRIHKLDFNADFIATA
                     VETILKYSEKIPDDQVDSDGYVDIVGTGGDSQNTFNVSSSAAIVAAGMGVNVCKHGGK
                     ASTSASGSGDLMNQLGVELMKVTSKSAPLIVKESKLCFLFAPAFHHGMGQVVNVRKQL
                     GIPTIFNILGPLLNPINIKARILGVYTKELGRTYCEAAVKIDRANGKRANTMVVCGEV
                     GLDEISPIGRTNVWYYNKEADKIEEFTLTPEDFGLPEHSLDLVRSGTPIENAVVLKEI
                     LKMNKEQVQPGINPLVDYIFMNAGALAVVSGLAQDWKHGVELAREAVYSGKAQTALDE
                     FISSIYKYT"
     gene            <53286..>56558
                     /locus_tag="C5L36_0E00330"
                     /db_xref="GeneID:40385823"
     mRNA            <53286..>56558
                     /locus_tag="C5L36_0E00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467580.1"
                     /db_xref="GeneID:40385823"
     CDS             53286..56558
                     /locus_tag="C5L36_0E00330"
                     /inference="similar to AA sequence:RefSeq:NP_010643.3"
                     /note="PKUD0E00330; similar to Saccharomyces cerevisiae
                     YDR356W (SPC110); ancestral locus Anc_5.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323440.1"
                     /db_xref="GeneID:40385823"
                     /translation="MSDNENQKNSTSPEFTPIGSKSGGVAENTMHTFSNMTPILKFTD
                     RNTQTDTNANANFGRNFDLKGRYSSAESSRKPNSTSFTLRRSQARLSRNDDYDDILQS
                     SSVASSIWEDELNERERADNPNNDPFSRRSADSANMEVPILNGKEKIRDDMIGDDSNM
                     LKRQFDLLTKLQSENTNLKVEIVSLRQHLSGLPSDSATLIDENISLNKRIVQLENLLR
                     DNGNEARDDLKSKVREYSERLDSLHRDYDNVLKEKEQLIHDSFNKETELKKLQKSYDE
                     LQDDYEKVVHLQGTVEKLDAENQELQDRLDDQMEKYSKLQNEHDQISHSHELSKLNSE
                     IDRLEDANLELQRELDKVSQEKENLETRYENLKGEIEQHDLDNEKVTHSPSPNNSFVI
                     TDMQAEIDALKDRLSAAETEKRTLQQKYDRDIRLSYHSSREKVEDMTKRLEESLKTID
                     GLDEQLSDKENENLTLHQEIKQLNLQIESLQRKNKLLNDQLNHLKDNNSDSTKLLTKE
                     VGDLYDKIEDYETVVQKLKSRIKDLEDSSLENRAEYLRDLEDDKNQLYESLVETEKII
                     KEKDSEIASLKLQLSSTENKEREEYVKVDDLIKVKEHVERERLEHENEINTLVEESRK
                     KIESLIDEIEKLEDSKDKLIETYEDLRNEYENLQTKYEELVNSAEVEELSNDLAKITI
                     EYKRSQDENDQLIKEYSSEVEILNEQLKLKDYDISRLRDELQNKHPLNTESINTKLNS
                     LEETIRNITDKKEEIEKLKIALEDENLLLKNENNRLKTKENKVAENLKEFEEDNNRLL
                     AEMKSKKVEIEQLNREILQLSSRNRQLERLNGRLTNEQDEILIETSKASNTVSQRDTD
                     NSMKLREYELKLQEKTNQYNNIVEEYNYMKNDLIERLKDMKKEIKSQGQNSQEEIRQW
                     KDRYEKTNEKLKVSERHLDILKKELKAVNEELENERERDLGRMDEPWYPPTPESPSRE
                     IDETMLNKLKILKLQKDMLMIKLNERNEKVSDLKYMLGYLRLEVEKKNEMIKRNKGLL
                     QTVGVKEDDATIRDPVRKLRVYFLTVLSGIRFKNRLNEIKKRNQQVLRLKSDIKLSKR
                     NV"
     gene            complement(<56602..>56940)
                     /locus_tag="C5L36_0E00340"
                     /db_xref="GeneID:40385824"
     mRNA            complement(<56602..>56940)
                     /locus_tag="C5L36_0E00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467581.1"
                     /db_xref="GeneID:40385824"
     CDS             complement(56602..56940)
                     /locus_tag="C5L36_0E00340"
                     /inference="similar to AA sequence:RefSeq:NP_010644.1"
                     /note="PKUD0E00340; similar to Saccharomyces cerevisiae
                     YDR357C (CNL1); ancestral locus Anc_5.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323441.1"
                     /db_xref="GeneID:40385824"
                     /translation="MADSEDAVNDTNINDSDPLDVKSLAANYDNLINTINKETDILAA
                     QVSRHVYERKQISDTEIYKISERLIQMDNLLSRCNDINDNIDKLDQLRVFTIDFNTRL
                     NSLISQLKTK"
     gene            complement(<57448..>58449)
                     /locus_tag="C5L36_0E00350"
                     /db_xref="GeneID:40385825"
     mRNA            complement(<57448..>58449)
                     /locus_tag="C5L36_0E00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467582.1"
                     /db_xref="GeneID:40385825"
     CDS             complement(57448..58449)
                     /locus_tag="C5L36_0E00350"
                     /inference="similar to AA sequence:RefSeq:NP_009524.1"
                     /note="PKUD0E00350; similar to Saccharomyces cerevisiae
                     YBL029W; ancestral locus Anc_3.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323442.1"
                     /db_xref="GeneID:40385825"
                     /translation="MIWTMDFIEPLIHTDFEQDPATLIYSTPIDPNIQLSPSDLDDIQ
                     KPAWQSLDLDLPLNTDETTQIDTSGPYLDGWSYPAPLANPIPAIEKMELPTSTLKPWD
                     LHLSINNDHSTSQLNTIDIDKIRPSSSSFISNSTSTIESPILKSQAFSIFNDNLRNLS
                     FGYTYNYNDTNNDNNDNNIISTTISTVATINDISPPTSIDDTDDFEDHEILNNLTPNT
                     KTGKKISDSRLSLAQLSVVLNLKGNDEETAKREKNILNILKNDLHFPIGEKTWIRDTP
                     INERHRILNELTDLVENRFHYGYSKKILSIIVRRASYYMMQGRLRRQRRLQRKLKKT"
     gene            <60114..>62378
                     /locus_tag="C5L36_0E00360"
                     /db_xref="GeneID:40385826"
     mRNA            <60114..>62378
                     /locus_tag="C5L36_0E00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467583.1"
                     /db_xref="GeneID:40385826"
     CDS             60114..62378
                     /locus_tag="C5L36_0E00360"
                     /inference="similar to AA sequence:RefSeq:NP_013619.1"
                     /note="PKUD0E00360; similar to Saccharomyces cerevisiae
                     YML091C (RPM2); ancestral locus Anc_8.865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323443.1"
                     /db_xref="GeneID:40385826"
                     /translation="MRPLRNISTKTSKKAPFSFSRNVSSHQNQQYAPQFFNPSYISPK
                     ELARLDEVGFKHNSSSSNKKSSKSIFQYVTPALSVTKNYVIFDTSNNTNKDNSGLNQN
                     LLSSSKQIPNYALNEEFERILLKKSNHISNKNSHVNISIGSISNNHTTLNIRRVNSNN
                     IKQVSIPNKLLRRAFSSSPQNSNSSSSSKSNSDSIHDLESKLSKLKIRNLDSSNNKYI
                     EEFKKFPNIDDAFDHMSENPLKIQEFTIDNLMNQNKFNEVLPVFNRMRNNGLVPTLPI
                     YNKVLKSIPLRQTNESLENNMTHLLNIYSDLLSNNIKPNMETYEIVIGSLVNSSLISY
                     SQLNYRNGFEFFKISLELFLINIDSKDFEFHNNLIYVNLIKCLNYYQIKDAISPMDLL
                     NKLESRISDDNKLEFYLQLTKLSAIFKDEELVESIFNNQIKPLKLLSNHDEIYQTLIQ
                     SYNLCNNFKKSSLLLDTIINNLPNKESAESQDLIRDYLSVFIRSQSLINPSDAFKMVH
                     QFSKIDWLPKLSIESLTTLAYSFLKLGDLQMTLKIWDFMVIRNDFINEFNKYNNNEFQ
                     ILISNFSNHFFEKILFTNNKNLILKVVREFLGKNCLKFDDNLLVNYLRYLQNLNSQES
                     DDLIIKLILNQGYKKILETNYNTNSSVDSKDSLSNYLSLIVDFIPNTITLKIFNSKLF
                     KRIVEEYRLTRDNIYGIMKVFNVVFNNPNDEFDNLLKYYSKVLDLEFNDTENCYVEIP
                     VEIENFKHQLQQYK"
     gene            <62906..>63612
                     /locus_tag="C5L36_0E00370"
                     /db_xref="GeneID:40385827"
     mRNA            join(<62906..62909,63296..>63612)
                     /locus_tag="C5L36_0E00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467584.1"
                     /db_xref="GeneID:40385827"
     CDS             join(62906..62909,63296..63612)
                     /locus_tag="C5L36_0E00370"
                     /inference="similar to AA sequence:RefSeq:NP_012010.1"
                     /note="PKUD0E00370; similar to Saccharomyces cerevisiae
                     YHR141C (RPL42B) and YNL162W (RPL42A); ancestral locus
                     Anc_2.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323444.1"
                     /db_xref="GeneID:40385827"
                     /translation="MVNVPKTRKTYCKGKQCKKHTQHRVTQYKAGKASLYSQGKRRYD
                     RKQSGYGGQTKPVFHKKAKTTKKVVLRLECVACKTKLQLSLKRCKHFELGGDKKQKGA
                     ALQF"
     gene            <63902..>66112
                     /locus_tag="C5L36_0E00380"
                     /db_xref="GeneID:40385828"
     mRNA            <63902..>66112
                     /locus_tag="C5L36_0E00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467585.1"
                     /db_xref="GeneID:40385828"
     CDS             63902..66112
                     /locus_tag="C5L36_0E00380"
                     /inference="similar to AA sequence:RefSeq:NP_014238.3"
                     /note="PKUD0E00380; similar to Saccharomyces cerevisiae
                     YNL161W (CBK1); ancestral locus Anc_2.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323445.1"
                     /db_xref="GeneID:40385828"
                     /translation="MESGEDNDYSMMDQSMVDQTQDNLLYYQQQQYQQQEQQYQQQQK
                     QLQQQQQQQQQQQQQLQQLSDVNLIQPINAFSSSYLRQQGSSPNLSQIAPPNYGNGIP
                     VMTPPNSRGVNYQQPQNQHQQQQTSSLYGSSPTTRLGEMFSQPQPPVSPTKSVRSSNL
                     TTVSTNSSFESPQKVNQSNLGNLSRMGSQQNLLLRTPLNQQQQQQQQQQQYQQQLRQQ
                     QQLKQQQSTPQQPTMKQSRPLQSQQESEKSENQYVYFERHPEWFSKQSQDRASAVKLT
                     LEHFYKTAIEHAIERNQRRIAFEQQLSTEISSERRNRETQLFGKNESQYLRLRRTRLS
                     LDDFNTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAD
                     ANSPWVVSLYYSFQDQLYLYLIMEFLPGGDLMTMLIKWQIFTEDVTRFYIAECVLAIE
                     AVHKLGFIHRDIKPDNILIDMRGHIKLSDFGLSTGFHKTHDSNYYKKLLQRETNNGSL
                     NGNSTMKSQSNQRNSVLVDPINLTMSNRQQMQTWRKSRRLMAYSTVGTPDYIAPEIFL
                     NQGYGQECDWWSLGAIMFECLVGWPPFCSETPSETYRKIINWQETLQFPEDIHLSPEA
                     EDLILRLLTNAENRLGRHNGAMDIKRHPFFRGVNWDEIRNVEAPFIPKLRSVTDTRFF
                     PTDDLENVPDSPALLQAEKDRELLKNKGLDTKADLPFIGYTFSRFEYLTRKNAL"
     gene            complement(<66329..>67327)
                     /locus_tag="C5L36_0E00390"
                     /db_xref="GeneID:40385829"
     mRNA            complement(<66329..>67327)
                     /locus_tag="C5L36_0E00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467586.1"
                     /db_xref="GeneID:40385829"
     CDS             complement(66329..67327)
                     /locus_tag="C5L36_0E00390"
                     /note="PKUD0E00390; Pfam Domains: Aldo_ket_red(1.4e-56)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323446.1"
                     /db_xref="GeneID:40385829"
                     /translation="MTKRTITLPRTNDEIPIIGFGSGTKWQWKKKGSEETAISKDNPS
                     NTDPDLVASIVQALETGFTHLDTAEFYTTRPDVGKGVNDYLAKYPNKSRSDIWVTDKY
                     NSVTPNDYDNGPLDGKIRGPYQSLKEGLKLMNLDYVDLFLLHTTGVPEGLTMVDVWNE
                     MIQLQKEGLAKNIGTSNFDIPNLQVIKDNCEVLPQVNQIEFHPYLQDQSVGIRKFCKE
                     NNIQIEAYGPLIPITKCNEGPLIPLLDELAQKYDVSNSKILLKWVHMQNIVTVTTSSK
                     VERMKDVLSVHDFQLSEEDFSKISEVGNTYFFRAFPIPPLPTHDEQLKEIRNVINK"
     gene            <67743..>68942
                     /locus_tag="C5L36_0E00400"
                     /db_xref="GeneID:40385830"
     mRNA            <67743..>68942
                     /locus_tag="C5L36_0E00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467587.1"
                     /db_xref="GeneID:40385830"
     CDS             67743..68942
                     /locus_tag="C5L36_0E00400"
                     /inference="similar to AA sequence:RefSeq:NP_011521.1"
                     /note="PKUD0E00400; similar to Saccharomyces cerevisiae
                     YGR007W (ECT1); ancestral locus Anc_4.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323447.1"
                     /db_xref="GeneID:40385830"
                     /translation="MTSSNNSSGAVTNALDERRIWIDGCFDFAHHGHAGAMRQARQHG
                     DELYVGVHNDEDILLNKGPPVMNLSERMAAVEGCRWCTKAIPNAPYVTDPKVMDKFKC
                     KYVVHGDDITTDKDGKDCYAEVKEMGRFIVVKRTPNISTTDLVGRMLLFTRDHHMLTI
                     DETQWNDWFTGNHSRLNDKKNILTPNNVERYEQYATGPDAKSLGVSVHAFTREGKLHE
                     LVKGLPIDGANKIIYVDGGFDLFNPGHILFLKEVRQIANERKAIVLVGLHDDETVNQI
                     KGVNYPIMNLFERSLCVLQSKYIDGIVLGSPFKVTREYLRNIEETTKSSVINIFHGPR
                     SIDDESYDDVKELVEFVNVQMYKDMNVASIVNRVIANREAFEERQRRKGWKAEKEKEL
                     EEIERSG"
     gene            <69322..>70191
                     /locus_tag="C5L36_0E00410"
                     /db_xref="GeneID:40385831"
     mRNA            <69322..>70191
                     /locus_tag="C5L36_0E00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467588.1"
                     /db_xref="GeneID:40385831"
     CDS             69322..70191
                     /locus_tag="C5L36_0E00410"
                     /inference="similar to AA sequence:RefSeq:NP_011282.1"
                     /note="PKUD0E00410; similar to Saccharomyces cerevisiae
                     YGL232W (TAN1); ancestral locus Anc_3.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323448.1"
                     /db_xref="GeneID:40385831"
                     /translation="MAKRKGGSNAGKDKKRQRSYTLIEPGTYGLYATCPKFKEVAAAK
                     EMRLILQDAIDKYYPEEKDTTAVRCEGNEKGGEAEVGVCEEVDIEDEIAKEIKEIKKN
                     DDKAKHNRNNKELRMREIPIGVESLVFFKLRQPIKPSEIVVKMCNDLYESKAKMGRFI
                     QRIVAIDRSCNATENEFKKLLEASVDRYVHDEMQEGKDLFESYNVNLVKRNFDTISRD
                     EFMEMIQGEMDTQFGEGTTQLRYKGARTLINVYCFKNNIGIGIVKNKDFERLCKFNVQ
                     QIFEKVMKEEDAA"
     gene            complement(<71127..>73424)
                     /locus_tag="C5L36_0E00420"
                     /db_xref="GeneID:40385832"
     mRNA            complement(<71127..>73424)
                     /locus_tag="C5L36_0E00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467589.1"
                     /db_xref="GeneID:40385832"
     CDS             complement(71127..73424)
                     /locus_tag="C5L36_0E00420"
                     /note="PKUD0E00420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323449.1"
                     /db_xref="GeneID:40385832"
                     /translation="MHRHSTPHIYTSNAPGSGMAMNMNNMNNMNNMNNMNNMNNMNNM
                     NNMNNMNNMNNMNNMNNMNGINGINRMNNMNTINSMNSMNRELDIDMASPPASENTPS
                     KTQSPVVWTSSYAFDESPQPQLKTRSSRFFPSPQMDSTSRDVAYSPSVFNNRRFSPVS
                     RHNSMLSFDPILPSPNSKTKTTTTTTTKTTTSTITATTTNSNPNLNPNTNTNTNTNTS
                     MNANTNTNINVTATPTYSNYYNVLNSQHIPSSHSLQLQPNNTNYSSYSSTPLNNNINN
                     LNNLNNMNNPNNTTFQQLPNLSSLNLINSNFPILNPLRSSFDLDDSNLELNDLSDFND
                     LSFLLDSHSPSPCPSPSTKKSKNLKPPKVSPIKLSNSTPSKEIIPDSKQIHLTQSPPL
                     LQNQHQHQLPASSPLASPLPSPISSSSTSPASSPIPSPSLPPANLFDDTPPSRSSYNT
                     NSRISHFVNHIITKHDLIYRSFGVTIDPVLPHLTDAILHTVFSPFGHIESVSETLSVT
                     SSSSSLSTSKSTIASSEFKLVMSMSQSQLTAINLNDRKLKLHYTDRSNKQIEITLSIK
                     LLNESKTLSDLLALEQIKENSLTPNESFISNSTFSLSNQLIKNNKLDVSWYPEGFSST
                     FHRRGINNFMFVRELQSKMIINKTRISNGSLIELGEFRISLPIDEMTTSSSSLANEAQ
                     SSKKSYLVNIDLRDLDGKSIQSDSIQTLNKQKFQKRLSVTSPTSTSSPTSSNSHSHTS
                     YTSRGRYKKRPSRGRQRTSRTVHTS"
     gene            <75627..>77375
                     /locus_tag="C5L36_0E00430"
                     /db_xref="GeneID:40385833"
     mRNA            <75627..>77375
                     /locus_tag="C5L36_0E00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467590.1"
                     /db_xref="GeneID:40385833"
     CDS             75627..77375
                     /locus_tag="C5L36_0E00430"
                     /note="PKUD0E00430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323450.1"
                     /db_xref="GeneID:40385833"
                     /translation="MNFVRDMNLLNYASRVSNIVDSLDMETKGIHRYLPSERTCSSSL
                     KPYISTLGVWIAGCAGLTSMSSFFLGPLLFGLGYSDTLLYGILGQLIGSLVAAYCSIM
                     GPPSGLRQICSSRYLFGPHFVKVVALVSIIGGLGWSITNNVLGGEILSRLSSNGSLNN
                     GLPLSVGVVIVAVITLLVAIFGIKWILLFEAFMGICFLVVILLLYILSSDKYTLYKHL
                     QTSPSENHLTKVGNRISFFTLAYSTTNTWGTCTSDYYIVFPENVSKIGIFLFTFVAIS
                     IPTLFSTIVGMLIGNAAVGDNLWNSIYNEESLGGLLNVVFSKWGKFGKFLLVVLWFSL
                     ITNNILNTYSAALNAQLLDTRIYRYIPRWLIVIVIFAITLVCSLLGKDHFSSILSNFL
                     PMLGYWVSIYFILLLEENTFFRSTRLVKLFKGELYGVPLPFPTASSTSSINDCNDTSD
                     GLENRSLVDGSLEKNTNVASSKDTSDIESQCPPNDTHSGNSIPPLATVPSKPFYNFDA
                     WNNPHILTNGYAAAFAFCCGVAGAIVGMNQVYYAGPIARKVGDDYADLGTFLALAFAG
                     VSYPLARFLELYYLGK"
     gene            <77746..>80553
                     /locus_tag="C5L36_0E00440"
                     /db_xref="GeneID:40385834"
     mRNA            <77746..>80553
                     /locus_tag="C5L36_0E00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467591.1"
                     /db_xref="GeneID:40385834"
     CDS             77746..80553
                     /locus_tag="C5L36_0E00440"
                     /inference="similar to AA sequence:RefSeq:NP_012632.2"
                     /note="PKUD0E00440; similar to Saccharomyces cerevisiae
                     YJR098C; ancestral locus Anc_1.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323451.1"
                     /db_xref="GeneID:40385834"
                     /translation="MALVCYRKDPVFPPFLFFQLGVLYVQIANPVPSSVLSFFPRVYP
                     TMPLQDPDVDHMADGLANTSLGSGNSNDSDDRSVQSYQPSIESSDLRGTREDDEDNDN
                     DQEYKQDHPRNTRRISIQDATSIIGGSDIKRTLSRSTAQGHQHGKFSDHNGIPKTHSQ
                     EESNKASTSPNASVSTSASASANYNDNGNDNDNDFTSAINPDTSHGEEETYSNMKERE
                     STKRVFNFSMLFSSEADTIEPELNLIRRQKFAIQNHLSNLHHQINGRHDTFPHVSKTI
                     RRITKYLPFKSSHSSGSKIIKKAAYPKAPLPPSNVKVYWEDIQNDRCFETHEHIRSKL
                     ERQESLSTIEEAKYYRDTDHYDDGKMKALRDSIINNAVPMQLTKSIGHKFSSLTSPTT
                     TNNQVMESNQIPQPQERTQLSLSKSNTINSSILDDNSKLLSSRAMSPAHNNSLLKDSD
                     PEMEIYDQLDGDVLVLGGYRGSILRDSHTHQRAWIPVIKAGLNIRKINLQIGPHEEDE
                     LNELNSRQVIENHILDPSDPRYPKVYPDGMLTHIGPVDISKKLIKRLNLNPRVHARDW
                     GYDWRLSPELTARQLHDEIEQIVENQKDGDKKGVILIAHSMGGIVAHGAMVLNPKLVR
                     GIIYAGTPMPCCNVLGPLRFSDSILLNKEILSNEVNFFIRSSFVFLPPSWGGEDEDGK
                     NGGMCLFRDLETGKRIKVDFWDPWNWVEFNLNPLVSSVRLKNDVKHGIIKVNEIKDLQ
                     LRQEIDQMLKKIKIDPETELIVQDEISKLSHPTVSWIDSYTYLKRTLSKTKKFLKSFE
                     RDPSIKYPPLAQVFSNSVPSIKYSLVNGLESIKRGEYYRFFYGPGDGIVYSGWTFPRD
                     INRHRLSGEDKPYQDGVDPIPDVPNWRAREYGYGEKYAFDLCGRFKGTCGHIGLLADL
                     KLVGQALKAIRDEELKRSQTI"
     gene            complement(<80731..>81234)
                     /locus_tag="C5L36_0E00450"
                     /db_xref="GeneID:40385835"
     mRNA            complement(<80731..>81234)
                     /locus_tag="C5L36_0E00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467592.1"
                     /db_xref="GeneID:40385835"
     CDS             complement(80731..81234)
                     /locus_tag="C5L36_0E00450"
                     /inference="similar to AA sequence:RefSeq:NP_012631.3"
                     /note="PKUD0E00450; similar to Saccharomyces cerevisiae
                     YJR097W (JJJ3); ancestral locus Anc_1.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323452.1"
                     /db_xref="GeneID:40385835"
                     /translation="MTLHANHVSFYEILGVSKDAERDSIKTAYHRLLLTNHPDKSNPN
                     ANTYSIPVIQQAYRTLINDDERIAYDKQLHDYYIKLGLVDSMGIDTDGIDHFDLSEFV
                     EDGERFVHDCPRCQCHEGFQVGEQDLENGVFENNKDNEEDEHGTYRILLQCSSCSLWL
                     CVDYSIQ"
     gene            <81531..>82838
                     /locus_tag="C5L36_0E00460"
                     /db_xref="GeneID:40385836"
     mRNA            <81531..>82838
                     /locus_tag="C5L36_0E00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467593.1"
                     /db_xref="GeneID:40385836"
     CDS             81531..82838
                     /locus_tag="C5L36_0E00460"
                     /inference="similar to AA sequence:RefSeq:NP_014151.1"
                     /note="PKUD0E00460; similar to Saccharomyces cerevisiae
                     YNL248C (RPA49); ancestral locus Anc_1.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323453.1"
                     /db_xref="GeneID:40385836"
                     /translation="MGKHSKESIPVVAEPGDAVIASFTNSGTISNDVTFDVFAAKGKK
                     MILHGESKNDELQYDAEELDDSQYLIGIYDSSNKKIKLVPSSKMFSGRVQSNSSLIND
                     AKLVKKLKRKDLSEEGTFVERRNALGEEFGTKKAKKAINDAARNRIDAAMLEDSQLDI
                     VDGIRESTKSIPDRNEMAKMVEKENRVIPKFHEDATNVEDIYPIEEIVPDDILSVFPV
                     DIFFKPIESDEDSDDKKDELLTKLEYLPYVPGKDRGLAHQKKSIFGRLIKSLLSESSN
                     GNINEDLRWKAQLVSFTSMLIGLYFNRRLSKREKLIESFTNLPPARGINYMLALFGDS
                     KRNNFNYDRDIKFYTIGPKEEDKLLCHIIVLLLKLFDYRLELSSLAADLSLKPSRLLT
                     LVRTLGCTVVVANKGDGKENAGSKFATLKVPFKVPEIARRFRR"
     gene            complement(<83271..>85172)
                     /locus_tag="C5L36_0E00470"
                     /db_xref="GeneID:40385837"
     mRNA            complement(<83271..>85172)
                     /locus_tag="C5L36_0E00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467594.1"
                     /db_xref="GeneID:40385837"
     CDS             complement(83271..85172)
                     /locus_tag="C5L36_0E00470"
                     /inference="similar to AA sequence:RefSeq:NP_009987.2"
                     /note="PKUD0E00470; similar to Saccharomyces cerevisiae
                     YCR061W; ancestral locus Anc_6.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323454.1"
                     /db_xref="GeneID:40385837"
                     /translation="MKTLHIISSILALATVANAHTHSQEQEQDMQPSRLIPQNVTQTP
                     EPWGHHHLHGVPILDTELSPQQKLYWEAYNTTTYLTLESSHQHLLFSHISLLLLSCFL
                     IYPLLLVFNNINSSYLLPLNYVNVLITTLACILYSVYINNVPELFPNMAYSKLVTGLL
                     FFSIIQTALTTLYSLSKYLSHSNYSKLPGLNIHLDDLNSPNPNSSSPASTLYEDDGDE
                     DARELVDANGNGLNFDINNEDDMDAHFHSSIKTPIVQSPPSTSTQNLLIKKLSSYNSI
                     SSFATTFSSLFNILHNISVWGLLVYYFVMLPTGVACLNLMGQSTRIFNLLAHFIKGEV
                     FIIIGIISLARYCGCFAGIGGAWNTAFVDFNHHQDLINPPSNSGIQGVGSGGHNIMNS
                     TFIKLHKLVYGAKNSGLICSFEGIESFLIFFYGSTNIFLEHLASKDGVWTAKDLQHVS
                     IAFMYLGAGLCGLIAEHKLSDWRRSLYSKLTKQSTLNNDASHKLVTPGFSPNPFPVFT
                     IFWTGLLMSKHAQASQLSTDIHVQWGSLLTYGSFFRVFTFLLMSYSPFKESIQCYLPS
                     KPLTELITSFCLICGGLVFMESTDQVIEALAYRGLTPMFTINVSVGVVSLFMAWIMVL
                     FAIKDRLKN"
     gene            complement(<85709..>86368)
                     /locus_tag="C5L36_0E00480"
                     /db_xref="GeneID:40385838"
     mRNA            complement(<85709..>86368)
                     /locus_tag="C5L36_0E00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467595.1"
                     /db_xref="GeneID:40385838"
     CDS             complement(85709..86368)
                     /locus_tag="C5L36_0E00480"
                     /inference="similar to AA sequence:RefSeq:NP_014042.1"
                     /note="PKUD0E00480; similar to Saccharomyces cerevisiae
                     YMR311C (GLC8); ancestral locus Anc_5.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323455.1"
                     /db_xref="GeneID:40385838"
                     /translation="MGKGILKNAIADASYRKESPNELAGETSFDRKAVIANTLLNAQA
                     GKARPAGTAFTTREKHDQEHLSEEQLKWDEKNLIINELGKSATMKIDEPKTPYEGGFD
                     PNNDYYREDNEEEKGEAIDEDDGFVLGEGEDDADDVENGDIEKVDSGSEESQEESASY
                     LPDAASKHSKFEEMRRRHYHMKALPLKKKVFVEEEGEEQDNSNNHNDIQDNDRDNRNV
                     D"
     gene            complement(<86727..>87671)
                     /locus_tag="C5L36_0E00490"
                     /db_xref="GeneID:40385839"
     mRNA            complement(<86727..>87671)
                     /locus_tag="C5L36_0E00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467596.1"
                     /db_xref="GeneID:40385839"
     CDS             complement(86727..87671)
                     /locus_tag="C5L36_0E00490"
                     /inference="similar to AA sequence:RefSeq:NP_011799.3"
                     /note="PKUD0E00490; similar to Saccharomyces cerevisiae
                     YGR283C (YGR283C) and YMR310C (YMR310C); ancestral locus
                     Anc_5.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323456.1"
                     /db_xref="GeneID:40385839"
                     /translation="MSVSLAFDGERLSRENPSLEKLTYAIHLIARHAAQRKINEIIII
                     GDPNDPCIVSIGALFQFFVTPRYLVRESLSQVLKKQHVPAKIFSKAKTLPPVPTLVTY
                     LNSHADKSSPYREGLSIWKKARGHKSASGKVHKASKSARTTRYVLVGEREVVEVKDPL
                     PLHVRVSVDMKTKNVVSGRDAYGYIGYTVRIASNVESVFTESSIEYTHGVYVPSRGVF
                     SKPDSGNDNNYDNGNGNDHDNNHDHDHDHDHDHDKETLALQPLPKYVSLVNKDQKQAL
                     VVIVSNRTSLRELCDSELVVAEPPLRMDDALVLTVAKV"
     gene            <88254..>89204
                     /locus_tag="C5L36_0E00500"
                     /db_xref="GeneID:40385840"
     mRNA            <88254..>89204
                     /locus_tag="C5L36_0E00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467597.1"
                     /db_xref="GeneID:40385840"
     CDS             88254..89204
                     /locus_tag="C5L36_0E00500"
                     /inference="similar to AA sequence:RefSeq:NP_012409.1"
                     /note="PKUD0E00500; similar to Saccharomyces cerevisiae
                     YJL126W (NIT2); ancestral locus Anc_1.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323457.1"
                     /db_xref="GeneID:40385840"
                     /translation="MTVIAIGQMCSSSNLLNNGIVASRLAKEAAQKGAHMLFLPEASD
                     YIASNAAHSKSLVQPVTRSPFLLELRSTLRDLNAAGTPLEVLVGVHEPSENMVEDPRT
                     KNTLLHLNNNGEIVHRYQKLHLFDVDIKNGPILKESNSVQPGSKIQPPFPTPAGILGV
                     GICYDMRFPELSLKLRSQGAQLLTFPSAWTMKTGPHFHALGRATAIFTQCYVVLPAQE
                     GEHITDAETTTTTTSNTTLDENVNGNPDSNVTAHQRTVLQKRESYGHSAVFDPLGNLV
                     TEIRHGEGIALAEIDLRLVETTRENMPLITHRRRDIFGDV"
     gene            <89319..>89705
                     /locus_tag="C5L36_0E00505"
                     /db_xref="GeneID:40385841"
     mRNA            <89319..>89705
                     /locus_tag="C5L36_0E00505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467598.1"
                     /db_xref="GeneID:40385841"
     CDS             89319..89705
                     /locus_tag="C5L36_0E00505"
                     /inference="similar to AA sequence:RefSeq:NP_012975.3"
                     /note="PKUD0E00505; similar to Saccharomyces cerevisiae
                     YKR049C (FMP46); ancestral locus Anc_1.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323458.1"
                     /db_xref="GeneID:40385841"
                     /translation="MFRTVQSTRGAITLFHNPACKRSVSLLEKLRSAQTNTSSSEYKY
                     SIDVSTTKPTSDQFNYIKQSVNLSPLSKSAFQEAFPDTRTLSTTEIENFNNSDNFVPP
                     LVVDWDNKLLATNTSGLEKILQKHNN"
     gene            complement(<89954..>91174)
                     /locus_tag="C5L36_0E00510"
                     /db_xref="GeneID:40385842"
     mRNA            complement(<89954..>91174)
                     /locus_tag="C5L36_0E00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467599.1"
                     /db_xref="GeneID:40385842"
     CDS             complement(89954..91174)
                     /locus_tag="C5L36_0E00510"
                     /inference="similar to AA sequence:RefSeq:NP_012412.1"
                     /note="PKUD0E00510; similar to Saccharomyces cerevisiae
                     YJL123C (MTC1); ancestral locus Anc_1.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323459.1"
                     /db_xref="GeneID:40385842"
                     /translation="MATDEKEIFEFLDSLPTEGAEGSSAVVVEKGNGDDEILEFLDEI
                     EGKTKKESTETKEKPKNEPKEEPREEVSDESKETGAKGEAEEATGKTPTSDAAEVADP
                     ITSIASWWNKSGSTRVSQGITSLWGTAQSIGEQAEEKLKKAREQDLASTLKDLGIGEM
                     GEMLDEDQISELKKLSKVDASKAIGTLNEGFSKGLSFFGGTLNEVIERIQTVQEKDES
                     IEVLLVHDFQNFGWLGDVVRDSLEEVMSEQVDGNIEVRVIERGAKIDGNVDFFSMFHG
                     SNVDAEKLINANIEKDIAREKTGKTQIVMSLLAWTTNDGKGSGEVEGDITIESDTSDS
                     FTIMLLLKDGVHDITIRGNSQPLPLKWAHWMEEKRGEDEIDPSEWVIEWIRKSIVNAI
                     GVVCQSYVIRRMGY"
     gene            <91434..>91745
                     /locus_tag="C5L36_0E00520"
                     /db_xref="GeneID:40385843"
     mRNA            <91434..>91745
                     /locus_tag="C5L36_0E00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467600.1"
                     /db_xref="GeneID:40385843"
     CDS             91434..91745
                     /locus_tag="C5L36_0E00520"
                     /inference="similar to AA sequence:RefSeq:NP_031358.1"
                     /note="PKUD0E00520; similar to Saccharomyces cerevisiae
                     YBL059C-A (CMC2); ancestral locus Anc_7.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323460.1"
                     /db_xref="GeneID:40385843"
                     /translation="MHPILDKNRFQNCEDLIDALEECHKSPYLETMMGKCSDIKVQLA
                     ACIHENRLAHDREKILQRREANKKLEMNKKKREEEEWGENGYLKKVVELELKNREKES
                     K"
     gene            complement(<91947..>92564)
                     /locus_tag="C5L36_0E00530"
                     /db_xref="GeneID:40385844"
     mRNA            complement(<91947..>92564)
                     /locus_tag="C5L36_0E00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467601.1"
                     /db_xref="GeneID:40385844"
     CDS             complement(91947..92564)
                     /locus_tag="C5L36_0E00530"
                     /inference="similar to AA sequence:RefSeq:NP_011020.3"
                     /note="PKUD0E00530; similar to Saccharomyces cerevisiae
                     YER094C (PUP3); ancestral locus Anc_7.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323461.1"
                     /db_xref="GeneID:40385844"
                     /translation="MSDPFSVNGGTAVAMVGKDCIAIASDMRLGSQSLGVSNNFEKIF
                     NYDNVFFALTGLASDVITVHEDFRKKTNMYKMREGRNIEPETFANLVSSSLYERRFGP
                     WFVGPIVAGLNSKSGKPFICGFDSIGCIDFAKDFIVSGTASDQLFGMCESLYEPDLEP
                     EDLFECISQSLLNAADRDALSGWGAVVYIVTKDKIIKRYLKSRQD"
     gene            <92826..>93995
                     /locus_tag="C5L36_0E00540"
                     /db_xref="GeneID:40385845"
     mRNA            <92826..>93995
                     /locus_tag="C5L36_0E00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467602.1"
                     /db_xref="GeneID:40385845"
     CDS             92826..93995
                     /locus_tag="C5L36_0E00540"
                     /inference="similar to AA sequence:RefSeq:NP_011021.3"
                     /note="PKUD0E00540; similar to Saccharomyces cerevisiae
                     YER095W (RAD51); ancestral locus Anc_7.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323462.1"
                     /db_xref="GeneID:40385845"
                     /translation="MTQEHIDLSYASQQDAGQEQALVEEENPNHSITDASVPADQLQD
                     EGVQPMGEAYDEEDEGQIGPSPIDVLIGNGISKKDIEKLQESGLCTVESIAYTPKKIL
                     TTIKGISDQKADKLILEASKIVPLGFTTATEFHQRRSELITLTTGSKQLDTLLGGGIE
                     TGAITEIFGEFRTGKSQLCHTLAVTAQLPVEMGGGEGKCLFIDTESTFRPVRIVPIAR
                     RFGLDEREAMENIAYARAYNADHQLQLLNQAAQMMAQSRFSLLIVDSIMALYRTDYSG
                     RGELSARQMHVAKFMRTLQRLADEFGIAIVITNQVVAQVDGGALFNPDPKKPIGGNII
                     AHSSTTRLYFKKGKGANRICKIYDSPCLAETECVFAIGQGGIMDPSDESEQMDED"
     gene            complement(<94096..>97125)
                     /locus_tag="C5L36_0E00550"
                     /db_xref="GeneID:40385846"
     mRNA            complement(<94096..>97125)
                     /locus_tag="C5L36_0E00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467603.1"
                     /db_xref="GeneID:40385846"
     CDS             complement(94096..97125)
                     /locus_tag="C5L36_0E00550"
                     /inference="similar to AA sequence:RefSeq:NP_009487.2"
                     /note="PKUD0E00550; similar to Saccharomyces cerevisiae
                     YBL066C (SEF1); ancestral locus Anc_7.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323463.1"
                     /db_xref="GeneID:40385846"
                     /translation="MPTKQNGVVPKQEPDTEENVLVSGPTQTTSSVKRKNNSTNNKAT
                     TTKSASKKRKKTTNNDDDQNVHNDSSNNTNNTNTTTGRSKSTSNSNAGHRPVTSCTHC
                     RQHKIKCNASEKFPDPCSRCQRMNLKCEIDPQFRPKKGSQIQSLRNDVDELRSKIAFL
                     TKNENLIAQVLQKTNIEGAEILAKNHGDNTDGNGENKNSISNNSGRGKENKMITPPLV
                     AKTHLKKDPVLLSLDGKSNSIPLINDSAVNKEQLNVALKAAVRSVSESPATFTPSENI
                     NDASFNGKSVTTHVNTHAIPQNNISPNTHISEFVLGDVKISIEKAKTLHKNFVDNFLP
                     YLPILISNDPIELYQQSQLLFWTVMLTSCLSDPVPSLYMSFASLIKQLAIETCWIRTP
                     RSTHIVQSLLILSTWPLPNQKVLDDCSYRFIGLAKSLSLQLGLHRGKFMSEFSRTQVA
                     LPDAEKWRSRTWLAVFFCEQFWSSNLGLPPSLQTDFILESARIDQSLPKNFRCLISLA
                     IFQAKLVNIMGLNVSSPDGLMEPANRAAPLHIMERELERLAFKLQIDDLVVECYYLYV
                     KLMVCLFSFLPETTSEDQAKYVTIAYNSATRIITIMSKLLEKRQLTEYPIYLRHSVTT
                     AAFILFRLHLTPYLLPKYIDSARQSIVTVHRLFRNMLGAWKDVENDISRTATVLEKLN
                     FVIITHPELYVDTQGIIVRMRSHLTGSLFYDLVWNIHEARRRSIEGSKDPNLSKRKCK
                     SKSVNKPLPLPFYNQITKDDFTAITTTTPNGTTITKLVPTDQAIINAKESAFKAGLSM
                     PTEINGIPLAMLEATGSISSKPSKVSLNRNDNISPRGKKNILKSSSSTNVSEQASLQV
                     TKPTSSANLGKCKSRQYPPPPLFPNVSNEKISLTADALGMRKTSNSMAEADFKNGYQT
                     SNLSSIPNVLEKGSQKMGSVDISNLDSLFDSPKLTNDPEGEPLNNRGGVRSSTETPED
                     IDPMNEMFIDSIFQQNSKPIEDDDLLGWFDMNMAPEF"
     gene            complement(<97555..>98286)
                     /locus_tag="C5L36_0E00560"
                     /db_xref="GeneID:40385847"
     mRNA            complement(<97555..>98286)
                     /locus_tag="C5L36_0E00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467604.1"
                     /db_xref="GeneID:40385847"
     CDS             complement(97555..98286)
                     /locus_tag="C5L36_0E00560"
                     /inference="similar to AA sequence:RefSeq:NP_009489.1"
                     /note="PKUD0E00560; similar to Saccharomyces cerevisiae
                     YBL064C (PRX1); ancestral locus Anc_7.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323464.1"
                     /db_xref="GeneID:40385847"
                     /translation="MFARSIIRNAAFKAPIRRFISFDAASQPRVRIGSVAPNFKAPTT
                     AGEIDFHEYLGNSWGVLFSHPADFTPVCTTELGAFSKLQSEFDKRNVKLIGLSAESVP
                     SHKEWVKDIEEVILGGKKFTFPIIGDESKEVSYKYDMVDEDGFKKLQAGQPIFTIRSV
                     FIIDPKKTVRLILTYPASVGRNTSEVLRVIDALQKTDAKGVATGVNWVEGDDVIIPPS
                     VSNEAAKEKFGEFKEVKPYLRFTKA"
     gene            complement(98582..98653)
                     /locus_tag="C5L36_0Etrna2C"
                     /db_xref="GeneID:40386410"
     tRNA            complement(98582..98653)
                     /locus_tag="C5L36_0Etrna2C"
                     /product="tRNA-Cys"
                     /note="PKUD0Etrna2C; codon recognized: UGC"
                     /db_xref="GeneID:40386410"
     gene            complement(<99706..>100662)
                     /locus_tag="C5L36_0E00570"
                     /db_xref="GeneID:40385848"
     mRNA            complement(<99706..>100662)
                     /locus_tag="C5L36_0E00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467605.1"
                     /db_xref="GeneID:40385848"
     CDS             complement(99706..100662)
                     /locus_tag="C5L36_0E00570"
                     /inference="similar to AA sequence:RefSeq:NP_009718.3"
                     /note="PKUD0E00570; similar to Saccharomyces cerevisiae
                     YBR160W (CDC28); ancestral locus Anc_8.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323465.1"
                     /db_xref="GeneID:40385848"
                     /translation="MDVNDFDKLEKIGEGTYGVVYKAIDTKHNNRIVALKKIRLESED
                     EGIPSTTIREISLLKELRDPNIVGLFDIVHSNSNKIYLVFEFLDMDLKKYMESIPEGH
                     GMNRHMVKKFMIQLVKGIYYCHSHRVLHRDLKPQNLLIDKEGSLKVADFGLARAFGVP
                     LRAYTHEVVTLWYRAPEILLGGKQYSTGVDMWSIGCIFAEMAQRKPLFSGDSEIDQIF
                     KIFKVLGTPTKEMWPEVECMSDYKKTFPKWKKQNLASIVTKLDANGIDLLEQLLAYDP
                     AIRISAKRALAHDYFKIDPESYHQMDYPQQSTMQVDTSTLYA"
     gene            complement(<101007..>102047)
                     /locus_tag="C5L36_0E00580"
                     /db_xref="GeneID:40385849"
     mRNA            complement(<101007..>102047)
                     /locus_tag="C5L36_0E00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467606.1"
                     /db_xref="GeneID:40385849"
     CDS             complement(101007..102047)
                     /locus_tag="C5L36_0E00580"
                     /inference="similar to AA sequence:RefSeq:NP_009717.1"
                     /note="PKUD0E00580; similar to Saccharomyces cerevisiae
                     YBR159W (IFA38); ancestral locus Anc_8.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323466.1"
                     /db_xref="GeneID:40385849"
                     /translation="MCDFLKSLSSLELTPYNTFLYAALVVGVVKVTTTVLSFTSLLLQ
                     AYVLPGVNFAKYGANRGNWAVITGASDGIGKEYAFQLAKKGFNIVLVSRTQSKLETVA
                     SEIQSKYKKETKIVAFDASTNAPENYQLLEDSLQGLPVSILINNVGASHSIPVSFLDT
                     TEEEMNQIITLNNIVTLKVTKIVAPLIAANTGKNKGTRGLILTMGSFAGLVPTPYLSV
                     YSGSKAFLQNWSAALSGELASQSIDVELVISYLVTSAMSKVKRSSFMIPTPKQFVAST
                     LKNVGRRVGAQERFGTITPYPSHALMHWGIANTLGVFSKFVNKMNLDMHKDIRKRALK
                     KAARIANEKKEL"
     gene            complement(<102318..>103460)
                     /locus_tag="C5L36_0E00590"
                     /db_xref="GeneID:40385850"
     mRNA            complement(<102318..>103460)
                     /locus_tag="C5L36_0E00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467607.1"
                     /db_xref="GeneID:40385850"
     CDS             complement(102318..103460)
                     /locus_tag="C5L36_0E00590"
                     /note="PKUD0E00590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323467.1"
                     /db_xref="GeneID:40385850"
                     /translation="MRGSSGNGKYHGRGNHSYRGFHGGSPSDRGYYQPPYYNSSPTPG
                     RGGVTSYGSRGVPSSAGNSTVPYYTSSRAYGEYPSCGQPPQQQQAPSTPVSADTNGPP
                     RPSSDNDWPGYNRTFNSRVRGSYRGSYSRGRGRGRSGWGRPTGGYYGNIGPINGGLKS
                     SFEYNPTDNEHEYYSYKREGFENGYELQAEQQHERRPSQHQAHHKQLQQQDAPAQHAS
                     QSQPYQPLKPHSSSQNQSGHGYHTEGSDSSLKIPIQNGNDSHPIKRDASDKSETASVH
                     TVNPETALAINNKDLEMQRVRERLQEAEFTEKHWISRIHVHGDMRKFLSRAFDSLDVA
                     NASLLNIGARRAELEIDVERYNRLLKAEDERVRLAEEKLEAMDLDV"
     gene            complement(<103772..>105187)
                     /locus_tag="C5L36_0E00600"
                     /db_xref="GeneID:40385851"
     mRNA            complement(<103772..>105187)
                     /locus_tag="C5L36_0E00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467608.1"
                     /db_xref="GeneID:40385851"
     CDS             complement(103772..105187)
                     /locus_tag="C5L36_0E00600"
                     /inference="similar to AA sequence:RefSeq:NP_014945.3"
                     /note="PKUD0E00600; similar to Saccharomyces cerevisiae
                     YOR301W (RAX1); ancestral locus Anc_8.774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323468.1"
                     /db_xref="GeneID:40385851"
                     /translation="MGNPHLDSQEEFVNKSNLVDATGLQNYYDALNELEKQNVNLNSF
                     EQPVSEFNRWPTLFEILNKKTESPLDLWSFYVFMRDEENAIDYLDFWIDTVQHINLCK
                     AYVKGLRDTLISSSKMKQSGKANDFITNKSDTRKALTQKRTRFDPPGVINDVYSNRNS
                     QNSSNASRSSSTLLELLMKNDLFEDQDPHRLSTFLRGETAIRTSDPLVNAKIEDLKRK
                     SQNLSSKLDEKWDESKEDMSSNFRTSLIDPEMVEKFIENDFDDQHRSFDQSHLISRSS
                     LRRSTRNILETYFSNDSEKKLEIPRGIASRLRYALENQGRDDPEVFDEAREYVFKAME
                     FNAYPNFLRNHALKNVTKKSAAIRLLLSIICALAAFWTGYTLIFMNYQSKSTRAVVVV
                     PFFFMSYLFFSAFYRIDPFLCFAGYSESIATPGGIIPNRDKYVRSVLTKRSLFVLTVL
                     CLVAAAFSIIFALVPGKRLVH"
     gene            <106080..>106706
                     /locus_tag="C5L36_0E00610"
                     /db_xref="GeneID:40385852"
     mRNA            <106080..>106706
                     /locus_tag="C5L36_0E00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467609.1"
                     /db_xref="GeneID:40385852"
     CDS             106080..106706
                     /locus_tag="C5L36_0E00610"
                     /note="PKUD0E00610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323469.1"
                     /db_xref="GeneID:40385852"
                     /translation="MSPHHIDLDEPKCSEYDYGRRFGTNSKIWDVYDTRASNSGPTGP
                     TSQKDSLFWLRRSRAVKGAYKMYSSQIRGTGSKGENEPVAACRAWLRGNVLLTRAPQV
                     TVAELEWHTLSHKVEALDSYRLFSLADGNTYQWTNQGKFLEKVKNLGEKESEVRERIA
                     KVVIASNSGFNLIVDESKIPREIALCTALCFWVDQWNTNLALRGIYWG"
     gene            <107184..>110612
                     /locus_tag="C5L36_0E00620"
                     /db_xref="GeneID:40385853"
     mRNA            <107184..>110612
                     /locus_tag="C5L36_0E00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467610.1"
                     /db_xref="GeneID:40385853"
     CDS             107184..110612
                     /locus_tag="C5L36_0E00620"
                     /inference="similar to AA sequence:RefSeq:NP_012643.3"
                     /note="PKUD0E00620; similar to Saccharomyces cerevisiae
                     YJR109C (CPA2); ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323470.1"
                     /db_xref="GeneID:40385853"
                     /translation="MAAVSRLLGFKTVKQFSKFPKLKKNGFKSFQLKLYSTSTYEGGN
                     IMKQFKDENGLNLVDVSKVLVIGSGGLSIGQAGEFDYSGSQAIKALKEENKKSILINP
                     NIATNQTSHALADEVYYLPVTPEYITYIIEREKPDGILLTFGGQTGLNVGVQLDKLGI
                     LKKYGVKVLGTPIKTLETSEDRDLFAQALKEINIPIAESIAVNTVDDALKAAEEVGYP
                     IIVRSAYALGGLGSGFANNETELRNLASQSLSLSPQILVEKSLKGWKEVEYEVVRDRC
                     DNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEEYHMLRSAAIKIIRHLGVVGECNV
                     QYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPQLPNPVTKS
                     TSANFEPSLDYMVTKIPRWDLAKFQHVNRDIGSAMKSVGEVMAIGRNFEESFQKAVRQ
                     VDPSFVGFQGAEFDNLDDALANPTDRRWLAVGQALLNEGYSVEKVHELSKIDKWFLYK
                     LMNIVNMQKELESLGDLSALSEDVMSRAKKLGFSDKQIALAVKSDELSVRALRKSFGI
                     TPFVKRIDTLAAEFPASTNYLYTTYNATSHDVEFNDQGTMVLGSGVYRIGSSVEFDWC
                     AVSTARALRKEGKKTVMVNYNPETVSTDFDEVDRLYFEELSFERTMDIYELENSEGVV
                     VSVGGQLPQNIALKLQNAGAKILGTDPEDIDKAEDRHKFSSILDSIDVDQPKWKELTS
                     IDAAEQFADEVGYPVLVRPSYVLSGAAMSVIRSKSELESKLLNAADVSAEHPVVISKF
                     IEGAEEIDIDAVACEGEVMVHAVSEHVENAGIHSGDATLVLPPQHLEPAIMLRLKEIA
                     DKVAKAWKITGPFNMQIIKANNPETGIPDLKVIECNIRASRSFPFVSKVLGVNFIEVA
                     TRALLKDPTLKPIDLMNKHYDYVATKVPQFSFTRLAGADPFLGVEMSSTGEIACFGAD
                     LIEAYWTTIQATMNFHLPLPPSGILFGGDTNNDNLGTVAQRLEKLGYKYYTASSQVAE
                     YLKKYTTAEIKTIEFPKNNKRELREVFQKYDIKAVFNLARTRADNLQDEDYVMRRNAI
                     DFGIPLFNEPKTALLFAECLKEKLPGRISDLSQQEVIIPGEVRRWSEFIGGKPV"
     gene            <111665..>112990
                     /locus_tag="C5L36_0E00630"
                     /db_xref="GeneID:40385854"
     mRNA            <111665..>112990
                     /locus_tag="C5L36_0E00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467611.1"
                     /db_xref="GeneID:40385854"
     CDS             111665..112990
                     /locus_tag="C5L36_0E00630"
                     /inference="similar to AA sequence:RefSeq:NP_010937.3"
                     /note="PKUD0E00630; similar to Saccharomyces cerevisiae
                     YER020W (GPA2); ancestral locus Anc_7.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323471.1"
                     /db_xref="GeneID:40385854"
                     /translation="MGICGSKDTESYSNRNTSAQNTGSTVRKSGPKSSSSEISHNKSN
                     PTAPLKSNEKFESFPEPTAKQQLQTVAEGQETTVNTSSNPKQSNVMDSTDGSNNSKND
                     TVEGKNKLKYHAKVLLLGSGESGKSTILRQIKIIHQNGFTDDERKEYKPFVFQNIVES
                     IQCITKALVQYNLKSQITNLTGTELEFLSTYELPYSATNDLSYSLDGRLVELTKKLVT
                     DEKVEKLLSSNEYEFYLLDSASYFFENLDRIGAPDYIPTTMDILRTRTQTSGIFDTKF
                     QMEDLEVHLYDVGGQRSERKKWIHCFDNVTAIIFCVSLSEYNQTLLESPTQNRLEESL
                     NLFESVVNSMWFKKTAVILCLNKIDIFIDQLPNYPLENYFPDYVGGANVNKAVKYILW
                     RFKQLNRANLNLVPYVTQATDTNNIKLAFAIVRETILHKNLLESGVITS"
     gene            <113494..>121437
                     /locus_tag="C5L36_0E00640"
                     /db_xref="GeneID:40385855"
     mRNA            <113494..>121437
                     /locus_tag="C5L36_0E00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467612.1"
                     /db_xref="GeneID:40385855"
     CDS             113494..121437
                     /locus_tag="C5L36_0E00640"
                     /inference="similar to AA sequence:RefSeq:NP_015442.1"
                     /note="PKUD0E00640; similar to Saccharomyces cerevisiae
                     YPR117W; ancestral locus Anc_3.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323472.1"
                     /db_xref="GeneID:40385855"
                     /translation="MIQYLKYPICVYVIFYLSVNFFLRGRVYIGFISWMHLLYINITL
                     GTLNIRIGSVSVSVRPLYFLHRKKLKAKNHDGLIIIDVHRVEINLTKVHNKSKLSSRA
                     NSPPKMKKELDPDSMETIVIKLLNIMKRVRVFLPLTIVIHDISIINHDQFINIGVFSS
                     SINCILHTNKFTNERCMKNALHFSLANVVDKNRKIIKDVKWSVSASSSIEKPFTSQFA
                     SLSSVLSSHAADIHVEELLELISKLFPMVKKPTNSDTQKDLAAELDKQKHTDITVLKI
                     LNKFKHVSLYLSLNDNSFSLNELSLNIKTLVFSLNTDNKQKKNKSCTKHDNPYLYKAI
                     ISLAGVKILYDLIPDSRFVLEFLNYYSIIDATTLLYCLKNLKNVDSIKEVASNEGFIL
                     RTFLTAPNLTLITSLQDILTMKEHFKRMKYEKAISKTDNQVEIKEPTCKVVTIIENLL
                     RLSHRFRTKFQFLTTTVQVALSDDMSALFTIDDLLVDSSLSDSMVTLFDINPDYVSTK
                     SIYSSLKNIQFIIVNCHLPSKVFVLDSLDASIYISVFDEYAAITSIKTSINHIEVLTE
                     SINNCKKLSKIATSWRNREPSKEINELIDAYKQKVYNLQKNEKDGLSEEDSPPYFIPK
                     LIEVFDLSIKKITLVSCFNNPVKYWDGEDQSELNKFKRGFSVVFEKLSFISDNTLEVP
                     DANFRMKDFSIFLIRDFDNEKLKKKYKRIFLLENMHIKYTHIYRKVHISLPLTDGCIS
                     VEVLWTFFYIITILKSIKGVKLRNDEKGITTKPLKKISKRHLQIHFSAPLIMLKVQFP
                     SDVSIVIEIDSLKFVKASANNDKNVLFKVCRIYCENPHAVNFWTLLMIVSDARITLKP
                     KDEVPDDGFPILIESSDIRIEIPYQYIFYRAFDNFKAFLKSSKKLKKNFKDLMYVDED
                     CKSFKVDVIRPSLAEHPFRMPKIRIKSKRILYCSHDDPFEEELTNVYMIGSVVYPASA
                     AKLKAFSKYETKIKKKLRTKYEKVLEFDDDDEAIIPSALKHTTSSTYMRKSVSTGTLR
                     ATDNNEASKRRINSSGSFNSKLRNQVMPDDAQAWHDYRKEYHTAVELPRHRMYRNLSK
                     TWVSAVKNFRDTKKSGRNASSTTGEDPYVRKEFLRKYPVITEGSFQPLFSLTVTNPTL
                     DLDVPEFGLDNYAEFMYRVAGGMPKDMKYGIFVPMNLKLSCKEFVVQIKDYPLPLVGL
                     GGAQYDMNDAIIFKGDLVICEQAYTEQEIRYNFVPCVPQYNDIQMRDNLYAFHISRTM
                     TNIKFVTDMNIHVNSLRSAAVSWAPSLQPGMSYAFDSFDLLSKPPLDISPKIGFWDKM
                     PLLVPSKFTFHFKNGITLFIKSSQSPYDLLGKSAGFAFKWNDDAKLLINSTGKSEDFL
                     IVQSNKFEIGVPVFDSNYIGNCVGAGNAAIDYKFAKIVLKLTSKPIIWKLGFIFERNK
                     HGEMNATPGSVERTKRFIPHYKVTLRNPDTFSSNEDKEKWDSYHGWRSQYIYLSLSAY
                     SRDDNKCKEIPFAPLGTTYNSLYLSYLTFYYFYFWWDSFKSSLGLPIKAGAMFKNDFL
                     SDKKSPKFGSTVHGISYVIDLSPLYLTHVYQHSSTNNNSGKLAFTGLKGFVESFTMDL
                     HQSRQEVIVENRENHSVTKEYKLRMKSGIVDLINADIRIITAVFNQVSASGILAKKMG
                     IDSVMSDTDTSSTNSDSTDRAWYDHDDFVELEGQQIPNEEPKWKVYQFVSTPRFYYVR
                     DLPSLEVDFPFDVVESETHNCQIEERDLIHAAPALVDTRIREVEDLINFNNYEISDLE
                     GKNANKYVQKTLANAKRDQQELHHRLHILRCLRDSFSEGIFPQYDEFVNDQEESDDEI
                     RYELLKAVSRVSSHVSTIKSKIPSTDARTSDYINRFSIYTPSIRWTRSVKSGFFRYLE
                     MAKNGRMIAFSLSHDAVRLAEELRKAIRREVGDDPDFSFTQCHPEVELERSDILLDDF
                     DKVLHDTSGLAEAEIEDSFLVKLILPQVAITSDGNKCLLITNNKVVLNSITVKGYQFN
                     ELSSELTLPLETRHGLLVTDLFAYVLERETALTNKYRLFTPKAVSWPPKLPIEMYYTP
                     VSLDESVVVQNMSFALIYVKPNELHLSKDGKSNNAGCKELLRVATPSVDVVVNSEQLN
                     FIRIVATNMFANDKTEIQKTKDAVKKFVRYSDFSNYDQLCTTLRELQLELHELFQCRL
                     LLVEANRGTSEHKDTIMDIHVEIERNIINLNAIVDILQTTKTQKYNELHKYLQFSICA
                     PIVKVLLMTDTQEPFIELNASDTCYMFTQSPTGESVNTFYINEFTLSNRHKEATFDTI
                     TRRLKNSDVPMFRLDWTLLPPVGGIAMVYEKIFSFGPLKIQFNMKFAGLLQEFFFPNS
                     EILKNDYDIDNDYDEFLNDVESISSDSSAAASTASSNTKLNKEGKISRVLHKIWHKSS
                     VKESSAQLSRTSSLGSTNSYSTSIARSSSVAENVSIMDERASKYSMVRNITINPIEME
                     VTFHGKGVMKLIKLTDFPVKMPTQEINNRIISNEEFFALVKHSMISYVLKNTHNLIKS
                     SIKKSTHTSGNPRSPSSTLRRSEEKKRNGSKSVHNTSHLHKVDGNKHMFKDADLLGPT
                     VNSGSFYVKNPSPFSEIMNSKQEFPKSGDAIDEAKVFRQLEDVTEEDEGTV"
     gene            <121688..>124639
                     /locus_tag="C5L36_0E00650"
                     /db_xref="GeneID:40385856"
     mRNA            <121688..>124639
                     /locus_tag="C5L36_0E00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467613.1"
                     /db_xref="GeneID:40385856"
     CDS             121688..124639
                     /locus_tag="C5L36_0E00650"
                     /inference="similar to AA sequence:RefSeq:NP_011614.1"
                     /note="PKUD0E00650; similar to Saccharomyces cerevisiae
                     YGR100W (MDR1); ancestral locus Anc_3.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323473.1"
                     /db_xref="GeneID:40385856"
                     /translation="MNFLKSVASMAQNAIESINNPKHLTADQLMQQEFRMPTSEHIIN
                     VVACDYIITSRVLYSLRDGAKSFSYLPPPIDANVRVSGVLTITDNYFMARKNGSDQNK
                     VVFHLATIKSFHKIPNAEMVHVRISTNNGMILDVFTDAPRNKAEQFWYLFNKQHELCK
                     SQEIKLMNFQMSLYSEYLISKNCKNSKLGEKHLDIPLHPKGGLGLMYKFPGDQTKEQE
                     VMKLKRWFEYFRRYGRNLELVQNPFFFNLIYIGVPNRLRGEIWELSCGAIYLRYQNND
                     EYGNLLLKNKDGHSLAIEEIEKDLNRSLPEYSAFQTPDGINKLRKVLTAYSWKNPEIG
                     YCQAMNIVSAALLIFMSEEQAYWTINVLCEKLIPGYYSKTMYGVLLDQKVFEALVKKS
                     LPSVGDQFAAHDIQLSIVSLPWFLSLFINTMPLVFAFRVLDAFFIQGPRVLFQIALAI
                     IKVNSEKLLQCTDDGECIAIFKEYFMSLDETFPVNGKLKRNFDLLWETALKEFSIIDD
                     KLIERTRNVYKNEVFEGIDLFVKRAEIRNLPKMHYLTNDQLSNIYDRYYRVLLQDKDD
                     PNRGELSMEYYSFKIFMSEITPWASLESQDKTQDRFLHRLYSKWSNESDLLSLQTLVS
                     GLDRVRDRDLMNSLSYFFELYLADGEKDRIPKETVLELAEELIFITSPWRDGTLFDTI
                     ANRELEDSIAEKLVEKREALIAQGVQIDPDQEISLPDEVKFDEEKWKGKQSLRYLSAS
                     SSFLNLAFQYALPYEDTNAPLIELDDTGRNESITHNKALDPNTPVYITSSMFRMIVLA
                     NETYSSFFEHEFWASFDVDLPGNTDQSVLGDLVGNIRGVVNNVMADGVRVANQVKKRM
                     GDARARADTSTSMESGLSSLGSAQVSATSKLNSHQRESIDSKGAASINTGWTLESGAL
                     NETFDDSNIDDFMENPEETVLLGEKENEYKEKLDTVDTDGDEDEYGNYIQASNKDTVN
                     EVKDKISDLLL"
     gene            complement(<124774..>128523)
                     /locus_tag="C5L36_0E00660"
                     /db_xref="GeneID:40385857"
     mRNA            complement(<124774..>128523)
                     /locus_tag="C5L36_0E00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467614.1"
                     /db_xref="GeneID:40385857"
     CDS             complement(124774..128523)
                     /locus_tag="C5L36_0E00660"
                     /note="PKUD0E00660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323474.1"
                     /db_xref="GeneID:40385857"
                     /translation="MSSRRRSSYIETSYTGVGAFSSAPAPHANALAAASVIGNALKAN
                     NHKPNGIEVPPLQGPRAPRKLSIVTSNSNRRNSVRHSSINNYPSSRTNSVNTANVRRA
                     SLYNIPKQRLNGQKSVPNLKSRRSVSDFTSSAKKHVPTTIKKYVPSANGLVAVEVPNP
                     KHPDNMNTQQKQQYINSQRGSSFRRSTSMAHLPPPKKSTMANNHARNSITKHITEETK
                     ILPDGTRVISTTVEEYLNDNNDLNYEDFEDSYEDFGDNHGEVDMSVTLDEDANDAPEM
                     TNLSTREILGKVDEAEEAKDIVEDIDENDGNFEKEANTDGLVQDIPYRSATTADLVDQ
                     LASEEDLEEKTKKIISNNEKLEEIERSNAFKSIENPVRDTVIVEEVISRPLVDNVMTF
                     GCHQIHLQGNKLSPGLHNESTPSTSTPHSYKGEQQLTIADEPVDRVIGNNVETLTDVH
                     DAEAHKPNATEMEATQSEISTKNKTTGLDENAEESDFIDDINVEDDSVGNYQSPNYAS
                     TQYNDEEYLEAQRKLDELVKQKEQEILQNLSQNGYPVDWNAENKVEQEYTNRSDEDIN
                     DDTVEAHADSNSDKHPVVEITEKENTPTVATTVSLLDDDAGKLVNDEDNELIQNDGRS
                     SNGSEKGGVENIESPSNKYDISPEQVPAVEVFSSEGPDCAHEHSILDHESFDEPRVVA
                     SDTATEVDNAKLNSDATKCGDSDAQGPSSSSSEYSAVSSIVNSHASYTTTQEPSTRTN
                     NKSMAQHLRPIVANVNRSPVYGNESGHDTTRQVCGLSKEVETLSNKSKDRTKTNTEPV
                     EPAFIRPSLDDINIPKREPSIQAQIDKVEEEKVNTRVLGNENNSSGSINEKLVRKSAL
                     KASKNLTAYSSSQNNSAKDAYLSLETAQNTKLNAKSSLMSPTTSAGQTNARSRSRAGS
                     AASNHAYQGAQINTGAVGGAPLAAAAVATKRHTAKPGSSSKTQSNQADKKYQRNSMLP
                     VPSHQGSTHANVKPPNPKVEEAKRRILGNRQSKIQAKNLYELAKTRKHIDAEELLRFD
                     DFNAPVRKSSFEKVTSRESLSESGPQSPNKNLKMSAMSLRSSGSPNYEQYERTKVTAS
                     FKSRFADNESDTDVPLQPPSVTPRVVADNSTTSLSNVEIDKPLGEKSKPNFRFNLLGK
                     KKAAVSSDASHNLPTHSVRDNVESIGNTRKSSGFSFRGHSRKKSETKTETSPRKESKI
                     EKFFTEQHGPNKKHEIHPLSNDYERANEVATEGTPKKSFFKKMFK"
     gene            complement(<128905..>130035)
                     /locus_tag="C5L36_0E00670"
                     /db_xref="GeneID:40385858"
     mRNA            complement(<128905..>130035)
                     /locus_tag="C5L36_0E00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467615.1"
                     /db_xref="GeneID:40385858"
     CDS             complement(128905..130035)
                     /locus_tag="C5L36_0E00670"
                     /inference="similar to AA sequence:RefSeq:NP_010568.3"
                     /note="PKUD0E00670; similar to Saccharomyces cerevisiae
                     YDR282C; ancestral locus Anc_5.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323475.1"
                     /db_xref="GeneID:40385858"
                     /translation="MISKILPLTRLSCLNNCRGFTRFYATVKSNSVAGQQRKKVLTFQ
                     TTKIGENEGIPSYNGSHESIIHPAFVTSSDLKTYMGRPVKPVVSVTKCETYNLESARK
                     NLSLKGLAPIQIVPGECVNFKWNQNDVFLFKFGTIVAWNVEESEVVDKIVPIFTDAEI
                     NSYSYQSEDLDYIELYHNEDEQRKDSFVSKETEIIVLNVPNNDQKLLDMLSFSYGISR
                     STRLAILEEAVESHIAMTRSQIDKLSQGEKIAVDPKEALKISGRLLLLRGKLNLYTEL
                     VETPDIYWSESRLERIHDKVSNALDISKRVNILNRKLDYLSEEAQALVSIMSTRTEVR
                     LELIIIYLIVIEVCYETYHFYERLGGKYNIEYFRSIIDEYRK"
     gene            <130269..>132782
                     /locus_tag="C5L36_0E00680"
                     /db_xref="GeneID:40385859"
     mRNA            <130269..>132782
                     /locus_tag="C5L36_0E00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467616.1"
                     /db_xref="GeneID:40385859"
     CDS             130269..132782
                     /locus_tag="C5L36_0E00680"
                     /inference="similar to AA sequence:RefSeq:NP_012442.1"
                     /note="PKUD0E00680; similar to Saccharomyces cerevisiae
                     YJL093C (TOK1); ancestral locus Anc_1.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323476.1"
                     /db_xref="GeneID:40385859"
                     /translation="MGLSKSHRRRVNLRHPFLETFYKRRLHLLRHSQQSRLRVSKSLA
                     TDILDEDIRRKQEVLDDLSPQIEYGNLTTLEPVEEAKILEKSISHNNIMNFIPNDEEE
                     VLSSSTEYESPETETLYHYVHRQKKKRLKRARTGRSPYKYPALSELEEAGIREYYDTF
                     LDTASWQVSNMILKPGDKHFLLWFFSSSYIPLICSCTGPLSNIFSLLAIICPWKLHKV
                     IDIRTKDPFWCYLINSISIAFAVTSNFFLLLNYRRKLRYASCQVISISGWGIASLMLT
                     GLIIGYHVWFYKVGLEEEYLLGEGFWYACITAILHFINFTLLAVNEIGFLKKKYKPVF
                     NIDHVEETLVIQTTLMGVWLIIGAAVFTRVLNLRLSDAYLYFVTSVVTIGMQGVVPMN
                     NVAGETLTSIWIICGLVMFGLIITSIGKMMFNFSKSTLYRHRIEHLRKKILKVHRMEE
                     EIVTTNEDSFKLMGNIHKWALFVQAVMQLVISVAIFMITLLCGALAFSLLEQWSYKDS
                     VYFCFYNLITLGQGSQSPSTPGGKTFFTAWALAAIPVMTILISTSSDFVFSKLTQIEK
                     IPFFEIVFEYCNSHSSLRRFGEFLRTRELRGLERQKISDLASIALAIVKENSDDLSLK
                     GTANPDPFKKVPILCHPADLLYSVLLNSENISSYDFIVSTPFVKLNAMTIQLANYFRE
                     GQIVNLDTVLLSEKRTLLTTSFQTLDGEFNSEKFKALYKIEDGGVVSPDGIIATNFKK
                     KNDFVLDKLSRLQVLFLNLRTKAHDMCTDPTRKYEFEEWEILLRLTNQTEALDDSFYW
                     IESRSPLTFPINQPRYFMLHYIRHIVLFLQEFAAEWDNM"
     gene            <133213..>134799
                     /locus_tag="C5L36_0E00690"
                     /db_xref="GeneID:40385860"
     mRNA            <133213..>134799
                     /locus_tag="C5L36_0E00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467617.1"
                     /db_xref="GeneID:40385860"
     CDS             133213..134799
                     /locus_tag="C5L36_0E00690"
                     /note="PKUD0E00690; Pfam Domains: p450(3.1e-41)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323477.1"
                     /db_xref="GeneID:40385860"
                     /translation="MLPEFLSETNPNSLGVSVCIVILTSALYYFVIYPLFFHPLAKIP
                     GPLPCKITKYWLIYKSWKEEKIGYVQSLHEKYGSIVRIGPDQVDICDASYIKDIYVAN
                     FDKTDFFAHFLFFGVPCAFSTIEKEKHKEFRKPTNRLYTKSKICSPQVMPRVEKVIYD
                     TLSVFHQYHNHELNIFLVFCDMAMDAVTSISFGPAYDPLLADPFGKGKTICGDFSIQS
                     SPGFWVTEMPYWLDWVVTKPVKEATKRCHDWVERQFNAAYQKLGSTTSKGVDIVLNSY
                     FEYDPEEDKNKQLTKLFDQTHAKSEIYDHIVAGHIGTSTILTYFFLEMASQPEVQEKL
                     REEVMKQLNNNEPIPTNNFNPIGYSVIDDEKKLPYLHACLNENFRLFTGVGQLPRVVP
                     PKGMLFRGSEIVPPVKIPCNSVVSMQPWSVHRVAAVFPNPNKYDPQRWLEASEVQLKT
                     MKSHLLPFGTGARMCLGQHLATAEVKMIMANILCRYKVQLADDFDYEKDGAMRDFFVT
                     VPKSEKMMLKFIPLESSTLF"
     gene            <135043..>136623
                     /locus_tag="C5L36_0E00700"
                     /db_xref="GeneID:40385861"
     mRNA            <135043..>136623
                     /locus_tag="C5L36_0E00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467618.1"
                     /db_xref="GeneID:40385861"
     CDS             135043..136623
                     /locus_tag="C5L36_0E00700"
                     /note="PKUD0E00700; Pfam Domains: p450(2.5e-39)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323478.1"
                     /db_xref="GeneID:40385861"
                     /translation="MLLELKSSGSTADMYSAAIVVLSTALVYYFIIYPLYFHPLSDVP
                     GPLICKLTRYWILFKSWNEERNRYVQALHEKYGTIVRIGPDQVDINDVAYLKDIYVGN
                     FDKTGFYAQFVNYDSHCTFSTTDKGTHKESRKVSHKFYSKTNICSPTIMPRIERVIHD
                     TLEVLHEKVNQPVNAFVLFCDMAMDAVSAFSFGNNYDSLLVDPFGKGERVVTDFGLQS
                     STGFWVTEMPQWYDWVVSKPVSKASQRCYDWIERQFNTAYDQLGKSISDGVESLLTVY
                     FDFDFSNNKPIQKSKLFDKRRTKSEFFDHIAAGHVTTATTMSYFFYEMASKLEIQNRL
                     REELLDVLNHGIPISSEDPEPISYSAVDDEAKLPFMHACMYENFRIHAGIPGQEPRLV
                     PSKGLIFRGSGKVPVVKLPGGTVVTMQPWSLHRVHSTFPDPEKYDPQRWMDADKAQLK
                     TMKGHLMHFGSGARMCIGQHLATAEIKMSMANIMCRYRVELVDDFDYEKDGAMMDIYT
                     TVPRSEKMMLRFIPLKSL"
     gene            <136934..>138049
                     /locus_tag="C5L36_0E00710"
                     /db_xref="GeneID:40385862"
     mRNA            <136934..>138049
                     /locus_tag="C5L36_0E00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467619.1"
                     /db_xref="GeneID:40385862"
     CDS             136934..138049
                     /locus_tag="C5L36_0E00710"
                     /inference="similar to AA sequence:RefSeq:NP_011935.1"
                     /note="PKUD0E00710; similar to Saccharomyces cerevisiae
                     YHR068W (DYS1); ancestral locus Anc_5.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323479.1"
                     /db_xref="GeneID:40385862"
                     /translation="MSDIPNLAGDAVLMKSDPVPEGSLPVFGIDYSKPESRNSTARDL
                     IDGMRYMGIQASSVAEACDIIEEMRAWRGKHISELEEHERKGTFDEEGYQKTTIFLGY
                     TSNLISSGLRDTLRFLVQHKMVDAIVASAGGIEEDIIKCLAPTYMSEFAAKGSELREK
                     GMNRIGNMVVPNDNYCKFEEWMVPLLDKMLEEQNDNAAKNGKDALDAGTPFWTPSKFI
                     DRLGKEINNETSVLYWCHKNKIPVFSPALTDGSIGDMLFFHTFKASPHQLRIDIVEDI
                     RKINTMSMNSFKAGMIILGGGLIKHHICNACLMRNGADWAVYINSGQEFDASDAGARP
                     DEAISWGKIKADARNVKVYSEVSVVFPLIVSATFASK"
     gene            complement(<138371..>138796)
                     /locus_tag="C5L36_0E00715"
                     /db_xref="GeneID:40385863"
     mRNA            complement(<138371..>138796)
                     /locus_tag="C5L36_0E00715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467620.1"
                     /db_xref="GeneID:40385863"
     CDS             complement(138371..138796)
                     /locus_tag="C5L36_0E00715"
                     /note="PKUD0E00715; Pfam Domains: NDUFA12(3.2e-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323480.1"
                     /db_xref="GeneID:40385863"
                     /translation="MSVSFFRTLKNVWRNGLRRSGRQVAYMNDTKSGTLVGEDDFGNK
                     YYETNDPAEIHMRTRWVEYKDFWRYDASHAEPGWHYWLAYGTDVAPNKLKKDEVAVRH
                     IAPQAHHPVNLTFTKGAFVPYNTAKPKYQAWEPKVNQRA"
     gene            <140006..>141187
                     /locus_tag="C5L36_0E00720"
                     /db_xref="GeneID:40385864"
     mRNA            <140006..>141187
                     /locus_tag="C5L36_0E00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467621.1"
                     /db_xref="GeneID:40385864"
     CDS             140006..141187
                     /locus_tag="C5L36_0E00720"
                     /inference="similar to AA sequence:RefSeq:NP_013459.1"
                     /note="PKUD0E00720; similar to Saccharomyces cerevisiae
                     YLR355C (ILV5); ancestral locus Anc_4.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323481.1"
                     /db_xref="GeneID:40385864"
                     /translation="MYRNAAARLARASKQSTRALSSMAKRPTAVSAVKSVKPLTQSVR
                     GLKKINFAGVEELVHERADWPREKLLEYFKNDTMALIGYGSQGYGQGLNLRDNGLNVI
                     IGVREGGASWKAAIEDGWVPGENLFSIEEAINKGTIIMNLLSDAAQSSTWSQIKPLIT
                     EGKTLYFSHGFSPVFKDLTHVDPPTNVDVILAAPKGSGRTVRSLFKEGRGINSSYAVW
                     NDVSGKAEERAIALAVAIGSGYIYQTTFEKEVYSDLYGERGCLMGGIHGMFLAQYEVL
                     RENGHSPSEAFNETVEEATQSLYPLVGKYGMDYMYDACSTTARRGALDWYPIFKDNLK
                     PVFEKLYASVRDGSETQRSLDFNSQANYREELEKELETIRNMEIWKVGKEVRKLRPEN
                     N"
     gene            <141900..>142580
                     /locus_tag="C5L36_0E00730"
                     /db_xref="GeneID:40385865"
     mRNA            <141900..>142580
                     /locus_tag="C5L36_0E00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467622.1"
                     /db_xref="GeneID:40385865"
     CDS             141900..142580
                     /locus_tag="C5L36_0E00730"
                     /note="PKUD0E00730; Pfam Domains:
                     AhpC-TSA(3.6e-37)|1-cysPrx_C(1.8e-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323482.1"
                     /db_xref="GeneID:40385865"
                     /translation="MSIPKPNNGTLRLGSIAPDFTTDTSLGELHFYEYIDQSWCILFS
                     HPDDFTPVCTTELGAFAKLEPEFTRRGVKMIGLSANDADSHRLWIKDIDEITGSHLSF
                     PIIADPDRRIALLYDMIDHQDATNIDDKGVQLTIRSVFIIDPAKTIRLIMTYPASCGR
                     NTAEVLRVVDSLQTSERLSRKVTTPINWVPGDDVIIAPTVDDNEAKQLFPKFRSIKPY
                     LRLTPLSK"
     gene            <143369..>145423
                     /locus_tag="C5L36_0E00740"
                     /db_xref="GeneID:40385866"
     mRNA            <143369..>145423
                     /locus_tag="C5L36_0E00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467623.1"
                     /db_xref="GeneID:40385866"
     CDS             143369..145423
                     /locus_tag="C5L36_0E00740"
                     /inference="similar to AA sequence:RefSeq:NP_011537.1"
                     /note="PKUD0E00740; similar to Saccharomyces cerevisiae
                     YGR023W (MTL1) and YLR332W (MID2); ancestral locus
                     Anc_4.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323483.1"
                     /db_xref="GeneID:40385866"
                     /translation="MHPQPQIEEKHLLPLHRGTSQQNGGFETGKHRRRLSRKRLLIIT
                     AFFLMMLLVVYRCTPPPALFQSPLTFSHTQQHPHDCKLDHLDTPTIALDGAPNPWNNV
                     EIQELEASVENDNGVNAQVNTKSNNLENAGNSTEISTVKTGNGGAEENEEEEEEDQTS
                     IYADSIIRNIMEGSNNAIIPRFKLVKRADETNSSTVQTPTLSFTAGTSTTPLDPTSSS
                     TDNSGTADPGNAESSASPNFDSTSTSTQDPLSTSTGDPNNSPSFTLSSTESSDPTSSS
                     FSSSFDTLSSSSDDGAPSIFPFTTSILSSSTSSEVSSSSPSTPESTFFFSTLPTSSSS
                     SSTLSSSSLTLSSSTATHPSFLPSTSSSSTTTSISTPSFPSTTSSSSSSSSLLSSFIS
                     TPSSSSSSSYSSPSSSTLSSSSSATSSTLSPSSSSESSTSTTSTSSSTSSTTSPSSSS
                     FSSSTITSASSTTSNDNKLLITVVPSTTIMNSASTVVIYHTITKSNTLANYSSGISSK
                     NKNIAIGVSIGIGIPLISAIIIVLLLAYRRKQQNSVRNYLDSNGRDAGIAVDEGNFFT
                     RFFRRAFIGLPILRNDPNGGDFDDDLHDDLAHDPKPIFSGKNDSDLFDSNSNSNNGFF
                     VSRPKPLHLVNSDNNDQSQTKEHDDTLDDEDVHYLDSDDTDDYVRPPGHDSSASPPQL
                     SQ"
     gene            complement(<145775..>147970)
                     /locus_tag="C5L36_0E00750"
                     /db_xref="GeneID:40385867"
     mRNA            complement(<145775..>147970)
                     /locus_tag="C5L36_0E00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467624.1"
                     /db_xref="GeneID:40385867"
     CDS             complement(145775..147970)
                     /locus_tag="C5L36_0E00750"
                     /inference="similar to AA sequence:RefSeq:NP_010070.1"
                     /note="PKUD0E00750; similar to Saccharomyces cerevisiae
                     YDL211C (YDL211C) and YNL176C (TDA7); ancestral locus
                     Anc_2.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323484.1"
                     /db_xref="GeneID:40385867"
                     /translation="MNLFKTFFFDVLVYCSLAMALAIPKVEDIERRGETSTSTSKCSP
                     FVWTTNTLTNTFYSTDVDGNVLTSYETQTISGRTLAPCALSFLPTTTIQTTVPSTTLV
                     STFTHCDENPHCTSTFWTTPICASETVFASCYVGITELFQENGYTASVSTTSCNSPPG
                     ATGSFQCHETTARIGLDGVSSTFTVTNCDIADFTCVTLSSGISSSYTPTTTPLPSTQF
                     STPFSTPSSSTLSSTPLSSNPPSSTLSSTSPSSTPLSSTSSSTLFSTASSSTSTPSTP
                     FSTPSSSTLSSTPLSSNPPSSVSTTSLTTFITDCGFSRVPVTCVPGVTVVPVGTNDVS
                     IITYSCAPPAGNTISGSFVNSQSVTTYFNGITTTVVTVSNAIIPSFSCPALSPSFTPS
                     SAQYSTLVTSTSKSKLVSLTSFPPTTTTKSLSSVTASSCVPVPSTSTTIITDCDSNML
                     TAKCVEGVSATLMKDVILWFTTTSCAVPNNLSGSFGPSTMIKSYSTGAIVTSFELTDY
                     VIPSFVCPNSKSSIVVPNKSVVTTSTTAVLKISHCSDERCSDSKTTLASTPVASTPVA
                     STPVESTPVESTPVESTPVESTPVESTPVESTPVESTPVESTPVESTPVESTPVESTP
                     VESTPVESTPVESTPVASTPVESTPAGVTNTPATSFFNSSSQTLGSFITPSIKSSNLA
                     GTRSTSVPAETSTISSSTVPKQVTYEGAGIKYTPTNMINLVFGVVMVAL"
     gene            complement(<148808..>150511)
                     /locus_tag="C5L36_0E00760"
                     /db_xref="GeneID:40385868"
     mRNA            complement(<148808..>150511)
                     /locus_tag="C5L36_0E00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467625.1"
                     /db_xref="GeneID:40385868"
     CDS             complement(148808..150511)
                     /locus_tag="C5L36_0E00760"
                     /inference="similar to AA sequence:RefSeq:NP_012587.3"
                     /note="PKUD0E00760; similar to Saccharomyces cerevisiae
                     YJR053W (BFA1); ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323485.1"
                     /db_xref="GeneID:40385868"
                     /translation="MEKEFRKLSLRPSKIDLSTIHENDISRENLKLLHKQQLLAKYID
                     KEARENTDDFDGEEFDFSTTDGDQQAMDFDRIVRDKVESQNREKTFKVSPNRLKSAMK
                     TPTSNHFLTLNKDFKSPRIDSISSSSSKTPSSINSYSESDTENSDYMVDFDEFQDPEP
                     EIDLIKNFNRRQMEAKRAAELARLENLAKYKKMKNNVLHNNNRLSKYYDKVDNDFIDD
                     FSKDKAFESVEIDTSKLDRFKSNTPAFSALERKSSLPAIKMGMATGLEGSPRKIHRFS
                     STMDINNNTYNQKTFTPADTLRVASELKAFNGKELDNIDDFDLTITYSDYKKLKRKSQ
                     KFDLSKYTEPTSHRNHNHHHSSKQQNSDQKLIHLTPQNVSQTAKLTKEGKLKLIRSLG
                     RPKVRKVMPGHMYGEIVYDPQLKKWMGNEEDAEKFESITSSKPKLINNNSMPQVVGNM
                     IYDDKKLRWISMTGNYEDDPFDEDFDTTIKLTEKKASTKIGKGTGGSAFGRLVPSEST
                     ISISENLKNPNNHFRVHPDMYKSWKNEEERWVRKVGNWFPNDEHAHEFKYDLKIFLNQ
                     Q"
     gene            complement(<150763..>153078)
                     /locus_tag="C5L36_0E00770"
                     /db_xref="GeneID:40385869"
     mRNA            complement(<150763..>153078)
                     /locus_tag="C5L36_0E00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467626.1"
                     /db_xref="GeneID:40385869"
     CDS             complement(150763..153078)
                     /locus_tag="C5L36_0E00770"
                     /inference="similar to AA sequence:RefSeq:NP_009544.1"
                     /note="PKUD0E00770; similar to Saccharomyces cerevisiae
                     YBL009W (ALK2) and YGL021W (ALK1); ancestral locus
                     Anc_4.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323486.1"
                     /db_xref="GeneID:40385869"
                     /translation="MSNRLSSTSASLSLSGLLETPSSKETGSSSQNDPNTFQIYVSPG
                     HSGHRKSTQRLTMHSYFDKENKLHSEKQQPLSSCSSPSGKVINGKFGSRSPLKDPLGK
                     DTLSPLKPRTQNKINTNNRHSSHRLSLTNSIRSVSTKSSRISSDQSRKESGKSHIASS
                     GESHHSGRSSKKRHSKVSIETSSTFSSSAKVITDEMDNIEIGIARQVDVKAKNYETVE
                     HKANLRGALIEEPMSHSIMDRENEEQKPISKSASFRRLRNSLSMKSIASSFKNDDDQL
                     QASKMANSDRRNSLKSRRKMSLENIRSFLKPNRSSLSSNVDYKNNISLPIMQPQTKDK
                     IIHKLRNSNSVVSISSFVSQNNLQDTQQLNNSTFNQEKITTSGMKSYDINQIHLSILL
                     KLCSQSKPVSFRSYMNNFQSSTQRKHLSKLDDRAEKFVFMEFSSTGKDYEMDLTPSGV
                     WKVIPFDLDGSSITKLIQELTLSILMSNKKGFVKIKSAKVVKGPCPSSVLDLVGPNDE
                     KITSQLFLIMRLDYGGQTLKDYHIESWKDAFLIFSQILDAMCLGEDEGYEHRDLNVTN
                     ILISHKLDDFDENAGIGNHGLGFNEKNIEVSIIDHALARGIVSGQVIYRDLYDADFFR
                     GSNEYRHVIYKLMRKVVNNRTHTLTFHNSTSAMSINTLASDISTMNISSQTADWSKSY
                     PIFNLLWIHYILHNLLFEKELKPIKMNPILKKKGWLVNGGEMSQESAVYEKLLQGYKM
                     VEPAVLFGQKRNKYMREVKNIYEFRDWYHSH"
     gene            complement(<153734..>154378)
                     /locus_tag="C5L36_0E00780"
                     /db_xref="GeneID:40385870"
     mRNA            complement(<153734..>154378)
                     /locus_tag="C5L36_0E00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467627.1"
                     /db_xref="GeneID:40385870"
     CDS             complement(153734..154378)
                     /locus_tag="C5L36_0E00780"
                     /inference="similar to AA sequence:RefSeq:NP_011495.1"
                     /note="PKUD0E00780; similar to Saccharomyces cerevisiae
                     YGL020C (GET1); ancestral locus Anc_4.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323487.1"
                     /db_xref="GeneID:40385870"
                     /translation="MSGCFLEDGAELMRNEYVLLTPLFSVLTGITICGFVMNRYLREE
                     ALAKYVLHHTDNVLVTQFKELEDALGERRDVEQERNRLSAQDNYAQWTKLNRRVEKLN
                     EKVDVLSREMETYRRGRIDQYRRWIKYAVHGPQYFVKLWFANRPVLYWRGGLTTSNNW
                     LTWMTAFPWGEKDSVTGMFWIVALERLLTVLVSFNEDVSRYRELRRCSSSKKDL"
     gene            <154840..>155727
                     /locus_tag="C5L36_0E00790"
                     /db_xref="GeneID:40385871"
     mRNA            <154840..>155727
                     /locus_tag="C5L36_0E00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467628.1"
                     /db_xref="GeneID:40385871"
     CDS             154840..155727
                     /locus_tag="C5L36_0E00790"
                     /inference="similar to AA sequence:RefSeq:NP_011496.3"
                     /note="PKUD0E00790; similar to Saccharomyces cerevisiae
                     YGL019W (CKB1); ancestral locus Anc_4.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323488.1"
                     /db_xref="GeneID:40385871"
                     /translation="MDYSSEEMEPWISQFCSMFGHDYFVEVAPEFIEDDFNLTGLSSV
                     IPYYKQALDVILDLEPESPLSPSDAPLVDHAAELLYGLIHARYILTKPGLHAMAEKYE
                     RNCFGSCPRYYCDGMHLIPIGRFDSPGIETVRLYCPNCNDIYLPSSSRYLNIDGAFFG
                     TSFAGMFMKMFPEIKRQSNERTRDIFQLKLFGFRLNEMAPCGPRMKWLRQWPSNEREY
                     KEFEMCKFGIPPLSVVDTVDADQMDEDAENSTNGGHGGSVDADKNKDADADDVDDDMN
                     SRKTGYHTNHSTEGGMSII"
     gene            complement(<155941..>156417)
                     /locus_tag="C5L36_0E00800"
                     /db_xref="GeneID:40385872"
     mRNA            complement(<155941..>156417)
                     /locus_tag="C5L36_0E00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467629.1"
                     /db_xref="GeneID:40385872"
     CDS             complement(155941..156417)
                     /locus_tag="C5L36_0E00800"
                     /inference="similar to AA sequence:RefSeq:NP_014746.2"
                     /note="PKUD0E00800; similar to Saccharomyces cerevisiae
                     YOR103C (OST2); ancestral locus Anc_2.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323489.1"
                     /db_xref="GeneID:40385872"
                     /translation="MARKDATKKPNTKKSSVSVIANAKNEANVATRSLKTQSQLGEPF
                     LAQITIPISATYSQYVKDLKGSSRLRLIDTFLAFLVAVGVVQFGFCVLGGSFPFNAFL
                     SGFGATVGQFVLTVALRLQSAESNKQLFKGLLPERAFGEYIFASLLLHFVLIHFIN"
     gene            <156646..>157476
                     /locus_tag="C5L36_0E00810"
                     /db_xref="GeneID:40385873"
     mRNA            <156646..>157476
                     /locus_tag="C5L36_0E00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467630.1"
                     /db_xref="GeneID:40385873"
     CDS             156646..157476
                     /locus_tag="C5L36_0E00810"
                     /inference="similar to AA sequence:RefSeq:NP_014300.3"
                     /note="PKUD0E00810; similar to Saccharomyces cerevisiae
                     YNL099C (OCA1); ancestral locus Anc_2.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323490.1"
                     /db_xref="GeneID:40385873"
                     /translation="MDTSGGPSMRDISQRVCAGEDKNVSKEKATEELVGKKDKSDKSD
                     ENDKSDKKDKKDKKDKKDKKNKKEKHAPPPGAVLITDLSSEGVLMGVDGAEDGEIMSI
                     PITPKFRVVPPLNFCPVEKNLYRSGQPSALNHSFLQQLNLKSIVWLAVEDPQDSFLKF
                     IDENNINFFYNLGYDSIGSNSWDGLSENSIKQALEIIADKRNHPLLICCGMGRHRTGT
                     VVGCLRKLQGWNLASISEEYRRFTGVKGGRILVELLIEAFDVNTVHINPQVAPDWLLR
                     "
     gene            complement(<157647..>158153)
                     /locus_tag="C5L36_0E00820"
                     /db_xref="GeneID:40385874"
     mRNA            complement(<157647..>158153)
                     /locus_tag="C5L36_0E00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467631.1"
                     /db_xref="GeneID:40385874"
     CDS             complement(157647..158153)
                     /locus_tag="C5L36_0E00820"
                     /inference="similar to AA sequence:RefSeq:NP_010517.1"
                     /note="PKUD0E00820; similar to Saccharomyces cerevisiae
                     YDR231C (COX20); ancestral locus Anc_8.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323491.1"
                     /db_xref="GeneID:40385874"
                     /translation="MGWWPFGKGNENTQSIENATSGQQHTETDKRDDLVLKQPIFLDE
                     VSGKFPESPQTRPPNGAEEQFSTSKEVKRFISTLKPEQFYLSNLVTIPCFREAGLSGF
                     TCFFVFSSVLFVYHKNLRKSVNWGFGGLLLGSIFGWEHCNNQRRNSLMAVKLAQERFE
                     KNHRERKE"
     gene            <158501..>160534
                     /locus_tag="C5L36_0E00830"
                     /db_xref="GeneID:40385875"
     mRNA            <158501..>160534
                     /locus_tag="C5L36_0E00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467632.1"
                     /db_xref="GeneID:40385875"
     CDS             158501..160534
                     /locus_tag="C5L36_0E00830"
                     /inference="similar to AA sequence:RefSeq:NP_014298.1"
                     /note="PKUD0E00830; similar to Saccharomyces cerevisiae
                     YNL101W (AVT4); ancestral locus Anc_2.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323492.1"
                     /db_xref="GeneID:40385875"
                     /translation="MSSFENSNVLSPHFEKAINRRQSTAKLSSSLANTPASASQLTTI
                     YRDRHSSASTNGGTEGNSVPRHSSSFSANLGSAMPSNSPRKPVFANSFYINTSTSPAV
                     ESDDESSASTSANANGNSNPTSNANMTNNDVMFHAVSPAGSYGSFVNDSTIVKNVAKH
                     LPTDPQNALKLPSGDITRDLYQLNQQSALRRSKSNEFLADRRGSMASQMRLPGGFRRD
                     FIQMKKQKFGYTLSQPSFLTKNFLEFLTIYGHFAGEDLEDEDFLACDIDTSSDKQDEE
                     SPLVSGQRHAVKEDTKKSSSLKAFFLLIKAFIGTGVLFLPKAFSNGGLVFCVILLFFF
                     SVLSYFCYYFLAQSTFTSGISSFTELGNKTFGKNLKRLILISIVASQIGFVAAYTVFT
                     AENLRAFVRNTVRLEFPLYYFVIFETICFAPMSLIRNITKLSIAALLANIFILTGIAT
                     IVFYTAKDLIKNGPAEVKLFNPDSWSLFVGVAIFAFEGIGLIIPIQQSMRNPEDFPKV
                     LLAVISVCCFLFIGIGWLCYATYGEDVQTMVILNLPQDSYAVISIQFFYSLAIMLSVP
                     LQLLPAIRLMEARLFKRRQSGRVDPKTKWYKNIFRVMVTLLTSTIAYYGSANLDMFVS
                     FIGSVACIPLVYMYPPMIHYKIVAQGRFARYVDAIIVLVGGVSMVYTTFLLFV"
     gene            <160792..>161463
                     /locus_tag="C5L36_0E00840"
                     /db_xref="GeneID:40385876"
     mRNA            <160792..>161463
                     /locus_tag="C5L36_0E00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467633.1"
                     /db_xref="GeneID:40385876"
     CDS             160792..161463
                     /locus_tag="C5L36_0E00840"
                     /inference="similar to AA sequence:RefSeq:NP_014299.1"
                     /note="PKUD0E00840; similar to Saccharomyces cerevisiae
                     YNL100W (AIM37); ancestral locus Anc_2.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323493.1"
                     /db_xref="GeneID:40385876"
                     /translation="MGRSFYKDEEEKYSVPGLPTVEQVKTEEKPDATTIAAAPETEVR
                     INKYGNLITTAPALQKLVSQIRESTEESYAKFIEKYEYITGTGKAHLAMAGHRIAEFK
                     GEDETLLPNICGVLTATLAGSIIARSHSFPIRFLFPVLFGSVALKYSLPQTYNNIATE
                     VKEIGLNVEEKYFPEFKQTRAGAAAKKEELFHSVDQLKEDSWNGLVSSVSSSRRFICE
                     TFKKD"
     gene            complement(<161578..>166125)
                     /locus_tag="C5L36_0E00850"
                     /db_xref="GeneID:40385877"
     mRNA            complement(<161578..>166125)
                     /locus_tag="C5L36_0E00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467634.1"
                     /db_xref="GeneID:40385877"
     CDS             complement(161578..166125)
                     /locus_tag="C5L36_0E00850"
                     /inference="similar to AA sequence:RefSeq:NP_014297.3"
                     /note="PKUD0E00850; similar to Saccharomyces cerevisiae
                     YNL102W (POL1); ancestral locus Anc_2.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323494.1"
                     /db_xref="GeneID:40385877"
                     /translation="MGKTDKLARLRAARSGAKIDDFDSEEENVNIYDVVDENQYRKHK
                     RDRVLNDDFIVDDNGAGYAENGAEDWDAQPNAYTSMDDEEEIEYNKENGKPKKLKKVK
                     MFKESEPVIPTKKIDSFFKVQPSQLEQRQKAKKSNDSSILEDILSDFTSQATSMMKKK
                     PTDAASKRKNPFSSLKSNGLNTSTPANKKTYVMSMSSNISDNKPFEFTSPSRKKQKVD
                     SNDETRDTTFYTAHQFEGSIPFETPSSPIRSNNFHSKANILDQLENVSMDVSTHENIK
                     NEEEEEEDDDDEDDDVIVSSKRNRNVVMVDRSVMLNGKKSINKAVDSSPLKNLKHIDI
                     GSSPSKASNISNMSNVSSITFEKLGGEDVVMKDDDGDDGIQMYWMDYIELDSSLLLFG
                     KIKSKDGRMVSGMVQVNGLCKTLYFLPRNGQARDQNQKSNPDESIATESYTAMDVYDE
                     IIPLLMDKFGLDSIKAKPEVKKYAFEHYDIPHEAEYLKVLLPYNTPKSQGVTIPADLT
                     GETFSALFGSGTSIFESFVLQRQIMGPCWLNITGCDFKSLQNVSHCNVEVAVSSPSDI
                     SPNLYTRDPPPPLNVLSINVQSYLNPKTSRQEVGSVSMALYRDLPQDVPIQPNLEPTE
                     EITLLRPVGGTTSLPISINALAEKRNIKLRTLNSEKILLNCLAGLIKKYDPDVFVGHK
                     LEGVTLDILLHRMKDLNISHWSNFGRRSRKVFPDKFSRSNGRYNLFLIREMLAGRLLC
                     DISNEMGQSLTPKCQNWELAEMFEVVCREKYTPMEVNLANPLVAEDPNKLLAAVNENV
                     LSARIIAKTAFGMQILSISKQLTNLAGNAWSHTLGGTRAGRNEYILLHEFEREGFISP
                     DRENQQQRQQRLNQKVNIDVDDENNDESNTVSNKKAKYQGGLVFEPEKGLHKNYILVM
                     DFNSLYPSIIQEYNICFTTVERANLVGDELPKVPSKRDMGVLPKLLQQLVTRRREVKS
                     LMKDPKLTPIEKAQLDIKQLALKVTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILM
                     DTRQLAESLGLTVVYGDTDSVMIDTMSDNYKDAIKIGEGFKEKVNERYRLLEIDIDNV
                     FKRLLLHSKKKYAALNVFFNSNGEESTTLEVKGLDMRRREYCPLSKELSEYVLNQILN
                     NSDPQEALNEIYTKLQDVREKFSKNAIPMVKLRINTKLSKDPSKYPNGVSMPAVQVAL
                     RLQDQGKVIKAGSVITFVITNGEPSEKAPLKNDQSSIASRARALVEVISNNEYTPDIK
                     YYCEKQLFNPIDRLLTRVEGYDVVRLADSLGLESQRYEAKARDIVQQNDLQPLESTIP
                     DSERFRDMKDFSLKCLQCSKNITFGGIQPSNLYQVTFQGIKCKSCNCFLPPLSISSQL
                     ELFIRKEISKYYECWLNCDDCGIRTRQISVYGRRCIGSNGTAHECKGVMSIEYNNKAI
                     YNQLLYLKSIFDVDKAKSKSLKPLAIDDENFKSASNQGEINALAEQNRSQFQIYQKVI
                     QKYLDVNGRRFVDLGSIFRNN"
     gene            <166480..>167391
                     /locus_tag="C5L36_0E00860"
                     /db_xref="GeneID:40385878"
     mRNA            <166480..>167391
                     /locus_tag="C5L36_0E00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467635.1"
                     /db_xref="GeneID:40385878"
     CDS             166480..167391
                     /locus_tag="C5L36_0E00860"
                     /inference="similar to AA sequence:RefSeq:NP_014749.1"
                     /note="PKUD0E00860; similar to Saccharomyces cerevisiae
                     YOR106W (VAM3); ancestral locus Anc_2.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323495.1"
                     /db_xref="GeneID:40385878"
                     /translation="MSFATPKKRKDEWDAVSALESGPLSSNDVEAVVERLRTGIQQQM
                     LRVSNITKAEKNLGTERDSATARELVDGYLQDCERIHRLLMQGESYLRGLIGTTGDGG
                     TGKLNLVTIDRLSEQIQNAQKAYVDVHRSYEAKKMSRSVQEKYELFQRERENLKNLET
                     DKTPLLSGKHNNAIYLDTPHGEGQMQMQVKVQTPEQVRNDEISESTLQLHADLIQQRD
                     NAITSISKGVQDINKMFKDLDAIVNQQGEQIDSIENNMMSIANNNQLATRELVKAEDY
                     QRRKGKCTCILLLVLVVILIIVLLVLS"
     gene            complement(<167611..>168395)
                     /locus_tag="C5L36_0E00865"
                     /db_xref="GeneID:40385879"
     mRNA            complement(join(<167611..168250,168364..>168395))
                     /locus_tag="C5L36_0E00865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467636.1"
                     /db_xref="GeneID:40385879"
     CDS             complement(join(167611..168250,168364..168395))
                     /locus_tag="C5L36_0E00865"
                     /note="PKUD0E00865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323496.1"
                     /db_xref="GeneID:40385879"
                     /translation="MLSLDESVGLFVRVITQHDQAIYGKIHSYSPRTLLTLIETPPNS
                     KSASSRVSQSPSPSDDEKYDKNAKFTAINIQHIKSIHALEKNKYTEKIHINDTFANKI
                     NAPCYIPKETLGYKIRNGTRDTRKQELEFRLRLMAKDKLSGEGLKLFRNLVNVIPIDT
                     FSIDPSGDIKFEDSAICILKPYKPGDVKVINGDDTQREKEQYNYIKKQVSSAWEKIEK
                     VEKGG"
     gene            <168696..>171668
                     /locus_tag="C5L36_0E00870"
                     /db_xref="GeneID:40385880"
     mRNA            <168696..>171668
                     /locus_tag="C5L36_0E00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467637.1"
                     /db_xref="GeneID:40385880"
     CDS             168696..171668
                     /locus_tag="C5L36_0E00870"
                     /inference="similar to AA sequence:RefSeq:NP_014272.3"
                     /note="PKUD0E00870; similar to Saccharomyces cerevisiae
                     YNL127W (FAR11); ancestral locus Anc_2.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323497.1"
                     /db_xref="GeneID:40385880"
                     /translation="MERPSINIRSWDRDFDPQTHAVSEDEIEGNEDNHDNNNDEDDDE
                     DEEGGGGVNDSYPSDEAKLAADAEVQEILSENDEEFPETLIDQNEMMETSDDQDIMGS
                     PHSSFSYDDTITDQEIDGLTNYNIILEYPQLNFKNDQLLSFIEELNDWFTFKDLQQLK
                     DILHISKNTRLSKLPVLRDNLIKYKNTQNGGKLLQELLSLAYLSMGSFNDARSHADIV
                     DKIRINISEMIKCEGLFEVLTDIIIESSAKLTEPTNLEVNVDMKQLKLISSHYFYSLT
                     IVFIMLLLFNTGELDDHKFKKSVNTLINEKEIMIEILKALDRWKWISINSDNEDPSII
                     LESMSSKVIDSEKIKVMVVSQFRLRNTLNFLNNLILFQFGDLKKLKATEDFLKFKFED
                     CKKSNKDEGKSITTLDYNYYVHELLCRYPTYTPPKLENSEILELIVKNEKPSSMSKLI
                     NVESLPINQHQNLKNSKENLFNMSNGPPEIHIATPMPSPTLTPQHTGNTKNCSSISEF
                     DHSSNEIKKKLYITQSSFPNIYPSTDNSNVPRSIQEAVNIFYNNINDDFNTKQFTTVF
                     EEFIVKENGIHTNSISDTSNKKDSFIFTEKDIEENPIFEDEIQSLQNVEEFYTKGLPY
                     LNSLVSIVLKLLNSNIIPSQQTDGKTRQRTPYTSKYQDAEKPYLSSKLNPFEKQKLEV
                     ERIKETMLKNASTIIMLLQEWFKLSHVLKFEYFSTLLYDQDFLIYLFRYLDSNKIQAF
                     SGKEVDFKEKDTLINNRIVYCDYKVLYYLEDYNFFKKCLALSTNKEKEIKHDDEIGDF
                     QSIFEKKTNKEDINPLSFILPFVPHSQVFTVINPNLRCCILLSNLLGSMYLTIEKFKI
                     QRIYKLIGLRPTEILRFYLTLHNEHFYSPILKTIKLISPFIGKKWRANNMDLISFVYL
                     FEKIGLKDPWLNNFLSVGIEENTKRGYDNESALRSLVKYYNYSNYGETLKKVGYSNDI
                     NEFMMDLEGTGDYFANNL"
     gene            complement(<171712..>173502)
                     /locus_tag="C5L36_0E00880"
                     /db_xref="GeneID:40385881"
     mRNA            complement(<171712..>173502)
                     /locus_tag="C5L36_0E00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467638.1"
                     /db_xref="GeneID:40385881"
     CDS             complement(171712..173502)
                     /locus_tag="C5L36_0E00880"
                     /inference="similar to AA sequence:RefSeq:NP_014273.1"
                     /note="PKUD0E00880; similar to Saccharomyces cerevisiae
                     YNL126W (SPC98); ancestral locus Anc_2.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323498.1"
                     /db_xref="GeneID:40385881"
                     /translation="MDMETVEEVVRDTQYLLLGADSRSFQFKTEPLLTVSITYTIRSN
                     SELQHVQDIVQLALIIKKLSLQPLTVFKSDVHAAFLDNINEIVRCFQTELDEIYTNNK
                     PTSLLEVNCKLTDWSVIFKHIYWLNIRCSTLNASDFLSLLFEYSLHGDTLIADHSLRI
                     FNSCKKNYFDLIQSWVLKGSFDSSCIDDSFFITKEKKFNSSKVPSFITNEFALKVYHI
                     GRAIDFIQNYLHHEEWVNDYYCYYCSEDFNQINVELLYKFVIDHLDESILTDFQNEVS
                     YLNRFLLFNQGDLINAIIEKGTLVLNKQASTLSSYQLIDLLKDSIDICSVSCNVPPDV
                     YNRIDARLLNIDIDTSIGWDLFTLDFKLIPPIQYIVSKSYKEYLRVFNFLLKIKHLRR
                     QLSLSWKKSNFNYKKSPHSVHNLKNYQRKFNLIRHQFISFIDTIFSYIENEILIVNFI
                     IFQQNLTPTRINLRNGKLLPVGDSMLNLDDLQRIHNDYILSISRSDLFSNDFNQILYQ
                     LIIIVQRFASLAIEFDQSISDIHQLESLNQSTDLSSHISSISLKIDKIMKKLNKDIVT
                     HFENCMNLLIQSLRNSSKSSLISLSHILEV"
     gene            <173885..>174742
                     /locus_tag="C5L36_0E00890"
                     /db_xref="GeneID:40385882"
     mRNA            <173885..>174742
                     /locus_tag="C5L36_0E00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467639.1"
                     /db_xref="GeneID:40385882"
     CDS             173885..174742
                     /locus_tag="C5L36_0E00890"
                     /note="PKUD0E00890; Pfam Domains: Mito_carr(1.3e-72)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323499.1"
                     /db_xref="GeneID:40385882"
                     /translation="MEEVDSILVDNVKSFASGGFGGVCAVLTGHPFDLTKVLLQTNQY
                     PSTAQAIKGTLAKNGPLGFYKGVTSPLLGVTPMFAVSFWGYDLGKRLVISNRGKSPDE
                     PLTIGEISAAGFFSAIPTTLIAAPFERVKVVMQIDKEKSSSGFAATVARLYKEGGIRS
                     IYKGSLATLARDGPGSAAYFATYEYVKNYLSKDNGQDDGLSLGAITVAGGLAGVAMWT
                     AIYPVDTIKSIQQSSSTRVSMSSVAKTLLKTKGIAGFFPGLAPALARSFPANAATFLG
                     VEFAKQLLG"
     gene            <175267..>176433
                     /locus_tag="C5L36_0E00900"
                     /db_xref="GeneID:40385883"
     mRNA            join(<175267..175664,175968..>176433)
                     /locus_tag="C5L36_0E00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467640.1"
                     /db_xref="GeneID:40385883"
     CDS             join(175267..175664,175968..176433)
                     /locus_tag="C5L36_0E00900"
                     /inference="similar to AA sequence:RefSeq:NP_011991.1"
                     /note="PKUD0E00900; similar to Saccharomyces cerevisiae
                     YHR123W (EPT1) and YNL130C (CPT1); ancestral locus
                     Anc_2.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323500.1"
                     /db_xref="GeneID:40385883"
                     /translation="MSIWIPQSSIGHLREYKYQSEDRSLTTKYILKPFWVKFERIFPT
                     WMAPNMVTLLGLLFIVVSDLLVMYFDPYYNKESPQWVYFYHAIAVFMYQTFDACDGIH
                     ARRTGQSGPLGELFDHCCDSMNTTLMVIQFSRNVIQTLKNEKREHEIDYAMKGLVTFI
                     SYYLMIVCLFIMYPTIWKDYTTTMLLTIGSCMSFTVGRIITGHLTKQEFPFVNFPMLV
                     PLTQSIAIELLTRVFDVEFDVAMQFTMYSGLGASLLIYGMFVTEIIYDITTYLDIWAL
                     TIKHPKPVKDE"
     gene            complement(<176558..>177211)
                     /locus_tag="C5L36_0E00910"
                     /db_xref="GeneID:40385884"
     mRNA            complement(<176558..>177211)
                     /locus_tag="C5L36_0E00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467641.1"
                     /db_xref="GeneID:40385884"
     CDS             complement(176558..177211)
                     /locus_tag="C5L36_0E00910"
                     /inference="similar to AA sequence:RefSeq:NP_014268.1"
                     /note="PKUD0E00910; similar to Saccharomyces cerevisiae
                     YNL131W (TOM22); ancestral locus Anc_2.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323501.1"
                     /db_xref="GeneID:40385884"
                     /translation="MSADAPTYSTNEVEAVLEQAVADAEAQVEQLEEQAAEEAVEEAV
                     EEAVEEAVEEAVEEAAVEAAVEEAVEEAVEEIEKKFAQEQSDAAVLAAASASTKEDSD
                     DETSEDEDEDDFDPSDETILDRIEALKDIFSPAQRSFFTSAYSKTISFAKSSTFNIGS
                     ALWYVATTSMLVGVPLAVAILNETQLTELEKELNGQGLGAPAVAPAVSAAPATEEAK"
     gene            complement(<177539..>178129)
                     /locus_tag="C5L36_0E00920"
                     /db_xref="GeneID:40385885"
     mRNA            complement(<177539..>178129)
                     /locus_tag="C5L36_0E00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467642.1"
                     /db_xref="GeneID:40385885"
     CDS             complement(177539..178129)
                     /locus_tag="C5L36_0E00920"
                     /inference="similar to AA sequence:RefSeq:NP_011990.1"
                     /note="PKUD0E00920; similar to Saccharomyces cerevisiae
                     YHR122W; ancestral locus Anc_2.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323502.1"
                     /db_xref="GeneID:40385885"
                     /translation="MSDEPINANPTVKDTSQLPTRETKTTLRTFPHEQYEAGLDSLVT
                     QYLFDCDNEDQRDDEDNGPDEPLDAQEIYDLIASISDPEHPLSLGQLSVVNLPDISVQ
                     QPNLEKGELGHVCVQITPTITHCSLATLIGLGIRVRLDRSVSKKYRPQIIVKEGTHQS
                     EKQVNKQLNDKERVCAACENPQLVKVVSQMLSTCVV"
     gene            <178567..>179667
                     /locus_tag="C5L36_0E00930"
                     /db_xref="GeneID:40385886"
     mRNA            <178567..>179667
                     /locus_tag="C5L36_0E00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467643.1"
                     /db_xref="GeneID:40385886"
     CDS             178567..179667
                     /locus_tag="C5L36_0E00930"
                     /inference="similar to AA sequence:RefSeq:NP_011986.1"
                     /note="PKUD0E00930; similar to Saccharomyces cerevisiae
                     YHR118C (ORC6); ancestral locus Anc_2.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323503.1"
                     /db_xref="GeneID:40385886"
                     /translation="MSSLFITSAIRDLIPTHPEPYPGELVNFAHSLYTASKMNVPLSG
                     SDEIARYHLACYTVVEYFKDSYSLPDPFLTKIPIPSKRFNQLLFAFKTTMTTITQNTP
                     KAKRIVDVQLQTPSTTPFSSKSTESYIDKIRQSKLKQQDLQQQQVNRSLTNQLLEVAA
                     TPPSTPQKAPRSKRTQLSPSKLSPYKARAKLVITTPILVSFCNKFYIPEHITMHILQT
                     FKLYKHVVPNGWGLLVGLVGISYMKLNKQRISKKLNLKTKLFKLLHVTQQGGLSYDEC
                     KQYIREVTRMICTQKWIKEAKYDFDTDTETESLMKGIAASDSVMSSLGSFLDSSVLYV
                     TMKDSPKVQKWVKSIRRTTPSTPARSPAPATI"
     gene            <179985..>183056
                     /locus_tag="C5L36_0E00940"
                     /db_xref="GeneID:40385887"
     mRNA            <179985..>183056
                     /locus_tag="C5L36_0E00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467644.1"
                     /db_xref="GeneID:40385887"
     CDS             179985..183056
                     /locus_tag="C5L36_0E00940"
                     /inference="similar to AA sequence:RefSeq:NP_014276.1"
                     /note="PKUD0E00940; similar to Saccharomyces cerevisiae
                     YNL123W (NMA111); ancestral locus Anc_2.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323504.1"
                     /db_xref="GeneID:40385887"
                     /translation="MAPETKRIYPQNGDAISPRKRQHINPDALGTDITVEDETAFDIQ
                     EDYDSDEVAQVAYIPQSETKWQKTVEKVVKSVVSIHFMQPVNFDTETSLCSEATGFVV
                     DAKQGIILTNRHVVGPGPFIGYAVFDNHEEVEVTPIYRDPVHDFGFLRFDVSKIKYMK
                     VQQLELHPESARVGEEIRVIGNDSGEKLSILSGFISRLDRNAPDYGANTYNDFNTEYI
                     QAAASASGGSSGSPVVNIEGHAVALQAGGNSETSTDFFLPVWRVKRALERVQACEDVT
                     RGTIQVQWTLEPFDKCKRLGLTSDVEGEIRKLGSDINGMLVASITLPEGPADGSIKEG
                     DCLVSINGELITSFVQVDKILDENVDKECEFIVQRNGVNITNTIKVGDLHKITPSKYV
                     TVCGATFNELSYQLARIYGIPVRGCYVSDASGSFQLGGQELNNCWIIDSIDDKPTPTL
                     DDFVEVMKSIPDKSFIPVKYHHLTDIHVPLFKNIFIDRHWCSTFRLATRNDTTGLWDF
                     ETIQKEPIKPLPLERKSAKFLDLPTEFENCKQLNRSFVQVDAIYELPLDSFGGHVRRV
                     HGIVIDAKNGYVLVSRHAVCHDLCDINITIAESIIIPGKVRFLHPTKGYAIIKYDPGL
                     VDAPVQTPKFSQEPLKRGDKVVFIGYNKSLRAVIDETRVSDIGIMNIPTNANSPRYKA
                     TNVEAVLVDSTSGQKCHSGILCNKEDGTIRGIWISCDGDDDRLYTTGIDITDIMWELE
                     FLKDDDNKMKDNEDNEDEMKDDEKTKDNDKTKDDNKNTDHDDDVKIIDVEFGTVSVAS
                     ARISGVPDEWITKVETSSKVDKFQFLYVPTTSVGLDNEPTCLLEPGDIILTANGELVT
                     RMRDIDNAIKGTSKNEDIIKFKVVREKKVIDLDVKLTRTKSFMTDRVVFWSGCALQNA
                     HHGVRQAINSLPSGIYCTTISNGSPGRFYSVGITNFITHVNEIPTNTLEEFLNVVRKV
                     KDNSYVKLRVVTFDSIPMAQTLKVNYHYFPTVNIQKINGEWKTTVDRQDDN"
     gene            complement(<183213..>183485)
                     /locus_tag="C5L36_0E00950"
                     /db_xref="GeneID:40385888"
     mRNA            complement(<183213..>183485)
                     /locus_tag="C5L36_0E00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467645.1"
                     /db_xref="GeneID:40385888"
     CDS             complement(183213..183485)
                     /locus_tag="C5L36_0E00950"
                     /inference="similar to AA sequence:RefSeq:NP_014277.1"
                     /note="PKUD0E00950; similar to Saccharomyces cerevisiae
                     YNL122C; ancestral locus Anc_2.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323505.1"
                     /db_xref="GeneID:40385888"
                     /translation="MFTFSLTSFIRPVVSSFRASLQVSALRHQSKTHRATYKRWRKTA
                     SGYKRGIQGRKHGNAGFAASVLKKRTGTAYSTHTQSKILQRLLPNL"
     gene            complement(<183845..>184369)
                     /locus_tag="C5L36_0E00960"
                     /db_xref="GeneID:40385889"
     mRNA            complement(<183845..>184369)
                     /locus_tag="C5L36_0E00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467646.1"
                     /db_xref="GeneID:40385889"
     CDS             complement(183845..184369)
                     /locus_tag="C5L36_0E00960"
                     /note="PKUD0E00960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323506.1"
                     /db_xref="GeneID:40385889"
                     /translation="MSRFVDEDEADVQTARDVAGVIGERDAVELAKELAEDDAEANEH
                     EVEKKRRSLHQQLAAYRYNRYKEHKKKMETQNSSYKMRKDTRQFYGKLEAEKAAKKQQ
                     ETQEFASELERFRRAKERAADDDSLSTSSSDSEAGGLHEKEKNNKKEDGLNRGVNAIV
                     EYSDSDNSSDNSTQ"
     gene            <184671..>187922
                     /locus_tag="C5L36_0E00970"
                     /db_xref="GeneID:40385890"
     mRNA            <184671..>187922
                     /locus_tag="C5L36_0E00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467647.1"
                     /db_xref="GeneID:40385890"
     CDS             184671..187922
                     /locus_tag="C5L36_0E00970"
                     /inference="similar to AA sequence:RefSeq:NP_011987.1"
                     /note="PKUD0E00970; similar to Saccharomyces cerevisiae
                     YHR119W (SET1); ancestral locus Anc_2.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323507.1"
                     /db_xref="GeneID:40385890"
                     /translation="MSYRGDHYNKSTSHSNYSGIAQDKGRRSTDNQYSYRNQHSYHSV
                     HQGQPNHTGQQHRDPNAGTYPHYGQSPSYRHSYWDYPNDPGDYDGQTYHRHNNHMDSF
                     YSNSSSYNAQMNRLSSQQYNGNYIDNSQRPTSKQKQPVHSSQGNNSNGESKPTQSKPK
                     AIIKSYNLGDAKQGNFISEMNKPFNSTEKIKSWKVSQIKDPVTQKVKLNMKYIDNPLE
                     KTIIDPRKNSTSNYSKALQKSVCPPIGNLKIPTFKFDKYSLGEKPSNEIVIWNLHSTT
                     SSLVIKNNLSVYGSILELKMVDDPLTAVPLGMCTVSFDGKVEQAHKIALKVIETCNKK
                     LLIQGRYIRCGLNVRNMLYNEIYEKSINARNEHLKKRTAEEIKREEKNKAELERIERA
                     KKEEASRREREARGARAAKESKDGPSRESNSNEPVGTISRKLPLSHDKRILPLSAFQL
                     NYKLQKIVSNRPYIFIADKHVSSMNVSSDHLRRFLRKYNISRILQQRSGFYLVFNKVK
                     EALECFDEADGRRYFNYRLLMTLYIPDDQIDQTRVGKAGVFKAAKDQISKELNAYLLK
                     DVREKIISQMILDILETDEIGEFAKEARIRKEEELKLIEKQEPVKSIHETVRVVKKID
                     LNIFKKSTKKRFVPLSHALNKDVQKSDEDSDDSDDSDDAHADRENNLKVKEDTAENPQ
                     KHTLEAVDNKPPKKKFKVTKPGEDLCEEEEGEQAPPISDDDAKMLDDTMSEITSPENG
                     GESKIYDIYSPSTNPPGPVFDDISQPFKPTIGHLRNLVKTDEDFAILSELCKDTKNDK
                     PIKNMEFWVWQHTQYVQECKKALEKDERDKEKSESDEVLDFAKEVLSNKDLKNVSGCF
                     RTEPYHKISDNLKSGYLLHRRKLTNLNPVKHENKDESIHVQHNNAQGSRANRANTRRF
                     VADISAQKQIIGETDLLDLNQLNKRKKPVQFSRSAIHNWGLYALEPISAGEMIIEYVG
                     ERIRQQVAEIREKKYLRSGIGSSYLFRVDENTVIDASKKGGIARFINHCCDPSCTAKI
                     IKVGGKKRIVIYALRDIRKNEELTYDYKFERELNDQERIVCLCGSPNCKGFLN"
     gene            <188184..>190170
                     /locus_tag="C5L36_0E00980"
                     /db_xref="GeneID:40385891"
     mRNA            join(<188184..188219,188671..>190170)
                     /locus_tag="C5L36_0E00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467648.1"
                     /db_xref="GeneID:40385891"
     CDS             join(188184..188219,188671..190170)
                     /locus_tag="C5L36_0E00980"
                     /inference="similar to AA sequence:RefSeq:NP_009916.1"
                     /note="PKUD0E00980; similar to Saccharomyces cerevisiae
                     YCL011C (GBP2) and YNL004W (HRB1); ancestral locus
                     Anc_1.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323508.1"
                     /db_xref="GeneID:40385891"
                     /translation="MSETMDFEDYSRDRSRSPARDVYIGEGRRNRSRSPRRDDDDRRY
                     QSSYRGDSRRSRPPRRGPPPRGSYAQRSSDYEIKANRKYENSIFIGNLPYNTQWYEIK
                     DHFASAGPIVRADVVTSHGKPRGMGTVEFQDRESAQNAIRMFDRTSFKEREIFVREDL
                     PPPEKQNGRDEFRPGKYDRYDRPPRDDRYDRPPRDDRYDRPARDDRYDRRGGYDRYYD
                     RYDGYDSYDRRDRFSRDTYAPPRRDFRREPKRERREARGFEVFIGNLPFSVKWQDLKD
                     LFKEIGEVERADIIESTPGRSRGMGTVHFYNEADVEKAIERFNGFEWFGRKIDVRPSK
                     FPKDDRAVPSTPKIRTDGLSKNTDFTLGVTGDGEESPIIYASNLPWETAESDLFELFG
                     SIATVERAELQYGRGGNSSGNAVVKFSDVETARSVIQQLNGYEYGNRHLKITFAKFPS
                     AEQLEALHEEIRKNTEETISSGLAEAPIERTSPVSEEHSKPAANPIEQSGAVDDGDEM
                     IEE"
     gene            complement(<190486..>192690)
                     /locus_tag="C5L36_0E00990"
                     /db_xref="GeneID:40385892"
     mRNA            complement(<190486..>192690)
                     /locus_tag="C5L36_0E00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467649.1"
                     /db_xref="GeneID:40385892"
     CDS             complement(190486..192690)
                     /locus_tag="C5L36_0E00990"
                     /inference="similar to AA sequence:RefSeq:NP_010494.1"
                     /note="PKUD0E00990; similar to Saccharomyces cerevisiae
                     YDR208W (MSS4); ancestral locus Anc_8.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323509.1"
                     /db_xref="GeneID:40385892"
                     /translation="MIVPTNEEGLLSPSSSTLPSLSKTSSPNKSILLSKSSSDAIITV
                     SSKDTGMTSVEGNKLLQLPSEQNDKEISIDNVTLKTTHTSITTNTPRLHDTDAIPSSN
                     LQLPTTLSHSEILQSTIKPLSDDNDNFKVSVAMDEPKEHTDDRSSTRSSTSSTQNIGF
                     SHLEISDSIHRLHSYRILADPNFNNKSTKSIGPTSISSNVGLVSKSDCNTCPIPLPHS
                     DPLPVDLEMTCSHLKVKNNTFPRSAADNQLIQLEAANQERNNSKSYHNHHSHKERSKF
                     QSISTIRIPDNYQKTELALTKADNGLPQGFSSDPRKKQRASKTQSLIHASRKKVKLKA
                     DDLYNIPGQSISEDHGSYAIVYDLVTGIRFSVSRCTKIQDQITDQNFNEVVRMIFNRE
                     GNNQAPPTKYEFKFKDYAPEVFRDLRRMFNVNQADYLMSLNDEIGIRAVGSSGKSGSS
                     FYYSNDRKFIIKTIHRSEHRHLRRVLKDYYYYVKKNPNTLLCQFYGLHRLKMSTRTGT
                     VKVHVLVMNNLLPLTVNISECYDLKGSTQGRYTSKEKQQKGSCQKDLNFLENHVKIHL
                     SSEKRVKFETQLKQDVALLKRLNIMDYSLLLGLRHINKNNNEVLDEEFKRVSQIVHKE
                     VPGAHKSTITDTDGGILAVDPNGNDMDLIYYVGIIDCLTNYSTLKKLETFFRTLKHRR
                     ESISAIPPIEYGDRFLRFITSNIESPGIMVPPKHHQGRFRAFKRITAHGHTA"
     gene            <193336..>196296
                     /locus_tag="C5L36_0E01000"
                     /db_xref="GeneID:40385893"
     mRNA            <193336..>196296
                     /locus_tag="C5L36_0E01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467650.1"
                     /db_xref="GeneID:40385893"
     CDS             193336..196296
                     /locus_tag="C5L36_0E01000"
                     /inference="similar to AA sequence:RefSeq:NP_011988.1"
                     /note="PKUD0E01000; similar to Saccharomyces cerevisiae
                     YHR120W (MSH1); ancestral locus Anc_2.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323510.1"
                     /db_xref="GeneID:40385893"
                     /translation="MSFLKQLSGIWKCPGSGSCFYAARFIWPTSIHRRVFSCTTTKRI
                     QPLQNDGDGDMVVTSQELNSMQIIIPSKEAAPENLPHVRRKTGYKDSEERKPALDMDE
                     LNGDTMIEDAGDNLVLGSGSGTGSGTYTDFYQGIIDTYKTYLHRHDGEYVVLVHVGSF
                     YELYFEQAEKYSNLLGLTLTKKVLKSGAIPFSGFPDKMLDKYLDIIYKNNLKAVICNQ
                     VLDPITNTLSRPVDRIMTPGIVIDETCRDFHRNNFLMALHFPEEMRKNAENVKVGVAW
                     CDVNLGNFHVLQIELSQLLATLTRINPAEILISDKVDLEKILDGSILPDLMEMKAYYI
                     SRLHSPATKKPLDEFTWRFRDNERLVSNIFDGLLQREKMAASIVLHYLDICLPNYKTS
                     FHLPSRSKPKTIMQIDSRAAQDLELLETIQSRKKVGALSHLMDKTVTSPGARRLNSWL
                     LAPSTKIEEIKYRHDLIELFSKDTYFLDLLCQYLRKTADIDRKIRRIDNRKAERLEYL
                     ELAYTIETVDQIYNLIKQAFDKKSLPLIEPIFEEFNNSKRLHGLAKHIRKTIDPRVAY
                     MKTSNNKSEGDFVRTFWDIKDTASSRLGKMRKNYESLVRESDNLRNHLQKIFKSEGYN
                     GSLRLIKDPKSFDYVVELKSTSKIITGMIQNLNLNVKEKSKSVTKLVNSQWTNIGQDL
                     IKLEYDICLEENHIMADLDNKVDKLYKEIRKIPPIIELLDVIQSFSRLALQCNLSRPV
                     VDDSDSFTIKNGRHLVVEEGLKNRLDVVNFTPNNCHLESSHAWVITGPNMGGKSTFLR
                     QNALIAIMAQIGSYVPADFAHIGIIDKIFTRVGSSDNIFKHQSTFMVEMNETAIILRE
                     ATPKSLVIVDELGRGTSINEGVAIAYAALLSLTTVKKSKVLFATHFGPEIARLLNQEE
                     TMKGSISFYRTTLDTVPSGDKNVTSKVTFNHKLEKGTSSHSHAIQIAGLAGFPGDVLQ
                     NAEISLEKLNNMYR"
     gene            complement(196343..196415)
                     /locus_tag="C5L36_0Etrna11A"
                     /db_xref="GeneID:40386398"
     tRNA            complement(196343..196415)
                     /locus_tag="C5L36_0Etrna11A"
                     /product="tRNA-Ala"
                     /note="PKUD0Etrna11A; codon recognized: GCA"
                     /db_xref="GeneID:40386398"
     gene            complement(<197704..>199491)
                     /locus_tag="C5L36_0E01010"
                     /db_xref="GeneID:40385894"
     mRNA            complement(<197704..>199491)
                     /locus_tag="C5L36_0E01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467651.1"
                     /db_xref="GeneID:40385894"
     CDS             complement(197704..199491)
                     /locus_tag="C5L36_0E01010"
                     /inference="similar to AA sequence:RefSeq:NP_014275.3"
                     /note="PKUD0E01010; similar to Saccharomyces cerevisiae
                     YNL124W (NAF1); ancestral locus Anc_2.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323511.1"
                     /db_xref="GeneID:40385894"
                     /translation="MCNQESREQLDIKGHTSASITNSKNADRMDGHESTNDEMRQELR
                     EEDTIASTNRKSKDEDNSQVVTEEEIFDINKVVKYSSDEESNDDEDESSDHDSNDEAK
                     NESSTHDSSDESSDDCSTDSSSDDDDESEKTTNNVVCDDEINEDETDGPIISKNEIVD
                     FKVPTLPTDYKIEPETNIQYVGKLSGVVEKNVMIECEYSAEEKVLGEGTVFCTEDRQP
                     LGLLYEVIGRLQSPVYTMKFNSVEEAEKFRERKGQRVYFIVPTAEILSTRYIKSFKGT
                     DASNCHDEELPEEEQEYSDDEKEAEAKKNKKRKRKQVHKEKAETEEVQKEDRSKTSQE
                     SKKPRNIATSNTQVGPLPKSVKARLTSLPAAKTRQHSQKEEPQQNKGMPVPSIPQNQP
                     PLDNMSMIQQFMGMLQQAASLPMQPSQHVPPGQNYNPQYNTQYNTQYNSQYSPQYSTQ
                     YSPQYSSQYNLQGNSQYNLPYNQQYSQSYDQQYVQNYNPPCGQQYGQAFGQQLTQPYG
                     PQFTSNSNNSYNVTNPSPAVSTANIPNANPNIPDGNARLIAQIAEAISKNPQTANLAL
                     GQLSTQTQSQQSNSTDENPAEDVYDPAAP"
     gene            <199809..>202469
                     /locus_tag="C5L36_0E01020"
                     /db_xref="GeneID:40385895"
     mRNA            <199809..>202469
                     /locus_tag="C5L36_0E01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467652.1"
                     /db_xref="GeneID:40385895"
     CDS             199809..202469
                     /locus_tag="C5L36_0E01020"
                     /inference="similar to AA sequence:RefSeq:NP_010812.3"
                     /note="PKUD0E01020; similar to Saccharomyces cerevisiae
                     YDR524C (AGE1); ancestral locus Anc_1.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323512.1"
                     /db_xref="GeneID:40385895"
                     /translation="MSIFEIVERSSLPEGVCPLIESLSFVDSKNEDGIAINMNSKCII
                     PSDKLEEVSVEGMDGGRIKLLRIPYGYNELSINFNEGVDISLVKCVITNGNKSCAFGG
                     TMLKSGISLSEDAIGSVSIQLLYDENKDFTFTFYRALPQKSLVPNKTHHQDTQTNEAL
                     NPYPIPMTDGPLFREAVSLYEQFASLLLKKFHSRIEKLSSVSHTSKNTEHKSQMRETF
                     KEFRKGFSVTPKPESLVSKYESAKAVTGNCYAYQFLVQIYRKDNESSVGRSSLRNLQN
                     FLSCKRGFDDESKKYYEWLSKLLGSGKSKDLKLFMRMSSFEASKLRYFNYLYDTVTGC
                     LLEMLKVDERIASEYLRCKAARLQLAQKIESVGMMKDLLEFQKNVSSFNVQNEALFLK
                     DPTSPYKLTSQCPSKTGLLFVHGGQGKSGWHKQWVVLLDGKLYEYMDWRRGSGLRNNP
                     IDIALCNIKLLESNETRMSVDIGHRKNCFRLINSQGIEHVFQAFTIEEATDWVKTLFD
                     ACQMIAFNDSNGKKKITGELSNNGNHDRSSRKIGKDKDNTASDAESSRAVKTSVGTSA
                     RSRMRRVSSVSQSLLYFVQGNDPSNYKCADCGTTEQVEWISLNLLVVFCIRCSSAHRS
                     LGTSVSKVRSLILDSFNEESKVLIHQINNSSMNAIYESDMPPKVKPAAQSSDEVRYRF
                     IKQKYAEKKYVNNFVRQNALPIMIEGIRNHNIRKVLEGIVGGADVNRRFYYTPQSKNT
                     VSEPSSNSHHENDKPIDMSFLEYALLHPTVLDGRQIFDIAELLTLNGCNVGSQVKKGS
                     LLSNSAKKWWQDRIDKINYIPLENQAKNTPLKAQQDSFEQRDPTIKRPSIMVNGSKKT
                     ANGSKSKIKNPKEGFSLFRKKTKSGLRSAD"
     gene            <202656..>203516
                     /locus_tag="C5L36_0E01030"
                     /db_xref="GeneID:40385896"
     mRNA            <202656..>203516
                     /locus_tag="C5L36_0E01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467653.1"
                     /db_xref="GeneID:40385896"
     CDS             202656..203516
                     /locus_tag="C5L36_0E01030"
                     /inference="similar to AA sequence:RefSeq:NP_014270.1"
                     /note="PKUD0E01030; similar to Saccharomyces cerevisiae
                     YNL129W (NRK1); ancestral locus Anc_2.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323513.1"
                     /db_xref="GeneID:40385896"
                     /translation="MKILTLVAALMVGYVILLVNPMMRTILIGVTGASSSGKSTIANI
                     LRTILRNCEIIHEDDFFKLEKDVPFDKKRNDRDWDCPDAIDIDKLKKTLALLKNGNMK
                     STYLSGFPVIRNEGGYYDYSLKSTEPPRNDSHFKCKPQTISKLKNEFDLLVNKRRYGE
                     YRIFLVDGFLILHDVELLQQLDLTLFIKANYSTLKSRREKRIYTVEGKEWVDPEGYFD
                     KFVWPGYYNNHKKIFINGSDEEVVKLSGGDLDAKFKYRYRVNEFRNDEYTNADDMIEE
                     ITTCIFRTIF"
     gene            complement(<203559..>206780)
                     /locus_tag="C5L36_0E01040"
                     /db_xref="GeneID:40385897"
     mRNA            complement(<203559..>206780)
                     /locus_tag="C5L36_0E01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467654.1"
                     /db_xref="GeneID:40385897"
     CDS             complement(203559..206780)
                     /locus_tag="C5L36_0E01040"
                     /inference="similar to AA sequence:RefSeq:NP_014267.1"
                     /note="PKUD0E01040; similar to Saccharomyces cerevisiae
                     YNL132W (KRE33); ancestral locus Anc_2.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323514.1"
                     /db_xref="GeneID:40385897"
                     /translation="MSTSINNTNKKKVLDSRVPALIRNGVDTRQRSFIIMVGDKSRNQ
                     IPNLHYLMMNANLKMNKSILWAYKKKLLGFTSNRLNREKKLKKDIKRGVREANDLDPF
                     EAFLSNNQIRYVYYKETEKILGNTYGMVVLQDFEGLTPNLMARTIETVEGGGLVVMLL
                     KSMKSLKQLYTMTMDVHSRYRTEAHNDVVSRFNERFLLSLSDCANCLVVDDQLNVLPI
                     SGARHVKRLPPKDEDEISPKEQELKELKESLADTQPAGSLVSLAKTVNQAEAILRFID
                     AIAEKTLNSTVALTAGRGRGKSASLGIAIAAAIAQDYSNIFVTSPSPENLKTLFEFIF
                     KGFDAIGYVEHQDYDIIQSTNPAFNKAIVRVDVKRAGHRQTIQYISPTDNHVLGQAEL
                     LIIDEAAAIPLPLVKKLLGPYLIFMCSTINGYEGTGRSLSLKLIQQLRDQSKNIIKDN
                     SQTQVVSRDDTSGTKEIDNISISNRSLIEVALDEPIRYAPGDPVESWLNKLLCLDAKL
                     PKQTKYATRGCPHPSECSLFYINRDTLFSYDPVSESFLQRMMALFVSSHYKNSPNDLQ
                     LMSDAPAHQLYALFGPDVGKDASIPTPLCVVQVALEGEISKDSIRSSLSRGIRAGGDL
                     IPWLISQQFQDEDFASLSGARIVRIATHPDYTKMGYGSRALELLTDYFEGKFASLDED
                     NKTLSDDKFSIKRLTDSELENASVSLKDEIKPRKEDALPPLFVNLAHQRPYYLHYLGV
                     SYGLTQQLHKFWKKSGYSPVYLRQTTNDLTGEHTCVMLKTLEGRDDKWLHAFTKDFHK
                     RFINLLSYSFSKFPSVQALSVLEASRVEGHKNAATFDKNELDKMLTPFDLKRLESYAN
                     NLIDYHVILDLLPYIAYQYFSDIIRDEVSLSHVQSAILLAIGLQHKELDDISKELNIE
                     TNQSLAMFSKIVRKVSQYFRSLVKESIVEELPEIDDDEMKELNGEEIPTVNDVEEMER
                     ELEADLAAAGNEALEEIRERKEKQKELINNLNLDKYKITDVSDWSSDKKSIDRAIKNK
                     GTVSLKKGSKRKPAESAEDVYKSEMKALAKDKSKSTRGKKSRK"
     gene            <207348..>209501
                     /locus_tag="C5L36_0E01050"
                     /db_xref="GeneID:40385898"
     mRNA            <207348..>209501
                     /locus_tag="C5L36_0E01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467655.1"
                     /db_xref="GeneID:40385898"
     CDS             207348..209501
                     /locus_tag="C5L36_0E01050"
                     /inference="similar to AA sequence:RefSeq:NP_013531.3"
                     /note="PKUD0E01050; similar to Saccharomyces cerevisiae
                     YLR427W (MAG2); ancestral locus Anc_4.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323515.1"
                     /db_xref="GeneID:40385898"
                     /translation="MSQKSGDGLPLLACVGEVVQPRRQTNIGDNKKSSPGSTKKTGSR
                     NRTRHNSSKRNLRTVVKNGNIRTGVDDDNCSNDINSILKASKKGQNISHLLSYSYIND
                     ESDYFYNDYKPREKHQKPFRRNNKPFRTEIHLSGLSYINANYKFILKHDGDYRAQMLD
                     PNLPLDTNSIARVMVKQHDYHCPICLGDEFVAPRMTNCGHIFCYPCLLDMFENARNDK
                     SKTSLGNMHNPFISCPLCSETIRERNPLLPVLIEHVHTGSSKVSEKTYVTLPLMHREK
                     SKIYSQQVSNFYQSKAFRGSIPWISSNCTPLNFKQYSPYINHSRLILSDTNFVLACFN
                     KEIDDLMTQKLIDCEMYGSSSEPFDKAIVKIKELVSILENERTSSTKITRGPPQAENA
                     SLENIMAGMSLSEEVTLPPYNEGYYYYECDVNSRIHYFLSPLDTLVIKHLFGMPLSKE
                     IDESLSNPAYNLPLALNLYIENINSEEGRVTPELVSKNPYLGNIPYGAEIEFLEIDWT
                     KFDNSFIPLNENDTAQIFTDSKYPIQIPPSLVKKLQARTRNIRNKRTSEEKARIRGER
                     RRERETLEVFNRDDNRNALAEEEDEIIDMLSENRWERNEFVHIDPVSNTPMLKGVVNP
                     LRPFDAAHAKKNVTDNNETGTGGSVGSDVPLMTTQTSVWGTRVPVVLDPEEEALQAEE
                     TREVEEMIRKAKAQALSNGKKGKKGRKVKMVPLPM"
     gene            <209798..>210673
                     /locus_tag="C5L36_0E01055"
                     /db_xref="GeneID:40385899"
     mRNA            <209798..>210673
                     /locus_tag="C5L36_0E01055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467656.1"
                     /db_xref="GeneID:40385899"
     CDS             209798..210673
                     /locus_tag="C5L36_0E01055"
                     /note="PKUD0E01055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323516.1"
                     /db_xref="GeneID:40385899"
                     /translation="MLKNFSRTLSRWNFVQRGRVARFVSQAPVIARRNLSSKKTQKTE
                     AKLSFEEESDLYVLGEVISSIEKYNAENKRVTEVVEQFKHAFLLNGIEIVKAPVPGLE
                     STKTDILHFSKSVDGTTKIDLIVDFKKVFNEDAREIQVVITDETKVSQLFYLMGDFSR
                     EDGMLFSNSMMIDSLEYNKTAVELRDAICDGEAWVFRMLNNKFQKTLDVRNVNVVKFL
                     SNIKRDAGEALDSLDSRTFVDALINYTVLTHLGVLKGHDEGDKLCSIFWLFGNYCENT
                     LYGRWLQDMMCCLKR"
     gene            <210909..>213125
                     /locus_tag="C5L36_0E01060"
                     /db_xref="GeneID:40385900"
     mRNA            <210909..>213125
                     /locus_tag="C5L36_0E01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467657.1"
                     /db_xref="GeneID:40385900"
     CDS             210909..213125
                     /locus_tag="C5L36_0E01060"
                     /note="PKUD0E01060; Pfam Domains:
                     PMT(5.1e-25)|MIR(4.7e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323517.1"
                     /db_xref="GeneID:40385900"
                     /translation="MPEIKGVYSHGGSLSNIEAISLRMGPIRPYVHINETQIQKRLNT
                     NVYELFQLLAAVTITIVIRLYCIEFPNKVLLEEIPIVSAINSYLTGRFFLDINPPFVP
                     LLFSALSRSLGYGVFTFEELSINSEYDSFPYQHLRVLNAIVGGLAVIYIYKILKISAV
                     NHYYALFGVFLFALENSMITQSRFMFTDSFYILFVAIFVCHHKLMSLKTKFSASWFFN
                     LLICTTALGLAISTHWSGLFLIVYAFLSSTITFWIASGDIDVSMNYLRIASLIKDFAY
                     LTIPFTIYLYFFNLHLSHLDSRGESYNLLSPAYQHSLKETHLDGLIADVSYGSTVMIR
                     HFKSGEYLHSHNDFYRTSKHQQVTLFDNFDDFNNFFKIYPVKGNSDRIMNDAMKIFVP
                     HKVKIKHVATDSFLVADSDFKPPLSEQEYNSEVTTQKDFSEMEEDTSEFQLKISTKYT
                     KDEKARVSLRAIESVFQIYNKRSDCYLLGTPLLLTEGFAESQHELICIKEPEYEASLW
                     YIDWNKHDKYSIDSGLVDFPELGFWDKFVEIHFKVFKKLFVGDIGYNNGFSVSFTDWL
                     FLRKGYVHFLDTEAHSAVYLLGNYITYHLVILVIFIYSVFKAYQLMTTNPYQHCTTVD
                     VSVYIYDHQMLDLILGYTLTLLLRKFVKIDLQLFDYLPILFFGILCVPQTFQLGHSKA
                     PKFTFFLTIISCLLVFLAFKKYSPLIYGLQWSYERCMKMMVGPGWDSGVCKVYYPF"
     gene            <213419..>214984
                     /locus_tag="C5L36_0E01070"
                     /db_xref="GeneID:40385901"
     mRNA            <213419..>214984
                     /locus_tag="C5L36_0E01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467658.1"
                     /db_xref="GeneID:40385901"
     CDS             213419..214984
                     /locus_tag="C5L36_0E01070"
                     /note="PKUD0E01070; Pfam Domains:
                     Pkinase(8.8e-70)|Pkinase_Tyr(1e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323518.1"
                     /db_xref="GeneID:40385901"
                     /translation="MFKLKSRSKNTYLRNPIKSSTHQQLSNYRFTDCIGRGNFGDVYK
                     AYDLKQGRNVAIKSINLEMSEDEIPILLQELSLLRSLRHRNITQWYSTFIIDVSMLIV
                     MEYCSEGSCADLLKFNRNGVEECVLSYIMKNTLQGLKYLHEMDIIHRDVKAANILITN
                     KREIKLADFGVSGQMDGMKGKKTFVGTPYWMAPEIIADLRTLRKDRINLERRLIESGL
                     GFRTLYKFWNKKIQENEYNENLEAQTFNEAMKGSQPIDIDNFEEVEYNEKVDIWSLGI
                     TLIELGTGKIPNHEKEPFKAIFEIPKSEPPRLPNKASYYLKEFSMACLSKDPTIRPSA
                     TELLKFKFITKTRLRSNSLAILSGHEYKLKRRKPKYDLQFETINHGSSVDWNLELTSI
                     KKENLPLSPLESNQNPKLSYYTDSMFSQDSSKEVTSDNIFNISGHNYLKNEQTANTSP
                     LALSPQRKHPTQTDIDVEYVTDLINQVANCSAAQEIAAAVRSTGAALIQLARGSTRHC
                     AAFRALIEGLNNV"
     gene            <215138..>215386
                     /locus_tag="C5L36_0E01080"
                     /db_xref="GeneID:40385902"
     mRNA            <215138..>215386
                     /locus_tag="C5L36_0E01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467659.1"
                     /db_xref="GeneID:40385902"
     CDS             215138..215386
                     /locus_tag="C5L36_0E01080"
                     /inference="similar to AA sequence:RefSeq:NP_010814.1"
                     /note="PKUD0E01080; similar to Saccharomyces cerevisiae
                     YDR525W-A (SNA2); ancestral locus Anc_1.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323519.1"
                     /db_xref="GeneID:40385902"
                     /translation="MHARDWLLAFIGIFLPFVPVAMKRGLCSADFWINIALCFLGFLP
                     ALVHCWYIISCYPHEQSSTYQGVTMPGREPQSYGAVSV"
     gene            <215517..>216311
                     /locus_tag="C5L36_0E01090"
                     /db_xref="GeneID:40385903"
     mRNA            <215517..>216311
                     /locus_tag="C5L36_0E01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467660.1"
                     /db_xref="GeneID:40385903"
     CDS             215517..216311
                     /locus_tag="C5L36_0E01090"
                     /note="PKUD0E01090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323520.1"
                     /db_xref="GeneID:40385903"
                     /translation="MPPMYSWTKNRGNTMLKSSMNVLHTLDTTGVLNLKELAILPPLS
                     RPFVILISIKCNNVLLSSSLTPGLHSSLKEMIQRSTIFKNLMYKVSYTDVCERDVSFE
                     VQLLDELYDIPTIEDLFVSAVEQDSINRLRMSTLNRVSISIEISSSNFRDYWGNGSIV
                     QDLNFIMFHNFQMLEFLLPLCFSYVTRNTYGATKPLLPLLIQTCLKSEETRIIEQRAL
                     LSGILKSLLCSPTWVQHVNSWHHGKIKRLTGEPSGFTVCWFVPPFP"
     gene            <218949..>220379
                     /locus_tag="C5L36_0E01100"
                     /db_xref="GeneID:40385904"
     mRNA            <218949..>220379
                     /locus_tag="C5L36_0E01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467661.1"
                     /db_xref="GeneID:40385904"
     CDS             218949..220379
                     /locus_tag="C5L36_0E01100"
                     /inference="similar to AA sequence:RefSeq:NP_011313.1"
                     /note="PKUD0E01100; similar to Saccharomyces cerevisiae
                     YGL202W (ARO8); ancestral locus Anc_3.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323521.1"
                     /db_xref="GeneID:40385904"
                     /translation="MVKDLSHLLSEESKGREPSRLKVAFKYYGKDNIVFLGGGLPLAD
                     YFPWETITATSPAPPFADGIGAPPSVTGNATISEIHKHKVEEFDIPLAKSLQYGATQG
                     STELVDFLKEHTQMVHNVPYEEWDVALTIGNTQSWEACIRTFCNPGDSILLEEFTFPS
                     AVECAKNLQVNFVPVKMDAYGIIPSALDELLANWDSSKPLPKLLYTICTGQNPTGSSL
                     NNERRREIYKIACKYDFIIVEDEPYYFLQMEEYKQGAESSVKSQTHEEFLSALVKSFI
                     SMDVEGRVLRLDSLSKVLAPGSRIGWIVGQKPLLERFIRLHEVSIQAPSGFSQSIVQG
                     LLARWGQSGYIDWLIALRKEYTIKRDFTIKCLEKNMPKEVVSWTPPIAGMFFTITIDA
                     SKHPKFEEFGKDPLKIEDAVYEHGLKEGCLMIPGSWFLAPNAEKSKEPHFFFRGTYAA
                     VPLETLGVGLERFAKAIRAEFGLPAN"
     gene            complement(<220584..>221202)
                     /locus_tag="C5L36_0E01110"
                     /db_xref="GeneID:40385905"
     mRNA            complement(join(<220584..220814,221197..>221202))
                     /locus_tag="C5L36_0E01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467662.1"
                     /db_xref="GeneID:40385905"
     CDS             complement(join(220584..220814,221197..221202))
                     /locus_tag="C5L36_0E01110"
                     /inference="similar to AA sequence:RefSeq:NP_013429.1"
                     /note="PKUD0E01110; similar to Saccharomyces cerevisiae
                     YLR325C (RPL38); ancestral locus Anc_4.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323522.1"
                     /db_xref="GeneID:40385905"
                     /translation="MAREITDIKQFVELARRSDVKTATIKTHTISKSNGKKVNQTKFK
                     VRGTKYLYTLIVNDEGKAKKLVQALPPTLKVTQV"
     gene            <221526..>222119
                     /locus_tag="C5L36_0E01120"
                     /db_xref="GeneID:40385906"
     mRNA            <221526..>222119
                     /locus_tag="C5L36_0E01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467663.1"
                     /db_xref="GeneID:40385906"
     CDS             221526..222119
                     /locus_tag="C5L36_0E01120"
                     /inference="similar to AA sequence:RefSeq:NP_013427.1"
                     /note="PKUD0E01120; similar to Saccharomyces cerevisiae
                     YLR323C (CWC24); ancestral locus Anc_4.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323523.1"
                     /db_xref="GeneID:40385906"
                     /translation="MFKKRKVKGTSEKRKREDNSKEIVEQDDCHNVQLELDPRIINRA
                     KTIVETDDSIPQKEKEEEEEQSDLPLLSKRPKKDDLFCPDLNIQEQHQKLHENEKQLL
                     NSKKLQEKDANGDKIYAGRIRTQSRKEVLVKPVSTHVKENYIMDYQRDVCKDFLKFGY
                     CGFGDTCKFLHVRDEFKKNERPVIKEWEEAAKKRRKF"
     gene            complement(<222194..>225079)
                     /locus_tag="C5L36_0E01130"
                     /db_xref="GeneID:40385907"
     mRNA            complement(<222194..>225079)
                     /locus_tag="C5L36_0E01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467664.1"
                     /db_xref="GeneID:40385907"
     CDS             complement(222194..225079)
                     /locus_tag="C5L36_0E01130"
                     /inference="similar to AA sequence:RefSeq:NP_009545.2"
                     /note="PKUD0E01130; similar to Saccharomyces cerevisiae
                     YBL008W (HIR1); ancestral locus Anc_4.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323524.1"
                     /db_xref="GeneID:40385907"
                     /translation="MRVVKFPWVKHTEGPRTFEIYSVSVSPDGSRLATGGLDGKVKIW
                     SIDTLDKYKEKEDRNAVLNPNECRPLSSMTRHQGAITCVRFSPNGRFLASGSDDKLVL
                     IWEKDEEKTKIMSMHRNELADDPIFEGNQNELNESDLEHWTVRKRLVAHDNDVQDMAW
                     APDSSILVTVGLDRSIVVWNGMTFEKIKRFDIHQSHVKGVIFDPAGKYFATMSDDRSM
                     RIFRYRKSLNIESNGNDIDFVVEHVIYEPFAKSPLTTYFRRSSWSPDGLYIAAPNGMN
                     EGVNANVVIKRGSWENELSLIGHRLPCEVCSFSPRLYDPTFNDKDTLSTETVLITTGQ
                     DRSIALWSSKCATPLAVITEVSKKSLTDVAWNPNGLSVFICGLDGNIISLFFDEGELG
                     NVVPLEENNKALIRYGKDRDMYFPESVEQLKLEEYAAKRGLVEGSLSESDRVDKKKSM
                     LHERSMDSQTSKQEPNNVKMNILIPRSKKHPNKQMPVAKIQQVQPQQPKPESKISREN
                     TLSLRTQKVTITKSGKKRVAPMLISANSSNSGNTTRIQFTSSNASTLKQINAKKRTDL
                     SQIMAVPFPSLPKSGLSTLVSSLRARIADDDVEAENSENAVDYIAETNQHKPPSSKSK
                     AKTNGFDHKRNGNFHHTYDGYQTKRRKTACPSWLKNAIVNPITIYGEKFANDEVIIET
                     SNSKDQVLEARFEYNNEYKYTNTNHNIPDKNWSELDSLSRLITKSRSRPNWEFFLNHK
                     VSAIADSSVDDIDYWCLGTENGRILIISATGRQICSTVELGSNVVKLICHGPKVLSVC
                     ENGMINSWEFKNMKNGYLSGKSIVENLSLAPLINMHSTVTESRKRIELDTVVESLLMR
                     DNACPLVVISHSDKKCIYTYDLGLEAWIEVFDNWYIKLLQLTTSASLSITKDRLFSLV
                     ISRIMRDPDFEASGLTNDKQVIESVRKSLVSLNEVVDQCINKRYENL"
     gene            complement(<226194..>227051)
                     /locus_tag="C5L36_0E01140"
                     /db_xref="GeneID:40385908"
     mRNA            complement(<226194..>227051)
                     /locus_tag="C5L36_0E01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467665.1"
                     /db_xref="GeneID:40385908"
     CDS             complement(226194..227051)
                     /locus_tag="C5L36_0E01140"
                     /inference="similar to AA sequence:RefSeq:NP_116622.1"
                     /note="PKUD0E01140; similar to Saccharomyces cerevisiae
                     YFL031W (HAC1); ancestral locus Anc_8.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323525.1"
                     /db_xref="GeneID:40385908"
                     /translation="MSSPSSNTPSAASSPAHSVSGSLPPRKRARTDAEKEQRRVERIL
                     RNRKAAHASREKKRKHVENLESYVVSLEANLQELFKRQECLLEKLSDSKCDFDLIDMV
                     QRPEGLVLSFEEERSLKNSNSNKNGQNGQNGNNKEKNSPNYSFQEPINKKQRVEIKKE
                     ENEEVVNVGLLNNDDLNLDILTPPCNDDLPLLSSYSSPSPPLSSGDASNPTTPLNGND
                     EMNLFTTESNMDFLNYLEPDFTTDSSTNDHDFEDPNFKGLEVGSSMGNIGLFNSVHSA
                     VMHTFRIIC"
     gene            <227465..>228901
                     /locus_tag="C5L36_0E01150"
                     /db_xref="GeneID:40385909"
     mRNA            <227465..>228901
                     /locus_tag="C5L36_0E01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467666.1"
                     /db_xref="GeneID:40385909"
     CDS             227465..228901
                     /locus_tag="C5L36_0E01150"
                     /inference="similar to AA sequence:RefSeq:NP_011519.3"
                     /note="PKUD0E01150; similar to Saccharomyces cerevisiae
                     YGR005C (TFG2); ancestral locus Anc_4.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323526.1"
                     /db_xref="GeneID:40385909"
                     /translation="MSQSPVSKSVSKSEPVLEKQGTSPAGDSVEAEINGEVAYDEDDM
                     PIPQGIVSVNEGQLEQNESLDLNLDNANNQIWLVRLTPQLAELWKNDEFLDGQLLGNI
                     KIPQNSIVKPNRNGNSNGNVNQRGTSAKSNKILLELNTDIEEHRKLDKEYELRLLKQV
                     VENEYAFSESQFRQFRQRLMYRTQVVNLPAQPKMRTLNKEALNHEASWTRKVRNYRKE
                     AQYREMRANDPTYQSKRNESGIGTTELSDDESDTKRRGRRSAKFEKFEKFRKFIPYAK
                     TIPKKTELVGKIVHECQVIPTQLAGDNKLRMIEQRKRLNQMVKRKTINYLKSERVGLM
                     HGRATPNIQTGSTITLSKELAMKKEAAKQEGRSARMDRDTLMNVLFRLFNEYEYWTMK
                     GLREKTNQPEAYLKECLESVAVMERKGPYALKWRLKDEYRKSISVEKKAIHGSIDEDE
                     GDNSQKGRGKDDEEDQDEDIEMEDIAAV"
     gene            <229287..>231236
                     /locus_tag="C5L36_0E01160"
                     /db_xref="GeneID:40385910"
     mRNA            <229287..>231236
                     /locus_tag="C5L36_0E01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467667.1"
                     /db_xref="GeneID:40385910"
     CDS             229287..231236
                     /locus_tag="C5L36_0E01160"
                     /inference="similar to AA sequence:RefSeq:NP_011518.1"
                     /note="PKUD0E01160; similar to Saccharomyces cerevisiae
                     YGR004W (PEX31) and YLR324W (PEX30); ancestral locus
                     Anc_4.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323527.1"
                     /db_xref="GeneID:40385910"
                     /translation="MPEKDSEATMSESTENGINASVMNSPSEANDSKELSSSLGSTIS
                     HIVGALSPGNATTSPTHTTITTSTKRGEDDAVLQIVEENQQDDTNTSETATKDRANAN
                     FISPVKPQPGVKFNLNEEIEASFTGVSNKSTDPIDMVLPDSVPSVESSPQTATDTKKN
                     PGVLGGIGVALGLTNEENHPESENKKKKKTIVKSSPLLSSTPPTVSKSLIKSYPFLIL
                     VLKALNVLTWNDNSNHLSIFLVLFVSLAILYYKPLIIYVGHLLPVLALWVYSECKKYI
                     KEYQAEHPSLDDVIQTMTLISKRSDTLLSPIVELDLTAGDLKRLLFTTVFLSPVYVAI
                     SFFILPPNKMLLTLSILVLTYHSKWSKITRSLLWKSRSFRLLCFYLTGLDFENSGLSK
                     TSALFNLNKKLSSRFSKHSSNNGSSSDGSVKSSVRFTYVIYENQRRWLGVGWTPNLLS
                     YERTPWTDEFLNESESIETFELPQLPLSIDLQDVDRSDGEFEEVTGTKGMVWRWIDKT
                     WRLDLTNDGAIQLPSTKPKTTANPKDDDGWIYYDNTWKNPSTEDGFSKYTRRRRWIRT
                     AELVYIGKEENDSHSKRNLNITSGKNVSSEEAANTSVKFSTSEVPTTDASVDDISTRK
                     GGLKRVDSTGEIKKRKSLRFEEPSG"
     gene            complement(<231340..>232434)
                     /locus_tag="C5L36_0E01170"
                     /db_xref="GeneID:40385911"
     mRNA            complement(<231340..>232434)
                     /locus_tag="C5L36_0E01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467668.1"
                     /db_xref="GeneID:40385911"
     CDS             complement(231340..232434)
                     /locus_tag="C5L36_0E01170"
                     /inference="similar to AA sequence:RefSeq:NP_011627.1"
                     /note="PKUD0E01170; similar to Saccharomyces cerevisiae
                     YGR112W (SHY1); ancestral locus Anc_3.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323528.1"
                     /db_xref="GeneID:40385911"
                     /translation="MKLFRVGVLRKRYYGVLQKRFASVKTHNVDWNPMKSQKQLSQGI
                     EFSGSFGRKVFFGLLCLAPIITFALGTWQTKRLKWKNKLIAECEDRLTYKPAPLPKYI
                     TKEDMPNLEYRKVLVTGHFDYSREVFVGPRLHNGIKGYNLICPFVQSNGGGEVLIDRG
                     WIRDDKVLLNRRNLQHLSCPKGEITVECVIRVPPQKGTFSMDHEKGSRLYQYLDADAI
                     AEELGSRPIYLQALQNFHDKPEWLKNEIEFQRGQLSQEAVEHQKKSKWAFWKTSSKDE
                     KNLQTSSAPVPEVDFDTAEEFDPLQFINAGVPLGKIPRVDYKNNHLNYLVTWYSLSFA
                     STVLLLYLFKTGKFLNPTEEKLKYARKIIK"
     gene            complement(<232685..>235429)
                     /locus_tag="C5L36_0E01180"
                     /db_xref="GeneID:40385912"
     mRNA            complement(<232685..>235429)
                     /locus_tag="C5L36_0E01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467669.1"
                     /db_xref="GeneID:40385912"
     CDS             complement(232685..235429)
                     /locus_tag="C5L36_0E01180"
                     /inference="similar to AA sequence:RefSeq:NP_009611.1"
                     /note="PKUD0E01180; similar to Saccharomyces cerevisiae
                     YBR055C (PRP6); ancestral locus Anc_3.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323529.1"
                     /db_xref="GeneID:40385912"
                     /translation="MERKAFLDQKPPPGYIPGIGRGATGFATSGGFRAPNRVPVTSAI
                     DGVSETDADQFKDADKPNEISVHSYDKEDLEADKIYDDLEKYLENKKTKRRKLMTDDK
                     KDKIEDKLVARDESLSSSINEISKQFQEVKNELAAVTPEQWENLPESGDFTRKNKRLR
                     EELQQNQRFYRNSDMIALGLKNAGATDSALDYSNVEVDENVPDDKDNDGNVNLLEISR
                     TKEKLLENQLRIGNQKKINEFDKSAYLEKLAPSASQYNIGDYKRTRKLFAKLRENNPT
                     NPQNWIASAKLELDANKIKRAKEIIQEGCEKFPKFQEIWLTSLEIHKDDIPVSKVIVA
                     DAIRYHHKSVRLWIKAAELEQDRIYKVRVLRKALELNPDSEDLWLEITKHEKDTEVCI
                     KMLEKATSLVPQSVRLWEALASLQKPTESMKILISSTEVIRKESVSSIWLKIAEIEEK
                     HSSNELKIAKYVSKSFETAGECPLHDWIMRAELSEDTSHELTCRAIIYQALENTSEDF
                     NTLIALSEKKLENNHFITADSILMFITSRDSSNEKAWNALFKLKRDNGDYKGLFLAYE
                     LAISANPENPDIYLDYLNDRLKYDTDTGSIRTIISSALNAIPASEKLWLFAISFESRC
                     GTQQVCQDLFDFCMKTLKEPTIDIWVEKIRFERRLQDLSAAQDSINKALNKFPDSPSL
                     YMEKANLLDSLGRLEESKQTLYDGITNCKNNDMLFIALADLYFEKLNNILKARSVLDQ
                     ALACHSKSEKLHHSRIKLEMKSGNKDHAKRLLFKALNLVPTSPLLWSDNIRLATKQQL
                     KNMYVLALKKTNDDPLIILTIAKDLWKSGKMDRANQFFKACLEKDPKLGDAYIFYYAF
                     LLANGSRDEMKALESQAVENLSLHGRRWEFIVDHNRYRDVPELQLLREAAVDVSKLNH
                     "
     gene            <235680..>237200
                     /locus_tag="C5L36_0E01190"
                     /db_xref="GeneID:40385913"
     mRNA            <235680..>237200
                     /locus_tag="C5L36_0E01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467670.1"
                     /db_xref="GeneID:40385913"
     CDS             235680..237200
                     /locus_tag="C5L36_0E01190"
                     /inference="similar to AA sequence:RefSeq:NP_013850.1"
                     /note="PKUD0E01190; similar to Saccharomyces cerevisiae
                     YMR131C (RRB1); ancestral locus Anc_2.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323530.1"
                     /db_xref="GeneID:40385913"
                     /translation="MSKRSASEIVENIEDVKKHTSAKPVDVEMAGEDDYAQQLGIEGE
                     MENLSGDDYESEGEIIELDHSDTELDGAIDADGLIEKAKQAEEKESEETLYLPHRSRP
                     LGPDEVLEADPTVYEMLHNVNMPWPCLTLDILPDRYGDERRSYPAKMYLTTATQASKA
                     KDNEMIVMKLSSLAKTLAKSEDEDDDVDEDDEDEDYDPILESETLPLKHTTNRIRVNP
                     WAAKTNEYLTATMSESGEVYIFDISSQFKAFDTPGYVIPKQSKRPLHIIKNHGNVEGY
                     GLDWSSTEDGSLLSGDVTGRIYYTHRNNSKWVTEKNPYQVNDASIEDIQWSKSEKTVF
                     ATAGTDGYVRIWDTRSKKHKPALSVVASQSDVNVISWCDRIDYLLASGHDDGTWGVWD
                     LRNFQPNTQPTPVVSYDFHKSPITSIAFNPLDESIVAVSSEDNTVTLWDLAVEADDEE
                     ITQQRNDTKELNDIPPQLLFVHWQKDVKDVRWHKQLPGTLVSTGTDGLNIWKTISV"
     gene            complement(<237364..>238194)
                     /locus_tag="C5L36_0E01193"
                     /db_xref="GeneID:40385914"
     mRNA            complement(<237364..>238194)
                     /locus_tag="C5L36_0E01193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467671.1"
                     /db_xref="GeneID:40385914"
     CDS             complement(237364..238194)
                     /locus_tag="C5L36_0E01193"
                     /note="PKUD0E01193; Pfam Domains: PQ-loop(1.5e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323531.1"
                     /db_xref="GeneID:40385914"
                     /translation="MSELQCAVYEDPQLGTFIINIGLAIGIFASYIPQHVKIINRRSS
                     EGLSPDFLLLGSVSAYSALLNIYIFTTLARHCCLNGLNAFQCSNSLTGFIQILLQAAG
                     YILIFVLCVFATGGSLRQSNRELSKLKNRFNIFLLFGVGCLGVYWLFLTFGDMSYVYR
                     LGNFFGLLSTLCAIIQYYPQMRTTYLLKHAGSLSIPMMYLQTPGGFIWSYSLFSQPNS
                     NWSSWLPYLMAALLQCTLLMMCLYYQWKYPTALTEANEQLRIVEENMRYNREHYDSIS
                     "
     gene            <238550..>238918
                     /locus_tag="C5L36_0E01197"
                     /db_xref="GeneID:40385915"
     mRNA            <238550..>238918
                     /locus_tag="C5L36_0E01197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467672.1"
                     /db_xref="GeneID:40385915"
     CDS             238550..238918
                     /locus_tag="C5L36_0E01197"
                     /note="PKUD0E01197; Pfam Domains: Complex1_LYR(2.4e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323532.1"
                     /db_xref="GeneID:40385915"
                     /translation="MTFPTAFAEATRFSTTNAELRIRVLNLYRRYLRHSREFVNSYDL
                     DIPAYQVKTKIRQEFERHRHVQDLSIKNVLYMKGQMEFQELVNFWKQQSHVMKYFEDF
                     EHYNSASGNSFVQKFLKGAN"
     gene            complement(<239098..>242256)
                     /locus_tag="C5L36_0E01200"
                     /db_xref="GeneID:40385916"
     mRNA            complement(<239098..>242256)
                     /locus_tag="C5L36_0E01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467673.1"
                     /db_xref="GeneID:40385916"
     CDS             complement(239098..242256)
                     /locus_tag="C5L36_0E01200"
                     /inference="similar to AA sequence:RefSeq:NP_013140.1"
                     /note="PKUD0E01200; similar to Saccharomyces cerevisiae
                     YLR039C (RIC1); ancestral locus Anc_2.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323533.1"
                     /db_xref="GeneID:40385916"
                     /translation="MHWPSSIKQIQKLTEVEPLDNLKKPNNSHTYKPDPHDDEIIDLL
                     TNYSNGLPYAILTYRSLYIFDWKHKVLVNVHIRSNESVENYGSNISVKLSPNLQTFAV
                     LTDKNTILVYTVKLKTDTELFSTFNKEGKLLQNGYPITSYQEDPMIYGGIDSKYINNK
                     DGQGQGIVKNILSSFIGSDDAEAPVFDFGLRLKLILNVVSPVVDYCFTNSIELMLINS
                     QPHAFQVIHLANTDNKKSEKGQVLDGSSESIKFALSDEVKWFNDPEINGGSEIVGLDY
                     NYDLACFLWWNEGGGLLLVRKRHDTKQLHLDATVVYKAIKGSAKVVSALTNHFRNTIN
                     ILLDDGSILIYKLNTDLSCKLLKKIEAPSTSKNPKGIVLHPHGDSILVYYENGWNIYS
                     VLGNLNFSTFEYDSMSISNCKKIQYLNAYELILVNKSNEIILIDLTVCNSGDGFNNLS
                     MKRPLLCDGEKIWIFKAYEKKLIEHYHFNYNINDVTNKETDLWLAEMLPLKFKVKNTS
                     IRSVSVSDDGNNVCVVGNYDVIVYSIVNRQWKYMEVIEQSAAFEKSESIINKCIWWKN
                     YLILGAVSGAKQKKHSQVIIFSTKILEKKVPFSYDFVVWNFEFEETQYDEYFVNFNVD
                     LHSDILFVMTNELNCYTWNLELTTNHVEKVRGDQQSSFISEDFLTSKKSSITLQRSTV
                     YQLKSCFNENDESIILNFSTILRLSECGLLFLTNTDLYYIKKKRDLNTNSMTNVVYLI
                     NDSVEYVHKLNNSLVCLFDGSQLIHYNLSDDSDITKLKPIKISTGNENFSADNCVELK
                     YIGVCSYPITTIPNQNIMFGIQVDCYNKVKLKLTTNRKNYLEDLINHYILSNMEVKKL
                     EEDSNAMNITTVYAKFSKFKNFKFVMEKLLFHYLHNCYEDKNYDSNDDYFNRLYSLIN
                     LTGNPYEIILNCLKKTETHLWTIYFSKAKENPRFIFNKLFTENDSQRLTAHYFIIMMN
                     YEYYGTKTNNKKSKKKNKGSKTDSYSLTSSDQDMVVNILKKLIISKDFETSFELIRFL
                     KVIDQEMTHNCLEKMKKSLLKN"
     gene            complement(<242790..>244453)
                     /locus_tag="C5L36_0E01205"
                     /db_xref="GeneID:40385917"
     mRNA            complement(join(<242790..244121,244442..>244453))
                     /locus_tag="C5L36_0E01205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467674.1"
                     /db_xref="GeneID:40385917"
     CDS             complement(join(242790..244121,244442..244453))
                     /locus_tag="C5L36_0E01205"
                     /inference="similar to AA sequence:RefSeq:NP_116616.1"
                     /note="PKUD0E01205; similar to Saccharomyces cerevisiae
                     YFL037W (TUB2); ancestral locus Anc_8.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323534.1"
                     /db_xref="GeneID:40385917"
                     /translation="MREIIHLSAGQCGNQVGAAFWETICDEHGLDPNGNYHGTDPLQE
                     SRLNVYFNEASSGKYVPRAVLVDLEPGTIEHVRNSQFGNLFRPDNLIFGQSSAGNNWA
                     KGHYTEGAELVDSVMEVIRREAEGCDSLQGFQISHSLGGGTGSGMGTLLISKLREQFP
                     DRMMATFSVVPSPKVSDTVVEPYNATLSIHQLIENADETFCIDNEALYDICTRTLKIN
                     QPDYAQLNRLVSSVMSGVTTSLRFPGQLNSDLRKLAVNLVPFPRLHFFMVSYAPLTAE
                     RSQSFRSLTVPELTQQMFDPRNMMTACDPTKGRYLTAAAFFRGNVSVKEVEDEMHKVQ
                     TKNDGYFVEWIPNNVQSSVCSVPPRGLDMSATFIGNSTSIQELFRRVGSQFSAMFKKK
                     AFLHWFTSEGMEEVEFTEAESNMNDLVSEYQQYQDATGLDEEDIDFDEHDQMNEL"
     gene            complement(<244917..>247109)
                     /locus_tag="C5L36_0E01210"
                     /db_xref="GeneID:40385918"
     mRNA            complement(<244917..>247109)
                     /locus_tag="C5L36_0E01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467675.1"
                     /db_xref="GeneID:40385918"
     CDS             complement(244917..247109)
                     /locus_tag="C5L36_0E01210"
                     /inference="similar to AA sequence:RefSeq:NP_013837.1"
                     /note="PKUD0E01210; similar to Saccharomyces cerevisiae
                     YMR119W (ASI1) and YNL008C (ASI3); ancestral locus
                     Anc_2.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323535.1"
                     /db_xref="GeneID:40385918"
                     /translation="MPTSDISGVASNVTSLSTVEATSTFDSTSPGNGDKGVYGLVRIV
                     DSLINAVIQQSKESNKETRMFFSYWMSPYALMCMITAVIMNRIVILASTRHQRRLPLL
                     SNAVLRGLAIYMLIRGSYGLFLSLRCYVKHPIVDFIFESSGEDFKFDENEYLKSKFLS
                     IPFGTKVYRSDETVGPTTSILRNFHLSLCISQILDTFTSVASGLNPSVETGITLFEYS
                     LAFQEAQFESTVSTELLVFAMIALANQINTHLLGMFNLLKYKLVTSSIIGLFTLAYYT
                     YKIFTINILKLPFSIIVGYFPHFCVLSIVLLSEGIYLLSGLARLSFEDLAMSSLFEDW
                     DSTDIPLSDDFYTALIRLGEFLINLSVNFYYLQETPSVLLPRNNYISEELLYMRKNCG
                     YGEETENSPDIKQLQIGLATRRKKSWAITNRIQMLSKITFNFFRLVLLKLKGGSKRIV
                     PNGQSLEKISDNYNLVERNGKYYFAKKEDETRIDVNRIEEDVLDKIYPHLLLNMNLTE
                     NDESEDYRDDLGGDFERGEYEKNHGEEEEEEEEEEEEEEEEEEEEEEEDDDHYDHDGY
                     DQDNDDHENEGPARQDKVCEREEINEVISDLITVGDLKDILNPSQELRVLSYHLRNLN
                     LPTSRLTRSHFREYYTDEMKLLDILIEKRKLSLHDFPNSQEHCEPLTHDELGTCVICH
                     ENTRQIILWPCKCLAICDSCRVSLLVREFATCVCCRRPVEGYSKVYIP"
     gene            <247540..>249000
                     /locus_tag="C5L36_0E01220"
                     /db_xref="GeneID:40385919"
     mRNA            <247540..>249000
                     /locus_tag="C5L36_0E01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467676.1"
                     /db_xref="GeneID:40385919"
     CDS             247540..249000
                     /locus_tag="C5L36_0E01220"
                     /note="PKUD0E01220; Pfam Domains: Pkinase(1e-26)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323536.1"
                     /db_xref="GeneID:40385919"
                     /translation="MNPSLGTTGYPESTQSKSPQRSNSLPSSICSSQMQSCNSNGKVG
                     VGENNIETQELDSICFTNNVRRLNCLNLPQVHGFISEDYKVKLQEGSSGLILKVRSKV
                     DQRYYVIKVLSHACIAQKKSSEHSSTVVTNIKSSTSLSTSTIRTPGIQGNSCVSISRI
                     HSHLSIERNLTVKEMYTLDSLNEYMILRKLNSKYVTPVYGLFRYDERTRIDGVESRSN
                     SSGDHEKPLNLCIMLDYYQYSDLLHLITDIRKSNIHVSSLFKDSIFSQLVMGLKYLHG
                     SGIAHRDIKPENILIDDKGVLKYADFGYAIDTCKIPDYPIDKESFVYRGTASFKAPEI
                     VNFKLMKILSKCDDIGEVFRSTDIWSLAILYYQMRFMSKPWRTASLSDKEYSRFEEKY
                     RMKNIGGMKTGFDMVRSFKGEFSFTTNIKLLKDDAIFAILKMLDPDNLKRWCIGDVYR
                     SSWMVSTRMLVEEYSRTHKGEPNELVKVARSVETSV"
     gene            complement(<249302..>250024)
                     /locus_tag="C5L36_0E01230"
                     /db_xref="GeneID:40385920"
     mRNA            complement(<249302..>250024)
                     /locus_tag="C5L36_0E01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467677.1"
                     /db_xref="GeneID:40385920"
     CDS             complement(249302..250024)
                     /locus_tag="C5L36_0E01230"
                     /note="PKUD0E01230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323537.1"
                     /db_xref="GeneID:40385920"
                     /translation="MTVNARSSQAPLGNCRKSFTSSRKHRLSKTKEPLVTNKKKIKIK
                     STSLISLCSPFVIPDDTRLVSYQLERERYPNIDDFSLIYGPLELNDRLLSSFYSSVTS
                     NDNNGNRQFHLNCLLNSISLINNDVPMDYYTDSDDLLHLEDGLVTDGESSDDDDVYNY
                     DDDDDNDNDNDNDNGGSEKVKSEKLHINANANINSNINLNANLLKHTNATILVDDIME
                     KTISDITDSDNHDTIQIGIANY"
     gene            <252054..>254087
                     /locus_tag="C5L36_0E01240"
                     /db_xref="GeneID:40385921"
     mRNA            <252054..>254087
                     /locus_tag="C5L36_0E01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467678.1"
                     /db_xref="GeneID:40385921"
     CDS             252054..254087
                     /locus_tag="C5L36_0E01240"
                     /inference="similar to AA sequence:RefSeq:NP_010057.1"
                     /note="PKUD0E01240; similar to Saccharomyces cerevisiae
                     YDL224C (WHI4) and YNL197C (WHI3); ancestral locus
                     Anc_2.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323538.1"
                     /db_xref="GeneID:40385921"
                     /translation="MSFYASNNSSDDLNLSLKNLTINTNLSKTNTNNNTNSNINSNNS
                     ISNSNTNTKTNNTITTNATANSSSNPNSSSNLAPYTILKIKNIPNDITLREAFLIFSL
                     CLNDVNFVDIVQEQNNQGSGTCPSIISKFYSSKIASQVFQLLNDKQLFGTAFPRVQCE
                     LINGPNNNTGGNITVTSQNKNHNSSNYLFMNPFNDDLHAYSNSIVTSNLNSKIEHSPG
                     ISSPKPNKLEDLKLNLTHDINDTLSSINNHHLSMMSSSNNHITGWPKEESTPLATPSN
                     TSQIIRNDPLLLNNPISMNLTTPILSDWPSNPPNSASNASFFSINDLTQTVVGNSYSS
                     AATTTTTSNNNNNINNNNNNINNNNNNNNNNNSNNSNNNNNNNNHNHNSCNSKPSSNE
                     NISTASHSNQPPLMRSQSHQSSTSPKHSTVIPDLSLLARVPPPANPADQNPPCNTLYV
                     GNLPPDTTENELRMLFRLQPGFKRLSFRTKQNNGASSHHGPMCFVEFEDVAYATKALA
                     ELYGKTLPRQNALNNNKGGIRLSFSKNPLGVRGPGQQRRNNGPSQQSQPPAQQSQGQQ
                     QQGQAQGQEQGQGQFQSQSQPQPLSQLTSQSHSQSKRHHLQQPQHLQQPPPQQTSTPS
                     DHSFQRMTDLPISGSHNVPSVNLQSIAFNNPAMNSVGLNNLNGYSFMNNQYPF"
     gene            complement(<254262..>255056)
                     /locus_tag="C5L36_0E01250"
                     /db_xref="GeneID:40385922"
     mRNA            complement(<254262..>255056)
                     /locus_tag="C5L36_0E01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467679.1"
                     /db_xref="GeneID:40385922"
     CDS             complement(254262..255056)
                     /locus_tag="C5L36_0E01250"
                     /inference="similar to AA sequence:RefSeq:NP_014199.1"
                     /note="PKUD0E01250; similar to Saccharomyces cerevisiae
                     YNL200C; ancestral locus Anc_2.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323539.1"
                     /db_xref="GeneID:40385922"
                     /translation="MYSTIKTIFTLFPLLFVSFIVERQQYTHRNNMSMKPLSAKTAAA
                     LDASLMSTLGYKLEQLMELAGLSVAQAIYADYKPDQFSNVLVLVGPGNNGGDGLVAAR
                     HLKLFGYREVAVYIPKQGKNPFYANLQTQLKSFNVPVHTGELNNVLKGRDLVVDALFG
                     FSGKPPLREPFNLIIDEIVKLQKRENVKLFAVDVPSGWDVDEGPVSQEYMPDALISLT
                     APKPCSAKLAPHVKHYLGGRFISKEIAEKWNFDVPQYQGVDQFVRL"
     gene            <255571..>257277
                     /locus_tag="C5L36_0E01260"
                     /db_xref="GeneID:40385923"
     mRNA            <255571..>257277
                     /locus_tag="C5L36_0E01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467680.1"
                     /db_xref="GeneID:40385923"
     CDS             255571..257277
                     /locus_tag="C5L36_0E01260"
                     /inference="similar to AA sequence:RefSeq:NP_010056.1"
                     /note="PKUD0E01260; similar to Saccharomyces cerevisiae
                     YDL225W (SHS1); ancestral locus Anc_2.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323540.1"
                     /db_xref="GeneID:40385923"
                     /translation="MVPYRKKDVRKGIRFTIIVTGPSGTGKTSFVNSLLDENILPHRF
                     EHSGEKTVGKTITYRALGSLTASELEKTFDPSLANQEPGIAITETSVEIIDEDDSKIL
                     LTVIDTPGFGDNIDNSICVSEICNFLEQQFDYVLAEETKVRRNPRFEDTRVHACLYFI
                     EPTGHGLRELDVESMTRLSKYCNIIPIISRADSFTENELANFKRNVLQDIERFKIPVF
                     QYQVDESETDPDIIEESRYLTSLQPFAIVTSDTEMVVDTKKTRVRKYPWGVVDINDTR
                     VSDFPVLKNVLLGSQLQELKDITHDFLYEAYRTERLSNVSDLKNEFSDSMRDLKINSS
                     EPPSMSNLAEITKSGGLPKFDIPKTRQSHQHQHQHQQHPELVEEEPESINGELSSNIR
                     RGSFDSSRSEKSSASTVNRKNTISGSPNIEGSPQTSMHSGSLIVGGSQVQQPHIDPKK
                     LRKISETVPYMLRHETIRSKQAKLEELERQSALELSRRAAELERKAKELKMRETMLRE
                     RLAKANGSGSLSLSNTADSKGASSIRSNVSENRKRETSYSVQTTTSEYEDTVEDNDGS
                     AA"
     gene            <257754..>259100
                     /locus_tag="C5L36_0E01270"
                     /db_xref="GeneID:40385924"
     mRNA            <257754..>259100
                     /locus_tag="C5L36_0E01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467681.1"
                     /db_xref="GeneID:40385924"
     CDS             257754..259100
                     /locus_tag="C5L36_0E01270"
                     /inference="similar to AA sequence:RefSeq:NP_014160.2"
                     /note="PKUD0E01270; similar to Saccharomyces cerevisiae
                     YNL239W (LAP3); ancestral locus Anc_2.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323541.1"
                     /db_xref="GeneID:40385924"
                     /translation="MSPSQINVDNLSNWTEEFKSDAKTQIGGSVLQHSNIDEVLINRD
                     AEIANKHIFNHKIEIEGLPVMDQKASGRCWLFASTNLMRVTAMKKYNLKEIKLSPSYL
                     FFYDKLERANYFLEQIIDTHKEPIDSRLVQYFLTNPVEDGGQFTMMAQIATKYGVVPD
                     QVYPDSFNTTTSRIMNRLVNHRLRSYAMTLRNALDEGKDVMSLKNEMQKEVYRLLTMF
                     LGNPPKPNEEFVWEFTDKDGKYESIKTTPLKYATEVLDFHAPEYVSLLNDPRNKYNKM
                     VQVERLGNVAGGEPVAYLNLEIEKLSQAVVNRIKNNKPVFFGTDTPKFMDKSRGIMDI
                     NLWDYELLGYDVRTMSKKERVVFGDSLMTHAMLITAVHVDENGKPVRYRVENSWGTKS
                     GQEGYYTMTQEYFEEYVYQVVIEKSEFAALNLDVSILEDKEPVVLPPYDPMGALAL"
     gene            <259596..>262205
                     /locus_tag="C5L36_0E01280"
                     /db_xref="GeneID:40385925"
     mRNA            <259596..>262205
                     /locus_tag="C5L36_0E01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467682.1"
                     /db_xref="GeneID:40385925"
     CDS             259596..262205
                     /locus_tag="C5L36_0E01280"
                     /inference="similar to AA sequence:RefSeq:NP_014161.1"
                     /note="PKUD0E01280; similar to Saccharomyces cerevisiae
                     YNL238W (KEX2); ancestral locus Anc_2.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323542.1"
                     /db_xref="GeneID:40385925"
                     /translation="MNFTWVFKILLCLIFSNRINAIGNKDFANKDYLMVEVKGDYDLH
                     NIQELHPDWEYEYEIDFLDNFHVFSMKKDHQLIEKFSKYTSIKELLQGDKKLIKREDY
                     DFLSSLNDNNVTGVHLLPRKQLVKRFPVPVSYGKDVPVLHSRENTNVDSSLDEIAQVA
                     EEFGINDPIFKEQWHIKNAFNPGHDVNVIPVWRKNITGRGVVTALIDDGLDYESIDLK
                     DNYCPEGSWDYNDNRPNPKPELTNDYHGTRCAAEIAASRGNDYCGVGVAYDSKVSGIR
                     ILSGEITSEEEAAAMIYGLDVNDIYSCSWGPPDNGRSMDEPDKLIKSAILKGIQEGRK
                     GKGALYVFASGNGGSRGDTCNFDGYTNSIYSLTVTAIDYKGLHPNYAESCTAVMVSTY
                     SSGSGEHIHTTDIHEQCTANHGGTSAAAPLAAGIYALVLEANPELTWRDVQYLTVLSA
                     AEIEPYDPSWQNSAIEGRKYSPKYGWGKIDAEKMVDMAQNNWTLLKPQAWYYMPYQQV
                     NKKIEKKIDEIEDNFEISNEVLRYSNFEKVEQLTITVDIDSQKRGDVEVDLISPNGIV
                     SKLAEKRPRDTDKGGFKKWTFSTVAHWGEEGTGNWTIKVRNVGEENTINFKGWQLKAF
                     GECIDPELAKRFDIDEDYSLVNNEDYNKNVENGKSLETPNSSETGTSNAETAHTTSEE
                     GIKPTNTGALGASPLPSEENKPNDGNDGNTAHAHKPTHHYVIYFVSLIVIGFIASLWI
                     FKKGKKGGARRLQDYEFDIIRPEDDESSRFEFEDLEDDEDAHEFHIESSDEDDHHPHE
                     QQQRQPPGMNSDSEFDLGSSYLSGHEKSNTVIEDVRQHEKKQNTESSGMLHSASSEES
                     PFGEINDNKRTIL"
     gene            complement(<263068..>266169)
                     /locus_tag="C5L36_0E01290"
                     /db_xref="GeneID:40385926"
     mRNA            complement(<263068..>266169)
                     /locus_tag="C5L36_0E01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467683.1"
                     /db_xref="GeneID:40385926"
     CDS             complement(263068..266169)
                     /locus_tag="C5L36_0E01290"
                     /inference="similar to AA sequence:RefSeq:NP_010066.1"
                     /note="PKUD0E01290; similar to Saccharomyces cerevisiae
                     YDL215C (GDH2); ancestral locus Anc_2.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323543.1"
                     /db_xref="GeneID:40385926"
                     /translation="MTAAIPNLQSLTLDNNFSQSSFQNVSREDVQANGYRPSVFESKD
                     DQISKVMDLLDSYSLIPENLIESETSFFYNDLGIDDTYFASESVENIASNILALYAAK
                     INATVNSNLNNDIHFKKITDNHAVYFETGSVSNFEKEIDDEFLDVADKSYRLESFTSN
                     LPNGEMIRCHFVYKSIFSNEENQLVNSSSSKEIDLISDDTFQKIATNYTKTLYSEILE
                     ESKLTEGPIVKHYTISETGELRIIIGFKKGSSHRYNSALSTLVKYYGLNIKRKYVENF
                     SNNYTIISMYLNSNPELESTLTTLQLTKEASLLYCIPDNKFYSKFENGEWSIQECIYA
                     HCGVIFATHFLNRSGPEFQQLKKILLDSSIVNPKNVELVSKIKERFNSETFSESYIIE
                     TFNSNSEFIQQLYKHFVDNHYTTSSTKMVRTLSYQRTSQIEGIENDSQFNEKIQDISN
                     DGYSTVLKVLYSFNKSILKTNFFQTSKIALSFRLNPSFLPVSEYPNTPFGMFFIVGSE
                     FRGFHIRFRDVARGGIRIVLSRNEDFYLKNMRSLFDENYNLASTQQKKNKDIPEGGSK
                     GVILINPGSAQLKPKECFVKYIDSLLDLLILNDPTREKIVDFYGKNEMLYMGPDENTA
                     GFVDWATLHAKKRGAKFGFPWKAFFTGKSPTIGGIPHDEYGMTTLSVRAYTEGVYKKL
                     NIDDWSKIKKLQMGGGDGDLGSNEIKLSGNETYIGLVDGFGCIVDEDGIDKNELLRLA
                     NNRFGNNKFDKSKLGPKGYAIMVEDKDIQLPNGKIIHSGIQFRNNFHLNLKEIYPPNS
                     INLWVPCGGRPNSIDVTTVQSLIDSKTGKSIIPIIVEGANLFITQAAKYILEDAGAIV
                     LKDASTNKGGVTSSSLEVLAALSLSDEEFQNKFCVDPVNNSVPRFYQDYVKEVQEIIK
                     INADNEFNMLWKLKQDTKKSFADLSDELSIAINKLGDELSSSKELWEDDVEFRNIVLK
                     NALPKLLLNEIGLDRILERVPESYLKAIFATKLASEFVYTRGIDANPAKFLEFVSSIK
                     RST"
     gene            <268067..>269035
                     /locus_tag="C5L36_0E01300"
                     /db_xref="GeneID:40385927"
     mRNA            <268067..>269035
                     /locus_tag="C5L36_0E01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467684.1"
                     /db_xref="GeneID:40385927"
     CDS             268067..269035
                     /locus_tag="C5L36_0E01300"
                     /inference="similar to AA sequence:RefSeq:NP_011043.1"
                     /note="PKUD0E01300; similar to Saccharomyces cerevisiae
                     YER118C (SHO1); ancestral locus Anc_7.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323544.1"
                     /db_xref="GeneID:40385927"
                     /translation="MLSLPKRTKTNRPASPTTVNLVIVITISISALAWIIAFVGSIAA
                     SQSIEHFPKFTWWGLVFQLFVVIIIPVAYYLGLLPVYRNFLMASVIIAFIYSSNSTNN
                     MIYYSSSSTSAASTGFILLSMTNFLWLVYLGSDESSPIVEFIDQYGKPINIIERKRLS
                     ISTQNRHNSNNYKSSGSNVVYQSTAYVNHNQSDIYSNMEDSHELAGFENPVSESLETP
                     QMSEFNDSAFRQSGILPVIQIDPNNNGTGTNLTGISSVSKYMESYPILVRGLYDYNAS
                     PDDVNELSFKKGEIFRVKNTNGNWWQAKNKKGEIGMCPSNYLEIVT"
     gene            <269472..>271595
                     /locus_tag="C5L36_0E01310"
                     /db_xref="GeneID:40385928"
     mRNA            <269472..>271595
                     /locus_tag="C5L36_0E01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467685.1"
                     /db_xref="GeneID:40385928"
     CDS             269472..271595
                     /locus_tag="C5L36_0E01310"
                     /inference="similar to AA sequence:RefSeq:NP_014019.1"
                     /note="PKUD0E01310; similar to Saccharomyces cerevisiae
                     YMR291W (TDA1); ancestral locus Anc_5.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323545.1"
                     /db_xref="GeneID:40385928"
                     /translation="MSKYIPSSASNNTSLTKVANGPSNRNNNYLTSSASTSNSNPNSS
                     YKNHKVFDLDEDFDSALCPPALSPFALSILDDKLGDRYKNSRESGSHRKIEKRDHNKL
                     HTNSTLNSISTNEFTNPKNQNLTNTTVTRHSTFMRKLGLGAPKRLTINGDFQSTGNSQ
                     LPDDHSESPNTGTNFKDIKRKHSLQLTPNRYSPTHKKTSLPASSINDLSNKTSTPTKQ
                     NKLPNSIVNSHVPILESPEFGRKTKLNLSDSKPNGGIIDIFRDDKPFVLNLDSKSNKE
                     NINPSNDFDHIQSLAEKKKEIYQLKKELQEYKDELDKQKKMKNEKQPDNNRDNNNVEN
                     NNMNSNQKITINKRTYNLLEQIGKGGSSKVYRCSIIDSPKRFFAIKIVNLEDHESSTI
                     QELKGEIKILHKLRHCNRVVRLLDYSLTSKNIYFVMECGNLDLATVLSNRHTLKKFYD
                     LEFIRYHSQEMIKCIDTIHQLDVVHLDLKPANFVFVNGILKLIDFGISNSIKGHTVNV
                     YREFQMGTPNYMAPETLIDCAENENGSSIWKVGKPADVWSLGCILYQLTYAMTPYASY
                     TGTKKILAITNPSININYPSNAVNLRKKPEERDNEDELERVCPYLIDMIKKCLIRDPS
                     RRITSQELLGHPFINPVIIDKSVIKEVVRGCVGFGGRHPELKKIALSTSHTDENSTKE
                     DKRAQERLDRLIEGVWKRVSGEKVE"
     gene            complement(<271866..>273032)
                     /locus_tag="C5L36_0E01320"
                     /db_xref="GeneID:40385929"
     mRNA            complement(<271866..>273032)
                     /locus_tag="C5L36_0E01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467686.1"
                     /db_xref="GeneID:40385929"
     CDS             complement(271866..273032)
                     /locus_tag="C5L36_0E01320"
                     /inference="similar to AA sequence:RefSeq:NP_010255.1"
                     /note="PKUD0E01320; similar to Saccharomyces cerevisiae
                     YDL029W (ARP2); ancestral locus Anc_3.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323546.1"
                     /db_xref="GeneID:40385929"
                     /translation="MEPIVLDQGTGFVKIGRAGTNFPDHTFPSMVGRPILRAEERTVE
                     GDLEIKDIMCGDEAAAMRSMLQISYPMENGIIKNWEDMEHLWDYAFYERMKINPQGRK
                     VLLTEPPMNPLKNRENMCNVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVT
                     HIVPVYESVVLNHQTRRLDVAGRDVTRNLINLLLRRGYAFNRTADFDTVRQIKEQLCY
                     ASYDLDFDTKLANETTTLVKNFELPDGRVIKIGSERFEAPECLFQPSLVDIEQPGVGE
                     ALFNTIQSCDVDIRSTLYKSIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLD
                     KFKVRIEDPPRRKHMVFIGGAVLANIMADKEHMWITKQEWEEQGPRILDKLGPR"
     gene            complement(<273379..>274179)
                     /locus_tag="C5L36_0E01330"
                     /db_xref="GeneID:40385930"
     mRNA            complement(<273379..>274179)
                     /locus_tag="C5L36_0E01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467687.1"
                     /db_xref="GeneID:40385930"
     CDS             complement(273379..274179)
                     /locus_tag="C5L36_0E01330"
                     /inference="similar to AA sequence:RefSeq:NP_011778.1"
                     /note="PKUD0E01330; similar to Saccharomyces cerevisiae
                     YGR262C (BUD32); ancestral locus Anc_5.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323547.1"
                     /db_xref="GeneID:40385930"
                     /translation="MSTELIECVKGILPGFDIRLVSQGAEALVFITDQHPYLPRDINP
                     RGISNSNQYIIKYRPRKPYRHEVLDLQITKSRTASEARLLYKLNSLGVKAPKLIGLDA
                     PNGIIWMEYLGFRLENGDFSSLKNWLWWLESCGEAHALGIEAKDVMRGVGESIAKLHM
                     NDIVHGDLTSSNIVLIKEGKDGLGLSLIDFGLSSYSALIEDKAVDLYVLERALSSTHS
                     LYSQLYNEWLLEGYSLCYDVHKKTSACVEVERRLLQVRMRGRKRSMLG"
     gene            <274737..>275693
                     /locus_tag="C5L36_0E01340"
                     /db_xref="GeneID:40385931"
     mRNA            <274737..>275693
                     /locus_tag="C5L36_0E01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467688.1"
                     /db_xref="GeneID:40385931"
     CDS             274737..275693
                     /locus_tag="C5L36_0E01340"
                     /note="PKUD0E01340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323548.1"
                     /db_xref="GeneID:40385931"
                     /translation="MNSTQPSTPLGGDLQGPRHASLDDTTGMSPTTQFPTNMKKIGDL
                     PFQTSYEEYDRFISEITARPVSGAEGVETSPRVGDHAYVDPVCFNGHLKNVRLLESRL
                     NYRFLELESKLRFLRLLAAGTDLKQDDLALIEADSEAMSQQVESLEAQVEELKKIGKS
                     LRKKIGKCVQQAEIRRCIEGKPILQDEINTMMHEIAEAREFFKENGLFDEPGLELLEW
                     AKMFVNENLLGAELLVNNIDKLKKETRVLKEELTRVEGKIVSMEEQEKSLDEEIGRLQ
                     AEKEALEKHLSQLDQTEASDNDMRLSNEYSAITKLVETWETF"
     gene            complement(<275891..>277219)
                     /locus_tag="C5L36_0E01350"
                     /db_xref="GeneID:40385932"
     mRNA            complement(<275891..>277219)
                     /locus_tag="C5L36_0E01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467689.1"
                     /db_xref="GeneID:40385932"
     CDS             complement(275891..277219)
                     /locus_tag="C5L36_0E01350"
                     /inference="similar to AA sequence:RefSeq:NP_010820.3"
                     /note="PKUD0E01350; similar to Saccharomyces cerevisiae
                     YDR531W (CAB1); ancestral locus Anc_1.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323549.1"
                     /db_xref="GeneID:40385932"
                     /translation="MTLNDNTHINQVGPSAGTDTEISKGTPASEYDFTVDENNYSSAA
                     TSGTSSRQSSIYRHNHCSNQKPLNVLNAHIVNDSNQYVFDNIPETKDICLPNHSIDDI
                     NEISVDIGGSLAKVVYFTKDPINEEGVRLNFYKIETDKIDRFIEFLNDIITKNFPDRS
                     RTEVTVIATGGGAHKYHDKLVEKLNCKVQKEDEMQCLIIGLDFFITGIKNEIFYYDED
                     DNKYIEIEQDDESSSPESVYPYLLVNIGSGVSMIKVTGPNEGNFERVGGSSLGGGTLW
                     GLLSILTDCNSFDEMLEMASLGNNENVDLLVGDIYGKSYNKIGLKSNHIASSMGKVFK
                     EVLDTKTGEKLSRMERLEKFDQRDIARSMLYAVSYNIGQISYLQAQRYDLKKIYFAGS
                     YIRNHNQTIRTLSFAIDFWSQGEKKAYFLNHEGYLGAMGAFLMRRNEPIH"
     gene            complement(<277900..>279249)
                     /locus_tag="C5L36_0E01360"
                     /db_xref="GeneID:40385933"
     mRNA            complement(<277900..>279249)
                     /locus_tag="C5L36_0E01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467690.1"
                     /db_xref="GeneID:40385933"
     CDS             complement(277900..279249)
                     /locus_tag="C5L36_0E01360"
                     /note="PKUD0E01360; Pfam Domains: Rieske(2.1e-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323550.1"
                     /db_xref="GeneID:40385933"
                     /translation="MATAVASPKVQPSAPPSDGASLENVVGMHTLPASWWISEKVLEF
                     EKRAIFAKSWLFCTHKSRFAKAGDYYAFNLLGWNFFIIRTKEGEFKAFHNICRHRAYP
                     VVRKQQGSSTIIGCKYHGWSYDTNGKLKKAPQFDNVEGFDPEANSLYAIKTHVSRQGL
                     IFVNFDNTEDAQPFEEFFAGLQEEMDEYDFGDYEYHMSYELDGQFNWKTLMDGYQECY
                     HCPTAHPGLNQAFKMETYKVVPKGNYCRHYAKITEMVDEVIKEEEDPDRESSWFGFGK
                     KKEAPKKVTKKRENPGGEFNGLWCYLFPNNGVNCYSPAWYSIRVLPITAKRTILQYDI
                     YTKKGLNDDKKKEFVDFLQQVEIEDYNLCEATQKNLNNGIYKTGYLHPTRERGVLHYQ
                     SLVRDLVKKHYAIEEAAGHPVNPAALSASQSKDAEELEKMCAGIECMGSTPAEGLEW"
     gene            <280359..>283058
                     /locus_tag="C5L36_0E01370"
                     /db_xref="GeneID:40385934"
     mRNA            <280359..>283058
                     /locus_tag="C5L36_0E01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467691.1"
                     /db_xref="GeneID:40385934"
     CDS             280359..283058
                     /locus_tag="C5L36_0E01370"
                     /inference="similar to AA sequence:RefSeq:NP_011686.1"
                     /note="PKUD0E01370; similar to Saccharomyces cerevisiae
                     YGR170W (PSD2); ancestral locus Anc_5.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323551.1"
                     /db_xref="GeneID:40385934"
                     /translation="MDHATQQVFNNQLVSSGVKIPIVFSVQERLENGTLGDCRIKDVS
                     ILKDHLTSSIIFDISKNRLSEYTVKFEVSICNLASIQRLQLNNDSIKAVVYLENEKTS
                     SILETISLKNLLELGSKKVSHFTKTLNEFHLDLNFSIDSSDKRTEEEITNHFTTLRLP
                     YSPQSDLTSLPSYFSSDISSTNQSFASLNSLSPPSRPNSTCSKKKSIPNFLKPSLKGS
                     SKTNSNIDISTSNPDLYHEDTDGFLILQIESATGLPPFKKKTQLGYDMDPFVVVSFSK
                     QIYKTNVCRHALNPSWKNQLINIRVSKYSLKFLLKLSVYDFDVFTFNDDICSTSLEIG
                     DLINESEHNSNDTWTYKKLPLSFSDRALSKKLLKTQNYMPELSIRFKYVPVSTLAGLV
                     HSFNPTKTRCPYCHKLDKKHASALQHLSICRMGLKPSQFLHKHYTTSNHASRRWYVKI
                     LAHIAYGRLTVGGNNAHILVQDRVTGLVLEEKISVFVKLGIRLLYKSVKSDNSSEKIK
                     KMLRSLSIKQGAKYDKPSSKSKIEEFVKFHGLKSTLVECENPDLSSYRTFNEFFSRKL
                     KSDARPLEGGTDNQIIVSVADSRLIVFNDISSAKNLWIKGNGFTVDKLLGRKETGEVK
                     FKYSIAIFRLAPQDYHRVHLPLNGKIVKINHIHGSYYTVNPMAIRSALDVFGENVRTV
                     ITLETEEYGDVELVMVGAMMVGSIILSVKVNDIVKKGQELGYFKFGGSTVILVFRNSR
                     EDSNMPKMVWDGDLLSNSNKKLETLVKVGMSVGHSVRSKEFRRGVKKEVSDSERREII
                     RRVTGIPENPTPGVGDNIKAKLGGMIDDVMSTKSVKSYNQRNEIENMLQSDWEIKELT
                     TLEGLNDNGELRDQIDIDVTRGFDGTNFFHMLDNSDEYNSLDK"
     gene            <283303..>284058
                     /locus_tag="C5L36_0E01380"
                     /db_xref="GeneID:40385935"
     mRNA            <283303..>284058
                     /locus_tag="C5L36_0E01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467692.1"
                     /db_xref="GeneID:40385935"
     CDS             283303..284058
                     /locus_tag="C5L36_0E01380"
                     /inference="similar to AA sequence:RefSeq:NP_012033.2"
                     /note="PKUD0E01380; similar to Saccharomyces cerevisiae
                     YHR163W (SOL3) and YGR248W (SOL4); ancestral locus
                     Anc_5.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323552.1"
                     /db_xref="GeneID:40385935"
                     /translation="MVKVYSYSNNDEIAQSLAKFIVSQQDSVLATKEKFNIAISGGSL
                     IGILGKGLLNNKDIKWDKWVIYFSDERIVPLSDNDSNFGAFEKEVLEKLAHAGKVGPT
                     VVTINENLIHPDDHTTDGEIAQTYASELPESGLDLVLLGCGPDGHTCSLFPGHKLLEE
                     NELDVAALHDSPKPPPRRITLTFKYLAKCTTLAFVATGASKQEALKEIFGNENSQLPC
                     AITNRLVSKVKGGICWFVDDDAIEGVDVQTLKY"
     gene            <284605..>284907
                     /locus_tag="C5L36_0E01390"
                     /db_xref="GeneID:40385936"
     mRNA            <284605..>284907
                     /locus_tag="C5L36_0E01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467693.1"
                     /db_xref="GeneID:40385936"
     CDS             284605..284907
                     /locus_tag="C5L36_0E01390"
                     /inference="similar to AA sequence:RefSeq:NP_076903.1"
                     /note="PKUD0E01390; similar to Saccharomyces cerevisiae
                     YLR363W-A; ancestral locus Anc_4.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323553.1"
                     /db_xref="GeneID:40385936"
                     /translation="MAQGNLKLSKKKAARVTKHQKNPKAAAPKIYKSKHVSTKEKQVQ
                     KLTKQHQAKLISSTEKLISSRVGHLELLKGDRRTLEKEERLREQAKATKAKAASGK"
     gene            <285499..>286980
                     /locus_tag="C5L36_0E01400"
                     /db_xref="GeneID:40385937"
     mRNA            <285499..>286980
                     /locus_tag="C5L36_0E01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467694.1"
                     /db_xref="GeneID:40385937"
     CDS             285499..286980
                     /locus_tag="C5L36_0E01400"
                     /note="PKUD0E01400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323554.1"
                     /db_xref="GeneID:40385937"
                     /translation="MYNCGISDTECSLDAPSKNEAQATTMKLTSLVSALALVNTVTAI
                     EKGAVFRFDNGCNDGKDKHIKTIPQTDATLNLAYDFGVSPFYNIAEVQDLENVMLGNK
                     KEDGNDYEKDKLIIIINGVDKPSKFLKEYDVKPVYKVKFKDDRQSSKFKSFLQKVPEQ
                     LSQLKEKAGYQMSSLSNEISILSDSNKKVSYLESIWNKYFHFEEDHKLQSMWRNVKES
                     IAPSNSESILKISIDKRSLDLINDSSFINEITQLDFFLNEELENNVKEGIVIVNIDSL
                     ISIFKKTGSTQTYETCKKIISKLLVEKLEKVGETVTTTLVVLPLDQSLKSVKCEKKLK
                     SHRNPQHKEHHKEHHKEHHKKDKPQHGERKSHHISPQMLNKRSEEDIFSAEKFQGACY
                     KNQLECIESTESCSGHGTCTLVGSCYQCECLPTRDDNKRTTYWTGAACEKVDYSSQFN
                     LLFWTSLVLLVTIVGGIKLLVSCGSEELPGVLKAATVQTKKAI"
     gene            <287516..>288415
                     /locus_tag="C5L36_0E01410"
                     /db_xref="GeneID:40385938"
     mRNA            <287516..>288415
                     /locus_tag="C5L36_0E01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467695.1"
                     /db_xref="GeneID:40385938"
     CDS             287516..288415
                     /locus_tag="C5L36_0E01410"
                     /inference="similar to AA sequence:RefSeq:NP_014866.3"
                     /note="PKUD0E01410; similar to Saccharomyces cerevisiae
                     YOR223W; ancestral locus Anc_8.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323555.1"
                     /db_xref="GeneID:40385938"
                     /translation="MTTVQFVVRYVNGLKDTVIQLDIHANPGMVNNVPIGYIRNEIRK
                     MYPELAKKRLKLLHNGRVLESHTNFSKEIAYLQKNLDEDNGVNDHNPKEKINIYFHCI
                     IGDDLTEKEVAEEEKLDQQPIKSTTDAPKGFDRLLSQGFSASDIQDLRDQFFRLHGAN
                     LPRNATQEQITELEDRWIDSSVNNEIDEFPANIRLSTSDPAGDASNVDGDDDGRNGVN
                     ANVNSNSNTNMVNVRQLMFQQNLQSHKDMFFAVCIGFALGGLALLLLFLDVGGIFDKK
                     TRIAVLSGVVVNLSFGLLHSWGG"
     gene            <288542..>289180
                     /locus_tag="C5L36_0E01420"
                     /db_xref="GeneID:40385939"
     mRNA            <288542..>289180
                     /locus_tag="C5L36_0E01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467696.1"
                     /db_xref="GeneID:40385939"
     CDS             288542..289180
                     /locus_tag="C5L36_0E01420"
                     /note="PKUD0E01420; Pfam Domains: MTP18(5.6e-100)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323556.1"
                     /db_xref="GeneID:40385939"
                     /translation="MSKSVSETITEKIPNIGEVDNKDNTDSTESALRYSAYANRIRTI
                     LLASHRYVAYTSDIGESFRPVAHPKLVTLGYGISWAYLLGDVGYETWKAKLRQEGRYK
                     PGLKPWDDTPLANPVAAMAYDDLDWKVLGVKRALFQSVASMGLPAFTIHSTVRYSSLL
                     FKNAKSKNLKTFGPVALGLGIVPFLPYLFDKPVEEAFDYLFDSFFTKPRKLE"
     gene            <289376..>290386
                     /locus_tag="C5L36_0E01430"
                     /db_xref="GeneID:40385940"
     mRNA            <289376..>290386
                     /locus_tag="C5L36_0E01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467697.1"
                     /db_xref="GeneID:40385940"
     CDS             289376..290386
                     /locus_tag="C5L36_0E01430"
                     /note="PKUD0E01430; Pfam Domains:
                     CRAL_TRIO(2.3e-28)|CRAL_TRIO_N(5.9e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323557.1"
                     /db_xref="GeneID:40385940"
                     /translation="MFGFGRKNTGPVKEWKVDDSKAVVSKTFDQPPTSIEHTPEYEDI
                     EKEEHEEIYNNVLKHFKETDLYPVKEGDCPKSDWKPLNKYEKLWLSKQCLLRYLRACN
                     WKQEEAIKRIIGSIAWRREFGIGGGEWDKITPESVEVENETGKHLVFGFDDEKRPCLH
                     LYNGKRNTKASDRQIQFLIFMLERTIDFMPQGQDKLCLCVDFKKYPESCTEDPKVPPV
                     SLGKSILYILQYHYPERLGRALFINMPTLVNIFLKLCWPFVDPYTKQKCKFDEPFDQF
                     IKPEQLAYNYGGDVNFDYMHDEYWDDFVAKAEKKRAKMMENFEKKGGEIGTSEWDIRD
                     GI"
     gene            complement(<290485..>290937)
                     /locus_tag="C5L36_0E01440"
                     /db_xref="GeneID:40385941"
     mRNA            complement(<290485..>290937)
                     /locus_tag="C5L36_0E01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467698.1"
                     /db_xref="GeneID:40385941"
     CDS             complement(290485..290937)
                     /locus_tag="C5L36_0E01440"
                     /inference="similar to AA sequence:RefSeq:NP_014867.1"
                     /note="PKUD0E01440; similar to Saccharomyces cerevisiae
                     YOR224C (RPB8); ancestral locus Anc_8.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323558.1"
                     /db_xref="GeneID:40385941"
                     /translation="MSSTLFDDIFNVESTDSARYDRVTRIVANSTSSPDTRITLDINH
                     ELFPVSENDTLTITLAKSLNIDDSSAMDTDDLVGANGSWRPPKPDQVSLMNDYDYVMH
                     GTVYKFEEGKDDKISVFCSFGGLIMCLEGNYRNLVGLKQENLYILMRK"
     gene            <291231..>294128
                     /locus_tag="C5L36_0E01450"
                     /db_xref="GeneID:40385942"
     mRNA            <291231..>294128
                     /locus_tag="C5L36_0E01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467699.1"
                     /db_xref="GeneID:40385942"
     CDS             291231..294128
                     /locus_tag="C5L36_0E01450"
                     /inference="similar to AA sequence:RefSeq:NP_014862.3"
                     /note="PKUD0E01450; similar to Saccharomyces cerevisiae
                     YOR219C (STE13); ancestral locus Anc_8.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323559.1"
                     /db_xref="GeneID:40385942"
                     /translation="MNDHTVIKGHSLESDYPIGNESDDGIIHDNIDDFDMDMDIENGN
                     PEIDYYPGLSKTGHSFLGQPESMASSIKRKIKKFLNLLNSYQGRKLIIGIFMASTAIV
                     LFALMLFAGHSGGDASLPGGAVHEGNGDGNTEYPYDNEKQNSGSDSGEKGLPENDVQN
                     LAKMSLDDMRSGKFWVFDYNVNFIDYDETNETKEVSEDSSRSKRSENDDKDDDKDDDN
                     DDDKDDDKDDDKEDDKGRGKNDEKDDVNVPKHKNGDPGYYLHQSEGMVYLQMASDKSF
                     KRSILELSKLQYGGNMLNPHLVSVTKDLKKFIVSSESEDVWRHSSLARYWIVDAETQE
                     VTPVHYTTKKSDSVEIIVPLKISYAAFSPDGHFVYFNYNSNLFLKDLKSGKSKQITKD
                     GDGANILNGKPDWVYEEEVLASDRAIYWDNKGSKFAFIKWDDTNVPVYNLELFGDNKY
                     PKILELKYPKPGFPNPVVSLYVYHIESSKIIKVKQPEDQEKDSDFLGKDFIIYQTTWI
                     SENELLFKRTDRSSRKIQVCVFDVKENKTKVVRAYNTDEYNGWYKNNGAIYVLPDKLG
                     YIDNVVHEKHDHLAHFKSAFDSEGDLITSGDWDVIGGVVGYNAEDKQVYFIGTSGNSL
                     QRQIYRVSLDGTILTGLTELDKIHHYSLDVSKTGKWGVIKYGGPELPTQKLVELDKLL
                     DGDYYDSIPTLNEVEKVEETLKNFEVPTKEYIPIKLHDDVTVNVIEVKPKDFDESKKY
                     PILVSVYGGPGIQKVSCEFNYGFEEVVSSSLDAIILYIDPRGTGGSGWEYRGWARDNI
                     GYWEPSDITEATIIYMNERESYIDKERVAIWGWSYGGFTTLKSLEFDEGKTFKYGIAV
                     APVTNWELYDSIYTERYMGVLSEDNKYEDAKISNFEAFGKVVQFLVIHGTADDNVHYQ
                     NTLQLLHEFDIAGIENYDVHVFTDSDHSIRHDNANVIVYDKLYNWLATAFN"
     gene            complement(<294291..>294800)
                     /locus_tag="C5L36_0E01460"
                     /db_xref="GeneID:40385943"
     mRNA            complement(<294291..>294800)
                     /locus_tag="C5L36_0E01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467700.1"
                     /db_xref="GeneID:40385943"
     CDS             complement(294291..294800)
                     /locus_tag="C5L36_0E01460"
                     /inference="similar to AA sequence:RefSeq:NP_012559.1"
                     /note="PKUD0E01460; similar to Saccharomyces cerevisiae
                     YJR025C (BNA1); ancestral locus Anc_5.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323560.1"
                     /db_xref="GeneID:40385943"
                     /translation="MLGAPINIQKWIEANEDKLKPPVNNYCLQNGGFTVMIVGGPNER
                     TDYHINQTPEWFYQYKGDMLLKVVDNGEFRDIPIKEGESFLLPPDTPHSPVRFANTVG
                     IVLEQDRPETMMDKMRWYCKNCSEICHEEAFHCHDLGTQVKAAIDKFDNDIKLKTCNY
                     CGTVNKSRP"
     gene            <295216..>297552
                     /locus_tag="C5L36_0E01470"
                     /db_xref="GeneID:40385944"
     mRNA            <295216..>297552
                     /locus_tag="C5L36_0E01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467701.1"
                     /db_xref="GeneID:40385944"
     CDS             295216..297552
                     /locus_tag="C5L36_0E01470"
                     /inference="similar to AA sequence:RefSeq:NP_012441.1"
                     /note="PKUD0E01470; similar to Saccharomyces cerevisiae
                     YJL094C (KHA1); ancestral locus Anc_1.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323561.1"
                     /db_xref="GeneID:40385944"
                     /translation="MAQDSSGIIAGMNPLKYSTTSPYTMFFFQLIVIITFSLVLNYPL
                     SKIKQPRVIAEVLTGVILGHTALGRIPNFTKYVFPPESIPGLTLVANIGICLLMFIVG
                     CEVDVKFIKKHIFTAVSVGLFNMAVPFGLGCLCAIGLWKEYRENADGLPQIKFTTFMV
                     FIAVALCITAFPVLVRIITELRLVKDRVGTVVLAAGITNDLFGWVMLALSVTLANASD
                     SLVTLYIVLVCFGWCLFICYPVRITLNWFLKNCLKEFDGSNEPSRPAMTLILVMVFAS
                     AFFTDIIGVHPIFGAFLIGAIVPRENNYVIGLTSRIEDLVNIIFVPVYFGIAGLSVDL
                     GLLRSGADWGWAIGLIVIAMVGKISGGLIASKLRGLFWRESLTVGVLMSCKGIVEIVV
                     LQVGLNANIITRKTYSMFIFMAIITTFLTTPLTLYAYPASYREKVQVWIQEAANEKLK
                     KTAVNDKETILVEKEDIVIDKLILAVDDVDSLSTGMLIIDILLENAQIPIHAINMKTL
                     TERTADILHASMMNEDENQHGYTSLNSTLSVFSIFCHYNRIPFTSEILYSLPENYLET
                     LLDNSSFSDNNLFMLPMTKKNFSIQNIRDIIKESQHLNYYKGIFINNGQFLFTQNDHA
                     DMGTKEANGRFSEDTMLNPTALKISSVTLFLNHPELTKNDKLAMHLFEILVKGKDLSV
                     GKVILDNIEPESRTNDIISSWIKDNDEIFGKIHFTITNKTNTLSKLDTGKSISAFLTD
                     ETKTFSELDRLIIVSADGNDINLISELVEKHEKVIVLF"
     gene            complement(<300563..>301663)
                     /locus_tag="C5L36_0E01490"
                     /db_xref="GeneID:40385945"
     mRNA            complement(<300563..>301663)
                     /locus_tag="C5L36_0E01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467702.1"
                     /db_xref="GeneID:40385945"
     CDS             complement(300563..301663)
                     /locus_tag="C5L36_0E01490"
                     /note="PKUD0E01490; Pfam Domains:
                     ADH_zinc_N(9.9e-11)|ADH_N(2.6e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323562.1"
                     /db_xref="GeneID:40385945"
                     /translation="MNSGLIRSKALTYSSFWNLGVSYINVPTNIKPGEVLVHVRAVSV
                     NPFDIMMHKLSLFFIGSFKKVTGCDFAGEVVKAGENAPFKEGDSIYGCRLAPMSINGT
                     YSEYIIVDPKKCIFCDKIPEGMIYEQAASIPCVSATAYGALKMGINRICPTIKDDLEG
                     SLKGKNILVIGAGTSVGSYAVEMAKKYMDAKAVVVTCGTRSEQRLRDAGADLALDYHD
                     GDLKNVNEILKYVKDHGKFDMVLDCVRNEVYYDYADIILKAPSDNGAFVQLYGSNSMN
                     LFNCSLSSIIFPSFKSIKYKLMHLLGVYKSPLYVYKLAYDSTFGSVIDTMWRKKLLDT
                     PIDSIFRGWSQYDLALHKVATANISGKVVCIL"
     gene            <301990..>302724
                     /locus_tag="C5L36_0E01500"
                     /db_xref="GeneID:40385946"
     mRNA            <301990..>302724
                     /locus_tag="C5L36_0E01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467703.1"
                     /db_xref="GeneID:40385946"
     CDS             301990..302724
                     /locus_tag="C5L36_0E01500"
                     /note="PKUD0E01500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323563.1"
                     /db_xref="GeneID:40385946"
                     /translation="MSLVKNNKVFITPTKKLFYTTSPLKRIYGPDGLTTSVLQRHNIS
                     RREKLLAAYRNVVRLVKYIQIHNHFRQILVVLAKIRLRQDYKYRRSIFLNTPYNESDF
                     DVRLVNTVNFIHNASLDNPYNETSRPSSLEFKIINSLVQFENTKALPGPLRGRLKSEF
                     VAIEKWRELRGIERAWNMSNADEKTKDERMWWLEGQKLRNDVCFDYLKELQLIEKKTF
                     LDHMVTSMIEYERAIVLLNEECHLFL"
     gene            complement(<302908..>306252)
                     /locus_tag="C5L36_0E01510"
                     /db_xref="GeneID:40385947"
     mRNA            complement(<302908..>306252)
                     /locus_tag="C5L36_0E01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467704.1"
                     /db_xref="GeneID:40385947"
     CDS             complement(302908..306252)
                     /locus_tag="C5L36_0E01510"
                     /inference="similar to AA sequence:RefSeq:NP_010708.1"
                     /note="PKUD0E01510; similar to Saccharomyces cerevisiae
                     YDR420W (HKR1); ancestral locus Anc_5.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323564.1"
                     /db_xref="GeneID:40385947"
                     /translation="MLNFFLIPLVLLSIPHASAGEHSDFFSTHANDKYNNNNNNNNNI
                     NQYINEISSSVDAQSSSSLFTDLTQSPTPVVSLTSLESSSSETFSDPTPTTTPMPTST
                     SSLDFSPTETNTQQSAPSTTSSSSDAQIISPSSSSSSSDTLNWGLFYTPSPSSLTEST
                     SSEETSSTPTLADSTSYTPAPITSSTYTSSSSTYNQQDTSETSLDTISLSSPATSFEV
                     SSDVQSRATALGFSNLESTTSSTEATSLPESTSLNEFTSSTSSTSSTDSTSSTEPTSS
                     TEPTSSTDSTSSTEPTSSTDSTSSTEPTSSTDSASSIEPTSSTDSTSSTEPTSSTDSA
                     SSTEPTSSTDFTSSLVSIQPSSESTVVWGPTQTSFSFASTPDWDLIFHTTVSSSVTTG
                     GSEGSVSASSVTTPSSVTDTYSSDTSGSLTTSEVESSSVSSTDATQPDSVLISPSSSS
                     SDGSSSSETQTTFSFPVLSSSNDIPASTYTPSSTQVSTSVSVQLSSTSSELFLSTSVT
                     SNTEASMKFSSSSASDILSLSTQIPSSNDVLSTSTPYSFSSTDSTSVGRSTFSEVSNS
                     TDTSFIAPTSSTSEVFDTSSGSFIPPTYSTSEVSSTPISTSTWVSNVTPAASTVSSRS
                     SVSWPSTSSQQYVQPSSLTSTVLPSTSVVSTSSISAITKASYMGVSSEIESHFSVSAI
                     SSSSQAYTSDFPSYPVTTSTFSSSQPVAQNQNTVPVSVATSISNPAPVSNIVTQTPVN
                     SNPATTSFVETNAPQSQDTSTSEETGKNATTSSSGILVLTTTWLPTVIIAETKTPSDA
                     SAEATSTSLATALLPRAIMPTNVVNENPDFELVTIGFTEALNYAFVVQHSLSSAQIFE
                     YLPLVLANGFPEVSTKHIVVKSLVPYQSVQVDYMITVAEVYFDKKYIDELQDAVTNRT
                     SLIYSNPDKTISSLAELIDPKIPVDGLLSSLNAVQSVGSSDSNNRASGENSREENIAA
                     SLGSLDSDAISASTTPASKKVGGIRRFFIIFFSVLGACLLYGAIVIYFFRRKMMKHRL
                     PEDNDWSDNDFSSSEDKFISKEFKDLNYSGSLGDVRLNRSESSLNTSQNHSSISNILG
                     FIKKQESPRSIPEISAPVNVKSSLGW"
     gene            <307408..>308253
                     /locus_tag="C5L36_0E01520"
                     /db_xref="GeneID:40385948"
     mRNA            <307408..>308253
                     /locus_tag="C5L36_0E01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467705.1"
                     /db_xref="GeneID:40385948"
     CDS             307408..308253
                     /locus_tag="C5L36_0E01520"
                     /inference="similar to AA sequence:RefSeq:NP_011354.3"
                     /note="PKUD0E01520; similar to Saccharomyces cerevisiae
                     YGL161C (YIP5); ancestral locus Anc_8.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323565.1"
                     /db_xref="GeneID:40385948"
                     /translation="MSKSNLFADNDIDGFQIDDNLNDDTLISPDNNPANLMASPEVPQ
                     SLHINNTPQFKKKYEGGIFSLNYYRQYFDLNTSEFISNCLSSLNPLSKPSADDFNHIG
                     DVYGSIWITATLVFLLFFCNSFAALLSGWFLNIDLKSMKINYFKMIISSINLLYGYSV
                     VIPLILYLILKFYLKVLFLVPLSKLVSIYSYANLMWIPAALLSIFRGFLVNHSILDTV
                     LKWICITIGALMSGASILHKLKIYFSSIFGEEEKKMMYALLALLFLAHVGFAIGLKVC
                     FFGKL"
     gene            310328..310399
                     /locus_tag="C5L36_0Etrna3C"
                     /db_xref="GeneID:40386411"
     tRNA            310328..310399
                     /locus_tag="C5L36_0Etrna3C"
                     /product="tRNA-Cys"
                     /note="PKUD0Etrna3C; codon recognized: UGC"
                     /db_xref="GeneID:40386411"
     gene            <310756..>311823
                     /locus_tag="C5L36_0E01530"
                     /db_xref="GeneID:40385949"
     mRNA            <310756..>311823
                     /locus_tag="C5L36_0E01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467706.1"
                     /db_xref="GeneID:40385949"
     CDS             310756..311823
                     /locus_tag="C5L36_0E01530"
                     /inference="similar to AA sequence:RefSeq:NP_010288.1"
                     /note="PKUD0E01530; similar to Saccharomyces cerevisiae
                     YDR005C (MAF1); ancestral locus Anc_3.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323566.1"
                     /db_xref="GeneID:40385949"
                     /translation="MKYIDEFDIDLVNQFLTFNTTEMHIQGTCDLFTTKPVGSDRKLY
                     KVLDKMYNTEDNDEGESLKDMDSKQRQNSLNSVGSTEKSQSSPDNVNSQFIQLKNRSF
                     SYSHTTKPQVLNNGDDATLKRSHSFASPTPETQIEHYEEDSPFGPLSQSSSRKLFGYL
                     IGALNGTFPDHDFSTVQPKHFTMLHSAGELIAKVNSFLISSGKSTGLDWIWQTINTHM
                     ELDHCVCFQFDPSQSFLDDLGVIWCNMYFMFNKKKKRVAFLYFLATILNEADNSTTIS
                     RRRNSKRGTLDEEGMKMGEDDSEYDLRYNEDYEPIYEDVFEDDDIDMIDGTNTINKDE
                     EGYDMSDDELANLNQDDEGYL"
     gene            <312120..>313721
                     /locus_tag="C5L36_0E01540"
                     /db_xref="GeneID:40385950"
     mRNA            <312120..>313721
                     /locus_tag="C5L36_0E01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467707.1"
                     /db_xref="GeneID:40385950"
     CDS             312120..313721
                     /locus_tag="C5L36_0E01540"
                     /inference="similar to AA sequence:RefSeq:NP_010287.1"
                     /note="PKUD0E01540; similar to Saccharomyces cerevisiae
                     YDR004W (RAD57); ancestral locus Anc_3.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323567.1"
                     /db_xref="GeneID:40385950"
                     /translation="MDLPRQCSEDSFLLKDDQSEQFLLSLTNNRVLASELLLYSPGVI
                     SDKLNKTENEINEFVWKYKNETLARIKRSLRHPFDPESSEIRPDHFTIGDESIDKKLN
                     GGIPVGYLIEVSGKSSCGKTNLLLTLSITIQLPKEFGGLGPSVFSSDHASTQLDNVKT
                     LYVPTESPLPSQRLKQIVDNYAELLQTNGISKERADLFPKLDNVLTTSSVMSTLDEQD
                     HILQYQIPAMLSRDPSIKLLIIDSMTHHLRVQLPWKEQSRYVRKTCRYLKTLARKYSI
                     TIIISNQVTDKPVKGLLTGENDILWKLNTEYQQAWMSGWDNIGIIYRQLMKREGIIDE
                     AGESFERLDYLDEISSADKFSQITNDSMTDSTGSTQQTQKQSLKSVLRLERKQLFDSS
                     YKVKVSGIGTRPALGLTLLENIDMRIVLSKEYAPILNENLIDEFSVELGIDSFNDSCG
                     TSHENNSISNTNYLETTTQNKQNENLIDKKQLVESLANNTYLKNYNFETFRTIRCVFG
                     PLIPPGETKSIEFEIWKGGLRKYVR"
     gene            complement(<313725..>314666)
                     /locus_tag="C5L36_0E01550"
                     /db_xref="GeneID:40385951"
     mRNA            complement(<313725..>314666)
                     /locus_tag="C5L36_0E01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467708.1"
                     /db_xref="GeneID:40385951"
     CDS             complement(313725..314666)
                     /locus_tag="C5L36_0E01550"
                     /inference="similar to AA sequence:RefSeq:NP_009707.3"
                     /note="PKUD0E01550; similar to Saccharomyces cerevisiae
                     YBR149W (ARA1); ancestral locus Anc_3.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323568.1"
                     /db_xref="GeneID:40385951"
                     /translation="MSASTTTTTLNTGAKIPLLGFGTVFEGDDYNLFKESLRAALLVA
                     NYKMIDTAWYYGTEKSIGEVLEEVFNEGKIKRDDLFITTKVWPCFWNDPETSLDTSLK
                     DLKLDYVNLVLQHWPRCFKKVEDENGRVPVPRDEKGNIQFDEDGDYLTTYKKLLKLKE
                     QGKAKAVGVSNYTIAMLDRAIEETGVIPAVNQVEMHPHLPQVDLYNYCKEKGIVLEAF
                     SPLGSSGAPNLKIPLVLELAKKYDTQPANIIINWCISKKIVVLPRSTNIERIKKGYDL
                     VELTPEEVESLDKFGEQSPHRFVRDDWGKGLGWDHWD"
     gene            <314959..>316830
                     /locus_tag="C5L36_0E01560"
                     /db_xref="GeneID:40385952"
     mRNA            <314959..>316830
                     /locus_tag="C5L36_0E01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467709.1"
                     /db_xref="GeneID:40385952"
     CDS             314959..316830
                     /locus_tag="C5L36_0E01560"
                     /note="PKUD0E01560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323569.1"
                     /db_xref="GeneID:40385952"
                     /translation="MNNNRVCHFTNLCRTCKMKVYVHMYPRQIQSKYIFRSYTQLSRL
                     SFTNIDRELLPIPYYKPSDILGTDVSKHSMERIMIPQFTEAPMGDQESSIVDIKNFPT
                     WYERLDSISSYRLHKDIALEGQEKKIYSSFSKCYSRVLSYYADHFISLTRERLHDLMS
                     KLDNSDKPDHVQKLYIKIDLSEKRLSTISRNTYVIYQRLKVERETLPFYLHQQFLIHL
                     NEGNIAKLLNVYFEFPHPRPLYLKREEFEKFMKLLLKIKISGDHKPLLKKIVEVFADI
                     RENGGPISLTPFEDTKYFSLMLNSWESEGMSKSEIYEKVLEIRAVKGPKPLKFVPAMW
                     NCFLTHVPEKSEEILKLMAKEIGLTRFTAEIVLNNADSFDRLCNTLELMKLKNFHMDE
                     KIFALVVRKYIQFGKTHEALELVEKLLDSFQDLTSRNYSFRPLSLERTEVFKLDILNK
                     AFQQLHNEQQEMEHQWLQYKFIPSPFALGELLVSLDREGIIRLLNTMIKHNIPLTHKH
                     ALNVIEKIEPSLLHLVLESVNRSRDFNINLKKISEEPKYNTAFYKNYTLQHQDIVLEL
                     REIFRKSLFLYDQMVDHVVPEKSRLKTVEQLVSITDYVKKNYNVTFSGKDDIDYLNS"
     gene            complement(<316957..>318393)
                     /locus_tag="C5L36_0E01570"
                     /db_xref="GeneID:40385953"
     mRNA            complement(<316957..>318393)
                     /locus_tag="C5L36_0E01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467710.1"
                     /db_xref="GeneID:40385953"
     CDS             complement(316957..318393)
                     /locus_tag="C5L36_0E01570"
                     /inference="similar to AA sequence:RefSeq:NP_012182.1"
                     /note="PKUD0E01570; similar to Saccharomyces cerevisiae
                     YIL084C (SDS3); ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323570.1"
                     /db_xref="GeneID:40385953"
                     /translation="MMLHSQEDPQYQTQIQSQAEAQIRLQQMHHFQQVQQMQQLQQIQ
                     QYQQYQQIQQLQQIQQVHQYQQLPPFPHNLHHDPHPQNMTLPYQAYQTLEIQQREQAH
                     LIQAQAHAQQQAQAQVHAQAQQAYAYQQQQQQQQQQQQQLEQQEPQIQPQYQYQAGSH
                     SQQNGNTEQPLTKRARRRIQMQTKLSKLEQQFLADKDVHYRDYLIQLQYNLSTLYTNE
                     NPEYLEKIRDKEEWRDMELVRLRLAEEYQVNFINNSFKQEYEQTVENTKAVIEMVKTK
                     LRDGLLNKIKQLKEDKALIDIVTSSKSGTVHTSTRSRNTLNDEDGSFVSMNSIRGNHE
                     GGGYNTEDGNNNGNTSGFETSTSNFFFSGERRSRRKRNHDNALLHDSTVTNSNDDSYD
                     SSATGGHSSRKKNRTNGNISSANEDEGKIYTENPILNEFLYGNKGSIGRKEKFSTRHT
                     NRNSPLCPPLKPEEINEDLNLLRSIRRK"
     gene            <318679..>319977
                     /locus_tag="C5L36_0E01580"
                     /db_xref="GeneID:40385954"
     mRNA            <318679..>319977
                     /locus_tag="C5L36_0E01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467711.1"
                     /db_xref="GeneID:40385954"
     CDS             318679..319977
                     /locus_tag="C5L36_0E01580"
                     /inference="similar to AA sequence:RefSeq:NP_013709.1"
                     /note="PKUD0E01580; similar to Saccharomyces cerevisiae
                     YML005W (TRM12); ancestral locus Anc_2.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323571.1"
                     /db_xref="GeneID:40385954"
                     /translation="MTAYYVRVDNGRHVKPLKTLLEKEGVFNHKLKITKLGPSNYAIP
                     VLLDDNKTGEVESFKRFLIKVFPDIKVCIEKSEEVNGHEKTIGTSLAVAMRGLFTSLG
                     VGDEVLVSQLLVDLPRRYSIYPPLLLLPVNTLDSEVWNKFLANLSLPQRNQIFRLILE
                     FYSTNTNALTHLAINKPIPESDNVIRSPTQLTTLYGDFNNFWCHVVQNGIYQTWMPTY
                     TMFSRGNIKEKARILTSYEDIDHNHDVVDMYAGIGYFTLSYLKRGARRLYCWEINPYS
                     VEGLSRGVTKNNFGNVYIVKKNEKVDLKQVNGARCVIFVESNEYCLERFRELKLQATS
                     SVRFDLSISHVNLGLLPTSKPSWPYSCQLLDLYGAETTWIHVHENIGILDLDNFLQNA
                     SAKLQGLSEEKRVEPIWLEKVKTFAPDVYHVVGDFKLVSL"
     gene            complement(<320084..>321454)
                     /locus_tag="C5L36_0E01590"
                     /db_xref="GeneID:40385955"
     mRNA            complement(<320084..>321454)
                     /locus_tag="C5L36_0E01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467712.1"
                     /db_xref="GeneID:40385955"
     CDS             complement(320084..321454)
                     /locus_tag="C5L36_0E01590"
                     /inference="similar to AA sequence:RefSeq:NP_013292.1"
                     /note="PKUD0E01590; similar to Saccharomyces cerevisiae
                     YLR191W (PEX13); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323572.1"
                     /db_xref="GeneID:40385955"
                     /translation="MSQQRPKPWEAANGNAASPNANNDPLPLHDSLVSDVRSTPEVPP
                     KPSSVPSSTNESNTLNGSGGYGNGGGSTYTSTYGSGYNNYGTSYSGYGGYGGIGGYSS
                     GLGGYGGMGGYSSGLGGYGGMSRYGMGGMGSYGGYGGMYGMGGMGVGMNGISSQGQGQ
                     GGMMDATARTFQVLENVVYAVSALAALLESTYYATHNSFFTILGVADQLGGVGGAIKN
                     TISGAVDSTKLIGSASFVDGTSGSNSNRGPLGIYALLSWLKRLIKKILGFSSSPSSRN
                     GSRNLLEEFTNWRSGIQAGSTNPQNNGKNKLSLKPLFAFLIALVGMPVLMSKFVRYIE
                     RHQREKIKGAGINFNGNSSQKNADVNTPNGRIDPRSLEFARATYDYIPEREDEQAGGW
                     KELKLSRGDLVAIISKVDGWSHCRSRDGRVGFVPTNYLEIIKRPERGKPVTKEKNDAK
                     TEQLVK"
     gene            complement(<321935..>323719)
                     /locus_tag="C5L36_0E01600"
                     /db_xref="GeneID:40385956"
     mRNA            complement(<321935..>323719)
                     /locus_tag="C5L36_0E01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467713.1"
                     /db_xref="GeneID:40385956"
     CDS             complement(321935..323719)
                     /locus_tag="C5L36_0E01600"
                     /inference="similar to AA sequence:RefSeq:NP_116695.3"
                     /note="PKUD0E01600; similar to Saccharomyces cerevisiae
                     YFR037C (RSC8); ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323573.1"
                     /db_xref="GeneID:40385956"
                     /translation="MSVAPETSTAEKNQASVENTQADLYAQANIYLAKQTKPVIIPSF
                     AKWFDMNGIHQIEKNSLPDFFSSQSNSKYKNAEIYKNVRDFIINAYRLNPIEYLTLTA
                     IRRNIAMDVGSLMRIYGFLSKWGLINYQIDPKTKSFTMGPQFTGHFQITLDKPNGFAL
                     QMNERAVSAEGDNGSADGDNVSTHNVNDVNGEGKSVVTAVMNEDEPATKKQKISNSVT
                     PDVKLNLQLRKNVYDSASDAFVLQDTNNNSNNAKQVKRVYCSITGNDITETKYHNLKN
                     KSNISQECFENSQFEDFFKSTDYVKLDKTVLNNTNKPWSNNEVLLLLEGIEMFGDDWN
                     SISGHVGSRPKDQCISKFIQLPIEDAYLFKHISKSSYVEYLKKLKENKTIDLSSILEK
                     LATGNNLSITSTTTTSTTTTLDLHNDNSNNNKIDATNIQKHAQSEIANQDKIISSILK
                     LSLRKFELKLQGFMNLESRISEQEKFIESEKENLILDKMKVKKQCVRVRQELQKASEI
                     IQSVQNMDPITPENIDSVVVEALAHLDRVVAEIKYDPTVTTNVSSLNAAALENNKTAE
                     VSTETQKVEEFEKPISIVEPKLYTMWSA"
     gene            <324124..>326406
                     /locus_tag="C5L36_0E01610"
                     /db_xref="GeneID:40385957"
     mRNA            <324124..>326406
                     /locus_tag="C5L36_0E01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467714.1"
                     /db_xref="GeneID:40385957"
     CDS             324124..326406
                     /locus_tag="C5L36_0E01610"
                     /inference="similar to AA sequence:RefSeq:NP_116696.2"
                     /note="PKUD0E01610; similar to Saccharomyces cerevisiae
                     YFR038W (IRC5); ancestral locus Anc_7.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323574.1"
                     /db_xref="GeneID:40385957"
                     /translation="MEDIEGEDISLASLLSKEYSDNKTEGYSESSASKVEKFDKSKLK
                     KLQVLIDQSKAFSQIISSSLVQQTAGKNADDNDDDDTKEPLKKKQKTTDNLETNTKVL
                     DTYGQPKSLVGVTLKEHQIHGMNWLISMYENGLNGILADEMGLGKTVQTISLLCFLLE
                     QGIQGPFLIVSPLSVVSNWCSELSSFAPKLSYVSYVGSKDHRQKLRRKSLRKFNVVVT
                     SYEISLIDFPYLKNISWSYLVVDEGHRLKNANCMLFSKLKSLNVSNRLLLTGTPLQNN
                     LAELWSLLNFILPDVFHDFATFQSYFNFSEFENLANESNPSDRESKEAFSSLVSMEIR
                     KALVDNLHTILKPFILRRLKKDVLRLPPKREYIIYSSLSPLQSTLYSQLLDSQVNFRG
                     ILLETFFPLYIKYNFPKLLKYADSYLGYRKDEKTDFYWDAPTAASLSEHYDFVQSQLR
                     VKRISNPLMQLRQLCDSPYHYFFPWNDDTKLNYDLILNTSKLQSLDSLIPRLLKDNPN
                     QKILLFSQFKSTIDLLRAYFEEHPNSKHGKSSVFPVKTCTITGSSSKLERDEAVETFT
                     NDPEHKVFLLSTRAANLGLNLTAATTVILYDSDLNPMVDIQAIARVHRIGQKNPCIVY
                     RLATRATVEEAIWERVIKKRVLEGIVIETGEFNGSDAWKTHSNKTTPRKESVLSSLLN
                     FYSSKTSNSTLNNFKDPKLRDSCLESNELNKEELNEITSHDLEKYKDNRVLDEVNMHH
                     IKLLSETDITGQNGLDGGIM"
     gene            complement(<326470..>328551)
                     /locus_tag="C5L36_0E01620"
                     /db_xref="GeneID:40385958"
     mRNA            complement(<326470..>328551)
                     /locus_tag="C5L36_0E01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467715.1"
                     /db_xref="GeneID:40385958"
     CDS             complement(326470..328551)
                     /locus_tag="C5L36_0E01620"
                     /inference="similar to AA sequence:RefSeq:NP_012750.1"
                     /note="PKUD0E01620; similar to Saccharomyces cerevisiae
                     YKL171W (NNK1); ancestral locus Anc_1.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323575.1"
                     /db_xref="GeneID:40385958"
                     /translation="MENTFPYDRPEKSGSNYSFLSSTNLIYREQLPPHYSLPTLVPRY
                     SPELRGLNNIDNEEQIPDINFRDAFPKFDIDLSQYYPIDTGEKNQKLRKTYSENELSK
                     YDSKNGRRKSMNANLEGSLVSCGEDKDLTFKVPRNIIKLNKEGIFDEYIPNFADFNLG
                     KFGIYENAISGEDNEWDINQFSIEKQDNGLVQKHDLISEDGSELSQQVTGSFREVIHN
                     GDASTTEFVTHRTKPIEIGHIKPDNETEYFEVTEEFFHRAASPERESDRFVISSIPKH
                     FQSLSFSYRKQMLFDLLPENLKNDVDYRNHITKILRKNSCTSLSNSSISSMFTPSKAY
                     PNQIEPNTNEMGSILMDNWKVGRVINRGRFGIVRECFNINDGKDIKAVKVIPIQKNVK
                     LLRKFQSEVIIWSRLHHPSCVPLLDLKFTSNNLFLLMPLYDEGSLFDKVKDWENRSIC
                     VNERFSVTISYLRGITESLKFIHSVGIHHGDIKLENYVLHKGVPKLCDFGMANYDLNY
                     SPDFSIPVHLGEKIHTEIKRVVDSFSAENLSKIILSSASTDTLTNLRRDRSFNPSSSD
                     HYLEIGNRVRITSSENLYGQESNIGSLPYAAPELLQPCPIASDRKADIWAFGIMSFAL
                     VTLKLPFWHVYEPRLKLKILDGNWESEEWKSLILAFPELIGIDGLIRRCLVDRETRCD
                     INDILDILSIL"
     gene            <328849..>330818
                     /locus_tag="C5L36_0E01630"
                     /db_xref="GeneID:40385959"
     mRNA            join(<328849..328852,328933..>330818)
                     /locus_tag="C5L36_0E01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467716.1"
                     /db_xref="GeneID:40385959"
     CDS             join(328849..328852,328933..330818)
                     /locus_tag="C5L36_0E01630"
                     /inference="similar to AA sequence:RefSeq:NP_012494.3"
                     /note="PKUD0E01630; similar to Saccharomyces cerevisiae
                     YJL041W (NSP1); ancestral locus Anc_5.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323576.1"
                     /db_xref="GeneID:40385959"
                     /translation="MSFNFGGANNTANSGNNSSPFNFGSSNNANSTNPSSTPKFGGFG
                     NANATNNPVNPASGFNFGSASSTSGSSAAPTSFSFGKTQSGASTTTPSFGSFGSLGST
                     TQGKQGTQVGSANVSGDSKPAFSFGSSNNTLPLNTTSSTNKSTLFGGTASNTGIAENK
                     PSFSLGTNPASSTSSSAANPTTAASSGFSFGTGSTKPSETNKPVGGLFGGASATSSTA
                     QPSSGSTVPSFNLAAAAKPSETTSLTNDSKASTGGFSFGGKPTDPSGSKAFSFGSTST
                     PTSNSVSTEPKPAIGGFSFGAKPAEKKDEAKPASGGFSFGAKPAEKKDEAKPASGGFS
                     FGAKPAEKKDEAKPASGGFSFGAKPAEKKDEAKPASGGFSFGAKPAEKKDETKLTDVT
                     KSNEKKVTFETSTTGTDKAPVKLEDFKPQPLSIMNKNMEDLITKWTNQLSLSSKTFES
                     YSEKINEWDRTLVKSSDAVSKLYNDTIQCEQKQEKIDQTLAYIEKQQDELDRLLTSYE
                     KQSDKLLASIEKSAAVPGNSLSNINNKETNDESREKAYKLAEMLESRLDSLGANFSSL
                     VGEVNEVSDNFNKSLLSSEAPEDGEQTLNDILKLLNNHMESLNWISENEKNLKAKLEK
                     LSVSK"
     gene            complement(<330920..>332896)
                     /locus_tag="C5L36_0E01640"
                     /db_xref="GeneID:40385960"
     mRNA            complement(<330920..>332896)
                     /locus_tag="C5L36_0E01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467717.1"
                     /db_xref="GeneID:40385960"
     CDS             complement(330920..332896)
                     /locus_tag="C5L36_0E01640"
                     /inference="similar to AA sequence:RefSeq:NP_012491.3"
                     /note="PKUD0E01640; similar to Saccharomyces cerevisiae
                     YJL044C (GYP6); ancestral locus Anc_5.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323577.1"
                     /db_xref="GeneID:40385960"
                     /translation="MNATGKTSLAKREDTLHQTLKMSADVGHCKHTSDESFPAKQNIA
                     RTSDQVNRIKEVLGLFPSRPSLASSVLSAYHVKKLSGKVPFCRTLLWKTSLLHIDITH
                     MKNGNSVMPFFDMTNLKGQRELYETLVTNIGIPWHLLPKDSLYYREIKDDVFGGNDVE
                     EDLCNLKLDGQSTVHMRKTKLKSQPVPSDEDPLRKPSLESFEDKEESDVNILQIIISD
                     VERLFPEHPHMFIEDTKNKKMIIEILYRYTKWSNHLRESKGDKKIGYVQGMHELCGII
                     HAVLKVELLTENEKVGNTDATIKNYDLSVEREDTHVSEGKLENEATTNSFESKLEEQI
                     KYFLSEKYFAHDVFAMFKELTLPLLDKYFTSSGIVRESIFFDLKLHHLDLGSANRPGL
                     ATSLRESHIESQLWLTRWFRMLLTREVGLAYAVRIWDGLIAYSCAGAQANTTENENDV
                     STLIPYIVILLILRVRSVLLSSMVPSLKEILEAYGEEKEPLSVLLHYPFDDQEIQSPR
                     SASPDPDDENVDSSITSYRLSKDIRYSKSYKELKRMLKIPKMPSSVTLLSDAILLCGK
                     TDAELNEMGPLLTKKYARDDVYDVLKLVEKDKLSSASFFDGVLKRTKSWKIAPSSSSS
                     GHSAVSSSASNGVDSNRTRLETRLQQRVHDRLRN"
     gene            <333455..>335851
                     /locus_tag="C5L36_0E01650"
                     /db_xref="GeneID:40385961"
     mRNA            <333455..>335851
                     /locus_tag="C5L36_0E01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467718.1"
                     /db_xref="GeneID:40385961"
     CDS             333455..335851
                     /locus_tag="C5L36_0E01650"
                     /note="PKUD0E01650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323578.1"
                     /db_xref="GeneID:40385961"
                     /translation="MLSVQNETNRSPNIGLDCTNNGNYENSKNLPPLPPPLSPPPISQ
                     PRLINMGDERRVLKGSGNQPDNFEDQVKKSTLPHDERVNQEAENALNIIKASHKSWIS
                     IMIKTIDKSRPDLIYTGKRSRNTISPEDWNDNKRNAMGNRTSHRVLVKNYFDHLVAFI
                     NEAPVSAVFKYIASKMLRVDDFDQVCPVGLKPNYLDLRIKGKRVTNLFITKQLMDYVE
                     ITLSPLLRHTGFSALMNTSKYMHKQNFTSKILRLIGFSEDVNLMTVSLTIVIFITRYI
                     YIKGIDVSPAIAFMEGVLDGNEVAELLNGINNSDDDPEEVVGKSLFAHMFSWKECAKR
                     TDLLALLSWARKVSMCLKLEEKYEFISTILDELNNYQNREINYERVIDCVSKFRSSFK
                     DGGHIELVESIADVDFDCKIQWLLLQFDLEGVTGFRESNKRRRVDVPESGCLTVKKRK
                     DETAFENGEGENKETNLEHTNLINRKIEHSELEPKIKLKEGNWSSEEKNEKRKTEQKQ
                     GELIVLKSDDEEPEQVNSEIHELKNEIQEACNKESKEKHQNNLGKILKQTEREKEEGP
                     ICRKDYKKNSDIQLKNEPKFARENLPITNKITEQQNGELPITAVKKSVAVQGNKSTDK
                     AKNIEWIKSSLESESTNFSHVPRQRFNYPELKFSNGFNGISKPAFKKIHFERPVDNHY
                     RTYPGYYSNDKYSGYYENSLHRHPQNFRPPKSNYRARRRREYQFLPRGNGNVFTNPIP
                     HKYYPPALEWCSYCGVAHVPGIHPFVNGELNPNTPTSKVMIYRKYDEEHRKTGRYKDY
                     "
     gene            complement(<336027..>337199)
                     /locus_tag="C5L36_0E01660"
                     /db_xref="GeneID:40385962"
     mRNA            complement(<336027..>337199)
                     /locus_tag="C5L36_0E01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467719.1"
                     /db_xref="GeneID:40385962"
     CDS             complement(336027..337199)
                     /locus_tag="C5L36_0E01660"
                     /inference="similar to AA sequence:RefSeq:NP_015059.1"
                     /note="PKUD0E01660; similar to Saccharomyces cerevisiae
                     YPL264C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323579.1"
                     /db_xref="GeneID:40385962"
                     /translation="MMNLAKLYEDRIVPNLGVYLTLISQFFNSCMIIFCKLLITDKDF
                     KTPLHPLQILFVRMAITYVFCIIYFVFYERNPNFPLGPKGFRFLHLLRAVGGFVGVVG
                     QYWSLLYLNVSDTVCITFLAPTVTSFMAYIFLGERFTKVEAIGGFTAFCGVLLIAKPR
                     FLLDLLSTASTKISEKITEDDIKDSHNRLIGSTFAFVSTFGTGTAMCAIRKIGFNSHP
                     LLMVSIYALFTTVASFLGILIIPGIGFQTPHTVKQWTLLIVIGVTGFFMQFLLTAGMQ
                     REKAARAIAMTYTQLVYASIFDYITNGKIPQGWSLIGEIIIVLSVFSIVYFKDLNQSS
                     SYTSLRDSDRDLESDAISAIELQDNLEGGDTDSNFKISSESEPETNANIECALESK"
     gene            <337527..>338096
                     /locus_tag="C5L36_0E01670"
                     /db_xref="GeneID:40385963"
     mRNA            <337527..>338096
                     /locus_tag="C5L36_0E01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467720.1"
                     /db_xref="GeneID:40385963"
     CDS             337527..338096
                     /locus_tag="C5L36_0E01670"
                     /note="PKUD0E01670; Pfam Domains: HMG_box(2.1e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323580.1"
                     /db_xref="GeneID:40385963"
                     /translation="MLSFLSIPRATLLRNTCQVRSIFASAVTLKEAVKTKTSAETIKK
                     AARKPTKKAEKTLTKTELKKSEKPKRPANAYALYLKEKFPTLKNDSNKSIDVTKQIAE
                     RWRVESDTIKESYKQKAAPAFVEYHQLIAKWEEKYKPTLNGYQKFLKVNLSGKATGKE
                     DAAKLLKEYASQWKALSDLEKEAWKNREL"
     gene            <338574..>339542
                     /locus_tag="C5L36_0E01680"
                     /db_xref="GeneID:40385964"
     mRNA            <338574..>339542
                     /locus_tag="C5L36_0E01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467721.1"
                     /db_xref="GeneID:40385964"
     CDS             338574..339542
                     /locus_tag="C5L36_0E01680"
                     /inference="similar to AA sequence:RefSeq:NP_009995.1"
                     /note="PKUD0E01680; similar to Saccharomyces cerevisiae
                     YCR069W (CPR4) and YNR028W (CPR8); ancestral locus
                     Anc_6.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323581.1"
                     /db_xref="GeneID:40385964"
                     /translation="MSRLSLPSFTSWVLLLSCLIVALLISPVNSAIIPSEVISKEDEE
                     AITDLLHLTIHESRNGNDHTVESSTPLGTIVIALFGKIVPNTVENFKGLSETYSKTET
                     LFHRVIPGFVIQAGDFDNNGGHSFFGYRGASPPADTDHPEAFGPFYSGLEDENFQISH
                     NKVGRVSVANAGPNTGGSQFFICLEPVPFLDGKHVVFGQVIEGMDIAQKIANVERDSN
                     DKPKNDVFIYSTKVEPYKSAQKDEKTAEEGKVGIIDKADTPSDTDSGYAKEHPTGLGG
                     SKRHLVLIPFAAFVILACYLGLKNRRSINSLIRGPRYRRVAANSSE"
     gene            complement(<339619..>341499)
                     /locus_tag="C5L36_0E01690"
                     /db_xref="GeneID:40385965"
     mRNA            complement(<339619..>341499)
                     /locus_tag="C5L36_0E01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467722.1"
                     /db_xref="GeneID:40385965"
     CDS             complement(339619..341499)
                     /locus_tag="C5L36_0E01690"
                     /inference="similar to AA sequence:RefSeq:NP_014427.1"
                     /note="PKUD0E01690; similar to Saccharomyces cerevisiae
                     YNR030W (ALG12); ancestral locus Anc_6.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323582.1"
                     /db_xref="GeneID:40385965"
                     /translation="MVNLSLYLVIQGLMTTSTLQHLLDLTLFTSITYMLLVAPYTKVE
                     ESFNVQAIHDFINLGIDSLDSFDHMYFPGAVKRTCIGSLLLSLPSIYLSNFMRQWALR
                     LISLATLINSIVPTSLGKVLAKELPNVLKETKVYQLIITRFLLSLVTFFSIIYLRKSI
                     AYACSKTSKNIGIWFSFFMYPLPHILFYSSRLLPNFICLPLFNAAIGLFLCGDIPRSI
                     TILVFVGVVFRFEVLVFTGALIFFCVSGIFRYGRPIMKFREAVVSVATSLLLSGFLSA
                     RIDSYFWNVEITIPEFESFIFNILKGNSSEWGVEPFHAYFTRYLPKLFASQFELTPIL
                     TLLFTVFSLLNAKKLYLSSHKKPDYNVDYVNYGVGTLTTLLWSSYLYMLVLSVNGHKE
                     WRFMVYLVPIFCCIAASAFEWVLSKVGKFIRKLLLLSICLLFLGSLLFSFVFGLISSW
                     NYTGGDAAQKLNLRLIDMYGPNANMIKPIVVHWDVGTCMNGASLFTQIGDNKASQDQW
                     VSMDDQPVKYWIIYDKTEDTDALAQIVDDFDYWVQYDDEPLAQPSDGYEWILVDMLEG
                     YDGINTQLVISLLKNPGQVFAQLFHSIESKNFTWIQNVLDNCIKKKVRGKIWERAKIQ
                     SL"
     gene            <341690..>342904
                     /locus_tag="C5L36_0E01700"
                     /db_xref="GeneID:40385966"
     mRNA            <341690..>342904
                     /locus_tag="C5L36_0E01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467723.1"
                     /db_xref="GeneID:40385966"
     CDS             341690..342904
                     /locus_tag="C5L36_0E01700"
                     /inference="similar to AA sequence:RefSeq:NP_014426.3"
                     /note="PKUD0E01700; similar to Saccharomyces cerevisiae
                     YNR029C; ancestral locus Anc_6.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323583.1"
                     /db_xref="GeneID:40385966"
                     /translation="MEEELEYIPNLVENENEEIVFEKVKKEPIDTTGTIIEEDKSKKV
                     PVTILTGYLGSGKSTLLEQIAKRGDRKLAVILNEFGDSIDIEKSLTVKDKENEVEEWL
                     DLGNGCLCCTVKDNGVAAIERLVAKRKGFDHIILETTGLADPGPITTMFWLDDGLLSN
                     VYIDGVVTVLDAENIETNLSDKDESHVHHAEEGTHGEDPHHNCDNVTVAHVQIALADV
                     ILLNKIDKIENDPKRIKRIESLVRDINANVPIYETKFGDISLDKILDLHAYEARDVSS
                     LVKTEKSTSGVHDHRMGTLSFNFKKLVDIREFKKFEKFLQDLLWDDSDADLLRNNMEI
                     HRTKGLVFIEDGDSYKVIQGVRKTYDVIDGMQDILEIELDSSRLVLIGKYIDGELVRR
                     KFSEVMGFDMFA"
     gene            <343165..>343443
                     /locus_tag="C5L36_0E01710"
                     /db_xref="GeneID:40385967"
     mRNA            <343165..>343443
                     /locus_tag="C5L36_0E01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467724.1"
                     /db_xref="GeneID:40385967"
     CDS             343165..343443
                     /locus_tag="C5L36_0E01710"
                     /inference="similar to AA sequence:RefSeq:NP_012369.1"
                     /note="PKUD0E01710; similar to Saccharomyces cerevisiae
                     YJL166W (QCR8); ancestral locus Anc_1.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323584.1"
                     /db_xref="GeneID:40385967"
                     /translation="MGHPGAYMGWWGSMGSPKQKRITIHSVSPYAQSPLHGSVNRAIF
                     NSFRRFKSQVLYIALPFAIVWSVWTEARDYNEYLYTKAGREELERVNV"
     gene            complement(<343721..>344025)
                     /locus_tag="C5L36_0E01720"
                     /db_xref="GeneID:40385968"
     mRNA            complement(join(<343721..343928,344009..>344025))
                     /locus_tag="C5L36_0E01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467725.1"
                     /db_xref="GeneID:40385968"
     CDS             complement(join(343721..343928,344009..344025))
                     /locus_tag="C5L36_0E01720"
                     /inference="similar to AA sequence:RefSeq:NP_011619.3"
                     /note="PKUD0E01720; similar to Saccharomyces cerevisiae
                     YGR105W (VMA21); ancestral locus Anc_3.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323585.1"
                     /db_xref="GeneID:40385968"
                     /translation="MADIPPQVLRKLIIFTALMILGPLVAFFTSQALFESSLVSGGIA
                     AVVANVVLIGYVYVAFNENIDGDSKEKKES"
     gene            <344447..>345388
                     /locus_tag="C5L36_0E01730"
                     /db_xref="GeneID:40385969"
     mRNA            <344447..>345388
                     /locus_tag="C5L36_0E01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467726.1"
                     /db_xref="GeneID:40385969"
     CDS             344447..345388
                     /locus_tag="C5L36_0E01730"
                     /note="PKUD0E01730; Pfam Domains: PhyH(4.6e-46)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323586.1"
                     /db_xref="GeneID:40385969"
                     /translation="MPLTPPELKQFEQDGYLAIVNYLDKKTVADLNNEIKEMLTSANM
                     GNHPMIKFTTGNDKDGHISDKYFFDSADKIHYFFEPDAIVEQNGEHKLLYPIEKSINK
                     IGHGLHFLNPKFNKVTVNDDIASICRQLGFRDAKAIQSMCVIKQPHIGAEVPPHNDAE
                     FLYTKPKTCVGFWFALEDCTLENGCLEFIPGSQHYPLQKRFVKDLKKGSGTKFAKLDN
                     PDEDFVESKEYKEFKEKISDDSLYKKVTIPAGTLVLINGKVIHKSSKNKSDDSRNAYT
                     FHVVDGTEEYDAYNWLQIPPAKPQGSQNFTRLYKNYE"
     gene            complement(<345537..>348902)
                     /locus_tag="C5L36_0E01740"
                     /db_xref="GeneID:40385970"
     mRNA            complement(<345537..>348902)
                     /locus_tag="C5L36_0E01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467727.1"
                     /db_xref="GeneID:40385970"
     CDS             complement(345537..348902)
                     /locus_tag="C5L36_0E01740"
                     /inference="similar to AA sequence:RefSeq:NP_013367.1"
                     /note="PKUD0E01740; similar to Saccharomyces cerevisiae
                     YLR265C (NEJ1); ancestral locus Anc_6.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323587.1"
                     /db_xref="GeneID:40385970"
                     /translation="MSIKLCGRNCRYANRKYLFSKSRYIHPLRQYTSSVSHDSDVTTK
                     QNKTTNKISNKMTSFISHSISSLESYLINQTNLRPDSIDDLPIDRANYIPAQLKSYNS
                     PFREFIDISNPQDIEYLLSIDRSSWYNVTPQIHSFMEFNCDYNLPLLLNHYARSLPEV
                     QKVINRKDRVSLSLTSLKKMISILVNLQWFNNASYILYRMDLPFNELVNVLNEILEEE
                     LIFQNSDWMRYFFLVHLNKHYEAINKNILANVDFLSFSGSMKTFKALQFMWNKQYLSM
                     DELKEDLSFFYEATGKSDHILLMYHFKSIELIKSTQIDNLELQIHELKKNISTLSSIF
                     TKKIHGGAVSLFIGEMSSATNDELQKFKGKELFERIEKRKISILNYLLIRKKIEIKDM
                     DVVVVSRFNLNFETIMLLWEYNLQKRNNRILNTIYYKFFVENIIKSLISCNYKSVPTG
                     KSIPTFKKKNLLHEIFKVEYQNISSTRKISILINQFKIYLRNNSVVSRDRVGGFLSLT
                     NNTMEYSYVMKRVMYSIFGPNSEFSYKEILKSLEVIASFSPTTLNKQYLFGVVNHIIF
                     RNYNDEGFFSFKSPNDRFFKSIEFIELLDSMDPLAVTYYSNLYPSIIKFFRDYVSSDP
                     RSMDDILAEEYTLKFIKLLNDSFNYISSNPKNLSILNPKNYSSKIYLIKQGLLQHLAS
                     ELRHLPNKFIIRLLKFRSDYLCKNNQDWIFKFNQSVFVYGIFLEVFFRRSRRGNDFSF
                     SDLPTSAFKLKIEEEMDKLAMDPDVWECLEFVAGFDWSAEISSSLLADSTKPDNLGEG
                     IAFVLSELKRMDGVDYFEREDFVNKFKPNKKVDGSGHIHRITDSLLDSISDSTHDDID
                     QAYLNNMEDSTKSFLSKRLASNELFEVDEIYENLRNFKDMTKINDIKGIGEDHENAFH
                     SIPDKFLNYNDDMNSHRNNKGKFKKRYSIQTKERMIRLYSPIRLKGLMIQSLIKQNPF
                     VVDFLINRLFTEYDSRIPVSLIHSIMIGVIKSEGKLKFTEKIDLIKILDVLASTIYKG
                     ASSRANSYLFMQYVRFKEFRTMLVDLVIQESKRSNSGSLKTLNWAMNKITNSSNLKNY
                     KEDLNRWTNELNNMKERQIGFWNPLNELGRWDD"
     gene            complement(<349212..>349961)
                     /locus_tag="C5L36_0E01750"
                     /db_xref="GeneID:40385971"
     mRNA            complement(<349212..>349961)
                     /locus_tag="C5L36_0E01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467728.1"
                     /db_xref="GeneID:40385971"
     CDS             complement(349212..349961)
                     /locus_tag="C5L36_0E01750"
                     /inference="similar to AA sequence:RefSeq:NP_012770.1"
                     /note="PKUD0E01750; similar to Saccharomyces cerevisiae
                     YKL152C (GPM1); ancestral locus Anc_5.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323588.1"
                     /db_xref="GeneID:40385971"
                     /translation="MVHKLILVRHGQSEWNEKNLFTGWVDVKLSEKGRQEAVRAGELL
                     KEADIKPDVLYTSLLTRAIQTANIALENADRLHIPVVRSWRLNERHYGALQGKDKAQT
                     LETYGPEKFQQWRRSFDIPPPPIEDHSEFSQFGEERYSNVDPNVLPKTESLALVIDRL
                     LPFWQDVIAKDLLANKTVIITAHGNSLRGLVKHLDNISDDDIAGLNIPTAIPLVYELD
                     DNLKPIKPAYYLDPEAAAAGAAAVAAQGQKK"
     gene            352570..352641
                     /locus_tag="C5L36_0Etrna7D"
                     /db_xref="GeneID:40386414"
     tRNA            352570..352641
                     /locus_tag="C5L36_0Etrna7D"
                     /product="tRNA-Asp"
                     /note="PKUD0Etrna7D; codon recognized: GAC"
                     /db_xref="GeneID:40386414"
     gene            <355049..>356863
                     /locus_tag="C5L36_0E01760"
                     /db_xref="GeneID:40385972"
     mRNA            <355049..>356863
                     /locus_tag="C5L36_0E01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467729.1"
                     /db_xref="GeneID:40385972"
     CDS             355049..356863
                     /locus_tag="C5L36_0E01760"
                     /inference="similar to AA sequence:RefSeq:NP_013375.1"
                     /note="PKUD0E01760; similar to Saccharomyces cerevisiae
                     YLR273C (PIG1) and YOR178C (GAC1); ancestral locus
                     Anc_6.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323589.1"
                     /db_xref="GeneID:40385972"
                     /translation="MPYLGPRSFNTTPLTSSNLAYLGDANDFQQGGSSPDKLNKVTRE
                     EEPRTNGFQTSSITDSSSNSISAFSSNIDNSSKSSNCSINTEVGSLSHRTMADLNEDD
                     NNTVILQPCNDETHLIIPHSPLKRYNTLTVGSNEVSNSFGSINELQDLTPKIPLLRKK
                     SGELVKSSLKLNSLTRSNSMPNTKSVRFATTLENVKFFKKSEKPTAVSNCRSSSTPRT
                     YWNFDSSSSSSSSSSSDNDGIDNDADLECDSQYSNHSILDDYKSNFDLNDNYDDMLND
                     TTNQKWIIKSNDCPHNPFSLNFARLASNRNVILESVKLNSSGNSLIGFVYVNNIAFDK
                     KIVVRLTHDYWKSFIEIENANYISSNHIFKYSDSNSNTYDKFSFIIKLDNLNIVSDEI
                     NLEFCIQYTVNNMEFWDNNDGRNYKVVLLKNYNNKSLAKLSKMNKSCRNNNVDDSKRL
                     EIDDSSIKLKDNKNFRYEFSDSFDNYKPKTDIASLRTSNSYGLKKIKSESSLPEFKSN
                     YTFTYNHLSNKSTSALHENKIDDSNYSLSSNRRFSNTQYSSKAVPQSASVPQNGFESN
                     DYDSIIKKFCFFTPNYQDQHNPSSISNLSYQKSEASCF"
     gene            <357460..>359877
                     /locus_tag="C5L36_0E01770"
                     /db_xref="GeneID:40385973"
     mRNA            <357460..>359877
                     /locus_tag="C5L36_0E01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467730.1"
                     /db_xref="GeneID:40385973"
     CDS             357460..359877
                     /locus_tag="C5L36_0E01770"
                     /inference="similar to AA sequence:RefSeq:NP_014811.3"
                     /note="PKUD0E01770; similar to Saccharomyces cerevisiae
                     YOR168W (GLN4); ancestral locus Anc_6.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323590.1"
                     /db_xref="GeneID:40385973"
                     /translation="MSSMSEEQLCQLFSQVGFEDKKIKEIIKNNKVSTSLALVIQASD
                     ALDSAPLDKSETALLHHLATLLKGKEVEGIDHVSKGIHSKKLTSNLQVSEALKYVESH
                     PNNFNNEEFEKASGVGIQVTEDEVKKIITDYLNTIKDEIENNRYKMVPALLANVRQLP
                     QLKWASPALFKPIIDAQILAMIGPKDERDVVKKEKKKKPVKDSRVDDKKKNVVEKARN
                     MFTEGFLGDLHKPGEEPQKWDDTIQAHREFIKGKVYTRFPPEPNGFLHIGHSKAIMVN
                     FGYAKYHDGKCYLRYDDTNPEAEEQVYFDSILRCVKWLGFEPWKITYSSDYFDQLYEL
                     AEKLIKSGYAYVDHSTAEEVKAQRGVKPDGTPGGERFPSPWRDRSVEENLTEFRKMRD
                     GFYKPGEATLRMKQDINSPSPQMWDLVAYRVLNAHHARTGDKWKIYPTYDFTHCLVDS
                     FENITHSLCTTEFYLSRESYEWLCDVLHVYRPAQREYGRLNITGTIMSKRKIAKLVNE
                     KYVRGWNDPRLYTLESLRRRGVPPGAILSFINTLGVTTSTTNIQVTRFDSAVRQFLDH
                     TTPRLMMVENPLKVVFDNLPDDYEELVDMPYKPGNDAFGSRKIPFTKTVYIDHSDYRD
                     EPTKGYFRLAPEQSVGLMRVPFNIKVKSVERDAEGKPILIHAEYLNDPSTHKKPKAYI
                     QWIPESAKYNSPVNISEVRIYNQLFNSENPSAHPDGFLADINKNSEEVVKGAMIEPAI
                     LEVKAKSPLNMPFTDEQFNIKEEAGNETVRFQALRVGYFCLDSDSTDNNLVLNRIVTL
                     KEDSEKD"
     gene            <360198..>361889
                     /locus_tag="C5L36_0E01780"
                     /db_xref="GeneID:40385974"
     mRNA            <360198..>361889
                     /locus_tag="C5L36_0E01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467731.1"
                     /db_xref="GeneID:40385974"
     CDS             360198..361889
                     /locus_tag="C5L36_0E01780"
                     /inference="similar to AA sequence:RefSeq:NP_013378.1"
                     /note="PKUD0E01780; similar to Saccharomyces cerevisiae
                     YLR276C (DBP9); ancestral locus Anc_6.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323591.1"
                     /db_xref="GeneID:40385974"
                     /translation="MSNVAVSKDYVDDSVTFESFGLDPRLIQAINKLGFEHPTLIQSQ
                     SIKLSLQEKKDIIAKASTGSGKTAAYCIPIVQSILVDMEGNTTTSQREIQSVILVPTK
                     ELSKQVTAFLKDLTVYCGKSIKTVNLNDIDNNLLLASVLNEKPNILVSTPSRILSVLE
                     ENAKVNLMDLMYLVIDEVDLMLSYGYDEDLEKLSNFLNLKQHMQVFMMSATLNDDING
                     LKDKFCNKPAILKLQDLDNQNKRLLQYYVKTNEFDKFLLIYVILKLQLIKGKLLVFVN
                     NLDRGYKLKLFLQNFGIRSCILNSELPVNSRLHILEEFNKNVYNLLIATDESNEYDED
                     EENDGNEGKKKAKEAKDYGVTRGVDFKNVACVLNFDLPTSSKAYIHRVGRTARGGKSG
                     MALSFVVLKDQWGTHKASSLPSAKRDERVMARIERTQKKLGYEITPYQFDKSQLDNFR
                     YRMEDSFRAVTQTAVREARLKEIKMELMTSEKLKRHFEENPQDLQTLRHDKALSKVRA
                     DANLKRVPDYLLPPGARQDVRKMGFVPFTKNKKRAQGKRRSGGKKKVDVLKKHRK"
     gene            <362300..>364654
                     /locus_tag="C5L36_0E01790"
                     /db_xref="GeneID:40385975"
     mRNA            <362300..>364654
                     /locus_tag="C5L36_0E01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467732.1"
                     /db_xref="GeneID:40385975"
     CDS             362300..364654
                     /locus_tag="C5L36_0E01790"
                     /inference="similar to AA sequence:RefSeq:NP_010188.1"
                     /note="PKUD0E01790; similar to Saccharomyces cerevisiae
                     YDL095W (PMT1); ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323592.1"
                     /db_xref="GeneID:40385975"
                     /translation="MAPKKSGKGTKLQSVGEVEPQTTELILETGELRRFPKSELSETV
                     AMNRIVSSTKERVLVAILVAFALLIRVSNLNNPNSVVFDEVHFGGFAKKYIKGDFFMD
                     VHPPLAKLLFAAVGALGGFKGDFSFEKIGDVFPPNVPYVLMRQLSAFMGVGTVLFMYF
                     TLRATGCNSLVSFFTAALLIIENGLVTISRYILLDSPLIFFIAGTAYFYTRSELEKPL
                     SFNWFKYLAICGSFLGFALSSKWVGLFTFAWLGLANVLRLWFVIGDLTVPVKSIVKNT
                     LARGIILVGIPTIIYLISFYIHFIVLDKEGEGAAFMSSAFRTDFKDTTVPRVTTADVG
                     VSSIITLKHLNTHGGYLHSHDHLYEGGSNQQQVTLYPHLDENNKWAIELYNETSEPFE
                     FIPITDGTKIRLNHIVTNRRLHSHDIRPAVSEIEWQNEASCYGFEGFEGDPNDDFIVE
                     IVKDLSVPGEAQKRLRAIDTVFRLRHAMTGCYLWSHETKLPKWGFEQQEVTCATQGIK
                     PLSYWYIEDNVNIYLPPDAEKVGYRPLSFFQKFIELHKKMWHVNNGLTATHYYESRPL
                     DWLLLNRGISYWSAAPHHIYLLGNPVVWWPASFLFLGFATYLLVLIFQYQLGYEIKVS
                     DTTFNFTYNVFSFLLGWGLHLAPFFLMDRQLFLHHYFPALYFAILALGHCFQLLYVSL
                     KNKKVLVYVLFGLMFSASLYSYFARFPITNGSDWTVEKCEQSKWLKSWDYDCSNFPSS
                     KADTNAPVKAGQGNIDFNSAMKPEEVEPIVEKVVANETPVKDEL"
     gene            <364869..>366077
                     /locus_tag="C5L36_0E01800"
                     /db_xref="GeneID:40385976"
     mRNA            <364869..>366077
                     /locus_tag="C5L36_0E01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467733.1"
                     /db_xref="GeneID:40385976"
     CDS             364869..366077
                     /locus_tag="C5L36_0E01800"
                     /note="PKUD0E01800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323593.1"
                     /db_xref="GeneID:40385976"
                     /translation="MNNIIAFNMNNSTETLFTMKKVDSFINEYLANVDSDKALTDITV
                     VKSFVKTILSNERDQDQSIVLILKILRGYTRNFDLSKASTEVKGYLITLGLKVLDNIN
                     YGKALSTTTNRDLFMLMLTRYFSSCNEFQACRLKESFLRFKTAYNDYKVSTFQVFTVN
                     QLFKNRMFYSICEIVGQFHVDEYDMAEEKCLNLQYPLYMHQVSHSLIIDGSYEQASKL
                     LSIILSLSFLTFERVTFDCISIEYMLLSMILNRSSNYDFIPLLKLREKIPTKIVDVFQ
                     SFHSYDLESFVYNYLLCIHEVGSNSSTSHLLDVFTTSRMIELSKLLLDNRYLHLSTKL
                     SKSRLRTQELYTNDLIRTLNSKISRYSIQLPNYSFNPMIKATGAKSIQPLKYIDDLAH
                     ANRDLKHMNS"
     gene            complement(<366136..>370134)
                     /locus_tag="C5L36_0E01810"
                     /db_xref="GeneID:40385977"
     mRNA            complement(<366136..>370134)
                     /locus_tag="C5L36_0E01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467734.1"
                     /db_xref="GeneID:40385977"
     CDS             complement(366136..370134)
                     /locus_tag="C5L36_0E01810"
                     /inference="similar to AA sequence:RefSeq:NP_009376.2"
                     /note="PKUD0E01810; similar to Saccharomyces cerevisiae
                     YAL026C (DRS2); ancestral locus Anc_7.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323594.1"
                     /db_xref="GeneID:40385977"
                     /translation="MSYSNRFVVGDDDENEDSFNFLQDDLPHNAHPVGVENHPKSDEK
                     SILDPFADKNEVVDPFSDAFELDTNKYKSLNINDPFVRSNKVDSSLQSKYSNGKSTHD
                     DFIDLFSDTEGNIIDDRINPDENPYNDSLKNLTIPENNTGLRSVYNQLKGSLGLSSYN
                     NVQTLSADPVFSENDNEESSHNFRPVEDTGAKATSTLSMFDIRRCLGKRKNEDDKGPR
                     IIYLNDQHRNNGSGFVSNHISTTKYNAFTFLPKFLFEQFSKYANLFFLFTGCIQQVPT
                     VTPTNRYTTFATLLIVLLVSAVKEMSEDIKRNTSDNELNKSKVLILNTSTGEYSEKKW
                     INVKVGDILKIRNGEALPADLILLNSSEPDGLCYIETANLDGETNLKIKQPRKETVHM
                     MDPRILSKLRGKITSERPNSSLYTYEGTMEIDGIEFSLSPDQLILRGASLRNTNWIQG
                     VVIFTGHQTKLMRNATATPIKTTDVERIINLQIIALFGILIFLAFVSSLGNVITLEVN
                     KKYLGYLYMEGTSRIGLFFLDILTFWILYSNLVPISLFVTVEIIKYYQAFLISSDLDM
                     YDEDTDTPTVARTSSLVEELGQIQYVFSDKTGTLTRNIMEFRTCSIGGRCYIENIPED
                     KEAVLQDGVELGYHSFEQLAKDLKESKNSHVIDNFLTLLAVCHTVIPEVEEDGSIKYQ
                     AASPDEGALVEGAAILGYKFHTRKPSSVVISVDGQNKTYELLNICEFNSTRKRMSALF
                     RCPDGKIRLFVKGADTVILERLSHDNEFVDATTKHLEDFAVDGLRTLCVATRIIPEAE
                     YAEWSDIYNKASVSLGNRADELDKAAELIERDLFLLGATAIEDKLQDGVPETISVLQD
                     AGINVWVLTGDRQETAINVGMSCKLLSEDMNLLIINEDNKDDTCQNMMEKLTVLQGDE
                     VSDEDKNSLALVIDGKSLGYALESDLEDMFLAIGTMCKAVICCRVSPLQKALVVKLVK
                     RKKKALLLAIGDGANDVSMIQAAHVGVGITGMEGAQAARSADFAIGQFKYLKKLLLVH
                     GSWSYQRISLAILYSFYKNITLYMCQFWFVFSNGFSGQSIIESWSLTLYNVVFVALPP
                     FVIGIFDQYISANMLNQYPQLYRIGQEGKFFNVEIFWSWAVNGFYHSAIIYIAVINIY
                     KYGNQFLDGEIADIWVVGITLYTVCLLTSLGKAALVSSQWTKFTLVAIPGSFACWFVA
                     FPLYTVIAPKVNVSKEYTGIMPFVYGSAVFWLTIIVVPTLCLMRDFLYKFYKRQWNPE
                     FHHIVQAMQKNQMQTHRPKFSSFQKTIRKVRQVHRMRKQRGFAFSQVEGQESIVRKYD
                     TTKSRGIYGELE"
     gene            complement(<370477..>370869)
                     /locus_tag="C5L36_0E01820"
                     /db_xref="GeneID:40385978"
     mRNA            complement(<370477..>370869)
                     /locus_tag="C5L36_0E01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467735.1"
                     /db_xref="GeneID:40385978"
     CDS             complement(370477..370869)
                     /locus_tag="C5L36_0E01820"
                     /inference="similar to AA sequence:RefSeq:NP_009460.1"
                     /note="PKUD0E01820; similar to Saccharomyces cerevisiae
                     YBL092W (RPL32); ancestral locus Anc_7.424; intron in 5'
                     UTR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323595.1"
                     /db_xref="GeneID:40385978"
                     /translation="MAPQLNPKIVKKHTKKFKRHHHDRYHRVGESWRLQKGIDSCVRR
                     RFRGTISAPKIGYGSNKKTKFLRPDGKKTFVVSNLKDLEVLLLHTETYAAEIAHNVSA
                     KNRVEILSRAKAIGVKVTNPKGRVTLQA"
     gene            <371625..>372206
                     /locus_tag="C5L36_0E01830"
                     /db_xref="GeneID:40385979"
     mRNA            <371625..>372206
                     /locus_tag="C5L36_0E01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467736.1"
                     /db_xref="GeneID:40385979"
     CDS             371625..372206
                     /locus_tag="C5L36_0E01830"
                     /inference="similar to AA sequence:RefSeq:NP_009459.1"
                     /note="PKUD0E01830; similar to Saccharomyces cerevisiae
                     YBL093C (ROX3); ancestral locus Anc_7.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323596.1"
                     /db_xref="GeneID:40385979"
                     /translation="MSRSRKACQLGNVYHLQQATPSVAFVLLLMSIKGDKQTSNGNYY
                     FVTPLSGYPAVEPSFDDDLIQLYNLKDISQALNRVNADGSKGTKLRKSYKSHISDLSG
                     KHTIPKEDRSFVNIALTPDNPELVKPKIEKFDLNYLDKVLNFEKTGPTGIPGFDPSKL
                     VLPGDNTKKEKKRKATSAATSPEQLPDIKRRQI"
     gene            complement(<372321..>379913)
                     /locus_tag="C5L36_0E01840"
                     /db_xref="GeneID:40385980"
     mRNA            complement(<372321..>379913)
                     /locus_tag="C5L36_0E01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467737.1"
                     /db_xref="GeneID:40385980"
     CDS             complement(372321..379913)
                     /locus_tag="C5L36_0E01840"
                     /inference="similar to AA sequence:RefSeq:NP_013559.1"
                     /note="PKUD0E01840; similar to Saccharomyces cerevisiae
                     YLR454W (FMP27); ancestral locus Anc_7.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323597.1"
                     /db_xref="GeneID:40385980"
                     /translation="MELWYNFLCGAVLLYSATKFFKLLINLLFGIQFDYINPLNLCVH
                     NITYGHPQESDVYIKVSRIRLNFSFFLKLKSFIGVNVSGVNIRLNKLPIDKGNETQGA
                     SDEDESYGKYTDQINKHVFDPEKPVSIISDNPRLNRLRSFLIKCVPHLSFSITEASVD
                     FSDDLSIIFEKIVGHLDINQSKQRVSFLDETSSVSHSLVFSVQIDKGNLFKPSKRQIL
                     SNFFDQCIIASQINVDLESGFISSLMPSVRMIGVDVSVLYVLKLVKFLNPSFEVTEGS
                     SRTTGSPSFNQTRMKLYVYSFFYKLIKTGSFTIQSFTVTEIPVSTHSKLNNFLERQDS
                     KSLEGMIFVSASMNSFTFDVSAVEPSQVGYSLKFVDDSFPLRWMASISDFKLSLDYSK
                     FELYDGTQKQFDILSISNLLLTVESTMMVNLMRVVFNNEIQKNFTQKQTVSEIQFNMA
                     NFSIDLSVDQLVVLLCVLSDRAEETRSFTEPSEYHKSNTNEQAHTSGNIYKETFLETS
                     PKFYFKFLFDKPTIILRSENEINKNVDNHLLFLQPSMLLAHLDVVTIDKTMKISSRLD
                     IPQTALVYQRNNSSISAATIAEMKDVFFRVNFLLPKFSSLKIFICLNHVLVDLTSIQA
                     LNGLGIMSNALRVSMHKYRSPKKHIQHPARYKKHNANKAFTNLPDWFSNFTVSIGVFK
                     LVLGSKSLFIEPKDLLDENDRGNIKKDSKIITPSKTTYKIGQTEFKIFNNNNDFIGDD
                     SASLSSSNSQRQYEDDDYYWTARGAVGEIGVSTSIRNPLLDISLKRKVLSIPHTDMSL
                     ICSRKKVFLLKTSVESIMLDHDIASHFTIFSSFYLLRHTFKFHLSETMVNEKHEYQLL
                     QTRKKEVKPKIGLLDLFNIQFYVREAQLKMMMPGDLHMRLDLFGLKCTFDGNTVTSEN
                     KLIQLSVKKKSDFPFFNRVSVIDNMKLNCVLPNEKGKLAKINIFNNNFKILIPSDFVV
                     HSMFDSIILTVKLTKKFLFSIKHGVIHERDKIKSSGIETLPIMKIKSKNLAFNVEDDP
                     FEVELGMIYQLGIIEQKQRLKKISIFDKVLENIRTNASKLCNDENCLRNFGIHLDKIH
                     LLTSTSFSNVKNSVLESLLIDIYQDLHKLWVNFSSSWVRIINEFKVKRRHTMEENADF
                     LTSNILQRLNVSDSFADNVVDSTDLPPLMGIFLNDTIITIKHPQFENDSNDVHNFLHR
                     VGKGVPKSTDWDKIIPMRLSLQASEVRVHLRDFPLPMVYIPNMLDNSRWNESFILKGT
                     LVIAEQMPKSDKEYWYDYMPMLPGLHSGDDMNHSYSWEAPKTICTVKAYYEINCAINS
                     DDSTTVTWSTAYQAVLRHLSDIFDTFSKDSKDPSPKLGIWDKLRNIMHGYMIFRWTDD
                     ASEVVFNILNSYDPYDILGLSAGFSLIFKNKVKWAVNDPGREKERDYFIFKSRNVMFG
                     VPNHLTTPLPCWCSNKKTFMVGVDESLLLTSFYGYYMNTEIYYDDSNENLKALYERTK
                     TQKFETLNIVLDGDVELKLSMVFERKLPDGSRTTEFRPHYENVLTSPKWAQGQDFDSY
                     SGFRSDFVHMALNLVTKNSKYNVLRVSPKTIFQFMTWFKRFSDDVALPIRNGSLWKSA
                     TQSVKLGSHLMTFKFMFDVEPLYIYHGYRFDLARPGEHTALGLKGKIGSFKCDLHQRK
                     EKMIKHVDFLGENFNVMKMSFYVGKVELKNIDLRVIGINFTERKDVTPKHHFQIFDND
                     KDWIDLNDFEEVDLPTVKDSDIEGQVLPLLFASHFSYKMNKKLAKNLFGDENTHDCII
                     NQEDGPEVSYNHICDVEKLKLKWYKNVRNIIFSYFTEMDFRAAYVNSSSFKDRSTILG
                     KLKQTKTQQQEPQSTRSTDSKINYNIESKKEFNEMMRNIKEFSSKIIPVDDLLVRLND
                     VQVQLMIDSAHEHLMLFRTKRNEIEIVSLMDEDWFRSVQSKFIAKRIGTVFEDADVLI
                     LSKNDYPFTKTTKDNYGTNGSWPVFLDGSEPNEFVESKTLLSNVLIYFMFENPSSTYA
                     SGKSRKKLYLNIPVFETRIDSESYLKSVKIARSVLVYTSPRQKKFASLVQAYSLLNDS
                     QDKLKLYTALDRVCGEIQSIVALHKALSPARTVANKEIEVESLLRARLSKLLTDSLLL
                     SRAILEDLIPRSEEEDDQCFMEWCITAAKINVNFTIDDQSFLSFMLKDGSFNRLEMLD
                     QTTINEVSIRSIQILNHDYNILYPELLSAFDPSSSVKANIPKTKAMLKIKWEIGDKIQ
                     GMPNIRNVQVSGLPMKLAMEDKTGIKLMEFLFPDENLYKTESNASEGEEGNDVFSYDS
                     SDEDILEFEGENDTSPDSELIEYKGVNDSLASHKGIPVTNSDPVNNVGADINEGKNLE
                     HRTSKLSIVSRSKSAISSNYSCNLNRKIVNEKSSRSFSNIEQEKYLGAIKNSMDIEYT
                     NGDILKMEKETKYFSIQNLTMEDFVLNISLYGKGMLRLINVTNLTLVVPKFVIQKEVW
                     TSIDLIDAIKKHVIKTLLKQSGHLLKNKLFVYRRRKRVNKQKYVKVKTRN"
     gene            <380349..>381536
                     /locus_tag="C5L36_0E01850"
                     /db_xref="GeneID:40385981"
     mRNA            <380349..>381536
                     /locus_tag="C5L36_0E01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467738.1"
                     /db_xref="GeneID:40385981"
     CDS             380349..381536
                     /locus_tag="C5L36_0E01850"
                     /inference="similar to AA sequence:RefSeq:NP_015489.1"
                     /note="PKUD0E01850; similar to Saccharomyces cerevisiae
                     YPR163C (TIF3); ancestral locus Anc_7.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323598.1"
                     /db_xref="GeneID:40385981"
                     /translation="MAPKKNVKMDLSTFLSDDTFGTQTDSWADEFDPSMLQNTNSTID
                     IGFNLPTQEPEIPEDGPFTARISAFPDYCTEDDLRNFFIDGLHLANPDQFIEDFRCPR
                     ERDGSLKNFAFITFATKELLLEALELNDKPIHNKPVYVSVAKPSKNAREPRGSRYGSR
                     FGDEDLDWGARGSMSAQPRRRREDIDLDWGSARSGMSQPSMERREFRGPPRERAPREE
                     NLDWGARGTLQQNEPERREFRGPPRERAPREENLDWGARGTLQQNEPERREYRAPRKE
                     RAPKEDDLDWSALRGSKLQQQPVRRSFKPKTDDFEWGARGSMLKEQEKKRSSQPEKKE
                     TPVDGPKKSIYSVLANEDSDEEDEEEGEKQQQQKEAKDSSEEITQATSNLHIGDEAGW
                     TRI"
     gene            <382500..>383328
                     /locus_tag="C5L36_0E01860"
                     /db_xref="GeneID:40385982"
     mRNA            join(<382500..382511,382894..>383328)
                     /locus_tag="C5L36_0E01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467739.1"
                     /db_xref="GeneID:40385982"
     CDS             join(382500..382511,382894..383328)
                     /locus_tag="C5L36_0E01860"
                     /inference="similar to AA sequence:RefSeq:NP_010349.3"
                     /note="PKUD0E01860; similar to Saccharomyces cerevisiae
                     YDR064W (RPS13); ancestral locus Anc_8.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323599.1"
                     /db_xref="GeneID:40385982"
                     /translation="MHSSGKGMSSSSLPYSRSVPSWFKASPEEVVDQIIKYARKGLTP
                     SQIGVLLRDAHGVNQAKIVTGNKIMRILKSNGLAPELPEDLYFLIKKAVAVRKHLERN
                     RKDKDSKFRLILIESRIHRLARYYRTVSVLPPTWKYESATASALVN"
     gene            complement(<383461..>383976)
                     /locus_tag="C5L36_0E01870"
                     /db_xref="GeneID:40385983"
     mRNA            complement(<383461..>383976)
                     /locus_tag="C5L36_0E01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467740.1"
                     /db_xref="GeneID:40385983"
     CDS             complement(383461..383976)
                     /locus_tag="C5L36_0E01870"
                     /note="PKUD0E01870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323600.1"
                     /db_xref="GeneID:40385983"
                     /translation="MPPKKSNEKPLILKAKRQSTTYMLDVSLKNTISQLKEKLVNMIN
                     TTGGLYVNNLPHKLDTDALHIPDNDIEIPQIGLKNSSDSENEEVKSRSVDDNGSVATR
                     ISGDSPVQITTEDITLAIFDDQNDIYHSKIRNLELDDSAKIAELNLHDFMCLAFKFKD
                     EEFKIFQTVYE"
     gene            <384243..>385745
                     /locus_tag="C5L36_0E01880"
                     /db_xref="GeneID:40385984"
     mRNA            <384243..>385745
                     /locus_tag="C5L36_0E01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467741.1"
                     /db_xref="GeneID:40385984"
     CDS             384243..385745
                     /locus_tag="C5L36_0E01880"
                     /note="PKUD0E01880; Pfam Domains: zf-C3HC4(7e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323601.1"
                     /db_xref="GeneID:40385984"
                     /translation="MSDHAFGSSATTAIFSVVIAAAITTLLLLGFFSFKYSLKAMFGV
                     YDPVFKSSGRYISPFEDHNMSRIVHPYVVYQGTTYFLYGVNSIALSRSKMKKLEVLSS
                     QQLNEFFPLKRYAEWLNGGQEEIHSINKGKLGYAGFVDTDHYRSHVEDPIESMPTNSE
                     NTPKEFVKHIETIGSKRELEEEDITDIPLEKFNYNISTASTLSQREAKIEVSVPFQTE
                     KHYTSGICTICLENLEDDDLVRGLLCGHVFHGQCIDPWLTTRRGSCPICKKDLYLEVR
                     DQIEEQEGEDDGESHGHYSNENPMVTINIGDFIRLPTGDPGSVHIDNLLNLDPSNAFS
                     YFIVLMITKLEAQILLTATVYLRNHNYSLDNVENPEYPEQNASEHGTITFNCHRIDPS
                     SVQMYFLEIASKLRQTMNTTDFKSPPLPDIQSLNPYIKRIVENHPRPFHPADITDLDE
                     AALKRTTEMLRYPRRIMYFAIGINKMELYYYNVVQIYNTRRNSRIRECNS"
     gene            complement(<385890..>386354)
                     /locus_tag="C5L36_0E01890"
                     /db_xref="GeneID:40385985"
     mRNA            complement(<385890..>386354)
                     /locus_tag="C5L36_0E01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467742.1"
                     /db_xref="GeneID:40385985"
     CDS             complement(385890..386354)
                     /locus_tag="C5L36_0E01890"
                     /inference="similar to AA sequence:RefSeq:NP_010348.1"
                     /note="PKUD0E01890; similar to Saccharomyces cerevisiae
                     YDR063W (AIM7); ancestral locus Anc_8.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323602.1"
                     /db_xref="GeneID:40385985"
                     /translation="MPEVLLTTQARKTKMSQAICSIPAETKQQLRKFRLTPIKQSSRT
                     IKTQIYKINKNEQTLQLEESLELEDLEELVEELPDNTPCFVLMNYGYTKPDGRYVSPL
                     VGVYWRPNTAQGQIKMMYAASVELFKKEVGCNLWLECSDEEDIPDLKREIEK"
     gene            complement(<386568..>387914)
                     /locus_tag="C5L36_0E01900"
                     /db_xref="GeneID:40385986"
     mRNA            complement(<386568..>387914)
                     /locus_tag="C5L36_0E01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467743.1"
                     /db_xref="GeneID:40385986"
     CDS             complement(386568..387914)
                     /locus_tag="C5L36_0E01900"
                     /inference="similar to AA sequence:RefSeq:NP_011062.1"
                     /note="PKUD0E01900; similar to Saccharomyces cerevisiae
                     YER136W (GDI1); ancestral locus Anc_8.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323603.1"
                     /db_xref="GeneID:40385986"
                     /translation="MDENYDVIVLGTGLTECILSGLLSIEGKKVLHIDRQEYYGGESA
                     SLNLTQLYHKFKPKKEYEGQFGKDRDWCVDLIPKFLMSNGELTNILVHTDVTRYMEFK
                     QVSGSFVYRGGNIAKVPATQMEAVSSPLMGFFEKRRMKNFLEFIANYKEDEPSTHHGI
                     NLDKNTMEEVYYKYGLERGTKDFIGHAMALHTNDDYLTQPARDTYNRIILYVSSVARY
                     GKSPYIYPLYGLGELPQGFARLSAIYGGTFMLDTPIDEILYDDNGKFEGVKTKEGTAK
                     APIVIADPTYFPEKVKSTGQKVIRAMCILDHPVPNTNDADSAQIIIPQNQVNRKNDIY
                     IAVLSSAHNVCAKGYYLAIISTIIETDKPHLELEPAFKIIGETKDVLMGIADLYEPLG
                     DGSVDRVYLSKSYDPSSHFESTTDDVKDIYKRVMGHDLVLKQRKTVEEEAELAGLD"
     gene            complement(<388256..>389593)
                     /locus_tag="C5L36_0E01910"
                     /db_xref="GeneID:40385987"
     mRNA            complement(<388256..>389593)
                     /locus_tag="C5L36_0E01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467744.1"
                     /db_xref="GeneID:40385987"
     CDS             complement(388256..389593)
                     /locus_tag="C5L36_0E01910"
                     /inference="similar to AA sequence:RefSeq:NP_014968.1"
                     /note="PKUD0E01910; similar to Saccharomyces cerevisiae
                     YOR323C (PRO2); ancestral locus Anc_7.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323604.1"
                     /db_xref="GeneID:40385987"
                     /translation="MAEEIARNAHRASTVLKTLSDEQRSTALYKIRDALIKSKDEILK
                     ANRIDMEEATKNKLSQSLIKRLDLSINGKFDSMCDGIVDVAHLEDPLNRCTLATQLDD
                     GLELYRLTCPVGVLLIIFESRPEVIANITALAIKSGNAAILKGGKESLHTFKAMSEII
                     NRVLDVSTDVPANSIQLISTRGEVSDLLKQDLYIDLVIPRGSNELVRNIKENTKIPVL
                     GHADGICSIYMDKDLDLEKACRIVVDAKTNYPAGCNAVETLLIDENLSVDLQTQILKA
                     LLDANVTLHIVPELLSEIDPHLKESYPSQLVTATEKDFDKEFLSFDIAVKKVNGVRDA
                     IEHINSHSSKHTDAIVTENEATADVFLKGIDSSGVYWNCSTRFADGFRYGFGTEVGIS
                     TNKIHSRGPVGLEGLVCYYYQMRGSGQVVGDYLGGGGTRVFKHVSMDPSNVKL"
     gene            <390517..>390690
                     /locus_tag="C5L36_0E01915"
                     /db_xref="GeneID:40385988"
     mRNA            <390517..>390690
                     /locus_tag="C5L36_0E01915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467745.1"
                     /db_xref="GeneID:40385988"
     CDS             390517..390690
                     /locus_tag="C5L36_0E01915"
                     /note="PKUD0E01915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323605.1"
                     /db_xref="GeneID:40385988"
                     /translation="MQFSTVLVTLASLAAVNAASNSTNGTTTSSVSTAGAPANAYGSV
                     ALGAVAAAAVALF"
     gene            complement(<391261..>391677)
                     /locus_tag="C5L36_0E01920"
                     /db_xref="GeneID:40385989"
     mRNA            complement(<391261..>391677)
                     /locus_tag="C5L36_0E01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467746.1"
                     /db_xref="GeneID:40385989"
     CDS             complement(391261..391677)
                     /locus_tag="C5L36_0E01920"
                     /inference="similar to AA sequence:RefSeq:NP_010807.3"
                     /note="PKUD0E01920; similar to Saccharomyces cerevisiae
                     YDR519W (FPR2); ancestral locus Anc_1.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323606.1"
                     /db_xref="GeneID:40385989"
                     /translation="MRLSELFTTIIGLASAVQGAPDQLQIIPQNEVSCRTPSQNGDVI
                     AVHYTGKLEDGTIFDSSLPRNKPIQFTLGVGQVIKAWDEGLLEMCIGEKRRLIIPSEL
                     AYGKRGAGGVIPPNATLVFDTELVSINGAKEEKDEL"
     gene            <392499..>393692
                     /locus_tag="C5L36_0E01930"
                     /db_xref="GeneID:40385990"
     mRNA            <392499..>393692
                     /locus_tag="C5L36_0E01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467747.1"
                     /db_xref="GeneID:40385990"
     CDS             392499..393692
                     /locus_tag="C5L36_0E01930"
                     /inference="similar to AA sequence:RefSeq:NP_013763.1"
                     /note="PKUD0E01930; similar to Saccharomyces cerevisiae
                     YMR048W (CSM3); ancestral locus Anc_2.612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323607.1"
                     /db_xref="GeneID:40385990"
                     /translation="MSSSHDRLSRAELLGIDVDKGIQVDSVTSTLFQTNQDGTQSSTA
                     KSKPKRSSDKLTPEILLSGRGLPKLIDTFKRFKFTKRSAKGKASKHNGVYKKVQYCDD
                     HHYDNLTRIIQIYQNWGHSISPHLMFDRFIGNLDRGIQKSDVKYWIREQIREEIRGKV
                     DRILQKEATEMERARAERAAREHVENNKDSLTDDEPDGVAGEVDVEEEREQDWAALFG
                     GQSQATDKDVNENDGPNNDNEDDGGYNVQGEAPIFSTFLRTSSQPIHSDLGSEHHTSE
                     MEDIPEDVMDGAARDAFDALDGLDEDEDGLAALLEAESNNEARDSQMFSQYIAHEPQE
                     RTLSKSLSPTTVGTLTTETETTTQTTTQTTTTLSTGASEGPSRPMTPEEEGFSDVDED
                     ELLQL"
     gene            <394091..>398269
                     /locus_tag="C5L36_0E01940"
                     /db_xref="GeneID:40385991"
     mRNA            <394091..>398269
                     /locus_tag="C5L36_0E01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467748.1"
                     /db_xref="GeneID:40385991"
     CDS             394091..398269
                     /locus_tag="C5L36_0E01940"
                     /inference="similar to AA sequence:RefSeq:NP_011786.1"
                     /note="PKUD0E01940; similar to Saccharomyces cerevisiae
                     YGR270W (YTA7); ancestral locus Anc_5.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323608.1"
                     /db_xref="GeneID:40385991"
                     /translation="MPTSRYTTRSRGSRSYYGPGDSDDDADFELDHAKLDGHEDDEPS
                     EEFEEDLREGSTGAADGDVANGHGHGRQYGGQGPVKKDEEEEEEEEEEEEEEVRPHRT
                     RARKQVNYNEDVLLAKLVDEDEELEEEYTNSRPLRASRTSRKVVHMDDDAGHYDKSDE
                     DYDGISGGASKKRTRHGKGIGTAGDDDEEGNGEGEDGLDGDEEFRIDDEEEDENYIKD
                     DDDDFLSGEELKSRNKRRKRESAFVVKDEDEFEDSDTPYEARKTAASLRRSRRSTRTE
                     NSLTSQSTTSSRRTRSANRNKWKGILESNQEGNGQLTLEDELRDLQNDSPLASPKRNL
                     RHRKEVNYTLPPPYLTEAQLEELEENASATSHASPRKGRNGGRFGGASSSNAVRRLFP
                     TVGPFGGSEVQSIFQSDTIPSGLAALANAESSDSEDDNELIKPTDPNNTGTTITTTNT
                     TNANIVGPTDLTNSSKKKNTLADTDPLGIDTNIDFSVVGGLDNYINQLKEMITLPLLY
                     PEVYSKFHITPPRGVLFHGPPGTGKTLMARALAASCSSQNRKITFFMRKGADCLSKWV
                     GEAERHLRLLFEEAKNNQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDN
                     RGQVIIIGATNRPDSIDPALRRPGRFDREFYFPLPDLKAREDILKIHMRKWEDKLDDN
                     FIRELAILTKGYGGADLRALCTESALNSIQRQYPQIYKANDKLKIDINKIKVNASDFT
                     RALKKIVPNSARNSSNVSEPIPDVIQPLLNKQFEEVMSKIRQILPMEKEISLLEEAEY
                     QSLNDDFRTQQLVKSFDSLRVFKPRIAIQGTKQQGLTYISNAILNKLEGFVIQILDLG
                     KIFSDSSISVENLCIQLFSELKRHKPSILFIPDTIGFLNSITESVRSTIKYLVRGINS
                     NDKILIYCEIEGDSNQVKEINDELEELFDLTEDEIINIRDPDNDERLNFFRKFWDSLN
                     ITPNEFNDISIRPKKDTTPLEIVEIKDNKINEENQNIKKLKELAKNDMRLKNSLKVKL
                     SGLLDIFKVRYKRFKKPIIDDHLLVHLFNETPDPNSNYQIKEDKILEVSSGKLYNNID
                     LDVIEERLWNGYYSEPRQFLHDLELILKDANTSSERDRILKANEMYAHAVVGVEEIEV
                     QFPLLVAQWKEVARREKMRKTEYMKLLQEKESKEKELGGKELNETESKECRSNALESH
                     LDNNVVPETIIDVNGNIENIESREILKDSNIGVGTLLNGNENGHVEYEIKGQTQVQEQ
                     SEPNDHGVLKSESELPVEPVHVGDPVEKVEVELMTEEAHKKLLAEETRSDSQIEEEKT
                     KETAFVSEPQSVVYDSAKVEKLRDQLLEKTSNFKLTKLERINSKLFDILWRHRLNLDK
                     TGLLRELDDFIAAL"
     gene            <399005..>399568
                     /locus_tag="C5L36_0E01950"
                     /db_xref="GeneID:40385992"
     mRNA            <399005..>399568
                     /locus_tag="C5L36_0E01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467749.1"
                     /db_xref="GeneID:40385992"
     CDS             399005..399568
                     /locus_tag="C5L36_0E01950"
                     /note="PKUD0E01950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323609.1"
                     /db_xref="GeneID:40385992"
                     /translation="MSKRNEIKEKEQLRLQIQAQFNKIDETVLSWLKPTPQLSTANTS
                     TDNEFANQIVIPNGKGINFDDSIKDEKKVTISDFLQDENLDKRKKEGLDKVKKVGDLK
                     KSGVGNSSNSLRALTNKLRKDRRGDFERKKALKSSIAEKIKGDKKIYKANDDDEEDSE
                     DEEDEILKRKSKGKNDVMGKGKNKRPF"
     gene            complement(<399812..>402013)
                     /locus_tag="C5L36_0E01960"
                     /db_xref="GeneID:40385993"
     mRNA            complement(<399812..>402013)
                     /locus_tag="C5L36_0E01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467750.1"
                     /db_xref="GeneID:40385993"
     CDS             complement(399812..402013)
                     /locus_tag="C5L36_0E01960"
                     /note="PKUD0E01960; Pfam Domains: HSF_DNA-bind(3e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323610.1"
                     /db_xref="GeneID:40385993"
                     /translation="MDGKPVQDNQHMANINATNMVPQQVYVESLRQGYTFQPMMQRPL
                     STSSNPNTNQNLNQNTFSGPGTNPNSNPNVNSNLNINVGQFPYINHQIYQHQQHPQQL
                     VMSPHPHIPMITASSIQYAPYPHAISPTGIIMNPMHQNHLLHQQQQQHHHHHQQQQQQ
                     QQQQQQQQQQQQQHHHQQFPPQQIHQQHHQLQILHPQPQMQHRSISNSSIPDHPHLNH
                     HHNHLQHLQINKNPKRLISKDTSTSKTKNIRKVSAFITKLYSMLHNPSLSHLIWWSGS
                     NQLDDTTFALLPGAEFSNCLTTYFKHGNVASFVRQLHMYGFHKVCDGNQSHMSHSYNY
                     SSGNHNNNNNNNNNNVYDHNPAVWEFRHTSGKFRRGDMKSLHLIKRRANSRKSRPSSV
                     KTLSITEREVEKPEICNNVKKEEAVEEEGDGDEDEDEVEEESKQAAVDTLLKHENQTQ
                     IIDKTENRDNTESGRDSERRGSTRKNDQIESIHGKTVTARPLHNPFEHYNSQQIHKPA
                     ASSSRSNSPTNMTKPHELFFKHSRQRYPSVFVDPCAPIPPSNIPKQPLQLPPIQPSDS
                     PAPMPKKNEGLMGLPSLSSISSQSSRSIPSPSSSISARNGRFNFSRTSSSSLNSITSQ
                     LRPSIFDLHAPSPASSISAHTSIFSGSSISSSTGSIGSISSILNEDRRLPSLSELPVP
                     LASSSLKTLVAESDSNITKHDDSRTKVEKSSLQTEPGERAKPDSSIEQNTN"
     gene            complement(<404179..>407262)
                     /locus_tag="C5L36_0E01970"
                     /db_xref="GeneID:40385994"
     mRNA            complement(<404179..>407262)
                     /locus_tag="C5L36_0E01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467751.1"
                     /db_xref="GeneID:40385994"
     CDS             complement(404179..407262)
                     /locus_tag="C5L36_0E01970"
                     /inference="similar to AA sequence:RefSeq:NP_011756.1"
                     /note="PKUD0E01970; similar to Saccharomyces cerevisiae
                     YGR240C (PFK1); ancestral locus Anc_5.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323611.1"
                     /db_xref="GeneID:40385994"
                     /translation="MSKISNFESGVDSVSNVLYTSFTVNKTSDYTSLIKFYNSLGFKI
                     IKTYSKEESLTSSIDIQGVSTDSRKECWLESFPITRTDSNGKIIPFQETIEYKYPQLT
                     PQLAKLNKGVVLKIRLVSHDVHKNPELPGRLIIFTSQLKDVAKLVESLNLPIIKPSPL
                     EKNRIEFFIEDPVGNLVGFTNKVNNKTIDSNDEFFASDEEIKKFKQTQEENLIKNASQ
                     TKKRIAVLTSGGDSQGMCAAVRSVVRAGIYLDCEVFGCYEGYSGLVKGGELLRKLEWS
                     DVRGWLSLGGTLIGTARCMEFREREGRLQAAKNMIIKGIDALVVCGGDGSLTGADLFR
                     SEWPSLVEELVTKKILTDEQVKPYRNLTIVGLVGSIDNDMALTDNTIGAYSSLERICE
                     MVDYIDSTASSHSRAFVVEVMGRNCGWLALMAGICCGADYSFLPERPPNAETWKDELK
                     EICLRHRGKGRRKTTVIVAEGAIDNQLNKITSENVKDCLVEIGLDTRITKLGHVQRGG
                     TAVAIDRFLATLQGVEAIKAVLENTPETPSPMIGIQNNRIVRIPLVEAVKTTKSVATA
                     IKEKRFDDAMSLRDSTFKEFYKNFLSISQDDDDKKLLPVEERLNIGIIQVGAPTAALN
                     PATRAIVLYLLSKGHKAYGIENGFQGLISHGSFRDLSWIDVEEWHNLGGSELGTNRVL
                     PNEDIGSVAYQLQEKKIDGLIVIGGFEAYQSVKQLKDASKTYPIFNMPIVCLPSTVSN
                     NVPGTEYSLGVDTCLNVLVNYCDAVKQSASSSRRRVFVIEVQGGNCGYIASYIGVVTG
                     ALAVYTPEHNISLKTIEEDLELLEKTFANDHGDERSGRIFIRNEKASDVYTTQLIADI
                     IMENAHGKYESRTAIPGHVQQGKIPSSFDRTSAVRFAIKACEFIEEKHAAISKKISEY
                     NSEHLILPNTSENSNGEEAIDGKFKHFENKDFFNTEKRLLYVYHHGKRILVADDNNAV
                     VCGIQGTNVAFRDINDVWESNTNVKLRKGNEIHWDKLNQVGDMLSGRLMIRENKN"
     gene            complement(<407738..>409666)
                     /locus_tag="C5L36_0E01980"
                     /db_xref="GeneID:40385995"
     mRNA            complement(<407738..>409666)
                     /locus_tag="C5L36_0E01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467752.1"
                     /db_xref="GeneID:40385995"
     CDS             complement(407738..409666)
                     /locus_tag="C5L36_0E01980"
                     /inference="similar to AA sequence:RefSeq:NP_009690.1"
                     /note="PKUD0E01980; similar to Saccharomyces cerevisiae
                     YBR132C (AGP2); ancestral locus Anc_3.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323612.1"
                     /db_xref="GeneID:40385995"
                     /translation="MSQRNPFKAVLTAAKDTFIPVPPSEIPHLSDFDHPLNAQVEVYA
                     RNSGDEEESRNSHSEELEYTDYNDCFDSKDLTKEDLNHDIKKEIDNLNINEKFVENSS
                     SSDIISKVHHLEHGRTHRKLQRRQIELIAIGGTIGVALFVNIGTSLKNGGCLSLLLAF
                     SIWCFPILEITCCCAEMVCYLPIKGAPFCVFADRFVDEAFGVMASWNFWVLEGALIPF
                     ELTLFNTLIHFWTADYSLAIPIVVELVVYFLINLAAVKWYGEVEFWLCIFKVLLSIGL
                     MLFTFITMVGGNPQHHAFGFTNWKSTDPMLEYIHVGGLGRFQGWLSCLIQASYMIAGP
                     EYLSMAAGETINPRKVLPGAFKGVFYRLSTFFVGGALCVGILCNARDPLLLDALSNGK
                     PGAGSSPYTIAMHNMGIKVLPTILNILLMTSCFSAGNSYTFCSSRTLYGLAIQRRAPK
                     IFSYCNKQGVPIFAVLVSLAWGALAFLQVSKNSNVVLNWITSLITSSQLINYFIILVT
                     YLHFRRAVIKQGIDRSKFTFKAWGQPYLCAITLTVVFIMIWIDGYYVFLPGSWSTSTF
                     LFTYLMCFVDFGIVVAWKFIKGTKYRSNPMEVDLHTGLEEVILHELMLEKKRTLYQQK
                     SPMARTWERLNEFLFGKN"
     gene            complement(<410378..>414802)
                     /locus_tag="C5L36_0E01990"
                     /db_xref="GeneID:40385996"
     mRNA            complement(<410378..>414802)
                     /locus_tag="C5L36_0E01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467753.1"
                     /db_xref="GeneID:40385996"
     CDS             complement(410378..414802)
                     /locus_tag="C5L36_0E01990"
                     /inference="similar to AA sequence:RefSeq:NP_011058.3"
                     /note="PKUD0E01990; similar to Saccharomyces cerevisiae
                     YER132C (PMD1) and YGL197W (MDS3); ancestral locus
                     Anc_8.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323613.1"
                     /db_xref="GeneID:40385996"
                     /translation="MRAMDFSANKCYPLVMPNLNDNDPRRRLDVRSGASINISNSRIF
                     VFGGCVFELDLPANFKLDTIHKAFVDGMKKTENIEDVCGINFNQYLSSECFRLSLINR
                     KWHHYDIAEGSDKPPTRMFHNMIIYNNCIYISGGLRFNEENNLVVLNDLWRFNLFEKS
                     WRCYYKNNNDRILKRYDHLSAAFSEMELFDKSLVNPGICIVGGMSEEDEIIEKAELFD
                     LMDDDLKVQTLPNLLAFDKLMNGSIPKGHPVKIRGSTCGMFSAFCSTTNEEKLFVFDE
                     SPNLSEYEPILMFRRDAKGIRYPKNNGFDTSPIGKLSFPRVGYFGTNMIIMGFAEDDK
                     KISAYMYNVRVNTWTKLHISCLHKIYTHKLTVGFVWSSHHKNVFLGSSVMKESGGSVN
                     YFDTLMVLALPFTNFFGNDSRKVLDKELNGNIPTSQGAGIQKQRQGKSETSVFDFFHQ
                     SNNPNEHSGGFADYAYHVAQQLPLNYICYTLPPHAIAIGKHAFERNTSFSDLDLVCCD
                     GSTISVPYALCRRRWGIGFDEILSDAYAKSYVEGKSQSLRSSQGSVHESRSSMDEYSS
                     LHSKSSSATPNFRYPFQDKKDRETTTTTTGVTANTGLIPTSGLSSAISPVRNTPRNSS
                     ANSRHHSLSGSLFPNTTLSRASISLSQSRRNSYNPMSRTNSISGSRRSSLGNTGLPRR
                     NSPIIQHSRRASTLSRNSFSIGNTNSNSNSININEATNNSHMSPHSSIEEVPRLSPPV
                     TNNSYKSFGEFGRVGSNSSYSGDSRSSSSTHSDGSSESIPSGMQDAINNYSIPPPKPM
                     PTQPPEDDIKDSTILSDSSEDCTFSKQDIDNSIIDLVYQQFQDENNINIDPLRIPRAL
                     YIPYSNATVHAIVEFLYSGHIGANWKLFPTGIELLMASKQLGIPLLYDLVMEIFFVIL
                     GTMESKLKNDLILYLEHHADGEGGADDERIDRIYDILDREGGDDMDMDIELLLEAASQ
                     SRRDSGTTISSDMKLDGDEEFYNGDFGPNCVDDDCGNSNSYHCMKPRKDSTMNGIDPL
                     EVDPREEGNMGRGTLDRYHMMGNGSDEGNKGSRGSSDCEGGEESGGVTITTGMLEERG
                     YETSDSSDNEEGEVLMSSFKNFSLTGGDSGRNLASEGGEARECSNRKKGHITAWPTFK
                     DLIDINSDVHSCTNASTNVNAAISTVGGTGKTTSTNSNAATNSNANGGEYHGCEGDTE
                     AGGPQMKLKGVFIELFVEAGALVNDSKLMLQAIYVLDLYKKFTSLKNTGSVDATNGTK
                     DKEKQKQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLHPMNK
                     SKSTNSTSKNSTVDTSLSNSELFGERLRGISSYPERGAPSMLRHVSSAPVNEVQQLRF
                     EREAEAEAEGYPRIYADTYADVDADATTGTKIRTERDTPVVTKVGVKAKTDTGISAYN
                     APLKLERSDSLQREKNEKSHRKRKTLLSRLRGFHQGRN"
     gene            <415079..>415444
                     /locus_tag="C5L36_0E02000"
                     /db_xref="GeneID:40385997"
     mRNA            <415079..>415444
                     /locus_tag="C5L36_0E02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467754.1"
                     /db_xref="GeneID:40385997"
     CDS             415079..415444
                     /locus_tag="C5L36_0E02000"
                     /inference="similar to AA sequence:RefSeq:NP_011037.3"
                     /note="PKUD0E02000; similar to Saccharomyces cerevisiae
                     YER112W (LSM4); ancestral locus Anc_7.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323614.1"
                     /db_xref="GeneID:40385997"
                     /translation="MLPLYLLNAVKGESIVVELKSGGIVNGTLENCDNYMNVTLTDAC
                     VSLVEDEPFHKIKHIYLRGTNIKLFKMGNEFIEKFKEQQQREKENHNRGNNNRQFNNN
                     RQYNNNRRNRRRNNDGGNW"
     gene            complement(<415650..>424664)
                     /locus_tag="C5L36_0E02010"
                     /db_xref="GeneID:40385998"
     mRNA            complement(<415650..>424664)
                     /locus_tag="C5L36_0E02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467755.1"
                     /db_xref="GeneID:40385998"
     CDS             complement(415650..424664)
                     /locus_tag="C5L36_0E02010"
                     /inference="similar to AA sequence:RefSeq:NP_009465.2"
                     /note="PKUD0E02010; similar to Saccharomyces cerevisiae
                     YBL088C (TEL1); ancestral locus Anc_7.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323615.1"
                     /db_xref="GeneID:40385998"
                     /translation="MLYVYFFIACIRTRLIIQILTMHVFNTPAQLATNKVKDKNDAIE
                     KLQNINFASPSTINSFDPEALLKLVNSLDLLIDSDLLLYSKPNSSSIVEIRLNKVSTV
                     LRSILVNILGSKQSIALYKPRQSEKIINTILKYLTYTPPGCKQTIVEPLMLNLTKTLY
                     SLFRVQCFRDHLYLKTYESILRKVLLCLELLIFDFKSIANNEAVLIELLSLLYEFLNP
                     AFTSGLNILLNSPSGSQIYYPRIVDVVLNYLKILFEDNKRERESLIIIFKIINKCLID
                     LSTSHTKFCYRLYKIGVQLILEAKSITSSRLITEMALFVNLIPQFVTLKNLYKIKGDN
                     WNINTSGELSFKTPNVITTSSERIGHSTDSSAIINASSEVEDNMGFSEEDEDDGEEKP
                     KIDLFSISRSNKRKYEGHHFLESNEELDNLAKVIDVLFGLFHDTSVKRQIELKYNHVQ
                     LHSFPVPKKEKNSWLCFHFLSLTKDSPSKPWLLFLGFGQLLIAYYQLKLEKFEAQKFT
                     DEVMMVKRKRLTFMKSDTYMQISDSLHYFDNPLDLLTSILTDESLNNNVQILTILKTL
                     SLLLGFIFSNSNMKSCYDILEKFINSADLHLTRIMHVFEKHDNNIKYWALHSLDIMFS
                     ILVYHKGFETANIKSSVVSIYHKSIKYSLDFLKDPNMSNVSCIFLFHLSVFETISNPL
                     LFTLNKNLVQQYENIIDLAEINGPAILSKEAVLFWYASYNIGKKYKFNNVQFLKLGDT
                     FNPQLFSQKVSNWIFCKLDQFSKISSITDTIPIVVQLKRLYGDDKEDFIPEQFISNES
                     FYDGPSLHLIRDFMKKQYLSTYILKKISPNGTIIEIPPYKFSNERLIVNEITLNKMNR
                     ELSKVFNLMMENANISVTLSWIIPIIVFFKQGQVATFPDFNLANYTDYVVSSLKDPKC
                     YLFYITLVDQLHAAGKVTIDKVLLPTVKTVQLGLNLLISSNQLHENQHLSEEDLFDSF
                     MPSSETEITACQFADYNKYNYNSLYFHRHTFEQKIINFVLNSELSTNVDSMFAALLLF
                     TSKVKDKFQLLGCYYEIMKWLECGQVVLSVNIVDGIFNQVTTFLEDHTMKTYEAALIC
                     VTRIFEYTSKTWMSASMGIESDGKSVYEYLINLYSKGMIHNELSLIGVFSFFQAIIQN
                     QMVASNLFDYRQILIESTKYFHLFDNYGKFQVLNSVLATVKSQKDIFETYTLFLKSFR
                     SPQQSVESSATFCCFMSRMSNASESLIITTVCNLLELSNFKQILDYMEFAISDITYSN
                     RIPHPNRLFWNFKEVFFKCWESFQLPIENFPFYLFGFSSLDDFFLRSYKEIIASSLAY
                     NHVGIIDTLKNKVNIKETAMIKDSMSLSVTLSWTKGGIRNGIFKIFEKYFSSSKALKS
                     SISEQYLLIVFQLLRFCDCSSEEELLSLFEGPNHFDLPLSIDALKFEFLEEYDLWIKP
                     KSCVEMINYFGNLCGIENIWSTQIVYHLASKLLLLIESSILGIEKLINLRRLKLLFIL
                     SHDGFQSTHVCDLLISNLSSYMKDSLLNNDTAIILTSLLQLNSGTLSNITVYSLVTII
                     CTLLEASRTPDSERLALWVLSNRNKFQTGEFTDIIHFGFDIVEDKNANCLPDLVEFVN
                     KAFRDKSHVQILMHYLSLLFKHNSTFQNFNLKIDSQRLTQEFIQNLFTIKTLYAENLS
                     DGMIQWIGRSLGLYYQNNGKIPNRELYEFDNRSLRHSNMIDFDDEVKSLDTIFRQIIH
                     DLPSSSLRARYCFETIVGVLLQKHNTQAENMSSQISYDELFREFEEFIYPISSYMCSV
                     LIDQVELETASYYKHGLDQALNGFTTILKVYKFERWLSQIVFSIINELSSQSSIMILL
                     ANYMRQIPRFVQECFCPLVLFYIQSESIKRGKIIGKMISDFFSQDFAILTKDSIVLFL
                     ELVLLIRLGTKNGNEKFVSIYRVIDIARVYEAALFINKNKTALLLFEDHHSAVGLVTK
                     GPILSNKRYESLLKNIYSGIEDNDLIFGLPIVPELDYGLQILRHNNLQWGEMMFNNAK
                     FESNLFWRCDERLATVNKITESMMDMGWSGISSIVNQYSSSVCEELVSTSDAMYEQLW
                     KLNQWDLSIPKDKSTEHQFVYSMLKNINDKPDFHSKLTKDAINDLVKIDISKFHKHGS
                     TQNETLESWVRTLTICNTVDDILGSEDQNFGSMLKKFSASTEWFREATVDEFENILLA
                     RRTILSIMSQYGSREEKGYFQISHGNCWLGIVNELNFYNNIMIEKGSTQKAVNGAVFL
                     NEISQVEHLVDNAYIKRIAKYNLAYAFWTQQSDTRFPIETLKDVIETDKTSATALPEA
                     QMVISSLPTELLIATLAKWSDECKQETSSVIMEKYIDPLTELLESIDVSNPPHDYLGL
                     TFHIMAKFCDDQIQKRESNSGVSKSLDSIKLLENDIKALAKFLKEETTKEKKKYAHLD
                     LLRLKNRHKQQVKEVQKEQEERANYITKAVNFYFKSMAYDDHQFIEQSIDRFCSLWIE
                     NNNIEIDSNQLLLLPTHNFVTWNNQLVSKLMDERTHFQDTLKNLLIHISLNHPFHTLY
                     LLKSLRITKVESDDPAAISRGNVAQRIWETLCTCESKFNVEGIHNILTSIDALSDKSV
                     EIANIKLKNIKRVPITRLPDGRWWIDSLPNLCIPSPVKSIQICKNKPYRRDELPLVLS
                     ISETLVVAPSGVSHPKIMKVQLTNGESQKMLLKAPDDLRQDAIMIQVFKKVNKLLWKD
                     IQTKKRRLRIRTYNVLPLGPSSGILEFVPNSMPLVDILKFLHQGDELDINDARLKMKE
                     VQTQAKSVRYQVYKSICKKIQPNLRTFFFNNFTSPDTWFESRCLYSHGVATTSIIGYI
                     LGIGDRHCNNILLDKSSGEPIHIDFGVAFDQGKSLPIPETVPFRLTRDLVDGLGVTKV
                     DGMFSKSCEHVLRVLRLNKQYIISILNVLKYDPLYSWTLSPLRKKKLQHIYYNVENDI
                     GFDEFVNTDLGSEANSAIETVKRKLDASGLSDEAVVRELIRDAVDPQNLALIFMGWSP
                     FL"
     gene            complement(<425023..>425918)
                     /locus_tag="C5L36_0E02020"
                     /db_xref="GeneID:40385999"
     mRNA            complement(join(<425023..425394,425877..>425918))
                     /locus_tag="C5L36_0E02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467756.1"
                     /db_xref="GeneID:40385999"
     CDS             complement(join(425023..425394,425877..425918))
                     /locus_tag="C5L36_0E02020"
                     /inference="similar to AA sequence:RefSeq:NP_009466.1"
                     /note="PKUD0E02020; similar to Saccharomyces cerevisiae
                     YBL087C (RPL23A) and YER117W (RPL23B); ancestral locus
                     Anc_7.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323616.1"
                     /db_xref="GeneID:40385999"
                     /translation="MSGSGAQGTKFRMSLALPVGAIMNCADNSGARNLYVMAVKGSGA
                     RLNRLPAASAGDMVMATVKKGKPELRKKVMPAIVVRQSKPWRRRDGTYLYFEDNAGVI
                     VNPKGEMKGSAITGPVAKECADLWPRIASNSGVVV"
     gene            complement(<426500..>427852)
                     /locus_tag="C5L36_0E02030"
                     /db_xref="GeneID:40386000"
     mRNA            complement(<426500..>427852)
                     /locus_tag="C5L36_0E02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467757.1"
                     /db_xref="GeneID:40386000"
     CDS             complement(426500..427852)
                     /locus_tag="C5L36_0E02030"
                     /inference="similar to AA sequence:RefSeq:NP_013311.1"
                     /note="PKUD0E02030; similar to Saccharomyces cerevisiae
                     YLR210W (CLB4) and YDL155W (CLB3); ancestral locus
                     Anc_7.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323617.1"
                     /db_xref="GeneID:40386000"
                     /translation="MYRTAHSQEQNVNDENKILESSKQDKSISVPNAYASIKSRTALG
                     VISDSTLNQSQTNPRYQSQGHYFPHSHQHDQQHDHQHQYQSNHIDAHVSHRGKIPILS
                     DNQKNQVTHSGSVSTISTSEDVMDQSSNDEANYIHEEQDEEFESDDYSFNQPLSPIMS
                     LKIEQEIDRVYTKFSRTELDPNDEDTYDCTMVAEYGNRIFNYLHELEIKYKPNPRYVE
                     QIQKDLCWEHRSTLMDWLVQLHSRFNLLPETLFLAVNIIDRFLSKKTISLSRFQLCGA
                     VALFIAAKYEEINVPTVSQMVYMVSNQYPRDAFLRAERFMVEVLGFEFGWPGPMSFLR
                     RGSKADDYDAEVRTLAKYFLEITIMDSRFVSSPPSWLAAGAQYLSRRMLARGEWSEAH
                     VYYTGYTAEQLEPLALYFEHCCLNAESHHKSIYQKYSERRFKRASLYANQYVRELYNS
                     "
     gene            <428807..>429862
                     /locus_tag="C5L36_0E02040"
                     /db_xref="GeneID:40386001"
     mRNA            <428807..>429862
                     /locus_tag="C5L36_0E02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467758.1"
                     /db_xref="GeneID:40386001"
     CDS             428807..429862
                     /locus_tag="C5L36_0E02040"
                     /inference="similar to AA sequence:RefSeq:NP_012410.1"
                     /note="PKUD0E02040; similar to Saccharomyces cerevisiae
                     YJL125C (GCD14); ancestral locus Anc_1.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323618.1"
                     /db_xref="GeneID:40386001"
                     /translation="MPFTDRKKYIEEGDLVLVYVSRTIIKPIYVTKGEHFNTRFGSFP
                     HDSMIGLEFGSQITTPKDRGFVYLLQPTPELWTMSLPHRTQIVYTPDSSYILQRLNVH
                     PGSRVIEAGTGSGSFTHAFARTVNDEGKLFTFEFHEERYQKAKEEFEAHQLNNIIITH
                     RDVCKNGFEIDNVDLQADTIFLDLPSPWEAIPLLKKVTTNDKQIGICCFLPCFEQVVK
                     AVEALQNEGWIDVELTDVSGRLWESHKAMKREVDDAVKRLRYVKERQREGLELIKAGK
                     HPRKENETKENETKEKDYGFNPFGRGKRILEGEDGFEWFDVSRLESEVKTHTSYLVFA
                     RKMPPMVRKLENTRDSV"
     gene            <430092..>431099
                     /locus_tag="C5L36_0E02050"
                     /db_xref="GeneID:40386002"
     mRNA            <430092..>431099
                     /locus_tag="C5L36_0E02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467759.1"
                     /db_xref="GeneID:40386002"
     CDS             430092..431099
                     /locus_tag="C5L36_0E02050"
                     /inference="similar to AA sequence:RefSeq:NP_010257.1"
                     /note="PKUD0E02050; similar to Saccharomyces cerevisiae
                     YDL027C; ancestral locus Anc_3.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323619.1"
                     /db_xref="GeneID:40386002"
                     /translation="MFYRSQLANIPTRNIVQRTHLRHLSVNTASKPVIYSQCSILKSN
                     PLLVPQLTFTSQLKANLLRSFSTSAKLLDYYRPPKNNVYSGLTGRIWSRIPDSVKLIS
                     LVSISAYLVIFVAVPILVMVVPPLVVGGWLFYRLNKYFKTKSVNKAFQSIADSTLIYY
                     PKKIRNPLLLPDPDQVNSELANFEMNRIIDAFWNNEQGIADYFKIPNIDDLALGTLEA
                     VEINYNSTSVVFADDYKMMVTQRRPLYNKSTNEDIADVVIRLKCLENPIAEGLDPIAN
                     ITKSLVQIEITPNNLFAPQFILKTPSVSTMPHDKDSDGFGDFDDDADGFINVKGKTKV
                     L"
     gene            complement(<431215..>432076)
                     /locus_tag="C5L36_0E02060"
                     /db_xref="GeneID:40386003"
     mRNA            complement(join(<431215..431938,432042..>432076))
                     /locus_tag="C5L36_0E02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467760.1"
                     /db_xref="GeneID:40386003"
     CDS             complement(join(431215..431938,432042..432076))
                     /locus_tag="C5L36_0E02060"
                     /inference="similar to AA sequence:RefSeq:NP_014604.1"
                     /note="PKUD0E02060; similar to Saccharomyces cerevisiae
                     YOL038W (PRE6); ancestral locus Anc_7.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323620.1"
                     /db_xref="GeneID:40386003"
                     /translation="MSGYDSALSIFSPDGHVFQVEYALEAVKRGTCAVGVKGKDSVVL
                     ACERRTTLKLQDPRINPTKINKIDYHVQLAFAGLNADARVLIDKARVEAQSHKLTLED
                     PVSVEYLTKYVAGVQQRYTQSGGARPFGISTLIAGFDENDNVPKLYQTEPSGIYSAWK
                     AQSIGRSSKVVREFLEKNYPNDEPMDEDQTVKLAIQALLEVVQTGAKNIEISVMKPNA
                     EPRPLTNEEIEVIVKKIEEEKAAEAEKKRPKTSD"
     gene            <432326..>432841
                     /locus_tag="C5L36_0E02070"
                     /db_xref="GeneID:40386004"
     mRNA            <432326..>432841
                     /locus_tag="C5L36_0E02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467761.1"
                     /db_xref="GeneID:40386004"
     CDS             432326..432841
                     /locus_tag="C5L36_0E02070"
                     /inference="similar to AA sequence:RefSeq:NP_012280.1"
                     /note="PKUD0E02070; similar to Saccharomyces cerevisiae
                     YIR015W (RPR2); ancestral locus Anc_7.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323621.1"
                     /db_xref="GeneID:40386004"
                     /translation="MEEIRGGVSLISPSQTKKEKNQSKKSKGSNRAPKIPNVIPKKDH
                     FQRVSYLYKLGAMMTMAKYVGDYDEHQQKQRDTLSRTYLNQMDLVSKKAVLKLHPSIK
                     RTICKQCSRLLVEGLTCSIRVVNESKRQQPHCDVLELKCVCGRAKRFPIGKNFDYSLF
                     SERENVLHDSI"
     gene            complement(<432976..>433410)
                     /locus_tag="C5L36_0E02080"
                     /db_xref="GeneID:40386005"
     mRNA            complement(<432976..>433410)
                     /locus_tag="C5L36_0E02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467762.1"
                     /db_xref="GeneID:40386005"
     CDS             complement(432976..433410)
                     /locus_tag="C5L36_0E02080"
                     /inference="similar to AA sequence:RefSeq:NP_012411.1"
                     /note="PKUD0E02080; similar to Saccharomyces cerevisiae
                     YJL124C (LSM1); ancestral locus Anc_1.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323622.1"
                     /db_xref="GeneID:40386005"
                     /translation="MSQEDIYLQSYPFTTAAAIIGYVDRKVCAVLIGGRSVIGVLRTF
                     DQFGNLVLHDATERIYLSETRQYAESQLSQIYLIRGENLLMMGDLDIDSEDEAVRGWE
                     RIDYIEGYNKFKKNVKDAKDRAYKYAKQISYKGAYAGGFQFM"
     gene            complement(<433821..>434423)
                     /locus_tag="C5L36_0E02090"
                     /db_xref="GeneID:40386006"
     mRNA            complement(<433821..>434423)
                     /locus_tag="C5L36_0E02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467763.1"
                     /db_xref="GeneID:40386006"
     CDS             complement(433821..434423)
                     /locus_tag="C5L36_0E02090"
                     /inference="similar to AA sequence:RefSeq:NP_012991.3"
                     /note="PKUD0E02090; similar to Saccharomyces cerevisiae
                     YKR065C (PAM17); ancestral locus Anc_1.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323623.1"
                     /db_xref="GeneID:40386006"
                     /translation="MFATRNITIGVRTLRPTSFLKTRSFLQQRLQSTLKKSYEPTKSE
                     LDIASKMSWEQFLTMRKQQRRLGGIGSIAAAILAMGASFSYFSQIEIDPTETLFGLDI
                     FTVYIGAILCTGFVGFMLGPAVIGDPLFAIINRKNMATFRIKQKLFLKHIAKMRVDAS
                     RQSMNNPVPDYYGEKIGSLKDYRQWLRDCNEYRRKAKEFL"
     gene            complement(<435144..>436391)
                     /locus_tag="C5L36_0E02100"
                     /db_xref="GeneID:40386007"
     mRNA            complement(<435144..>436391)
                     /locus_tag="C5L36_0E02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467764.1"
                     /db_xref="GeneID:40386007"
     CDS             complement(435144..436391)
                     /locus_tag="C5L36_0E02100"
                     /inference="similar to AA sequence:RefSeq:NP_010262.1"
                     /note="PKUD0E02100; similar to Saccharomyces cerevisiae
                     YDL022W (GPD1) and YOL059W (GPD2); ancestral locus
                     Anc_3.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323624.1"
                     /db_xref="GeneID:40386007"
                     /translation="MFLISKSLHFTRSFSNTIKTLNRSNIKMVSPAERLSTIASTIKP
                     NRKDSTSLQPEDYPEHPFKVTVVGSGNWGCTIAKVIAENTVERPRQFQRDVNMWVYEE
                     LIEGEKLTEIINTKHENVKYLPGIKLPVNVVAVPDIVEACAGSDLIVFNIPHQFLPRI
                     LSQLKGKVNPKARAISCLKGLDVNPNGCKLLSTVITEELGIYCGALSGANLAPEVAQC
                     KWSETTVAYTIPDDFRGKGKDIDHQILKSLFHRPYFHVRVISDVAGISIAGALKNVVA
                     MAAGFVEGLGWGDNAKAAVMRIGLVETIQFAKTFFDGCHAATFTHESAGVADLITTCA
                     GGRNVRVGRYMAQHSVSATEAEEKLLNGQSCQGIHTTREVYEFLSNMGRTDEFPLFTT
                     TYRIIYENFPIEKLPECLEPVED"
     gene            complement(<437830..>438261)
                     /locus_tag="C5L36_0E02110"
                     /db_xref="GeneID:40386008"
     mRNA            complement(<437830..>438261)
                     /locus_tag="C5L36_0E02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467765.1"
                     /db_xref="GeneID:40386008"
     CDS             complement(437830..438261)
                     /locus_tag="C5L36_0E02110"
                     /inference="similar to AA sequence:RefSeq:NP_012413.1"
                     /note="PKUD0E02110; similar to Saccharomyces cerevisiae
                     YJL122W (ALB1); ancestral locus Anc_1.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323625.1"
                     /db_xref="GeneID:40386008"
                     /translation="MPSKNSINKPKGNITRQRKSHLASKKRAQRARQAVTSVTQATGS
                     SALVPLSASGGVVVNTVLSNKKARKLERNLKYAQLRREGSVGKGKRVDVEMSGEEIAQ
                     AKDKENVYRKALWSVVERSRVQGIPIMTPVGQGTTLGGGSF"
     gene            complement(<439209..>439898)
                     /locus_tag="C5L36_0E02120"
                     /db_xref="GeneID:40386009"
     mRNA            complement(<439209..>439898)
                     /locus_tag="C5L36_0E02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467766.1"
                     /db_xref="GeneID:40386009"
     CDS             complement(439209..439898)
                     /locus_tag="C5L36_0E02120"
                     /inference="similar to AA sequence:RefSeq:NP_012414.1"
                     /note="PKUD0E02120; similar to Saccharomyces cerevisiae
                     YJL121C (RPE1); ancestral locus Anc_1.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323626.1"
                     /db_xref="GeneID:40386009"
                     /translation="MVKSIIAPSLLAGDFAHLGCDCQRMFDNGSDWVHLDVMDGHFVP
                     NITMGPPVISCLRKAVPRKEDQPGKNFFDCHMMVSNPEQWVPEIAKAGGDQYTFHYES
                     TKDPVGLVKSIKAHGMKAACAVKPGTDVSVLYELAPMLDMALVMTVEPGFGGQSFMPD
                     MMQKVRDLRAKFPDLNIQVDGGLGKGTVEVAAEAGANVIVAGTSVFKAEDPSAMISYL
                     REEVEKNLKKD"
     gene            complement(<440296..>441393)
                     /locus_tag="C5L36_0E02130"
                     /db_xref="GeneID:40386010"
     mRNA            complement(<440296..>441393)
                     /locus_tag="C5L36_0E02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467767.1"
                     /db_xref="GeneID:40386010"
     CDS             complement(440296..441393)
                     /locus_tag="C5L36_0E02130"
                     /inference="similar to AA sequence:RefSeq:NP_012992.1"
                     /note="PKUD0E02130; similar to Saccharomyces cerevisiae
                     YKR066C (CCP1); ancestral locus Anc_1.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323627.1"
                     /db_xref="GeneID:40386010"
                     /translation="MSATAFSRSTLNIAKHTVRPSYNRRVLLASAVAVGTVAALAYSY
                     HNNNNNNNNNQGGSIIQKALFGFGASAVTTNVRDASPVKHDEEYYQKVYNAIAQKLID
                     EDDLDFGSYGPLLVRLAWHNSGSYDKNDKSEHKGGSYAGTMRFEKEQRDPENAGLKKG
                     IDYLQSIKVQFPDISHGDLFTLGGVVAIQELGGPKVPWRPGRTDLPVDVTPPYERLPA
                     ASQETGKYIRTVFADRLGFTDKEMVCLIGVGHALGKCHRENSGYEGPWTFSPTTVSNE
                     YFKLLLNEDWQIKQWDGKRQYEDKKTHSLMMLPADMALKFDDKFRKYVEEYAKDEEKC
                     MKDFSAAFSKLLERGIKFNVEPMVFKRLDEQ"
     gene            complement(<442445..>443020)
                     /locus_tag="C5L36_0E02140"
                     /db_xref="GeneID:40386011"
     mRNA            complement(<442445..>443020)
                     /locus_tag="C5L36_0E02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467768.1"
                     /db_xref="GeneID:40386011"
     CDS             complement(442445..443020)
                     /locus_tag="C5L36_0E02140"
                     /inference="similar to AA sequence:RefSeq:NP_011368.3"
                     /note="PKUD0E02140; similar to Saccharomyces cerevisiae
                     YGL147C (RPL9A); ancestral locus Anc_2.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323628.1"
                     /db_xref="GeneID:40386011"
                     /translation="MKYVQSAESINVPEGVSLTIKSRVVKVVGPRGELTKSLKHVDVA
                     FEKVNNKLIKLYVHNGDRKHVATLRTVKSLITNLIKGVTVGYKYKMRFVYAHFPINVN
                     IIEKNGTKFVEIRNFLGDKRVREVPIPEGVTCELSKNQKDELTVTGNSVEDVSQCCAD
                     VQQICRVRNKDIRKFLDGIYVSERGHVVEEL"
     gene            <443496..>444401
                     /locus_tag="C5L36_0E02160"
                     /db_xref="GeneID:40386012"
     mRNA            <443496..>444401
                     /locus_tag="C5L36_0E02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467769.1"
                     /db_xref="GeneID:40386012"
     CDS             443496..444401
                     /locus_tag="C5L36_0E02160"
                     /inference="similar to AA sequence:RefSeq:NP_010624.3"
                     /note="PKUD0E02160; similar to Saccharomyces cerevisiae
                     YDR337W (MRPS28); ancestral locus Anc_5.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323629.1"
                     /db_xref="GeneID:40386012"
                     /translation="MFASNIRSAVGTSLTAARAVSSVQVRSLATVQRVLSKSEKKLRK
                     TEKKKKNIAFKNSVEAKKEKVDPVLGKPNNMFIQRLKSEIEEPNVLIHGYEFNDVDKL
                     LYGAKQYRLEQLKQLNSTEDILQATEKEEQMKRDILFRILTLRNADNEEKQKKLRQLA
                     VSEFQRFEGDTGSSEVQAAVMTVEIYNLMDHIKKNPQDLLHIRKVRMLTQKRQRILRY
                     LKRDNAQKYFWTIEKLGLTDENVHMEFNMDKRYMDEFEIWPGRQMVKLNKRENEEIKK
                     KRRLEKQAIRKALNSHAASNDGVSA"
     gene            complement(<444529..>446115)
                     /locus_tag="C5L36_0E02170"
                     /db_xref="GeneID:40386013"
     mRNA            complement(<444529..>446115)
                     /locus_tag="C5L36_0E02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467770.1"
                     /db_xref="GeneID:40386013"
     CDS             complement(444529..446115)
                     /locus_tag="C5L36_0E02170"
                     /inference="similar to AA sequence:RefSeq:NP_010346.3"
                     /note="PKUD0E02170; similar to Saccharomyces cerevisiae
                     YDR061W; ancestral locus Anc_8.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323630.1"
                     /db_xref="GeneID:40386013"
                     /translation="MTKGLPLVKLLEAWFLRNTPVAAIGKQPMPVFSSPVSFILNPKQ
                     RLAIVGDTSKTDFLSVLANKYVAEPPHSRSYPASLKDPKFKTELLRFVNNGSWGHGAS
                     NSSGGFTHLSSRYEFFKDLEVDEIVENFIADRSYNSNIEYSKEKISKLIHNLNLVGLQ
                     GQFITTLSNGQFRRARIAKELYREPAILCIDDPFLGLDPFATNTVNDVLKKTSFDKNN
                     KTTIVLGFRVQDEVPKWVEHVVIVNQTGIVKQGTRDELLYDLERLQDDFHRKHNQLEN
                     KLRANFGQQRKPSNREVLQGNKSNSPIIEMKNTNISYKGKPIIKDLNWTVREGEKWHI
                     RGRNGSGKTTLLSLITLDHPQSWNRTIKVFGVERAPGKVNYFDTNKYIGFTSPELHAI
                     YPKDHTVFETISTGFVVGSYIRPRDNLTAEQVTKINHYLTLLDISQLKDEIFGDIPVS
                     KQKLVLLVRAIINDPRIVILDEALSAMVDEDVIKGKILIDNLDATCLVIGHVEEEVPK
                     CNKYILLNDAKRGHYEIGNV"
     gene            <446815..>448527
                     /locus_tag="C5L36_0E02180"
                     /db_xref="GeneID:40386014"
     mRNA            <446815..>448527
                     /locus_tag="C5L36_0E02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467771.1"
                     /db_xref="GeneID:40386014"
     CDS             446815..448527
                     /locus_tag="C5L36_0E02180"
                     /inference="similar to AA sequence:RefSeq:NP_010347.1"
                     /note="PKUD0E02180; similar to Saccharomyces cerevisiae
                     YDR062W (LCB2); ancestral locus Anc_8.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323631.1"
                     /db_xref="GeneID:40386014"
                     /translation="MPEVYDISELSTRVPDPPVSHLTIAEKAEMEFGALTNEKYLVSS
                     QYDPNRGLKGQILDEPPYYVVITTYLSYLFLIIVGHIKDFFGMKFTPKYYKALIGKNG
                     YPPWYSSFESFYPRRLKKRLDDCFARPIHGVPGRYVHCFNRVTPDYNDTFYYDGTSKP
                     CLNLSSYNYLGFAQSVGICTDDSIEAVKKYGVSSCGPRNIIGNTDLHTKTEQILAQFL
                     GKEDSVIFSMGWGTNAHLFTSLVNSKCLVISDTLNHASIRFGVRLSGAAVKVCPHNDM
                     EALEKILKESISQGQSKSHRPWKKILVCVEGLYSMEGTYCNLPELVRLRDKYKFYLFV
                     DEAHSIGAVGKRGRGICEYYGIDPNKIDLLMGTLTKSFGAAGGYVSGDKKIIDRLRLD
                     ITAQTYSETIPPAVLQQISTSLRIIAGELNGNEGQLRLQRITFNSRYLRLGLKRLGFI
                     VYGADDSPVVPLLLYNPAKMPAFSRMMLDRGIAVVIVGYPATDVISSRIRFCMSAALT
                     KEDIDDILAACADIGDKLNLKFSSGIAGGEKHPGDYKKGIRPRWTIQEVLATTADDCL
                     VEMY"
     gene            complement(<448840..>449484)
                     /locus_tag="C5L36_0E02190"
                     /db_xref="GeneID:40386015"
     mRNA            complement(<448840..>449484)
                     /locus_tag="C5L36_0E02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467772.1"
                     /db_xref="GeneID:40386015"
     CDS             complement(448840..449484)
                     /locus_tag="C5L36_0E02190"
                     /inference="similar to AA sequence:RefSeq:NP_011563.1"
                     /note="PKUD0E02190; similar to Saccharomyces cerevisiae
                     YGR049W (SCM4) and YLR356W (ATG33); ancestral locus
                     Anc_4.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323632.1"
                     /db_xref="GeneID:40386015"
                     /translation="MGKCLTIVKLIGIGSLGLSSAAFLVSNYKLVPDVLKVSSSSVET
                     LKNKASKLITVLRLQFWSLGSLSTFLFYQAFSHSPSYGKHPYLIYSALAFPIALAYNY
                     YFTFSDEQKLIADAEEKIIYKTETKLVKEAVQQEEENSPLDNSVYNDLGSKSPKFEEK
                     EVSVQVPHVSKVELSETTYKDILKSLSNSYNVTSAILGAGFLLASVGYFGDNLK"
     gene            complement(<449823..>451859)
                     /locus_tag="C5L36_0E02210"
                     /db_xref="GeneID:40386016"
     mRNA            complement(<449823..>451859)
                     /locus_tag="C5L36_0E02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467773.1"
                     /db_xref="GeneID:40386016"
     CDS             complement(449823..451859)
                     /locus_tag="C5L36_0E02210"
                     /note="PKUD0E02210; Pfam Domains: Asp(3.6e-71)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323633.1"
                     /db_xref="GeneID:40386016"
                     /translation="MLPLYILWTVLAATVTATPVQSTGYWALNTRKVRNSVHHKGLAK
                     RDASLSLSLVDEDTFYMADIEIGSGNSKVGVLVDTGSSDLWVVASNNTYCKPNTAGSL
                     SKGRQLLHIKDQFVHKIQHKSTNQIDCSEYGTFDPSKSSSFTSNFTDFSITYDDDTFA
                     RGTWGQDTVNIGSIEIRNMNLAVCDDTDNEQGVLGIGLAGLEVTAAGSSSNYEYENLP
                     LKLVNDGIINRAAYSVYLDDSSNSEILFGAIDHSKYQGDLVKLPIVNALYQSGVGKPV
                     QLAVTLNELSYMKNEEKASIGSGAAAALLDTGTTLSYFPDSVVNSLVQLFGMKYSTSL
                     SYYITECSIGNDASLNFNFQGLQLDVPLSSFLINLYTQDNQVSDKCAFGILSSSNENY
                     MTLGQSFLSHVYMVADLQGLEIALAKGNNGNSKNLDLIINEIPSAKQPANQSTYGSKF
                     STFNVIATPSISTVSSSSTLSSDSATSSSSLSSTASYTVSSSSTTSLSSTTSSSSNTS
                     LSSTTSSSSNTSLSSTTSSSSTASSSSTASSSSTTSSSSTISSSSTTSSTIAKTSSAT
                     SSTADTSYSASTTSSESNPSSSFPATSVHRTSVHSTNRTSSQTVNHSSPSQTSLSTSY
                     SSTLSAPPSSSATESSTGSPSPSVSSISSTSHNGGSKLTAHSLGGLALLICALM"
     gene            complement(<452172..>453512)
                     /locus_tag="C5L36_0E02220"
                     /db_xref="GeneID:40386017"
     mRNA            complement(<452172..>453512)
                     /locus_tag="C5L36_0E02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467774.1"
                     /db_xref="GeneID:40386017"
     CDS             complement(452172..453512)
                     /locus_tag="C5L36_0E02220"
                     /note="PKUD0E02220; Pfam Domains: Asp(4.4e-44)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323634.1"
                     /db_xref="GeneID:40386017"
                     /translation="MASLTPLFIALQLIKLVYASSNYFMLPLHQISGAYFAKLDIGTP
                     PTEFRVAVDTGSSDLWIHSQNDPACSLNIAGFSNCTFGVFNSSNSSTYTNLNQSFTAL
                     YQDTTFANGVYSTDDIGANGLPLGTFQFALVNDSSTPMGILGVSLPQLEASALNKGRH
                     QYNNFPLQLYENGIISYPAYSVYLNGNKGSNVLFGGIDHHKYKGQLVKMPLIKGIQPE
                     IKTLSVELNSLSITVGDSLSISPNSSTFLFQGSIPAIIDTGTTIATLPLSLYKQLALA
                     LGLQYDAVYDGYIGSCSSLEEKNIHFSFSGVLLSAPALNFVANLTENTCIYVASPSIV
                     PQLVLGQAFLENVYLVVDLQAKSLAMAQSNLHSDISDIQVLENGILSIPIVSDLVSIR
                     NTSSIPTPQHTSTSTTKPSTHLQTLVHKHSVANGAPNIFSIGSHWWLVAYIALY"
     gene            <454093..>454980
                     /locus_tag="C5L36_0E02230"
                     /db_xref="GeneID:40386018"
     mRNA            <454093..>454980
                     /locus_tag="C5L36_0E02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467775.1"
                     /db_xref="GeneID:40386018"
     CDS             454093..454980
                     /locus_tag="C5L36_0E02230"
                     /inference="similar to AA sequence:RefSeq:NP_010541.3"
                     /note="PKUD0E02230; similar to Saccharomyces cerevisiae
                     YDR255C (RMD5); ancestral locus Anc_8.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323635.1"
                     /db_xref="GeneID:40386018"
                     /translation="MYRQVDALRRSIDELAEAHVADAFLDNSEMLVRRLEGIHRRLSF
                     GEEVTVKEMDEIIDSYVVDTTESEKKAMRMFKHVQGRLEKPGVDLDLVCSSSTADKAL
                     LSGDTKRMVRAIAMEMLYIGEDRAALALAPECYHVANWFAQLQQRQQVATQTYGEGHA
                     RLLSGGHRGFYLVSHGLKTHPPLGRALLAGEIALGALVAHGRNGRHPKGDGLALLYAV
                     PSDELPVVEHPLLVCPVQRVETTSTVGERPYVLVCGHFIGEQALKRLVEGAYSGEIKC
                     PYCPSRGAYSEARPVCILP"
     gene            <455338..>455895
                     /locus_tag="C5L36_0E02240"
                     /db_xref="GeneID:40386019"
     mRNA            <455338..>455895
                     /locus_tag="C5L36_0E02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467776.1"
                     /db_xref="GeneID:40386019"
     CDS             455338..455895
                     /locus_tag="C5L36_0E02240"
                     /inference="similar to AA sequence:RefSeq:NP_013322.1"
                     /note="PKUD0E02240; similar to Saccharomyces cerevisiae
                     YLR221C (RSA3); ancestral locus Anc_8.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323636.1"
                     /db_xref="GeneID:40386019"
                     /translation="MSPLTVPKNNRRTRKKRRTQVSSSDSSSSSSSSSSSSESESESK
                     SNLNSNSRPNNHPNSNSNLSGEHSYNAPLSQASTETNIDSLQLHVPSSTRATPAAENL
                     STPRDVHVTRLRVAQLAKLDNDSSRGTPHRGTAVDSDEWLTAMLAEYGDDIDTLRTTA
                     KDFSTESVAIIAQLLRESQNVFEEV"
     gene            <456609..>458297
                     /locus_tag="C5L36_0E02250"
                     /db_xref="GeneID:40386020"
     mRNA            <456609..>458297
                     /locus_tag="C5L36_0E02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467777.1"
                     /db_xref="GeneID:40386020"
     CDS             456609..458297
                     /locus_tag="C5L36_0E02250"
                     /inference="similar to AA sequence:RefSeq:NP_013221.1"
                     /note="PKUD0E02250; similar to Saccharomyces cerevisiae
                     YLR120C (YPS1) and YDR144C (MKC7); ancestral locus
                     Anc_8.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323637.1"
                     /db_xref="GeneID:40386020"
                     /translation="MNTAALVTIFCTLTSSWAFPLPDGDNSDTNPGYFKLSARKIYGR
                     NLNDALQKRDNNGYLEVDLSNENTFYLTDIEIGTPSQKVGVLVDTGSSDLWVVQSNNT
                     YCESGTTGPLSKARADIIDWSLNTTDLQNHDNFIGKATSQSSNLIDCSQYGTFDPTDS
                     ETFQSNDTSFAITYADSTFAKGTWGRDDVVINGVNVTDLSLAVCDDADNAMGILGIGL
                     AGLETTYSGSSSLSSLFSSSDRYTYENLPLRLKSLGIIKHTCYSVYLDEADSKNANIL
                     FGAIDHSKYTGNIVALPIVNSLKSKNYDTAIQLDVTLNSVTLIDSKSKTEATLGNGAA
                     AALLDTGTTLTYVPTNLLKAIYNLVDAQYSQSIGYYVVKCNAVDNMTLDFNFQGFDIN
                     IPFSSFLVSLSTTSGSTSQYCMLGLQDSQSTTFTLGDNFLRNVYMIADYENMEIGLAV
                     ANHSASNEDIQVVSTGIPNANQPVSSLEYGKSVTTLVVQSTIVTSSIPSSQSLSTAQT
                     IPVSTTKDNKASDESSISTDARTVSSIPSSTHNYAARNEVGVMAGVFAVLAALL"
     gene            <459323..>461731
                     /locus_tag="C5L36_0E02260"
                     /db_xref="GeneID:40386021"
     mRNA            <459323..>461731
                     /locus_tag="C5L36_0E02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467778.1"
                     /db_xref="GeneID:40386021"
     CDS             459323..461731
                     /locus_tag="C5L36_0E02260"
                     /inference="similar to AA sequence:RefSeq:NP_015241.1"
                     /note="PKUD0E02260; similar to Saccharomyces cerevisiae
                     YPL084W (BRO1); ancestral locus Anc_8.560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323638.1"
                     /db_xref="GeneID:40386021"
                     /translation="MTTFVHFPLKTTDQVVWSTPLSSFLSSTFGRSFTSDLQPAFSRL
                     DELRTNIQHASFKDADIIIPQYIDYITQIDSLRLRLPLELVTIEFKWLDTLKEEEISQ
                     KSVSFEKASIMYNLACLHSYKGSVAASNIDWKLAVSSFAHASGIFEYMASHFLHSPAS
                     DLDVHASKLFSHLMSAQAQECFLWNYMHTAETKHSLVAKLAKGVSERYEKVIKYLNKG
                     VDLDCLNECKWKKEYFLAFAYFHDAQNYGSVPQIGYAITSASQGLDTCKELRKIKVDS
                     ILNDIGEELKKEITSKLKEWEKDNDLIYHHAVPDKINVPAIKKLEGAKSIDFEKQLME
                     NGGCRDLFDKIVPMEAHQSMSIYSEKQAQILRKLKEEINVANEEVVSVFEFSKIPSSI
                     IEIQNLLRSRNSTVEEEEREKEAGYPRVLAMAHEMETSSMSSDQFDMTEVNSKREEIK
                     ESLEKIDELLMKDDKNMLIKSLPINNELTKLRDEVSSTRRIMVEADLSDSKLSDLWSK
                     YEVEISVLRKGVSKLHEWLSSSNTDDLNKQISLLDLDDSSDNYDINTANELIENIYAN
                     KKSLELLVNERNSTLQDLTEAMHAEDISSVLINYRDASDEELEQVFLEQLSKYDAYRS
                     RINDLIDAQPNKIFDLKESLGSLLDLGIVKKKLEEKKRERGTVKSKINRLIDAYEAFK
                     LCTKGVGEAVNFYTKLQHRTSEILNRIQSIVNQRDSYISDSRSSIGSDPTGNLGGFGG
                     YTVNYPQQQQPPAYSTSSEQTPNIPPLPSKPAYTGNTHSSLPYSTPSVYDPNMYSQFG
                     QSWK"
     gene            <461878..>463722
                     /locus_tag="C5L36_0E02270"
                     /db_xref="GeneID:40386022"
     mRNA            <461878..>463722
                     /locus_tag="C5L36_0E02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467779.1"
                     /db_xref="GeneID:40386022"
     CDS             461878..463722
                     /locus_tag="C5L36_0E02270"
                     /inference="similar to AA sequence:RefSeq:NP_015295.1"
                     /note="PKUD0E02270; similar to Saccharomyces cerevisiae
                     YPL030W (TRM44); ancestral locus Anc_8.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323639.1"
                     /db_xref="GeneID:40386022"
                     /translation="MPFKVFHPFDVMNKSITLLSRRFHSYTRMAEETGNALKQQTVIK
                     SQLQKHDAWKSGPRQNTDLTLKPDEIPNIRGEPSPLGGSWCGIFENKVEFKSEHFVTA
                     MSNLIKSPNINSTVILRSDILRRNVFNDDDEQTETFVAANINDEPLLNEPLDNVLTRH
                     IDDTEIKYVPINSDFKPINEFVRRMIPRNPSKDYIINQTCLLLRNRKENSYLIIYTPH
                     ISDPEEIPFYLPPAKSIGILFNEKTSKLSIYYLPFDSQDKNIFKDMAPSERPIRIAYR
                     LLGTAKKHSNGVMNGYSKRVNHDQVVPKQIFQDRYILLKQKYAKTLVDNWCESTDPRK
                     HVFEDIAIAAFLIEFWNLIYPDKTSFQFRDLGCGNGVLVYILIMEGYMGEGIDARARK
                     SWDSFPKEVQKQLREQVIVPSVLLRPHPMQFAQNPYISDNGQVWKVPINDQSSHQSPT
                     KAGSKNVQLVECYSSAELLSDARINVTEFPLNTFIIGNHSDELSCWIPLLGYPFIVIP
                     CCSHSLSGDKTRYPVIKGLNGRTTPQEGNSTYQGLVDHVEYLAMMSGWKVEREMLRIP
                     STRNAAVIGYQRSEFVPKSIYEIIAMEGGATKWVENTMALMKKKPRNH"
     gene            complement(<463871..>466021)
                     /locus_tag="C5L36_0E02280"
                     /db_xref="GeneID:40386023"
     mRNA            complement(<463871..>466021)
                     /locus_tag="C5L36_0E02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467780.1"
                     /db_xref="GeneID:40386023"
     CDS             complement(463871..466021)
                     /locus_tag="C5L36_0E02280"
                     /inference="similar to AA sequence:RefSeq:NP_015282.1"
                     /note="PKUD0E02280; similar to Saccharomyces cerevisiae
                     YPL043W (NOP4); ancestral locus Anc_8.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323640.1"
                     /db_xref="GeneID:40386023"
                     /translation="MSTTEEKVQDDSLDRKTLFVRSIPFDITNEQLSDFFSQFAPVKH
                     AVIVNDNENKSRGFGFVSFTSDDDTLIALQESKKKKLNDRLLRVDIAKRRERKKDDSK
                     SSTPKKNNVAPEKIALQKTARLIVRNLPWSVKNSDELANIFKMYGPVKEAKIPKKPDG
                     KMCGFGFVTMTKHANAEKAVKESSNLKINGREVAVDFAVSKSHWTVLKDEQPEEPVEA
                     SAEEDDSDRDSDVDGAVGTEEEEDAEEDAENDDDSDEEVHDEDVKLLELEDEEPKERK
                     KRNRQEKFCVFVRNLPYDVTEDALKAHFEKLGEVKYALPVIDKETGLPKGTAFVAFYK
                     NNAYEECLLNAPSVSANSILLPDDVSPFYVYEGRIMQIAPALDRDSAARMAEKSAESR
                     KELLGRTPKESDKRNLYLLNEGRIGPNSKLAALLSKGDLDIRERSFNLRVEQLKKNPT
                     LHLSMTRLAIRNLPRAMNDKSFKQLGRKAIVEFAKEVKEGKRHPLSKEEIDRSTKHKH
                     FVLEKLGITDDEEKKRVSKHGVVTQAKVINEVKGSGEYGRSRGYGFLEFRDHKHALMA
                     LRWLNAHEVTKDEITNGLTEEQTKLALKEKTINRRRLVVEFAIENASVVKRRYDQISR
                     SRTEGKTLKRKRENGEDTKEEETSKKKSGKDNKRQKVNGKNGKRGNLNKGSHVGKPRS
                     IAEGRSENDQKLSALSEDAKRMIGKRRRQKKQKK"
     gene            <466277..>468001
                     /locus_tag="C5L36_0E02290"
                     /db_xref="GeneID:40386024"
     mRNA            <466277..>468001
                     /locus_tag="C5L36_0E02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467781.1"
                     /db_xref="GeneID:40386024"
     CDS             466277..468001
                     /locus_tag="C5L36_0E02290"
                     /inference="similar to AA sequence:RefSeq:NP_010540.3"
                     /note="PKUD0E02290; similar to Saccharomyces cerevisiae
                     YDR254W (CHL4); ancestral locus Anc_8.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323641.1"
                     /db_xref="GeneID:40386024"
                     /translation="MALKRRKLNNSGILSNSYIPPLRATQIDRELQKLPPDSLYNLTH
                     LWLSIPSTQPVPNAYLRRKGYTKSSLADTFLTKLKSLKNFKNKTQLKKKLINTILVEF
                     YPNGLNTLQLAQIDVQLLVDRPTSSSWISSTVKIVNGSSDIPSNEEDISNDERNDKIS
                     KLTNYTFSLDSQLFLDKFIANLANLYLTHVYISRHPYFPLIMVRVQMYDYTYHRSSAT
                     HSEVFQDLTNRALFKSEKMKFNEDLDRILNNKNNRTPNQEINTNLQRQVRLQIQPQVR
                     SHKPFYILLPISSPHVIHSVFPPDDVCSRLILQTLETTLANDDFYKVNRPCEAKTNKL
                     DTNTSIITSRKIRIFRDADIPKPIKNLNTMFLLRGISRFGSSLGAWAPYAEGIVDMDI
                     FENELKHLIVQPEEMIELDGHSDDDLQGRPKAEDRKQRKIISALKFKGTLKRIKPKKL
                     YKCNGNHGDSDDYNDASIDLEEYEQNNENFFESEQKRLQNRYASAVPINESKFEIKAQ
                     LEKKKTQGNEKDVFSFTMELTGSDVYGGLHELADQGVIDPCKIPDWLTGEVPMGGTVV
                     NGKLRTKR"
     gene            complement(<468762..>469397)
                     /locus_tag="C5L36_0E02300"
                     /db_xref="GeneID:40386025"
     mRNA            complement(<468762..>469397)
                     /locus_tag="C5L36_0E02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467782.1"
                     /db_xref="GeneID:40386025"
     CDS             complement(468762..469397)
                     /locus_tag="C5L36_0E02300"
                     /note="PKUD0E02300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323642.1"
                     /db_xref="GeneID:40386025"
                     /translation="MMKPMDLKKLRPSCLAYLTRMQGRSEQMFDCSLYSNFESESSDA
                     GYGCPEEVMQLEHSYNDTYSLTCNTKLSIDEVEMSDYTLINSTLDSSDISLLDGNISL
                     NQSINRNKRKMTHLEGTPTKRRKVTALSIKFTNFISSDSDPLEGQEVELVVQKTPQLM
                     SEPHHYFQQFLAEPCCTLPSPHKLQDTPQLRTRQINTHLCRLDFDPLFSDE"
     gene            <469874..>471424
                     /locus_tag="C5L36_0E02310"
                     /db_xref="GeneID:40386026"
     mRNA            <469874..>471424
                     /locus_tag="C5L36_0E02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467783.1"
                     /db_xref="GeneID:40386026"
     CDS             469874..471424
                     /locus_tag="C5L36_0E02310"
                     /note="PKUD0E02310; Pfam Domains: Abhydrolase_1(1.9e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323643.1"
                     /db_xref="GeneID:40386026"
                     /translation="MQRFTLSQLSRRQVATARLVKQVIRSISSTSNNLKPRPTNVRNA
                     SATSVNDSLKNRPPSVSQMSFPCLEKLEERTRELEENGPEPSYSKITRENVEIYQSKD
                     PIFLDYGGYLPQFEIAYETWGTLNDDKTNAVLLHTGLSASSHAHSTLKNPKKGWWEGF
                     IGPGKYLDTNKYFVICTNVIGGCFGSTGPQSTDPLTGQRYATTFPILSVNDMVRAQNR
                     LVKEHFQIEKLHASMGSSMGGMQCLAYASEFPDQVNKIISISGCARSHPYSIAMRHCQ
                     RQVLMTDPNWNKGHYYGQLIPHTGMKLAREIATITYRSGPEWEQRFGVERMDPSKKPA
                     LCPDFLIETYLDHAGEKWYSEFDPNSFLYISKAMDLFDLGARNRNKALKSRLQAETIY
                     NGEYIPDSELEYKPSEICEFTQPIERSRTRRFTPEESKQDLLQGLSRLSNKDVLVIGV
                     ESDILFPAWQQREIVEMLRQGGQLNGGSGKNIKHVELSEADSFYGHDTFLLALDHIGV
                     PVSSFLDG"
     gene            <471623..>473149
                     /locus_tag="C5L36_0E02320"
                     /db_xref="GeneID:40386027"
     mRNA            <471623..>473149
                     /locus_tag="C5L36_0E02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467784.1"
                     /db_xref="GeneID:40386027"
     CDS             471623..473149
                     /locus_tag="C5L36_0E02320"
                     /note="PKUD0E02320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323644.1"
                     /db_xref="GeneID:40386027"
                     /translation="MMKKKKVLKFLRFFELKWYHYLLILRMNWEQMSQPAKKSKAEGY
                     QGFKLSKSSKNEIETINLDEPIVTKEWFFQNYIKPRKPVLIKYNANSEKFRLKTENFR
                     PDTLIKTLGDEGDLLQVEELSKGGFGSGHDRLKLSLGDFLGRIKNGESLYLTTQYEEN
                     DPKIAENNTEEGEEDDDDHDDNDDDEGEGHGYAGFEKIDENASDVDEFGDVDDFEDDY
                     KDEFADELLGDDSNDINIIYQPPLTNLLDDKLESLPPHATEITESLVPQQINLWCGRT
                     PAETPQLEIGLNDAGSVKNVNNGLSQANATSTGLHHDHADNLYILVQGKKRFTLFSPD
                     FAYYLYTTGDVRDIYHTGVIDYVVNEKAKSWINVRADGGCLDSKCEIGGDQKTEQSNG
                     ERQAPPSFCRIPPSLLHLNELDEPKRVALEKYALECFPLFVPYKDQSIQITLEDGDLL
                     YLPAGWFHEVTSYGDKTNDNIHVALNYWFVPPDGESVNSPYTDPIWEEDFRKWKDLYL
                     "
     gene            <473326..>474789
                     /locus_tag="C5L36_0E02330"
                     /db_xref="GeneID:40386028"
     mRNA            <473326..>474789
                     /locus_tag="C5L36_0E02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467785.1"
                     /db_xref="GeneID:40386028"
     CDS             473326..474789
                     /locus_tag="C5L36_0E02330"
                     /inference="similar to AA sequence:RefSeq:NP_014917.3"
                     /note="PKUD0E02330; similar to Saccharomyces cerevisiae
                     YOR274W (MOD5); ancestral locus Anc_8.725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323645.1"
                     /db_xref="GeneID:40386028"
                     /translation="MNSLFRRLKFRIQSTMSIPRGNKSEKQVISIIGTTGVGKSQLSI
                     ELARRFNGEIINADSMQMYHGLDQITNKHPTEERLGVPHHVMDHVKWEEQYYIHRFKR
                     ECENAMKKCWDDGKIPILVGGTHYYLQSVLFDNKTIGSNDEVEVDASKLTKEQKEILN
                     GDSNIIYEKLKEMDPVISQKFHPNDTRRIKRALEVCYVFNEPASSVYGRQRETNDSNG
                     TSLKYDTLFFWVYSKLPQLDTRLDSRVDKMMYNGGLTELGELYKFYQKEILVGNETVE
                     KMDSGVWQVIGFKEFLPYLNKHGPDTLIAIDSAVDTKERNEAIDKLLMEKEFAQCCDE
                     MKLKTRRYARKQIKWIKNLLGPQLKEEEANGFVKFGKIYVLDATNLSLWNEGVGKRGK
                     QICEEFLRLGYVKQFVDIPDSLNDEKLIIEKSPNKAENWVHHVCEICTDRETGKPLVY
                     VGDQWEIHLKSKKHRHNLNRGKRKREYEEWLKKKNVK"
     gene            complement(<474976..>476862)
                     /locus_tag="C5L36_0E02340"
                     /db_xref="GeneID:40386029"
     mRNA            complement(<474976..>476862)
                     /locus_tag="C5L36_0E02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467786.1"
                     /db_xref="GeneID:40386029"
     CDS             complement(474976..476862)
                     /locus_tag="C5L36_0E02340"
                     /note="PKUD0E02340; Pfam Domains:
                     Xan_ur_permease(4.2e-67)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323646.1"
                     /db_xref="GeneID:40386029"
                     /translation="MNLFTKAEKNASVTTDTQSIDGNLSAEIQDESTFSFNPKEHALK
                     LFKKCTTKEGIFGDYDYAYLFTPTLPFLTQKKTQPFFGINDDIPILLGLLLGLQHALS
                     MLAGLTTPAILISSFANLSQLQTQYLVSASLITSGILSTIQITRFHIYRTPYYIGTGL
                     LSVVGVSFATISIVSKGFPMMYKTGFCPISSDGTKLPCPDGYGAVIGTSCVCGLLEIA
                     CSFIPAKALQKIFPPLVTGPVVLLIGISLVETGFEDLAGGSGCIGSTCAKGLPWGSAQ
                     FVGLGFLVYVVIIISEKWGSPIMKSCAVIVGLLVGCIVAAACGYFTHENIDIAPAVTF
                     VWVHTFKLSVYGPMVLPFLACYIVLMMEAIGDITATSDVSRLEIEGLVYDSRIQGGVL
                     ADGLNGILAGLFTLPPMSTFAQNNGVIAITKCSSRTVGYWCCFYIIIMGIFSKFAAAL
                     VSIPSPVLGGMTTFLFTSVTVSGLKIISTTPFTRRDRFVLTASIMFGLGSTLVPTWFD
                     YVFTYSGDNHALQGFFNAIILVMETGFAVTGFVGVILNLLIPQEEDETDIIDEVDEEM
                     KLFHQEHPHPIREAIETLSPFTSRTSRISRPSKRLEIHDGVEFSDDANYQHEVQPLPK
                     KDTP"
     gene            complement(<478346..>478657)
                     /locus_tag="C5L36_0E02350"
                     /db_xref="GeneID:40386030"
     mRNA            complement(<478346..>478657)
                     /locus_tag="C5L36_0E02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467787.1"
                     /db_xref="GeneID:40386030"
     CDS             complement(478346..478657)
                     /locus_tag="C5L36_0E02350"
                     /inference="similar to AA sequence:RefSeq:NP_015279.1"
                     /note="PKUD0E02350; similar to Saccharomyces cerevisiae
                     YPL046C (ELC1); ancestral locus Anc_8.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323647.1"
                     /db_xref="GeneID:40386030"
                     /translation="MDNEDYDTGPAYVRLVSNDGHTFVVSKDVASVSGTLQNMLSDTF
                     EEGQTNTIKLHDIDGTVLEKVVEYLYYNRKWADSVDVPEFAVPTEMALELLVAADFLH
                     V"
     gene            <478975..>481455
                     /locus_tag="C5L36_0E02360"
                     /db_xref="GeneID:40386031"
     mRNA            <478975..>481455
                     /locus_tag="C5L36_0E02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467788.1"
                     /db_xref="GeneID:40386031"
     CDS             478975..481455
                     /locus_tag="C5L36_0E02360"
                     /inference="similar to AA sequence:RefSeq:NP_015280.1"
                     /note="PKUD0E02360; similar to Saccharomyces cerevisiae
                     YPL045W (VPS16); ancestral locus Anc_8.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323648.1"
                     /db_xref="GeneID:40386031"
                     /translation="MSLHPSLSWELIDTVFYRSRPCYESLNWPFDNFNLKDYMVSIGP
                     FASIYALYPKSAVVNLQLTDVNDCITVLNGSGMEIFRINWNFTLNQIVKVGFTRDSKL
                     IMVLKTGICRLYYNYQGDFNEYDLKLGTIKDARFSLNGDFAVQTHSNKFAYIPNIQDP
                     SPVIFQQLETEDVEPYHITTWTFTASKGPSETAATHGEFQDSVRFFIFTTTGISILTS
                     TSTEPILLNHAFLQSVHLVSISPNQNFTALYAANSIYILDGEFNDLLIQHENVSNVSD
                     LRWCSNDVVVYTCNNSLNVLGPTLETLKFYTSGTPYLHAEIDGLYYLTNDGLNFFSRV
                     PNITEETFKIGSSSPSSVLLDSIEYLDRRSPKANDLLEVIMDDLVLAVDGCIRAASEE
                     FDVYWQKNLLRAAAFGKVNLDLYDSTEFVQTCNYLRILNIIRAPDKGIFMTYNQLQEF
                     GIEKLIDVLLLRQLHYLCLKICDFLDLPNFKIMTDWASCKLKYSTNSSDHELLSLIVT
                     KLEKEKIDWTSLSYVAHNEGRTTLAKNFLTYEPSTSKKVRFLLDVGDGNYDELEYALT
                     ISDEDSDADSILLILLQLHGTLTNVEFFKIINDKPSAIGVLKSYFYQFDDTMLENFMF
                     QDDDIIGQILLENNMAKKTVLMNRSKYTQFLQSPTNNFNKVEQVQLDLRNTFANIVAG
                     EPIIKTLEKIIVVDLKKAQNVASKLNVTSRQFAMCVLQTLAPIAAKHPELYDFANSKH
                     GKVLKFETYFRELLKRGEKRQAGLYLKSCKDMASREKIKAYVQCGMWKEAVQEAAYRK
                     DTDILTQMRDSRTGWESKLASEELQRLA"
     gene            complement(<481452..>482876)
                     /locus_tag="C5L36_0E02370"
                     /db_xref="GeneID:40386032"
     mRNA            complement(<481452..>482876)
                     /locus_tag="C5L36_0E02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467789.1"
                     /db_xref="GeneID:40386032"
     CDS             complement(481452..482876)
                     /locus_tag="C5L36_0E02370"
                     /inference="similar to AA sequence:RefSeq:NP_013938.1"
                     /note="PKUD0E02370; similar to Saccharomyces cerevisiae
                     YMR211W (DML1); ancestral locus Anc_8.724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323649.1"
                     /db_xref="GeneID:40386032"
                     /translation="MMKETITLSYSQIANQLVTHFNNLQDDRFHENPDSITNLAHILP
                     KATKGSKFISNLYPRSILFDYSNGTGALDPFIYFQENPMNSIDMKDVQTIQTTPTLDL
                     NHYQNNLNKGKPTVGLDNERTQFWSDFAKVTYKPTCVIKHPSYVYDPETSKGVDKNTH
                     SQKFDGHQLGVDTFQDIEAFHDSIDDQVRKMFEESNNVNAVNAVVELDSAWSGVCFES
                     LKHLIDDQLGGKGSKVMLWSLQRDYKYVREMTITGKLDRIQKLTDLGNLDVGGIASLN
                     LDFPSTLPIVNPWAKTSVLSIPFDFFNNIKDVDIGEVLYKLTDGGQQKFINDVRTLWN
                     DEVLHLGGGLFTNKPDEDAYTFAKSVVTSQSCIEDIKGFEDFDALVAKSTPRLYLQTY
                     KSRHDIKYTDSMPSFFQNADIPACSLGVTSSLRGDFKTMHDFVSKYCRSDVREELKND
                     LENLVESYTHGFEYTDGEDEDDVY"
     gene            <483191..>484570
                     /locus_tag="C5L36_0E02380"
                     /db_xref="GeneID:40386033"
     mRNA            <483191..>484570
                     /locus_tag="C5L36_0E02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467790.1"
                     /db_xref="GeneID:40386033"
     CDS             483191..484570
                     /locus_tag="C5L36_0E02380"
                     /inference="similar to AA sequence:RefSeq:NP_012841.1"
                     /note="PKUD0E02380; similar to Saccharomyces cerevisiae
                     YKL082C (RRP14); ancestral locus Anc_2.636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323650.1"
                     /db_xref="GeneID:40386033"
                     /translation="MGNSLEERLQEHSNAFDGLLSLIPAKYYYDEETSNQWQQKRKSK
                     EERQENKRQKLNPENNKNVTAKDVLTEAEKTAKPVVLPGEKFKKHQEMMKRQKEVHEA
                     DSGDDVVAPGSEELENSSDEEENADKGDGDEAIIQDSVTIVFDDNGEESVNGEFKKAQ
                     IQEKQKKQKGKPELSQEEREARERKHKELKAKLQAKIQSMREKRKAPGTKVAGAATSR
                     QQILEERRRKAELKKDLKKKGIEEDDDESSSDDDDEEEEESDANQEKPGSNVMFGNIE
                     FMDGERVSSDLTSTRKIGKKKGPANKDIKGHLKILEREKEKVKDMDADARKKLEDKQK
                     WQKALASVQGVKVKDDERLLKKALKRKEAVKRKSEREWKDRIQIVADEKKMKADRREE
                     NLRIRKENRGKDRKHQVKQLPSYKRNRGSKKLAGSGAKRAGFEGGIRSKGKGSTGGKS
                     PGKGRGGKK"
     gene            <485035..>487185
                     /locus_tag="C5L36_0E02390"
                     /db_xref="GeneID:40386034"
     mRNA            <485035..>487185
                     /locus_tag="C5L36_0E02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467791.1"
                     /db_xref="GeneID:40386034"
     CDS             485035..487185
                     /locus_tag="C5L36_0E02390"
                     /inference="similar to AA sequence:RefSeq:NP_012818.1"
                     /note="PKUD0E02390; similar to Saccharomyces cerevisiae
                     YKL104C (GFA1) and YMR085W (YMR085W); ancestral locus
                     Anc_2.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323651.1"
                     /db_xref="GeneID:40386034"
                     /translation="MRWIDTNKFTNMNNANQMFLFLCYYSGIFGYANYNIARTRGHII
                     NNLVDGLTKLEYRGYDSAGIGIDGENDWTEDSPIREIQLFKQVGKVSNLKEEIDSHHP
                     DVSEVFYNHVGIAHTRWATHGGVTQNNCHPHSSDKLTQFAVVHNGIITNYRELKQFLK
                     NEGETFSTDTDTEIIAKLFKYYYDKDPELEFYQLCKEVLYQLQGSYGLMVKSVHYPNE
                     IIATRKGSPLLIGVKTEQKLKVDFVDVEFINDPTDEQSEGTTLLPNKSRYGSSLRKSE
                     SRAILPDHNMPIEFFVSSDASSVIEHTKKVLFLEDDDIAHINNGELHIHRARQSEGMS
                     TTRPVHTLEMQLAEIMRGGYDHFMLKEISEQPDSTFNTMRGRLDFKNKNIILGGIKPY
                     LSSIRRSRRFQMIACGTSYHSCLAVRALFEELIGVPVSVDLASDFLDRQPPVFRDDTC
                     IFVSQSGETADSMQVLKYCRAAGCLTVGVVNSVGSSISRETDCGVHINAGPEISVAST
                     KAYSSQFIALVMIALQISNNVIDNKERHVEIINGLEEIPRLIAKVLDKKDEIKEISLK
                     HLHGKDSMLVCGRGYQYASALEGALKIKEISYIHAEGIQAGELKHGTLALIDENMPVV
                     AFATQDSFSPKVNSAVQQITARNGRPIIVMTEGDKMIDRSKTAACIEVPKTVDCLQGL
                     VNIIPLQLMSYYLSIAAGHNPDRPRNLAKSVTVE"
     gene            <487597..>490230
                     /locus_tag="C5L36_0E02400"
                     /db_xref="GeneID:40386035"
     mRNA            <487597..>490230
                     /locus_tag="C5L36_0E02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467792.1"
                     /db_xref="GeneID:40386035"
     CDS             487597..490230
                     /locus_tag="C5L36_0E02400"
                     /note="PKUD0E02400; Pfam Domains: Peptidase_M1(4.8e-152)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323652.1"
                     /db_xref="GeneID:40386035"
                     /translation="MFPFLYKSFSSGLRNRINLRAMCNTVTKRGFPDTSLHEQLPRNV
                     LPTNYDVKCYNIDQVKNVFKGRAIIDLDVLEKTKSITLNQKFLNFDKVVVKGRDASQE
                     VSEITKNDEKETVEFKLKNEIEPSEKCIQLVIDFNGLIRTDMAGFYTSNYKNDKGETK
                     YILTTQFESTDARSAFPCYDEPNCKATFRISIEVSKELTVLSNMPLEKETETDSEKKL
                     CIFAKTPKMSTYLVAWAIGQFEYVESSTAREYNGARLPIRVYTIPGQSENGRYALETA
                     QNAVDYLSTVFDIDYPLPKLDLLAVPQFGANAMENWGLVTFRATALLFDPVKSSIEYK
                     VKVSYVVSHEVAHSWFGNYCTMNWWSDLWLNESFATYIAWLCVDHKHPEWEVFNSFVS
                     SSMQSALDLDSLKNSHPVEVQVYHANEIDEIFDAISYLKGGSVIRMVAESIGIELFLK
                     GVSNYLKKYPFGNAKSDDLWDAISEVSNQNITELVEPWIRAIGFPSLHVSKEGDKIKI
                     EQKRFLTEGITEEDDQITWWIPNVEGMNTKEVKIDDDDFLKLNKNTTGFYRVFYSEEL
                     FDNIVKNLDKLTAKDKIGLVADTGAGARAGLVATSQFLELISQLKNENDVAVWSQIID
                     RLGALRNSFFSDEEISSKLLNFSKDLYKSKFEELINTKNLDFNQQRLASLIFEQAGIC
                     GLDSAVQKASQLFKANDIKPHFKQAIYRTLLANESTATEEVFNTIIKDVKEPNTIDSR
                     EVALRALGSIKNSKSFLSNILELFFDGTVPEMDYQFLATPLAANFSTKVEFWSYFKMN
                     YPKFRGDVSMWTLDRVIKNFLPKLVSDELATDIEKFFSDKDNAGYEKGLKQSLDSIHN
                     DCAWSRRATEDVSRWFIKHGY"
     gene            <490943..>493405
                     /locus_tag="C5L36_0E02410"
                     /db_xref="GeneID:40386036"
     mRNA            <490943..>493405
                     /locus_tag="C5L36_0E02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467793.1"
                     /db_xref="GeneID:40386036"
     CDS             490943..493405
                     /locus_tag="C5L36_0E02410"
                     /note="PKUD0E02410; Pfam Domains: Asp(9.4e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323653.1"
                     /db_xref="GeneID:40386036"
                     /translation="MAVSEESITEATMLLVIQLITSLLTLATASPIYRRETHSAKVEK
                     PGLLQQELVYGPDFIAVDVGIGSNNQSLLLKLDFNTADIWVNSDLNDFCLAYYSIPNF
                     VNGTENAAMWNSFNENLRGNFTNQINEFHNEKINALETIAPTATSKLSSQLNKIQTEF
                     QSLLSEQHVSVTKEISNFLGTASLPTDSVIETFLSGVHSAAENLGKEITSNAYNFERE
                     ATSMGELLGVKVTTVSDHVLTLVTGPAQDFASEVTSKGGEFATKVTSEGGEFATKVTS
                     EGGEFATKVTSEGGEFATKVTSEGGEFATKVTSEGGEFATKVTSEGGEFATKVTSEGG
                     EFATKVTSEGGEFATKVTSEFGDVTSDVVSGWNKFTTDITSKGGEFATKVTSGYGDVT
                     SNVVSGWDKFTSNFVGIFKKASPTTRSSVAHTSTYNFIPQETQISNGSVIFDNSTIGI
                     DDFLYQVSHDCSLFGVFNDSSSNSFQSSSEIFFSNDSYGAFGHLGNDTIHMGGVSVDN
                     VTFGVADSSLSNIGIVGVGKSNRNSSFKSFPEILVDRGIINKALYSIDFNYHAPSILF
                     GAIDYAKFGGNITLLPLLNETEGAIAVTLSGLGITSFDNETAEFVQGKAPAILDPTSN
                     SVLFPREVLSSFVSSLNKTFDVSYNSSFGRYVLHRDDDVYIDDYALNFDFQGYNFSVD
                     LDNFVIPVLEDETIFINGSTLSNGASANSSFYFSKFDEPYPVDDIPVHVNNASFIDEK
                     TFILNIIESDDGSVVLGLDLLDSTVLVIDLESLQVGFTRSHSSDSQIVVIENKIPFSS
                     KAPKYSDYYGSNNVTSLTAVHV"
     gene            496896..496987
                     /locus_tag="C5L36_0Etrna10K"
                     /db_xref="GeneID:40386397"
     tRNA            join(496896..496933,496951..496987)
                     /locus_tag="C5L36_0Etrna10K"
                     /product="tRNA-Lys"
                     /note="PKUD0Etrna10K; codon recognized: AAA"
                     /db_xref="GeneID:40386397"
     gene            complement(<497103..>498650)
                     /locus_tag="C5L36_0E02420"
                     /db_xref="GeneID:40386037"
     mRNA            complement(<497103..>498650)
                     /locus_tag="C5L36_0E02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467794.1"
                     /db_xref="GeneID:40386037"
     CDS             complement(497103..498650)
                     /locus_tag="C5L36_0E02420"
                     /inference="similar to AA sequence:RefSeq:NP_010409.3"
                     /note="PKUD0E02420; similar to Saccharomyces cerevisiae
                     YDR124W; ancestral locus Anc_8.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323654.1"
                     /db_xref="GeneID:40386037"
                     /translation="MTSEIDHDIENVKNLARQLSDKYNVSFIGFFQNANRTFERMISA
                     GIETTITPNGSFESFALNNITNSSDFQDLFSFLINPSSKTSSPKQFCSNASNSWISRS
                     EDPFPKDIYKMVNINPHHRLDVKNYLYTCLEEFQQIPCKLLSKAWIKIVEPKKQAKYP
                     YKSGDSSKPYWWPEDCIHREPDHLKKDERINLLINILRIFKHKKSELIYAASLIPGLR
                     QGNITTDIGNHFGERKMSLLNDMFQLANAENDSNIKSLRVIKPGKKYSSVFYKKNNMK
                     SLGTSSDYSRTHNETPKRKYGSKSSNNCETPLSMAVDPQTKLAPYPHPLNNTDNEFGY
                     HDLTEYMITSRHDDIKNIDLQSSAGLASPFIPDSSTKVKYPINTHVTPPKYFNIGDKS
                     NEVNIDTQFFNDNTTFNITKNIKTKPLTPINPFKIYNQQVSPPPTGTFSTPRNTNALG
                     TLNQSAMNSLNQKLHYITNTSHLLESKLEGEKEIPVSRKIRTFKIVHDKLSRGGCDHD
                     ETDVEIE"
     gene            <499159..>500403
                     /locus_tag="C5L36_0E02430"
                     /db_xref="GeneID:40386038"
     mRNA            <499159..>500403
                     /locus_tag="C5L36_0E02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467795.1"
                     /db_xref="GeneID:40386038"
     CDS             499159..500403
                     /locus_tag="C5L36_0E02430"
                     /inference="similar to AA sequence:RefSeq:NP_013198.1"
                     /note="PKUD0E02430; similar to Saccharomyces cerevisiae
                     YLR097C (HRT3); ancestral locus Anc_8.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323655.1"
                     /db_xref="GeneID:40386038"
                     /translation="MCRRTNYFSKLSPALDGSALTMSQVDIERLENELKILTVKEINE
                     HPTKSREELALEFFQVASYKESVGQLSEASDYYWKAFKLDDKVDNKYRDILFSARRER
                     EAEGKNSHEKSTVKVEPLKLNKGQLNKLLDSYAKCKFIAEDEEKPVFFERLPYEVLQH
                     IIEVLIIRDTPSWINFSVVCKRLAYMGFRDKNVWSLLSRIVYERQNYRDNDEERFKSL
                     IRSQWGNNYYKMLNERPYLKYRGVYISKVTYMKEGARSENSNSWTLPYKMVSYFRYYR
                     FYADGTCLKIITILEPKKVIPKLHKGYTVDEDAELMRENETNQENTVESFNKRSWLRI
                     FAGRYTISLQGDVETNCDGPVEKYRFIDKFKIVNSGQHHRHNKLEWVDLGYYDTVNER
                     HSSLNRENEKDFMFSRVKSYGY"
     gene            <501090..>502796
                     /locus_tag="C5L36_0E02440"
                     /db_xref="GeneID:40386039"
     mRNA            <501090..>502796
                     /locus_tag="C5L36_0E02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467796.1"
                     /db_xref="GeneID:40386039"
     CDS             501090..502796
                     /locus_tag="C5L36_0E02440"
                     /inference="similar to AA sequence:RefSeq:NP_012297.3"
                     /note="PKUD0E02440; similar to Saccharomyces cerevisiae
                     YIR031C (DAL7)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323656.1"
                     /db_xref="GeneID:40386039"
                     /translation="MTKPAELYCTSLEGVQVVGEVSDKPLLSEATPRDILTIDALKFV
                     VLLHRAFNGTRKQLLANRQDVQKRLDAGESLTFLKETEYIRNDPNWRCATNHPKLMCR
                     KVEITGPPDAKMIINAFNTNVHTYMTDFEDSCAPTWSNMLYGQVNLYDAIRDKIDFTN
                     DKTGKRYKINREGRRVPVMIVRPRGWHMVDQHILVDGEPISASILDFGLFFYHNAKYL
                     ISQGLGPFFYLPKMEHWKEAKLWNDIFCVAQDCLEIPRGTIKATVLIETLPISYQLDE
                     VLYALKDHSSGLNCGRWDYMFSTIKRLRNQKDKILPDRQQVTMTVPFMTNYVKQLIKV
                     CHKRGVHAMGGMAAFIPIKNDEEANKVALEAVRKDKLREVLAGHDGTWIAHPGLLDTA
                     LSVFEEHMPTPNQLYKLKDDVSVTESDLVDTNIEGGQITMKGLNANIYIGLNYMESWL
                     RGLGCVPINHLMEDAATAEVSRLQLWSWCKHQVKMNDTGKTITPDFVCQLIDEEVARC
                     SHKEGNKYELAAQCLKDEISGKKPVAEFLTDILYPYIATPGKPVDLNSLKQSTPVCAS
                     RL"
     gene            complement(<502912..>503949)
                     /locus_tag="C5L36_0E02450"
                     /db_xref="GeneID:40386040"
     mRNA            complement(<502912..>503949)
                     /locus_tag="C5L36_0E02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467797.1"
                     /db_xref="GeneID:40386040"
     CDS             complement(502912..503949)
                     /locus_tag="C5L36_0E02450"
                     /inference="similar to AA sequence:RefSeq:NP_010042.2"
                     /note="PKUD0E02450; similar to Saccharomyces cerevisiae
                     YDL239C (ADY3) and YNL225C (CNM67); ancestral locus
                     Anc_2.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323657.1"
                     /db_xref="GeneID:40386040"
                     /translation="MENYIYDKYKDPHDFPALDLNLNLNSPNSTTSLSSQLPRISDEH
                     FKEILEKKKRARKTSKTEHVQRVDADTLPVRVDRITSSTPITESHNDADLKLKELQER
                     IEQLAIENSDLASENKSLNDKLDQLEQDLQYNSHLLSKERDLNKSLVSNYDSKLKSLN
                     SQLELDNSTIEILRNDNSTLQSELADLKGLLSARDIAISNLNSELSNERNKSSNLNVQ
                     VAKLSTQIQGSENVLKLSNDYFGSKYSFLEMDKIDSLSLFESQNLLKNIVHVLNVNFT
                     GLKSSILFIRDEVFPFFNKIHNLLHSRKSGNLLVVNNSANLTLSDRENLKQCMHLLIE
                     DVESLKQSENR"
     gene            complement(<504049..>504771)
                     /locus_tag="C5L36_0E02460"
                     /db_xref="GeneID:40386041"
     mRNA            complement(<504049..>504771)
                     /locus_tag="C5L36_0E02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467798.1"
                     /db_xref="GeneID:40386041"
     CDS             complement(504049..504771)
                     /locus_tag="C5L36_0E02460"
                     /inference="similar to AA sequence:RefSeq:NP_010408.1"
                     /note="PKUD0E02460; similar to Saccharomyces cerevisiae
                     YDR123C (INO2); ancestral locus Anc_8.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323658.1"
                     /db_xref="GeneID:40386041"
                     /translation="MATPEHHDQQIDFDQAASLLLESPQYGYPIASPNFDQIGQLLLS
                     PNSASFVDSLYGSTNPLASAGSMGHEGSRISLELLTNTETIALESFLDSIANEQTTVP
                     AAADITTTADIAVSKGTSSIATDTDLVQTTPARKTNRGIARQTAVGQPTNSRKLQHNE
                     TEQRRRDAIKSAFDRLNSLVLDSKFDLEGLTRPTSSRKPKRVRKSTNPRRMKKNQVLL
                     MAITEINQLIIENNLLKRELNV"
     gene            complement(<504960..>505814)
                     /locus_tag="C5L36_0E02470"
                     /db_xref="GeneID:40386042"
     mRNA            complement(<504960..>505814)
                     /locus_tag="C5L36_0E02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467799.1"
                     /db_xref="GeneID:40386042"
     CDS             complement(504960..505814)
                     /locus_tag="C5L36_0E02470"
                     /note="PKUD0E02470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323659.1"
                     /db_xref="GeneID:40386042"
                     /translation="MSLRKMATTVRIGFVPEHYAVPLVFAKKLGYYEESGLDKYEFVP
                     YPSGSGHLIQSLKKREIDIAVGLTEAFVRGISTGDEGEYSIVGQYVTSPLRWAISTGI
                     GRKDLTIADIKKVGISRLGSGSHVMSFVLAMEHGLAPFEYQVQDNFANLRAGVNNGTT
                     DAFMWEYFTSKKYYDSGDIRHLGDIYTPWPSWVITAGAHVEASVVDAFNRGTQRGIDY
                     FNANKDKGIDHILESDSLDYNNKEDVENWAKAVVFCDNVAESVHQQPWRDVVAKTKDV
                     LREAGVIQ"
     gene            complement(<505895..>507100)
                     /locus_tag="C5L36_0E02480"
                     /db_xref="GeneID:40386043"
     mRNA            complement(<505895..>507100)
                     /locus_tag="C5L36_0E02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467800.1"
                     /db_xref="GeneID:40386043"
     CDS             complement(505895..507100)
                     /locus_tag="C5L36_0E02480"
                     /inference="similar to AA sequence:RefSeq:NP_010368.5"
                     /note="PKUD0E02480; similar to Saccharomyces cerevisiae
                     YDR083W (RRP8); ancestral locus Anc_8.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323660.1"
                     /db_xref="GeneID:40386043"
                     /translation="MLFEVEGWGLEKKKVKKSVGKKRRFRESEEEVTDEASKLGLAVP
                     KQKKEKKEKKDKKDKKDRKERVELEEKVEAGGKTRPGPGSNSSKEEVVEERPSKRVQT
                     LPPAYGDDIDASKLTPLQRKMLNKLSGSRFRWINEQLYTTDSKSALEMIQRQPELYEE
                     YHKGFASQVESWPENPVDVLTRKLVYKGVQKMTNAPGGLLGVDDHGGKTVVVADMGCG
                     EAALAINVDNFMQEYKRDGQNALKKFKKKFGHGGEVNLKNRKLAIKVHSFDLKKINDK
                     ITVADIKNVPLPNASVTVAIFCLSLMGTNFLDFIAEAERILVPNGELWITEIKSRLVD
                     SNGGTFVNAIEGLGFKLRSKDDKNKMFTQFEFYKSDKKKAKFESRSHARGESTESEWL
                     LKPCIYKRR"
     gene            complement(<510903..>513320)
                     /locus_tag="C5L36_0E02490"
                     /db_xref="GeneID:40386044"
     mRNA            complement(<510903..>513320)
                     /locus_tag="C5L36_0E02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467801.1"
                     /db_xref="GeneID:40386044"
     CDS             complement(510903..513320)
                     /locus_tag="C5L36_0E02490"
                     /inference="similar to AA sequence:RefSeq:NP_010114.1"
                     /note="PKUD0E02490; similar to Saccharomyces cerevisiae
                     YDL167C (NRP1); ancestral locus Anc_7.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323661.1"
                     /db_xref="GeneID:40386044"
                     /translation="MKEEELAGPKALELGPGGSTHLVSTTLSGESSLKKSDSSTLFIY
                     IDFEYEDQSGEDKDNRHSNTSNDMNMLNFKKLSYSVVDSTIYDVLESKEYDIKEVKEF
                     IDKLTDSINDFAFSQKKPFCFVVLKGWDLRLKFIKYCKDNELQLPNYLEYPNYFDLYK
                     EYIKFEEVNGNAEFNSIEYKKLDLDTIKKKFSIESTELSNIDAMIQITRKMHELSKFK
                     FIFQKPHDLNLDLSYFFNEKSKIIYITNLPNDTTQSELDSVFNQQNDRSITFWLIKNP
                     NYNGGNSMNLTLSGFIIFNSHEEAIKALTLNGSSFNNKLIEVQPSSIEVFNKAQDILI
                     SFPTSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPIASVTTIQESIYGNNNYNGGLS
                     KPNNNQLYNGNLGNIGNSGNSSGNIGNSGYINNNIGNNGNSSNSSITNNNNNSNNNNS
                     NNNTINNNINTNGGNNNGNLNNRQNSNVPFRAGDWKCLNEACSYHNFAKNVCCLKCGS
                     QRVQSAIINGHVHNNHKNRNHLVDYNTRSNSLPQLSQQNYNGNNNGSSSYKYIKPISS
                     SSQLSNGSSNPVHAGFEFDLQSKFNHLNISTPNTSGMNTPPISTSSTPTSTINNYMNA
                     FGGINNVTGPIPSGLNDFGFDVTRTLSTPTPGMNMSGLGGIDNINGAMLNGMSGIGMN
                     TGLSNMNMRNMNNLNGISNANNMNIGSMNNNSSSLNNMNLNSLTLNNNVNHLRSINNT
                     NNLNDVGNVNLRNLNNMNLNEVNLSMGMSMDMGMDMGMDMGMGMGMGMGMGGMNVFGS
                     SGLNNEI"
     gene            <513954..>517025
                     /locus_tag="C5L36_0E02500"
                     /db_xref="GeneID:40386045"
     mRNA            <513954..>517025
                     /locus_tag="C5L36_0E02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467802.1"
                     /db_xref="GeneID:40386045"
     CDS             513954..517025
                     /locus_tag="C5L36_0E02500"
                     /note="PKUD0E02500; Pfam Domains: DUF221(6.4e-111)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323662.1"
                     /db_xref="GeneID:40386045"
                     /translation="MLEQMGLTQGVLEFTKNFSSSLSGNNNEQSDGNVFVASMMSLFN
                     GTILDSDTGGYNGDGGDGGNQPPIFDPRRQTQTLFKVQLYVCTTLGLFLFLTFCLLRY
                     KFPLFFSIRSYRNKKIKKLPNNMFSWIKILISINNEQLLEVIGLESYVFLCFFRMSIK
                     ILMSLSILGLCILSPIRYWMLGTFDRDDTSLGFISNYLARGNDPDDENAEPVAYLVIC
                     TIFTYIFTGIIFWFLFKETNHIIKVRQRFLGSQRSLTDRTIFIKNIPKEMCNEEDLKS
                     HIEELKVGKIDQIRFVYDYSPLIELYNVRDGLIRQLEIKYSQLCGLDIQMFDSVNVQN
                     VHLKVVKSENPPSKDKIVYNPYMKESCINDDDNSDAEYYILNIDDEKYEKKKRSCVKV
                     EKSDKEIIDESLRRLIKINDDINECRASNQFKRLPLAFVTMDSVTDAQMAAQAVFSPK
                     VFELITELAPAPMDINWGNLLMSNRTLFFRKNIIEFIIILFSILLIIPIRYITSLLNI
                     NAIRKMWKEFGDYLLKHEFMRTIVTGLLPTYLFTIINVILPYVISSLSSLQGLRSKGD
                     VELSVIKKNFLYIFFNLFLVFTLFGTLSSYKALLTDTTKIAPLLATSIKSLSLFYIDL
                     IILQGLTMFPFKLLQIGDLSMIFWNFIVNNSKKTPRMFRDLIYNPPIFDLGLILPQHL
                     VIFIITILYSSISTKILVSGMVYFILGFYTYKYQLVYSLVHPYHSTGKAWPIIFKRVC
                     LGVFFLHLQMFGSVALEQSFILAGFMLPLFPVTIIALMVFNKDYQPLLDYIALDAIKT
                     KGRSVDQEPEDDGLDTLLLNTGISGSAVTQNKFIQRKTSAVSLFLDGDDNCDAVVVNK
                     SSGSDTSNVECECLTDADNAVDDEIHTSGVNNNYHDANLSASPSSSTVSPPNFTPLTS
                     NLASLNNNIPLRRKCSTIEEEREATQCYIHPCLLDENYGLMVGFCNDDIDYLNFRITS
                     SSEGFALESQMDGQQVDLRVSSECHEDEDLEVARGIVSGYVTRKNVSEEVW"
     gene            complement(<517089..>518456)
                     /locus_tag="C5L36_0E02510"
                     /db_xref="GeneID:40386046"
     mRNA            complement(<517089..>518456)
                     /locus_tag="C5L36_0E02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467803.1"
                     /db_xref="GeneID:40386046"
     CDS             complement(517089..518456)
                     /locus_tag="C5L36_0E02510"
                     /inference="similar to AA sequence:RefSeq:NP_013296.1"
                     /note="PKUD0E02510; similar to Saccharomyces cerevisiae
                     YLR195C (NMT1); ancestral locus Anc_7.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323663.1"
                     /db_xref="GeneID:40386046"
                     /translation="MMQGGGDKKAKKTIEDLFKQLAVEEETSPAAPPKSMDEYKFWKT
                     QPVPRFDETDEEITEGPIDATKTVNDVRKEPYPLHASFEWVTLDLESKTDLDQLHELL
                     YDHYVEDHDAVFRFAYSKSFFNWALKPPGWVKEWNVGVRVKETGRLVAFISGVPCDLT
                     VRKNTVKSVEINFLCVHKQLRSKRLAPLLIKEVTRRVNLHNIWQALYTSGTVLPKPVT
                     TCRYGHRPLNWAKLFEVGFSSLPTGETKASMVAKLSLGSETKSKGWRKMEEGDIDSVF
                     ELYESYRERFDISQIMDKDDIKHWIYGGAQQDGKVVHAYVVEDAGSGKITDFISFYVL
                     PFTVLQNPLHKEIGIAYLYYYASGEGIGKDKKDPVSQTLLKKKLKSLVTDAMIEAKKI
                     NIDVFNALSSQDNNLFLEDLKFGAGDGFLNYYLFNYKVKPIFGGLDKDYDFAKDTSGV
                     GVVLL"
     gene            <518669..>520501
                     /locus_tag="C5L36_0E02520"
                     /db_xref="GeneID:40386047"
     mRNA            <518669..>520501
                     /locus_tag="C5L36_0E02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467804.1"
                     /db_xref="GeneID:40386047"
     CDS             518669..520501
                     /locus_tag="C5L36_0E02520"
                     /inference="similar to AA sequence:RefSeq:NP_011853.1"
                     /note="PKUD0E02520; similar to Saccharomyces cerevisiae
                     YHL010C (ETP1); ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323664.1"
                     /db_xref="GeneID:40386047"
                     /translation="MLISEDDLSVASKYTIVFDVFSVSEIFESNTKAAELYARTLVHK
                     GIIKPTTVHRESSWISQLYNSGDIFTKRNPCPVYKDIEFSQWTERILNFNYSILKHTL
                     KFPDYRFSAIELTPIDFGDQAMSFSKSLTKERLNGEIIGAGVVRLYKDSDTHLNTTKI
                     IKGDYTHIPGDETTVAILAIPFYFSVSDLLIGVLDEKDVKQISHLRLVKSSTPNKFML
                     LIKFRSKEYVKPFIRKYQGKKFNSFEPETCSVLQIKEILIRPKNEEELKNVKSSLPYL
                     LEDPFTNVKSSSKPAGKSIQKYTELATCPVCLDRLDSDVSGLLTIPCQHTFHSDCLSK
                     WSDDSCPVCRNALKPNKNKRLGTSLLNESTLVGFDSTEKCMDCGNTKSIWICLICGNV
                     GCGRYEQKHAIKHWEETGHCFSMESNTQRVWDYAEDGYVHRLVQNEADGKIVELPLHD
                     ESKKSNEEKIDKIGFEYSKLLITQLESQREYYENQLSEFKSSLVYEKSQVNKLEKMME
                     ELKVTVSESVNEMSILREEQRRKNEEKASLKEQNNNLLKLNKAMVQKLKMYETNTELL
                     KKENEELHEQVSDLMFFLESREKLKDSSDDVKEGKLFMVPKNSK"
     gene            complement(<520552..>521970)
                     /locus_tag="C5L36_0E02530"
                     /db_xref="GeneID:40386048"
     mRNA            complement(<520552..>521970)
                     /locus_tag="C5L36_0E02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467805.1"
                     /db_xref="GeneID:40386048"
     CDS             complement(520552..521970)
                     /locus_tag="C5L36_0E02530"
                     /note="PKUD0E02530; Pfam Domains:
                     Pkinase(2e-86)|Pkinase_Tyr(1.7e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323665.1"
                     /db_xref="GeneID:40386048"
                     /translation="MSDIFELDEEQLSNKLDERLNIGDESELSVSIIDDNTCEKTADR
                     KIEHFKKYRSNSVISVGNLDNRVGDSYEVPFEDFYEAELEESRQNSSIPTNEQSRNNV
                     SSEVPVVHSRRLVVTDFQPIKVLGKGSFGKVILVKHKTTGRLYAQKQLKKATMIVNTK
                     NYERTLTERTILEKVSHPNIVKLYYALQDFDKVYLFLEYLEGGELFFHLSNERIMSEK
                     IACFYVAEMILALRHLHINAGVIYRDLKPENCLLNRHGHLVLTDFGLSKVAMQANSMD
                     GTAQYIAPEVIKGENYDSRCDWWSLGAVMFDLLTGQPPFTGNNNKRIMDKILTKKIAY
                     PFYLSQISKDFLSKCLNKNVEKRINLDDEQVFNKVKNHQFFRYINWKHIEEQNDAQQP
                     PPIIPVISNPEAAENFEDEFTSLDITPPNSPIPKFIYDNIEESRSNSTSSIIEIKKPD
                     DKGDYQKSVYFTDFSFTRKSCL"
     gene            <522412..>524064
                     /locus_tag="C5L36_0E02540"
                     /db_xref="GeneID:40386049"
     mRNA            <522412..>524064
                     /locus_tag="C5L36_0E02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467806.1"
                     /db_xref="GeneID:40386049"
     CDS             522412..524064
                     /locus_tag="C5L36_0E02540"
                     /inference="similar to AA sequence:RefSeq:NP_015370.1"
                     /note="PKUD0E02540; similar to Saccharomyces cerevisiae
                     YPR045C (THP3); ancestral locus Anc_7.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323666.1"
                     /db_xref="GeneID:40386049"
                     /translation="MGTSKKKLNKNGSPKAVAGINTTRYSKGSGSEEVSPLSVAKSVS
                     NSKWKDPKTWPPSLHDFIARSFKEASTKNFNSTNTAKFKSQLKSLINMAIESDRIMRN
                     DWDKQEVPLLIGSKSEGLSLYCDNAEIAQKGRAGPEQNISTTNGAKRKNIFGEDESDS
                     EDVTLGEKEPKAMTSSKSISLGDSLKKLKKQKKEPATLPASLPSIPSTSNQMTNQQLK
                     DLRSKRFERELSIPVNHNYKDDVVSTKPIVGRNNNLEKKYLRLTSQPNPDTVRPLKVL
                     KKTLQLLFDKYFDGASYSYLCDQCKSMRQDLTVQNIRHDFTIMAYEFHSKIAIENGDW
                     GEFNQCQSQLKELYAQADLTKPHYFEFLGYRVLYYILTGNNTEVYELELDIETKGLRQ
                     NNDDFFSCALELFRHISSSNYYLLSQTVCKIYNRNKEERRQMIKTNDKGRLLITHKDA
                     LLLKHNKSYFFTKFVESIMKRENVRSLSTLCAGYRQLPVEFLKRLLCFEDDTAWEGFV
                     EANRLGAFLNDNKTLFNCHQAKYVVEELKNQMFKKIDIKGQI"
     gene            complement(<524146..>525357)
                     /locus_tag="C5L36_0E02550"
                     /db_xref="GeneID:40386050"
     mRNA            complement(<524146..>525357)
                     /locus_tag="C5L36_0E02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467807.1"
                     /db_xref="GeneID:40386050"
     CDS             complement(524146..525357)
                     /locus_tag="C5L36_0E02550"
                     /inference="similar to AA sequence:RefSeq:NP_010710.4"
                     /note="PKUD0E02550; similar to Saccharomyces cerevisiae
                     YDR422C (SIP1); ancestral locus Anc_5.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323667.1"
                     /db_xref="GeneID:40386050"
                     /translation="MGEKVEDILKGNMPRTKDRYNNVIHTCTSITSLGSLNGKDTRMH
                     EVGVMPEMPDFTKRPKIMKPHSSNDYFSTEHHESIGSAFSPDDDTVQSNHYVYPHVRN
                     TSVTFFSDGLNDEHTYNELPLDESLDDFEVEYSDEDMIGEEEEEEKGGECECGDCLTP
                     SRNETPDPHYQSLGNDINRSQSPFLQKPRAEYTTEIPYFYDPSKLKYPYKSPLDYSDE
                     EFEQMNHFDFLNDLKFSTPPILPVYLNSNLLNDSSSKNYKTFPYQYQESNVPYVNTIY
                     RYRINDLNLMDKYSAMKSTRPALKRASSSNSSNSSNMGTRSTKSNGMTNRIKLLRENS
                     NGSKNGVKLKHADKIDLIEKNLVPHHVMLNHLITCNLNKDGYITSSCITRYKGKFLTQ
                     IMYFSNELEKL"
     gene            <525791..>527527
                     /locus_tag="C5L36_0E02560"
                     /db_xref="GeneID:40386051"
     mRNA            <525791..>527527
                     /locus_tag="C5L36_0E02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467808.1"
                     /db_xref="GeneID:40386051"
     CDS             525791..527527
                     /locus_tag="C5L36_0E02560"
                     /note="PKUD0E02560; Pfam Domains: Asp(1.7e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323668.1"
                     /db_xref="GeneID:40386051"
                     /translation="MVLHKLITIVLYLLIVKASYLSLPISKKSYSTEEGIISKQRPHR
                     LIKNRKAVLKRNVFGELETTIRFDQTFVEVHLRFGSNRDPVTLLLDTASSDLVVNSSD
                     NEFCISDGPDPESSFDTLVNSLAFYKREEAVSCPIPNSRTKIRKKSTTTVSENFKYKT
                     ESVIDQHSMQHSSNIAVSSAPPYPKIKNYSSTPDPSFIQNHANYLMETTNCPHFGMYD
                     PYNSTSFYNLTTPLNIQYLDGSAYSGFYGTDDVYFADTKISQVQFGLNVETDKEWGTL
                     GIGFGSNENTAQDGLKEYDNFPKKLKREAIIKKQVFSIYAPYNSAPQSLIFGGYDRNG
                     YIQESGLTLVPIIDYSPRDKKGSGPFYLSITINSISFSYGNLKQKEEVAKGNAVTILD
                     TGSTSSIFPDYIIAQLVIKYSFQWSSQLNCYVIQEKEIPKDDFYVTFDFQNALIKVPL
                     IDFTYPVIDGDTLSPTGMRSLQVTSSDSDLLVLGDDILQNVFFIVDMEDLNIALGQIN
                     PDKTSENIVVVRDKIVDAIKSNEWDNVWGYNGCRKLELINISGSRTPEEYHSDKNISL
                     YFPGLTGNGFSW"
     gene            complement(<527701..>529659)
                     /locus_tag="C5L36_0E02570"
                     /db_xref="GeneID:40386052"
     mRNA            complement(<527701..>529659)
                     /locus_tag="C5L36_0E02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467809.1"
                     /db_xref="GeneID:40386052"
     CDS             complement(527701..529659)
                     /locus_tag="C5L36_0E02570"
                     /note="PKUD0E02570; Pfam Domains: Asp(1.4e-11)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323669.1"
                     /db_xref="GeneID:40386052"
                     /translation="MVNASNLVTTIIGLTGLSGLAKADYIKLDAKKLRGSWAQQADVE
                     KTPLYAYYKGNLNSSEVVNGTVAGLYNENIYYVVDLAIGSNAQNVTVLVDTLSSDLWI
                     NSVDNEVCAYGVDEELGSNFTIAYEFVNTITSSSSMGASATASISGGSSGPVLSTITS
                     SRYDSSSDAYFIDVEVVTETTDIATVTSTHVSTTSHDIQFYPSASSTNYLSLYPSPTF
                     AIQNLTVLNYEPQNCSAWGLFNESDSDSFTTEGEKFEALSFEFENVTGIWVKDTVVYG
                     DAILPNVSFGLVDDSLSDSFGVFGLGLPSSQSTWLTNGTHYDSFIDNLKYNGYINKSV
                     YSLYENYLTNGSSLLFGGVDLEQFIGNLTILPLIEVPVAFNDSRNASAIAITLSSIYF
                     DDDYDNANDTHLIASGLGAAILDTTSATATLPYYVFDEIVHYAGFNYSESLEAFVANS
                     SQLENKTLILDFQGVEVDIPILDLTFPLVDISGKHDNAGEFVVFGVSASPNTYVLGDV
                     ILQYLYVAVDLDDLEIAIAPKNFEPLSEDIVAVTSHFPNATSARHYNYTYGYHGVTDL
                     KLNEVHNPNSVTKTSFFLSYIPSATPFSITVGDASSTTKQSSNTKKAKSKAITTKTST
                     ERETTKSKGEKTSSTKTSTNEKSSTTKN"
     gene            <530925..>531491
                     /locus_tag="C5L36_0E02580"
                     /db_xref="GeneID:40386053"
     mRNA            <530925..>531491
                     /locus_tag="C5L36_0E02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467810.1"
                     /db_xref="GeneID:40386053"
     CDS             530925..531491
                     /locus_tag="C5L36_0E02580"
                     /note="PKUD0E02580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323670.1"
                     /db_xref="GeneID:40386053"
                     /translation="MASKLEQMGEALAEINKQNFKPSGIFTNSLLNTTDPTQIIRDIR
                     DEEAVFFLGKKMQEIDYEMISNLGFNNSDQYAQYEVSKLLQERSNDAELDLMVEEAVP
                     RDLREDVEYSDDIEDLVAIYKRCHTIKRLWASPTMTMLDSETLSLLKNTQDKLDQVVG
                     LLREISQLRRDVKSQTQQFNQSFSSEGR"
     gene            complement(<531614..>533836)
                     /locus_tag="C5L36_0E02590"
                     /db_xref="GeneID:40386054"
     mRNA            complement(<531614..>533836)
                     /locus_tag="C5L36_0E02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467811.1"
                     /db_xref="GeneID:40386054"
     CDS             complement(531614..533836)
                     /locus_tag="C5L36_0E02590"
                     /inference="similar to AA sequence:RefSeq:NP_012660.1"
                     /note="PKUD0E02590; similar to Saccharomyces cerevisiae
                     YJR126C (VPS70); ancestral locus Anc_4.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323671.1"
                     /db_xref="GeneID:40386054"
                     /translation="MDIEKHTTRPHTLGKALTRRTVLYVLYSVVLVYIATSFSKYTFD
                     REFPLVATSGVSEEYSKLILHSLETNNVGKLLYDYTRDNQLAGTNLKMVNYTLEKYKE
                     LGLQDAIVDEYTAYISYPLNQSVVLFKDNEVKYVPSLQEDTLKEDPNSYEKVPAFLGY
                     AGNGNVTAEYVYCNYGTFEDFNKLEESGVLLKGKIAIVRYGKIFRGLKVKFAQDHGMA
                     AVVIYTDTYDDGEVIVENGFDAYPNGPARNPSAIQRGSSQFLSVIPGDPTTPGYAIKP
                     GEDLPREDPFISTPRIPAIPMSFKEIQPILSKLSGHGPKIDSWEDGLVKDFDYSVGPN
                     PKYTLNVYNKQDFNISTMHNIMGKIKGKDDSKFILVGNHHDSWTPAAADPHSGSAAVL
                     EVIRAFRDLSATGWEPRVSIVFASWDGEEYGLIGSTEFAEYYSWKLKKECIAYLNTDV
                     ASVGSILSIQSSPLLNHVLLESAKQIPYPNSTISLYDHFFQHHEKIGTLGSGSDYTVF
                     LEHLGIPSADMGFSNDLKTAPVFQYHSLYDSYHWMSEFADPGFVFHNLLAKFLALTTL
                     HLSTEPVIPFRTGDYAIALSEYYDNLDIPDQWNFDHVDKCHHHNSTELLESVKAKLDE
                     LKASSAEFDVEIMNILALYEKWDSLTYWQRIKLHFRAKGVNSILQYFERHLLYGKGLN
                     ERPWFKHFAYASGRYTGYKGQELPFLAEAIEDLDRKDFFHALRHFDGLLSTLIRMTTL
                     "
     gene            <534787..>535941
                     /locus_tag="C5L36_0E02600"
                     /db_xref="GeneID:40386055"
     mRNA            <534787..>535941
                     /locus_tag="C5L36_0E02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467812.1"
                     /db_xref="GeneID:40386055"
     CDS             534787..535941
                     /locus_tag="C5L36_0E02600"
                     /inference="similar to AA sequence:RefSeq:NP_012996.1"
                     /note="PKUD0E02600; similar to Saccharomyces cerevisiae
                     YKR070W; ancestral locus Anc_5.652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323672.1"
                     /db_xref="GeneID:40386055"
                     /translation="MTNSEIQRMSTPVEEVSQQLESKQDIGFVFDIDGVLLKGKKRIV
                     EATEIITYLQKEKIPFILLTNGGGMTEKKRIDFINMTLQLETPIHPDQLIQAHTPMKT
                     LIPHHKRVLICGGPKDDVREVAESYGFEDVIRPVDIIRANPTIWPYHMFTDEQIEQWG
                     RDPNDTKLDVDGTGCKENLPIDSILCFNDSRALGAEIQIISDLLNSENGVLGTRRTVK
                     SSKPSIPIVFSNNDFLWANEFVQPRFAMGVLKIATQTIYSKINGGEELEQLTLGKPEK
                     VCYDYAHHILIDWRDVLLGKKKAGNVCLPQLNNEPLNSPFKKVYMVGDNPESDITGGN
                     RYNWGTILVKTGVYQEGDFERNPEISKPSLGVFANVKEGVMHALKLNGLA"
     gene            complement(<536081..>537172)
                     /locus_tag="C5L36_0E02605"
                     /db_xref="GeneID:40386056"
     mRNA            complement(<536081..>537172)
                     /locus_tag="C5L36_0E02605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467813.1"
                     /db_xref="GeneID:40386056"
     CDS             complement(536081..537172)
                     /locus_tag="C5L36_0E02605"
                     /note="PKUD0E02605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323673.1"
                     /db_xref="GeneID:40386056"
                     /translation="MLSLQFKRLIHSIKKSPVGFAFDIDGVLMQSKNPILPYARDTLT
                     LLQDHKIPFVLLTNGGGQTEASRVSFLNKSLSLKNPLRTSQIVLSHTPMRNLTGKYNR
                     VLVVGGDDPQTREVAQSYGFQEVIRPIDIVREGPNIWPFIRYTREEIQALSKPVDLRQ
                     PIDAVFVFNDPRDMGTDTQIVIDALCSENGVLGTRRGIGSSKPSVPIIFSNMDLLWST
                     GYPIPRFGQGAFRLTIRELYKQLNNAELVDTVLGKPWPVSYTYAENVLNDEWKLLNGD
                     RSGANEIPELGVKPKEQLVENVYMVGDNPQSDISGGNNYGWETILVETGVYKEGDFHK
                     YPTLAKPTFGIFPNVWDGVTSALKRHQVI"
     gene            complement(<537590..>538531)
                     /locus_tag="C5L36_0E02610"
                     /db_xref="GeneID:40386057"
     mRNA            complement(<537590..>538531)
                     /locus_tag="C5L36_0E02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467814.1"
                     /db_xref="GeneID:40386057"
     CDS             complement(537590..538531)
                     /locus_tag="C5L36_0E02610"
                     /inference="similar to AA sequence:RefSeq:NP_013321.1"
                     /note="PKUD0E02610; similar to Saccharomyces cerevisiae
                     YLR220W (CCC1); ancestral locus Anc_8.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323674.1"
                     /db_xref="GeneID:40386057"
                     /translation="MSIVGVKQLISKALSSSRESSPLGVNENSSLLNKQVNPNNYTDN
                     NASDGNTVADVTGGSRHSDLESATESSTRDQSSKPFPLNYLSSVDPRTMSDLIIGLSD
                     GLTVPFALTAGLSSLGDTKLVITGGLAELVSGAISMGLGGYLAAKSESEFYVSQVRKE
                     KQIFFQNQDTITDELFDILIDMGASEETSESFINDLSNNPQKMIDFIIQYGKGLEEPP
                     EGRILSSALTIGAGYFFGGFVPLIPYFFLATVGKALLASVALMLVTLFWFGYFKSVIS
                     MGEDCSKWTRVSEGFQMILVGSIAAGSAWSLVYLIDS"
     gene            <539794..>540393
                     /locus_tag="C5L36_0E02620"
                     /db_xref="GeneID:40386058"
     mRNA            <539794..>540393
                     /locus_tag="C5L36_0E02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467815.1"
                     /db_xref="GeneID:40386058"
     CDS             539794..540393
                     /locus_tag="C5L36_0E02620"
                     /inference="similar to AA sequence:RefSeq:NP_014695.1"
                     /note="PKUD0E02620; similar to Saccharomyces cerevisiae
                     YOR052C; ancestral locus Anc_5.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323675.1"
                     /db_xref="GeneID:40386058"
                     /translation="MKINIRIPAISDDILILTVPDNATVDDLKVAARVAFIPSTNELN
                     ACTKINAWYSGHKLEHSKSLASYNITPESIEFNSNLLVYLTTNDSEMMLERIRAESSA
                     LVDDEAASVDIHPVQLKKAKTKSKSRSKSKSKKCSFLNCNSTPLRMVGDCQFCQGKFC
                     SKHRLLESHNCKGLKICKDKCYERNALKLQSEQTVASKV"
     gene            complement(<540656..>541795)
                     /locus_tag="C5L36_0E02630"
                     /db_xref="GeneID:40386059"
     mRNA            complement(<540656..>541795)
                     /locus_tag="C5L36_0E02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467816.1"
                     /db_xref="GeneID:40386059"
     CDS             complement(540656..541795)
                     /locus_tag="C5L36_0E02630"
                     /inference="similar to AA sequence:RefSeq:NP_013706.1"
                     /note="PKUD0E02630; similar to Saccharomyces cerevisiae
                     YML008C (ERG6); ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323676.1"
                     /db_xref="GeneID:40386059"
                     /translation="MSPSENIKLAEKNFQKDKDFAKAMHGKTTEGGGLSALTGKNQEA
                     SAVAIEGYFKHWDGKTSEEAEKSRLEDYSALTKHYYNLVTDFYEYGWGASFHFCRFFK
                     GEPFRQAIARHEHYLAYKIGIDENMKVLDVGCGVGGPAREIQRFTGCSVTGLNNNDYQ
                     IERANNWAKANGLEDKLNFVKGDFMQMDFEPESFDAVYAIEATVHAPVLEGVYSEIYK
                     VLKPGGKFGVYEWVMTDAYDETNEEHRKIAYGIEVGDGIPKMYKKEVAEKALKNVGFE
                     ILYENDLADNNDEIPWYAPLAGDWKYVQNVADLWTYFRTSAFGRKVTTLAVGTLETLR
                     LAPKDSVKVTEALEDAAVSLVEGGKQKLFTPMMLYVVQKPLKEES"
     gene            544865..544948
                     /locus_tag="C5L36_0Etrna15L"
                     /db_xref="GeneID:40386408"
     tRNA            544865..544948
                     /locus_tag="C5L36_0Etrna15L"
                     /product="tRNA-Leu"
                     /note="PKUD0Etrna15L; codon recognized: UUA"
                     /db_xref="GeneID:40386408"
     gene            complement(<545390..>546403)
                     /locus_tag="C5L36_0E02640"
                     /db_xref="GeneID:40386060"
     mRNA            complement(<545390..>546403)
                     /locus_tag="C5L36_0E02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467817.1"
                     /db_xref="GeneID:40386060"
     CDS             complement(545390..546403)
                     /locus_tag="C5L36_0E02640"
                     /note="PKUD0E02640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323677.1"
                     /db_xref="GeneID:40386060"
                     /translation="MVSKLVFKGDKTKNKPKKRNSNRGTEKATKTERFFPINGRLKKM
                     NEIDLNSITTGWTILFPIDLTYAKKSIIDSNSGKLPIIITFENEEKKRILEERKTTEN
                     GAIKTFLKFTDDFETSDPNAIINYTDAVSSLPITNIEPKSVNQVFILSDVTSLFGSSK
                     KFIESNSSRASLYSIQTTTGKYLMHNLSTNELELSVTLTENSVFTLNHYLLDGIPKYR
                     LCIGKNTTQTMVIAGSDIPKVINDEEDVLDSISRFTIKLKCEDAYTTKQILQASYDES
                     RPQESSGFISGNVKKTVLDLAKNGFKLNDKIISEISNAYKSGNLNEWVVEFKEKNVHD
                     RRT"
     gene            complement(<546616..>547569)
                     /locus_tag="C5L36_0E02650"
                     /db_xref="GeneID:40386061"
     mRNA            complement(<546616..>547569)
                     /locus_tag="C5L36_0E02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467818.1"
                     /db_xref="GeneID:40386061"
     CDS             complement(546616..547569)
                     /locus_tag="C5L36_0E02650"
                     /note="PKUD0E02650; Pfam Domains: Abhydrolase_1(2.2e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323678.1"
                     /db_xref="GeneID:40386061"
                     /translation="MLKTNSLRIARTPLKTLFPSIVRFVHNTNGLLDYDILEPKQKSH
                     IPPAIFLHGLLGNRRNNKSACRMLAERLQTPFILPDLRNHGTSFHAEPFTYKTMTDDL
                     NFLIDNLPESIPKDEGFIILGHSMGAKVAMIHALRHPDQVKGVVSVDNIPYVNPDRSL
                     DTFEKFHISIRFILNCIKKHPEWTLSDLKKHMMKWVEPSELITDYWLANITRRGGVLT
                     PKVPLEMINNSIEEVLDWKLEDYGDLEEYAHQKNMPPLTIIRANYSKIVGTDIHKHAI
                     QKYFPDYEIAPIDCGHWVVTEKRPEFVKIVEDWAFRRFGPV"
     gene            <548034..>549104
                     /locus_tag="C5L36_0E02660"
                     /db_xref="GeneID:40386062"
     mRNA            <548034..>549104
                     /locus_tag="C5L36_0E02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467819.1"
                     /db_xref="GeneID:40386062"
     CDS             548034..549104
                     /locus_tag="C5L36_0E02660"
                     /inference="similar to AA sequence:RefSeq:NP_009596.1"
                     /note="PKUD0E02660; similar to Saccharomyces cerevisiae
                     YBR040W (FIG1); ancestral locus Anc_3.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323679.1"
                     /db_xref="GeneID:40386062"
                     /translation="MITCGLTLVKQFPKLLALILTIVNIALIFFVLNGATHDSSAYNS
                     LALIEYKFNSSSDIYSLLSLQYSKNHSHEKLDEFVIKVGYRGVCISFTDGKDNLNCGY
                     TSDMDAAYSSKVPSFSVTDNNNSTGRASLEMFDIAYSIQEKSYKSNIYIAELICLLAA
                     LICQVYTILGFLPFQNYVLLLILGVLTSFFIINCIAITWLMVVLGNLVGVGGVLTMNI
                     LSFTVVSKPVGILCATLAITIVQGSLYLWHFLGGNIKVQSKNSTTSKVDMASTDLHRG
                     ISDYFPNKFARGAGYGRYGEYGRYGGHGRYDGYGRNEDYGPSGPGYIINPSLKHAWDF
                     ERGPTSYDNSVLSSITTLRGTL"
     gene            <549694..>550383
                     /locus_tag="C5L36_0E02670"
                     /db_xref="GeneID:40386063"
     mRNA            <549694..>550383
                     /locus_tag="C5L36_0E02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467820.1"
                     /db_xref="GeneID:40386063"
     CDS             549694..550383
                     /locus_tag="C5L36_0E02670"
                     /inference="similar to AA sequence:RefSeq:NP_013061.1"
                     /note="PKUD0E02670; similar to Saccharomyces cerevisiae
                     YLL039C (UBI4); ancestral locus Anc_4.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323680.1"
                     /db_xref="GeneID:40386063"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGA"
     gene            complement(<550442..>555847)
                     /locus_tag="C5L36_0E02680"
                     /db_xref="GeneID:40386064"
     mRNA            complement(<550442..>555847)
                     /locus_tag="C5L36_0E02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467821.1"
                     /db_xref="GeneID:40386064"
     CDS             complement(550442..555847)
                     /locus_tag="C5L36_0E02680"
                     /inference="similar to AA sequence:RefSeq:NP_011833.1"
                     /note="PKUD0E02680; similar to Saccharomyces cerevisiae
                     YHL030W (ECM29); ancestral locus Anc_4.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323681.1"
                     /db_xref="GeneID:40386064"
                     /translation="MSQDLQLIQNVELRFALADSTEKFQSALNTYLAPLLLKFAVDDT
                     QVRTQLAKTIKFLLSKINATSELKLPAQSLLNQIREPNLKPNQNATIVQNYTLLFLSK
                     AITRLSEDERYDIFFNLLNNISGFTVSVAARLFNISCKVLELSPDANMDRFSSLLECL
                     PEKDKQFLEEKYFKFMLLHPVTAGVNGSISNNITQPGLSSVDCSFFFYYAGVTFDSSS
                     LAQYKLKILKFVENAVGIDKSIILICASCDSDSRVSSYASTCLKRLTIDYESEELIGI
                     LADLFIGSHEKPPVKSHLQEAFLSIFCKSKIAARNDLIEKISPIGLNSENLKLKQATV
                     SFVRWYTTVNSLDSKGDDTAKRIGDQLKLNLSNVSTGGEDPYLIENRRFQYETLGLLL
                     KKSKKLLDFSYIQFLIDMLDIESKDLKPTIMDALLGITLNLSSLTNEDKLKLKNLFVD
                     IFKKGISRFSDQSTNFVRFIAIKYTNILFPFEDALSRALNILGQSIHDKIETIEESKR
                     GLNPYLFSLDNANTGEEIRFPQFHAIVKCIIEYRDLINAEVALSFAVRSLIMNSISYQ
                     DTVVAIDQYWETRVDQALNIDPVVKKSLLSSLETYVDLDGRLTNDYKSSALKQFIDFF
                     FNSLIQSNKLSSLITLYKIISLCPPVVTDSLTVHISFLMDNDFENMSNESYHYISQLT
                     GIICTSFNVSNNDLVSIVNKLLEEESISPLAYVISRLYLRGRRDVLSEELLLKALGLV
                     EKHLNTSSTKSLEVSLDAISQFSMFGCLNSTSAQINNYKETFIKKIQPLVKKCLEPAV
                     YAWCYLGLTMADETFPSSENTMFEEAIYATYLTKQIDNLFALGEGLAILSDGWSSKNM
                     KGLIDIPGTVLSIEFYPKRCEPILNNVLAFCENPKPSLRKAGCIWLLSMVQYCTDDII
                     ISRLEEIQKAFMRCLSDREEIIQDAASRGLSITYGMGSYEVKEALVYDLLGSFTDSNK
                     ATKDLISGYVDNDTQLFDEGVMNTGGGESVSTYKDVLNLASEVGNPGLVYKFMSLAKN
                     SALWSSKKGIAFGLSAILDKEQLDKLLKDNPNLSRKLIPKLFRYKYDPNTSISRTMNN
                     IWNSLILNNKKTLDDNYDNIFNELLNGMGNREWRIREASTAALQDLLSQCDFDKFKNS
                     LETIWMMAFRAMDDIKSSVRKEGASLTRFLANIMVMKLNNSLSKSGQEAILKQLIPFF
                     LGNSGLLSDAEDVKKFAFETLMKLISTSSQSLKPFISEIVKQLILLMSSVEPQAINYL
                     TLNADKYNLKIEDIDSHRLGAVGSSPLMEAIEKLMDLLDESNISNFIEELEAAVKTAV
                     GLPSKVAGSKVIVILIMRHFFIIGKHGDQLLKIASSQMKDRNETVAKSYAIACGYCIR
                     VASNKKIGSFGKKVTRYYFEKRSDSGTDDKLPKVSSIACESVSNFSGDQFQSHASLFL
                     PLAFIAKHDLNKEIAKTFSKVWSDYTNSSVSAIKLFFPEIINLINSHINTPAFALRRT
                     IALTIIEIIDVLDIRINELNPGHLAELYKILLESLDGRIYDGKEKLLDSLVNLACKSS
                     SFLSKNDELYQRVEERVVFEANRKNKQYQKFSVLALGKLLSVYHEKDSLYDQYVNLVD
                     QLLESSVNDSDDSDDDGDITMRSDSTPIKKTSLVQVNLTQAIILNLIQSLSNGNSINE
                     KVLRYTFDTTITFLKSTSVDLLPTSDAKFKLKQGILSILTRLVELNKPGLINNDWYND
                     KVIEVWEIVGSLTSTTDNLQPILVGFARVSGLILNQLQIKDDYTSLIIRELKILSSEN
                     VSPVVTIECDKILSKFK"
     gene            <556379..>558379
                     /locus_tag="C5L36_0E02690"
                     /db_xref="GeneID:40386065"
     mRNA            <556379..>558379
                     /locus_tag="C5L36_0E02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467822.1"
                     /db_xref="GeneID:40386065"
     CDS             556379..558379
                     /locus_tag="C5L36_0E02690"
                     /inference="similar to AA sequence:RefSeq:NP_011834.1"
                     /note="PKUD0E02690; similar to Saccharomyces cerevisiae
                     YHL029C (OCA5); ancestral locus Anc_4.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323682.1"
                     /db_xref="GeneID:40386065"
                     /translation="MMTLTESTLGSPSLELPKTTDSDSTIVPNPRKSLNEHYRCASPT
                     SSESSVSISNSSTKYQGRRYNGKLPITEIPELVELCQQFLKSQNITGLSMIARQAGLP
                     PHLRHKIWPLLLKSHPFVQNPYVEIDLDDYEERKAEPDGDENHDVKGTSGDIKSYTVP
                     IKEIRFDLGKYLRSAERYYPKTITHEIKDMFEIQGKIFDVIENAIIKFLKKWGSIIHY
                     NSSLTWIALGLAEWVPPLENSQFVLCGRDDIARNGTKLRNINDNYFEKITRSTYSSET
                     SSTTFDSPYTHSPVSFTPSASPMNTPPIGHKPMSFAEIYERMALVILHSPDPAQLEDS
                     KKYESTQMLPILKDSEHLSISPYLGGTIKDRVSFFLSCMRKLLPELHSYMAEEDCLNG
                     DWLLWWLKYDGSKVWSRYDRGRTWDLILGYRSDIKNFESDMKELSELTSEQIHLLGQD
                     LFWTPLDGIKEEENGNNKPDNLGLDSGGEDDDVNGDEAIDEKQDETLQHFSKPCRSES
                     VLTISKSENPLVIIEKTPTFGALSLDSLSSELPSLDDIEPIHELPFSKVHPHIEIIFI
                     SLAFLKSKEYTITELDQSEIKTLLNRLSSLKTDSGEMNSFVNTNDENQRITNIHSQHN
                     HENSNGERRKSNRDIENILVEAGELWRKFLYIYMMEESDLEK"
     gene            complement(<558867..>559097)
                     /locus_tag="C5L36_0E02695"
                     /db_xref="GeneID:40386066"
     mRNA            complement(<558867..>559097)
                     /locus_tag="C5L36_0E02695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467823.1"
                     /db_xref="GeneID:40386066"
     CDS             complement(558867..559097)
                     /locus_tag="C5L36_0E02695"
                     /note="PKUD0E02695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323683.1"
                     /db_xref="GeneID:40386066"
                     /translation="MQFSTVVLFAASALAASSTVTEVTSATITSCGPEVTNCPARHDN
                     GTVSSTYSDAAAAQGSYFAAGAAALAAGALLM"
     gene            <559491..>561230
                     /locus_tag="C5L36_0E02700"
                     /db_xref="GeneID:40386067"
     mRNA            <559491..>561230
                     /locus_tag="C5L36_0E02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467824.1"
                     /db_xref="GeneID:40386067"
     CDS             559491..561230
                     /locus_tag="C5L36_0E02700"
                     /inference="similar to AA sequence:RefSeq:NP_012489.2"
                     /note="PKUD0E02700; similar to Saccharomyces cerevisiae
                     YJL046W (AIM22); ancestral locus Anc_1.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323684.1"
                     /db_xref="GeneID:40386067"
                     /translation="MLGTSQKRLCTYIFSLNICRCYSIPPGFTLVPSSVKIQGTKDKF
                     NLKPKDIADTLQNDPNLADFYEGSFEANGHSTEQPFDPFDLSDIPIDHEPAELKGEEL
                     LPQLPRDSLNQYQTMPTEQFIKFMNKKSLSSDNDPLISDNFLSDMVNKKFDKENHVVP
                     NNRDNYFKDTTSCDEPWKRSEMAEFVGNDDVAILNRQPKLKQLSDIINTELPLVIISK
                     LTDPRLNLSLEKYIYDYLPDPREPVNRFAKRLLLYKNSSCIVVGKNQNIFREVNMRLA
                     STYSIPILRRFSGGGTVVHDLGNMNFSFMSSKDEFSRTAFTNELVKKWNSNKYTEFQL
                     DINEKGDMVRKSDMKKVSGSAFQISKGRSLHHGTMLLNSDLKVLSKLLKIDPVRKANI
                     TDRATSSIPSPVTNTNIPPEVFIDVSVNSFLEKFGLPTNLESKINKHDFDNLKVLKTG
                     NLEVQVLKINDLLDLPSEIWDTYKQLKSWDWIFGKTPRFQIVMSLDNNTLSLKFDVDK
                     GRIISMEYDSKFENDNRLAELTTALSSKHTPVYFSIFSISKYIKDNQLLEEISWNIDQ
                     KVNLQNIGIKGLN"
     gene            562925..562998
                     /locus_tag="C5L36_0Etrna8I"
                     /db_xref="GeneID:40386417"
     tRNA            562925..562998
                     /locus_tag="C5L36_0Etrna8I"
                     /product="tRNA-Ile"
                     /note="PKUD0Etrna8I; codon recognized: AUU"
                     /db_xref="GeneID:40386417"
     gene            <563384..>564214
                     /locus_tag="C5L36_0E02710"
                     /db_xref="GeneID:40386068"
     mRNA            <563384..>564214
                     /locus_tag="C5L36_0E02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467825.1"
                     /db_xref="GeneID:40386068"
     CDS             563384..564214
                     /locus_tag="C5L36_0E02710"
                     /inference="similar to AA sequence:RefSeq:NP_015208.1"
                     /note="PKUD0E02710; similar to Saccharomyces cerevisiae
                     YPL117C (IDI1); ancestral locus Anc_8.610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323685.1"
                     /db_xref="GeneID:40386068"
                     /translation="MSLSAYHKLIKGLSAEELLKQFPEVIPLEQASGLSSSVTDLKSE
                     DADVFSGHDEEQIKLMAENCIVLDYNDVPIGSGTKKLCHIMENIKKGLLHRAFSVFLF
                     NSENKLLLQQRATEKITFADMWTNTCCSHPLCVESELGADQGDITDLESSVHGAKVAA
                     QRKLFHELGIEAVDIPLEDFKFLTRIHYMSPSNGPWGEHEIDYILVIKADAKFNPNLN
                     EVKDVKYVSQVELKEMFANPNLVFTPWFKLICESYLFKWWDDLDNLKENMSDNIDRML
                     "
     gene            <564660..>565799
                     /locus_tag="C5L36_0E02720"
                     /db_xref="GeneID:40386069"
     mRNA            <564660..>565799
                     /locus_tag="C5L36_0E02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467826.1"
                     /db_xref="GeneID:40386069"
     CDS             564660..565799
                     /locus_tag="C5L36_0E02720"
                     /note="PKUD0E02720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323686.1"
                     /db_xref="GeneID:40386069"
                     /translation="MIFAIFSTAVAILFSYIVLQHYAENASKLDKGDNNKLNILAPGI
                     VPVNNEFRWENQKPFPYKPFKKGSYKMTLAIRKLDPNDMFCIEDTYLDRVNLRKKIFQ
                     NEKLYGFHESAIESLKEAYTYIFLFLMRRYPMYFVLSTDSTTIDNKITGESFPLDPTN
                     LKPNQIMYNIVSNIEEDILILIKNPETSEMDEYVLRAAISLFPAGFNPLEKMNNPLTK
                     IHEPVPGYVNKLQLSMNKFFSRLNTHEYIVRNNWSIQTHCNLCAPSGSHATEEEATVI
                     HPFYPEELDYNKVFFRVEKQCFTRLAKTGSNLMVIRTYVTSLMELRDSLNDEEKETLC
                     SAIDGLTGELAIYKRRIQWGDAAKAFIRGESNGINTTAKKYLFVS"
     gene            <566062..>569109
                     /locus_tag="C5L36_0E02730"
                     /db_xref="GeneID:40386070"
     mRNA            <566062..>569109
                     /locus_tag="C5L36_0E02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467827.1"
                     /db_xref="GeneID:40386070"
     CDS             566062..569109
                     /locus_tag="C5L36_0E02730"
                     /inference="similar to AA sequence:RefSeq:NP_013412.1"
                     /note="PKUD0E02730; similar to Saccharomyces cerevisiae
                     YLR309C (IMH1); ancestral locus Anc_4.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323687.1"
                     /db_xref="GeneID:40386070"
                     /translation="MFSKISQIGKTFADEINRINDEVNNANSGEQVQIADPSIAKKIL
                     NTKTPEISNLTNPDDMERESTAESTGSDSEMKERLPLGEQSVSKIEELIPGTAVPAAS
                     LPPEIRSKMNKFLKYEKKYPELYNAYKLEKKKTALVKAFENMLKEQTPCSSIGELNSV
                     RDYLNGLTSKNQMLNDELSKLTKDKKVADEEISALKKSMKELQKALTTRKSQEAEELE
                     NLRKENKTLKNERLNKHKELTEYEQLAKENKKLENELNVMKAKIADHETERQELENIM
                     QEKDSLAAKLEEKCMENGEIIQNTRLLENNLEKSKEEFNKVKIEKEKTRVALEEKIND
                     LEKSLESNKKLNDMFRQKIDVLNKKSVGDNKDGPVNVKANGGLINGKKGGKKKSKKQN
                     SGAAACDSILAQSSSSSDVEVVELKHKVEEVEAKLSEEQAKSGELENRLKEKVIEIED
                     LNDMLRNVADSLVEAEKKNKEVADHQKKVEELELKLETKKSELEMLRIQNANALEDYE
                     KTKKSLSQKAEEYYNEYIKLESELSLKKEDISTMKHTIEDQESKICTLELSLNEAKAN
                     EEKLEAKNKKLREEVSSLKSEIEKMEQDGILHSSLKSDFEKAKLELSKKEKLLLEAEN
                     KIKFIQEEKSKINDSIIELKVQNKELKQQKLKFEDTRSGLCSENEKFKNELNESTLRI
                     NKLSLENTKLVKLYEELNDKYEEAKNFKSNSSSQVESLRKRVDELSMQNNEYENRIDM
                     IQEELTQSRNMLQERNHEMGTLRKMLMENEESQAHEIKQLKSKYDRLLEEKEHGDSEY
                     MVLLKNKQREIDELKRSLEKMNLRVEEVELHKNSLMLEIEKLHKTNELPSKTSTSKAS
                     SLADIHPADTEEYNSKVINTLRVSLKRAEKRLKEIEDINSKLRVSNQESSEKLIRLNK
                     KYKLLSQQYKRRLSDASASNSRKNSSINLDEGEADVLQHEPKELSDTQSEQTDVKEKV
                     TYIKNVLFGFLEHKEQRKMLLPVIKMLLYMSDDDTKRLTELLE"
     gene            complement(<569197..>570831)
                     /locus_tag="C5L36_0E02740"
                     /db_xref="GeneID:40386071"
     mRNA            complement(<569197..>570831)
                     /locus_tag="C5L36_0E02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467828.1"
                     /db_xref="GeneID:40386071"
     CDS             complement(569197..570831)
                     /locus_tag="C5L36_0E02740"
                     /inference="similar to AA sequence:RefSeq:NP_011875.1"
                     /note="PKUD0E02740; similar to Saccharomyces cerevisiae
                     YHR011W (DIA4); ancestral locus Anc_5.598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323688.1"
                     /db_xref="GeneID:40386071"
                     /translation="MECCSNICLTINFLLRKHILCKEFHTCSLFFFLPPCVTICSKKR
                     LMRIGNMFFYSHFLYDGKQRTRRLNPAQVMLRRTYSTLAADSAANLRTTNTLRKAQLD
                     LKNAYNNFDEYKLICQRRNVSFPLDDSFKADYERLQKVNETILNFKHESKNLQKALKD
                     LKIQEKKNNIDNSMEQEKILDKLSKYKPIVSEKSKIWTELEDKLFIQVASLPNLIHPS
                     VKEQQRLLEYINPTGEIIQSKTDDFQVQSNPKLDHKNIMERFGLVDFSQATKISGRGW
                     YYLIGDGALLEQALIQYALKSARKAGFKMALPPSIVKTEVTKACGFMPRDTNNETQVY
                     ELKNDDLCLTGTAEIPLAALNANKEFSHTELPLNVVGLSRSYRAEAGAAGRDTRGLYR
                     VHEFTKVELFSWTSPDETLSMGQFDSIVEFQKEFIKSLGLTARVLVMPHDDLGAPAYK
                     KIDIEVLMPGRGAWGEVSSTSNCLDFQSRRLITKVRDPSDKKLKFVHTLNGTACAVPR
                     VVLSIIENFYDPEKDVIVVPEVLRPFMDDKSEIRPQ"
     gene            <570845..>572230
                     /locus_tag="C5L36_0E02750"
                     /db_xref="GeneID:40386072"
     mRNA            <570845..>572230
                     /locus_tag="C5L36_0E02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467829.1"
                     /db_xref="GeneID:40386072"
     CDS             570845..572230
                     /locus_tag="C5L36_0E02750"
                     /inference="similar to AA sequence:RefSeq:NP_012112.3"
                     /note="PKUD0E02750; similar to Saccharomyces cerevisiae
                     YIL154C (IMP2'); ancestral locus Anc_5.710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323689.1"
                     /db_xref="GeneID:40386072"
                     /translation="MSLEGAIGEEKKLMSQLRGRQTKAESVSRSRSVSANPKVSRATT
                     RSNSAAHSIAEETPYPTSITFQDPSLRLLTEPVKEEDVNVSSEERLTDEEEELAFQDE
                     GRTLPNFAVPEESDTNRTDEIALMNERQMMKKAESAKVADSILASERAISNAKAIGRH
                     VPHQIMDTLEEKAKKAGTEIHVDPEEFYQEKTERKSKLEEYAVYKKRLIQSGSTTNTG
                     FIAPYTRDEENKIDTELAKMLNEKTKLSEVESDATHQRAIRTITRGNYFETLVSNDIK
                     HPKSFMLCMDFSEESKYALEWCVGTVLVDSCVLYILNVLEDDDYSSMHLNGIPSSGKE
                     SHTQHSTGASRERTRVNNVNEITKMVVDQLKRTKLQVHVVIESCHHPIPRHFIVGIIK
                     HISPTLVVVGSKGSSAIKGVLMGSLSNHLVRKSPAPVMVVRNRLKKMTKKTKFTNNIT
                     SLRGLADAKID"
     gene            complement(<572376..>574865)
                     /locus_tag="C5L36_0E02760"
                     /db_xref="GeneID:40386073"
     mRNA            complement(<572376..>574865)
                     /locus_tag="C5L36_0E02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467830.1"
                     /db_xref="GeneID:40386073"
     CDS             complement(572376..574865)
                     /locus_tag="C5L36_0E02760"
                     /inference="similar to AA sequence:RefSeq:NP_011517.1"
                     /note="PKUD0E02760; similar to Saccharomyces cerevisiae
                     YGR003W (CUL3); ancestral locus Anc_4.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323690.1"
                     /db_xref="GeneID:40386073"
                     /translation="MLHTGAKQQKTKTKIRPPRKSGSKTEVNPEESWKLLSTAIHDIQ
                     NKNASKWSFEQLYRIAYNLVISKNGKFLYQHVRDEIVDHLEKNVRGIIEELLITQHSN
                     EQEIDKFEAAKIINSFNSIWDDHLISIWLISQVVMYMDRTFTKENQLPLIYDVGLLVF
                     QNSIVMHELDHNNTTIGEQLINVFINYFNLNRNGDIIDKFMLKSTISIFESLSDPEGN
                     TYYSKFFEPELLRSSHEYYAKKVKELLDYQSGTIYVTKVIDLINDELARFQIFIPDQT
                     TNKLKDLMYTDLVFLNIKHILKLENDGLQKWIETRDYDLLGKVYKLTSRTESTKDIFK
                     ECLKTIIIKKGEHLKEISKIQTNESQTTNIDIDEKKKKSKKSNKELNTLFAINYIRNF
                     IIAKSNYDLIIIKSLDGDIEMHKEVEQACSTFLNENNRVQEYLSLFIDDCIKKSLKDK
                     SHKEVDEIFNESISIFRYIKDKDIFEKYYKNHLAKRLLNNKSISNELELMMINRLKTE
                     AGSSFTTKLEGMVKDIKTSEDITKMYEQSIANTSLLSDLARMNGGREFEVDYSILTPN
                     NWPIPVNKTMQDIDYVPALDIAKASFEKFYHSTYNGRNLTWAPNMCTIDLKMNFPSKS
                     YLINMPTLAAFIILTCFNDDDTEDGTKSLTFEEIKGKTKIPEQDLVRHLQSIAVAPKT
                     RILKKVPMSRDIRPTDSFSLNLEFKSPQTKFKILAVSVSSSSKNSGGKLDATSSTSKV
                     ESEAEHVETLASVQKSRELEVDAAIVRIMKARKSAKYQVLVTDVVRIIGDVSKRFRPQ
                     PSLVKSRIEELVEKEYLRRDADDRELFWYVA"
     gene            <575109..>577154
                     /locus_tag="C5L36_0E02770"
                     /db_xref="GeneID:40386074"
     mRNA            <575109..>577154
                     /locus_tag="C5L36_0E02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467831.1"
                     /db_xref="GeneID:40386074"
     CDS             575109..577154
                     /locus_tag="C5L36_0E02770"
                     /inference="similar to AA sequence:RefSeq:NP_011516.1"
                     /note="PKUD0E02770; similar to Saccharomyces cerevisiae
                     YGR002C (SWC4); ancestral locus Anc_4.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323691.1"
                     /db_xref="GeneID:40386074"
                     /translation="MSDILDVMNIKSFPQRQKKKKEPLQSQQNLVEARQIYTPEEYAS
                     DNQKRKLSAMNRELYNLIGTNVPPLAVDTASVTNAGGTKKFKAKLVTLKKDQPWRKLG
                     FKNSARDDDLILYHWAKTNLGKNVEGPKKEEEEEEEEEESSKIEIDPNEYRFTKYNTR
                     LEIPSFSRKEYDEAFRLYQDSQKKSMEIKLAQDKSKEEKEKERDNERETEKGEDKRKD
                     KGKEKEKEKKQETQNEKEKEEEKEKKPETQNEKEKEEDIKETSTINESVETVTKNNDN
                     EEKQIVDSVENNGEVTAEKVVKEEADTKANTETQTEIEESKESSEFSDPKEREWTYEE
                     TKKLFDLCSLYDMRWAVIYDRFQDDYPDRSLEDLKAQMYNISANLLEKRGDINDRALI
                     KSLRSFDKERELLRKHYLTRLIHRAPTEIAEEESLVIEARKFELAAKKMLYERGQLLQ
                     LLDSPQSSASVQQYLTSQGLTQLYNSLMSSEKSKKRKAEIPVAPLLGPNAIPHTQHIS
                     MSNAAAAATAAIHPTSSFSAAATASAGMSLSNSTNSSNKRRNAGTNVSGRSSTPLSQG
                     QKGVSKLSEIQQLLHKTLSEEDLQVYGIEIHQDRIQPGVYVRSQKIASFKPSVQAKVH
                     EILGQLGMSVKPTIPTGPVAKKFDELLHKISHLVDLKKQSDKLTTEIELVKRQKGLL"
     gene            complement(<577223..>577660)
                     /locus_tag="C5L36_0E02780"
                     /db_xref="GeneID:40386075"
     mRNA            complement(<577223..>577660)
                     /locus_tag="C5L36_0E02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467832.1"
                     /db_xref="GeneID:40386075"
     CDS             complement(577223..577660)
                     /locus_tag="C5L36_0E02780"
                     /inference="similar to AA sequence:RefSeq:NP_014246.1"
                     /note="PKUD0E02780; similar to Saccharomyces cerevisiae
                     YNL153C (GIM3); ancestral locus Anc_2.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323692.1"
                     /db_xref="GeneID:40386075"
                     /translation="MELLPEGTANKNDVTFQDQQQINRFSTLMTKFDRLNEKLKKLQS
                     EKEQIDDVSLELELVDEDELVDYLIGGEVPETANPNGVIIGDGCFVKLKQSQVMEKLQ
                     EKSDKLENEITETETDISSIEDTLKSLKSTLYAKFGNSINLEK"
     gene            <578826..>579938
                     /locus_tag="C5L36_0E02790"
                     /db_xref="GeneID:40386076"
     mRNA            <578826..>579938
                     /locus_tag="C5L36_0E02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467833.1"
                     /db_xref="GeneID:40386076"
     CDS             578826..579938
                     /locus_tag="C5L36_0E02790"
                     /inference="similar to AA sequence:RefSeq:NP_015360.2"
                     /note="PKUD0E02790; similar to Saccharomyces cerevisiae
                     YPR035W (GLN1); ancestral locus Anc_7.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323693.1"
                     /db_xref="GeneID:40386076"
                     /translation="MSPLLEKSQTLRKYLDLPQHGKVIAEYVWIDAAGNMRSKARTLN
                     KKINSVSELPEWNFDGSSTGQAPGGNSDVYLKPVAFYPDPFRRGDNIIVLTECWNNDG
                     TPNKFNHRYECNKLMNAHADEEVWFGLEQEYTLLDPVDNYIYGWPKGGFPAPQGPYYC
                     GVGAAKVYARDVIEAHYRACLYAGITISGINAEVMPSQWEFQVGPCEGIKMGDELWMA
                     RFLLERVSEEFGVKVTFHPKPLSGDWNGAGCHTNVSTKSMRVPGGMKQINEAIEKLSK
                     RHKEHIELYGKDNEQRLTGRHETASMETFSAGVANRGASIRIPRSVQAEGYGYFEDRR
                     PASNIDPYLVTGIMVETICGAVPDADMYQEFKRESA"
     gene            <580726..>581889
                     /locus_tag="C5L36_0E02800"
                     /db_xref="GeneID:40386077"
     mRNA            <580726..>581889
                     /locus_tag="C5L36_0E02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467834.1"
                     /db_xref="GeneID:40386077"
     CDS             580726..581889
                     /locus_tag="C5L36_0E02800"
                     /inference="similar to AA sequence:RefSeq:NP_012621.1"
                     /note="PKUD0E02800; similar to Saccharomyces cerevisiae
                     YJR088C (EMC2); ancestral locus Anc_7.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323694.1"
                     /db_xref="GeneID:40386077"
                     /translation="MDPLLDYLNTQSLTHSYINIDVEDIPHLHHAVCYYTQSPSVLHK
                     YEGLRNEPSRLPSFDFSQMKRTSPSQVDYKLRVRLYTMQLRLEIIMSEFRLAGGTISR
                     LKDLFAQLGLQDEIGALVQVITLRSELLEVEAVLQMDSDEKGTLFDHLAKVKNTVNSY
                     IDQSTKLVIDSANRTAALSITGMGTDALRDPVDLYAIEKRKTALDIDIANLAKIVKIK
                     DKSLDPLISSQETIHALFELLKQRPLDNEILIELAHQYLNIGKFKYALWCVSESLLIG
                     CNDAWNIWSLRGEICMLQSVALLKDEDGTNAARNWLNIAISSFCYSIELCEGYIRAWC
                     GIYRCLNKLKGFAELDSVQLSLLDISLKLLNEKKNDHAVALDERENIKWILGS"
     gene            complement(<581969..>582475)
                     /locus_tag="C5L36_0E02810"
                     /db_xref="GeneID:40386078"
     mRNA            complement(<581969..>582475)
                     /locus_tag="C5L36_0E02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467835.1"
                     /db_xref="GeneID:40386078"
     CDS             complement(581969..582475)
                     /locus_tag="C5L36_0E02810"
                     /inference="similar to AA sequence:RefSeq:NP_012619.1"
                     /note="PKUD0E02810; similar to Saccharomyces cerevisiae
                     YJR086W (STE18); ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323695.1"
                     /db_xref="GeneID:40386078"
                     /translation="MQTVQGSETFEYQQPNTPITTTSMESEESDTSPLKLKNGAKECS
                     TSNAYMERPKKQQNVQQAMLREKLIHAFRLNRKKQLTLERINKYNVKLMEELKTPRVK
                     ASNCALMVINYTEQTHDPLIPQVWGYPKKNKFKSLTYNGDDNKQRGRPAQSEGLDETA
                     TNGCCVIM"
     gene            complement(<583571..>586006)
                     /locus_tag="C5L36_0E02820"
                     /db_xref="GeneID:40386079"
     mRNA            complement(<583571..>586006)
                     /locus_tag="C5L36_0E02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467836.1"
                     /db_xref="GeneID:40386079"
     CDS             complement(583571..586006)
                     /locus_tag="C5L36_0E02820"
                     /note="PKUD0E02820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323696.1"
                     /db_xref="GeneID:40386079"
                     /translation="MADQDVFCSSKNILTGAPDSGQNKDSGEKVSENIQDKQTDFANK
                     FRRLRACARCHRLKMRCVFEDPNYESCTRCFKAGLRCSATVDPTSAMAKPRPRKKCKI
                     KGTGPLVNLQVSINEANKYIKTFQEENYSEVDAELNEENLAMLQDQLAEVQRLLAHTL
                     AIHRRRNSTNEADRREANTINSIKAGSVKSVPGLPWISKDANIVKELIKIGIITDTET
                     SQRLEYFKTELYPYWPCISFPKHYTYSWLLDNEPLLLLGCITVTTLNEPDLHDTLLYY
                     LEEALSLRVAITGNITVSMIDVYSILSLWCSPPKKWGSYKHQMSLMMALSLTLCLDIG
                     NEACKHSSTVLTDDSFDKQMVRTYMSVYASCGSLGLSLPKFKVVNWTPVHEKCSHLLI
                     KGETNQSDKFLHFFTRLVSIGEEIFQFFCPNGFNKKLSLANTQPKGTSKEFKITNNEL
                     RSTMIGYEQRMQTLARDSKLFSTSSKAKNLLSIIYYQLLMTMYDYVVCHVLDKREVVT
                     EVYLQTLTRLVKASEKVIESFTQLCNQTSNFPTFFYYRPMHALVALIRARLLIKAQHL
                     DLDVDVEKDYKKVCASIKNISSRSIVAKKMSVILTRVSKWMKVSNKFDKTGSTNLMMD
                     LLNELGKEKAVESIKIDLNVADQGDNMNLSDKSKIRLNNPRDCNDNIYNSFPDLVASS
                     ISMRPTSSVEGSSSTISMPSPIGFSSSEYSQTDEANRSSLKRAKNTDVQTSSEHPLVQ
                     LDTTLDDLTDIQKQQEFLHGLFSQIDSDIMGAEDQVSDTNLATPIPFMFDFLGSGPQA
                     SELPILEDWYKNL"
     gene            complement(<586251..>589154)
                     /locus_tag="C5L36_0E02830"
                     /db_xref="GeneID:40386080"
     mRNA            complement(<586251..>589154)
                     /locus_tag="C5L36_0E02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467837.1"
                     /db_xref="GeneID:40386080"
     CDS             complement(586251..589154)
                     /locus_tag="C5L36_0E02830"
                     /inference="similar to AA sequence:RefSeq:NP_009630.3"
                     /note="PKUD0E02830; similar to Saccharomyces cerevisiae
                     YBR074W; ancestral locus Anc_3.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323697.1"
                     /db_xref="GeneID:40386080"
                     /translation="MGVGSVLRNTFRFRKTSLTFLVFLTFIITIILQKVAVHNALKVT
                     NNNTELLNFAWEHLQIISSTKHPFTSPKNDELHDYLYDVVSSLSYDVPYVEVSSDKVN
                     NHTILINQHDVFNKSSDDNRVIFYESSNILVKIEGTDSQLSSVLLSAHFDSVPTSFGT
                     TDDGMGIASMLAVLKHLLQSGKQPKRTLVLNFNNNEEFGLLGAEAFMKHAWANEVEFF
                     INLEGTGAGGLPVLFRGTDKSVIDWYSNVRTPFANSIFQEGFNSGFISSQTDYHVYEK
                     FGLRGLDIAFYLPRSFYHTYKDSIKYTSKGSLWAMASNVIDILDDVLYSSKKYNEDLN
                     YSIYFDILNIWFFNFSMVQNFTINVLLLVTVPILLSILQLIVNRRKTWFVGIRGWSRF
                     PVALILSYYANKLLLMYLYNLNPLLVSVNYYLPLILSCCLTLLINYLVLNLANIIKPV
                     HEQKLIILLELNAISWISLVWMTYQINEYSNICGYVSTIVYLLTSIASLFGLLSFVFL
                     KSPCYKREYKVYYGSSEEATDEHTQEMSNNSSERTFSGPEVHDINDNANDDEDSDSER
                     QPLLNESEVIIDHETRDTFMHNIKQKALNSFQYDWLIQFLILVPISVFFIYSEGILTI
                     GALHETVQESSVYAKNVWDLVMAVGILLAIVVSPFIHKFNYVGIQITFLLFLFSLMCC
                     YFAPFSDESTPIKFRYVKTFDATTNKSISEVYGREGFILDTLTEVPTIAETDVKCTTY
                     NSSGTEMCTYEGTRPWLLSGTVEDNSYNSYLNVSILSNTNDGWSTDLRSVDSLDKFTP
                     LEAVLEIQVRESRQCYMTFNATNPKFKAPVKMITYYTEGNENNTDIGIDAVPNGMSRD
                     KHGNWIYKTMKGIDIFQMHKLSWESTASKSNIFLVKLQWLPFIYDNDVEVISNLGVNV
                     QCFWSDYDDIVDVNGTQHARVEDYLDLMKFTAIGVAWTNLRPGVVQGNGFVEI"
     gene            <589416..>590531
                     /locus_tag="C5L36_0E02840"
                     /db_xref="GeneID:40386081"
     mRNA            <589416..>590531
                     /locus_tag="C5L36_0E02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467838.1"
                     /db_xref="GeneID:40386081"
     CDS             589416..590531
                     /locus_tag="C5L36_0E02840"
                     /inference="similar to AA sequence:RefSeq:NP_010332.3"
                     /note="PKUD0E02840; similar to Saccharomyces cerevisiae
                     YDR047W (HEM12); ancestral locus Anc_3.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323698.1"
                     /db_xref="GeneID:40386081"
                     /translation="MYNIYLELYGQVMNFPELKNDLILRAARGETVERPPVWLMRQAG
                     RYLPEYHEVKGGRDFFETCRDAEIASEITIQPIDHFDGLIDAAIIFSDILVIPQAMGM
                     DVQMIDKVGPRFTDPLRTPEDLKRVNFSADVKKELDWAFKAITLTRTKLNGRVPLLGF
                     CGAPWTLMCYMIEGGGTKIFRFVKEWIFKYPEESKRLLKGITDVAVEFLALQVQAGAQ
                     MLQIFESWGGELSADDFEIFSLPYLKEIAERVPLRLKELGLEKVPMTVFAKGSWYALD
                     QLCDSGYDCVSLDWLYRPEDAVKVNKNRVTLQGNLDPCVMYGSRETITKEVERMIKGF
                     GGGKKHYIVNFGHGTHPFMEPEQIRHFLEEVHRVGSL"
     gene            complement(<590630..>592999)
                     /locus_tag="C5L36_0E02850"
                     /db_xref="GeneID:40386082"
     mRNA            complement(<590630..>592999)
                     /locus_tag="C5L36_0E02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467839.1"
                     /db_xref="GeneID:40386082"
     CDS             complement(590630..592999)
                     /locus_tag="C5L36_0E02850"
                     /inference="similar to AA sequence:RefSeq:NP_010244.1"
                     /note="PKUD0E02850; similar to Saccharomyces cerevisiae
                     YDL040C (NAT1); ancestral locus Anc_3.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323699.1"
                     /db_xref="GeneID:40386082"
                     /translation="MAKFEFVSPSSSIMSEADRLFRVALTDYESKNYKKALASVDKIL
                     KKAPHHSPTIALKALIVCFYHPNQPESKDVNALVTLSEETLAECQSLIERASEYDPKN
                     SIAAHLSALYYRQIKDYAKAAHYYTVAYSNNPYNKAILRDLSSCLSQLRKFPLLTKTR
                     FDYLQAEPGYRQNYSTTAMAYDLNGEYESAIKICEQIEEIIKDKLIEEDMVENSEAII
                     YKATLYIKLEQYEKALEYIDQQLDRTDKFRCYDTFGLLEMKYELLMKLGKYNEGQLVI
                     RQLLIKNPDNIDYYRDLFKCLQIEDNVDLKLKVLTKLAKFYPRSDLPKYLPLTFLKGE
                     LFESHLDAYMSGLFKRGVPSAFNAIKTLYKEKDHPQIILKVAEKYESSEKDPLNLTWI
                     KYFVSQHYYRLGDYENSMKKINEAIQITPTLIELYMYKARILKHQGKLADAVNEMNTA
                     RLMDLQDRFVNTKTVKYYFRANMIEEAIKTASLFTKNDEEPTGVKDLHQVQACWFIAE
                     YAEALARLFKEKLSLFQELEKKEPSATANDDGGNQDDDEINIHLIKKQVSAYLGLSLQ
                     RFFSIFSIYEEYYDDQFDFHFYAFRKGTFRAYHETIQWSDELFHQPFIGRIYSDVMTL
                     LQYTVENKDLLERALDLSTTTTRRSKKDKKDEIKWKESMLKYNKVYDSDSLATQLVEN
                     IVLKKDYSRIEKIENLIKVQNPSGKPETIDFLNGQFNYDLIEGRYVVALASLRKVKEL
                     ARGEGPTAERAKLVLDEMTRKLHKFIDAPSDDPKIQSLQKIVKLGLMRN"
     gene            <593816..>595051
                     /locus_tag="C5L36_0E02860"
                     /db_xref="GeneID:40386083"
     mRNA            <593816..>595051
                     /locus_tag="C5L36_0E02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467840.1"
                     /db_xref="GeneID:40386083"
     CDS             593816..595051
                     /locus_tag="C5L36_0E02860"
                     /note="PKUD0E02860; Pfam Domains: NUP(5.9e-141)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323700.1"
                     /db_xref="GeneID:40386083"
                     /translation="MNFKLLTTALSLASTVNGFKLDFPSSSVLAKPSYSVTAKPSASG
                     SKLPSPVQTAGFNETIYKEFTQHSPKMFVINMFSLEEEPFLESYDFVHEFEIPGLSPI
                     YNTIHCDKDYELCQVTTGEGEINAASTISALALSPVFNLTKTFFLIAGIAGISPHQGT
                     IGDVTFARFAVQFLEYEVDARDMPSNWTTGYFALGTDQPGEYPVNIYGTEVFELNENL
                     RDRALSLAQTAFLYNGTKANEEFRLTYNYAPANNTPKAIACDTLAGDTYWFGEDLDES
                     FANYTSLITNGTATYCTTQQEDNATLEALIRAGSYGLIDFSRIVVMRSASDFTYSDHY
                     SGNKSVEFFDHVYQGGITASLVNLVYASRPYIADVLENFETYDSGKYEPSNYIGDFFN
                     TLEDDISKRTWGNPTWGTA"
     gene            complement(<595309..>596670)
                     /locus_tag="C5L36_0E02870"
                     /db_xref="GeneID:40386084"
     mRNA            complement(<595309..>596670)
                     /locus_tag="C5L36_0E02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467841.1"
                     /db_xref="GeneID:40386084"
     CDS             complement(595309..596670)
                     /locus_tag="C5L36_0E02870"
                     /inference="similar to AA sequence:RefSeq:NP_012727.1"
                     /note="PKUD0E02870; similar to Saccharomyces cerevisiae
                     YKL194C (MST1); ancestral locus Anc_4.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323701.1"
                     /db_xref="GeneID:40386084"
                     /translation="MSRGGTLFLRNNGFFRQFCNHTHPPNGKNPSTSTATLELATKQQ
                     LYMLDQNSPGSVFFLPHGTRIFNKLLKFMKLQQEKQGFTEVITPLMYKKQLWETSGHW
                     AKYAEDMFRVEGNDQSKFDESERNDVYGLKPMNCPGHCLVFKRFNRSYKELPVRFSDW
                     SSLHRNEASGALTGLTRVRRFHQDDGHIFCTHDQVGEEISKTIKLIKICYGVFGLSKF
                     RMLLSTRPDNYIGSLEDWSRAESELSKVLDSELGVSNWSLREGDGAFYGPKIDILLTD
                     QFGKEHQAATIQLDFQLPQRFELEYQNDKDDYDVPIMIHRAIFGSVERFMALLIDHYA
                     GKWPFWLSPRQAIVIPINDAHKEHAKKVVKELSNEHEDFDAPTKLSEKKFYVDLDDRN
                     ETIGFRTKDAISKGYNYIILIGDKEIETGKLAIRSRDNRKIENIPVEQIIQKFNNLED
                     QYN"
     gene            complement(<596950..>601221)
                     /locus_tag="C5L36_0E02880"
                     /db_xref="GeneID:40386085"
     mRNA            complement(<596950..>601221)
                     /locus_tag="C5L36_0E02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467842.1"
                     /db_xref="GeneID:40386085"
     CDS             complement(596950..601221)
                     /locus_tag="C5L36_0E02880"
                     /inference="similar to AA sequence:RefSeq:NP_014981.1"
                     /note="PKUD0E02880; similar to Saccharomyces cerevisiae
                     YOR336W (KRE5); ancestral locus Anc_7.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323702.1"
                     /db_xref="GeneID:40386085"
                     /translation="MILGDFATFSLALLSIIGACVAETEIPPKNAVDISLAASWNRTP
                     YKLNVLEAAASVNESLYEPLVLKLLNIEPDYDNGEFNADEDYIEVSDSDFLNHAMSLL
                     HGDYEKYMFNLQLSNHLSTARINAHFQYYNTSVKDTHECDVDAVLFEPLGPSPQHYCD
                     PDAAFMLQNANYAFIFDTFKLPFDRRLGSTFTPSSYIIYGDYRDETFRKMFLNMYQFA
                     GTGKLNLVWRYVNTHPDNRPELLAGYGAALNLKKTDYIAIDDSGFTQEQESKLLELGS
                     NNKDETVNITDIYRHNFEKVQKVDLEDLSTIGLKFTKLISESKSQFKDLMTILAEFPK
                     YARTISKIGYSEDELKAVAGVADEDYGKFVENGIYINDALVPVEKTDLFEIFRAIKRE
                     VSFIKLLQAIDIHYDDARTLMSRFAQMISPYFASTKRRFNFSRYDDLVVYLNNIEEDY
                     KYSLFDSTIDAYIKKPDVNELPRAKENIHQMIFIIDLTDLEKLENLISFLRTMFIEAF
                     PIQFGVVPLSTSNELNEKITSQLYSAYAEDGREGAFKYLITLRSSLAGENHHPPDNFS
                     QLEEPLLKERLEKLGLFYKNFGIDHEMPTIFSNGVVFGFHKVVDALNNVFDDMLYLYD
                     MKSQIGEGETYSEFLRKDSVHSKDTNIVPERISQIKGNFIKPPSIIASKHWFSTDRLI
                     IEKPIIPGQAPITINLLGSFFNTEYIRQVEEVLRYSQTNEGIKIVISDVTPTKDFKKL
                     LQLQTVEEKISFLSTLVESDTEDNYKIRDYVRFCKEMFGLNFEKEYLNAYIVVAGRKV
                     QIKNFMDVHSIESLVHYECASRLNVLKELENEFDYNVPFKNEYDRFQHFAWVVSYTYF
                     FPAPEPYSASNIPRFHRYKFSEENTIIKQAKDELIEVDILIDPVSEYAQELVSFIPLF
                     EKESFITLKVHLRPKRSVDILPINRFYKELVNTDVNQVSEKIRFEKVPEKTLFNVELH
                     ETQRWLVSINNASTDLDNLMLDLTDSKSAFGEFLLENILVEGYTSNDATGLPLEISGP
                     SKYETTVLANTYFQLKANPGTWTIKIKDYTKGSLVYMMTEEVKTISVIELDGTIIDLD
                     VQKRWLMESISLVNPLNETGVKAFSEKMYAYFFETMDFIYSFIKPTQADINIFSIASG
                     HLYERFLGVMVSSVMKNTNSSVKFWFIENYMSPDFKKKLPLLSEKYGFDYELIMYKWP
                     VWLDSQRERQRTIWGYKILFLDLLFPQDLKKVIYVDADQIVRADLKELVDIDLEGAPY
                     GYVPMCDSKKEMESFRFWKTGYWKEFLGLKYKYHISALYVVDLEKLREVAGGNILRQQ
                     YQYLSKDPESLSNLDQDLPNLLQPHLKIYSLSQEWLWCETWCSNDTLKDAKTIDLCNN
                     PQTKEPKLNRAKRQIQEWVELDQENMILFSGSTEVLKEDLEHDEL"
     gene            <601566..>602312
                     /locus_tag="C5L36_0E02890"
                     /db_xref="GeneID:40386086"
     mRNA            <601566..>602312
                     /locus_tag="C5L36_0E02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467843.1"
                     /db_xref="GeneID:40386086"
     CDS             601566..602312
                     /locus_tag="C5L36_0E02890"
                     /note="PKUD0E02890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323703.1"
                     /db_xref="GeneID:40386086"
                     /translation="MIQQSVRTTLRQRQRFSSRFNLLSNTRYQSSSSNAKVLQEKEAK
                     LQQLHKTQKELQKAKLFKQQQQKKMLAEENANRKSTGVETIKLKKGFSNVNKVPETHN
                     LEPKDVLLDRLYQGFNPLLSPIKPALKKKQPKILVNILDDLQLDDDMFVSEEDEVIDS
                     MLGPKLTISKYIFDKDPQVEAKLKELDAMDAEEVNGGRSSADIVAASFEERGHSGQRG
                     RGRLRVQFKRNSKTPGPKSKSQKPSSEGEE"
     gene            <603478..>605511
                     /locus_tag="C5L36_0E02900"
                     /db_xref="GeneID:40386087"
     mRNA            <603478..>605511
                     /locus_tag="C5L36_0E02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467844.1"
                     /db_xref="GeneID:40386087"
     CDS             603478..605511
                     /locus_tag="C5L36_0E02900"
                     /inference="similar to AA sequence:RefSeq:NP_013721.1"
                     /note="PKUD0E02900; similar to Saccharomyces cerevisiae
                     YMR008C (PLB1) and YOL011W (PLB3); ancestral locus
                     Anc_6.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323704.1"
                     /db_xref="GeneID:40386087"
                     /translation="MLHLLGAATVLVSVVSAWSPTDSYAPGIVECPSYLNDKHNSTRA
                     GFLRRADGISDEEFEWIQQKDELTFDHLRTFLEGTGLNGTESFLDDIASNSSARIPRI
                     GLAFSGGGYRAMLCAAGQISGLDNRTRGVDEHGLPLLDSVSYIAGLSGGSWFVSSLVY
                     NNWTSVQEIIDQNGQDDAIWNLEHTIITPHGANIIKDAAYWKTLDDQIDEKRDAGFNA
                     SMTDPWGRGLSHQFFPGLEDFGASMTFTSLRNWDVFTEHVIPFPIVVADGRAPGTYIV
                     NLNSTVFEFNPFEMGSWDTYLETFVDLHYVGTTMDGGKAAGNGSCWSGLDNTGFVFGT
                     SSTLFNQFLLQINSTGISGVAYDAAEAVLKKLSKKENDIAPWFPNPFYNSPWGSAKNM
                     ISDHDLNLVDGGEDNQNVPLSPLLVEDRGVDVIFSFDNSADTDFSWPNGSSLVNTYER
                     QFVNASANFAFPYVPSTDTFLHNNLTAKPTFFGCYASNLTDLMKEVDTEYVPPLVIYI
                     ANRPWTYSSNTSTFKLSYDDDEKLAMIENGFAVSTFNNLTIDKDFKKCIGCAILQRSK
                     ERQGVPIGDECKACFDEYCWDGSTYTYEDDSYPDAFTDTGVYNSSVNQANPQEVQDVK
                     TSTDSTATESTSAMSTGTVSSISSTHKNDAGVVQNVSPWVHLLTTILGYCAFL"
     gene            <605845..>607329
                     /locus_tag="C5L36_0E02910"
                     /db_xref="GeneID:40386088"
     mRNA            <605845..>607329
                     /locus_tag="C5L36_0E02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467845.1"
                     /db_xref="GeneID:40386088"
     CDS             605845..607329
                     /locus_tag="C5L36_0E02910"
                     /inference="similar to AA sequence:RefSeq:NP_014247.1"
                     /note="PKUD0E02910; similar to Saccharomyces cerevisiae
                     YNL152W (INN1); ancestral locus Anc_2.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323705.1"
                     /db_xref="GeneID:40386088"
                     /translation="MSEFTTSVIGEAKSTQKEILHNTLVVVVTKAHGLRNVLKMDKQS
                     PFITMRIQNQEESTKVVPRGGQNPGFNDDLWFNLDGVEDKTLYINAYHQKKNDAKLIA
                     SGEVDFTPALKKSIEEGYDGWFDVYWEGKEAGKLYLEITYYPKKDELPNNTVNFARKS
                     AQSKNVTLKSDSHGVFKNSPIDINDTKIDNGLPELGESMSKLKSKKRSPHRFALKSSP
                     LRTSPTRSSSVLDSPRSDSSPARPSTGNTLMSYLDKTMKWPLFNNLGLGYGDSDSRKH
                     DEFEKMAEAQTKLKLKSPELMSERPKNLFSSYYETESDDNSLPDADEYYKQSVRSRQE
                     QIFKSDNERMVSLNTSRSDESDDSEEEITLGQSIEIKPHRVQRHQTEPILPFKTSARS
                     NAFTLDDAEMRRSYQSKKLPDIINDSDDSNDEDIPPAPPKHLMSVGPLFDGRKSSRMS
                     NFARDEHRPIETSNGRSIIYSETSPEKITSWYERRKTNRRQQKS"
     gene            complement(<607437..>608132)
                     /locus_tag="C5L36_0E02920"
                     /db_xref="GeneID:40386089"
     mRNA            complement(<607437..>608132)
                     /locus_tag="C5L36_0E02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467846.1"
                     /db_xref="GeneID:40386089"
     CDS             complement(607437..608132)
                     /locus_tag="C5L36_0E02920"
                     /inference="similar to AA sequence:RefSeq:NP_014248.3"
                     /note="PKUD0E02920; similar to Saccharomyces cerevisiae
                     YNL151C (RPC31); ancestral locus Anc_2.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323706.1"
                     /db_xref="GeneID:40386089"
                     /translation="MSFKGGQRQLLPFGLDWADITQNSINELEFPMPVNGEPTKIEVE
                     NYQQFLSLTSIMKDSSFYTGNLKSLAQEQGNSGRQKKNIAYLEGGVNDGLKRYSDKYR
                     KKIQIGRSIKDHPFIEKFFPDELQSVISSKSGKKSLNVSKYRKGSRFGTDIDKLIKNA
                     EQRQKEIMERLNEVAANNNDDDVEEDNQDEEDNMDDEFDDDDDDDYNAEKYFDDGDDF
                     DEGDVDGDDEAAF"
     gene            complement(<608441..>608872)
                     /locus_tag="C5L36_0E02930"
                     /db_xref="GeneID:40386090"
     mRNA            complement(<608441..>608872)
                     /locus_tag="C5L36_0E02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467847.1"
                     /db_xref="GeneID:40386090"
     CDS             complement(608441..608872)
                     /locus_tag="C5L36_0E02930"
                     /inference="similar to AA sequence:RefSeq:NP_014250.1"
                     /note="PKUD0E02930; similar to Saccharomyces cerevisiae
                     YNL149C (PGA2); ancestral locus Anc_2.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323707.1"
                     /db_xref="GeneID:40386090"
                     /translation="MDLVIGFAERIQTRVFGDLDAYKFIRLVIIIGGYIFLRNRVSDY
                     LKQKQLKEQIIRDKQMREEKLINDPTGEIERAANEDLFAEHEGIGKSEKAWGWGKATR
                     RKVAKQKALFEQEIERAAIEAQSKLQKGYDSDEEINEFLQD"
     gene            <608980..>609579
                     /locus_tag="C5L36_0E02940"
                     /db_xref="GeneID:40386091"
     mRNA            <608980..>609579
                     /locus_tag="C5L36_0E02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467848.1"
                     /db_xref="GeneID:40386091"
     CDS             608980..609579
                     /locus_tag="C5L36_0E02940"
                     /inference="similar to AA sequence:RefSeq:NP_009990.1"
                     /note="PKUD0E02940; similar to Saccharomyces cerevisiae
                     YCR063W (BUD31); ancestral locus Anc_6.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323708.1"
                     /db_xref="GeneID:40386091"
                     /translation="MEIYQQLGNSTQSLRNRTEYGQQNNATTGYAFDGNLSAGANDIR
                     QGEMTAGKNNKITSNPVKISKRSSPPKGFLKIQPTLKKFEDKLKELESEEHSSARPKH
                     ELHWDLHRINHQKSRYVYSLYYQRRLIDKQLYLWLLKHRFANGQLIAKWRKQGYETLC
                     CLECIGETVCVCRVPKSVRKTDPDFRCVKCGCRGCASSD"
     gene            complement(<609632..>610066)
                     /locus_tag="C5L36_0E02950"
                     /db_xref="GeneID:40386092"
     mRNA            complement(<609632..>610066)
                     /locus_tag="C5L36_0E02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467849.1"
                     /db_xref="GeneID:40386092"
     CDS             complement(609632..610066)
                     /locus_tag="C5L36_0E02950"
                     /inference="similar to AA sequence:RefSeq:NP_014252.2"
                     /note="PKUD0E02950; similar to Saccharomyces cerevisiae
                     YNL147W (LSM7); ancestral locus Anc_2.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323709.1"
                     /db_xref="GeneID:40386092"
                     /translation="MSETDNPVKVMDAQNSQQGEQQQSHEQNQNTDQSTQKRNRQQKK
                     NAYAPKRGPIMDLKPILNKQVSVKIASGRQVQGTLTGYDQLMNIVIENAEVTTPEYIS
                     EGEAQVEKLDKVVIIGRLIVAFEPLDGFEIINTKGEHFDFVI"
     gene            complement(<610354..>612822)
                     /locus_tag="C5L36_0E02960"
                     /db_xref="GeneID:40386093"
     mRNA            complement(<610354..>612822)
                     /locus_tag="C5L36_0E02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467850.1"
                     /db_xref="GeneID:40386093"
     CDS             complement(610354..612822)
                     /locus_tag="C5L36_0E02960"
                     /inference="similar to AA sequence:RefSeq:NP_011371.1"
                     /note="PKUD0E02960; similar to Saccharomyces cerevisiae
                     YGL144C (ROG1) and YDL109C (YDL109C); ancestral locus
                     Anc_2.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323710.1"
                     /db_xref="GeneID:40386093"
                     /translation="MALKRETERGEVTATVTATAMVTETETLTTDTGMETPLDVLYRN
                     TQALHVGDVHRFIITYTPTDITKELGSHLYIKIKNTENVLMNSALLTGPYMLYCDIRS
                     QEYTHKKKCFVSDDQPVYDPNIIPGNSLVHRLTLNRLKDKYTWYVDVISQIVFSTSAE
                     INFEIVIAKSEAALSSSSVNHLKNSNYYPQCLHIQHLTTLDIWNKPPQSSTDPIHLVI
                     LTHGLHSNTSADLFYMKEQIEEMASSTGENIVIRGYFGNVCKTERGIKYLGRRLAEFV
                     VNESLKGLDVSKVKKVSFIAHSLGGPVQTFAISYINYNYPEFFQNIAPENFITLASPL
                     LGISNENPAYVKVFLKFGIVGKTGQDLNLDGAEPLLLLLPSEPTRKILKRFKRRTVYA
                     NVLNDGIVPLRTSALLYLDWKALTKIYETLHNGDSSNMKRNDMNETGEIPVEMNKEMD
                     NAENIEVGTNLASSIKSKFQSTLGFCFPNMQASKTTQKYNYFQTTEDTVPENDNGRLD
                     LTRESMTPIPRSSVLSSLRKVLLPPSPSPKYINDPKSRDNVILHDKIYTPDMIPKSHT
                     VLSKNVIISHLTQNKRHRFFEEKIARRWHQGMTWKKVLVNLQPDAHNNMIVRRRFANA
                     YGWGVIDHLVETHFSNDCFKGADLEQWEYKKKIDDNIELDEAELKHLNSQLGKVIDRE
                     YLKQNTVHTPCRLKKIFSDSSSPSPSDPDCKARHNEDKEVTRTKGSELSQHYKDTPNG
                     EVNEHEAVSVYSGTSSAINDGAWLNETESGYYDGPTGMINTVNEWKDNMLYPKSNGRG
                     TDSKNAVPPAIERNECSTYFFENV"
     gene            <613587..>615635
                     /locus_tag="C5L36_0E02970"
                     /db_xref="GeneID:40386094"
     mRNA            <613587..>615635
                     /locus_tag="C5L36_0E02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467851.1"
                     /db_xref="GeneID:40386094"
     CDS             613587..615635
                     /locus_tag="C5L36_0E02970"
                     /inference="similar to AA sequence:RefSeq:NP_013826.1"
                     /note="PKUD0E02970; similar to Saccharomyces cerevisiae
                     YMR108W (ILV2); ancestral locus Anc_2.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323711.1"
                     /db_xref="GeneID:40386094"
                     /translation="MLSRSFAKSATRFPAASRTALSMRSTAKTFLNSKHIPYYSISAA
                     RFKSSASTIVREAPAPAFNQELDDTTGNVSNSNGDFDSSLIGKTGGEIFHEMMVRHGV
                     DTVFGYPGGAILPVYDAIYNSDKFRFVLPRHEQGAGHMAEGYARASGKPGVVLVTSGP
                     GATNVITPLADALADGIPLVVFTGQVPTSAIGTDSFQEADVVGISRSCTKWNVMVKNV
                     AELPRRINEAFEIATTGRPGPVLVDLPKDVTAAVLKHAIPLSSSIPKKTIPALSKSVS
                     TQYTVECIERAVELLKKAKKPIIYAGAGVLSSDDGPKKLKELADKACIPVTTTLQGLG
                     CFDQNDPKSLDMLGMHGSGVANMAIQNADLIIALGARFDDRVTGNIAKFAPQAKLAAQ
                     EGRGGIVHFEISPKNINKVVEATEAIEGDVTENLELFNKLAPQMESRPEWFRLIDEWK
                     EKYPYSYQMETPGSLIKPQTLLKTISAEAHKTGKEVIVTTGVGQHQMWAAQHFTWTKP
                     RTFITSGGLGTMGYGLPSAIGAQVAKPDALVIDIDGDASFNMTLMELSSAIQANTPVK
                     ICVLNNEEQGMVTQWQSLFYEHRYSHTHQSNPDFMLLAQSMGLNGVRVTKQEEMIPGI
                     REWLSTEGPCLLEVYVEKKVPVLPMVPAGKGLDEFIFFDPEVEKQQAELRHKRTGGKH
                     "
     gene            complement(<616063..>618753)
                     /locus_tag="C5L36_0E02980"
                     /db_xref="GeneID:40386095"
     mRNA            complement(<616063..>618753)
                     /locus_tag="C5L36_0E02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467852.1"
                     /db_xref="GeneID:40386095"
     CDS             complement(616063..618753)
                     /locus_tag="C5L36_0E02980"
                     /inference="similar to AA sequence:RefSeq:NP_012505.1"
                     /note="PKUD0E02980; similar to Saccharomyces cerevisiae
                     YJL029C (VPS53); ancestral locus Anc_5.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323712.1"
                     /db_xref="GeneID:40386095"
                     /translation="MNSLKNEIINSRVDSRKNGSQTLEKDGLANIPSPDVNSSNYDPM
                     VDIFELFDTPAALNDINHILKYSCAYQTKLEKEISKEREEYKKVLMESNPEKDYSKLD
                     SELIKILDDFGKLKVNVKETEKSINEMTSSIKKLDHSKRNITFTMTTLKRLQMLVTAY
                     DKLERQMEREKQVKNYKEIKQLLSAVLELNKYFQDFKSIDEVNQLNNLILKKKNHIID
                     DVMHDFELQFHEELNNDNLVEACYILEMLGESNSLKLKQWYTDASLREINQIFTSSEE
                     AGSLENLSRRYIYFQNILSNFVLKSSKIFPESWHMDLLLVEKFCEFTKKDLQEVLEKE
                     MRLKGISDVNVLLNALSNTLDFEQFLNKKFKYHKDFDESMANPSAPDFTKSISNVFEP
                     YLNIWIDEQSKTIEKKLMEFSNPSNLFKKTGDNEDSTNNNIDSGETINVLESAAELFR
                     LYRQMLSQISKLTSGKSLIKLTRLFNRYLNQYQRKILDSILPDSKSLVSVDLENQKEG
                     VDIICLVLNTSSYCSATIIQLEEKIKSLIQPAELSEKVELNSSNDGFVQLIAYCISLL
                     FYKVENDIQIAWKELSNFNWVVLNEVVGESRYVTTLKSIIKEDCDYIFPRLSKSSYIR
                     NLLDRMVDMLLNKILSVVVKLTPVSVIMAEQIKLDLQELKTFVNFLPTITENGEKVLA
                     SASFKANVNMKFKQIDNLMKILMVPDKPVDTFINSYFTIIGDSSFSNFMKVLQLKGVM
                     DIQATEKDKFKYMDMFKLQLGSYEDSSHELKESDEFLEKINLANTTLTTVRSHGHKKS
                     NSRSIYLPSTVGSSNLTSNSSSNYTLPNLLTPPEPPSHAILNNGSPAPSSTSTSPRPN
                     FGFFNNAKLDTISIEKNLKAFTENKTNFNEKFQKFFKRGE"
     gene            <619071..>620738
                     /locus_tag="C5L36_0E02990"
                     /db_xref="GeneID:40386096"
     mRNA            <619071..>620738
                     /locus_tag="C5L36_0E02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467853.1"
                     /db_xref="GeneID:40386096"
     CDS             619071..620738
                     /locus_tag="C5L36_0E02990"
                     /inference="similar to AA sequence:RefSeq:NP_012526.1"
                     /note="PKUD0E02990; similar to Saccharomyces cerevisiae
                     YJL008C (CCT8); ancestral locus Anc_5.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323713.1"
                     /db_xref="GeneID:40386096"
                     /translation="MSLKLPGNINSSLFKQGYQVHSNTDGAINRNIQACREISKMIST
                     SIGPCGKNKIIVNNLSKIFITNDAATMIRELDIVHPAVKVLVMHSEQQEEEMGDNTNY
                     VLVLGGELLNLAEKLVVLGLTPTEIIQGFRMANKFVNNELEQLVVGQIVDFQSKEQLL
                     KIIKPVIMSKQYGQERIISDLVATAVQQVMPKDRPQAFNVDSVRVVKIMGGALTNSFV
                     IKGMVFPREPESEVKKIRETAKVAVFNCPVDISASETKGTVLLHNADEMMNFSKGEED
                     ELHKVIKEIADSGVKVIVAGQGIGELALHFMNKYNLLVLKVPSKFDLRRICRICGATP
                     LVRLGAPMPEEMGIIDVVESKEIGSDRVTVFRQNEETSMTSTIVIRGATKNNMDDIER
                     AIDDSVASIKSVVRDPRLLPGAGSTESELVKRVTNYGEKTPGLMQLGIKKFAEAFEFL
                     PRLLCETSGLDPSEILPRLYASHDENDKETLKFGIDIESDNVNDCLLDITEENIYDSY
                     ISKLNAINLATEAVCTILSVDQIIVAKKAGGPAMPQQPKPGNWDQAD"
     gene            complement(<621073..>622608)
                     /locus_tag="C5L36_0E03000"
                     /db_xref="GeneID:40386097"
     mRNA            complement(<621073..>622608)
                     /locus_tag="C5L36_0E03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467854.1"
                     /db_xref="GeneID:40386097"
     CDS             complement(621073..622608)
                     /locus_tag="C5L36_0E03000"
                     /inference="similar to AA sequence:RefSeq:NP_010659.1"
                     /note="PKUD0E03000; similar to Saccharomyces cerevisiae
                     YDR371W (CTS2); ancestral locus Anc_5.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323714.1"
                     /db_xref="GeneID:40386097"
                     /translation="MALKSLYVCAIIYAIFPHLAVSTATSEAGNDFITAIYYSSWSYP
                     NQAPSDIPLSRITHIFYAFAGMNQHTKNIAFEKAGVELHQGIPFETDALRNDINDLTS
                     LCNSDDVDSIQYRDLPWVGSYLQNSAQFLLDFHINASGIVGQLGQIRQLNPRLKVSLS
                     IGGDGAFKEWKKMASKISYIEQFVGNVVANIEKFNFDGVDIDWEFPSTKRESIMLTNV
                     VKYFRFYLEKKYPREHKILTVAIPMDVQSLTLFQFQKIDKYVDFYNLMGYDASGKWSR
                     VSGYHSPLYPDSKIPGSSLSVDTAVQFLSNYINSSKIILGMPAYGVSFNTDKMYDKFT
                     DCAKIRLSHTTNDVDESSTDNYNDYTNDCIVDYVNLPPPGYVEVEDLRIGSSYAYSTV
                     KERKGIIVYDTPNIARVKANYVVRNGLGGGMWWDSKGDPLTKNTSRSLVYNFIDELGG
                     ILKLTSNITMFSELRPQFRGGIVSQPVTDQDFQISHASPNFSVYNIGRIIWLCLFYCT
                     FFS"
     gene            complement(<622887..>623753)
                     /locus_tag="C5L36_0E03010"
                     /db_xref="GeneID:40386098"
     mRNA            complement(<622887..>623753)
                     /locus_tag="C5L36_0E03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467855.1"
                     /db_xref="GeneID:40386098"
     CDS             complement(622887..623753)
                     /locus_tag="C5L36_0E03010"
                     /inference="similar to AA sequence:RefSeq:NP_010303.3"
                     /note="PKUD0E03010; similar to Saccharomyces cerevisiae
                     YDR020C (DAS2); ancestral locus Anc_3.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323715.1"
                     /db_xref="GeneID:40386098"
                     /translation="MFLIHESIQPGISRGWYSNYLFKLETMSSEISTILVLIAGGHSS
                     GKECGATLLKEQLLSRFKHDVLNIQTINMQDYMSESAGCGSRAPLQFNFDQIKNDLTQ
                     QMNDGISDVIILYGLYALYDKEIVEMATIRTYIDCDADVRLGRWIKRDILQDEKDGEN
                     EQKKLELLLNVYLNYSRHEMKTYIQDTRERADVILPRGADPVGFTLVLDGIQPLLIKK
                     LERKTVSFSDTESSLSVTPNIQQPQRSFSTSSMNRETVISHLKELSQEPSVKSLSNDN
                     FANSNKIYYELN"
     gene            <623917..>625107
                     /locus_tag="C5L36_0E03020"
                     /db_xref="GeneID:40386099"
     mRNA            <623917..>625107
                     /locus_tag="C5L36_0E03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467856.1"
                     /db_xref="GeneID:40386099"
     CDS             623917..625107
                     /locus_tag="C5L36_0E03020"
                     /inference="similar to AA sequence:RefSeq:NP_010304.3"
                     /note="PKUD0E03020; similar to Saccharomyces cerevisiae
                     YDR021W (FAL1); ancestral locus Anc_3.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323716.1"
                     /db_xref="GeneID:40386099"
                     /translation="MEFDRELDKELKFKTSKKVPVTPTFEAMGLKESLLRGIYGYGFT
                     LPSAIQSRAITQIISGRDTIAQAQSGTGKTATFSIGMLEVLDTGNRSTQAIVLSPTRE
                     LAVQIQNVIRALGDYMNIRVHACVGGKSVGEDVKALTKGQHVVSGTPGRVLDMIKRRS
                     MTTRNVKVLILDEADELLGKGFQDQIYDIYRHLPPGCQVVVVSATLPKEVLNMTKKFM
                     SDPVKILVKRDEITLEGIKQYFVQVEKEEWKFDTLCDLYDSLTITQAVIFCNTKKKVD
                     WLASELKKANFTVVSMHGDMKQEERDKIMNEFRLGNSRVLISTDVWARGIDVQQVSLV
                     INYDLPTDRENYIHRIGRSGRFGRKGVAINFVTEEDVSTLHDIENYYSSQIEEMPVNI
                     ASIM"
     gene            complement(<625251..>626633)
                     /locus_tag="C5L36_0E03030"
                     /db_xref="GeneID:40386100"
     mRNA            complement(<625251..>626633)
                     /locus_tag="C5L36_0E03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467857.1"
                     /db_xref="GeneID:40386100"
     CDS             complement(625251..626633)
                     /locus_tag="C5L36_0E03030"
                     /inference="similar to AA sequence:RefSeq:NP_010306.1"
                     /note="PKUD0E03030; similar to Saccharomyces cerevisiae
                     YDR023W (SES1); ancestral locus Anc_3.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323717.1"
                     /db_xref="GeneID:40386100"
                     /translation="MLDILQFIEEKGGNPQAIRESQKKRGASVEIVDEIINEYKEWVR
                     LRFVADELNKKLNKVQKEIGLKFKAKEDASELLKEKDSIIAEKKAAIEREQAADKQLR
                     SKVNQVGNIVHESVVVSNDEENNELVRTWTPEGTEFDKLTNVATATGAPAKLSHHEVL
                     LRLDGYDPERGVKIVGHRGYFLRQYGVFLNQALINYGLSFLAKKGYTPLQAPVMMNKD
                     VMAKTAQLSEFDEELYKVTDGDDEKYLIATSEQPISAYHSNEWFESPAEQLPIQYVGY
                     SSCFRREAGSHGKDAWGIFRVHAFEKIEQFCITEPEKSWEMFDIMINNSEEFYKSLGL
                     PYRVVGIVSGELNNAAAKKFDLEAWFPFQKEFKELVSCSNCTDYQSRNLEIRCGIKTQ
                     NQKDKKYVHCLNSTLCATERALCCVLENYQTEDGLVIPEVLRKYIPGEPEFIPFVKEL
                     PKNSTSNKKK"
     gene            complement(<627028..>627726)
                     /locus_tag="C5L36_0E03040"
                     /db_xref="GeneID:40386101"
     mRNA            complement(<627028..>627726)
                     /locus_tag="C5L36_0E03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467858.1"
                     /db_xref="GeneID:40386101"
     CDS             complement(627028..627726)
                     /locus_tag="C5L36_0E03040"
                     /inference="similar to AA sequence:RefSeq:NP_013515.3"
                     /note="PKUD0E03040; similar to Saccharomyces cerevisiae
                     YLR411W (CTR3); ancestral locus Anc_4.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323718.1"
                     /db_xref="GeneID:40386101"
                     /translation="MSQVFLPYEMQQKMDMAGSGAATSHKCKISMLWNWYTIDSCFLA
                     RSWHVTSRGMFAGTCIGIFFWVISYCWLHRFIVEYDNSIINFKQKKHGIDACQSCCGP
                     AGESNNIANTDDSSEDKHSSSDHQVIDVNTNRPGSDIWAPLLQTFSHRWFIGWLKKKD
                     NVIYPNPLEHIGRSGLYLMEWTISYLLMLMWMYYNGYVIITMILGYFFGQLIFNYTPL
                     TVVPARTYMTPSCQ"
     gene            <628159..>629043
                     /locus_tag="C5L36_0E03050"
                     /db_xref="GeneID:40386102"
     mRNA            <628159..>629043
                     /locus_tag="C5L36_0E03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467859.1"
                     /db_xref="GeneID:40386102"
     CDS             628159..629043
                     /locus_tag="C5L36_0E03050"
                     /note="PKUD0E03050; Pfam Domains: Ctr(1.5e-14)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323719.1"
                     /db_xref="GeneID:40386102"
                     /translation="MDGTSTMNHMAGMNTMNGMDMSSITGTFTISPTSTMHMSMGGMG
                     AMSESAMSMMTDIATATMSEMAGMSGMETKSGSMPMSSSTGMAAMGHGGMKMKCSMSM
                     LWNWNTKDVCFISKQWKTSTRALFGGTCVGVFALLLAINWWRRILVQYRVYSAELRKT
                     EVENWLQAGHPVGDTHTTFTNVDFTKRYNMVAEALIPLLEACKHKWFWALNKNLAVQV
                     DDMVYVYPSILEHILYCIGDTMEWSVHHTIMLLFMYFNGYVFISCMIGAFIGFMLFQY
                     KEIDPTRRGDNVSKRCCL"
     gene            complement(<629255..>629660)
                     /locus_tag="C5L36_0E03055"
                     /db_xref="GeneID:40386103"
     mRNA            complement(join(<629255..629526,629654..>629660))
                     /locus_tag="C5L36_0E03055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467860.1"
                     /db_xref="GeneID:40386103"
     CDS             complement(join(629255..629526,629654..629660))
                     /locus_tag="C5L36_0E03055"
                     /note="PKUD0E03055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323720.1"
                     /db_xref="GeneID:40386103"
                     /translation="MAEFQHAPEVSFDEIDYRNASDLKNAQESLLKEQFVKIEVLKIV
                     RKSLENCFKVNGPNGYEDCREIADKYLALLPESRAQGYLGYQRNDPTK"
     gene            <630820..>633738
                     /locus_tag="C5L36_0E03060"
                     /db_xref="GeneID:40386104"
     mRNA            <630820..>633738
                     /locus_tag="C5L36_0E03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467861.1"
                     /db_xref="GeneID:40386104"
     CDS             630820..633738
                     /locus_tag="C5L36_0E03060"
                     /inference="similar to AA sequence:RefSeq:NP_009943.2"
                     /note="PKUD0E03060; similar to Saccharomyces cerevisiae
                     YCR017C (CWH43); ancestral locus Anc_1.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323721.1"
                     /db_xref="GeneID:40386104"
                     /translation="MVASSSVSRPLLRINAQFVAIAHTICSASAFIAAFVIGYALHFE
                     KIVRNEYFGYPDEWFPSVSATIGDRYPERSVFQILIALTSGPRFLLLFFSYIRLYKPN
                     SSFPKVALISGIIRTVTCGGWVYITSTDDHDWHDIFMISYIVLTLPWDISIIKLTSPG
                     TTLKKYRKLTAYAFFGTLFPLIYLFVQHKIHHTPGSYSYYAYTEWLLIVFDILFDSWA
                     ILDFRDLYLEIRPTDLNDEFFSINFRVSPYSAGADAASSSNFSSKNYDHYGPEKSNFK
                     LSDNFIPKNSEFNGSYIQIMINIVNAYMFWTIFTALFLCIWYFPLWYMGISGYELVII
                     TSLSPILLKFKKLREFAYTYPNKIRFYACIFGVGSFMISDPMLRLFSISIGNALSFIG
                     LTSEVALLGMTKSSTIIRSYATTFMLGLTLTSIGKFAYWTNNPVWPILNEKTGGLNKI
                     GIVIGLLAAHYTQFPKALASKTKDYEDNVSTSWKYVALAFGSLMFSWMSMLTDSSVII
                     TWVWDGYPISGPTPVPHGAVTLSVMLFGIYFGFYNPRSYKLITGLGIIGSVILYSFHG
                     WLGYFGGMIYTFWLTYVSQICFEQLSGYYDNIAKVMFAALSVTTILVLMHVWVVAYAF
                     VPGGPLLRERTDIVLGSSVLLIAMFVYGLKGIELNHIKVKKHISKFNNIIVSLLFLSG
                     IIAFNRFQYSVPKPYHPKSRLVTAGIWTIHFGLDNDMWASEYRMRDLIRDAELDVVGL
                     LESDTERIIMGNRDLTQRIAEELNMYADFGPGPNKHTWGAALLSKFPILNSTHHLLPS
                     PVGELAPAIHATLDMYGTLVDVVVFHSGQEEDEEDRRLQSLELQRIMGSSDRPMILLS
                     YLVTTPHEGNYHTYVSEESGMHDIDVTDDDRWCEYILYKKMKRTGYARISRGSITDTE
                     LQVGKFVVPFPDEYDETYSQDVVPEVWMNVDRRFPDIFRGDGVRDHRYHVFEEPKYYI
                     "
     gene            <634252..>636924
                     /locus_tag="C5L36_0E03070"
                     /db_xref="GeneID:40386105"
     mRNA            <634252..>636924
                     /locus_tag="C5L36_0E03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467862.1"
                     /db_xref="GeneID:40386105"
     CDS             634252..636924
                     /locus_tag="C5L36_0E03070"
                     /note="PKUD0E03070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323722.1"
                     /db_xref="GeneID:40386105"
                     /translation="MTGNHTAKPSYFGDQLIYEFPSPKEEVDDDGSPRGVTPKIIERA
                     GSIFIKSGIPKVTPFPRFEYEDDDIDLVESTTTVDQNTVGGNTWDNDRITVDNSDPAK
                     REKVYSCIEHDPNNHNLASLTPENSLGSSLLSDIGVNDAQVYEDDVVDILTEDNANSQ
                     VFYTNKEEEPSSIRQFDDANPEAIPTLHKEVSLSKTSKEEELLRSRPSLRQVDSTKRR
                     KFVNPYLKNSLIRKYKNIHKEEISVQETDTNDDSSGTGINLEELEIPRRSSKRIQRMS
                     NSVRRAFLPALQSLEESRNYSRNSSVGRSRVSRLSSSRTLKTLGNSIRKKNNEQLSRK
                     TSKLNGDSIKTIKTLATEIRRSTHDKNRSSVDFEKLDQLLQELINIQSEESLVSSRRP
                     TTSSVSKSTSHSHSTISETKFTHGEEPIEFPGVQPYSAKEVSRQNSLRRSLSTLSTKL
                     ERLNNTYSTKVPPTCVSKKPSTLMGERKRSSTGNPNSHCELKRSNAVKRKYGFITPLV
                     LFLKSIGNASKKSWRFIRASGKKVLFRGRNQEKSVYARSNKNKSLTKPKIGKPVVVDI
                     HQTPFKTHNLNREVVPERKFLPIPQNTTVIDDCNVGDVGDVGEGEYDFGDDFDDVVDQ
                     VASDLEVIPSNDTGKEEPLEGDGEKLVGVWKHYLSESIVNRVNLKVDLSKAEQLERVE
                     SVQSKRSRITSIEDYKRREFDNLVYKYIGGGSSTSLSVSTASNGSSTGYYASANESVN
                     DESIRNSISKSSLSTWSTISTGYTGSATDEHSYTGSSEEDDISTIEEENDTDISSIED
                     VYDTYSLVSHAAGQPESDEITKSVSTRSGISDSSSRRSSLKHSRGMTNLKSILHRENT
                     MKSSTMGRKLSERVFSGVSETSDVFSYTASVGAC"
     gene            <637658..>638497
                     /locus_tag="C5L36_0E03073"
                     /db_xref="GeneID:40386106"
     mRNA            <637658..>638497
                     /locus_tag="C5L36_0E03073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467863.1"
                     /db_xref="GeneID:40386106"
     CDS             637658..638497
                     /locus_tag="C5L36_0E03073"
                     /note="PKUD0E03073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323723.1"
                     /db_xref="GeneID:40386106"
                     /translation="MSVANNHMVPLSDIADWVDTLSFGLVHRIRKKTHPTQNSVQTVS
                     NSLKSSKKLHSSKDASLKRRNTTCGDPSRKHKGSMVMDPLSSSGISDTITAAYVFDTS
                     LLESDSCNENDDTFDIERVTKNFRSMSARPLGVKRSHTLDSSRPARSLSAPLFTSSHD
                     KKLTKKSSLIFSHQKAVRAISSPRAKTPNSTRSNSVESKDSERTINSNTTVVPIKPLK
                     RVTIVDTPTDLITGDNIDSAVSPTPLVEQPNDGIVDTKSETSSVFSVEPRFRLVVDDH
                     ITA"
     gene            complement(<638745..>639854)
                     /locus_tag="C5L36_0E03077"
                     /db_xref="GeneID:40386107"
     mRNA            complement(<638745..>639854)
                     /locus_tag="C5L36_0E03077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467864.1"
                     /db_xref="GeneID:40386107"
     CDS             complement(638745..639854)
                     /locus_tag="C5L36_0E03077"
                     /note="PKUD0E03077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323724.1"
                     /db_xref="GeneID:40386107"
                     /translation="MFYIRPQEQITTCSLFPLNEQYLLNDLRREYYRQQQIEKRQRQK
                     LNQPDVEFTQNLDEYFIILNKKLSRDNYKAMKTFEGYSIRLVDDSLIIKSKRDNFYKS
                     VQLPENVAYGTDITYRLYDDGYKMVISIPKKKAIQIKTPAFGFPDLFDNLKILSDVFD
                     SSYVGRCNEGRKIRIPISDSNESDEVSINKKGIEDSQIGNEEGKEQLDERMQEETEIC
                     NENASAVFDSKHGRDCEAKAGTPLKSDQTLEGNSDSDWEDIEDGNENVWMDIDEEPKS
                     VSINQNAKDEVAVDGKSENRASVLSEQPDLLKNYKTTLKNTVFVPNMARNDDPMSSES
                     ESSLESPNSVEESTAGPARRTYSPSIENVVDAEFL"
     gene            complement(<640204..>641937)
                     /locus_tag="C5L36_0E03080"
                     /db_xref="GeneID:40386108"
     mRNA            complement(<640204..>641937)
                     /locus_tag="C5L36_0E03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467865.1"
                     /db_xref="GeneID:40386108"
     CDS             complement(640204..641937)
                     /locus_tag="C5L36_0E03080"
                     /inference="similar to AA sequence:RefSeq:NP_012760.1"
                     /note="PKUD0E03080; similar to Saccharomyces cerevisiae
                     YKL162C; ancestral locus Anc_5.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323725.1"
                     /db_xref="GeneID:40386108"
                     /translation="MFSIKRRFILKKTNGGSTLTFSRSITRKSVIKKNGREGSLDSKA
                     SAAPMSAQGKGISRLRKDNKKTKSKFIHDYSVFPETLQYRLPLEEERGKPPKEHSNII
                     KLIFEQGGVESMAMDINEEKFNRYPITNPSKLNKRKERPLSVKMLSSDFIEDSLYNVN
                     YGYFSKEVVIFQPDKAFDYNHLAGQDEFMQQWLQAYDKYDQDKANTLQVIKRPVHNSK
                     TSDIKDKGAILEENKAENDDNKITKPSLQLWHTPTELFQPYYGEGLAKYILESYKSND
                     SGHDLIIYEVGAGNGTLMLNILDYLEKHEPGIYETVKYRIIEISSKLFNKQNSRLERH
                     KNHVEVINKSILEWETPVNEPCFLIALEVFDNLSHDVVRYDIDTKRPYQGYVVIDEHN
                     DFHEYFSPTLDNLTKELLELREQSQYPISKLKNHPVNTIYPVRKLKEIFNPLRNNLSD
                     PEYIPTRLYKFFKILNRYFPNHQIIASDFTHFDKTIKGYNSPTVQTMYKDNMVNVDSY
                     MVEQGYFDIMFPTDFRFINELYKQVTKKQSETCSHAEFLKRWADYEKTKTKSGENPML
                     ELYSNAAFIYS"
     gene            <642202..>645177
                     /locus_tag="C5L36_0E03090"
                     /db_xref="GeneID:40386109"
     mRNA            <642202..>645177
                     /locus_tag="C5L36_0E03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467866.1"
                     /db_xref="GeneID:40386109"
     CDS             642202..645177
                     /locus_tag="C5L36_0E03090"
                     /inference="similar to AA sequence:RefSeq:NP_014691.1"
                     /note="PKUD0E03090; similar to Saccharomyces cerevisiae
                     YOR048C (RAT1); ancestral locus Anc_5.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323726.1"
                     /db_xref="GeneID:40386109"
                     /translation="MGVPALFRWLSKKYPKIISSVIDEEENPVDDIPKLVQYSDPNPN
                     GELDNLYLDMNAIVHPCSHPENRPAPETEEEMMIEIFKYTNHVLNLARPRKLLMIAVD
                     GVAPRAKMNQQRSRRFRSAKDAQIAYEEKQRELAEMEARGETIDDAIKGKKSWDSNSI
                     TPGTPFMDILAASLKYWVAYKLSTDPGWAQLQVIISDASVPGEGEHKIMNFIRSQRSR
                     PDYDPNVSHCIHGLDADLIFLSLATHEPHFRVLREDVFAKDNNNKHLTTKDRMMMDEE
                     TKEKLKNQSQPFIWLHINVLREYLQVELQIPRLPFKYDFERAIDDWVFMCFFVGNDFL
                     PHLPSLDVRDSSIDILIGIWKNLLPKMKTYITCDGKLNLERVEKLLSELATKEDEIFR
                     KRHEDDERREARFRRIDQDREQRRIVQQQLLGVVSKGKDNAPINPSQNMTLTSLSTGK
                     LAGGLQMTNNDIVQNIESISKANTTNQSVAAVLRQNLMKEDKEASENKDSGSQEGDDA
                     PIDVSEEPASKKRKLNDQDQGADEKGEADGDGEEEGEEEEEDDDDDDDDENPDLADTD
                     IKLWEPGYKTRYYQHKFKTTNEKKITEIRRDMAKCYVEGISWVLLYYYQGCPSWNWYY
                     PYHYAPFAADFVGLNEFKIEFEQGTPFQPFEQLMSVLPAASNHNLPEVFRSLMSEPDS
                     EIIDFYPEDFEIDMNGEKQSWRGIALLPFIDENRLLSVVRSKYHELTEDEKRRNSHKQ
                     EVMFVGKQNPYFKKFAKLYNQEKKKEKVEFSFSKTHLAGTATSNEIYVPNSIFKFPFE
                     TKNDEYPNLNTSDFMLVNYTMPPKVHGKSMILTGYRPHKPVLLPEDREKIMYYKNYHN
                     NRYQRNNGPINQFINYKEHTGPGQESMYNSRPGGYKFFTDMYEREINHQATTAAFNQG
                     RQNFQNMYQNNYDTYVDPNQGYNTYGGGRGGYGGGRGRGGFNNRVGYGGRGRGGYNGG
                     YNGGYNGGYNGGYNGGYRR"
     gene            <645451..>646080
                     /locus_tag="C5L36_0E03100"
                     /db_xref="GeneID:40386110"
     mRNA            <645451..>646080
                     /locus_tag="C5L36_0E03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467867.1"
                     /db_xref="GeneID:40386110"
     CDS             645451..646080
                     /locus_tag="C5L36_0E03100"
                     /note="PKUD0E03100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323727.1"
                     /db_xref="GeneID:40386110"
                     /translation="MRENGNRPANSRTGQLLLKGQLNEYARKPKKTFDIHDLSMKIEH
                     ARKRPRIELEAPSIKPLDGLSLDGIRAITSKYQDLKKRGPTSVIKPKGVSTNPLISQL
                     QEIVDAERASAEHGIQKIQDYDQSDRDYIGVVRAVEYISDSIKIVVLEKDNVRRKLCL
                     GCLWNEWIDLKEGDTVVVSGLESNSALKVGTREVLEWSNKWKKLIESAN"
     gene            complement(<646161..>647630)
                     /locus_tag="C5L36_0E03110"
                     /db_xref="GeneID:40386111"
     mRNA            complement(<646161..>647630)
                     /locus_tag="C5L36_0E03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467868.1"
                     /db_xref="GeneID:40386111"
     CDS             complement(646161..647630)
                     /locus_tag="C5L36_0E03110"
                     /inference="similar to AA sequence:RefSeq:NP_013816.1"
                     /note="PKUD0E03110; similar to Saccharomyces cerevisiae
                     YMR098C (ATP25); ancestral locus Anc_2.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323728.1"
                     /db_xref="GeneID:40386111"
                     /translation="MLRSVRTIHPLAKYVTLACQRSFHVSTPVFNSPWYLDPKESPSI
                     TSPLKSVTIPKLPERHPQALENLVTYLATELGIDDLSVFDMRNKSTTTQGAYDIADFM
                     VIGSGKSAKHLQSASTELDFYIKHELHKLPTTEGILKSGALAKYHRKLLKKGKKAPNY
                     SKNTYGVTPNTWVMTDTKTDGIVIHMLTKERRVDLNFECLWAKDSEKEKYSSTSKNHD
                     SDDIFKGIRYFHSTSQLKSNSFDPYNVTFDNYADQFRSLLRKHLVDYKVTSLKDLKDH
                     LDSMYSAGITMNYSLIVEYFNTILKSEEFHQPFNTNMKAYIHRELFLFNLLDSYSVLL
                     TNEQILDLLSLIIVSGSGFNNESFLTLKSIIKTFNIQQKELHDHSKILGKVQLLSEKL
                     TDNYNSTHRELKRRIDSLLLTAYANKQNWFSFFKVLDSAIQRNDIPLVQASLPLVAVC
                     SDNLTAYQYETKYLPLIKEAGMPKEIARFADIIYDKTHE"
     gene            <648363..>649373
                     /locus_tag="C5L36_0E03120"
                     /db_xref="GeneID:40386112"
     mRNA            <648363..>649373
                     /locus_tag="C5L36_0E03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467869.1"
                     /db_xref="GeneID:40386112"
     CDS             648363..649373
                     /locus_tag="C5L36_0E03120"
                     /inference="similar to AA sequence:RefSeq:NP_010640.1"
                     /note="PKUD0E03120; similar to Saccharomyces cerevisiae
                     YDR353W (TRR1) and YHR106W (TRR2); ancestral locus
                     Anc_5.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323729.1"
                     /db_xref="GeneID:40386112"
                     /translation="MLKSVLGKTNTTIKHIRMVHNKVTIIGSGPAAHTAAIYLARAEM
                     NPVLYEGMMANGIAAGGQLTTTTEVENFPGFPEGITGSELMDKMRAQSEKFGTKIITE
                     TISKVDFSSRPFKLWTEFFEDDEPITTDAVVIATGASAKRLNLPGEETYWQQGISACA
                     VCDGAVPIFRNKPLAVVGGGDSACEEALFLTKFGSKVYMIVRKDHLRASAVMQKRVEK
                     NEKLEILYNTVSLEAKGDGKFLTHLAIKNVKTDEVKDLPVSGLFYAIGHTPATKIFEG
                     QLDTHENGYLKTKPGTASTSVEGVYAAGDVQDSKYRQAITSAGTGCMAALEAEAFLAS
                     ME"
     gene            <649629..>651662
                     /locus_tag="C5L36_0E03130"
                     /db_xref="GeneID:40386113"
     mRNA            <649629..>651662
                     /locus_tag="C5L36_0E03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467870.1"
                     /db_xref="GeneID:40386113"
     CDS             649629..651662
                     /locus_tag="C5L36_0E03130"
                     /inference="similar to AA sequence:RefSeq:NP_013622.1"
                     /note="PKUD0E03130; similar to Saccharomyces cerevisiae
                     YML088W (UFO1); ancestral locus Anc_8.863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323730.1"
                     /db_xref="GeneID:40386113"
                     /translation="MTPLALNNLPVEILTQILALVDPLTLQSFPLVCKTWYRILQDDQ
                     VWREIFKLQYPYSLFSSVSKGSTYRSELAHRSQLRHNFRRGKLLTQQYTINHIITGHV
                     DIAWSSNILTVIDVPRDMAYTCDIRTGKSSKFEVGFVPEGATCFDIGRKMVVFGKWNG
                     SLSCMMINHKGLLVASPKICTGEGNERVGRISCVCVVETAAIGQNSKLNLKNVWSNSQ
                     IDLKRSTVIFAKGGITAFSGDENGKVYGWDTKNGKLVGSYTIRDGVKVSKIKSDGKSV
                     VICVLENFEIYSLSNAFDKLNNPVEVEKVGTILGDTDVNINNIFVDYGTETVTVWDDL
                     HLVIYSYGSKRIVHSLTYDAPLGSTITHVAFESGDKQYIKQDHDIIGGDPLLAAIALS
                     TGYLEIINIREPHSNTILRPIHNHRIIPTFIEEHDSVLDILNSRRSPISSIALNSVVV
                     GIASHLGTVEIFDIMTGEYLRTVIDRIGKKKVQELQQILSTEEINNLIKISLDDTLTR
                     GALIIGPHIQYFLCGQDKHENDTRKFKASKRLNDRKGDTLKDIEFSLDNYRADVLQNA
                     REKKLRAKYNGEVDSEEEVDIALGLSLSLNYDEDEELRKALELSQLAEPLLVTDDEQL
                     MNNAGRLSQNTYSTDPTELALDSDEELRLAIELSMRESYKNYANADEEQWQPL"
     gene            complement(<651771..>652661)
                     /locus_tag="C5L36_0E03140"
                     /db_xref="GeneID:40386114"
     mRNA            complement(<651771..>652661)
                     /locus_tag="C5L36_0E03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467871.1"
                     /db_xref="GeneID:40386114"
     CDS             complement(651771..652661)
                     /locus_tag="C5L36_0E03140"
                     /inference="similar to AA sequence:RefSeq:NP_011274.2"
                     /note="PKUD0E03140; similar to Saccharomyces cerevisiae
                     YGL240W (DOC1); ancestral locus Anc_3.562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323731.1"
                     /db_xref="GeneID:40386114"
                     /translation="MFLFCISNNLVTFIQCCRYHCISWEFAKRTLGTLIPPFRKIYIN
                     SVNNMVQAYNPSILEKGRMPSRRVRQAYEFQEEAQSPPPGGGLKIPIHVDEEEGVNPD
                     TQFDHDEILYMRGLEEVESLGLMDIGNLASWEISSFKQGCDLSMLRDESPHTYWQSDD
                     AQPHSLIIRFTKSMNIERISLFLNYPLDESYTPDRMAILAGTGEHDLLEVTKVEFVEP
                     IGWQHIVFNEVSKNGLLKCFILKILFLSNHQNGKDCHVRGLKVLSPGMKSKSRLRNDG
                     NLQDCVGFTSIKFISQSSIR"
     gene            complement(<652823..>655045)
                     /locus_tag="C5L36_0E03150"
                     /db_xref="GeneID:40386115"
     mRNA            complement(<652823..>655045)
                     /locus_tag="C5L36_0E03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467872.1"
                     /db_xref="GeneID:40386115"
     CDS             complement(652823..655045)
                     /locus_tag="C5L36_0E03150"
                     /inference="similar to AA sequence:RefSeq:NP_010289.3"
                     /note="PKUD0E03150; similar to Saccharomyces cerevisiae
                     YDR006C (SOK1); ancestral locus Anc_3.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323732.1"
                     /db_xref="GeneID:40386115"
                     /translation="MMNHINNSNNDQDIERPPHFKNVFATSDVASNPSEMINTNNIVT
                     SESRRPSLVPIPVNIQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQQQQQQHQQ
                     QNQQIQQSHLQHNVQQQVEGEKSSGVVDIRHLTITPSNPESLQSQDNVSAVPSAQMMQ
                     VDMDLNTDTESIQSLDGTARTNPNPMIPSSAKLSTKFQLTELPQIPSFQQLTQSKRNK
                     ISNKSSKHIKNSKKFRSKSLPNIYIPSKRSQQRLLELSRHNSSKFQNNHPFNQQYQQL
                     HFQQQQNKQQCNHQNQNHLIQQQMLLLPPVNLQSMHEIDLQEVLKNPQLRHDILFDPQ
                     LQFRPNLDGERGKRKRIQSDNYWNMIKSEAKSLLSHNNHHYVNENSPILIMFKCLKSI
                     MVSLIPSKDISSIDEILDDSLLVQQLNGKCFDFLGFSNWICSVFKLHCAPMRDSWVDE
                     LNSLFHKACSSAEVDINYLVEGFKTLFLILEAMKLDVANHQIRILRPLLCSSAVTFEK
                     EYFNNAIKKHKINFTPSLLWFKKNSIHLNSKNPKEILNYSILNLLSCSNMCSQFPNTL
                     NFDHTRLLLLRVDVRHIICTKLCSILYKTLVQMHKLDKSLLSDDNMMKFKSDILNIIV
                     DDKGNSKWTKNLKNLSIQMINKLFGNLDSQKIDFAYNWLLKQTQPSSKVYSILESKLF
                     EKIQSHLAMKDTYTNNNDTTINDELIVNVELNDVIERLTQLIDFNYQVFGDLYTSYLN
                     "
     gene            complement(<655748..>658018)
                     /locus_tag="C5L36_0E03160"
                     /db_xref="GeneID:40386116"
     mRNA            complement(<655748..>658018)
                     /locus_tag="C5L36_0E03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467873.1"
                     /db_xref="GeneID:40386116"
     CDS             complement(655748..658018)
                     /locus_tag="C5L36_0E03160"
                     /inference="similar to AA sequence:RefSeq:NP_013795.1"
                     /note="PKUD0E03160; similar to Saccharomyces cerevisiae
                     YMR078C (CTF18); ancestral locus Anc_2.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323733.1"
                     /db_xref="GeneID:40386116"
                     /translation="MSANDVLRSLLETRTDKKLHGANLLQANTNITRPKQATLSNGRR
                     ITLKPRTTELDSSIFDMRKEGTSGNGYHDMDALWEKLRIEEKTTKELSEFDSHNRELE
                     QGANELRNLSNKRRVNTLWTEKYRPNKFIDLIGNEKTNAHILKWLNDWTYVVKGGKLI
                     DSNTYGRDMNIDPLKRPRKKVLLIHGPPGIGKTTIAQCVCKQLGYEMHEINSSDERSG
                     PAVKDKVQNAIKMRSLSGKDVCLLLDEIDGAVGSEGGFIRVLINLLQKDLKATEEWNS
                     FSKLKYHKKEHFIRRPIIAMCNDIGARCLDQLKPYCEVVSFKKSSKKSIKKRLKMILE
                     SEKVGPINESLLDDLIISLDGDIRNCINFLQLNSKNLNGRIKDSEIVWFQLLKEIFNL
                     ENQNIRNKKGKNVIFKELMIKLSNSSSDLTRINNGCFNLMLQLNDEYDNNLKKLDEAS
                     DWLYFQDIISKNYTLFDKEELHFYEAVTPLRFFQLFANFTDGQFYDKNARFNFKSQDN
                     FELRKQVNEMISTLLKGYKLRIDRKVLITNEISMLNYIVVPNVSKTAKEFSKDDKKVE
                     RVLEILNDLSIRIETYNGGYNGRGDTNVNENGQRRTVVSRSNTYKFKPDIVIGLIDCN
                     STNKTAAESDWRGYGASYATLNTTRATPFIEVLDEVYRTSLRKHQEANKILKREREKN
                     VEDPEVAKKRAVSSADYFIKQYNTFHSQLHKNEANGGISGRGVMAENENRILVKYHEG
                     FSNAVRKELVWNSLFK"
     gene            complement(<658309..>659232)
                     /locus_tag="C5L36_0E03170"
                     /db_xref="GeneID:40386117"
     mRNA            complement(<658309..>659232)
                     /locus_tag="C5L36_0E03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467874.1"
                     /db_xref="GeneID:40386117"
     CDS             complement(658309..659232)
                     /locus_tag="C5L36_0E03170"
                     /inference="similar to AA sequence:RefSeq:NP_013581.1"
                     /note="PKUD0E03170; similar to Saccharomyces cerevisiae
                     YML125C (PGA3) and YML087C (AIM33); ancestral locus
                     Anc_8.862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323734.1"
                     /db_xref="GeneID:40386117"
                     /translation="MADKLEGVDLLKTPLHGIYIPVALCIFGITILNYDYLPYVVGLL
                     ALYISFNIIRVKLKRPVLSSTKFQDYELIDKTIISKNSAIYRFKLYNEYDQLNIPVGH
                     HLACKVEIDGKDEIRYYTPISNQLDEGFFDIIVKSYKDGKVSKYFATLSPGDKVLFKG
                     PVGRMSYRTNMAKKIIMIAGGSGITPMLSVLGSIVTTPEDTTEVKLLFANETENDILL
                     KEELDVYLEEYPNFDLRYFVKHPSPSWNGYTGWITKDVLKKELPEPNDDTKIFICGPM
                     DMKKQMLHDLEELGWSKGVLQSKQDDQVFCF"
     gene            complement(<659696..>661633)
                     /locus_tag="C5L36_0E03180"
                     /db_xref="GeneID:40386118"
     mRNA            complement(<659696..>661633)
                     /locus_tag="C5L36_0E03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467875.1"
                     /db_xref="GeneID:40386118"
     CDS             complement(659696..661633)
                     /locus_tag="C5L36_0E03180"
                     /inference="similar to AA sequence:RefSeq:NP_014916.1"
                     /note="PKUD0E03180; similar to Saccharomyces cerevisiae
                     YOR273C (TPO4); ancestral locus Anc_8.723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323735.1"
                     /db_xref="GeneID:40386118"
                     /translation="MSSRNSESSYSRYDSAVESFVDADNNNDIDNENVNDNFNDNVNE
                     YYPDAENLELRKTITVKSTQHDTSNIDNYIESTKNDENTYQEELENELTREATNLSRI
                     SRKLTGHSSLKDVEKQEYTQEEEEDPEIVGYDPKTCNWDSPDDPDNPHNWAPFKRWYC
                     TMVTAFLCLVITLGSSIYVDAIPEMMVKWGVSQTLGLAGLTFYLVGLAFGPAIAAPLS
                     ELFGRKIVYCGSLPISMLFTMGVGLSPNIGSVIVLRFFAGLTSSGALAIAGGTITDIW
                     KPQEIGLAMTLFCLAPLAGPVIGPIIGGFIGQNKISPKPNRVGGLRWAMWVDLFFAAT
                     IFIPLFIMPETYKPIIMRKRIIKRGKKLKKGMPLMQFLIVIVFITLLKPVEMLFVEPI
                     VLVFSIYTAFVFAVLFGFFEAFPVIFRGIYRMELGVSGLPFLGVGLGLLFGAICYLCL
                     DKFYFFKKWDDGYIGMKDKDGNPIPPTPESRLLPCMIGSVCFGPSLFWLAWTARHSVH
                     WMAPTASGVLFGFSLVLIFFSILTYFSMAYPPISVASALAANNMTRYIVSSVFPLFTV
                     QMMENLHVYWGVSVFAFIALAMVPVPWVFNKYGERLRNRSKYGWTALYEQERKAKLEK
                     EKAKQDRDINSQETATFDDKE"
     gene            <662987..>663301
                     /locus_tag="C5L36_0E03190"
                     /db_xref="GeneID:40386119"
     mRNA            <662987..>663301
                     /locus_tag="C5L36_0E03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467876.1"
                     /db_xref="GeneID:40386119"
     CDS             662987..663301
                     /locus_tag="C5L36_0E03190"
                     /inference="similar to AA sequence:RefSeq:NP_013468.3"
                     /note="PKUD0E03190; similar to Saccharomyces cerevisiae
                     YLR364W (GRX8); ancestral locus Anc_4.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323736.1"
                     /db_xref="GeneID:40386119"
                     /translation="MSTAAALIKQHKFLMLSKSWCPDCHYAINIFTKYKVLPKVHIVE
                     LDKMEPREAVQLEKQFTEISGRKWVPSLFFNGEFSGNEATLKELESLDKTESWFKKVG
                     LL"
     gene            complement(<664273..>665295)
                     /locus_tag="C5L36_0E03200"
                     /db_xref="GeneID:40386120"
     mRNA            complement(<664273..>665295)
                     /locus_tag="C5L36_0E03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467877.1"
                     /db_xref="GeneID:40386120"
     CDS             complement(664273..665295)
                     /locus_tag="C5L36_0E03200"
                     /note="PKUD0E03200; Pfam Domains: IMPDH(3.8e-170)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323737.1"
                     /db_xref="GeneID:40386120"
                     /translation="MTKDLVTAKKGVSLSEGNEILRTSKKGKLLIVDAEGNLVALLSR
                     TDLQKNEDYPNASKSTATKQLLCGASVGTMDADKRRLELLVEAGLDVVVVDSSQGNSI
                     FQLNMIKWIKKTYPEIEVIAGNVVTREQAASLIAAGADGLRIGMGCGSICITQEVMAC
                     GRPQGTAVYNVTEFANKFGVPCIADGAVQNIGHITKAIALGASCVMMGSMLAGTTESP
                     GSYFFKDGERLKTYRGMGSIDSMQKTDTNANASTSRYFSEGDEVLVAQGVSGAVLDKG
                     SVTKFIPYIYNGLQHSCQDIGVKSVKELTEKVNSGDVRFELRTPSAQFEGGVHNLHSY
                     EKKLHN"
     gene            <668454..>670028
                     /locus_tag="C5L36_0E03210"
                     /db_xref="GeneID:40386121"
     mRNA            <668454..>670028
                     /locus_tag="C5L36_0E03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467878.1"
                     /db_xref="GeneID:40386121"
     CDS             668454..670028
                     /locus_tag="C5L36_0E03210"
                     /inference="similar to AA sequence:RefSeq:NP_010996.2"
                     /note="PKUD0E03210; similar to Saccharomyces cerevisiae
                     YER073W (ALD5); ancestral locus Anc_7.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323738.1"
                     /db_xref="GeneID:40386121"
                     /translation="MLRLTTRTNTLRSPRVFSALSSIRCYSDLPVYQTITLPNGQTYE
                     QPTGLFINGEFVKSQQHKTFEVINPSTEEEICHVHEARAEDVDLAVDAANKAFHSTWS
                     KMDPSIRGKYLLNLADLMEAHKDTLAAIESMDNGKALVSAQGDVGLVINYLRYCAGYA
                     DKLFGKLVDTGSNYFNYIKREPIGVCGQIIPWNFPLLMWSWKVGPALAAGNTIVLKTA
                     ESTPLSALYAAKLAQEAGIPKGVINIVSGFGKITGEAISLHPKIKKLAFTGSTATGKH
                     IMKAAAESNLKKVTLELGGKSPNIVFNDADIKKAVNSLVLGIFFNSGEVCCAGSRVFI
                     QEGVYDEVLEEFKKAAENLKVGNPFEDGVFQGAQTSQQQLSKILSYVDSAKSEGATLI
                     AGGERLGDKGFFVKPTIFADVKPTMKIYTEEIFGPFAAVTKFKTADEAIKLANDSEYG
                     LAAGIHTKSLDTATYVANNLEAGTVWINTYNDFHHNMPFGGFKQSGIGREMGEEAFEN
                     YTQWKTVRVAINDGPQ"
     gene            <670745..>674719
                     /locus_tag="C5L36_0E03220"
                     /db_xref="GeneID:40386122"
     mRNA            <670745..>674719
                     /locus_tag="C5L36_0E03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467879.1"
                     /db_xref="GeneID:40386122"
     CDS             670745..674719
                     /locus_tag="C5L36_0E03220"
                     /inference="similar to AA sequence:RefSeq:NP_009378.1"
                     /note="PKUD0E03220; similar to Saccharomyces cerevisiae
                     YAL024C (LTE1); ancestral locus Anc_7.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323739.1"
                     /db_xref="GeneID:40386122"
                     /translation="MSINSNGCAAYRDSVSFDDSDPPEINRMASRRSKGSIGSIGSVG
                     SVGSMADVKSGLNMQQLLLNFEENEPIFENELLYPTPTESEILHFDDNNKLMYGTVEA
                     LITYITSPHILNYQFLVDFFLTFRSYIQPLPLLELLLCRLSWCLKKSLDKSDKEKALV
                     GKLTLIRTFVTIRHWLLNHFHDDFINDSMLRTLFATTINELGKHKKYVGDDCHNLQLK
                     TIRDLKKTYIALVSLYWDVDNEMHNDLSDYDISSYQGLDATRLSMVGLNNLNDPSTRR
                     LSVLSMLDNTSASNPLQSYLKKDSNQQYLKKDTNSFLYPKDSLNSLNIKKQDDMSTSP
                     SIDLLYNTIIDKTPISGFVSLDNKKHFKGGFTTKGNIEISQDSKIRQIHPITKELSNE
                     KTEPPIYKSNKNIVEKNTQVISRSASVKAKKRSFIKSIFGQSEKENGPQSLDYLIPQR
                     DRKDEVQRTRSNVQQKQEKTIKENHHQDMIHNLEKQVLIKESSLDYLEEIVINEYQDM
                     LQHPSFKHRYSKKLRGINRKSVLSMPMDLSMSFDVESGFNVLDSPTKIRPPRVSDNQP
                     EKSMNLDRGDANHPSFSTPIDTFDWSDSNNLIETDNGNQVFVDMGVTTADLDNALNDG
                     DIHIDRRSHSLSKDDKLQMERQSFQHFETKRFSQIPLKNKHLSDSRLLRHRHRKSLKN
                     MSRKIEPLLSNPQQQQQAYFNETISVNNIKRQSVLSTKSYATYDSEFSTGSSEDRREL
                     KNLNTEVTLRKKNAISNLRVEVGNDSNISEEFNDTELMDNTIHDQRQLGEILDSAGDL
                     FGKPVNSILDAFLELPFNNDFGDAVRITSNISILPSPTPSQTYYNGLSQADINELAAI
                     PDEKVDGDPFNYTLSKLRGECTKFQVIVGLNDADSNIHNKLDEEEIHRKHALAVVCES
                     PTKAKDMIHDNIENTLNDQFHRNDSDVSDESKVEKQVRDLYIVNNSTSDSLQRTSVHS
                     KATLGSKLEMSCYSAKMKETGSILSRVSTGKLLKNDAEKSNFELQSLMVTPQALNSRE
                     HGITVEDVLNENLHIPFIFKYDCDQIATQMTLIERDILLELEWRELINLKWDQPLRPY
                     NSWLKLILDSKNKSGLELITLRFNLVNNWIISEILLCKDINLRVLTITRFIQLADKCR
                     RIQNYGTLFQIMLALNSEVLRQLKSTWIRIDPITILRFKDLKDLTSPNNNFKCYRDEV
                     TSVIPSKGFIPFLPLALSDLTMYSEMPTFVSSKHKDIDLDSLAEFDASSEIDYQLVNF
                     EKFRVTGETVKNTIRHIEWSKFYELETNKEILSRCLYISSLSEEDMSLCLKQIELNPA
                     SPTF"
     gene            <675194..>679669
                     /locus_tag="C5L36_0E03230"
                     /db_xref="GeneID:40386123"
     mRNA            <675194..>679669
                     /locus_tag="C5L36_0E03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467880.1"
                     /db_xref="GeneID:40386123"
     CDS             675194..679669
                     /locus_tag="C5L36_0E03230"
                     /note="PKUD0E03230; Pfam Domains:
                     Myosin_head(4.3e-302)|DIL(5.1e-17)|IQ(5e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323740.1"
                     /db_xref="GeneID:40386123"
                     /translation="MKLEVGTNCWIPDQKEGWISVIVQSKEYSPEHKKYRIELVSDGP
                     INESYAIEVPELNEKDEKLPKLKNTDDTVDDLTALPHLNEPSVLNSVKLRYQMKKIYT
                     FSGIVLVAVNPFDRVDYLYTQEVIKSYHKAGKSDNPPHVFSIAEESFKLMKKNQQSQS
                     IIVSGESGAGKTVSAKYIMRFFASVHHEGASINITEIEKQILATNPIMESFGNAKTTR
                     NDNSSRFGKYLEISFDNKNLICGARIQTFLLERSRLVYQDQNERNYHIFYQMVSGLEK
                     RLKNKLYLTRVQDYHYLNQGQTASIEGVDDVAEFKVTREALKVIGIDKETQFEIFKVM
                     AGLLHLGNVEIENSRNEAFLSSDNQSLQYACDLLGFDHKEFGKCLVKKKIVTRSDSIS
                     SNMKYHEAIVARDSISKYIYSLLFDWIVEHINQDLYPPEIEAKSVSFIGVLDIYGFEH
                     FFINSFEQFCINYANEKLQQQFTHHVFKLQQEEYTKEGIEWSFITFQDNQPCIDVIEN
                     RNGILSLLDEQCRLPSGSDQAWAEKMFHSLTVPPFNKVFKKGRFGNDKFVVSHYALDV
                     TYDIKGFLEKNRDTVSDVQNKVLESTKNKFLQSLINSKLVDGDLSTSANDTYKRESGF
                     NRNKRPTLSHMFKNSLNQLVAKLGNTNAHYIRCIKPNEAKSAWTFDNLMVLSQLRACG
                     VLETIRISLVGCPSKYCYDEFIERFVVLLDAEDEKKVKRKMVVSMDEKKKISSKLLRS
                     YVEENALFQLGRTKIFFRAGVLGQLEIAKSNKIFAAATTIQKYGRCHFERIKWLLARR
                     STIDLQSLIRGFLSRLNQQHTISMIVRIQAITRGFVCRRKTSQLISKTTLIQSYIRRY
                     IVREEFVRLVDEHKKRVAAMLETKNRLLAEEKKEEANVFHGDKEKFVETYQGKGDGER
                     EKILVLDDQLEQRTHSQAQNASPSCIFKSSDTSPNLSEDLPVSFINFDALSQGTERSI
                     HKVEYNEDVDKMLEAWNLICESLPPQRYTYDDLLGMKPYKALCTISRFLIQKIRVTNT
                     RLNEVLGGETIKSKTLNDNLQRSFSSDVLMFKKTMRRLKYVKPEAVSKRHSIRSISGS
                     PNTNRSSSQQSIQTMSRFDRSYKSALADISGYQKGTRLVTESVAQLVLEDIRPIAVSA
                     LDEDDPDDVKLVSVDELLYHSRLISEILTGMWSVGMYNESAMFLMSCFEIIEKEVQYC
                     VEKSDHFEHAARLITNLHDLNVKISNIRTNIMQDLNTKLFGGGVDRSKYLKILSIVRR
                     FTECFFAKMYTAWMDGIRGEIQKIAPDALALDDTYFAIKKTPHSYFRHAIQKGSKYKM
                     YDVVRLVNNLYVALNKNRYEKPIVDSIIKDLLKFMDIICFNDIMMRSKYLNVEKSTLI
                     KSNITLLLDWCANQQIPDAPGFVMHLLTLCQILQLKKHGLSDVDQITSVCTCLTPSQI
                     KRIVGQVDKQEERICSYSTVGSTPSFDNTLDSSISDTDFLIAIDYEMFENKILDV"
     gene            complement(<679784..>681445)
                     /locus_tag="C5L36_0E03235"
                     /db_xref="GeneID:40386124"
     mRNA            complement(<679784..>681445)
                     /locus_tag="C5L36_0E03235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467881.1"
                     /db_xref="GeneID:40386124"
     CDS             complement(679784..681445)
                     /locus_tag="C5L36_0E03235"
                     /note="PKUD0E03235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323741.1"
                     /db_xref="GeneID:40386124"
                     /translation="MQRMPEHKESSLNTYPTFEPVHPESSSMGKKSSYIRKKLSKLGL
                     SSSEVNLSRDQTEEENNRPLIEQDDEDDIGSPSNGFTKPEIRISNSMDDAEIPTLSAD
                     TTDPHSSSSGGKMDTKKHQTSTTHKIMQKLNHSTHSLTGIIPPPNLNKRKSTVSLNGY
                     PSRHESPNRNANGYNAPKIPSKVYSSPSKNGSLNGRYLATNNDHSFITAANHNHTNNN
                     MSLPMPPTLPRTSSSSSSKHSPSGSVSLSNPSSSDSENPKPLTASSLPQFVPVNITQA
                     ASGVLLPPTALAPIHKTVSGVSHKSSNSASNINVPGSSRADSTSQSSCYKRNAGLLQA
                     VYRSTHKGDDISDNSDINTNETDSHPSANTNTNLRQGSYQNFHQADREFFSDHKEYTV
                     SPNIINEFLNLKKSFQAGIKKRMELLEKENENLVSRIKQNNERLNNVHAQLAEQLDEI
                     KNYIELVNEKKDNEVKNLYMEGISEKLSDLSARIDTVKKQMVINKSSVKLFDKKLTTI
                     EKIRISNKARNKYIKLLLTIAASVIFLVFLILKFFGFNLVHFSIY"
     gene            <682035..>686603
                     /locus_tag="C5L36_0E03240"
                     /db_xref="GeneID:40386125"
     mRNA            <682035..>686603
                     /locus_tag="C5L36_0E03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467882.1"
                     /db_xref="GeneID:40386125"
     CDS             682035..686603
                     /locus_tag="C5L36_0E03240"
                     /inference="similar to AA sequence:RefSeq:NP_009373.1"
                     /note="PKUD0E03240; similar to Saccharomyces cerevisiae
                     YAL029C (MYO4) and YOR326W (MYO2); ancestral locus
                     Anc_7.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323742.1"
                     /db_xref="GeneID:40386125"
                     /translation="MSTVQLDVGSLCWIPDEKLGWLPVKVKSLSKEGEKHKIELESED
                     DPERVITITTDDLSDSNPQVPLMRNHAENVEDLTTLSHLNEPSVLNVIKLRYSQFNIY
                     TYSGIVLIAVNPFQRNDELYSSYRIRRYANTRRGDEEPHLFAIAEEAYRCMINRKENQ
                     SIVVSGESGAGKTVSAKYIMRYFASVDSDENQHDMSETEKQILATNPIMESFGNAKTT
                     RNDNSSRFGKYLEILFDDNTVIRGAKIRTYLLERSRLVFQPKTERNYHIFYQMIQGLD
                     EETKKSIHLTHVEDYYYLNQGGVPIIEGIDDRKEFEDTRNALSLIGIDSEKQLQIFKI
                     LSGLLHLGNIEIPKTRNNASLSSDEPNLVKACELLGLDPVLFAKWTVKKQIKTRFETI
                     NTDLKYNEAINARDAIAKYIYHNLFDWLVEYVNSDLCPPEIEESISTFIGVLDIYGFE
                     HFEKNSFEQFCINYANEKLQQEFTQHVFKLEQQLYVDEEIEWSFIEFSDNQPCIDVIE
                     KRLGVLDLLNEESGLPSGSDQQWADKLYQNLAKPPTDKVFKKPRFGNNKFIISHYALD
                     VPYDTEGFVEKNRDTVSDGQKDTLKATTNEFLNEVLTRSEKSVNNEEGKVAPPKPGRK
                     APAKETLGSKFKGSLIELMKTINSSNVHYIRCIKPNEQKLAWEFDPNMVLSQLRACGV
                     LETIKISCAGFPSKMTYPEFADSFNVLFDSNDRSRILKGDVDEEFLKSLTRSFMEEHI
                     KDDHSFQIGKTKVFFKAGILGNIEKMKSDKNKKSAIIIQKYLRAYPPRKLFKETREAT
                     INLQSAIRGFIVRKNIQREKEEGASILLQSLTRGFIMRKRFAEAVKSCVRLQSQIRGF
                     TIRKNVFKNHQNKAAILIQSVGRGSIARREFNKTRRAAIIIQSHGRRQLAKKEFSQLK
                     EEAKSLNKMQQVQYSLENKVIELTQSLSSKIEENVRLVNEIEQLQSLVSKTQEEHSNL
                     KTRMLETEGEHSNRIVEYENNIIELNNEISQVKFDYEAARKKVEELTESQNKLKVELT
                     ENLDALKKAQQELLESKDEKDTLYNQVETLKSELNELQEHISSGKFNNTIQGTIPNGT
                     QSLTFKEKNPSNVEYGGDENDELEEINLELLRLLNDSTTLHKEVVENLFKGLKLPPAV
                     VASQPSQKEVLFPARIIIIILSDMWRLGLTSRSETFFGEVLSVIQTMVSELKDEDIIT
                     YGAYWLTNTHELYSFVSYAQSTVTANVEIAKAMGEEDYNIFMKLIADAKEDFESLSYN
                     IYNIWMKKIMNILDKKIISAIVLGQSLPGFMSTDQSPLLSKMFQKDPKYTMDDVLTFF
                     NNVYWAMKSYYFENYVMETVIIELLKFVNASCFNDLIMRRNFLSWKRGLQLNYNVMRL
                     DEWCKGHGIPDTSNYLSHLFQVSKLLQLRKNTPEDIDIIYEICYKLKPVQIQKLFSIY
                     HIADYEVPISPNITQGLADKVRESGQTDYLEPVNKDTLFDDPFRDIKLRPFNKIEAYV
                     PARLNVPTIRRIVELSTLNATYQSQISE"
     gene            complement(<687224..>687616)
                     /locus_tag="C5L36_0E03250"
                     /db_xref="GeneID:40386126"
     mRNA            complement(<687224..>687616)
                     /locus_tag="C5L36_0E03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467883.1"
                     /db_xref="GeneID:40386126"
     CDS             complement(687224..687616)
                     /locus_tag="C5L36_0E03250"
                     /inference="similar to AA sequence:RefSeq:NP_009372.1"
                     /note="PKUD0E03250; similar to Saccharomyces cerevisiae
                     YAL030W (SNC1) and YOR327C (SNC2); ancestral locus
                     Anc_7.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323743.1"
                     /db_xref="GeneID:40386126"
                     /translation="MSSAQAYDPYNPFSDDAARELHPQDPSPFNAQPHQEEGRSKLQN
                     LQSTLDDTAGMMRDNIQAINERGEVLEDIDNRAYTLQNNASLFNKSANQVRKDMWKKN
                     LKLKLCVALVVIIIIIVIVVPLVVHFSN"
     gene            <687996..>688451
                     /locus_tag="C5L36_0E03260"
                     /db_xref="GeneID:40386127"
     mRNA            <687996..>688451
                     /locus_tag="C5L36_0E03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467884.1"
                     /db_xref="GeneID:40386127"
     CDS             687996..688451
                     /locus_tag="C5L36_0E03260"
                     /inference="similar to AA sequence:RefSeq:NP_015407.1"
                     /note="PKUD0E03260; similar to Saccharomyces cerevisiae
                     YPR082C (DIB1); ancestral locus Anc_3.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323744.1"
                     /db_xref="GeneID:40386127"
                     /translation="MSMLVNLPTGWHVDAAILSENDRVVIIRFAKNGLSRETLSIDRI
                     LEKAAPLVAGFAAIYLCDTSTVPDFDEMYALNEGGAPFNVMFFWRNKHVMVDFGTGEN
                     NKMDFLINNVQELIDIIECVYRGAIQGKGLVVAPRDYSYMNKGGRRVRE"
     gene            <688701..>689312
                     /locus_tag="C5L36_0E03270"
                     /db_xref="GeneID:40386128"
     mRNA            join(<688701..688747,688889..>689312)
                     /locus_tag="C5L36_0E03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467885.1"
                     /db_xref="GeneID:40386128"
     CDS             join(688701..688747,688889..689312)
                     /locus_tag="C5L36_0E03270"
                     /inference="similar to AA sequence:RefSeq:NP_013682.1"
                     /note="PKUD0E03270; similar to Saccharomyces cerevisiae
                     YML030W (RCF1); ancestral locus Anc_5.571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323745.1"
                     /db_xref="GeneID:40386128"
                     /translation="MASQNYPSSFDDPLQDMSVLEKIWYRSKQQPLVPLGCLATTAAV
                     IMAAKGVRTGNAPKAQFWFRWRVGLQGLTLVALVFGSLYYDQRIAGAKKTEEELALEK
                     ARMREKLWVEELERRDTEMKERQKRAELARKMMQEGANPDSSSNSNSNSTSNNV"
     gene            complement(<689567..>691747)
                     /locus_tag="C5L36_0E03280"
                     /db_xref="GeneID:40386129"
     mRNA            complement(<689567..>691747)
                     /locus_tag="C5L36_0E03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467886.1"
                     /db_xref="GeneID:40386129"
     CDS             complement(689567..691747)
                     /locus_tag="C5L36_0E03280"
                     /inference="similar to AA sequence:RefSeq:NP_015117.1"
                     /note="PKUD0E03280; similar to Saccharomyces cerevisiae
                     YPL207W (TYW1); ancestral locus Anc_6.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323746.1"
                     /db_xref="GeneID:40386129"
                     /translation="MNEHIVALGAFAAFLYLAGKLGLLLLIVMCVGLMYCSKDVANGG
                     DSVKRRSRRGNKSKVIPPSITKMRKAKDGEELYTGSQNPLGESPIYIFYSSLTGASKR
                     VALQLYDTLNASLGAPLSLVVKLLSLDDDVEDLDDYFLNVPKLDKPPIYLLVLPSYES
                     DSPIDYFLEMLRETSTDFRVDKYPLRALAGYAVLGLGDSESWPELFCYQGKLADKWLS
                     KLGGRRVFPFGELCVKSSNFKKSCEEYTKRLVDLLLDDDPFLYEEDDDDDEDEDASMD
                     EEQLANSDDDGNGGGSSDDGTLVDVEDLQRNEKRVNLVDKKKMVAKDSPTYKSLTKQG
                     YTIVGSHSGVKICRWTKSALRGRGFCYKFAFYGINSHRCMETTPSLSCSNKCVFCWRH
                     GTNPVGTTWRWEVDKPDMILNGALEGHYKKIKQMRGVPGILIDRFNEAFKVRHCALSL
                     VGEPIFYPYINQFLEMLHDKEISSFLVCNAQHPDQLSTLGKVTQLYVSIDAPTKEELK
                     VVDRPLFRDYWDRLERCLDILRTVQSHQRTVFRLTLVKGFNMSDESVGGYADLVERGL
                     PALIEIKGATFCGSSEGNGNPLTMQNIPFYEECVKFVKRVNEELNNRGLEYGLACEHA
                     HSCCFLIASKKFLVDDKWYTHIDYERFFELLKSGESFDKMDYISETPEWAYFGSEQGG
                     FNPDDTRWNRKEEKLKKKAERERVAATATATATTAVDVVVDGPN"
     gene            <693024..>695798
                     /locus_tag="C5L36_0E03290"
                     /db_xref="GeneID:40386130"
     mRNA            <693024..>695798
                     /locus_tag="C5L36_0E03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467887.1"
                     /db_xref="GeneID:40386130"
     CDS             693024..695798
                     /locus_tag="C5L36_0E03290"
                     /note="PKUD0E03290; Pfam Domains: Pkinase(1.1e-50)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323747.1"
                     /db_xref="GeneID:40386130"
                     /translation="MPLFKREPKTTPNSATNSTRTSPNSSPITNHGFDANQPTPLTLP
                     NTKSTTSMTSMNGDTEGRVSRSSSMSRKFKSLFTGGGNNSNGNAENKPNNDVDVLKSI
                     KSGTYQPPLPIPDRSLGRSTNKQVGSRSTNFNDNVDNLRKMTIKEPELNDIDCELNIP
                     EDEVIETLKQEHEQQFQDDGHGARGQGLGKEGEYSQHPRFRSSTISTMSFRNANESSK
                     IPGSQPASSRSRSNSASDSRRLKHSETVSVGSTHLKNERDIRIKLCDRICIYEFGRCH
                     EHDYSKFKTHLNKSSTGLFSWMKKKENKSENDESYAMIEKSISLLPDKYSGNLMKVKN
                     NPKNYIWNYDDDEEEDGDDDYDYDDYITDDDEDEDEDEDGYTDNQHVKHRKSIHSMPS
                     SRNSNFAKSIKSNRSTLSRQSKLITRHYNSDDEYEDENDYEKHLAENDSSDNDDNMGT
                     KVKDTSNKVDHVGNKSDDNSDGSYEDDDGDDDDDDDDDDDFDDEIDNMMIEPIIGKEQ
                     VFLINSMLSKIENPDKFMERVREKERLGKVKLTMAQKYGHIEGVIGKGSYGTVCISSK
                     TVNNTQVFYAIKQIKRKQGESLRHFGNRVTSEFMISSSLTHQAVINVYDLMVDPISLT
                     YSEIMEFIPCGDLFSLISNTNGLNIVECDCFFKQILNAITYLHSVGVSHNDLKVENLL
                     LTRKGQLKITDFGTSAVFKTAWENEVQLSLGACGSERYVAPEQYIKDLEYDPRLGDVW
                     SLGVIYLTMYYGKYSWEASKLDDESFTRYVETRAKYDYSRKSTTRAHQFLCLRRGAYP
                     PIENIKGGIQHTWVSKGGVRDGNSRENEEELINDSRRYVLYNILNPDPTFRMRTYQIW
                     QSEWIKNFRVCDAGRGYVSYDNYIEMAMKSVRDIQAKERDREMERDKDKDREKSKEQK
                     KSHGFLGFKV"
     gene            complement(<695984..>696643)
                     /locus_tag="C5L36_0E03300"
                     /db_xref="GeneID:40386131"
     mRNA            complement(<695984..>696643)
                     /locus_tag="C5L36_0E03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467888.1"
                     /db_xref="GeneID:40386131"
     CDS             complement(695984..696643)
                     /locus_tag="C5L36_0E03300"
                     /inference="similar to AA sequence:RefSeq:NP_013176.1"
                     /note="PKUD0E03300; similar to Saccharomyces cerevisiae
                     YLR075W (RPL10); ancestral locus Anc_8.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323748.1"
                     /db_xref="GeneID:40386131"
                     /translation="MARRPARCYRYCKNKPFPKSRYNRGVPDPKIRIFDLGRKKASVD
                     DFPLCVHLVSNEIEQLSSEALEAARICANKYITTQSGRESFHMRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRGAWGKPHGTAARVTIGQVLISIRTKDSNKDVVIEGLRRARYKFP
                     GQQRIIISKKWGFTNLNRDEYVAKRQNNEVKEDGAYVKFLSKKGSLEENFKEFPHYFV
                     N"
     gene            <697685..>698242
                     /locus_tag="C5L36_0E03310"
                     /db_xref="GeneID:40386132"
     mRNA            <697685..>698242
                     /locus_tag="C5L36_0E03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467889.1"
                     /db_xref="GeneID:40386132"
     CDS             697685..698242
                     /locus_tag="C5L36_0E03310"
                     /inference="similar to AA sequence:RefSeq:NP_013175.1"
                     /note="PKUD0E03310; similar to Saccharomyces cerevisiae
                     YLR074C (BUD20); ancestral locus Anc_8.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323749.1"
                     /db_xref="GeneID:40386132"
                     /translation="MGRYSVKRYKTKRMTRQLDQIFDDLSTPESIQKLKNQEEDETLP
                     GMGQYYCVQCAKYFFDNTSLKGHIRGKVHKRRVKELKVKPYTPEEADFAAGVNVEKYL
                     DRVNKYKNEEEQRRLMEAELLKNQTEEYELRDRQKWEQMYPEKAVEEAQKKLEQESLE
                     KKRALKKAQKYELEPLTDDEIQIDP"
     gene            complement(<698367..>699809)
                     /locus_tag="C5L36_0E03320"
                     /db_xref="GeneID:40386133"
     mRNA            complement(<698367..>699809)
                     /locus_tag="C5L36_0E03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467890.1"
                     /db_xref="GeneID:40386133"
     CDS             complement(698367..699809)
                     /locus_tag="C5L36_0E03320"
                     /inference="similar to AA sequence:RefSeq:NP_013174.1"
                     /note="PKUD0E03320; similar to Saccharomyces cerevisiae
                     YLR073C (RFU1); ancestral locus Anc_8.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323750.1"
                     /db_xref="GeneID:40386133"
                     /translation="MGRERRSLSSTSSTSGSSFSSPLNPPIDPKILISRSKMYESKYP
                     LHLLLKSANGILRNARSYDKEGAREDAFVLYSRFVDLIANQVSSRSELKRSKMAFKKN
                     KTSKDSEVYAEYVKLLPNLSMAMDRSEHLMSEIRKEYIDYKKVEMALEEARELQRKKF
                     LERKERGEKQLQEMRRSIERRKSSMHSDDRELLNKLRSLSTTSSTEFENRPNLQVPSY
                     PSINDTAIAEDESYAYSQMSKAPKLPSYPAISKNNAPSYDLVSAPSGANQVSLQKPKV
                     KSEANHKTVNFTEGGAPLRTLYLPADLPQRFLEIAEPNTSKKLETCGILIGKLNRNAF
                     FITHLLIPEQESTSDTCSTLNEEKMFEYIENEDPDLFILGWIHTHPTQSCFLSSIDLH
                     TQNSYQIMLNEAIAIVCAPTDHHSKKLGVFRLTDPPGVPTITNCSQSGFHPHEEPNLY
                     VDCNRVSNKQVSSGHVVIKTGLTFKVKDLR"
     gene            complement(<700081..>702186)
                     /locus_tag="C5L36_0E03330"
                     /db_xref="GeneID:40386134"
     mRNA            complement(<700081..>702186)
                     /locus_tag="C5L36_0E03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467891.1"
                     /db_xref="GeneID:40386134"
     CDS             complement(700081..702186)
                     /locus_tag="C5L36_0E03330"
                     /note="PKUD0E03330; Pfam Domains: WD40(3.3e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323751.1"
                     /db_xref="GeneID:40386134"
                     /translation="MYVPLDLTRPNIKPIAFGHILATNIYPVHATDHNAIFRLSEEDY
                     SFNYLDSTYRGDIGIRISRTPLSPQDPSTYAALSKYTEYYLRRLHSSIGALPANQLEK
                     APLKVPKDLVVSHSDGKTELLMIGSMINPLSSDKFKPVHLTPGCHSLIVTYEREQHNN
                     QTNTLNKLFGKTGKHEKHSYHHVDQSDLKLPKSNLNRNTSTFVERITTCDNYIKKLNN
                     ARSILISAHGRVFSVLALDDDPKQIDIDPVCLRVTVSTSVITSMSAFKQYRLNSDKSL
                     DVLFGFASGDILWLNPLKMKYSRWNKKGSFKKEIITSIEWSTCGNYGYVGFADGDLLI
                     FNRDYEDNDLVYAPKVHSRKKNLKIYHSLNTSPCNHLVGHYKLAKKPITSIKSHPTYN
                     NIIVITSDDGFTRVFDLLTESITDIVPSYYGGVLTSEFSPDGKYLFLGGEDDIVSVYS
                     FQSMHIFGMSNERGLLRLVSRLQGAKSWVRGIVVRQQAFSSSLSYTVGAASDDGYIRF
                     YEFQPRSSRKAKKHHTVMTNHMGTPKSPAQKALSALSIERSGSLESRHRKLTPRASTN
                     HSLSPAPNRLSLRELINSGASSTSLVRSQNHSSKQMKLGDGVLMCPVQINDKANDSLV
                     SHHVMFKEKKLNHNILFSEVRDTYIHNTVGMESVTKTLPVSEKNVNLGRLSGLYIEDH
                     YIWAFVAGGDLIRFKKYSS"
     gene            <702847..>703974
                     /locus_tag="C5L36_0E03340"
                     /db_xref="GeneID:40386135"
     mRNA            <702847..>703974
                     /locus_tag="C5L36_0E03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467892.1"
                     /db_xref="GeneID:40386135"
     CDS             702847..703974
                     /locus_tag="C5L36_0E03340"
                     /inference="similar to AA sequence:RefSeq:NP_009370.1"
                     /note="PKUD0E03340; similar to Saccharomyces cerevisiae
                     YAL032C (PRP45); ancestral locus Anc_7.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323752.1"
                     /db_xref="GeneID:40386135"
                     /translation="MANKDLQLFKKDTEKGKDVQRQETIRKTREELNKIVAKKLHGEK
                     VTTLSSSSTNNDTTYVRYTSAQVANISAIEGNVPKQRIIKIKDEKVDPMLTPSFKIRK
                     APSGPPTDSIVPVLHDELNTEKITKADQKKWQIAPAVSNWKNTKGFIIGIENRLKNSG
                     DVNELSEEDKERSIAKFSALSNALKSAEQKAKQDINARASWRKRKEAEEDHEAQERLN
                     RLAEEARKARASSADRVEPTNERDNIHVSKHERRMERRRRAEEELKRDRLSTKQKVRK
                     LAEEQGRDVSERVVLGVSEAIKKKQKESVYDADLYLKSNTRSNNGDEIAYDSPLFNQD
                     AVLNDIYRSRNLSGYRGLGSKDQEDSGSTSVAFVKDSEKQK"
     gene            <704254..>705729
                     /locus_tag="C5L36_0E03350"
                     /db_xref="GeneID:40386136"
     mRNA            <704254..>705729
                     /locus_tag="C5L36_0E03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467893.1"
                     /db_xref="GeneID:40386136"
     CDS             704254..705729
                     /locus_tag="C5L36_0E03350"
                     /inference="similar to AA sequence:RefSeq:NP_013733.1"
                     /note="PKUD0E03350; similar to Saccharomyces cerevisiae
                     YMR020W (FMS1); ancestral locus Anc_2.567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323753.1"
                     /db_xref="GeneID:40386136"
                     /translation="MEHHEVVIIGAGISGLAAAELLDKHKVEYVIIEARDRIGGRIET
                     NRKGLTEYDLGASWAHDTLTNPLFDKILEDNEIHNLYSLYYDDQYPLYFTKDRGPQYV
                     SSNKIEQVVKELEKFIEIRYFEEIGKRDVSLKEIIAEYIRKQSRVLTKEQVLLAPQLA
                     RHLELWHGIGWEQMSSKFGLVDNVGRNCLFRNGYDKVIEQIHSKLDQNKILKNSIVKL
                     IDRSTSTVKIELTDGRVINSNWVICTVPQSILQLPIGEIGAIEWRPSLPANIKESLDN
                     MSWGKLGKVVFEFDTAWWGHHDTDRFVALANSDNQLFEVWCQSTGASAKVGHTQPSPP
                     SPESWDSPLLILNFHKIKNTPALLCFTQGTLTEYLEENPDRAWGYMEPILSRLANVDL
                     DSDETQDNRVQVTPPVNTIVSQWTVDPFSRGSYAACKPGDDPTDLVIHLERGLDKVRF
                     AGEHTILDGAGAVHGAWMSGRREAEHILIREGKLEGELNEW"
     gene            complement(<705799..>707577)
                     /locus_tag="C5L36_0E03360"
                     /db_xref="GeneID:40386137"
     mRNA            complement(<705799..>707577)
                     /locus_tag="C5L36_0E03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467894.1"
                     /db_xref="GeneID:40386137"
     CDS             complement(705799..707577)
                     /locus_tag="C5L36_0E03360"
                     /inference="similar to AA sequence:RefSeq:NP_013734.1"
                     /note="PKUD0E03360; similar to Saccharomyces cerevisiae
                     YMR021C (MAC1); ancestral locus Anc_2.568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323754.1"
                     /db_xref="GeneID:40386137"
                     /translation="MILVDGEKYACQQCIRGHRSSTCKHIQRPLVLVRSRGRPLTDSS
                     QRIAIFAEEITNENEKKEALKNENNIKNNFLAAKKIITEHATVYSSSKNEIKQEPPVK
                     SERSYCCSKIKPKQELKQTCSDSVGINQGESKCSCCSDVNGEGSKKQNDTVFVLKAAK
                     RQVFNVEKESLRLLDPVMDIPNSKVGLDVIYKVSKSKKMQSCKNKRIKDDILRTINKP
                     TGKTSCCGSKAQANHVHANPIESQVYQFKVNLGKPVEPSNNCSQNMQRKIIERHDQTL
                     NSPYVRPSYINEYDPSIYSSSTQQSELINHNTANSNTIYPLSAPVDQLQYNLYVADSC
                     TVPGSCACDPDKCDCPDCTEHQQFRDSTLTIRQQFEEFQFPNKENNHIRPFGKVELKP
                     TIPQFEQSFIDMLNSYDDPKSHGDTPSSVELDDCYCEADKCCCFNCVQHGILNGIRLR
                     DGKSIIEIQTTDVNQPNTHFLRHQSPSTPSSFSTSSENSNQALTDRDRWFQQHQSYIN
                     NQFQEAVQKSSVERLGSTHEIPNNTSREYNNITVAMGNQHISSPIEILNQQPINQNIS
                     GQQNSNLPYPDEQVFTPINQINFGAI"
     gene            <708071..>710758
                     /locus_tag="C5L36_0E03370"
                     /db_xref="GeneID:40386138"
     mRNA            <708071..>710758
                     /locus_tag="C5L36_0E03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467895.1"
                     /db_xref="GeneID:40386138"
     CDS             708071..710758
                     /locus_tag="C5L36_0E03370"
                     /inference="similar to AA sequence:RefSeq:NP_014982.3"
                     /note="PKUD0E03370; similar to Saccharomyces cerevisiae
                     YOR337W (TEA1); ancestral locus Anc_7.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323755.1"
                     /db_xref="GeneID:40386138"
                     /translation="MSKRDSMDQPEVKRKRRTPLSCISCRNRKVKCDRHKPRCSRCEK
                     ANIACEYDSPILFSEITTSSIAGEKDNYNMFFVSSLEKTNKKNDPVIDEPYVSANGDT
                     AQEKLKRINELKKELHDLEQSFNEETECFSLILDYDNNSSVHFVSKYNARLMAFGSFM
                     MSSIWKRDPLMKKFIKTFVILRSKAIKVVPSNDPAHIVERYLPQAKEEGEPKYLKHMK
                     IFEFLNSQLKSKKSTKIMLDKEGIVKKIEEVIPPLEVINFHLEYFMRYIHPFIPILDE
                     YIFRSNIASIIISDNDRSKPKISLTSKLDYTRISLLLVIMRLSYLSLHLKISMTEETL
                     SPIIDYVLSFPLNPDIFNIVQASLDKLQYLRKTSTETFQLLLLIRFYQCRACEDGDGF
                     VGTDGKVFVGLITSTAKVLGLDTKFNDPRPIHEHEENIDMNSFPLHLRMNLLTRGPGP
                     FINLWKKLGILTLEADLGHSMVSGACPLIDHDPEMSRNHGLMFDKVNSNVIDLKLEET
                     IVKRLQLYEEIDYPVAQLFAKLHSYKSKAKVVEVEESLRNIYQIIEEKYRLVDVVDEY
                     SRLSNVMTLKSIIEVFNSMLMIQYSLVLHQEHNALKYPAIEEDCKKKILTNIPTILTQ
                     SIVLADSMLLAWTKISSFTFNQLQNTEAEYKDFILILAPAIQNALPKLMMILFFISIR
                     ILTFSHAIKANGRSNEFANKIVQFEKMNKHVLILMKTMIIVGERLSINWYAALRSYLY
                     FKKLVEWFESGGKFALDFQIEYSRTVELKDISEDIRNLKQVEMVNSILTSFDDIIIEN
                     LNLKFEVMEKNYGLDNIHGIYKSVFVKYESADMSTIPDDMSFMQSGTTPDDHNYYTNA
                     GIFEPSEFIDWDDVTNWFNQGNVFGDIGDSLEREINSFI"
     gene            complement(<710854..>711285)
                     /locus_tag="C5L36_0E03380"
                     /db_xref="GeneID:40386139"
     mRNA            complement(<710854..>711285)
                     /locus_tag="C5L36_0E03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467896.1"
                     /db_xref="GeneID:40386139"
     CDS             complement(710854..711285)
                     /locus_tag="C5L36_0E03380"
                     /inference="similar to AA sequence:RefSeq:NP_116328.4"
                     /note="PKUD0E03380; similar to Saccharomyces cerevisiae
                     YBR255C-A; ancestral locus Anc_7.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323756.1"
                     /db_xref="GeneID:40386139"
                     /translation="MTQDTVESKTLTPEQRETNDFNGGFSNQNMHHTSKEHLKRLNSA
                     ILKATFVGALYGGLISIPTELLIRWRSPLYRAFGWRIRMFYHTIWIASAAAFHAEREV
                     IRFENIIRQEEAERRNKLLELSIMQGVYTPESEGFKSKRGD"
     gene            complement(<711689..>712195)
                     /locus_tag="C5L36_0E03390"
                     /db_xref="GeneID:40386140"
     mRNA            complement(<711689..>712195)
                     /locus_tag="C5L36_0E03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467897.1"
                     /db_xref="GeneID:40386140"
     CDS             complement(711689..712195)
                     /locus_tag="C5L36_0E03390"
                     /inference="similar to AA sequence:RefSeq:NP_013409.1"
                     /note="PKUD0E03390; similar to Saccharomyces cerevisiae
                     YLR306W (UBC12); ancestral locus Anc_4.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323757.1"
                     /db_xref="GeneID:40386140"
                     /translation="MPPKITTAQKRLLRELRELNENPTEGIVACPISENDLFHWKCLI
                     TGPTDTPYEFGVFEATLDFPSDYPLSPPKMKFVTPILHPNVYKDGTVCISILHASGND
                     PLNYEPANERWGPLQSIEKILLSVSSMIADPNPNSPANVDAAKLWRSNRDKYDEIVRQ
                     QVRHSLQL"
     gene            <713630..>716563
                     /locus_tag="C5L36_0E03400"
                     /db_xref="GeneID:40386141"
     mRNA            <713630..>716563
                     /locus_tag="C5L36_0E03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467898.1"
                     /db_xref="GeneID:40386141"
     CDS             713630..716563
                     /locus_tag="C5L36_0E03400"
                     /inference="similar to AA sequence:RefSeq:NP_013732.1"
                     /note="PKUD0E03400; similar to Saccharomyces cerevisiae
                     YMR019W (STB4); ancestral locus Anc_2.565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323758.1"
                     /db_xref="GeneID:40386141"
                     /translation="MSVSQHRIPVVSESLVGDKSNKTTTNNNTENNTNNNTNNNSKQE
                     SIVTSPSQLNSLLNPSKSSTALSRMDQQQKSAPPGSNISDKHLQSSKVHTSEATNVRN
                     GEGVAADDEEEDEEEDEYSGKPNQTHSDSESMKIDGNVGIRSNQKTPRKRSKVSRACD
                     ECRRKKVRCNAILDPNTSEIQKICTNCEKSNDKCTFTRVPLKRGPNKGYNKKNINTSS
                     PNRDPRSRSNSNPNPNSIPNPNPKSIKKSGSISGETNKPLSYLPISNEQNPSRQHFIL
                     PPLNSIPFRNPVEQNNQRPYPSSHPHPHPHPHPQQHQQQQQQQPLSPSPQAELYPTQQ
                     QIELRQHPQQHSPQQNAVSSNQQGIFWKVPVEMPSFSPEAINSRRRRGSVESISSLSS
                     SGSNKRLMTGKGSFSSNTKSGFGVEASDSEDEFFSNNLNRLSRSNFQVPFKLQHSRRG
                     SVDTNNESNRSSLSSIGSLNLSQSQLQAQPQSPIMPMSGVVLPPQVNDVRERIFTLLD
                     SYYKTLYPQYPLVPPSMVMKNSIQSIIGGSEFSTVIDILHLSLQSVLTLTNSPEGLLH
                     ITRAYEIAISIFVSKSAIYSSTSAKIVLTSSLTLLNYAIVLSGYEYSLGFGVAFSFMK
                     DWFVFREGYDSPSFVQLIQLVVLDSLYSLYFGVPRSNTVCFAIDGNFIESFFKEVEFP
                     MDVDIEWVSIGLHLVVLNNKLQEMDTLGKLDSIEVTGTRYKFMAIIKLYYELFTYCQR
                     LNVQQVINEYNSVIDNSTEFSSITEVLEKYIYNVELDISKITKKLTNLIDEQCDDLEI
                     TKPNVLISLILVKCYHISTNCEVLVNSLLTLNQMLDLSNNTNSGLNKNTISNNQTPSS
                     TNESTSTRSRSSSINSVNVIRSGSASTQVYSLTDYNHRLLKLRDSIRGNIRRCLAINQ
                     THRHCIEIMSQLERSPKPDINVPRTNSNSEIKYSVVIQSWIRLVNVFLTSEITKEGIN
                     GWCYA"
     gene            complement(<716860..>717261)
                     /locus_tag="C5L36_0E03410"
                     /db_xref="GeneID:40386142"
     mRNA            complement(<716860..>717261)
                     /locus_tag="C5L36_0E03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467899.1"
                     /db_xref="GeneID:40386142"
     CDS             complement(716860..717261)
                     /locus_tag="C5L36_0E03410"
                     /note="PKUD0E03410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323759.1"
                     /db_xref="GeneID:40386142"
                     /translation="MGIFSKIRKAFETPERNRLLDTENNKQQFDVDKEDEPPSNQLLD
                     TVSNREGAEVALGANDGDKPKNHLEDTLSNEQAEVLVQGENPNPPGIPSNNKLLDAKS
                     NEFPAGSLAQVTEHNPNHISQGNPLNSARLK"
     gene            <717701..>718393
                     /locus_tag="C5L36_0E03420"
                     /db_xref="GeneID:40386143"
     mRNA            <717701..>718393
                     /locus_tag="C5L36_0E03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467900.1"
                     /db_xref="GeneID:40386143"
     CDS             717701..718393
                     /locus_tag="C5L36_0E03420"
                     /inference="similar to AA sequence:RefSeq:NP_014774.1"
                     /note="PKUD0E03420; similar to Saccharomyces cerevisiae
                     YOR131C; ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323760.1"
                     /db_xref="GeneID:40386143"
                     /translation="MTVHGKYRLALLGHGNGVPLRGVIFDMDGTLTKPQTWMFAEMRK
                     QLSVPDGVVILDYLLDIPDGPLREEAEGKIRAIEERAMHEQEPTLGLKELFLNLRTCN
                     VKTSICTKNVAKPVDAFCSKFLKDRELVTGPIITRNFYPPKPSPKPLLHIIDSWGVSP
                     HQVLMVGDSREDMQAGLEAGCAVVLLRHEDNGDSEAAFAVEGSKSKLDGIVTDFFELY
                     KLLQDGIVVDRI"
     gene            complement(<718431..>720449)
                     /locus_tag="C5L36_0E03430"
                     /db_xref="GeneID:40386144"
     mRNA            complement(<718431..>720449)
                     /locus_tag="C5L36_0E03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467901.1"
                     /db_xref="GeneID:40386144"
     CDS             complement(718431..720449)
                     /locus_tag="C5L36_0E03430"
                     /inference="similar to AA sequence:RefSeq:NP_009847.4"
                     /note="PKUD0E03430; similar to Saccharomyces cerevisiae
                     YBR288C (APM3); ancestral locus Anc_2.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323761.1"
                     /db_xref="GeneID:40386144"
                     /translation="MGFIDAIYILDTEQDPVFQYQLDPNVPSFSYIQNQLLTIKREIN
                     PQSSTSILSLESASYERIFEADPSSESIGLDPVVKLDSKWTAAWCKCEDLYILAVGTS
                     RPGTLEVVSDDEDEGEDDDDDDDDDEGEEACEEGTAVEEDYEKDDNQVNGQETKGEEE
                     GHWSDINQHNAFSDNDCKTTENNTQDVTEDSAKSQHIYNVLNPLQYINFFDILAQAMK
                     MMLQTDTLTAHKIRIKSHTIVMLLQELFDASVPLISDLNQLRELLPNDSIIDKLVSAT
                     KQIQNTAASSISTFKSGYIPNIRNDNTPEPTNTFNYSTILEKSGNKFPWRSTQVKNAQ
                     NEIYIDLYETIDVTIYPKGGNKALKNLKGNYTSFPTANRNPYINSDALFSKSVIHGHI
                     DLTTSLPGSPNLEIQLNAPYGIDLDECYPSLHHAIDKSVWTNSGGKIIELVPPDEKCK
                     LLTYHIDLLEMGDSNPDLDISKYAGSIGVELYSGLGTNKNEFEIVLSTGCGLNSGFGT
                     NDVNVKEIEAIEIEIFLPESASSLDLSSNEDGLGEAGRDFNGTATYGANKSTSDEDPN
                     LQLKVLRSSTGTIIHSESGNSYKWVMDSDVVIGGRYTLRGCIGIGDCNEEKKVPIKPK
                     FLKVNYRHHGSVPSGIKVQGVKVLSGGIKAKPFKGVKYTSKSGDFIVR"
     gene            <720746..>726583
                     /locus_tag="C5L36_0E03440"
                     /db_xref="GeneID:40386145"
     mRNA            <720746..>726583
                     /locus_tag="C5L36_0E03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467902.1"
                     /db_xref="GeneID:40386145"
     CDS             720746..726583
                     /locus_tag="C5L36_0E03440"
                     /inference="similar to AA sequence:RefSeq:NP_009672.1"
                     /note="PKUD0E03440; similar to Saccharomyces cerevisiae
                     YBR114W (RAD16); ancestral locus Anc_3.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323762.1"
                     /db_xref="GeneID:40386145"
                     /translation="MSRLERLVTILETGSTPYVRNTAADQLADLAKQHPHDTLNLLSR
                     VYPFLFHKKWETRISASRAFGGIISHIPQWDPNADEETAASTTDQCKMENEEDIKVKL
                     EEDCDDEDQEFKLKLEKLLNTDEYEAMLVSFQDWNLNEILTSGCVLLSATDDSFNVFK
                     SDSAGELMNKKLKTSTFTKKIGYDELMTQIKVKTEIEREPSVPSDSSSPVKEENVDTP
                     SQSAKVSARMRALAKRKAKLGNSKPMNVDITQSTISNQLSRSEKLSLDSNPKNELDIT
                     SQQNGTKLVIENKPLQETVSSFAKFADHVWILQGVYELLIKSLFSPDWEIRHGSTLGL
                     REIMRFKNQALSAGRVSNKSRSENDERNKKTLEDLIVRILAILSMDRFGDYVSDTVVA
                     PVRENAAQVLAAVIRWVDDKTLQIMFTCLCDLIKQNSLPRVIWEAKHGGLLGLKYFVS
                     IKPEFLISNSNLFCETANIVINCLRGSPNDIDRDDDVQTVAASVIIPITKQFVSLQSD
                     LVKELLSVLWGCLIDLKDDLAAATGSVMDLLGSLCCEKLVIDVLHEMSTSSEDWNFAK
                     LVPRLYPFLRHSLTNVRKSVLKTLLSFLDIPDEKMSLWIDGQIVRLIFQNILMERNHE
                     LLELSFVLYEKLIDYMTKKSTPIDSILQEHIIPLIDLMNTPIGLPRFNYSMNPTNILR
                     PSGQFMTPSDIQLTGINFKQSNTVHSTHEHHDKRRKRKADLETPKSPPVENKSTGIPT
                     SEYDLQVNIDAPMINVDVTLVPIETIYRTRLLAAAALGRTMSRYCNEEKLLAILKILK
                     ENMLSSYITPRMISSWVLNEYFSSIIKLGRVEGVDYSKISQYVNPLLIELLTSSSSSF
                     PFFKELVPLLKSTRFQCNYLLLLFREQAHLSPSKLKSIAILVQGESEAGPGAFSLKDA
                     QDIVENWFDSSYRTLSASTRISVGKLLENERDRIRRSITEVNDEYQSRLNSTLSSIAG
                     AYIHSINFEGEGKLPNKLNPVIRSLMDGVKLTNSNEIQNYTASNVAYLVGQLIKESRI
                     SIAEKIVKNLCGFLCVDPAEVPEYSPNKNYDGILSLIREGREANMEDEIIPVPTADDN
                     EKQRIDFQIRSAIIKRRGGKVTLESLVSLFGPELFSKLPKLKSLMLDQFVLLNKNVDE
                     LTDKEGQSVIDSYELINTLFPHLNSGIRGEILAKLSELMHGLLSSKSVFRYSAAKCLA
                     TIISTMPTQGFQYLVEDILPLLSNPLHVEQRQGVIECIYHVVQYMGSKILPYVVFLIV
                     PVLGRMSDSNKDIRLLATSTFAQIIKLVPLESGIVDPVDMPQRLLDSRQKEREFLAQM
                     MDPSKIEPFELPVSIKATLRKYQQEGVNWLYFLNKYHLHGILCDDMGLGKTLQTICMI
                     SSDHYLRAEKFAKDGSIENRKLPSLVVCPPSLTGHWEQEVNQYAPFMKVLVYAGPPTV
                     RNTLKDEINSKVPDGIDIIVTSYDVVRNDISFISQFDYNYCVLDEGHIIKNAKSVLSK
                     SVKQLRSEHRLILSGTPIQNNVVELWSLFDFLMPGFLGTYKQFDTRFAKPIALSRKNK
                     GKKEQERGSLLLESLHKQVLPFMLRRLKEDVLGDLPPKIIQDYYCELSNLQKQLYRDF
                     IHKQKKNIVKDIEEVEVGEGSDDDNSNGKQHVFQVLQYMRKLCNHPSLVLTEKHPQFK
                     EVTAYLKKYNMELDDIEHAPKLLALKNLLKECGIGLIGNESTVISQHRALVFCQMKDM
                     LDIVENDLLKKHMPNVTYLRMDGSVDPRYRQNIVKQFNEDPSIDLLLLTTKVGGLGLN
                     LTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKRVVNVYRLITRDTLEEKIMGLQKFKM
                     NLANTIVNQQNAGLASMDTHQLLDLFDADKVDEGEGRDGEVEKRSDGEHVKSKANGAK
                     GIEDVTDDGGLGGKAGSVVKELGELWDAREYEEEYNLNTFIETLK"
     gene            <727946..>730222
                     /locus_tag="C5L36_0E03450"
                     /db_xref="GeneID:40386146"
     mRNA            <727946..>730222
                     /locus_tag="C5L36_0E03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467903.1"
                     /db_xref="GeneID:40386146"
     CDS             727946..730222
                     /locus_tag="C5L36_0E03450"
                     /inference="similar to AA sequence:RefSeq:NP_009670.3"
                     /note="PKUD0E03450; similar to Saccharomyces cerevisiae
                     YBR112C (CYC8); ancestral locus Anc_3.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323763.1"
                     /db_xref="GeneID:40386146"
                     /translation="MASYDKKFIQQCAATWIAIGTCADTIGQVEKAVEAFSTALRYSP
                     NNAKALTHLAHVYRTRDAYAEAADLYRRALALDQHNGETWGLLGHCYLMLDDLQSAYT
                     AYQQALLNLQNLSVPKLWHGIGILYDRYGSLEYAEEAFVRVLEMDPNFEKANEVYFRL
                     GIIYKLQGKLQKALECFQYILNVPPAPLTQTDVWFQIGTVLEQNRDFNGAKEAYERVL
                     QASPNHSKVLQQLGGVYSQPEAPFYDLDIALQLLGQSIELNNTDAHSWYYLGRVYMSK
                     QDYSNAYEAFQHAVNLDSRNPTFWCSIGVLYYKISQFKDALDAYTRAIRLNPYLSEVW
                     YDLGTLYETCNNQIGDALDAYRRAASLDPENPHIAERLMQLSKYEKEGGALPPPIQNQ
                     HQLTMPSYQMIQQQQQQQQQAQQAQQAQQAQQAQQAQQQAQQAQQAQQQVQQAQQAQQ
                     QAQQAQQQQIQQTQLNQASQPTEPSQQFQQPNNPVMLQPLVHQPPQIVQPVQTQQSTS
                     SYSVMPPVPHTTDSLHADGKNDKKQKKAKKQVGEVAKVGESTSTNSESSKTSEVGSKE
                     IKHDTKTEEDAAEVSGQSKNASLVPPSEIKEEKKTDPKPESVAESPQSKNQDNGAEKR
                     PLENSQPETEEKRQKVSPTLTPTSNLNSEPSSEGKGEVDVVEQTQQGTPQQEPEKKQE
                     QQEQRKDVAKTHEAFVQVEKKTIDLKPMDVEEVKELKDIVHNEVEDEEVKNTAKLVAE
                     PTTESKVREIDEDENYDD"
     gene            complement(<730382..>730660)
                     /locus_tag="C5L36_0E03460"
                     /db_xref="GeneID:40386147"
     mRNA            complement(<730382..>730660)
                     /locus_tag="C5L36_0E03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467904.1"
                     /db_xref="GeneID:40386147"
     CDS             complement(730382..730660)
                     /locus_tag="C5L36_0E03460"
                     /inference="similar to AA sequence:RefSeq:NP_878049.2"
                     /note="PKUD0E03460; similar to Saccharomyces cerevisiae
                     YBR111W-A (SUS1); ancestral locus Anc_3.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323764.1"
                     /db_xref="GeneID:40386147"
                     /translation="MSDLYEKIQGELVSSGKYKEIYNLLETELRNSGWYDNFLNLTID
                     TVEGTPDSDLQFGKLVNMLQDKGIESVPDEVKVKVLQKIAQFLDDVVE"
     gene            <730853..>731542
                     /locus_tag="C5L36_0E03470"
                     /db_xref="GeneID:40386148"
     mRNA            <730853..>731542
                     /locus_tag="C5L36_0E03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467905.1"
                     /db_xref="GeneID:40386148"
     CDS             730853..731542
                     /locus_tag="C5L36_0E03470"
                     /inference="similar to AA sequence:RefSeq:NP_009669.1"
                     /note="PKUD0E03470; similar to Saccharomyces cerevisiae
                     YBR111C (YSA1); ancestral locus Anc_3.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323765.1"
                     /db_xref="GeneID:40386148"
                     /translation="MLRYLRCCVRTMSNTREQYKDAAKLLDPASTVAKITKRTKLENE
                     NAKFVNLEKLEYVSPLGKQGVWEIATRTTKPKGSLVDAVIIVPILKYPNGDKKLVFVR
                     QFRPPCNGVVVEFPAGLVDPNDSIETCALRELKEETGYVGVIRKKTGVVWSDPGLVDA
                     NCSMVWVDVDMSLKENKTPVPHWMDNECIEVVDVPLNELEGKIDEWTKQGYLIDGRVQ
                     TLVIGMAMANE"
     gene            complement(<731621..>732280)
                     /locus_tag="C5L36_0E03480"
                     /db_xref="GeneID:40386149"
     mRNA            complement(<731621..>732280)
                     /locus_tag="C5L36_0E03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467906.1"
                     /db_xref="GeneID:40386149"
     CDS             complement(731621..732280)
                     /locus_tag="C5L36_0E03480"
                     /inference="similar to AA sequence:RefSeq:NP_013785.1"
                     /note="PKUD0E03480; similar to Saccharomyces cerevisiae
                     YMR069W (NAT4); ancestral locus Anc_2.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323766.1"
                     /db_xref="GeneID:40386149"
                     /translation="MEEARILLDTLQKSIISWDRLREFQIEVMEVSDLEASEQDNCIE
                     LLDHNLGALYTKTQGPRWRLHKKEEMLEEGLVYLLIKDLELGKLLGFLSFKIVHDDDM
                     DLHLLYLYEIQFTEVLRNKGLGTFFLCKLEEIVKKINGSGKIKKLWYKRDSEYYDGLD
                     DPELELTGIGLTVFGENENARRLYERLGFALHSTSPQPKKLRNGKIVYPEYMTLEKKI
                     H"
     gene            <733411..>734433
                     /locus_tag="C5L36_0E03490"
                     /db_xref="GeneID:40386150"
     mRNA            <733411..>734433
                     /locus_tag="C5L36_0E03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467907.1"
                     /db_xref="GeneID:40386150"
     CDS             733411..734433
                     /locus_tag="C5L36_0E03490"
                     /inference="similar to AA sequence:RefSeq:NP_011356.1"
                     /note="PKUD0E03490; similar to Saccharomyces cerevisiae
                     YGL159W; ancestral locus Anc_1.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323767.1"
                     /db_xref="GeneID:40386150"
                     /translation="MLVVNESVVTSLFANLTRAGVKQYQDTLLRALQEYEKHPEIIPP
                     RIVTSTEQCVHLFMASTGTHVGMKAITGSKEGFKGITTILDKDNGYPLGIINGATLTA
                     FRTALCNTLPLVKYYPLEHTYENETLVVFGVGDQAVWHVRLSLILYPGRFSKVVVSNR
                     TVSKAVKLCELFGHEYPNVEFLPYGLSTGEDDDPLLKEFEKTTVVFTCIPTSKPTVTR
                     KLVQNCKGHCFIGAIGSYKPHMTEIEGAVLHDLVLNKGGKIVVDSVEHCLHEAGELII
                     NDIKESDLVDIPSLYTSQFDDASFKESEVVVSKLVGLCIMDVWVGNQCLEEARKAGKG
                     IEIDDF"
     gene            <734709..>736529
                     /locus_tag="C5L36_0E03500"
                     /db_xref="GeneID:40386151"
     mRNA            <734709..>736529
                     /locus_tag="C5L36_0E03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467908.1"
                     /db_xref="GeneID:40386151"
     CDS             734709..736529
                     /locus_tag="C5L36_0E03500"
                     /inference="similar to AA sequence:RefSeq:NP_014009.1"
                     /note="PKUD0E03500; similar to Saccharomyces cerevisiae
                     YMR282C (AEP2); ancestral locus Anc_8.847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323768.1"
                     /db_xref="GeneID:40386151"
                     /translation="MLRGYKVASSHVRGVAFFVPSNRINEYSKRELQENATIELFEDN
                     YKKLKHYYEDRFPDIKFKNVKTQKTPFAKFSFKPNDDTVVAALDSVNIDFFQNINEKI
                     PVADDVLAERDFRKMVKLALYNTKVPKLYNLLKCNLSRISTLKDELTPSDVSVIIRRL
                     ISYHDMVSKSAKFMTKNRKYLYEDNESYVTRLNEISDSLYTQNTLIFNACARAFDLSI
                     SDYEEIVMFHYRNGKIPKTVEIIAGLEKKAQEVDSKLYLSNKLWFCKLDILSKTSNQF
                     WKIYGEKLFRNEKKVGLKNNYLYPHHGHNFQILLQRYEHDKSINNLPDDADIINVIIK
                     GLGKHCDIPSLDKLIESYWGIKIDRISERGVYLMEHFNIRKNVNALIWPNEKIITSIL
                     LSYATNGDVATGIMVNNMILEKYNDKRILNSLNTIKYWEFVLRCVGLYGDATEKNIAR
                     LLNETEIIDDHGNSLLEIKYRFFDIVSNMSERFVRFPTREMFQLKIRYSSSHEILNGL
                     PIAYKQLNNDGYNHSRLNYRANQHTLYKYVEECCKELGNRGLFLDAKSIIEKYITSKQ
                     ETKSLKDMLGEMQEIYARKRVKEDERKRRVEDEDDDFQLW"
     gene            complement(<736725..>737654)
                     /locus_tag="C5L36_0E03510"
                     /db_xref="GeneID:40386152"
     mRNA            complement(<736725..>737654)
                     /locus_tag="C5L36_0E03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467909.1"
                     /db_xref="GeneID:40386152"
     CDS             complement(736725..737654)
                     /locus_tag="C5L36_0E03510"
                     /inference="similar to AA sequence:RefSeq:NP_014008.1"
                     /note="PKUD0E03510; similar to Saccharomyces cerevisiae
                     YMR281W (GPI12); ancestral locus Anc_8.846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323769.1"
                     /db_xref="GeneID:40386152"
                     /translation="MGLLKLSYFVTLTFLAWVGLTTILPNFCNTDPSKSKLLNYDGYL
                     QSAYYNSINTPAIVENNLVNSHIVLITAHPDDESMFFTPSLTELSKGNYNNKIHLICL
                     SNGGYEGLGNIRERELHNAAKLLSIETVRVLDFKDDLKVYWDTDEIKESIDEELRSLK
                     KQYGIKSKREIVFLTFDEDGVSGHPNHMSIHKAAKEYAQAKHIRAYYLKSWNLFVKYS
                     NLFITSIELACRWLTKSETIRAKLAKYNIDLSQILLLGENHSQSIRIYSDLNSLFLNF
                     STMTWSHYSQIVWFRWIWIFSSKYMNSNELVPM"
     gene            <738370..>739842
                     /locus_tag="C5L36_0E03520"
                     /db_xref="GeneID:40386153"
     mRNA            <738370..>739842
                     /locus_tag="C5L36_0E03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467910.1"
                     /db_xref="GeneID:40386153"
     CDS             738370..739842
                     /locus_tag="C5L36_0E03520"
                     /note="PKUD0E03520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323770.1"
                     /db_xref="GeneID:40386153"
                     /translation="MTVALSGSSRRFCVGTVSKIACPIRGKRYNSSAQYEDPEDVKKR
                     EDLYKRLTGKPLDDIETKKIYETPLVSTVAFRNPEVLSSPFVCLDENIALRSIFTELL
                     NKTELDKYDYFMKINTDTSATHQDRLDAVINWRHKFKKSFKSIPVNINESNLILNSNF
                     IEFFDRVTANMHDFDITRSVSQLQEEFYKLSYTDTFILHLKYVPKLSEDKRGVFINQL
                     DKYLQESILHFHDSSLEQICLELLKLKEVQLITNIINSYDTTTHSRFYDNISPHFLHQ
                     YLEGLITQNDVQTASQVLNYLSDNEYIIPSDTLTQYFKLVHTVVTNVQAPKNKKEMLF
                     NLLTKSTSCMLLQDGMLNEEIVFYITDFIRINILHIFVKYLQLSPNYKELNSIPDIII
                     QRISSSSPFHRKSDQKKAIFTTNLLNSLNFESKEISDACKKNIIRIYAEAHSPLAVLN
                     WSKQLEIPLSTVERDSFVKILSVPSGSDNVTSSFDISDKL"
     gene            complement(<739954..>740793)
                     /locus_tag="C5L36_0E03530"
                     /db_xref="GeneID:40386154"
     mRNA            complement(<739954..>740793)
                     /locus_tag="C5L36_0E03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467911.1"
                     /db_xref="GeneID:40386154"
     CDS             complement(739954..740793)
                     /locus_tag="C5L36_0E03530"
                     /inference="similar to AA sequence:RefSeq:NP_012715.3"
                     /note="PKUD0E03530; similar to Saccharomyces cerevisiae
                     YKL207W (EMC3); ancestral locus Anc_1.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323771.1"
                     /db_xref="GeneID:40386154"
                     /translation="MSEVHITLDPQIKTHVLLPITIVMLLVHLLRQLSNVFLKPKQQL
                     QTRGKVRESQHLQRLTMIGQNRNTVLCRSEWDSRKLQINDLYNKPTSLNKILEKPSTT
                     KENKSGTSEFSNPFEQSGMNDTIMQGLKTNIINYLPQPVLMFYMSYLFRGYIALKLPF
                     KLTSNFKPMFQSSIMTPDLDVSYVTGISWYFANLLGVESLGNLVSYVFGMKRLLSSPE
                     DDLLENVSLLLGSGGLNQIQVAGLGTPKAVDTFKKNIDAIRMANYDPCIDNVQKRVVD
                     SFK"
     gene            <740983..>742017
                     /locus_tag="C5L36_0E03540"
                     /db_xref="GeneID:40386155"
     mRNA            <740983..>742017
                     /locus_tag="C5L36_0E03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467912.1"
                     /db_xref="GeneID:40386155"
     CDS             740983..742017
                     /locus_tag="C5L36_0E03540"
                     /inference="similar to AA sequence:RefSeq:NP_012596.3"
                     /note="PKUD0E03540; similar to Saccharomyces cerevisiae
                     YJR062C (NTA1); ancestral locus Anc_1.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323772.1"
                     /db_xref="GeneID:40386155"
                     /translation="MQKKMKLRIAAVQLNSILGNVEENMSKALKMLEQAFPSSKPKPD
                     LVVLPELALTGYNFKSPAHIHPFLEKAGNGKSYQFGKMISERWGCLTLLGYPEKYDKA
                     NEEIIYNSAMLIDAKGKLIHNYRKTHLYETDKIWGCKESPDGFQAFDVPFNGEKIRTT
                     IGICMDLNPYEFTAPFEKYEFSRFASDNKCQLILIPTAWMNSNWKENWTLEQANEFHK
                     IYQNTKLEPEINDEHNHVKDHSILIPQVSIKLAKDYRLEEVDGSTGRYWIMRLNPLYS
                     ETHDFKQVVVVCNRSGMEDKLMYGGTSTMYTFFGGPMERTPQGLSIDFNVEGSLGQGT
                     EGVLVREVEI"
     gene            complement(<742136..>743335)
                     /locus_tag="C5L36_0E03550"
                     /db_xref="GeneID:40386156"
     mRNA            complement(<742136..>743335)
                     /locus_tag="C5L36_0E03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467913.1"
                     /db_xref="GeneID:40386156"
     CDS             complement(742136..743335)
                     /locus_tag="C5L36_0E03550"
                     /inference="similar to AA sequence:RefSeq:NP_012594.1"
                     /note="PKUD0E03550; similar to Saccharomyces cerevisiae
                     YJR060W (CBF1); ancestral locus Anc_1.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323773.1"
                     /db_xref="GeneID:40386156"
                     /translation="MESPKRIAEVNITEIDNVADKRQRTENTDIDPQMKEMYAGNEGS
                     LNEAQTDTGSIDPLFTAGNGSSQPEERQEERQEERQEQRQEERQEQEEKEEQELTEKP
                     VSEEQPVSGEQQGSEQVQEQQDVIKENHNVNIQEKPSEASTFIDKQEPETAPIAVMSG
                     GVLTVDSDKSVQDQTGSQASASVVNTKGQPMVIMNSKTVSIKDPNTISKIKKLNHKEV
                     ERRRRETINNAIRELQAIVPTTHTNKSQIIRKAVEHIKKLKEREETMRNKWTLEKIIT
                     DQAINELANSNEKLKSELEKAYRENELRKNVIVRMISLLCKQTNSDDVNNYLAELSSM
                     MVDDEEEEEEAGEGQRAQAEVVAAKTGEDVVREDGNEHTTNEGEAEVEETGKEEPTKE
                     TRETNTN"
     gene            <743962..>744141
                     /locus_tag="C5L36_0E03555"
                     /db_xref="GeneID:40386157"
     mRNA            <743962..>744141
                     /locus_tag="C5L36_0E03555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467914.1"
                     /db_xref="GeneID:40386157"
     CDS             743962..744141
                     /locus_tag="C5L36_0E03555"
                     /note="PKUD0E03555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323774.1"
                     /db_xref="GeneID:40386157"
                     /translation="MCKPATCDKCNKATWFGCGQHIPVAMNSVPREQWCTCKHPENST
                     TSRDYPPKQGTGIKV"
     gene            complement(<744298..>745353)
                     /locus_tag="C5L36_0E03560"
                     /db_xref="GeneID:40386158"
     mRNA            complement(<744298..>745353)
                     /locus_tag="C5L36_0E03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467915.1"
                     /db_xref="GeneID:40386158"
     CDS             complement(744298..745353)
                     /locus_tag="C5L36_0E03560"
                     /inference="similar to AA sequence:RefSeq:NP_012368.1"
                     /note="PKUD0E03560; similar to Saccharomyces cerevisiae
                     YJL167W (ERG20); ancestral locus Anc_1.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323775.1"
                     /db_xref="GeneID:40386158"
                     /translation="MDKAIGKKKFLDLFPELVDELLDVLRENGMPKDAITWFENNLNY
                     NTPGGKLNRGLSVVDTYALLKGFKSYDDFEPSEYKKAAILGWCIELLQAYFLVADDMM
                     DQSITRRGQPCWYRVEGVKEIAINDAFMLEGAIYILLKKYFRENEYYADLLDLFHQVT
                     FQTEMGQLLDLITAPEDHVDLSKFSLEKHSFIVIYKTAFYSFYLPVALAMYMAGVTDE
                     RDFKQARDVLIPLGEYFQIQDDYLDCFGKPEDIGKIGTDIQDNKCSWVVNTALKICTP
                     QQRKMLDENYGRKNPDNEKVCKDLFYELKIDSLYHDYEEQVAKKLQEQIKEIDESRGF
                     KGQVLTAFFNKIYKRSK"
     gene            <745692..>746738
                     /locus_tag="C5L36_0E03570"
                     /db_xref="GeneID:40386159"
     mRNA            <745692..>746738
                     /locus_tag="C5L36_0E03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467916.1"
                     /db_xref="GeneID:40386159"
     CDS             745692..746738
                     /locus_tag="C5L36_0E03570"
                     /inference="similar to AA sequence:RefSeq:NP_012749.1"
                     /note="PKUD0E03570; similar to Saccharomyces cerevisiae
                     YKL172W (EBP2); ancestral locus Anc_1.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323776.1"
                     /db_xref="GeneID:40386159"
                     /translation="MAKGKGKSYKKESAKAVKDTPTGKKEKALKKKVEESNIEDEKKQ
                     QESESSGAEQEEESDNDSESDSDDEEHLDLNALNESEGDDDDEEDLLEETGKEEEEKD
                     EEEEEEEEENEEENEEDDVPLSEAEFDSDADVVPHTKLTVNNKIALKNALERIQINWS
                     KYQFDESQSITYHAKVESEIKDIYDDTERELAFFKQGLDAATEGRKKLLALKIPFSRP
                     SDYFAEMVKSDDHMDKLKAKLVAEATEKKAREEARRQRQLKKFGKQVQHETLQQRQKE
                     KREALDKIKSMKKKRKNNEMSGADDGFDIAVEEASKVGSEKQRVKKQKIRQNVSQNRN
                     NSRPGKNRRRNKRK"
     gene            complement(<746860..>749817)
                     /locus_tag="C5L36_0E03580"
                     /db_xref="GeneID:40386160"
     mRNA            complement(<746860..>749817)
                     /locus_tag="C5L36_0E03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467917.1"
                     /db_xref="GeneID:40386160"
     CDS             complement(746860..749817)
                     /locus_tag="C5L36_0E03580"
                     /inference="similar to AA sequence:RefSeq:NP_012748.1"
                     /note="PKUD0E03580; similar to Saccharomyces cerevisiae
                     YKL173W (SNU114); ancestral locus Anc_1.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323777.1"
                     /db_xref="GeneID:40386160"
                     /translation="MPTRQGIMDYQEKDELMFDEFGNLLNDDSGSSSDSESDMSLDHE
                     STENTTSTAIVKSEESNTNLSLSKTFDPSVETIIASVDTKSLNEPIVEPNVEKKFLIE
                     ERNLPHTDYSKEYMWRLTSLPERVRNVALCGNLHAGKTSLLDMLVEQTHTFDNNDKRD
                     KEKPLRYTDNHILEIKKGISIKSSVMSMLLPDMKDSSTVVNFIDTPGHSNFCDEIMVG
                     ARLADIIILCVDVVESVTKTVELVIEAALKMKTKIVLMITKIDRLLLELRLPTLDAYY
                     KIRRTIEQVNETITNICQSLDLNPNDENVRLSPELDNVCFSSSVFNLVFNLKSFTQKY
                     IEQNNLSKNVKVTVDSFSTKLWGDIYYENRKFFVKPKDPLACANSRTFIKFILEPIYK
                     LATVSLTLDAPDRKEFTEQHMKLRMKNYTYKLDSKPFLKHIFTEFFGFPSKPLLSALK
                     NTVSPKENSDSKLEYLFTGPKNSDVAHYVHDCSPSNPLVANVVKLVDTHDSEHFYALV
                     RVFSGTLKCEDTVRLLDESNSSLGSDSFKMQKISKCYMWCGRYRVEVTELRAGSIGLI
                     SGPAIDQFIVKTATIYDKRIDPSSNFTFKQLEQTIPPVFKVALQAYNPKELNKFLDAL
                     KKLNRSYIGCEVSVEDNGEHSILGYGELYMDCLLHDLRILYGGIDIKVSDPMVRFNET
                     TDELSKIKLTTKSNNGKNSISIIAEPLAPEIANDIRRGILSLRNDPPRQFAKKLRDKY
                     KWDSLAARSVWSFGPADTGTSILCDDTLPEEVDKDLLKSYKSPIVKGFQWAVKEGPLC
                     DDVVSEVKFTIIDVQLAPELADRNDAQIIQMVRKACHAALLIGAPKLLEPIYQIESIC
                     HVDALGALDLLLERRRGFVIGKERIEGSLLWKVNGIVPVIESVGLEVDLRLSTRGLAY
                     PQMIFSRWDRVPGNPLDDTVFIPLLKRVPLSSTARDFMMKTRRRKGLKEDVSLQNYVD
                     RDTWNMLMEIGAM"
     gene            complement(<750046..>751389)
                     /locus_tag="C5L36_0E03590"
                     /db_xref="GeneID:40386161"
     mRNA            complement(<750046..>751389)
                     /locus_tag="C5L36_0E03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467918.1"
                     /db_xref="GeneID:40386161"
     CDS             complement(750046..751389)
                     /locus_tag="C5L36_0E03590"
                     /note="PKUD0E03590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323778.1"
                     /db_xref="GeneID:40386161"
                     /translation="MLIMNISSYMVFLFFLMIEKNDSLCYYPYFLTGMPPREIPGFFY
                     DEEKKRYFAIPSSRDVADFHTSEVKRIRQKVEKNKRQKQLPRKLSRSQTVLSRFKIQQ
                     DAYFVHVERRWKLFQEAQTTSDTLKSLLVHQSNEIVMERPIQMSVPYDSIHIEGVLKF
                     NGFRLVLESGMIAYTGCVFYQDTPNGILAKAYSHKGMLGVRGEGDEQECHLQYDNLEG
                     LIESYKPTTNGKLLLLKNGIPSDREIQFYCDDFYIFNDYRKEALVQNSFSFTYESDVI
                     AIDQNGGCRAYCCRNGNVFVQTGQKKPMKIEFGSAACGVKLVNTEYFLVCIVSGINNN
                     LRSYKVNPELSTFSLYIIYEDYKWPVRVSSNLKGDTSMEHVFAVESQTEHSDKLELKF
                     YDVHCPRPLKMISGPFFINNLSTSEYEWAIDGGSIFLFDKESQKLNIFKSSIELD"
     gene            <751512..>753182
                     /locus_tag="C5L36_0E03600"
                     /db_xref="GeneID:40386162"
     mRNA            <751512..>753182
                     /locus_tag="C5L36_0E03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467919.1"
                     /db_xref="GeneID:40386162"
     CDS             751512..753182
                     /locus_tag="C5L36_0E03600"
                     /inference="similar to AA sequence:RefSeq:NP_012747.1"
                     /note="PKUD0E03600; similar to Saccharomyces cerevisiae
                     YKL174C (TPO5); ancestral locus Anc_1.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323779.1"
                     /db_xref="GeneID:40386162"
                     /translation="MSEHYNGDPLPGNGESNSQDLPGIGSSLHHINHQFHISENIKNL
                     GHQIAQEIYYDDDNAEEVRHFHYKQELHHKFTVSSIIGLGFSLMNVPFGVASTLSIGL
                     VCGSNVTILWGWVIFGLFSIMISLSLSEIVSKYPTSGGVYHFSSILASEKYSLITSWF
                     DGWYLIIGNLLMFVSYSFGGAQFILSMFGLLQSSYKKDSLFIMLVFVGIVVISAIVNL
                     KFQHYIDKINEFCIYWTFYTVLFADILILLFSSEFHNFKYIFTHFDASRSGWPDVIAF
                     LIGGIQFSSMTFNGYGAIVSLSEEVKSPEKAIPKGLIYSILASTITGLIYIIPLLSVL
                     PELSKLLDDNPDIFPIDIVLQLSTRSFLVTFMISLMIVGAVFFASIGSLTTVSRTIFS
                     FSRDHGLPYNSLWQQLDTTNEKETVPKNALLLAVVTSVILGSFSLISTSAFNAFLGCS
                     VMAMNIAIGIPILCLIINKRKKVRGATFKLRKFGYVVNICSCFIIILTCIILCFPPSL
                     DINIQSMNYSVAAFAIFSIAIGFGYTFWGRYNFVGPLLDATEDSHSGL"
     gene            <753530..>755902
                     /locus_tag="C5L36_0E03610"
                     /db_xref="GeneID:40386163"
     mRNA            <753530..>755902
                     /locus_tag="C5L36_0E03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467920.1"
                     /db_xref="GeneID:40386163"
     CDS             753530..755902
                     /locus_tag="C5L36_0E03610"
                     /inference="similar to AA sequence:RefSeq:NP_014619.1"
                     /note="PKUD0E03610; similar to Saccharomyces cerevisiae
                     YOL023W (IFM1); ancestral locus Anc_1.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323780.1"
                     /db_xref="GeneID:40386163"
                     /translation="MLARSLISRACLSNLSKPNILAIKRDLSHTFYANAAPLRRSRFQ
                     PIKKESESAAETATAAGSIEELLDTKIAEKLNEEKVVETAKSSKSKQQHKRPQNKDVK
                     SENDQQKQKVNDKRAAQGSKNSEPENIQKRDYKNEQKRINSTQKPAKVSKVKVKAKKK
                     AADNPNSPKYKLDIPTFLSVANFATILKVRVPELIEKLDDLGFENITNEHILDAETAE
                     LIAQEYGFEVNRDDNTGADLFPASETTDSSKLTPKAPVVTIMGHVDHGKTSILDYLRK
                     SSIVKGEFGGITQHIGAFVVQTPVSKKKITFLDTPGHAAFLKMRERGANMTDIIVLVV
                     AAEDSVKPQTVEAIKHAKGSGVPIVIAINKCDKPEANPDKVVADLASHGIDVEDYGGE
                     TPVCRISAKTGLGMKEFEETIVTVAELLELKTEERANVEGWVLESQVKKGLGNVATLL
                     IKRGQLKPGCILVSGTTFCKVRVMKDEHGKPIKVAKPAQPVEVSGWKELPEAGDYAIQ
                     AKDENYAKKVIINREKRKRMMDEASQVEEMNKRRIKSIEDSKKSEKIQEYQLQGFSLE
                     EIKELEPDLFDDESNKIKYVNFIIKADVSGSAEAVRQSIEGLGNDEVKSRIIFEEVGA
                     PTESDIARAKDSDAEILVFNTKVPKDILNSASKSKVEIKEFNVIYHLIEHVLKTLTSK
                     LTPIYETKVISKVAIKQLFEIGLKGKETMIIAGSRVIDGTFKKNSQVRLVRNGEVIYT
                     GKVKQLKVVKNDVNEVKNGADCGVSLEGDPEMKEGDIIEAFEQIPIQRHL"
     gene            complement(<756049..>756948)
                     /locus_tag="C5L36_0E03620"
                     /db_xref="GeneID:40386164"
     mRNA            complement(<756049..>756948)
                     /locus_tag="C5L36_0E03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467921.1"
                     /db_xref="GeneID:40386164"
     CDS             complement(756049..756948)
                     /locus_tag="C5L36_0E03620"
                     /inference="similar to AA sequence:RefSeq:NP_010965.1"
                     /note="PKUD0E03620; similar to Saccharomyces cerevisiae
                     YER046W (SPO73); ancestral locus Anc_7.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323781.1"
                     /db_xref="GeneID:40386164"
                     /translation="MCVNIPERHHSERLNIKNRGVLDTKPQKTVKVNSYGYIQSVASL
                     KRPDFPYNFTIANYEDIEKKLARLPQFANTQNLFRCLQNIQLAADNRSEKLENAACTR
                     CTYEIIIENQRGATWFGSKMYTNNSVLYPIDPPKYQTLSGKKINSISLYPDTGKWIWP
                     KWHVLLINDVDEEGWIYSSIRFGSENWSGIGKFGNFVRRRIWIRMAESAEETQATETL
                     GIIKPKKSENAKEIALSNIIHVDVNNKPKALLESSHEEEKRKKLLCKKERFAAKGLKI
                     ETKNWPKKEREVLRSDIINMNYI"
     gene            <757309..>759582
                     /locus_tag="C5L36_0E03630"
                     /db_xref="GeneID:40386165"
     mRNA            <757309..>759582
                     /locus_tag="C5L36_0E03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467922.1"
                     /db_xref="GeneID:40386165"
     CDS             757309..759582
                     /locus_tag="C5L36_0E03630"
                     /inference="similar to AA sequence:RefSeq:NP_012367.2"
                     /note="PKUD0E03630; similar to Saccharomyces cerevisiae
                     YJL168C (SET2); ancestral locus Anc_1.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323782.1"
                     /db_xref="GeneID:40386165"
                     /translation="MNKTANRSDIDNSQSATPIPEKKQLYSHYEDKTEEVKKQFVILK
                     ENQYISRLKNVYSASNEFMTCDCNEEIIDGVNHACGPDSDCINRLTNIECVNGQCDCG
                     ESCQNQRFQRREYADISVFLTEKKGYGVRANVDIPANTFIIEYMGDIIDSIEYKSRKE
                     KYDAEGIKHFYFMMIQDNEIIDATKRASLARYCNHSCSPNAYVDKWVVNKRYRMGIFA
                     KTDITKGEEICFDYNVDRYGAVPQTCYCGAPNCLGVMGGKTQSETVRLLPHIVTEALG
                     VTATDEKKWLKEQRKSGIKVTTANVESHVNVEFVKALELKPLSVADIAKVSSCLMQPE
                     LDFIVIQRIVERLLISQGENFDEILRRFNRLHGIQALGDALQTLLDNIKSKINKAQQK
                     LVEDVVHLLELWPVLKSKNSIRDSNLETTLVQLKDKGINSELKSRIDKLVESWSGLEI
                     VYRIPKKSESISSRKILDERRSRSTDHMISTKLPTGPSSATKKPWVSIDASSLPSNRK
                     LKGIPLPPGWEWATDPKNDRIYFYNRHSNVTQWNQPSWDDYTKQEEEKRKREKEREKE
                     RERIKEIRDLKYLEEKRARQREVELREQEERRNILSTIIAQASTNNDVNSSGKKSNLK
                     TNGDAKRKNVSIEENTSQRQPSPYNDWDGKKHASNERKWALLFAAYVPNVIKKYESST
                     GREVIKNCARDIVHLLAEKEAKRHAGENIPRELSHERKLKIKSFCKIYMEKFMIKFEN
                     KKRKIESSNPSSKKTKV"
     gene            complement(<759809..>761212)
                     /locus_tag="C5L36_0E03640"
                     /db_xref="GeneID:40386166"
     mRNA            complement(<759809..>761212)
                     /locus_tag="C5L36_0E03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467923.1"
                     /db_xref="GeneID:40386166"
     CDS             complement(759809..761212)
                     /locus_tag="C5L36_0E03640"
                     /inference="similar to AA sequence:RefSeq:NP_012745.1"
                     /note="PKUD0E03640; similar to Saccharomyces cerevisiae
                     YKL176C (LST4); ancestral locus Anc_1.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323783.1"
                     /db_xref="GeneID:40386166"
                     /translation="MSISEKYFPQEPQSPELKTAIPGPQSKAKLEELSAVYDTKAAYF
                     VTDYYKSLGNYIVDADGNKLLDSYCQISSIALGYNNPALLKVAHSDEMAVALCNRPAL
                     ACFPSTDYYEILKKGLLSVAPKGLDKVCTAHTGSDANEMAFKAAFLFQASKKRGDKPF
                     TSEELESVMENKLPGTSDMVILSFEKGFHGRLFGSLSTTRSKAIHKLDIPAFEWPKAP
                     FPQLKYPLDQFQAENKAEEERCLKALEEIIVNSPAKIAAAIIEPVQSEGGDNHASPEF
                     FQGIREITKKHGVILIVDEVQTGGGASGKMWLHEHYGIVPDIMTFSKKMQNAGFFFSE
                     AGLAGDQPFRQFNTWCGDPSKALIARTIIEEIKDKNLLTSVTETGDYLYSKLEAISAK
                     YDKMINLRGKGRGFFIAFDAPTPELRNKFIAECKKLGLNIGGCGEQGVRLRPALVFEK
                     KHADILASIIDQAFSKI"
     gene            <761631..>762689
                     /locus_tag="C5L36_0E03650"
                     /db_xref="GeneID:40386167"
     mRNA            <761631..>762689
                     /locus_tag="C5L36_0E03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467924.1"
                     /db_xref="GeneID:40386167"
     CDS             761631..762689
                     /locus_tag="C5L36_0E03650"
                     /inference="similar to AA sequence:RefSeq:NP_011679.3"
                     /note="PKUD0E03650; similar to Saccharomyces cerevisiae
                     YGR163W (GTR2); ancestral locus Anc_4.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323784.1"
                     /db_xref="GeneID:40386167"
                     /translation="MDKSIISNHNCETDSNATVLLMGLRRSGKSSICKVVFHNTQPLD
                     TLYLESTTKPTTENFKSLIDLAVIELPGQLNLFEPALYDYEKIFASIGALVYVIDSQD
                     EYLSALQNLGVIIKYAVSVNPKIRIEVLIHKIDGLSEDFRLDTQRDIMQRVGDDLLDY
                     GLEGVQISFYLTSIFDHSIYEAFSRIVQKLIYELPALENLLDLLMQYSNFDKVFLFDI
                     NSKIYVATDSSPVDIQNYEVCAEFIDVSIDLDGLYETNNEDNRKKPTYSENTYDENRN
                     VPEEVDNSQIYRPTKCISRLENGTMLYLHQMIRGLALVAVSRLENDDEITSISVIDHN
                     VAIFKKSLEKMWEQAKLR"
     gene            complement(762822..762903)
                     /locus_tag="C5L36_0Etrna11S"
                     /db_xref="GeneID:40386402"
     tRNA            complement(762822..762903)
                     /locus_tag="C5L36_0Etrna11S"
                     /product="tRNA-Ser"
                     /note="PKUD0Etrna11S; codon recognized: UCU"
                     /db_xref="GeneID:40386402"
     gene            complement(765366..765447)
                     /locus_tag="C5L36_0Etrna16L"
                     /db_xref="GeneID:40386409"
     tRNA            complement(765366..765447)
                     /locus_tag="C5L36_0Etrna16L"
                     /product="tRNA-Leu"
                     /note="PKUD0Etrna16L; codon recognized: CUG"
                     /db_xref="GeneID:40386409"
     gene            765548..765619
                     /locus_tag="C5L36_0Etrna9E"
                     /db_xref="GeneID:40386418"
     tRNA            765548..765619
                     /locus_tag="C5L36_0Etrna9E"
                     /product="tRNA-Glu"
                     /note="PKUD0Etrna9E; codon recognized: GAG"
                     /db_xref="GeneID:40386418"
     gene            <765940..>766734
                     /locus_tag="C5L36_0E03660"
                     /db_xref="GeneID:40386168"
     mRNA            join(<765940..765944,766047..>766734)
                     /locus_tag="C5L36_0E03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467925.1"
                     /db_xref="GeneID:40386168"
     CDS             join(765940..765944,766047..766734)
                     /locus_tag="C5L36_0E03660"
                     /inference="similar to AA sequence:RefSeq:NP_011515.4"
                     /note="PKUD0E03660; similar to Saccharomyces cerevisiae
                     YGR001C; ancestral locus Anc_4.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323785.1"
                     /db_xref="GeneID:40386168"
                     /translation="MPTLSVATLAALQSFKQEEQERIEKFQKLHKSAEEAFESRNNLT
                     IDDFKEDWQLSQFWYADSTADTLLDALLEGATEDTVVCIMSAPSVYAIINKRDRSTLP
                     TKHIYLCEYDKRFELLSGKDHFGFYDYNEPENIRDDLKGNVDRLLIDPPFLEEECQFK
                     SSQTAKLLLKSAASKLITCTGERMKDIVLKNYEKEGVQVTNFFPEHKNGLSNEFRCYS
                     NFDCKLWDRVKD"
     gene            <767022..>769133
                     /locus_tag="C5L36_0E03670"
                     /db_xref="GeneID:40386169"
     mRNA            <767022..>769133
                     /locus_tag="C5L36_0E03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467926.1"
                     /db_xref="GeneID:40386169"
     CDS             767022..769133
                     /locus_tag="C5L36_0E03670"
                     /note="PKUD0E03670; Pfam Domains: PGAM(6.8e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323786.1"
                     /db_xref="GeneID:40386169"
                     /translation="MHIVLIRHGTRIDKDRPGVSPDQSNVSLRPSDRIPDNIADIINQ
                     AQKVKPQREEFNLDVESSSWLSNFDPPLNQRKASEEMDSAFKKISTNILGKHKPDKIM
                     IHSSPYNRCIQTSELLLDKIKKSKTLDSKVPVKLRVDQALSEWLNENYNLKYLPPNDD
                     GYSMINNVNAYLNQEINENDCEGEFSSQTRHQLRDARDFMWSYNQLGHCGEYGESASS
                     FTRRCFYYLIYLLQFYYTRQDAKADRNMVVFIVSHGAVISTLLQILLGRSVFNEIPLC
                     TPIYFKQSEKRRSVFKLMDYDFNLYQLLSPSSDQEFYKILDTPIELTKLDPENLRSEL
                     TIGTTGYTTIIQSIPKKPESTQKLDVLSTRRRRNTINIGDKEHHEDSNQSLKQTLSSR
                     QLYRLNKDTNEEKVIDLDKLHSYFGGDSESDSDEEVDGLQKIVNVNDFDDHGKSLKNN
                     IYKGSITSLSSFNEENKSKFQLNDKNFYSKQSPIESDPYSHFFLERSSTMEHNGEFDS
                     INMTMSMSRKSSQGQNANVKFDGLTGSDSDRSIDTEEYESDSGDEPILSFGTKDKIQN
                     MVNIRVSDESNKENTAKPYITGTFGNVPLKGGKDRTNSVSNTTNAISSTNMGSVMGCS
                     NSHSGTKLAIPKLISTRNMNLLVRGGDSEESMTRTANNSNSILKNLLFDQKASPFGED
                     ANSADDDDDDEDSGWFGGFSR"
     gene            <769668..>772850
                     /locus_tag="C5L36_0E03680"
                     /db_xref="GeneID:40386170"
     mRNA            <769668..>772850
                     /locus_tag="C5L36_0E03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467927.1"
                     /db_xref="GeneID:40386170"
     CDS             769668..772850
                     /locus_tag="C5L36_0E03680"
                     /inference="similar to AA sequence:RefSeq:NP_011754.3"
                     /note="PKUD0E03680; similar to Saccharomyces cerevisiae
                     YGR238C (KEL2) and YHR158C (KEL1); ancestral locus
                     Anc_5.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323787.1"
                     /db_xref="GeneID:40386170"
                     /translation="MSFFRKITPHKHSPKGNISNGSPPMSQLPPPPADQIKDEQHSFR
                     KLSGNSIKPSVNALKEGFKRVNEDVKQLTNQKNENTEVGSNKRPPLNTSDSKQQETVF
                     NAAINKPSNVSIHSEKGEVIVETKTPWKKKKLYNSPFPRFGHAVSSYTAPNGSIYLMG
                     GLSGNAVFGDMWILEPIRDNHDSNSKDSENSPYIASPIENPQKVPSPRTGHASILIGN
                     AFIIFGGDTAINNEPSLDNKLYFFNITSLKWTINDPMGEKPCGRYGTQISVLNVESAN
                     HQWCSQLYVFGGELNEVFFNDLWRYDLSRFRDPKNRWIRLEPHGDIPPPLANHTVTAY
                     DGKLFVFGGKNMNAVSDKLYCYDPYTNRWSLCRLKGINLPPALHSHSATVYGSLLFIF
                     GGKQINDRNSGDLYVIDLTNMNSWKLFSDLLYSPGARYGHSISANVKDAKLVIMGGDV
                     YDNDFDGIEDTSINLIDESKFALTSSVVFECDIHLVQRFIEKQVLNDTRQEVKNIESP
                     TAKFPTEYKQEVLKQSRNNSFIDLVESPAANGIPSSTPINSDEEIDENNSTNNKTIEN
                     SVTTPLNVSSEKNGDDITLETIDRVTIPVAQGRTINPAHMQSDAFADDVSPSSSSKEK
                     NQAKKSNVSLGSNQIRDSHDSLPKTLKTPDQQIDSSPSFSTPSIQQHAALPFSPAVVE
                     KDNLKIQKLVKMVNDIKSEMKRSVNNANSQIVKLESEKAQLLEQLKKREMGDSLSKPA
                     ISENADVSNNLLNGDTTLQKSLEYEKFINDELSTIPLMSRLIEDQKNKISNLESRLHD
                     DEDLKEKVLKLEAENLSLRSKIENLMAINGASEVSKVPPIESLTAKINELSIKWSKVG
                     PHVESKVSEDLHKYKAMSESLTKQLEESLEKQKELEHLYNQSKNSIQLSHKAMLLAQS
                     ESSNLKNELKNVKNELEDLKMKRRVFSASSGRLPSSASRIPSSSSVVGHLSGPKNQDV
                     SNMQDKLDGSIDNSKSVDPESQSLNCEESGYEGGDVDLSHERYQFKIRDLEANLFIVS
                     QERDQIKKELISLKKELYNTSHDTSMYSSV"
     gene            complement(<772909..>774456)
                     /locus_tag="C5L36_0E03690"
                     /db_xref="GeneID:40386171"
     mRNA            complement(<772909..>774456)
                     /locus_tag="C5L36_0E03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467928.1"
                     /db_xref="GeneID:40386171"
     CDS             complement(772909..774456)
                     /locus_tag="C5L36_0E03690"
                     /inference="similar to AA sequence:RefSeq:NP_012029.1"
                     /note="PKUD0E03690; similar to Saccharomyces cerevisiae
                     YHR159W (TDA11); ancestral locus Anc_5.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323788.1"
                     /db_xref="GeneID:40386171"
                     /translation="MGNRLQDESNVPKLIAGNDLPITRENSPKSKNIGTVSKEPQLSF
                     KTPDSRHTRNRNGSLVRSSTISSGSKSPVRGHLRSFSGASCNSTLSRSNSVRKGINLG
                     LNVIGTSSLNDTTRDKEHTPRRQLFTTPLKQEGFTSISLSQYKSDSEPGARSSIETNN
                     SDVSSIINSPTPSIPKSQAEENKIEDPLSDKFRLLASKEMELLEIKNQLNDLLKRKRE
                     SENDLKRLKLSIEKQLLRNLKQQNNEQSRHRIDQNIPKSPTSIHKCVMKPSSSTNDPL
                     INYSGVDSSVQTNTNDTTLNNKYDKRQSWFSKPLSLFQQFDNLITKEFEKLQIPDEEN
                     EDLKLIDMSYNVNDKAADRDAQYSAPIRSLVSDTASSSADVMQSVSQHIWSFVNDVKS
                     NLLIEEEPEHELPITSSPIKDESPGNDNPKVRIRTASISKRRSYSQHIQHKKRPSMNI
                     VNDHIEVDKNAAKEVIRSISRNGNSEPEINDDKNTKELTTPEIEKNSLGDSIDESELW
                     DNELLDI"
     gene            <774825..>775841
                     /locus_tag="C5L36_0E03700"
                     /db_xref="GeneID:40386172"
     mRNA            <774825..>775841
                     /locus_tag="C5L36_0E03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467929.1"
                     /db_xref="GeneID:40386172"
     CDS             774825..775841
                     /locus_tag="C5L36_0E03700"
                     /inference="similar to AA sequence:RefSeq:NP_011899.1"
                     /note="PKUD0E03700; similar to Saccharomyces cerevisiae
                     YHR034C (PIH1); ancestral locus Anc_5.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323789.1"
                     /db_xref="GeneID:40386172"
                     /translation="MTFLKDTRAVQLEEIELVPHFVIKTKIFTPYKGFLSGTKLFINV
                     CTNCKIPTKPVKDSKGKVIEDFDPKSVFVSISNGEWEIPILTTPETRETVDKKGNKSI
                     LIDCVINDKYMMWCMLNEDLKDILVQWCIDAVEFQIGGEFMVDRDSISLPKRTYMGEH
                     PDKIQIDLKHLEESTQELEKLSRDMYEGKDDPINFVNAQRLDELEQDDRNDLPPLIPQ
                     ESKKSGLIIEVDESDRAEKKKAKIEPAKETPNKSIRFEVEVSKLEANKTKLNHKYELR
                     ITSQLQSASDYELSLNVKEKELLIYNPESRSKLNFPLPLDITCEDITSFYVKPEKKLY
                     VYIK"
     gene            complement(<775942..>778932)
                     /locus_tag="C5L36_0E03710"
                     /db_xref="GeneID:40386173"
     mRNA            complement(<775942..>778932)
                     /locus_tag="C5L36_0E03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467930.1"
                     /db_xref="GeneID:40386173"
     CDS             complement(775942..778932)
                     /locus_tag="C5L36_0E03710"
                     /note="PKUD0E03710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323790.1"
                     /db_xref="GeneID:40386173"
                     /translation="MLHTLFSKTQLEYCNYHLHRAAPSTGKSYPLSISFSHMQVQESI
                     PQYQLLHGEKKILETANGIVVVTPTNLVYYSYNSSNGTLHYQSQRQLVTRTVKYLNHW
                     DALFVESVSKDRSSTNIISYQTMANTPNIKLLPDTHHWHRSICGYTFNRISYTKLHET
                     SPSSSLQPVSSMAIVYSTPIENVSLQYSSSTHSISIDSSSIAVFTFEPIQIFTECLSD
                     QGKINRESIAPKTTSFLSSSTSPLFHFQLLEFKASHLIVSIFDTLHYSDLIEDRIYPP
                     FQLQGNITCASRMENSNFLIAVTDVGGVFQLNIKTKSITPLLNTPLPIIADQVNITTK
                     HIILHGQHTGLLTIDRVSHQTGYIHNTLHRFDQSNLFTGISYAYSTDSNDLVISFTDG
                     HNSILAKETNNIDVLRLHPHGGHSLLGFVDNHRFLTRSNNRYYLNGEVQTDLHDDVCA
                     VAPNIRIYRDSIEYLEDEEEIQVINKGTVGALSISKDASIIYTDARLLVIIHPYPKGG
                     YSFCEIPFTPLNIKRLSNSECHRDAKIDGIDAEELLQSYALFNETKLLIGSLSIPWSP
                     EDPIKDVERVPNSLNRLYVLTYSGSLWEFNSVTYECVLILQSLKIKFLTSLGKATIVA
                     IGNTLSIVNYKNSNKLEEIYKFDGDVLSYMKTSSSETYISVTSGLYRITESATPRFHE
                     FPISGIVKERIQYSDSLSLIYSQSQLALYNDKSAEIFSIFSVPDIYQVRLDLELNPLT
                     PTIIISTFTLNQTSFLIQLEYRNHSFQLVNYKPIDTYFPIHIEPYYGKYYSGLHVSSY
                     RAATTKRKTDFSITQEIKTDMTYDLQNKRLLYISRGNRLAELSQNSRSFKRGVRRIFT
                     NQDGFIYLVDEDNAISIYEDKPHVISGIEEASSVGEYVWINDHSGQISEKPTRFKPGV
                     LGFMVAGLKLGVTWVPDEEEKVILKRRKEKREDIRGLGSPNSSETESSSDMNSDSDSD
                     TSSLDSGSASSDDETEQGSQDDAN"
     gene            complement(<779100..>779780)
                     /locus_tag="C5L36_0E03720"
                     /db_xref="GeneID:40386174"
     mRNA            complement(<779100..>779780)
                     /locus_tag="C5L36_0E03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467931.1"
                     /db_xref="GeneID:40386174"
     CDS             complement(779100..779780)
                     /locus_tag="C5L36_0E03720"
                     /inference="similar to AA sequence:RefSeq:NP_012051.3"
                     /note="PKUD0E03720; similar to Saccharomyces cerevisiae
                     YHR181W (SVP26); ancestral locus Anc_5.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323791.1"
                     /db_xref="GeneID:40386174"
                     /translation="MFIQILAIAGAILGFIVATLSIAAGLYYISEIIEENLSFTKRFL
                     NRSILTVSSIMLLLVVFDNFPIKLTLFSLASNLIYYQNLKHFPNIHLSNITFIASAVL
                     AFLNHYLWFNHFNNPYIPSIDERLAPDFVPPHYPSFTEIASFFAICIWLVPFALFISI
                     SSNENALPLAAAQTSDHGNNKAAKSANLVRSIINKALLNLSSLSSALGFNFKFSRSNS
                     TNPNELYI"
     gene            <781628..>782917
                     /locus_tag="C5L36_0E03740"
                     /db_xref="GeneID:40386175"
     mRNA            <781628..>782917
                     /locus_tag="C5L36_0E03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467932.1"
                     /db_xref="GeneID:40386175"
     CDS             781628..782917
                     /locus_tag="C5L36_0E03740"
                     /inference="similar to AA sequence:RefSeq:NP_010435.1"
                     /note="PKUD0E03740; similar to Saccharomyces cerevisiae
                     YDR151C (CTH1) and YLR136C (TIS11); ancestral locus
                     Anc_8.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323792.1"
                     /db_xref="GeneID:40386175"
                     /translation="MLHHPSSESICPLTVRAASSLKSLSSNDHRLTNINNSINNTLNS
                     SASETSLASNTPSFNINIVSDASDCSISSPHSNRSSIVDYSGPINLSNVSNQISTDNT
                     WMTYMNQNATQLNNSGTNTNSNTTIGINTNGATAAATTVPSITTDAGPWNDSTSTNMS
                     QESLSNFTFTNWNFNSLQTSSNLKKSLEFSMDDPFLPSNLKQSSPLLNDGFNRNINNS
                     SFINESVRNNQFLNKQQQQLQQQKPPTSVSPLSASAAKKSLNWNNMNSILNDLTNQPM
                     SHRHSGSFSQNSTCSSIGDELVNQPYYQAQLTNLKMKNAPVEESSNKIPQNQHYNSCI
                     NSGKANINRQLFKTELCETFQKTGKCPYNEKCQFAHGLHELKLVSKPKKWKTKMCKNW
                     IESGFCRYGKRCCYKHGENDDGSNGLNCIPSHQNVLY"
     gene            <783589..>784842
                     /locus_tag="C5L36_0E03750"
                     /db_xref="GeneID:40386176"
     mRNA            <783589..>784842
                     /locus_tag="C5L36_0E03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467933.1"
                     /db_xref="GeneID:40386176"
     CDS             783589..784842
                     /locus_tag="C5L36_0E03750"
                     /inference="similar to AA sequence:RefSeq:NP_011942.1"
                     /note="PKUD0E03750; similar to Saccharomyces cerevisiae
                     YHR075C (PPE1); ancestral locus Anc_5.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323793.1"
                     /db_xref="GeneID:40386176"
                     /translation="MQRSIFQNRLRRAEQELGFNFSEEVESENQDEEEPKDITGKVAG
                     VVHSKDVRDSTKETSQYPKWSTVFDENDIFCNNEGYSFQTYFKKPILQDGDTPIVFIG
                     HHGAGSSGLTFGELCKSVVSNTRNGYISKPGFFTFDFRGHSMTNLLNADDEGNYRMDI
                     DTLVGDFKFIIDHFLAKFKDRYSSKIHLFIIGHSLGGSVAIKLLRDHQFDDVKGLVIV
                     DIVEETAIHSLDAMDSYLNKLPKSFQTLEMAINWYVNQGLINNSQSAKLSIPSLLKHN
                     QNGSWEFIVDLRKSKPYWNDWFKGISNDFVTLPNRISKLLVLANNDYLDKPLIIGQMQ
                     GKYQLMVFYSDTNLSNFLTTSTTVISDSMKIGHFIHEDVPNKFTKALLQFVERNDLSF
                     RRNDESNSQLQLINKLNAKWNAHKK"
     gene            complement(<784859..>786985)
                     /locus_tag="C5L36_0E03760"
                     /db_xref="GeneID:40386177"
     mRNA            complement(<784859..>786985)
                     /locus_tag="C5L36_0E03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467934.1"
                     /db_xref="GeneID:40386177"
     CDS             complement(784859..786985)
                     /locus_tag="C5L36_0E03760"
                     /inference="similar to AA sequence:RefSeq:NP_011941.1"
                     /note="PKUD0E03760; similar to Saccharomyces cerevisiae
                     YHR074W (QNS1); ancestral locus Anc_5.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323794.1"
                     /db_xref="GeneID:40386177"
                     /translation="MSHYITLATCSLNQWAMDFEGNRDRILESIKIAKSKGAKLRVGP
                     ELEVPGYGCLDHFLENDTYIQSWEMYSTILADKETYGLLLDIGIPIIHKNRRYNCRIL
                     SYDGQILLIRPKILLANDGNYREMRYFTPWLKTQYVEEFRLPKLIRDITGQNFVKFGD
                     AVISTLDTVIGCETCEEMFTPQAPHIQLSLDGVEIITNSSGSHHELRKLNTRLSLIME
                     ATRKCGGIYLYSNQNGCDGDRLYYDGCSMIVCNGEILAQGKQFSLDDVEVLTATIDLE
                     DVRAYRALASHGIQSRMSPVYDIVHVEAELSPDSVNFDVTIEPTLPREVFYHLPEEEI
                     ALGPACWLWDYLRRCKGSGFFLPLSGGIDSCATAVIVHSMCRLVIENIKAGNKQVMKD
                     VQMITKNDNFPNTPQELANQIFHTCYMGTSNSSNETKSRSKELSSKIGSYHVDLNMDN
                     VVSSVVALFEVVTGRRPIYKIFGGSNIENLALQNIQARLRMVLAYLFAQLLPWVRGKE
                     NTGGLLVLGSANVDEQLRGYLTKYDCSSADINPIGGISKNDLIKFIRWSVDYFQLPIL
                     KEFVDATPTAELEPITKDHIQSDEADMGFTYDELSIMGRLRKVEKCGPYSMFIKLLHI
                     WKDKKTPDEIASKVNSFFWYYSVNRHKQTVSTPSYHAEQYSPDDNRFDLRPFCIDPSF
                     SWGRHKIQSVLKKMENNEKINTMTVD"
     gene            complement(<787317..>789989)
                     /locus_tag="C5L36_0E03770"
                     /db_xref="GeneID:40386178"
     mRNA            complement(<787317..>789989)
                     /locus_tag="C5L36_0E03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467935.1"
                     /db_xref="GeneID:40386178"
     CDS             complement(787317..789989)
                     /locus_tag="C5L36_0E03770"
                     /inference="similar to AA sequence:RefSeq:NP_009468.1"
                     /note="PKUD0E03770; similar to Saccharomyces cerevisiae
                     YBL085W (BOI1) and YER114C (BOI2); ancestral locus
                     Anc_7.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323795.1"
                     /db_xref="GeneID:40386178"
                     /translation="MSNRENSIGSHTHTQLYTVIKSFEARLPDELTIQEGDIVEIISD
                     DSEFDDGWYMGKNLSTGQVGLYPKIFTKIKKSSNDLVKKPSLLRSRSRRTPQSSPITA
                     NSSSYFEDSHEAPAVTHPSNNNDANVNRYVSDIDNALKELSVDKKNASSTSIVNSNDD
                     SLNRENVENWSPYQVAEYFSNIVGAETANKFIVHKISGHILLELELAYLKELDINSFG
                     TRFEIYKEIEELRKFQNPTLGNSSFNQNEFFNSTIRSNDNIHALASNQLNKRQSSIGS
                     SRFSYKQTPRPQSYVELGNPNRLNSIKTSPSPLQFDNSNTDLSSDALQMTPEPIVSNE
                     QFASPRRAPAPPSYPSPVSNNPTKFGIKSPEKLPVMTSNTIPKLTGPSHSRNTSTGAV
                     SSIYIDTSPTVNSRRNSITASRDESLYIDNNAKYINKTNKGHRRYSSVVINKEVDGED
                     NRSSNTYNEPNTPIDTVTAFERQKNTNGSPLKQANMSPNRRSVSAKEFAQIMKNKDVT
                     NKRVVSDIAAQSTSTKTALNAPPPPTVSKSGSFRQRVGNRLNSKAQTSAFQEGIRAIK
                     PDEALKDADYSGWMFKKGNLSIGSWKHRFFTLHKTRLSYYVTTSDSKEKGLIDITSHR
                     VLPATEAEDKLSAVYAASAGYGRYCFKLVPPAPGSRSGLTFTQQKVHYFAVETREEMR
                     GWMSALMKATIELDETVPAISSCVTPTIPLQKAQELMAAARENARENYENIQRIKEGR
                     MNTTLLESDNKEQQTSYLVNDSSYDSGSPVDENETTFNTSSRRTNSSMTPTSPDSNPL
                     RKYGKQSGSKSSSPLNGMSTPYLMTSGMISPNAVNESSTNIDSPARYASTKGYFPTVT
                     KLDDDTPLDPPSKTLHSSNSFSKRLRSLRKSGKD"
     gene            complement(<790509..>791960)
                     /locus_tag="C5L36_0E03780"
                     /db_xref="GeneID:40386179"
     mRNA            complement(<790509..>791960)
                     /locus_tag="C5L36_0E03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467936.1"
                     /db_xref="GeneID:40386179"
     CDS             complement(790509..791960)
                     /locus_tag="C5L36_0E03780"
                     /note="PKUD0E03780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323796.1"
                     /db_xref="GeneID:40386179"
                     /translation="MQNSPQDSYIHASSNETSPLSNEDIIAQKILKRAEIAKMTRQLK
                     EKLLRVGLKVRDQNSISGNDDNNAHPHQLNSSTSSTPMSSPSKSLSEDVANDITATAI
                     SNIQNSKLLTPTKSRLSLDGNNISLSSLTPATISPLKRKRSMMYRTNSHYEQHDDTLV
                     SPLKRSNTTGMLNSSPFDMTSSPYQFTRGSLLVTPQSLPHSSTNNATQPPKTPPLKQF
                     DIFQTVQRSSEIKLVTKSNTLKPSNEFQNENSRRMSPKKKLLPPLQQDPDLNRTIQAD
                     QPWDENTPSLQMNPDKEQSTNSLLSTPRASTSKNNQDDGADLLLFLSNSPARTFNNKE
                     QRDINKMLAIPTTPKANNSNHNIISIGGSGLESTPLRNGFLSPTQNSMMQPLLGTPIG
                     INLLSNNNNNNQHGRFQAPATPNNRLSSNSHKNVNRTPGFSMSDYINFTPSPRVARTP
                     DYYQHSYNIYTKNLMNVSKDLNNITNIKEDEEL"
     gene            <792813..>794012
                     /locus_tag="C5L36_0E03790"
                     /db_xref="GeneID:40386180"
     mRNA            <792813..>794012
                     /locus_tag="C5L36_0E03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467937.1"
                     /db_xref="GeneID:40386180"
     CDS             792813..794012
                     /locus_tag="C5L36_0E03790"
                     /inference="similar to AA sequence:RefSeq:NP_012049.1"
                     /note="PKUD0E03790; similar to Saccharomyces cerevisiae
                     YHR179W (OYE2); ancestral locus Anc_5.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323797.1"
                     /db_xref="GeneID:40386180"
                     /translation="MASELADSNLFKPIKLGSIELKNRLVYAPTTRFRNSTDFVATDS
                     MLEYYTRRAKNNGGLLITEATFAAPEFGLYERGPMIKTPEQVKAWKKIVDSVHEQGSY
                     IAIQVWNLGRTADPACLKKHGLPFVSASDFYFDEASKKAAIECGNELRALTIPEIKAM
                     VDEYVACAKRCVDEAGFDIVEIHGAHMYLLDQFLQESSNQRTDEYGGSIENRARFMLE
                     VVDAVVAAIGADKVAIRLSPYAEFQGALGYKSRINPIVTWGYVLSELERRAKEGNRLA
                     YVSVVEPRVSGIFDNPDAAKIDFTWPDLIWKGPIIRAGGYLDPENLSKLANAVNKDDH
                     TLIATARYYTSNPDLVNRLKNGYPLTPYNRADFYRIGSNIGYLNYTAYGEEEDHTKDD
                     VEPKALF"
     gene            complement(<796497..>797204)
                     /locus_tag="C5L36_0E03800"
                     /db_xref="GeneID:40386181"
     mRNA            complement(<796497..>797204)
                     /locus_tag="C5L36_0E03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467938.1"
                     /db_xref="GeneID:40386181"
     CDS             complement(796497..797204)
                     /locus_tag="C5L36_0E03800"
                     /inference="similar to AA sequence:RefSeq:NP_013845.1"
                     /note="PKUD0E03800; similar to Saccharomyces cerevisiae
                     YMR126C (DLT1); ancestral locus Anc_2.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323798.1"
                     /db_xref="GeneID:40386181"
                     /translation="MISYLKSPGKFISLEWLYSASFAILMFFILSMTSTMPVDVIVQS
                     KTTNTHLATNTVIILVICVVFIAFATVLHLFRLLFNKLLLQEIPKPYIPITEKDIGKH
                     ASRMIEKEMDRCMQIKEMAMPKGNIEHPGLYHPSEYDNSDNVYELPNDLIYENVIQII
                     GQEIKYNGTLTLSNSKILRLDNHYSLREHLQFYQSDPKIKRFLDSYEELRFSGKPIYL
                     KDFEEFLQNWSYVKKTI"
     gene            <799022..>800749
                     /locus_tag="C5L36_0E03810"
                     /db_xref="GeneID:40386182"
     mRNA            <799022..>800749
                     /locus_tag="C5L36_0E03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467939.1"
                     /db_xref="GeneID:40386182"
     CDS             799022..800749
                     /locus_tag="C5L36_0E03810"
                     /inference="similar to AA sequence:RefSeq:NP_011707.1"
                     /note="PKUD0E03810; similar to Saccharomyces cerevisiae
                     YGR191W (HIP1); ancestral locus Anc_5.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323799.1"
                     /db_xref="GeneID:40386182"
                     /translation="MFDRFRSEKKQPTLSVEAVPDNSSNSIDISKQVSYIPYDITSHA
                     DVEKLGYDPEDSGLGELKRGLSSRHVQFISLAGAIGTGLFVGSGAALSTSGPAGLLVG
                     YLVLCFFVWSIMNQLAEMVTWLPIPGKSTPYALVERYTGNKSFSFAAGLNLWYAQALL
                     TPAEISAAAFVIQYWTDLNVAIWISIFWVTIVALNFCAVKVFGETEFWIASIKILTIV
                     GLIIVGIVIFFGGAPKSHGVLGFHYWKHPGAFVEHLAGGNTGKFLACWTSIIKSAFAF
                     ILSPELITICAAEAEAPRINLPKAADRFIYRLFFFYICSVLVIGCIVGSNDPRLMNAI
                     NEGAEGAAASPFVIGIQIAGIKVLNHIINAAILSSAYSAGNSFLYASSRNLYSMSVRG
                     DIHKVFARVNRFGVPYVSVGASAAIALLAYLNVSDSSSVAFTWFSNISTVSGFIEWVF
                     VSITYLRYRKAMDYHNMNDRVTYRPPIQKFGAYACIFFFSLVALTNGYAVFFHFNGSD
                     FVAAYITLPIVLFVYLAHATWTKNWKGFAPPEEIDVVTGLEEIEKETREYVPPVPRNF
                     LERIWFWIA"
     gene            <801159..>809294
                     /locus_tag="C5L36_0E03820"
                     /db_xref="GeneID:40386183"
     mRNA            <801159..>809294
                     /locus_tag="C5L36_0E03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467940.1"
                     /db_xref="GeneID:40386183"
     CDS             801159..809294
                     /locus_tag="C5L36_0E03820"
                     /inference="similar to AA sequence:RefSeq:NP_011320.3"
                     /note="PKUD0E03820; similar to Saccharomyces cerevisiae
                     YGL195W (GCN1); ancestral locus Anc_8.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323800.1"
                     /db_xref="GeneID:40386183"
                     /translation="MSDSPADKWVDDVLPLLEQLRQSSVNTMNVSIFKLNAVLADDHE
                     KLDSNQKDQVLFAILSTYARYPFDSTFDKNVLKSFQNFIAIDGEKFSKHILGFIAKQS
                     TKPIATRELLILSRWNSAVINYVDDNDLFLSLLKVCIASSINLLSLVTDYSQVESLDN
                     HHLKAIKSIKTDIASSLRSIAKKNPEYIFDVINHICVDKLPVSGIISILGLLAFAIKS
                     NSEAIETLKSFETKIYEFFVKVCLTTKIYPNKVALHFFGTFINMFLSAKSFEEILIPG
                     LEKSALRNSELTFSIYSPSIFESLNYSSMDVALILSKTKFFGQLFSSLKATKESVKIG
                     ASTTLNIIVKNTSSASGDSLVLYADELFKVLKGISASAVEQKCYILDVLSSFEYSNKN
                     SSKKIIEMIIPFITKENNEVVLNQLLNILLPRFIFFISSATEFDQRDKIIELLNAGLK
                     NSKAPIKTAWNTAFASAMLSSCATGESIEQFALLFNSGITDTLLTVFDEVMKAPLPSV
                     NNKLIAAGYSSIATLFHLVEAFDNQTLAEKLNHFDVVGKALTETETKMSCFTNTKVVS
                     KLNTEESQEWFVRALLALSRHLTEPSTLYGSAALYASISRNMTPKVRNLSRSLLHEHY
                     EQNQKVIGSSLTLAVNSLIKEVEGNPDLNYEYNYLLPMISATFHSFGSCDVTLLESQL
                     VDLLIPFKHKMLSGIPNGWVSLCLKCHADPGKIVSEYANKIIDSISSILGDPSETIFE
                     NGIFQAACDTTSIISFFSPGTIVPILSRIIEDDLSTVKSLDIDETKYQIWKGKDGELV
                     VDVLAKKTSVNISKSKDAETLKWEQSVRKELEAKKKVAKKLTKEEQIKVNEQLLLEKS
                     IRDTINSQYMSLRRGLAVITCLSRQARTVDNGTAIWFPVAISNILTLLNSKPAVKLTG
                     ELSSECFLSLSDVVATESLSGTSSMKFVGSSTLRLHDVDHIPAEYTGRDLQELLSSQL
                     FSLKLSSDKSLFNSLTLMYVLPLLVKIIENGKNYIIRSGKKITKVNTEFSEEAPEEEQ
                     LTMALEIISSNSELFEDHSIPRTSIITHLIELLALSSKAKAAKECFVSLCQNIAATIS
                     DSDLTIILKSLINPNVFVRATILEVLDQEFDLSDLKMSEELWILCFDNVTNNKEVAET
                     IWAESGFQIDEGAPTRLIEYIGNPDNGMRLSISKAIAAAVIKYDSVDLFHAILDKLLK
                     LFREMAQPPAPEVDQFGLVINNAANAKDRWEQRCGIALALNYMAPLFKNESEVSKVFK
                     FLIEERALGDKEIMVRSELQEAGSKIIEQHGKENVETLISIFEACLAEKDEKSKIQDL
                     VKESVIILYGGLARHLDDTDKRIDSIVERLLESLDTPSEDVQYAVSECISPLVPFIQS
                     KLSSIIDNLFEKLFVGKSLAVRRGAAYGIAGLAKGVGIKALSEYDIIRNLTEASDDKK
                     DSQKRESVLFAFECISQSFGPLFEPYVIEILPIVLRSFGDSSAEVREATDYAARIIMK
                     NTTSYGIKKMIPLAIENLDDFAWRTKKGSVELLGSMAYLDPAQLSSSLPEIVPEIVGV
                     LNDSHKEVRKAADAALKKFGEVIRNPEIQELVPILLKAIGDPTKYTNDALDSLINTQF
                     VHYIDGPSLALIIRVINRGMQASSANTKKKACQIVGNMAILVDSHDLMPYLSQLVNEL
                     IEAVVDPVPQTRATAARALGSLVEKLGEEKFPGLISNLLADLQDESKRGDRLGAAQAL
                     AEIISGLGIAKLEEMLPIIIQGTTSSKSFVREGFMPLLLFLPVCFGSQFAPYLSQTIP
                     PILAGLADNNEDIRDVSLRTGRLIVNNYAKKAVDLLLPELEKGLSDYNARIRLSSVEL
                     TGELLFKISGISGKQELADDVSLSKNVTKAFNEVLGDDRRNTVLSNLFVCRSDTSGAV
                     RATAANIWKALVANTPRTIKEILPTLLNIIVRRLASPDDIQRNIVAATLGDMIRRVGG
                     NALSQILPTLKEAMVSSDSDAKQGICIALYEIITSTAENAIIEHQDIFVGIVKEALVD
                     PNPSVREAAAQAFDSLQESIGNSAVDEVIPQLLEMLNTSDGSEDALSALQEIMSTKSD
                     VIFPILIPSLLTPPINGRAIGALAEAAGSALYKRLSTIINALVDGIANKLGDEEELYS
                     ALTRTLISVDSDEGCHPLLQQILALMKHEDVNKKKIIYNVLPEFFKESTLDYSIYIED
                     VVSHCIYLLNDPDDEIVSRAFETLSVLVKKQPKQVLERLVIPAQQTLSFIQNDSKQIK
                     AFALPRGPGCVLPIFLQGLMYGNPVQRETSANGMSIIIDNAPAVNLKPFVTTIVGPLI
                     RVIGERFSSDIKSAILLAINKLFNKIPQFLLPFIPQLQRTFIKSLSDPSSEILRTRAA
                     RALGTLIKYQPKVDPLVTELLNNAKGIDSSDVPLKTAILKALLEVVDKAGNKMSEASK
                     NGVMVLVEEEMFNDEAGVGAAVAYAKLVGALSKILEPSELTNMVKNKILSANLNDENS
                     SRFAILTLNAFLKDSAVQVLNSGLFNEICEFMIAASNSSKPYVTDNATIAIGKFVLSL
                     DKVQETDGEIVRKLINQLAVSMIRPTSNSLDTRRLSLVVVRTICRYQYEVAVSPNLDI
                     LIPSVFSCVRDPILPVKLAAEKAILAVLNSVDDESNIQYNSWIDSLNGANTVTNAVGT
                     TIQLRSITEYVKRVVVRLANVERERITAGGDKEAMFSDQFEDESEIWAIGGVELSEE"
     gene            complement(<809455..>812781)
                     /locus_tag="C5L36_0E03830"
                     /db_xref="GeneID:40386184"
     mRNA            complement(<809455..>812781)
                     /locus_tag="C5L36_0E03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467941.1"
                     /db_xref="GeneID:40386184"
     CDS             complement(809455..812781)
                     /locus_tag="C5L36_0E03830"
                     /note="PKUD0E03830; Pfam Domains:
                     Ank(3.1e-13)|KilA-N(2.7e-12)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323801.1"
                     /db_xref="GeneID:40386184"
                     /translation="MEFTPQGNHREGNTENRRDMVEVYTATYSHIDVYESTIDGIQLM
                     RRCDDNWVNATQILKIAGFGKTQRTRLLEREVHNLVHRKVQGGHGKFQGTWIPLDLAI
                     QLATRHEIPSEKLNVLFYNPETDPPLPKKPPSSSTRSANNTPSGNEKKRLLKIDPKTP
                     TNDRKLSSPQKHKKSLLNTSESQMTSLDMPPTFGMFDGSKRHQSQPQPRQLHAKSKSA
                     SNLPLQNSQLITPKSNNRLMVSSNPNSAMNSSYYEPSVQYHQIQAQRELQMLQQQQHG
                     KQQMNPSQNFEVRQPAAHPLIPKSASHSNHQPFYENPNHTISSMTDDQFQGFQSMTES
                     SISSNSFALQDPHKSSHNLHLRYQEYSQSPRYDGLNPNVQNIFQTPRQTFKHQRHHSS
                     PQIVQPGINQLSVSQPSLSAPPNVQLQQQNQILHPHHVNDDPFTDEFDENQEYYTSSL
                     LAFFINDAPVPDFLYNPPADFDIDRSIDDEGHTPLHWAAALAAVDVIQLLVQNNANTL
                     RLNNAGMNPLSKLVHFNNSYDWKNFHVILPWLKNCLAVPDSNQRTPLHYVVSLSGVPN
                     KENACHYYFDEIIKFMYQQQRKAEKFNNENQNSRNLVQLLVNHPDTNGDTALDLALKI
                     NSKDFVTKLLQQGANKSKVPLHDISQDILRESNSYFNTISNSHYNSALQEQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQRHQQHQQQQQQQQQQQQQQHQQQQQHQQHQQYQQ
                     QQQQQQQQQQQQQPHQQLHHQLQQRQIDEQLMMNSVTKPVHFNGEPETIEKNESMWNV
                     SNVEFTQSTSIMLQDTDDKENTFTQIPSNEIEHSHLNEQVNTSTPQKPDNKNILPKIS
                     PKVVVKKEADDGSLLVIEPSRISMPEINNFVKSLPSMVLELKNTLDNKIDHVNYNVET
                     INKLDSQINSLSHKNAKLLKKISKAVNHDSSVDFTKLSSSDNDAIENFVNSKLVQLEF
                     SLNEKSEKLTNYAERLQALVVANLVKHEEEIIKENFSRGAQSTNELVVSALKLSLLQI
                     KRRKMINLMLQFFLDYENGDVQLNKNIDNSIFVDQKVDTTLITESKIPIFKKLISTLC
                     RLSTSDINTDFLCDIEKMLT"
     gene            <813081..>813863
                     /locus_tag="C5L36_0E03840"
                     /db_xref="GeneID:40386185"
     mRNA            <813081..>813863
                     /locus_tag="C5L36_0E03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467942.1"
                     /db_xref="GeneID:40386185"
     CDS             813081..813863
                     /locus_tag="C5L36_0E03840"
                     /inference="similar to AA sequence:RefSeq:NP_012001.1"
                     /note="PKUD0E03840; similar to Saccharomyces cerevisiae
                     YHR133C (NSG1) and YNL156C (NSG2); ancestral locus
                     Anc_2.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323802.1"
                     /db_xref="GeneID:40386185"
                     /translation="MTSRKEMSGVYKNEFGSTSTTQLTDPPLYSIYGGRNIIDDENED
                     VKDVNQVNGHVPYEPNDDEPCTGTVYSDGGSIVFSFLRPMFFGITVYKLFQTLHYNDP
                     VIFPSLNLPIDYGSNHGFFNEAFMISLNTIVLDRFLGILITFFWGKSNVAIRERSISQ
                     LFVVILGIVYFFRKIAWTSTVHADLIFMLINVIFTRYVGCTLGETVVSLLMFGSSMGV
                     LTLLDNVNGGSQTASNLWRCTFLWFLSVVLLRVRETESGLWV"
     gene            complement(<814147..>814521)
                     /locus_tag="C5L36_0E03850"
                     /db_xref="GeneID:40386186"
     mRNA            complement(<814147..>814521)
                     /locus_tag="C5L36_0E03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467943.1"
                     /db_xref="GeneID:40386186"
     CDS             complement(814147..814521)
                     /locus_tag="C5L36_0E03850"
                     /inference="similar to AA sequence:RefSeq:NP_036194.1"
                     /note="PKUD0E03850; similar to Saccharomyces cerevisiae
                     YHR132W-A (IGO2) and YNL157W (IGO1); ancestral locus
                     Anc_2.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323803.1"
                     /db_xref="GeneID:40386186"
                     /translation="MSSSKPTDPNDPLYTPDTSKVDLSSLSPQELKLYKLYGKLPKTN
                     DILRGKLKERKFFDSGDYAMSKAASHGERANIPDQVGVLNPLHNPEIENVARINRNSV
                     VGSVSIGTNVSKKSKLEEDSTG"
     gene            complement(<814810..>815625)
                     /locus_tag="C5L36_0E03855"
                     /db_xref="GeneID:40386187"
     mRNA            complement(<814810..>815625)
                     /locus_tag="C5L36_0E03855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467944.1"
                     /db_xref="GeneID:40386187"
     CDS             complement(814810..815625)
                     /locus_tag="C5L36_0E03855"
                     /note="PKUD0E03855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323804.1"
                     /db_xref="GeneID:40386187"
                     /translation="MTRKLVEYSDSESDDSDVRSMEDGFPCDHKPRFEGENKETEFIP
                     PIHDILNKFSKVPIRINGAHRRRAEDGSRGSKIETFFFYFPVFLSGEDADTIDGYIEL
                     VREKVEAAGGKVRNLAINDLTRGREPLHISICYNMRATSEEADRITTEMKRDKVLQSV
                     SFPIPLEFQGVTIVDNRITSRQFVIMELSETSKSTLRPFVDCLNHLSSLLTPSSNYDP
                     DRLHVSIAEIHHLDTSTTTLNLPPFTALTSLSLCANPLVSTRGRSIKPLFTHQ"
     gene            <816083..>818230
                     /locus_tag="C5L36_0E03860"
                     /db_xref="GeneID:40386188"
     mRNA            <816083..>818230
                     /locus_tag="C5L36_0E03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467945.1"
                     /db_xref="GeneID:40386188"
     CDS             816083..818230
                     /locus_tag="C5L36_0E03860"
                     /note="PKUD0E03860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323805.1"
                     /db_xref="GeneID:40386188"
                     /translation="MTTFQQAPIGSDLSLDGTRVSLSKVSYGRRYFNEELNYDDDDDD
                     DDDDDDDYDDEEYEIYEAELFSNEKLLSPTNSKAVTSPGTPLNNTTIDRIRKISRRFE
                     PSSPISKLNSISNASSLSRSLNDITNISRTSPSRSSKSGSLKINTSLTSMYNNNNNSR
                     ISIEQKRNKIIENLSKRSSKNLSNPYFYQYNSNSTPRSAPPVTPRNSDSDYTFDESFD
                     FIGDSKVKGNVILDTVLNYNSYTNNNTLETVNEAAESADTGESNELNRIEEAEIIDSY
                     GDCDNDSGNYDTGSHNRSKDYNDNNNNNNNNNNDSNNYDDNTHGTSAELGDGEKSANN
                     SRDSSSSNDHSKLDSSNGDTSGSSDSTSSDANGSKHIKRMQRHSSGLFSEVSTGSAIL
                     AKANRLTSPHESLINASHQRDSTLSDLTIDTNRLDSSKLNSNLSFDGLSKLEATIGSI
                     PEDSMDFEPVIVLKNMKNMDVSNDDTIETRLKDVTINPSNRSSQSIVGKNPSSDKLKR
                     KPPPLPTLRDTTISDGENTRSTGESIYTSNLMEDHFQKDNDFDENIPTPPLNIPHLTQ
                     SNDEKPHQPTLQRISQNFQYISDSNLTSLESVSLGSQQNLIPSAKKTEKNYEVKDPEN
                     YPIPSLHQLESGQNTPSYNHQKKCSDTQCILFLILSLLAPPFYLVIALGYLDSTFGRF
                     DRKYKIISAAMFTICLIGSVVGIAVGLGVGMTR"
     gene            <818461..>819942
                     /locus_tag="C5L36_0E03870"
                     /db_xref="GeneID:40386189"
     mRNA            <818461..>819942
                     /locus_tag="C5L36_0E03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467946.1"
                     /db_xref="GeneID:40386189"
     CDS             818461..819942
                     /locus_tag="C5L36_0E03870"
                     /inference="similar to AA sequence:RefSeq:NP_013860.1"
                     /note="PKUD0E03870; similar to Saccharomyces cerevisiae
                     YMR140W (SIP5); ancestral locus Anc_2.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323806.1"
                     /db_xref="GeneID:40386189"
                     /translation="MGNVPAKESVDSSTGSRSMTTADFAKQFLIARLDTNSNEHTLVK
                     HGKEKESKKWAFRAKQMNNLIVKYDENVDGGYLAPFDNYKYNLDYQTELVRELIKNRK
                     LSPFFTPLQDYDENWTDEELLEYLKNNLTIHKRVDLNTLADDIEDPNEHKLHMSSSTK
                     KKIESKLKTLKLKQQAGATQNYEIERHLRDFKEYQVIPEKFPNIFSDDLLLRIYKDCE
                     ECPICFLYYPKLLNSTRCCDQPICTECFVQMKRLDPHYPHDEGGTPGPANQEEENDPG
                     KLISEPVKCPFCAVGDFGVLYSPPADFRVGLDSSCKPGEYNFNDPGVIEENEGEDSKD
                     NENVVLTEADLADPFSTKRETLERRNKLKHSRKTSNITQHGSSIERARRGSVPKDGVG
                     VITIDLIRPDWEQKLLSARAKIARRSAAATALHATSLLTEEENANGDTGGRRRHSHRS
                     HARNGHTYEEQQLLEERLIQEAMRLSLLDEEERQMRERMRNSL"
     gene            complement(<820129..>821940)
                     /locus_tag="C5L36_0E03880"
                     /db_xref="GeneID:40386190"
     mRNA            complement(<820129..>821940)
                     /locus_tag="C5L36_0E03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467947.1"
                     /db_xref="GeneID:40386190"
     CDS             complement(820129..821940)
                     /locus_tag="C5L36_0E03880"
                     /inference="similar to AA sequence:RefSeq:NP_011523.3"
                     /note="PKUD0E03880; similar to Saccharomyces cerevisiae
                     YGR009C (SEC9); ancestral locus Anc_4.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323807.1"
                     /db_xref="GeneID:40386190"
                     /translation="MGLKKFFRSEKEMSKEEAKEFLQTNGVVVKDDADYYKRKFKFQE
                     FGKLVQDKPIKDNTLRPVNNSRMTAYGDYDDDYNPSGNNYDSSYGSSNQGYGYDAYTS
                     EYSPGTRTQKEYRAPSSTNTGRHDRPQPAYSSSYSSQANGERKPKNSRSQPQNYNSYS
                     QPSRTSGKSSTIYGCSPSEGASQQSIKDIPRNDNKYGYEPSISNYNESNGYGFDPYEE
                     TSVVSKAGDPNALSKVETSNTTVTKSTYDPFAPGEEPYGSYSGYGGYEVQAKQEEPED
                     DDQFDGPYGNSVDPYTAPYAQQQDAATITDAAVNDAATGMQALQLQEEQKQKQEQEQN
                     QGFDPYGPTVSTQTDLDLNDYQPAEQAYDEDEFEEDLDEDEEELNRIQRQTKDVREDT
                     VQLSRQLVDNLVQANDTATNTLGVLGSQREKIYEMQNNIGTMKVQQRFVDDHVKDLEH
                     YNRSLFHIKVSNPFTRNSRRRAKDQAFLAQRQEDRSNKDRLNKDLLNSQKALINGLKV
                     DQTKSELQEKYDYDRRVKEAAKYLTKDHDEEDERMEVEIGTNIDQAQKFANHLKKKAE
                     AMNLEIQQQNRDLNEASENVDHLDDKIVMTTRRIRGI"
     gene            complement(<822214..>823473)
                     /locus_tag="C5L36_0E03890"
                     /db_xref="GeneID:40386191"
     mRNA            complement(<822214..>823473)
                     /locus_tag="C5L36_0E03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467948.1"
                     /db_xref="GeneID:40386191"
     CDS             complement(822214..823473)
                     /locus_tag="C5L36_0E03890"
                     /note="PKUD0E03890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323808.1"
                     /db_xref="GeneID:40386191"
                     /translation="MMSLKEKENREVNVGEMESMLRLDQADEGGKEGLEEEQDEEGDD
                     RILNKLADEDKHDAVDAASMAISIDQQKNETHKVLEGNGVEEGGEGGEEEEEGEERDK
                     DDMGNGLLASLATDIEKYQKKVQLKKHLEDSVGKEIIENLNKERKRKVEPENSEKEIL
                     IDDIEDEEEGEEGGDEENDSDSKRKKRKLDGKKHVKWTKAENDAVVYYKEELKYSWKR
                     IAKMLDNRHTWQSIQMRYLRNYKSRNEEWSKYMETRLIDAIRKDWENRWFRVAKSLGK
                     DFTAERCMSKNIEICKKVDTPYYSSIFEKKDIQVGYENPNNDIRDEEAHKKLMLVYMG
                     LDSISYEDELQDKGAEEATTDDSVSSTTQQSRNTESSQKVTDPTDSTESTVMLSAKQV
                     DGEHSGEPQVSVGLIEGDSGTKHQQDE"
     gene            complement(<823652..>824449)
                     /locus_tag="C5L36_0E03895"
                     /db_xref="GeneID:40386192"
     mRNA            complement(<823652..>824449)
                     /locus_tag="C5L36_0E03895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467949.1"
                     /db_xref="GeneID:40386192"
     CDS             complement(823652..824449)
                     /locus_tag="C5L36_0E03895"
                     /inference="similar to AA sequence:RefSeq:NP_014447.3"
                     /note="PKUD0E03895; similar to Saccharomyces cerevisiae
                     YNR049C (MSO1); ancestral locus Anc_6.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323809.1"
                     /db_xref="GeneID:40386192"
                     /translation="MFKNLRNIASEIKGDHARSTPDDSVSSESKTRRFLSSKSSSSGI
                     HLRKKHKEWEEIDGKTEDETVVHLALVKFFREHGKQQPSYLGHQKSSLQVKSSVSSQM
                     QQQPTRQSLATSHFQAQPSNQHEASRSKSVLSKRSEPSIRRSESRPSLESHTSRFASH
                     RHNNSSPPLRQQQQQPQQQPQAKHFQEEQDIQQKYHQHHAVSAPVARQYHNQEQSSER
                     PQVNHSSSEGSRNETTSPGRFQSRFSSHTSLHNLHTSGSRFGRRKEQ"
     gene            complement(<824664..>826007)
                     /locus_tag="C5L36_0E03900"
                     /db_xref="GeneID:40386193"
     mRNA            complement(<824664..>826007)
                     /locus_tag="C5L36_0E03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467950.1"
                     /db_xref="GeneID:40386193"
     CDS             complement(824664..826007)
                     /locus_tag="C5L36_0E03900"
                     /inference="similar to AA sequence:RefSeq:NP_014448.1"
                     /note="PKUD0E03900; similar to Saccharomyces cerevisiae
                     YNR050C (LYS9); ancestral locus Anc_6.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323810.1"
                     /db_xref="GeneID:40386193"
                     /translation="MVKQVLLLGSGFVAKPTVDILAKQDDIEVTVGCRTLSAAKALAG
                     DVAKAISVDATNQEELNSVVKNYDLVISLIPYIYHANVVKAAIASGKTDVVTTSYINP
                     TLRSLEPEIKNAGIVVMNEIGLDPGIDHLYAVKTIDEVHKAGGKIKSFLSYCGGLPAP
                     EDSDNPLGYKFSWSSRGVLLALRNSAKFFKDGKEVSIASEDLMSSAKPYFIYPGYALV
                     CYPNRDSTTYKELYQIPEAETVIRGTLRFQGFPEFVKVLVDMGFLKEDANEIFSKPIA
                     WKDAVSQYIGAKSNSEADIIAKIDELTKFKDEADRERILAGLKWLGMFSSTEIIPRGN
                     PLDTLCATLEALMQYEEGERDLVILQHKFGIEWADGKTETRTSTLVDYGVPGGYSSMA
                     KLVGVPCAVAVLEVLKHQGAFAKPGLYAPMTPEINDPIMKTLKDDYGIFLTEKTL"
     gene            complement(827516..827589)
                     /locus_tag="C5L36_0Etrna5N"
                     /db_xref="GeneID:40386412"
     tRNA            complement(827516..827589)
                     /locus_tag="C5L36_0Etrna5N"
                     /product="tRNA-Asn"
                     /note="PKUD0Etrna5N; codon recognized: AAC"
                     /db_xref="GeneID:40386412"
     gene            complement(<828985..>829416)
                     /locus_tag="C5L36_0E03910"
                     /db_xref="GeneID:40386194"
     mRNA            complement(<828985..>829416)
                     /locus_tag="C5L36_0E03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467951.1"
                     /db_xref="GeneID:40386194"
     CDS             complement(828985..829416)
                     /locus_tag="C5L36_0E03910"
                     /inference="similar to AA sequence:RefSeq:NP_010385.3"
                     /note="PKUD0E03910; similar to Saccharomyces cerevisiae
                     YDR100W (TVP15); ancestral locus Anc_8.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323811.1"
                     /db_xref="GeneID:40386194"
                     /translation="MESINLEDDTNPCYAVVFKIINLVVAALSVLCGFSELFSRFDYF
                     FQGLFVTGLGVLIGYLEFRIPPKLFTYASSFFSFLGRGCIYMLIAVLNLHGSLVRYII
                     AFVLLATGILYACLEFVSSVQPPNNMQGETGFSDDMLDDII"
     gene            complement(<829888..>830649)
                     /locus_tag="C5L36_0E03920"
                     /db_xref="GeneID:40386195"
     mRNA            complement(<829888..>830649)
                     /locus_tag="C5L36_0E03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467952.1"
                     /db_xref="GeneID:40386195"
     CDS             complement(829888..830649)
                     /locus_tag="C5L36_0E03920"
                     /inference="similar to AA sequence:RefSeq:NP_010384.3"
                     /note="PKUD0E03920; similar to Saccharomyces cerevisiae
                     YDR099W (BMH2) and YER177W (BMH1); ancestral locus
                     Anc_8.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323812.1"
                     /db_xref="GeneID:40386195"
                     /translation="MSTSREDSVYLAKLAEQAERYEEMVENMKAVSSSGQELSIEERN
                     LLSVAYKNVIGARRASWRIVSSIEQKEEQKGNEAQVKLIRDYRGKIELELTNICDDIL
                     NVLNEHLIPTAQSGESKVFYYKMKGDYHRYLAEFAVADKRQAAADASLEAYKAASEVA
                     VTELPPTHPIRLGLALNFSVFYYEILNSPDKACHLAKQAFDDAIAELDTLSEESYKDS
                     TLIMQLLRDNLTLWTSDMSEASQEENTASNEKQDE"
     gene            complement(<831726..>833399)
                     /locus_tag="C5L36_0E03930"
                     /db_xref="GeneID:40386196"
     mRNA            complement(<831726..>833399)
                     /locus_tag="C5L36_0E03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467953.1"
                     /db_xref="GeneID:40386196"
     CDS             complement(831726..833399)
                     /locus_tag="C5L36_0E03930"
                     /inference="similar to AA sequence:RefSeq:NP_010386.1"
                     /note="PKUD0E03930; similar to Saccharomyces cerevisiae
                     YDR101C (ARX1); ancestral locus Anc_8.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323813.1"
                     /db_xref="GeneID:40386196"
                     /translation="MALQISPKDTNLLLKEKNILTADVLDKYRVAGEITQTCLAFIIS
                     LINDSYHLGAHEPYSAAELCLLGDSFMQSLIDTKYKKIIEKGIAQPVTLDVNNIVAGY
                     SPELNDEESNMTFKAGDVVTINLGCHIDGYTSNLAHTIVIYPPGATPPGPLLGENADI
                     ICASYLATETVVTLLACALTPEKIPNSLANGPVKQITGSLIRKVVNEIAKSFNCTVVP
                     LSKVRRVRRFLAGQAEGVVAERDFKGVVWSEKDQEEELLRASESINETQISIIDKSQG
                     RIDNPDNTIPTDDFVVSPGEVYSVDIRMAPLNREEPGIVTLESLDGFKSKKEEFNPKH
                     SIFIRDVSIAEQLKLRNSRRLLSLVDKKQSVYPFKLAYVSEHFPLQKDKNIVEQLIKV
                     EKDVKVFKFGLAECINKQLFVSKPIVAGKFIPLKNILNLSTSTGINGYDASNPTLPGL
                     ELPLPKLGVTLLKLKTLLKQSPAVNVSRFSSTVALSTESGCLRLGGGVQNFKCSWVHS
                     DYELQGDIAALVNELAALTQDERFGIKIRETVVLKDTIAGPVAEETMEE"
     gene            complement(<833644..>834294)
                     /locus_tag="C5L36_0E03940"
                     /db_xref="GeneID:40386197"
     mRNA            complement(<833644..>834294)
                     /locus_tag="C5L36_0E03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467954.1"
                     /db_xref="GeneID:40386197"
     CDS             complement(833644..834294)
                     /locus_tag="C5L36_0E03940"
                     /note="PKUD0E03940; Pfam Domains: tRNA_bind(1.8e-31)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323814.1"
                     /db_xref="GeneID:40386197"
                     /translation="MFARSFIRAISLPHKIESLRVLSARYETTVAKSASTPDLNPNIL
                     DLRCGIIRHVIRHENAEKLYVSQIQVGPQENDTIQVCSGLVGLVPIEKMQDLHVVVVN
                     NLKPSKMRGVKSEAMLLCADGPDRVIPISPPTTSVPGTVLGFSNVPKVELQDKRKIKS
                     KAFETISNDLHVNALGQVTWRDGCILHAIEEDDIVNPDTHCMVKPFSPDLEGAQVR"
     gene            complement(<834573..>837155)
                     /locus_tag="C5L36_0E03950"
                     /db_xref="GeneID:40386198"
     mRNA            complement(<834573..>837155)
                     /locus_tag="C5L36_0E03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467955.1"
                     /db_xref="GeneID:40386198"
     CDS             complement(834573..837155)
                     /locus_tag="C5L36_0E03950"
                     /inference="similar to AA sequence:RefSeq:NP_009738.1"
                     /note="PKUD0E03950; similar to Saccharomyces cerevisiae
                     YBR179C (FZO1); ancestral locus Anc_8.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323815.1"
                     /db_xref="GeneID:40386198"
                     /translation="MTVHKDSTGESYLVPDDSSVDMNASFSENYAYDEEEDDNQTLLN
                     GNEGAKKLPAMVNYNTTTGTLEGTTLNDGEVGRGPEIAINSANYEDSSTAHIKQLKYN
                     QNKILLDRAINSTITLFAEFKENNVHSPIHYPVDQMMSNGYDSKLNSNTSKRALLLQE
                     DTTISGPKFELLKLELKTGAKSSESLIGNLDEHTISLLLDEKFEHILRHLKNLKARVD
                     DISSKVLITGDLNSGKSSFCNALLRRNVMPVDQQPCTNVFCEIINYKENRGIEEVHAI
                     PIGATYDIKHTNSYNKFPLEKLEDLVYENDKYALLKVYINDNRPTEESLLKNGIVDIR
                     LIDAPGLNLDSYQTMQLFSRQEEIDLVVFVVSAENHFTLSGREFISNVNKDKKFSFVV
                     VNKFDSIKRKDKCVEKIMQQIGDLSPETHKDSEDFVHFISSTDIIKDGPDGGSPDDGD
                     DSNPESHDAPRPNPNFNRLEAALRNFVLDKRSVSKLLPVKNYLSKIYQEVLLLIDMNI
                     ENYQENKSKLEKELNEITPEYNDIVRTSVKLNEKIVKVIDNCTDEVYENTRKSILDVI
                     ESFTRNFEVDNSVTIFNIDQFIQTTKLKVVHDILSTIEDAEDFARLSTLHGIEHIRSL
                     GRSIVGDDKLVEQKFKPESMYSHKKDQQFKSQININFELIDLVDFDSVIQFFRGAQSL
                     FSLTNFSPLSSFGKNGSSITKLVSTGVLKTGISSMVLLYVPKLVTIFSNVNSVIKLPK
                     IFLVSSVAILVGYPIYYIIKESPKTVHKNIIKKIQTNLVNDDYIHLNSLRISKEVRKV
                     LNYPAKDVSIGINGLIEQKSNLKMKLSNKVHVLNGNIAFIQDLKQRVDVQQRMLDGLE
                     LDID"
     gene            <837703..>838989
                     /locus_tag="C5L36_0E03960"
                     /db_xref="GeneID:40386199"
     mRNA            <837703..>838989
                     /locus_tag="C5L36_0E03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467956.1"
                     /db_xref="GeneID:40386199"
     CDS             837703..838989
                     /locus_tag="C5L36_0E03960"
                     /inference="similar to AA sequence:RefSeq:NP_015224.1"
                     /note="PKUD0E03960; similar to Saccharomyces cerevisiae
                     YPL101W (ELP4); ancestral locus Anc_8.581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323816.1"
                     /db_xref="GeneID:40386199"
                     /translation="MSFRRRGDVISGRGPVPSNPMLNRVPGARPGSVMPARGVVPNRI
                     IKADTGDRRIPAATEVAAVPSGDFSKNKGFKHPGVKPSSVLSNISCISTGTKDIDTIL
                     VHGGLPTNTSLLIEEDGSTDFSGVLIKKFVAEGIVQNRRTGKLINHCIVIGMDSTFGN
                     ELPDVYAGNRKERKKKLVKEQEGKLSVSNINAGNELKIAWRYRKDIADATSNMNTAIR
                     ELDESKYPEYNHQFDLTTSIRPSPDSSEITYIPLDNYKNVLDSVKRTVERELKNGDKM
                     IRIAVPYMLNPMIYGCDDLIDFDSVAAFIFNLRRIINSHEGRLSMVASMSSELYEDTV
                     LLSKLEELLFDGIIRLVPFPHELNVLMEKVYKTQREKIKQGYVDIYRVPIVSSMGLME
                     KRLKEYSFKNSKTNFHVEQWSIPVEEEEVDDKSTDF"
     gene            complement(<839071..>840234)
                     /locus_tag="C5L36_0E03970"
                     /db_xref="GeneID:40386200"
     mRNA            complement(<839071..>840234)
                     /locus_tag="C5L36_0E03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467957.1"
                     /db_xref="GeneID:40386200"
     CDS             complement(839071..840234)
                     /locus_tag="C5L36_0E03970"
                     /inference="similar to AA sequence:RefSeq:NP_014439.3"
                     /note="PKUD0E03970; similar to Saccharomyces cerevisiae
                     YNR041C (COQ2); ancestral locus Anc_6.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323817.1"
                     /db_xref="GeneID:40386200"
                     /translation="MWSTGSLRLGIVGVRRCVPKLIKANNYSPLLNVSFKKYYSTEVQ
                     AKKSPVIGTIKAAGLEITKPPLTDARSVFSEKELEEARINRLKGLGILTKFPEKWIPY
                     MELMRIEKPIGTLLLLSPCMWSITMAAYMTSAPLLSTLWMLSVFSVGAFVMRGAGCTV
                     NDMWDRNLDNKVARTTERPITSGRVSMPQAWTFLGAQLAVGLVVLLQLPLDCFLLGAS
                     SLLLVMTYPFFKRVTYYPQVVLSACFNWGALLGFPAMGVWNWPVMIPLYLSGFFWCMT
                     YDTIYAHQDKKFDVNVGIKSTALAWGNSTKKICYGMSVAQMGCYVTSGFLAGMGPFFY
                     LGALAGGYRLFNMIKKVDLDNPANCWMWFKENINTGHVFWLGILLDYLWKLFF"
     gene            complement(<840457..>841584)
                     /locus_tag="C5L36_0E03980"
                     /db_xref="GeneID:40386201"
     mRNA            complement(<840457..>841584)
                     /locus_tag="C5L36_0E03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467958.1"
                     /db_xref="GeneID:40386201"
     CDS             complement(840457..841584)
                     /locus_tag="C5L36_0E03980"
                     /inference="similar to AA sequence:RefSeq:NP_011498.1"
                     /note="PKUD0E03980; similar to Saccharomyces cerevisiae
                     YGL017W (ATE1); ancestral locus Anc_4.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323818.1"
                     /db_xref="GeneID:40386201"
                     /translation="MDQLHYIKSTRCGYCRQKKEIWKSWALQSISETMQDRGYCNSSS
                     ITFQGDQLSLRRYEELMKEGWRRSGDFMYKPDLLRSCCRAYTIRTNYELYLEDGYYNK
                     SAKKTMRKFYKSVGCTQNAISTELDDFYHAKEHGGDKGFFTVLLPNTFSYDKFELYKK
                     YQFKVHGDKEEDVDELSFYNFLCLDPFRKEETEDLFDWRLLNKEWTSGQYGEELKKLQ
                     GPIHECYFADNKLIAVAVLDILPTSVSSVYFIWDPDYAHLGLGNVSAIREIMLTKVLE
                     KEYYYLGFLIADCEKMIYKAKFGGEIRNFSKRGGDPLWVRLKHVSNQLEDGYFKVFDS
                     EMNDIAEQQYGMDSDCYDSEFVSSFDVVSKTQLFPTPKVIP"
     gene            <841799..>843661
                     /locus_tag="C5L36_0E03990"
                     /db_xref="GeneID:40386202"
     mRNA            <841799..>843661
                     /locus_tag="C5L36_0E03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467959.1"
                     /db_xref="GeneID:40386202"
     CDS             841799..843661
                     /locus_tag="C5L36_0E03990"
                     /inference="similar to AA sequence:RefSeq:NP_010772.1"
                     /note="PKUD0E03990; similar to Saccharomyces cerevisiae
                     YDR484W (VPS52); ancestral locus Anc_3.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323819.1"
                     /db_xref="GeneID:40386202"
                     /translation="MSIAPHRNSISKRSSFIIGGHNRFGNHPNDRTVELGHGQNEMRT
                     TISRLEYLNNKFNIDPSFDIEVSGEEEGQEAGLEHEGQALKWNSEFMKIDIQQKETAF
                     AEYSCKILDSLELLKPLFKYIRSLEMNLDSLSNEMEALKARLTNLNEEIKKNAKVDQT
                     LTPVLMDILISPQTVQIICSATIDENWVNQLTVLSEKKEILQAYKDSDKVNQDNITHL
                     SQIIENLEKKCVERIKKFLIDHIKAFRGIDSSSVKIQKKLLSVKEIMVFLKDRNPKLA
                     KEFENAYIYTIRWYYYFNFVKYISSLENLTLQENEFDTDSAFKHTTRPLPSSSTSTFR
                     SLLLDNSDSINEYLINLPRRLEQLEDESNKYSILAQIAESANSNLKFFMEQIFQFLNQ
                     TILDNFTIEFNFIMGFFDITDNEELSSTMKQMFSPIFKLGTNFTKYLLQYCKSDYFGI
                     LHTIRRIQKMEYEIQMRCLPELFQTYLNSQLMVLWPAFQNNIDILCDNITATLMSTSV
                     IKQIMNNKANLLIPLKATQSFSMVLSNMVKLVQNLVFELETSEPLNGSIERLSSTYEK
                     GMIQLASNLDPNKRKLFLYVNFQLMYNVLDSDSSIKEKMPDLTDHYKRLVEAYS"
     gene            <843865..>844692
                     /locus_tag="C5L36_0E04000"
                     /db_xref="GeneID:40386203"
     mRNA            <843865..>844692
                     /locus_tag="C5L36_0E04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467960.1"
                     /db_xref="GeneID:40386203"
     CDS             843865..844692
                     /locus_tag="C5L36_0E04000"
                     /inference="similar to AA sequence:RefSeq:NP_012469.3"
                     /note="PKUD0E04000; similar to Saccharomyces cerevisiae
                     YJL066C (MPM1); ancestral locus Anc_1.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323820.1"
                     /db_xref="GeneID:40386203"
                     /translation="MGIFDPSRNDQDKNKDVQINSVSLFDDKLGLDAIGDWHNQIQRT
                     LSKTNDITLDALGTLKGLTNGVGSILGAFDDTITGSLLTPRISHKPNEIVTKGIPPPE
                     VYDECKKAEGLGVWDQYGLWHCLFPRSSIPYDYHTGRRSDDIIIDDSSLVSREDIEND
                     VDHKYGTFFKNMEDMLGWQSSMKRAIQEQKRRQWADWEKKEKSKWGFLTGFTNGDDSS
                     EDDEGKTVVGRESETRVVTLPNGDLERTTVMRRRYSDGTSKVREFSEIIGPDGEVKK"
     gene            complement(<844839..>845099)
                     /locus_tag="C5L36_0E04010"
                     /db_xref="GeneID:40386204"
     mRNA            complement(<844839..>845099)
                     /locus_tag="C5L36_0E04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467961.1"
                     /db_xref="GeneID:40386204"
     CDS             complement(844839..845099)
                     /locus_tag="C5L36_0E04010"
                     /inference="similar to AA sequence:RefSeq:NP_009776.1"
                     /note="PKUD0E04010; similar to Saccharomyces cerevisiae
                     YBR217W (ATG12); ancestral locus Anc_6.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323821.1"
                     /db_xref="GeneID:40386204"
                     /translation="MLIRLKAIGAIAQIHPSVEEFPDTAEFAAVHLHILRKLNLPDNQ
                     PLWCYVGNAFVPPMDTKLAVLDGMSSSKDILTVTYSQVEAFG"
     gene            <845300..>846742
                     /locus_tag="C5L36_0E04020"
                     /db_xref="GeneID:40386205"
     mRNA            <845300..>846742
                     /locus_tag="C5L36_0E04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467962.1"
                     /db_xref="GeneID:40386205"
     CDS             845300..846742
                     /locus_tag="C5L36_0E04020"
                     /inference="similar to AA sequence:RefSeq:NP_014689.1"
                     /note="PKUD0E04020; similar to Saccharomyces cerevisiae
                     YOR046C (DBP5); ancestral locus Anc_5.643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323822.1"
                     /db_xref="GeneID:40386205"
                     /translation="MSDIKKQDAADLMASLNLAESKAKEEKTVPKVDEATDVKKVETN
                     ENSTKEVKDADPKEPLPEGNLVKSTYEVKVKLADLQADPNSPLYSVKSFEELGLKPEL
                     LKGLYAMKFSKPSKIQEKALPLLLSNPARNMIGQSQSGTGKTAAFALTMLSRVDEGNP
                     NVQAICLSPARELARQTLDVVQEMGKFTNIKTQLLVPGSLERDSKIDGHILVATPGFL
                     LDMIRKKRVSVGSVKVFVLDEADNMLDQQGLGDQCSRIKKFLPKTTQLVLFSATFPDE
                     VRRYAEKFVPNANSLELKHEELNVDAITQLYMDCADENEKFKNLCEFYGLMTIASSII
                     FVQRKDTADKLYMRMKQEGHAVSVLHGSLESSERDRLIDDFREGRSKVLITTNVLARG
                     IDIPSVTMVVNYDMPFDKNDRPDPSTYLHRIGRTGRFGRRGVSISFIDSKKSYECLQS
                     ISKYFGGIEMKKLPNDDWDEIEEIVKKAFK"
     gene            complement(<846902..>847759)
                     /locus_tag="C5L36_0E04030"
                     /db_xref="GeneID:40386206"
     mRNA            complement(<846902..>847759)
                     /locus_tag="C5L36_0E04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467963.1"
                     /db_xref="GeneID:40386206"
     CDS             complement(846902..847759)
                     /locus_tag="C5L36_0E04030"
                     /note="PKUD0E04030; Pfam Domains: SNARE(1.9e-09)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323823.1"
                     /db_xref="GeneID:40386206"
                     /translation="MNSENPFEVPENPFSDPYVPVGSGNNASFMSECQRIKREIETYK
                     SNTERLRHLQHQQMTSVSESEKQQILQSIDSLTMSMKSSQLDIKQSIEDLKLQVDRSD
                     PDMVNQLNNLNRLFRSGLKDMIMEEDHFREAVTHQAVEQYQIINPQASYNEAQQFVLQ
                     NGPDDVFATSLEMQNKTAEARQVYENVKYRHDELVKIQEMAASLNQMFNDLQDIVLEQ
                     DEILNSANYQVNSAQQELEKGDANVVKAVNLSKRNRKCKWIILVLCIILAAIIAGVVA
                     GVVKHFQNK"
     gene            <848062..>849564
                     /locus_tag="C5L36_0E04040"
                     /db_xref="GeneID:40386207"
     mRNA            <848062..>849564
                     /locus_tag="C5L36_0E04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467964.1"
                     /db_xref="GeneID:40386207"
     CDS             848062..849564
                     /locus_tag="C5L36_0E04040"
                     /note="PKUD0E04040; Pfam Domains: Abhydrolase_1(5.3e-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323824.1"
                     /db_xref="GeneID:40386207"
                     /translation="MSKVQNRETAEEDNRGGRKQQTLADEIGEAYGGHSFTIWDSLRV
                     YLSSFRDQRKEYERKLLNHLPLFQGEGQHVYGREVEVLDVEVSGSYIHEVCIRNTEVS
                     CDGDKLDIVLVHGYGAALGFFYKNIEALSSIGGSSLHLVDMLGFGCSGRPAFPIEDCR
                     NDMDRVLRAESFFVDSFEEWRRKRGVTKCVVIAHSLGGYLMSAYYLKFGREVVEKLIL
                     VSPVGVEDSEASLFRKYKCGYGGEDSDDSDDCDPFEYNVDKDYRIAKEQGVDLSKELT
                     DHLHEQEWGFEDYDDEDDGDGEDKIEDDDGVSLMSVITHDGDAVDDTEMRRTRVEQVM
                     RQLKTRVVPGKILTRFWERHYTPMDIVRLFGPLSGSVVAIWVYNRFQRVHSEPELFDL
                     CNYTTSLFLSRGAGEYALGSLLAPGSLARLPLCERLPSQIRVPVLLLYGEEDWMDKMA
                     GYKLAQDINTYGGQAKYRVVRNGGHHLYVDNPDEFAKQVVQFIRERGSLE"
     gene            <849954..>850286
                     /locus_tag="C5L36_0E04045"
                     /db_xref="GeneID:40386208"
     mRNA            <849954..>850286
                     /locus_tag="C5L36_0E04045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467965.1"
                     /db_xref="GeneID:40386208"
     CDS             849954..850286
                     /locus_tag="C5L36_0E04045"
                     /note="PKUD0E04045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323825.1"
                     /db_xref="GeneID:40386208"
                     /translation="MQRILGTKAFGWQDDMLFCPLVLDALNVLEPGSAPLLSASSGTT
                     TATATATATSTTTTSAVAATRDGCLSANTTVAASVARSAVHTPRPKKVLDIVNPHTGL
                     RVSSPKPL"
     gene            <850756..>852426
                     /locus_tag="C5L36_0E04050"
                     /db_xref="GeneID:40386209"
     mRNA            <850756..>852426
                     /locus_tag="C5L36_0E04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467966.1"
                     /db_xref="GeneID:40386209"
     CDS             850756..852426
                     /locus_tag="C5L36_0E04050"
                     /inference="similar to AA sequence:RefSeq:NP_010713.1"
                     /note="PKUD0E04050; similar to Saccharomyces cerevisiae
                     YDR425W (SNX41); ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323826.1"
                     /db_xref="GeneID:40386209"
                     /translation="MDYHDFSDDNNPFVGSNHFYSNGFVDMDMESDAMAHDGLHPESS
                     DNDDIVESDNEDNDRRCGRDNHKNDDNGGDKDTRDNKQEGNEENNDFDDDEADYSVMD
                     TTYDSIPYSVSEQPTFYVPTMTKCDTNAQFQISTFEILKDYKGTRTIYYKIENSAANT
                     HILRRYNDFRSLRSYLSKFYPYLFIPPIPEKHSLSRFLKNPFNYKSDMSIIELRIRLL
                     NYFLMKINNHPTLSTSPIVVKFLDPLINNWNSCLNSPPFTNLSSNSFLLVSTRNPTKP
                     SPYFSYLPIPPLTLLKTFSTRLNSQVFQKLENQLKIFLKIIVNLETKMKNLIKTLNAL
                     RVNLVEFGAVLNIFSIMENQNYNIEKFGNKIDLNFLNIEILSTNLSIKIKEPLIIMKN
                     SVIYLLQMLHFRKLKELQFVYFQNIIQKKQSRLKSLVNSINTQPILPALDPNSSEPIS
                     SPSLNLAIENMKLKNKSHQITVENLSNESKQQILSEIKTLNNELNSNLVPCFKFLLDD
                     VQFLSVQVEKNTKHELKHLLQMMSTLQQNWKSNVWGEYFASCLDVWKK"
     gene            complement(852580..852653)
                     /locus_tag="C5L36_0Etrna6N"
                     /db_xref="GeneID:40386413"
     tRNA            complement(852580..852653)
                     /locus_tag="C5L36_0Etrna6N"
                     /product="tRNA-Asn"
                     /note="PKUD0Etrna6N; codon recognized: AAC"
                     /db_xref="GeneID:40386413"
     gene            <853822..>855336
                     /locus_tag="C5L36_0E04060"
                     /db_xref="GeneID:40386210"
     mRNA            <853822..>855336
                     /locus_tag="C5L36_0E04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467967.1"
                     /db_xref="GeneID:40386210"
     CDS             853822..855336
                     /locus_tag="C5L36_0E04060"
                     /note="PKUD0E04060; Pfam Domains: Amino_oxidase(4.7e-42)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323827.1"
                     /db_xref="GeneID:40386210"
                     /translation="MTFIDRGVSDVVVIGAGIAGVKTAIELTKSGISNVILEARDRCG
                     GRLYTEKLKSGVDADLGASWFHDCLDNPMLKKYFESGKIKFNFDDGRFSYFNENGLID
                     DNEKLKPIANEIKLYLASLYDKLTPNEDISVKEAVYRYIKEKRYLLTDYQVKYIPQLI
                     RYFEMWIGSSWEILSGRSISADAHKGRDAMVLNGYQTVFNCELQELKDAKGKDNISAF
                     IKLKRIVYKISWNEKSQLIEVYSKYANITEVYKSKYIVVTVPLSVLKLSSGEEGSIEW
                     VPPLPASFTNSISNVSFSNLGKVFFEFPKCFWNLEDDRLLSMAKVEEEYYEACRYDKE
                     DLCTYKFLKCRQDVPIRENEVPNGLDYTVLFMNLAKPTQKPIILALTSSPLTQYIEQA
                     SSNIIFEVFKPVFARIAGLPESSIPQPIEVKTSKWSNDPFARGSYTGVTIGDSYEPFL
                     EEVLNPNKIFDGRGRVRFAGEGTIDDGNGCAHAAWNTGLREAEIIKRMINRAKL"
     gene            complement(<855432..>856184)
                     /locus_tag="C5L36_0E04070"
                     /db_xref="GeneID:40386211"
     mRNA            complement(<855432..>856184)
                     /locus_tag="C5L36_0E04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467968.1"
                     /db_xref="GeneID:40386211"
     CDS             complement(855432..856184)
                     /locus_tag="C5L36_0E04070"
                     /note="PKUD0E04070; Pfam Domains: RRM_1(1.8e-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323828.1"
                     /db_xref="GeneID:40386211"
                     /translation="MEQNQTESQGIYNEAVEGSQFQEQPQQDQPQQQQGIENSGSRGQ
                     FQTNQETDQIEQMKEHISRMEEESERLNQMQQQIMQMDDAMEITDNGDAPMDGVEEDA
                     KFQSIQERKEIDGRSIYVSNVDYSATPEELQQLFSECGTINRITILTNRLTGTPLGYG
                     FIEFESAESIPKALENDQTLFKGRPIKVTPKRTNLPGFGSRGRGRGGFVGRGRGRGGF
                     GGRGRGRGGPRGRGGFRGRGAPRGARGGFNPY"
     gene            <856434..>859103
                     /locus_tag="C5L36_0E04080"
                     /db_xref="GeneID:40386212"
     mRNA            <856434..>859103
                     /locus_tag="C5L36_0E04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467969.1"
                     /db_xref="GeneID:40386212"
     CDS             856434..859103
                     /locus_tag="C5L36_0E04080"
                     /inference="similar to AA sequence:RefSeq:NP_013101.1"
                     /note="PKUD0E04080; similar to Saccharomyces cerevisiae
                     YLR001C; ancestral locus Anc_5.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323829.1"
                     /db_xref="GeneID:40386212"
                     /translation="MLHKNIRTCGLAFLLLGHSFGLGFHIPLQDGLAQDNDEEVPTIS
                     IIDILSSNESYTSLILTLQRSDLVDYVNELTNVTFLAPVNSAFDRHDIPRGSKMSKNQ
                     LNKFIINSTIFREDINGICILDTLGKGSPYIENLNIPILLEHRFVDGEDHETYMVENA
                     NVIGDDVYMPAFDNILLSVDDLMIDDKESVCRYFLNSLNRNTGDERFKTFSSLIVSEN
                     TCRSEMLSNMTFLVPSDKSLSFNHVEIKYLNNVRGLHDKNLFLSNFLVDGIIGGNLNN
                     APVVTHNWNNNEVKITSSYLGDEIIINDKYHATTSNFLLADGIIHYFDSFEFDQSFES
                     YPRFTSRKYLIGLDYDEFVDELDFRKLSHLIDDASLNQTIFVSIDYKIMGALQNQMYY
                     HFVEGNNIDSLQPGESRLLTSKFCLTEEFCQKIKIQRITDTGSLVLNSNVNIVNTKPY
                     KVGNTSIYILEDDISLPAKLQIAIASELTKHGKSISYFKEFSLLKELSRGDSFHTIFF
                     PASKLWEDLDVTLEYMENNPSLLQEILEGLVIEGLIYDNFEGTQLLQTYGGDVVNITT
                     INKGLLQINNSTLIKTSFDNEILYSNGVIHPVYDELPLPKTLDISVFDLLQDQSGDIF
                     EKILEKTNLTGYLALPDYSILLPPDKSLLQENITEMVGDYDYLDKFVKLHILPPGAMD
                     MILNCHSNQPLDSNSTTMIPTILEGHHLTCRQLSSGGIMLSITEGANNEVRILRKGLT
                     INVSELKSGILILDRPLSPRWLNKNPGKLYLHLPFLAVIVGILIGVVCVIFGFGCCLL
                     ITLGSNSMRTADEEESENVAANSSHIANVNERLPLLSENVGGNNINEHDNNGIGQGSS
                     LKKVTGKPQKNYSSFESRYSANASTSPIEVIQE"
     gene            complement(<859350..>860948)
                     /locus_tag="C5L36_0E04090"
                     /db_xref="GeneID:40386213"
     mRNA            complement(<859350..>860948)
                     /locus_tag="C5L36_0E04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467970.1"
                     /db_xref="GeneID:40386213"
     CDS             complement(859350..860948)
                     /locus_tag="C5L36_0E04090"
                     /inference="similar to AA sequence:RefSeq:NP_013123.1"
                     /note="PKUD0E04090; similar to Saccharomyces cerevisiae
                     YLR023C (IZH3); ancestral locus Anc_5.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323830.1"
                     /db_xref="GeneID:40386213"
                     /translation="MDSGVLKNRNEKSTPISRDNNASTESTHEIKPDDVIIKSNPDVE
                     RLEMMEKLVLTKIDKLLGKFELKLSNMEKYLEQSAVDVENTASTILSYTPSYSNLVST
                     LKSIKGYLQKNQQHSLHPLTKIIDDYYEQEKQPKGEDKKHSLDEKAHSTLANSTQTFQ
                     EYKQQLFYAIQVLNARLTDFEKHHNLPPLNTHPSERLIALKETLYNYDVALTTSKKRH
                     LTFYELPFQWRENKYIIYGYRFATSHFSAMTSWLHWHNETVNIWTHLLGSAYMVYLGL
                     VHFPQSEHFQTYAASLSDKAVMYLFISSSIICMMFSVFWHSYANIGFVTTRSKFACFD
                     YSGIVILISSSIISTEHISLKGHLKLKLLFMGFSSIAGIVGIIMAWHPYFDRPESRIL
                     RILFFISLSFLGVVAFSCSCFFHSIQYCLNLFFPLLFSFVWYLSGVVFYGSFFPECCR
                     TDVEVDNFEISDETIMQLDREGKFLEYLHKQPVKTCNHGITSLWWIDWIGNSHNLWHL
                     FVIGGVLGHYKALLDMFKYGYEHQ"
     gene            complement(<861470..>862771)
                     /locus_tag="C5L36_0E04100"
                     /db_xref="GeneID:40386214"
     mRNA            complement(<861470..>862771)
                     /locus_tag="C5L36_0E04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467971.1"
                     /db_xref="GeneID:40386214"
     CDS             complement(861470..862771)
                     /locus_tag="C5L36_0E04100"
                     /inference="similar to AA sequence:RefSeq:NP_009405.1"
                     /note="PKUD0E04100; similar to Saccharomyces cerevisiae
                     YAR008W (SEN34); ancestral locus Anc_4.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323831.1"
                     /db_xref="GeneID:40386214"
                     /translation="MTATNIKLSTEIDEMQIPVPVSSMKHFRQAQLTRFQHLPRNSSP
                     LATFQNSYSFDGQPMDESRSTSEETGASTLEEDDGRVVDKSEHEKAEGNGVLVDMIPL
                     FVHGEHVLIFNSRHMKELTIRHGITGQLAGTLPLAPQQNALLGFPWRLTIYEVMWLLE
                     NKHCVLIDSEDTIENVFVGQWLGDATLQEKLSSHLQVKLDKWREEKQKEIEEQMKKLN
                     IIKKDHRAMKPLDNAMLASSASMPDLQQVLNDDQRKRDELAERKRKDREMHDKSKRNN
                     IVFMETPNDDLKFMEVHIKDKSACLLQKMIDNEVEDVNQIWRNYQIYKYLKDNLGYYL
                     LPGMRFGGTFVSYPGDPLRYHAHQIVDTKHYYNDDIGLFRMSNRGRLATGVRKVWVVG
                     GDRNVDPAQNSKINITDTIIHGEVPFTDSDMVCFSIEWAGF"
     gene            complement(<863229..>865088)
                     /locus_tag="C5L36_0E04110"
                     /db_xref="GeneID:40386215"
     mRNA            complement(<863229..>865088)
                     /locus_tag="C5L36_0E04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467972.1"
                     /db_xref="GeneID:40386215"
     CDS             complement(863229..865088)
                     /locus_tag="C5L36_0E04110"
                     /inference="similar to AA sequence:RefSeq:NP_010213.1"
                     /note="PKUD0E04110; similar to Saccharomyces cerevisiae
                     YDL070W (BDF2) and YLR399C (BDF1); ancestral locus
                     Anc_4.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323832.1"
                     /db_xref="GeneID:40386215"
                     /translation="MQVASEKHTLTEEDREQGLLKKQKIEEDQPQQATQVAQVDRKDQ
                     QDKQGQKESETQEPKTQESNTTSGPPLNPDGTPMVPAPKPPQEPDMDNLPANPMPPHQ
                     KKYALNSIKAIRRLKDAGPFLLPVDIVKLNIPFYYNYIPRPMDLSTIEKKITVNAYET
                     PQQMIDDFNLMVNNCFKFNGKDAIISQMVRNIQASFEKHMLNMPSKDQPNRPKTGGKS
                     MTRKANNDNSVPKIRRDHTSVLDSGRPKREIHPPKPKDMPYDIRPRKKKYQPELRYCQ
                     QILKDFHSKKHEGIVWPFLDPVDPVAMDCPNYFDIIKNPMDLSTIQNKLTNGEYETAN
                     DFEKDIRLMFTNCYTFNPEGTPVNMMGHRLEAVFNEKWAKRPQTPVSPSGSDDESEEE
                     FDDNEEFNIDINSITDPTIEFLLANIDRMTQDLKRMRQEKYDQLKKDWLKKRQQKRGK
                     KGRKYSTNSKGANKSFSKKKDVNMENDEVDDANIGSSNSSFYPKHVTYEMKKEISEAM
                     QHVNEKMLKNVITIIREGVPDLQDDDEIELDMDILDNATLLRLYRYLVGGKNGKKQQK
                     KSSENSEEEKIELLKQKLAQFESNGNNGGINGANNDDSSSSDDDSDDESSEEE"
     gene            <865806..>867962
                     /locus_tag="C5L36_0E04120"
                     /db_xref="GeneID:40386216"
     mRNA            <865806..>867962
                     /locus_tag="C5L36_0E04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467973.1"
                     /db_xref="GeneID:40386216"
     CDS             865806..867962
                     /locus_tag="C5L36_0E04120"
                     /inference="similar to AA sequence:RefSeq:NP_014030.1"
                     /note="PKUD0E04120; similar to Saccharomyces cerevisiae
                     YMR301C (ATM1); ancestral locus Anc_5.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323833.1"
                     /db_xref="GeneID:40386216"
                     /translation="MWSRRLVFTPTLPRTSRVPTSLFFIKPFTPLTNVSNPLIHLRLA
                     SSSNKTTSNTSTSANKPNLVTNSKQARAAPSLPSVSQLKIIADLLAYLWPKDKPWVKF
                     RVVTALSLLISAKLLNVQVPFFFKSIIDQMNVDWQSLSDSMTSNLPDSALTNAIVENA
                     PIVPPAIGALILAYGLSRFGAVLFGELRNAIFASVAQGTIKSVAKNTFVHLLNMDLSY
                     HLSRQTGGLTRAIERGTKGISYVLTAMVFHIIPITFEISVVCGILTYNYGASFAAVTL
                     LTMLAYTIFTIRTTTWRTGFRRAANKADQQAASVALDSLINYEAVKIFNNEALQAKKY
                     DAALSKYRDESIKVGTSLAFLNSGQNFIFTTALTAMMYMACQGVVAGSLTVGDLVLIN
                     QLVFQLSVPLNFLGSVYRELKQSLLDMEALFKLQKQPIKIKSKPNALPIKVDKGEIKF
                     ENVDFSYVEGRKILNGCSFTIPAGKKVAIVGPSGSGKSTILRLLFRFYDIDPSKKSSI
                     QIDGQDIRDVDLDSLRREIAVVPQDTPLFNASLLENLRYAKPNASDEEINDIIYRVKL
                     DNLIRSLPEGVHTMVGERGLMISGGEKQRVAIGRAVLKDSPIIGLDEATSALDTSTEQ
                     EILNTLKDILANEKVRRTSIWVAHRLRTIMDADKIIVLKQGTVVEEGTHKELIAKGGE
                     YAKMWEIQEVWEEEDVDILEEEAKEKREEKEQQETK"
     gene            <870541..>871686
                     /locus_tag="C5L36_0E04130"
                     /db_xref="GeneID:40386217"
     mRNA            <870541..>871686
                     /locus_tag="C5L36_0E04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467974.1"
                     /db_xref="GeneID:40386217"
     CDS             870541..871686
                     /locus_tag="C5L36_0E04130"
                     /inference="similar to AA sequence:RefSeq:NP_013916.2"
                     /note="PKUD0E04130; similar to Saccharomyces cerevisiae
                     YMR191W (SPG5); ancestral locus Anc_6.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323834.1"
                     /db_xref="GeneID:40386217"
                     /translation="MLPRVVQELIQASRKTAREFRKALDDVAELLNERQLEQALRERG
                     QPVKVPVRSRGNDSRHPLQRRHFSTSRNAKFNASNISLNFKSIRDVRLKQNNIRTRIS
                     VTNTLRAATYQAQPFRSPIRGCLFTRGPGSSLYNHFPRHNARMYSTFGPNMTHQVIEN
                     LSQSIRMLFIKGGETAQNMMTKESSFKVLNNDTFAEKDIELAGKVSDFSGLRENGCIV
                     TFDLITPSIQYIPDSGFFDNDSSEKFHSIFESSMKHQEKVLNDVQLFRNNIGSTSFKF
                     ERKNDRNRLKFYVPSCDLMKMEYLLQEAGIQTAVVLVNRESPTSSFDNISNYSGPELV
                     SDSDNDSVLSTDDDLSDYFASNSDERVSVLSSSNDYYDTLPSSMVVV"
     gene            <871990..>874170
                     /locus_tag="C5L36_0E04140"
                     /db_xref="GeneID:40386218"
     mRNA            <871990..>874170
                     /locus_tag="C5L36_0E04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467975.1"
                     /db_xref="GeneID:40386218"
     CDS             871990..874170
                     /locus_tag="C5L36_0E04140"
                     /inference="similar to AA sequence:RefSeq:NP_013917.1"
                     /note="PKUD0E04140; similar to Saccharomyces cerevisiae
                     YMR192W (GYL1) and YPL249C (GYP5); ancestral locus
                     Anc_6.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323835.1"
                     /db_xref="GeneID:40386218"
                     /translation="MEQERIDTSTSKDSNTSFASAMDNTGTSLSGTNEEERGTVRNET
                     GEQGNSDQSGTSQEHEKEENVDEEDEDLFAAYEIDHPVSQPGNEETEAANASEHIQLE
                     GSRDEQEVQTKEEDSSSVKPDLPPRDTTTDVPVSTGKPDLPPRDVTNMPRSEEASEVD
                     AEKDDQYTANTSVESEHPSVIVNTRRNNIAGVPKTPTWFDFEHAGTDMYTSTLDSLSS
                     PVNMNMAYTRFQENEDKLLQKEPVERDDIMHSRDSLKKTFNEIKTGVSITQNEQLINQ
                     IDWEFWSEVFNDYSSIVKNKQSELRKNITKGIPMELRGMAWQIICDSNSMRLKEFFIN
                     TRNSRSDFEKLIRRDLARTRFIKDAQIRDKIEELFSIIKTYSLYDHEVGYTQGMAFIT
                     VPLLMNMEPDAAFCMLVRLMFTYGFRELYLPEMPGLHLRIYQFDRLMEDTLPELYNHL
                     ENQNIKSSMYAIQWFMTLFAYKFPLDMVLRIYDVVVAEGLESILKFALNLMMKNEQHL
                     LTLKFDSLLDFLKEKIFYYYQETPNPNEETANEATYQIDKFISDAMEINILPLTLQRY
                     TTEFDEIDKLEKLREEQAKDLQSQNGLLTKEIRKIEALYAVLNKEHVEIADEMIQGKI
                     KIGSLEEENQFLKEQIEQLETRLANLKANSDTKVDFTTSTKEIGTGLDEEIQSAMEKN
                     LEVMDQNRILEDQLAELEEENRQLKEAKTKVSSVFGGLKKGKFW"
     gene            <874453..>875223
                     /locus_tag="C5L36_0E04150"
                     /db_xref="GeneID:40386219"
     mRNA            <874453..>875223
                     /locus_tag="C5L36_0E04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467976.1"
                     /db_xref="GeneID:40386219"
     CDS             874453..875223
                     /locus_tag="C5L36_0E04150"
                     /inference="similar to AA sequence:RefSeq:NP_013918.1"
                     /note="PKUD0E04150; similar to Saccharomyces cerevisiae
                     YMR193W (MRPL24); ancestral locus Anc_6.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323836.1"
                     /db_xref="GeneID:40386219"
                     /translation="MDAFRGVIKGVRGFSTTVCSSARAYKSVVNRQLKKTPEYKVGDP
                     RSPRLWVPKEISKYPAYPYGESRLFKRSDRGLYGGQVVSFGNKVSEMGNRSRRSWLPN
                     AIVKSLWSESLNKVIKMRLTARVLRTITKEGGLDNYLTKDKQARIKELGLFGWRLRHD
                     VLKARALAKLPPRYQVFKKEDGSEVKVYFDGEYQGQPVKLTIGKRKLLQQLFPAVKNN
                     TVGNLSFASFNVGRANKDIGEIMAECEKLNVDLKNYIL"
     gene            <875763..>876570
                     /locus_tag="C5L36_0E04160"
                     /db_xref="GeneID:40386220"
     mRNA            join(<875763..875775,876284..>876570)
                     /locus_tag="C5L36_0E04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467977.1"
                     /db_xref="GeneID:40386220"
     CDS             join(875763..875775,876284..876570)
                     /locus_tag="C5L36_0E04160"
                     /inference="similar to AA sequence:RefSeq:NP_013920.1"
                     /note="PKUD0E04160; similar to Saccharomyces cerevisiae
                     YMR194W (RPL36A) and YPL249C-A (RPL36B); ancestral locus
                     Anc_6.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323837.1"
                     /db_xref="GeneID:40386220"
                     /translation="MAASGIIIGSNKGHKVEAKAVPARQSFKKGSKSQRTTFVRSLIR
                     EVAGLAPYERRVVELIRNAGEKRAKKFAKKRLGTQKRALAKVEEMNAIIAQSRKH"
     gene            <876882..>877565
                     /locus_tag="C5L36_0E04170"
                     /db_xref="GeneID:40386221"
     mRNA            <876882..>877565
                     /locus_tag="C5L36_0E04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467978.1"
                     /db_xref="GeneID:40386221"
     CDS             876882..877565
                     /locus_tag="C5L36_0E04170"
                     /note="PKUD0E04170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323838.1"
                     /db_xref="GeneID:40386221"
                     /translation="MYKQVARLQAVARYSTEPKAAPPSFFHNQSVIPLKHGEAVKEAT
                     VAPDTVESGPKAMSLAAPAAPAAPLKPPTVFGGTSNGRDSQDYFSSYKEFCRGMAYLG
                     VGIGVVYFMFDQHERLDESERHMKVMRKKQRELATQMQTYKSKLNKMAVENAKKNVLV
                     QGKMQMHIALLRQQLEKAGMKPVSIEEAIDKFQESVKVEVVGNAVSLWVPGEDDIKRS
                     IPDPHEYKK"
     gene            complement(<878261..>878506)
                     /locus_tag="C5L36_0E04180"
                     /db_xref="GeneID:40386222"
     mRNA            complement(<878261..>878506)
                     /locus_tag="C5L36_0E04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467979.1"
                     /db_xref="GeneID:40386222"
     CDS             complement(878261..878506)
                     /locus_tag="C5L36_0E04180"
                     /inference="similar to AA sequence:RefSeq:NP_878145.1"
                     /note="PKUD0E04180; similar to Saccharomyces cerevisiae
                     YMR194C-B (CMC4); ancestral locus Anc_6.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323839.1"
                     /db_xref="GeneID:40386222"
                     /translation="MSSTCTDPCKPQACAIQACLKRHGYDESKCTVLIDSLYECCSNF
                     YRENGQEARSPCCPVPRLLEFKVEQRKQEQLDAKLIR"
     gene            <879129..>880121
                     /locus_tag="C5L36_0E04190"
                     /db_xref="GeneID:40386223"
     mRNA            <879129..>880121
                     /locus_tag="C5L36_0E04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467980.1"
                     /db_xref="GeneID:40386223"
     CDS             879129..880121
                     /locus_tag="C5L36_0E04190"
                     /note="PKUD0E04190; Pfam Domains: PQ-loop(1.9e-35)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323840.1"
                     /db_xref="GeneID:40386223"
                     /translation="MLDILADHISPSPLREQLSSVFGSISFACWLILMVPQLVEQWRL
                     KTVEGISPFFLLMWASGDVFNFLGAIWGGLLPEVILIAFWFLFADFGTLAFYFYISKY
                     YDHAKHGKHGKLHHHHLNHSNTEVVESTPLNVPGDLEYGVLGDDSGIHHSNATDDHHN
                     IDNHNHNHHHHHNERRKSSTIEDVVYEPERHSVFVRIVLPLLLVIAAGTFGSILSPNA
                     SVSSLTNGSSTATANDLVPQICGYLSAILYLTARFPQIYHNYKKQSTEGLSLLFFLLT
                     MLGNITYSLQIFAYSTDPQYIMLNMSWLLGSAGTIVEDLIIVAQFYMYRNNHNL"
     gene            <880330..>881646
                     /locus_tag="C5L36_0E04200"
                     /db_xref="GeneID:40386224"
     mRNA            <880330..>881646
                     /locus_tag="C5L36_0E04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467981.1"
                     /db_xref="GeneID:40386224"
     CDS             880330..881646
                     /locus_tag="C5L36_0E04200"
                     /inference="similar to AA sequence:RefSeq:NP_009467.1"
                     /note="PKUD0E04200; similar to Saccharomyces cerevisiae
                     YBL086C; ancestral locus Anc_7.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323841.1"
                     /db_xref="GeneID:40386224"
                     /translation="MDKLFKDNASGRKLSFGVELEVKELVNVPLFDNTECFMVCTVTN
                     EKLKYNYKHKNIHSSSYTSNPVLVKGHRVKFGQNGEYKNQFNIHAYSSKDSILADKWL
                     SISFLTRIEGNDRTDLLGSTWVNLSEYVNERDEKIFRKLLDQSKTNTIVNMSLILRHL
                     SNDGDKTYRAKSQLPTPIPTAARKPHLNTSIIESLCESQANDHPPSPRSPTMSFSKSH
                     RLSVPPPKPVSPSKNDLSTSGSLLNGVLNHQHSMALSSPRELSKPYDNNLQQIMNEAC
                     ESAIEGSTLLDELMNKIYRFTWEAKTTSYEEYTPAECVIDIVERNGSGWRKNEEGLNY
                     IDVINNEFKESNQKQQKMMAGDYEDLNFTSDDDDDDDDNDNGGDSDLKKGVLGRASDS
                     LDSYDQFYSYYKDSAKRKNRTIRFKPLTEAEVREDLRSWHISVKDC"
     gene            complement(<881666..>883471)
                     /locus_tag="C5L36_0E04210"
                     /db_xref="GeneID:40386225"
     mRNA            complement(<881666..>883471)
                     /locus_tag="C5L36_0E04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467982.1"
                     /db_xref="GeneID:40386225"
     CDS             complement(881666..883471)
                     /locus_tag="C5L36_0E04210"
                     /note="PKUD0E04210; Pfam Domains: GDA1_CD39(2.4e-49)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323842.1"
                     /db_xref="GeneID:40386225"
                     /translation="MDKGMGVDMDAFKNYIVVVDVGSKGTRAHVYAWSSIREKLLETS
                     GGGGDVKVKLSFPTLEYVKNASKKVKPGIHEYVAENGVDEDDIRRYLDHLLGKTLQNV
                     PREQHYRTPIFFHSTAGIRTLNLEAQNDLMEEICSYLKEYTDFFIPDCKSHINVLPGE
                     IEGLYSWITLNYLLRGNDDDSVESGDKSSFGMLQLGGGSTQICYEDNKDYTLDLVLDD
                     TYNLYSTSFLGFGLKQLHEQYLETLVISNTDVDPCLPRGEELRTTISGEKYLIKGSGD
                     FNQCRDKIYNQIIKNIENCSEYLSNADPNTFQISSCILDSKLDLDQFIAISGFSDTIK
                     KLADWSDISLDETNNGMVYNSQRLLQSTIDLCNSPIQNVENDEINLCFNSVYVFSLLH
                     SGFGLGLDESITINDEFKNFKFTWTYGRALLYAYDDAKREYDEFYDIIDDTKQIGYKY
                     KLSPTKFIKGSEQSGIEPRPSFEMQSSYPTFTSPPTSPSTGSSNEEFDDLEENVSVPS
                     HSKYGLIFTIILVIMFCLLPLTRNFIAQLLRKLKIKLLGFKSLNASRKSTMNNQQDLE
                     MFSLDNDLENNEIDEFNVSDQEDWDNDSDGIERAL"
     gene            <883752..>884231
                     /locus_tag="C5L36_0E04220"
                     /db_xref="GeneID:40386226"
     mRNA            <883752..>884231
                     /locus_tag="C5L36_0E04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467983.1"
                     /db_xref="GeneID:40386226"
     CDS             883752..884231
                     /locus_tag="C5L36_0E04220"
                     /inference="similar to AA sequence:RefSeq:NP_010463.1"
                     /note="PKUD0E04220; similar to Saccharomyces cerevisiae
                     YDR178W (SDH4) and YLR164W (SHH4); ancestral locus
                     Anc_8.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323843.1"
                     /db_xref="GeneID:40386226"
                     /translation="MLSASRVGLGVSRHTFIRQSPVLVASRGFFKTIPQPPGNIVGTV
                     NDAYVPPPPNKMHGSLHWTFERVVTIGMAPLIVAPLVTGHSPLDGAMAGLLLYHCYAG
                     FQSCIIDYIPKRVYGGMHTAAMALLTFGTFVAGYGIYKIETEEKDGVYGLLKKLWKA"
     gene            complement(<884825..>886816)
                     /locus_tag="C5L36_0E04230"
                     /db_xref="GeneID:40386227"
     mRNA            complement(<884825..>886816)
                     /locus_tag="C5L36_0E04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467984.1"
                     /db_xref="GeneID:40386227"
     CDS             complement(884825..886816)
                     /locus_tag="C5L36_0E04230"
                     /inference="similar to AA sequence:RefSeq:NP_010461.3"
                     /note="PKUD0E04230; similar to Saccharomyces cerevisiae
                     YDR176W (NGG1); ancestral locus Anc_8.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323844.1"
                     /db_xref="GeneID:40386227"
                     /translation="MNLSMNLGMKFNLDFNTLNAALTSCQLTMPPTRRRRTQASSPPP
                     PLQPSSSAKPAPSPPQVSASGRPRVKGRPPLKQTAPSSLPPIPLAPSNVKRENGLPAS
                     LPQIPKKQQHLQQQQLQQSAPLPQPPDRKSFWDILKTGDDVSKMKDPLNELFGLILDE
                     LRSRNVEESVISNIGKIKVKEEVEEEKAIVKEREEGNEDDDENIRPRKKIKLKLETEP
                     EFEPDNAEESEIPSVYRPENPSALQDIDMGKLMKDADQLGLYDDEKARLKYKDEEEFL
                     KCKFAVASFPKNDLQDMLPGVIPMTDFSGPKPTQQVAWNSWLSYIEPFFRNFNDEDLK
                     FLKSEFIAPLYLSKYLNIPPSERKSDTLLNPNYIPPLGPKYSEVWSLENEGKNVKVSR
                     LSQSLSNKLKKLNAGKGNSENLPSSIEEPDKVSCGPLTSRIISGLVDDDDNDFGELSH
                     EMNEEETINFEKLESRLNLELKYIGIFMNVIQTLNDDSWEQDWSLHQEDDEICFQLRK
                     LQNDLHDVEKKNNFRKSKIIPIIEEHIAWQEYISIVDDLDKQVEQYYRRRINVLPRKH
                     KKKNHNHDEKDEQVNIVSNASFKGLLDKRSRWIEKIGSLFKSNLEMRRMPSESIFKEN
                     EGEPNEEENEDSEEENDEEEEEAENDDDEEQEEENDNGG"
     gene            complement(<887501..>888424)
                     /locus_tag="C5L36_0E04240"
                     /db_xref="GeneID:40386228"
     mRNA            complement(<887501..>888424)
                     /locus_tag="C5L36_0E04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467985.1"
                     /db_xref="GeneID:40386228"
     CDS             complement(887501..888424)
                     /locus_tag="C5L36_0E04240"
                     /inference="similar to AA sequence:RefSeq:NP_010460.1"
                     /note="PKUD0E04240; similar to Saccharomyces cerevisiae
                     YDR175C (RSM24); ancestral locus Anc_8.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323845.1"
                     /db_xref="GeneID:40386228"
                     /translation="MFRAVKRFYSSQASSIDAQLARLSKESKISLTSQELIDRPQLWK
                     GLPPSTVVELYRARVISQGKNYKRSEDELKAILSCASNPLEAQTLYGIYNSTEGDIYK
                     ADSETDYENYIVEGEYMEDPLEPYGFDEYPTSAQDIVRDFRDLLEFNRKAAYELPQLA
                     KFRKAYKPSENTPVTYKYTRFIGESHPGERKVVLSLKLKDLNLSPLAEHKFKLLSGPR
                     YNHKTDVFLISSDNYLEPAQNASFLSTVLNDLVNEANNNPEEFAELPLDKRHTNSIYK
                     KKQTRGKRTIPFPKEWEQKQSPDDIKVSIKN"
     gene            <888786..>889451
                     /locus_tag="C5L36_0E04250"
                     /db_xref="GeneID:40386229"
     mRNA            <888786..>889451
                     /locus_tag="C5L36_0E04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467986.1"
                     /db_xref="GeneID:40386229"
     CDS             888786..889451
                     /locus_tag="C5L36_0E04250"
                     /note="PKUD0E04250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323846.1"
                     /db_xref="GeneID:40386229"
                     /translation="MMREMDGRDRLWEAINRENGDENTIRKDNIVMREALMRFLGATG
                     RGEEKRVGVQRSQHYAVNVEDKYARDGCEIKDESEDDLEYNDDEDFDLEYVSKSNDIR
                     RVPPEFVSYKGESHEESIGEVAARYNVSKSIIGPVLHTIRSIDKRWRSKRNDRVRKRV
                     RNVVKPRERRRSEVARPKQGPEEPKDVFHTEGDTNRKGAGINTIGETLFKMMEDVEDE
                     MFV"
     gene            complement(<889739..>890407)
                     /locus_tag="C5L36_0E04260"
                     /db_xref="GeneID:40386230"
     mRNA            complement(<889739..>890407)
                     /locus_tag="C5L36_0E04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467987.1"
                     /db_xref="GeneID:40386230"
     CDS             complement(889739..890407)
                     /locus_tag="C5L36_0E04260"
                     /inference="similar to AA sequence:RefSeq:NP_010459.1"
                     /note="PKUD0E04260; similar to Saccharomyces cerevisiae
                     YDR174W (HMO1); ancestral locus Anc_8.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323847.1"
                     /db_xref="GeneID:40386230"
                     /translation="MADELKTVKDSLVASLFALSKAANEVSKNIIDLNNLVDTSVSSS
                     SSSSATSSLSNSRRLKKKNDIEAYDVVEDVPHDELLAPHVIEKKVRKRKAIKDPNAPK
                     KPLTSYILFFNSLRSQVAEKNTGMSQTEIAKLISQQWKEMPDEEKAYWRGLYEKEKVR
                     YDSEMSKYNASKLPDLTDIDHGNIDIDDIIIPELDMDNHGGLDQDEPKKKKSKKSKKV
                     KKDE"
     gene            <891132..>891836
                     /locus_tag="C5L36_0E04270"
                     /db_xref="GeneID:40386231"
     mRNA            <891132..>891836
                     /locus_tag="C5L36_0E04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467988.1"
                     /db_xref="GeneID:40386231"
     CDS             891132..891836
                     /locus_tag="C5L36_0E04270"
                     /inference="similar to AA sequence:RefSeq:NP_013347.1"
                     /note="PKUD0E04270; similar to Saccharomyces cerevisiae
                     YLR246W (ERF2); ancestral locus Anc_8.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323848.1"
                     /db_xref="GeneID:40386231"
                     /translation="MWRMHALATRHALAGTCALALAPLVGFLVGIAHTYWEISRSIPI
                     ITLYLWSLTFYSLIKSAIPCRGIPRDIHIIDIKDSKEIPLVYNTCNFSKYCHTCNVWR
                     PHRAAHCSKCNCCFPQCDHHCPWLNNCIHYQNYRYFITFLLMGNSTMLLLMVLSFLKI
                     HLDGIHSSKWALANGILISLTWPYMALLLGFHIWLGEKGITTREFFAKSPKRSWCLTD
                     ADHGLQNISMQWFHGN"
     gene            <892008..>892835
                     /locus_tag="C5L36_0E04280"
                     /db_xref="GeneID:40386232"
     mRNA            <892008..>892835
                     /locus_tag="C5L36_0E04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467989.1"
                     /db_xref="GeneID:40386232"
     CDS             892008..892835
                     /locus_tag="C5L36_0E04280"
                     /inference="similar to AA sequence:RefSeq:NP_013269.1"
                     /note="PKUD0E04280; similar to Saccharomyces cerevisiae
                     YLR168C (UPS2) and YDR185C (UPS3); ancestral locus
                     Anc_8.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323849.1"
                     /db_xref="GeneID:40386232"
                     /translation="MKEFNQTLVFDYPWDYVSAANWRKYPNKMSTHVVAVDVLNREFD
                     PIQQTLLTERLIKCEQNIPSWLQVIIPNVNVSYVREVSIINLQNQTLTMRSINLTMKN
                     LLKVYETVQYEPASDPNKTTFTQCARLSSNQPWIGPKIESWALATFAQNAAKGKMGFD
                     SVLQLGLLPNLIEDLNNRKDDILDDIEKVSSKIIDEIKSCNAFKDINNISLDVLKDLT
                     IDANKKLQLPDKDITDEILETLNLHRILVNNAISHHTSEIIRQLQVQISKIFSNEKD"
     gene            <893153..>896338
                     /locus_tag="C5L36_0E04290"
                     /db_xref="GeneID:40386233"
     mRNA            <893153..>896338
                     /locus_tag="C5L36_0E04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467990.1"
                     /db_xref="GeneID:40386233"
     CDS             893153..896338
                     /locus_tag="C5L36_0E04290"
                     /inference="similar to AA sequence:RefSeq:NP_012625.5"
                     /note="PKUD0E04290; similar to Saccharomyces cerevisiae
                     YJR092W (BUD4); ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323850.1"
                     /db_xref="GeneID:40386233"
                     /translation="MSLNDILAAANQSVDDLINQLETIHPSSESDSSMTTEPLNVDDS
                     VVALEQPVHPIGPKPYVSPHKGKPLPAIQFSPSDYSIKSMPNLNYSDSDEETVVQSPV
                     QQHHPNFNRNESMKSTISTNVKLDTIIVNDSIESEEPTREDVKLSHQHKRSSSLSDFV
                     GGIIRSFSSNHIQSRNFSSATGNTVFESAEEGYDEEDEDGKYDDDNVHGDKEFQNENS
                     MDEDNADQEHVEMGIDEHKEREDSFDSPSSQYSEDSMANETIQNDTINNAPLDMFEEE
                     IEKSVVENTEIESLHGDFQLDLPFEDDIFDTEFIEFNRKLNSRNSSNTSASTTSNRIV
                     SIERGEQQELLNIWSKQKNYNVPIKKHVEFDSIHTPIKKSLIVNTSNPKSVHILNSNS
                     IYDKLEVLPVGVKGYHHVQVRSVNDAVSDNESSHSVIKYDINDEPEELSLQLQDLTVD
                     LSADSETSIQKEIANWDPKPEPNFHHERNKSSIDVLKSVWSENDRESSQLSNDFLYQL
                     THSDTFHRLNKKNIESYLYKETDFEADNVRLMPPPQHQQIYQFNQNESMSRIVPGLGI
                     SEGVLEYEDDDNVDDIDTIGSIHTSLKPIEFEQQQKSPISPAREKMIAHFQQQLRQKK
                     EQESHRELQHQLQSQIHQHAKSVQSSPVKPIKFEHKKVNKSYDPNNDSVDDIFEEFAE
                     SPSKSKQNISHYAIDDDQLNPFLEPTPKPVTATLADSNSHSEHQVEQAKVLEGRLFLR
                     IHDINSLKLPELEKRNAKFQLNIDNGIHCIKTEFISSKNGVIPIDKEFELIVKDKLDV
                     IITIKVKYDKPVGKTVEVVSERKVKSKSKFGRLLGKTEVEKVRRKVQQPPEKDLIAEY
                     TGNDGSCGKLKITFSEYHDKIHGKPATFSLTCFNEWKTTVSKSGSVVNKEPTPICSCR
                     IQMLYIPKTLENETLPVSISNAMHQLKEVRKLGNLSHQGIMTQIGGDVKLMTRRSFKL
                     EKHDLLAYNLENHKLKAKINLKKVTDILTLPNNEFIIKFANQETISFTCDTSQEREAW
                     VRSLKESMTIHLLMKQPWLKTVMVSMDGIAV"
     gene            <896629..>897762
                     /locus_tag="C5L36_0E04300"
                     /db_xref="GeneID:40386234"
     mRNA            <896629..>897762
                     /locus_tag="C5L36_0E04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467991.1"
                     /db_xref="GeneID:40386234"
     CDS             896629..897762
                     /locus_tag="C5L36_0E04300"
                     /note="PKUD0E04300; Pfam Domains: TauD(1.5e-15)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323851.1"
                     /db_xref="GeneID:40386234"
                     /translation="MTSDTIKVTPLQGRKLGAQITMPSYTTDPSKLNESDFKQLKKAL
                     LEHSVLIIPGMEGLKPESQHALNVRFDPSSATNYGHKEELFHSSKSILAKDGKCVPRR
                     PEVMMVGNGSFEAGHEGMKEFTLEHPTHKTFHKQLLTNDEMANKQTRFYRWHIDAALY
                     ELSPPVVTTLLGLIVPPSNDRQTIIYEDTNESIDIAKGATAFASGKVAFDLLSKDQQE
                     QALNTIVEYAPHPYIYINDCKATSDGLTIVSEEPGKEASLDSLPEWEESKIKRLPLVW
                     TNPETGNHHLQVHGCCVYKLLDATTGKTIADLKEAREIVHKMMRPAISPENIYCHAWN
                     QGDLCIFHNRGVIHSVTGELDPSEKRLMHQCNIASGSDPEVVL"
     gene            complement(<898108..>899232)
                     /locus_tag="C5L36_0E04310"
                     /db_xref="GeneID:40386235"
     mRNA            complement(<898108..>899232)
                     /locus_tag="C5L36_0E04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467992.1"
                     /db_xref="GeneID:40386235"
     CDS             complement(898108..899232)
                     /locus_tag="C5L36_0E04310"
                     /inference="similar to AA sequence:RefSeq:NP_012626.1"
                     /note="PKUD0E04310; similar to Saccharomyces cerevisiae
                     YJR093C (FIP1); ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323852.1"
                     /db_xref="GeneID:40386235"
                     /translation="MDDDDAFLYGSDTENIDLKEANNLEPNVDAIKTDENTINPSSKE
                     IALHESKNDEMEVGSSKDGGESKSSDANDDSDSDSDSDSDVEFIIGSLNKPPPVVIPE
                     LLETRKDEEENNEEDKKNDAEEAAAPSGMVQIKTVPVFTTSPNGINIDKVGMYNDIPI
                     TEVSLDELKDKPWRLPGADMSDYFNYGFDEVTWRAYCAKHERLQQEINANKMFPFNPT
                     GNSGTAGGSMPFMMGMPGFMGMPGLSNMPGMPKMPNMGMNNMLNSNNSSNNNVSMNNG
                     GTTNNTTTSSNLNSKLPNIPNIPNKPNLPNNPNLNTRTASATPEQSYANLRNQRENDR
                     DDKGNWRDRDRGRDDRRDDRRDDRWDDDRGPAPKRRRRRR"
     gene            <899600..>900303
                     /locus_tag="C5L36_0E04320"
                     /db_xref="GeneID:40386236"
     mRNA            join(<899600..899601,900027..>900303)
                     /locus_tag="C5L36_0E04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467993.1"
                     /db_xref="GeneID:40386236"
     CDS             join(899600..899601,900027..900303)
                     /locus_tag="C5L36_0E04320"
                     /inference="similar to AA sequence:RefSeq:NP_012628.3"
                     /note="PKUD0E04320; similar to Saccharomyces cerevisiae
                     YJR094W-A (RPL43B) and YPR043W (RPL43A); ancestral locus
                     Anc_7.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323853.1"
                     /db_xref="GeneID:40386236"
                     /translation="MAKRTKKVGITGKYGIRYGSSLRRQCKKLEIQQHAKYDCSFCGK
                     KTVRRDATGIWTCKSCKKSVAGGAYTVSTAAAATIRSTIRRLRELAEA"
     gene            complement(902493..902611)
                     /locus_tag="C5L36_0Etrna9I"
                     /db_xref="GeneID:40386419"
     tRNA            complement(join(902493..902529,902573..902611))
                     /locus_tag="C5L36_0Etrna9I"
                     /product="tRNA-Ile"
                     /note="PKUD0Etrna9I; codon recognized: AUA"
                     /db_xref="GeneID:40386419"
     gene            <904770..>907931
                     /locus_tag="C5L36_0E04330"
                     /db_xref="GeneID:40386237"
     mRNA            <904770..>907931
                     /locus_tag="C5L36_0E04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467994.1"
                     /db_xref="GeneID:40386237"
     CDS             904770..907931
                     /locus_tag="C5L36_0E04330"
                     /inference="similar to AA sequence:RefSeq:NP_010078.1"
                     /note="PKUD0E04330; similar to Saccharomyces cerevisiae
                     YDL203C (ACK1); ancestral locus Anc_8.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323854.1"
                     /db_xref="GeneID:40386237"
                     /translation="MKKSQIRANLLNENSVFPQQSNVETPPGNSSYTQNCVYSQQDHP
                     SGRQHYNQPQPMRYVNHPLAQNSFQEAYYQPNQPIQAHRKQRQSSRQHQQPPPHHQVQ
                     PQPQQPPLQAQPPQHIYNTGYHQGQSQGPSYVQPQVQPSIVPHSAHSSEATQQSAYHH
                     SYQSQQSHLQPQPQIHRGSHRSHEVFPVSDEQPYYQEQRGSYSGPYQSHPHNRRSDIH
                     EYYDEPALEPVQPTPQPPIPVAPMIPPIQNGGRIPSESHSRPLRAKDQVFTIDSDEED
                     DKVHKSKSKAEVDKIQLLEEKIQRLERVLALQELTSKKSSNNINHDAAESSNNDNNNN
                     NNMKGDEVGKEAFVSSSQYVENSKGSSINGLEKLSGPPLPPPPPPEKRSLSSSPKANL
                     FTTENSRVDSHFDASMRMSASSLIPTDKSISDQSVGDEGDLEAEYNNDDDNDEPPPSY
                     EELEKSGSLTYSQSIYRTGFEKAGYQMDHVATPLTPKDKSKPRDESDEVDKVDDETMK
                     FSTRLMSKRKIPSQITDDMFEKAALRISSQKDSSDINNKHEDKVPAPRVKTEKTIQTP
                     IKMTIQEPTQEPILTKTEESVRSKARSATKPIEPSNFIKYSTPSSYETLSNGVIQPIL
                     PSKCSDSVETSISAFRRTREKALADYKQFTPSIQFNWAILLLETLSKSEVISQMTIDG
                     KIRKNPLPFKKLKKQRLMFLSTAIKVLEKLIQVAPNDTRARLYLGDIYSGGIHPGLVE
                     RDERIGYELFFESAMQQNDPVACYRIACCLESGVGCKQDIPKSILFFEKGATLGDPSS
                     MCQLGMMHFAGVNGCIQDVSLSISYHKQAYETLRSKSVMGSDPLISTRSFQDARGALY
                     TLAKLHQTDSKILCLSDRSDPKTLKTIQELKDCNAWCNKGKALKYYLEAAKLGHNESQ
                     ACLGYYYSQGFFPTHSFKSDKESNEGIMDPIDARKSIYWFSKAAADGHTYAALGLARW
                     YGAGAVDSDGRVILKRDEQQAFLWGRKAADGGELVEAEFMIGVCFEQGYGVEKNLVMA
                     ANYYERSAMKGYKKAIAKLKALR"
     gene            complement(<908353..>909357)
                     /locus_tag="C5L36_0E04340"
                     /db_xref="GeneID:40386238"
     mRNA            complement(<908353..>909357)
                     /locus_tag="C5L36_0E04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467995.1"
                     /db_xref="GeneID:40386238"
     CDS             complement(908353..909357)
                     /locus_tag="C5L36_0E04340"
                     /inference="similar to AA sequence:RefSeq:NP_012838.1"
                     /note="PKUD0E04340; similar to Saccharomyces cerevisiae
                     YKL085W (MDH1); ancestral locus Anc_2.641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323855.1"
                     /db_xref="GeneID:40386238"
                     /translation="MFSRISARQFSSSAASAYKVTVLGAAGGIGQPLSLLMKLNHKVT
                     NLSLYDLRLGAGVATDLSHIPTNSVVKGYGPENNGLKDALTGSDVVLIPAGVPRKPGM
                     TRDDLFNTNASIVRDLAKAAADHCPNAVLLIISNPVNSTVPIVAEVLKSKGVYNPKKL
                     FGVTTLDVLRSSRFLSEVVNTDPTTETVTVVGGHSGVTIVPLISQTKHKDLPKETYEA
                     LVHRIQFGGDEVVKAKDGAGSATLSMAQAGARMASSVLKGLAGEVDIVEPTFIDSPLF
                     KSEGVEFFSSRVTLGPEGVQEVHPLGVLSTAEEEMVATAKETLKKNIQKGVDFVKANP
                     "
     gene            <909956..>912067
                     /locus_tag="C5L36_0E04350"
                     /db_xref="GeneID:40386239"
     mRNA            <909956..>912067
                     /locus_tag="C5L36_0E04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467996.1"
                     /db_xref="GeneID:40386239"
     CDS             909956..912067
                     /locus_tag="C5L36_0E04350"
                     /note="PKUD0E04350; Pfam Domains: RINT1_TIP1(1.7e-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323856.1"
                     /db_xref="GeneID:40386239"
                     /translation="MNTSIHYREPCATTRLLNERVATVAALAGVDDVCVHLSSACRPQ
                     DEDTVSTNSTAATATATATAAATAAASSDGYWNNEGEVDDTLKTLLEEKAQIMGQIKT
                     LHCNRAKRVRERVLQIVQTFDSSVSKEAIMGVRSDATLGGVGGDGIEDVGEVEEIVGR
                     VRDDVVDVVGHWEEGGEVSEDGVRKFGLFVELQMQIQLLISLEEELTKEREEVEGEGE
                     VEGAEYPQGIGNTPKLEGPGGTFWAIDAILTHFSKQFVFHFQGEGETNRLDKPEFALN
                     YVLLYLRNKLSLAKSVFAHSFATVVAHYGGIHGSFSTWFIKSILRLLTNKFGLEVNNL
                     VLHSNHHLLSHLVLELKKFDWALKNEFNYIPHAGEEWNGLTNDLILCHTKVWNVWLQS
                     EKDFVNGRFDEIINMDDAWQLDYDIVENGYTKPTKSSINLVNLLKSITFNYQSLPLKF
                     QLKFLSEVQLKLLNFYFDTLKKGYYALKHIKTVQVDGVSTLERICRVWCSSNYIIETL
                     DKWGDELIFIELWQSLNNREDDFKSTFFDSVINGYRLEIVNKIPKLITNYFDVQFNRI
                     MKDYFQENADWINVMGNSLSVSTSVSSALDFIVATLAKDLQFLQRTVSTQTYEAWKLL
                     VSERLANYIERNIIMANTFSIDGALKLQSHVEQIYHSLNLPRCYLSHGKLMASIEVLK
                     GNHPSYPLNEMTVSMLVNRRG"
     gene            <912218..>914806
                     /locus_tag="C5L36_0E04360"
                     /db_xref="GeneID:40386240"
     mRNA            <912218..>914806
                     /locus_tag="C5L36_0E04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467997.1"
                     /db_xref="GeneID:40386240"
     CDS             912218..914806
                     /locus_tag="C5L36_0E04360"
                     /inference="similar to AA sequence:RefSeq:NP_010728.1"
                     /note="PKUD0E04360; similar to Saccharomyces cerevisiae
                     YDR440W (DOT1); ancestral locus Anc_5.556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323857.1"
                     /db_xref="GeneID:40386240"
                     /translation="MVKEIQEETLDEDLWNHNINIGRNILFFSLSFPSSYSCLFILFS
                     FTESFLHRAIVYLSSVMTVSMPPTNVNMNTVPLSPAESANGHLECKAMATATVGDVSG
                     SGRGNEDISGDGSISGDGNIHGVGSISGNGSIHGVENTSGDGNISGNGSISGNGSIHG
                     VENTSANPATTPAVKKRKVTNELAQLLTSAEWYTQTFRGSRVRESSLKFQKQKDLKIQ
                     EMIRGDKEVTMTTHTLETPEEIAEKERIRKERAEKMKAKAEERKKEKELKRLKALERK
                     RLIEQGVIKPHRVKSKSKQDAVGEINLDPNELKSSKNYYGGGHLAELLKASSYYTNLG
                     SQFDGSRRKVRPVERLNEDKEYLNELNRKSKGKRLLKNKAADHPKLKRLKTVDNTTMR
                     RHTKKVANIKAEEGEKEEVDKLEKETKEEEETRDEVTQREPEPIWFINLNENKNDIEI
                     NDTRSFFQSFVYDKQNDSQIPSDIVSAADLVKRRIKTYRTDHEVYKLQRVQLHFPFSE
                     YKEDYILALPKDELQFNPFDEIGKNMEILSTQFFPPDESVKVVNLQDPENCIVGKYIK
                     AFDDNDLDLLLKCIDEFNNLIDELRNNGKILDHVINKKAFSICVIYELLNQCYLRRVL
                     PDSKKLSNYKAFSNEVYGELMPAFLSSVYRACNLNSRSCFIDLGSGVGNCVIQASLEF
                     GCESYGVEIVEHASRLGDLQLAEFNNRCRVLGLNPGITKLFSQQSFIDNPPVKAVVDR
                     CDVILCNNYLFDANLNKKVIDLFQDLKVGCKIISLKPIVPAGHRLDGNNINSILNKMK
                     TSKFIYEENSVSWTSKGGFYYITEVMDTMDEALFRIRATRSRREDSIDERTRSNTPLN
                     AFTNNV"
     gene            <915281..>915862
                     /locus_tag="C5L36_0E04370"
                     /db_xref="GeneID:40386241"
     mRNA            <915281..>915862
                     /locus_tag="C5L36_0E04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467998.1"
                     /db_xref="GeneID:40386241"
     CDS             915281..915862
                     /locus_tag="C5L36_0E04370"
                     /inference="similar to AA sequence:RefSeq:NP_010729.3"
                     /note="PKUD0E04370; similar to Saccharomyces cerevisiae
                     YDR441C (APT2) and YML022W (APT1); ancestral locus
                     Anc_5.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323858.1"
                     /db_xref="GeneID:40386241"
                     /translation="MHENKELQALANELRSALHQYPNFPTEGVLFEDFLPLFRSPHLF
                     NKLIVAFKLYIEENFDQTIDYIVGLESRGFLFGPTLALALDAGFIPIRKAGKLPGDVY
                     KVGYTKEYGEDFFEIQQEAIPEGANVLIVDDILATGGSAHAGGELVQKCKGNILGFCF
                     VMELDFLNGRDRLQAPTFTLLQGQPESLKESSV"
     gene            complement(<916038..>918521)
                     /locus_tag="C5L36_0E04380"
                     /db_xref="GeneID:40386242"
     mRNA            complement(<916038..>918521)
                     /locus_tag="C5L36_0E04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029467999.1"
                     /db_xref="GeneID:40386242"
     CDS             complement(916038..918521)
                     /locus_tag="C5L36_0E04380"
                     /inference="similar to AA sequence:RefSeq:NP_014643.1"
                     /note="PKUD0E04380; similar to Saccharomyces cerevisiae
                     YOR001W (RRP6); ancestral locus Anc_6.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323859.1"
                     /db_xref="GeneID:40386242"
                     /translation="MSEPVRSKADVLLEQYAPLLKNLIRFSSAVNAKDIKFYKSLEPR
                     ISDEAEEIDANLVGIMNEMVISASTINATPNEGERFKVDSDAENTKVLSNVLDTLLER
                     VELNLDNHYRARKNTRPSRVSAQLDINDDGYTYLDKNDMNNPNSGHSLPARSNPNMDK
                     PQAKFLDPIDNFEKTPFKPLIKFKPNAMKPLDESLQLVEATDEIPEHYENPYSYEIMN
                     AEYPSWILEPVPLDERYESIPWEGSPAAEWIDSPEQLSKLLIELNKCKVFAIDLEHHD
                     YRTYHGLTSLMQITTDSKKDYLIDPLSPQLRPHLPMLNEAFTNPNIVKVLHGAFMDVI
                     WLQRDLGLYLVSLFDTFHAAKQLSLGKYSLAFLLEEYVRFRTSKKWQLADWRIRPLSS
                     EMMDYAKADTHFLIEVFYKMHDELLKIPQALQKTLYASRKVAIRRFEYSTFRPKNLSM
                     SSNNAVVTTSYSVPLTDEVQKNLNLGYDRDLPWTSLIFSNNVAFERRPLLEILFKWRD
                     QEARKLDESSRFIMSDFMLISLINAFQIGHPENVNISSVMAVINKTSKFGGSFYVRKI
                     VKELTEVIKNAVIELEGVDLNELMQKIDDDKNELANQIEKEVNKYISEDAYENVKDVN
                     KLGQQFGHFIEFYNRTNPQVAHSDLKTNISTIEESSEDGLFSIKYGKNGKAEPIKNRD
                     INDRISKVVEFFTEEMGKSDVTYEIDQEDVEEFERKEMEPEQESKQQEINERDEIITL
                     RKKQSQSHNPRKRKMNEEVDLSIDFNKSIMNMGDEGLSRREKRNRKQEQNKPSFNPYG
                     TGMLEELNVPKLKKKKIVERGKNVVFKKK"
     gene            <918900..>920108
                     /locus_tag="C5L36_0E04390"
                     /db_xref="GeneID:40386243"
     mRNA            <918900..>920108
                     /locus_tag="C5L36_0E04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468000.1"
                     /db_xref="GeneID:40386243"
     CDS             918900..920108
                     /locus_tag="C5L36_0E04390"
                     /inference="similar to AA sequence:RefSeq:NP_010715.3"
                     /note="PKUD0E04390; similar to Saccharomyces cerevisiae
                     YDR427W (RPN9); ancestral locus Anc_5.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323860.1"
                     /db_xref="GeneID:40386243"
                     /translation="MAMQIDPDTALINIREEVENVDAELAGQFYSLEDYYERKLWYQL
                     SELLRTVIYKNPNSQGIRLKLFENFILSFGDKINQLQLVDFLVISLKDSTPQDSYEYL
                     NNLKQRVLKLGETKSHNTGDDDINDYEIIQALIYLDNELAKVKLDLGFVDEAVSIIDE
                     SEKKIDSLNVSVDNRVNASFYLVRAKLMKGKGDFNSFYYNSLLFLSCIPELEELQDKQ
                     LIVQDICISGLLGDKVFNFGEIIMHDIFQYLNDNWLKELLLSLNNGDLNTFNKLIANT
                     DALGQYKDIESRLDFLRQKVCIMAFIELVFNKPTTSRIIQYAEIMEKIPLLRTASEVE
                     YLVMRCASLKLVKALINQVEETVEVSWIQPRTMTLVQIENMKTKMETWNEKVTSLNAY
                     LGECGRELFV"
     gene            <920778..>922724
                     /locus_tag="C5L36_0E04400"
                     /db_xref="GeneID:40386244"
     mRNA            <920778..>922724
                     /locus_tag="C5L36_0E04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468001.1"
                     /db_xref="GeneID:40386244"
     CDS             920778..922724
                     /locus_tag="C5L36_0E04400"
                     /inference="similar to AA sequence:RefSeq:NP_013818.1"
                     /note="PKUD0E04400; similar to Saccharomyces cerevisiae
                     YMR100W (MUB1); ancestral locus Anc_2.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323861.1"
                     /db_xref="GeneID:40386244"
                     /translation="MKGPNGKSVILNRATVSISATVYDRRALDCTDDKALVNSLNHLT
                     FLTSSSAKVREAMIHDGAIERLIDILYECRDPKTKTEIAMFAWKWVLSLQCLVLAGTR
                     GSEQMRKKLVDAGIIPILATILDNHFLTRKNHSLNHDTSSSNSPASRNNYVGGNTTSN
                     TILTNTPTSADTPENFGSISNEDILITDTHDDNNTNHISHVLRHIRSVVDEADRTIFG
                     AQEEIDKFMTKSDSSLGNQLISKPRMLGEEEMELLNVVELIKCFQVLGDCDINSDYHK
                     IINEKFQSIDEDPFLSQELKRRLEITNLVNPSLDPFNNFMESHPLSQAIPRTFENGLI
                     LPATDDVIWSLQLLAFISKYSYLRYPLSSTYFINGLSFRSKNHPPPLETDCASTDFDE
                     LMNDSNDEPFTAVEFERSLGLSDSKYDILKGELEDKQTYQIRLIQEKRLENLKKLSNE
                     NDKNIVEDFVEILKTEDQVDKMVILERIRLNSNKIKHESLGKLRTKNKIIYRNKLKEY
                     SKKWDYDNSWDEFETPLEISSLIDKEIQPFVTLNIFPLIERFTVRSWFSEDICYWAAV
                     VVRNANRKDEKMGGRRQCAHFGCGKWEDHPKQFSKCRRCKRAKYCSRECQTKAWLFHK
                     HWCVPANQGTSAQQTISNTSNSEQ"
     gene            complement(<922911..>923855)
                     /locus_tag="C5L36_0E04410"
                     /db_xref="GeneID:40386245"
     mRNA            complement(<922911..>923855)
                     /locus_tag="C5L36_0E04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468002.1"
                     /db_xref="GeneID:40386245"
     CDS             complement(922911..923855)
                     /locus_tag="C5L36_0E04410"
                     /inference="similar to AA sequence:RefSeq:NP_012802.1"
                     /note="PKUD0E04410; similar to Saccharomyces cerevisiae
                     YKL120W (OAC1); ancestral locus Anc_2.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323862.1"
                     /db_xref="GeneID:40386245"
                     /translation="MVKDSASQKISTAGGFIAGGLAACGAVTFTNPIELVKTRMQLQG
                     ELAKTKGPKIYKNPLQALFLIYKNEGLRGIQKGLTCAYIYQIGLNGCRLGLYEPCRNI
                     INPIFYPNEDPRRVQNIPINIFAGALSGIAGAIIGSPMYLVKTRMQSYSSSIQIGEQT
                     HYKSVWDGLCSIYKAEGFTGLFRGVDAAILRTGAGSAAQLPLYNFTKHEMMKTDFFGT
                     GASLHLSASIVAGLGVGIVMNPWDVILTRVYNQKGDLYKGPIDCLLKTVKSEGLFALY
                     KGFGAQILRIGPHTVLTLMFMEQTMSLVYAVEKKILKA"
     gene            complement(<924336..>925850)
                     /locus_tag="C5L36_0E04420"
                     /db_xref="GeneID:40386246"
     mRNA            complement(<924336..>925850)
                     /locus_tag="C5L36_0E04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468003.1"
                     /db_xref="GeneID:40386246"
     CDS             complement(924336..925850)
                     /locus_tag="C5L36_0E04420"
                     /inference="similar to AA sequence:RefSeq:NP_013692.1"
                     /note="PKUD0E04420; similar to Saccharomyces cerevisiae
                     YML020W; ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323863.1"
                     /db_xref="GeneID:40386246"
                     /translation="MKLPSNPSRLMSSKPSSPPRPKKRTSSLVIDDEPSIGKDSHLFR
                     EDRNWKFWPRERAQSWSFWSNPPHVHLEATGGSLDNPRGNTTIKKDLENLVIPKLNNL
                     PLATTSVYLNHNYKRIRRVFGYSEKEQHLNRLPAPTPLKKVLIIGVHGFFPTKMLRPI
                     IGEPTGTSLKFATLGESAVLEWAREREMDVEIRKIALEKEGKIFNRVDFFFDILSQNK
                     SEIDESDFIFVCSHSQGTPVSIILIAKLLEYGIIDGSKKIGILGMAGINLGPFYGMDK
                     SLFVRAYSTIENESLLELFQFQNFESLQSRKYVESLKTLIKNNVKLVFIGSIDDQLVP
                     LYSSVAIHIHHPNIFRSIYIDNSTNTPDFLARILKLSCMLLNLGYSDHDVIKEISPSL
                     PGPITGGGHSKIYNELQVYKLALDFTLQTNSSSIAIDQPIKLKPFDIKKLGKLSNPFN
                     LPWCVRGLFFETKRKLPHGDEEIDNVFKEFDCWHPNSKALKDVKYRLNGIKAKL"
     gene            <926400..>927404
                     /locus_tag="C5L36_0E04430"
                     /db_xref="GeneID:40386247"
     mRNA            <926400..>927404
                     /locus_tag="C5L36_0E04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468004.1"
                     /db_xref="GeneID:40386247"
     CDS             926400..927404
                     /locus_tag="C5L36_0E04430"
                     /inference="similar to AA sequence:RefSeq:NP_013691.1"
                     /note="PKUD0E04430; similar to Saccharomyces cerevisiae
                     YML021C (UNG1); ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323864.1"
                     /db_xref="GeneID:40386247"
                     /translation="MTKREITDYFPSRKKAKSLSSETTPNSTPSTSTTPNSTPSTSTT
                     PNNKQPQPQPATPSPALELPHLSSPFKEEFVKTLTEHQKRLLQLEIDTIEPEWFKVLA
                     ERGLFTSESFLSLKEFLLGEIQRGKEIYPSSNDVYAWSRATPLKMVRVVIIGQDPYHN
                     KGQAHGLAFSVKDVNAKKPPSLANIFRGIHTDFPQLAKKGLPKHCDLSAWTHRGVLLL
                     NSVLTVEAHRANSHAKRGWEEFTSGVLEALLEFGPAHIVVMAWGKSAERTVRAVVARV
                     ERRTGGPVAGGRHLLLYGVHPSPLSAHRGFFSQGHFSKCVEWLRVHGYEDIDESFWEI
                     "
     gene            <928168..>929079
                     /locus_tag="C5L36_0E04440"
                     /db_xref="GeneID:40386248"
     mRNA            <928168..>929079
                     /locus_tag="C5L36_0E04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468005.1"
                     /db_xref="GeneID:40386248"
     CDS             928168..929079
                     /locus_tag="C5L36_0E04440"
                     /inference="similar to AA sequence:RefSeq:NP_010059.1"
                     /note="PKUD0E04440; similar to Saccharomyces cerevisiae
                     YDL222C (FMP45) and YNL194C (YNL194C); ancestral locus
                     Anc_2.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323865.1"
                     /db_xref="GeneID:40386248"
                     /translation="MNLRNTVTPLTASIAILFLLGTLLLYFLTVLSGATEHSILKRFY
                     WLQADCSKFPGAPFSGQCRWTNYAICAVVDGYNHNCIKSAAHPFSPKDNFSSTVGVPM
                     AFINNRNYYYYTSRIGYAFELVGISFLTFSLMALVVHLFTKFKVKLAFKGLFWSFYIL
                     AFVFTVISVALSTSAYAKGRQKFRDDGIEASLGTKTWAVAWTTVALMLINMPLLALAT
                     VEWNKGRDSFYSPDYYTTNKESYQEPLAVNPVPTSTGPWFKRRSATKNSSYSQQPPIS
                     ATPAIKEEVKAGAVPLDKHPADDTLQP"
     gene            complement(<929568..>930266)
                     /locus_tag="C5L36_0E04450"
                     /db_xref="GeneID:40386249"
     mRNA            complement(<929568..>930266)
                     /locus_tag="C5L36_0E04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468006.1"
                     /db_xref="GeneID:40386249"
     CDS             complement(929568..930266)
                     /locus_tag="C5L36_0E04450"
                     /inference="similar to AA sequence:RefSeq:NP_011497.1"
                     /note="PKUD0E04450; similar to Saccharomyces cerevisiae
                     YGL018C (JAC1); ancestral locus Anc_4.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323866.1"
                     /db_xref="GeneID:40386249"
                     /translation="MPGGEDDEEEEQEHTYIHKHIHIYKLDKKFLGFIMWRLTRNYTT
                     ARKTFFQMFPQTFPNGTSFKINPRTLRKEYRHLQSISHPDLKREANERVEGDGAAEAE
                     EGEDSSMINKAYETLMDPLKRAQYISKVEGGLDLGDDEVGKSLQFQDKEMLMEMMDVH
                     EMLESMSTEREAEEMRSANDRKIEEIVQQLEVCFNVKDWERFAMLAVRLKYCYNIKNV
                     LREWEAGKPINLTH"
     gene            <930829..>931218
                     /locus_tag="C5L36_0E04455"
                     /db_xref="GeneID:40386250"
     mRNA            join(<930829..930853,930992..>931218)
                     /locus_tag="C5L36_0E04455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468007.1"
                     /db_xref="GeneID:40386250"
     CDS             join(930829..930853,930992..931218)
                     /locus_tag="C5L36_0E04455"
                     /note="PKUD0E04455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323867.1"
                     /db_xref="GeneID:40386250"
                     /translation="MAGHFGRHLLHADKNVEKFSDFRENLIRHYKWNIKSAGIAVLFL
                     AAIPVGLSYIGYKYQDVNCIAKRRTTSIWQAENNWVPRS"
     gene            complement(<931621..>933216)
                     /locus_tag="C5L36_0E04460"
                     /db_xref="GeneID:40386251"
     mRNA            complement(join(<931621..933069,933208..>933216))
                     /locus_tag="C5L36_0E04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468008.1"
                     /db_xref="GeneID:40386251"
     CDS             complement(join(931621..933069,933208..933216))
                     /locus_tag="C5L36_0E04460"
                     /inference="similar to AA sequence:RefSeq:NP_015444.1"
                     /note="PKUD0E04460; similar to Saccharomyces cerevisiae
                     YPR119W (CLB2) and YGR108W (CLB1); ancestral locus
                     Anc_3.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323868.1"
                     /db_xref="GeneID:40386251"
                     /translation="MSRDIVQKQPVENTNTENVSQLIQRKGTDEGTGLRNNHAQRTAH
                     QQLERQVLTDIQGQNGSKKQFPVHSHGLHETTVQSNVQAQPQGSGIQKEEESGHLTAI
                     SGMSMCSPFYTSTVQYENTSLQANKSIKIKGDESLISERKDDVDRYRGTSLKRCAPVE
                     TEDELIEADQTQESKRLRLDTEENDEEEEDAGVVERIGISHDEQGWDDLDSGDFDDPL
                     MVSEYVQDIFEYLHELELRTLPNPNYLQMQRNLRPKMRSILVDWLVEVHLKFKLLPET
                     LYLSINIMDRFLSKELVQVDRLQLLATGSLFIAAKYEEVYSPSIKNYAYVTDGAFSED
                     EILGAERFILEILNFDMSYPNPMNFLRRISKADDYDVNTRTIGKYLLEITIIDHKFIG
                     YLPSLCCAGAMYISRKMIGKNDWNKNLIHYSGGYKAEDLEEVCIMIMDYLVSPIIHEE
                     FFKKYASRKFMKVSILARQWAKRLLNERKNIMEDI"
     gene            complement(<933618..>935978)
                     /locus_tag="C5L36_0E04470"
                     /db_xref="GeneID:40386252"
     mRNA            complement(<933618..>935978)
                     /locus_tag="C5L36_0E04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468009.1"
                     /db_xref="GeneID:40386252"
     CDS             complement(933618..935978)
                     /locus_tag="C5L36_0E04470"
                     /note="PKUD0E04470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323869.1"
                     /db_xref="GeneID:40386252"
                     /translation="MLTVSNTYKDTSSQGVLKMLGITTSMTRKRKATGKTVSSKEIPG
                     FSKWIASEVYIEDRIVESTLETLSLNMIENIDWMNNAMDDILYIGTADFEDLDNEESG
                     KVGIAERDEKIDENDKGIQNRKENDNGDENIKGNENDNKKDIEKKDRILNEHENENGN
                     QNENKNTNNNGEKDVNGYQHDSSMKNDKGNQKADVQSNISPVQPEGNSFLLLKSPRRY
                     RSPSSPIKESNRRQIEIIKNTTTLLVEQEHDIQATEYADGSNDSFDMIRNDIRKSFAA
                     KQKILELKTSPYKPDTKTSPSKNEKKSPEEEIKELSRLIDHASDGIFSDESDDTTLNL
                     KTLEKIELSQVKKKSSNGYKSPIKFSEMPMLEPLTLGSTRKKSIIKKTSLPRLKSRPS
                     GATPSHGMVFEERRLDDKRKSLRKSISDRKSLTLQLKPLPKDTFMSANTSTDEPTIKL
                     NRNFTKKVKQEREKHEKERYERVLMEKEKREKKRKEEEENERERERKKTIKEEKEKEN
                     KNPYKTPTQSTKTNSEKNDLISRLMQPTESSRRKSRHSTIGSPNKSAKTSTKTTPRHA
                     VSKLDSTSAVKLNAPVLVPTAAATMPSLLPALDLGNERRSPLKKQQLPLTKRSLKSST
                     DFDQYKNRPLDGDVELGGMLYHHRKNNSIAGGSRIPVLKKSHLVSNTIKPIIKTTDTA
                     TSTNILPDDIPMLASENEDEGPETSHYVPSGDDGEWFSEKNLQRQLYIQRGVNPESVF
                     GKPAKFECETVFGRKYGPNVNFDWSMYRPPTTEERAAYMKSMRYGL"
     gene            <936384..>941744
                     /locus_tag="C5L36_0E04480"
                     /db_xref="GeneID:40386253"
     mRNA            <936384..>941744
                     /locus_tag="C5L36_0E04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468010.1"
                     /db_xref="GeneID:40386253"
     CDS             936384..941744
                     /locus_tag="C5L36_0E04480"
                     /inference="similar to AA sequence:RefSeq:NP_012911.3"
                     /note="PKUD0E04480; similar to Saccharomyces cerevisiae
                     YKL014C (URB1); ancestral locus Anc_2.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323870.1"
                     /db_xref="GeneID:40386253"
                     /translation="MSSGDRSKYSANVSTDSALRLAEFIEDCENEQDEISTSDENIQK
                     IKNFLDVKFNTTSIVQIQSFCATTNDHSSLSALNVNLATLIKLANRYPQLHQSIKFLV
                     LEIISTHNVKVFYRCLSNEHPGVANPALKLISQIVSFNNGVFVDEFLENFDLTVKSFC
                     DLMYPTKATAKLSKNGKSFLTVRHNMVTFWINLCSNASPLTRMDLLSNNKKINSGWIK
                     YITEFDNNSLIKRTLQFFETKVLNEPSFRKMTKCKLLGDFTIGKFVELYKISDIKDEI
                     HKLLLKITTDEENGLLFHDYRTYFQNVPLACLPSNANFNNNGVSIQIADQKFKINNKI
                     IYNILTSLKPWSDTLHLKLLISILEHVPELNAPYNYHLLHINGTHDPKLTSFYVGQTL
                     LLTKITQLPIPQDFITFTKTFIDQSIGSPPSIGKYYSIKLLMEAICPAQLNRSSLTKG
                     LKAKEPLIRHLTTQLVISVIKKFSKINKLLKINENSIFSSFSQELMKDLINLKLPDPS
                     VFVGLTNEVLKTEKVNKLLLLNYMKTAEYYQNILDINVPLQLGPVSKLIGIDIEDPNS
                     NKEKLSDVDILLFNSYLSLTAMQSISSQHNKWWNVTKGSKNSLFTSIAKLPYDLQYHD
                     ENDKEKANIVIDDNLLHKVVEVLSNLVDDQLVFEDFRLKNNNILFSQTWAVVLSFINT
                     FNSLSTENVESISTICKIVDESISRAIKTPYRYYDIVSKISKGSRLSVFYVAVCEQCK
                     FADAKFKPIVHSWIEYLSLFMFLLGEPIDTMKIIAKDYLSIDIEFNLQNYEKFVENHR
                     QLVNEQATTFSMISLTPFKQLKTVVKNLIPKSDAEVIAILDRINTIINSDYELKSVEE
                     LLLDLISTYASYVMQRYNGTALDGINEYEINLLDGKYWNSFFVNEEDLVGSQLRSSKK
                     FFIMSLLREVFLELWGKVMNSSFKKSLTESIEKLVHSINLSETAIKKVSEYIWVLSSE
                     KLVSLLISKENHQFSDALLEVAQSRKVKLETSQIIEYCRISKDVQLKLSNIQSFRGLA
                     NGATFDSDQVEELVKLAKESHTKVLYYNILEIVCVQSEAYVKKIVQSLETEFEEISSD
                     IEGYKFLQFLSTKDKTFRKRLYDIAVQKIGLMVGKHTPISVTLNVYLHTISLHMKNEK
                     LDEVVETMIEQLLSLNDVRNVASLIFSPEMTSVILQLYVEEDDKANVKKTWLYRATLY
                     ITKVFAESQGEVEIEPFLESLMETFKESFWKYVPKNMLNSQLEVICSRPWINNLKVLK
                     YCTWIVRTGSKNVIECTKVFNILINNSSLVFNQGNDKDEERRYYTSVILYLLINMNVK
                     QLTTYENIMKITKMYKGTNRASDLVLKEVLKLMEIEHGESWIQFVSNWDLIDDWFPVI
                     TDGIVEVPELIIDTPGIPGCLTVSLYKGIIDKSVQYFNPANRNVKFPELKNTLITQRE
                     DIELLKEFYESKDVDALEINNNVVYDIEFLLLLIINNEDLFKIVDDSVKVNIRALIDT
                     GLLQLVVCGLSHESPDVQEISRRIISSILLTIEFDLKMMELKREGKGPETETGASVST
                     FKERSAFKVYLGNLLYTLEFKKYVQMEEGVVEPVPKLFFILLSYLVPVLANPSHFLYE
                     KSYRYILSGSKYRDFEIPMYKTIMVNFMKDEHSSHGEKSDDNDYYKELQWMLNALGNS
                     ITSNEDLKTLRRNGVFEELLNLLNSPMLNTTTVESILNVFEKIIKLENGADTLNRSFG
                     FLSFVELKKALFEGSKGKLGQEMKNLVIKSIISSDCNGKDKRSREWCEDDFKLIVKRV
                     CK"
     gene            complement(<941874..>942257)
                     /locus_tag="C5L36_0E04490"
                     /db_xref="GeneID:40386254"
     mRNA            complement(<941874..>942257)
                     /locus_tag="C5L36_0E04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468011.1"
                     /db_xref="GeneID:40386254"
     CDS             complement(941874..942257)
                     /locus_tag="C5L36_0E04490"
                     /note="PKUD0E04490; Pfam Domains: Cyt-b5(9.9e-10)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323871.1"
                     /db_xref="GeneID:40386254"
                     /translation="MAPSFEPKTPVDLDPPKDTPLTLEQVAQCDGERNQCMWIAIMGT
                     VFDVSKNTKMYGVGKGYHALVGKDASRALGKSSLDAEDVDPKVSWDYSSLNEKQLKTL
                     NDWYTFFSKRYNIVGKLVDLPSTSN"
     gene            <942533..>942922
                     /locus_tag="C5L36_0E04500"
                     /db_xref="GeneID:40386255"
     mRNA            <942533..>942922
                     /locus_tag="C5L36_0E04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468012.1"
                     /db_xref="GeneID:40386255"
     CDS             942533..942922
                     /locus_tag="C5L36_0E04500"
                     /inference="similar to AA sequence:RefSeq:NP_013842.1"
                     /note="PKUD0E04500; similar to Saccharomyces cerevisiae
                     YMR123W (PKR1); ancestral locus Anc_2.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323872.1"
                     /db_xref="GeneID:40386255"
                     /translation="MSNFLVRLWDAIFLPGTNRELEQATHASFALLTLSLVWMLYTSR
                     SIHFFNLLVISLCLWAAVAWFLTELKKEKAKLKSNGELLAEQEETSLSSSSPSSPSSQ
                     TPADSAESAAIPPSKGKTTGASANFKD"
     gene            <943204..>944584
                     /locus_tag="C5L36_0E04510"
                     /db_xref="GeneID:40386256"
     mRNA            join(<943204..943972,944046..>944584)
                     /locus_tag="C5L36_0E04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468013.1"
                     /db_xref="GeneID:40386256"
     CDS             join(943204..943972,944046..944584)
                     /locus_tag="C5L36_0E04510"
                     /inference="similar to AA sequence:RefSeq:NP_014291.1"
                     /note="PKUD0E04510; similar to Saccharomyces cerevisiae
                     YNL108C (YNL108C) and YOR110W (TFC7); ancestral locus
                     Anc_2.169; intron location uncertain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323873.1"
                     /db_xref="GeneID:40386256"
                     /translation="MTLKTIYIARHGYRSNWLPLPEQIPPPTGIDSDPPLAPHGVKQA
                     QELAGFITKDLPQKNLPVPQMIFSSPFYRCIETINPTAEALHLPIQLERGLGEWFKPH
                     RKIVPVPADHLTLHKFFNTVPSEMDWLWDTVIPSLEGETEEEIFKRCQVFWSKFIPKF
                     ESIYPNVECIILVTHAATKIALGMALAGYSNVRDFLTEKDGGDGKTTRIGGSTCSLDG
                     YAKSSNGDTWNLFMNAETSFLSCGAEMDWHFATSQFEAGKGSSKDEARKIDYTSNSNQ
                     NNHNDNIDNKESDENSDGDGDGDDEYQDVYVNLVFPASSTSYDLNNDPLHIQNSNSNQ
                     RGNMASNEIQESIDYKNEAGVSTAINKLRVSGWEKETPLVQNKNDILQGEWTRLVGTE
                     LIFDENGQYIATVDDHILLQYGRLQEQKLDKSTLLERARNLAK"
     gene            <945096..>947888
                     /locus_tag="C5L36_0E04530"
                     /db_xref="GeneID:40386257"
     mRNA            <945096..>947888
                     /locus_tag="C5L36_0E04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468014.1"
                     /db_xref="GeneID:40386257"
     CDS             945096..947888
                     /locus_tag="C5L36_0E04530"
                     /inference="similar to AA sequence:RefSeq:NP_013131.1"
                     /note="PKUD0E04530; similar to Saccharomyces cerevisiae
                     YLR031W (YLR031W) and YMR124W (YMR124W); ancestral locus
                     Anc_2.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323874.1"
                     /db_xref="GeneID:40386257"
                     /translation="MEAAMGVSKGRKGPRPPLSGPNMSNGVDQAGFIDINYETPINQQ
                     SQPLPNSYPEMNGYPPHGYPVRGHPQYPPMPKQGIPPSQGANMYMNSNGSSVSTYSQM
                     YHNPSAAASGMSFGGNTGGVGSAGPYGRTPYGSSANNRPRAQRRNSNSSISTKSVNNF
                     VKKQWNRFGNKGSAASIKDEEEDDGGIEVDTSQNEISFDDLAHMRGDTLGSFNLKDST
                     PYIPTLKVSMNPSKKMTGEQYRKIQMANKKNKAVSLTRHQELMQAQFKQQQQEQLQQF
                     PANGPPRAMSLQRNPNGYLRGPPPPNMPHLPYPPNPGMPPQGLPHGYGYSPMGPYLGP
                     PQGYPPVPQQYGYPPVGPRSMSMQSQNTMQRGYPGPLFNPQNQPPIPTSETTNMPRSF
                     SNQSGPGGIRSQTNNNLENAKEAENKPRVPVEEKKPKKVTKIDFSTFSDDDDDSHGVN
                     DTTTLTSANVKDSNKREINENNSSKGVVYSEEDPEEEDQFDPKHESPVKGHSRRADGR
                     AGADSVVTFESFNASEQKANQNALYGTTNSTQQTVFYSASEFPTSDDNQQRNKIKQLK
                     NNSSKLNLSEINDEIDDVTQRLSDFPGDETKVHDKSNRDSVATSKSTQPLHFDNEPAG
                     KSISNELQQQHQHKPLLSPSPVSTVGINKNMVDMSLKLKSQESLQGKTVKDNKTNHNQ
                     LFPIPSRTNLITPPSSASLLLDGRSAKSKSADFDPQTPVSTYSIPTSAFTAEQFGLLN
                     DNQSLLQELELVTTELASSVSREIQLEDTLRRGGSEVDVNISQEFKLDHVIIDDDKVE
                     IKPEAYRNSREYAKTLTALAKQLNDERKKRYTIEEMLLQYQESSNLPDTQRQLLYEEK
                     QNVRQLNDRVNDLLENEKLYRSDKELLETENEALKFELEEVKRKYKNIENQVIPQMQD
                     RLNFLEAFYEQQNLNM"
     gene            <948141..>951170
                     /locus_tag="C5L36_0E04540"
                     /db_xref="GeneID:40386258"
     mRNA            <948141..>951170
                     /locus_tag="C5L36_0E04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468015.1"
                     /db_xref="GeneID:40386258"
     CDS             948141..951170
                     /locus_tag="C5L36_0E04540"
                     /inference="similar to AA sequence:RefSeq:NP_013844.2"
                     /note="PKUD0E04540; similar to Saccharomyces cerevisiae
                     YMR125W (STO1); ancestral locus Anc_2.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323875.1"
                     /db_xref="GeneID:40386258"
                     /translation="MSEEYSRKRQRVDDDIGYAPLEDNELPPHLQDNEDVPPHLQNNE
                     DVPPHLQNNEDVPPHLQNNEDVPPHLQNNEDVPPHLQYNEKESARSESEQAHGQEAYN
                     PKRQRQTLNNAELERAQGLCQSLQTLGDVPYEVKVLYTQGTETIVYLWHDDNFRNSIL
                     RYFGAVIIDMPHKANLFSGLILLANAKISKVGEDVIQWLKARLVEVFDDIRGDSMEVS
                     DSLGNNGEEGEMRCMKSWNRVILIFRMFGLLSPMIQDFESIVKLAKDLIDYSIQLQNG
                     SEERVALAELLYYEMLISLPYCLANEKGNKCKEQLKKIIESAKQFNVRVSEGDEKFKP
                     IVQDAGELVAMSEILKDTPQVVDSYLDEMNLFYDVSHVVDPLIRTVLAEKKLVEEKSE
                     IQEGENEQEGNQNGPEIEEKVEHTGQEKDEEKTDDVIFATHTVGTIEIPSAELLDQIS
                     QLDKYASIADTLWKHPRYVLNIFPYERQRQELDFDTLPPAKSYASMLLNDVLNCTLIN
                     MEYNRVVVSKQILNYPLYFNEKAFCKPNSPLDKLMIIDNLRKGIDFDLIKNLEESSDF
                     DENIKQSMIASAKRIQDEYEQGFQSTWKMEEIVLTNIINLIFLIPQIELPPIYFETLV
                     EDTCGRDWTLVKRYNYESNESLVFSKVVGDSFRYLYENVEKLRYENIVKFVNWFVLQV
                     SNFKFEWEWQEWVPQFLEIGDSQIYHPKVFFIRNAIHKEILITNYKFIKSKTLPEELR
                     KYANLSLKSREELVEYDCKFFGTEFAQLNTVDPFENEEDNYGNNNGDDIVETNTETYK
                     LFSHYLFNHDEHPFNDICRDVYMNLENVEDSNESLLELIDRLKERVVNEGDVKNANEY
                     IVTLVLQSVCLIGSRSFSVFEESLNKVFGDKLKSVLEHVDAGEAEKKEWIINAVLRIW
                     NSEPRIGLMFLERLARYHIIDEGTLVRYVWNYNCLPLREVYADEFLERLIDDREDLNL
                     VYLECLERQVEKSKEDGDEYQCKYLRDAMEYRRRERV"
     gene            <953171..>958828
                     /locus_tag="C5L36_0E04550"
                     /db_xref="GeneID:40386259"
     mRNA            <953171..>958828
                     /locus_tag="C5L36_0E04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468016.1"
                     /db_xref="GeneID:40386259"
     CDS             953171..958828
                     /locus_tag="C5L36_0E04550"
                     /inference="similar to AA sequence:RefSeq:NP_013446.1"
                     /note="PKUD0E04550; similar to Saccharomyces cerevisiae
                     YLR342W (FKS1) and YGR032W (GSC2); ancestral locus
                     Anc_4.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323876.1"
                     /db_xref="GeneID:40386259"
                     /translation="MSSDDHYDPNRSQQGGQYDPAYQYDQQQYNQQYDPNVAAYGQEG
                     YDPNYQYQQQQPQQGGYYDEQQYGGGQYYQNQQGGGYYDQPGQHDPESYSDFSYGPGG
                     VPGTPYDNGNGNGGYGANYTPSQMSYGDPRSSGASTPYYGAGANGMYDQGMIALPTDP
                     YPAWTADNEAPVTIEQIEDIFIDLTNKFGFQRDSMRNMFDYFMVLLDSRSSRMTPAQA
                     LLSLHADYIGGDAANYKKWYFACQMDIDDRVGFANIDLGKIKNSKKKSKKSIFKRSKK
                     NKEEQPVENSENVLQEIENDDSLQAADYQWRARMNILSPMERVQDIALWLLIWGEANQ
                     VRFTPECLCFIYKCAKDYLLSDQCQNRLEPIPEGDYLNRVITPIYRFIRDQVYEIVDG
                     RFVKRENDHNKVVGYDDVNQLFWYPQGLARMHVGETRLIDLPQEERYFQLGEIDWNQT
                     FVKTYKETRSWLHVVTNFNRIWVAHISVYWMYCAYNSPSLYTHNYVQVLNNQPLASSR
                     WASATIGGAVASGINILATLFEWMYVPRSWAGAQHLTRRLVFLIILFAVNLAPVIFVF
                     AYAGLTYKSTAALAVSIVFFFVAVATIVYLTVMPLGGLFSSYMKGNSRRYVAQQTFTA
                     SFAPLHGLDRYLSYLVWVTVFAAKFSESYYFLILSIRDPIRDLSTMTMRCHGEKWWGN
                     KLCKQQARITLGLMYATDLILFFLDTYMWYIIVNTIFSVGRSFYLGISILTPWRNIFS
                     RLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPS
                     DVEGKRTLRAPTFFVSQDDNNFTTEFFPKDSEAERRISFFAQSLATPIPEPLPVDNMP
                     TFTVFTPHYSEKILLSLKEIIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKILAEET
                     VAFEDEKEDDVKQEIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYA
                     RAIKLLYRVENPEIVQMFGGNAEGLERELERMARRKFKFVVAMQRLAKFKKEELENAE
                     FLLRAYPDLQISYLDEEPPLEEGGEPRIYSALIDGHCEIMSNERRRPKFRVQISGNPI
                     LGDGKSDNQNHSIIFTRGEYLQLIDANQDNYLEECLKIRSVLAEFEELNVEHVNPYAP
                     TLSKEPVKVTHPVAIVGAREYIFSENAGVLGDIAAGKEQTFGTLFARTLAQIGGKLHY
                     GHPDFLNSIYMLTRGGVSKAQKGLHLNEDIYAGMTAMLRGGRIKHCEYYQCGKGRDLG
                     FGSILNFTTKIGAGMGEQMLSREYYYLGTQLPLDRFFSFYYAHLGFHINNLFISTSLQ
                     MFMLTLVNINSLAHESIVCIYDKNKPITDVLYPLGCYNLAPAIDWIRRYTLSIFIVFF
                     ISFVPLVVQELIERGIWKMCYRFIRHISSLSPLFEVFVAQVYSTALINDVSIGGARYI
                     ATGRGFATSRIPFSVLYSRFAEGTIYVGARCSIILLFGTIAHWQPALLWFWTIIVALM
                     FSPFVFNPHQFAREDYFIDYRDYIRWLSRGNTKWHRNSWIGYVRLARSRVTGFKRKTI
                     GDESEKAAGDAPRAHRTTVLMSDTIPCAIYCAGLFVGYTFINAQTGVRDAKMVNATLR
                     LIICALGPIVINCGVLFVTLGMSCCSGPLFGMCCKKTGAVMAGIAHGVAVIVHIVFYI
                     VMWVMEGFHFARMLLGLITMIYIQRLIFKCITLFVLTREFKNDHSNVAFWTGKWYGSG
                     LGLAAWSQPSREFCAKIIELSHFAGDFVLGHVLLFCQLPLVLIPTIDRWHSMMLFWLK
                     PNRQIRPPIYSLKQARLRKRMIKKYSVLYYTVLVIFVALIAAPAVVGGLKNVNVTPTD
                     LPEFADGLFQPRHQNNNDTGFGSGSYHPHWTTTTSLVTFSTKK"
     gene            complement(<959207..>960982)
                     /locus_tag="C5L36_0E04560"
                     /db_xref="GeneID:40386260"
     mRNA            complement(<959207..>960982)
                     /locus_tag="C5L36_0E04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468017.1"
                     /db_xref="GeneID:40386260"
     CDS             complement(959207..960982)
                     /locus_tag="C5L36_0E04560"
                     /inference="similar to AA sequence:RefSeq:NP_013128.1"
                     /note="PKUD0E04560; similar to Saccharomyces cerevisiae
                     YLR028C (ADE16) and YMR120C (ADE17); ancestral locus
                     Anc_2.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323877.1"
                     /db_xref="GeneID:40386260"
                     /translation="MPEYRKTAILSVYDKTGLLDLAKGLVGANVRLLASGGTARLLRE
                     SGFPVEDVESITHAPEMLGGRVKTLHPAVHGGILARNIESDEADLKEQNIEKVDFVVC
                     NLYPFKETVAKIGVTIPEAVEEIDIGGVTLLRAAAKNHSRVTILSDPRDYPVFLEELS
                     KDAEISKELKQTLALKAFEHTADYDTAISDFFRKKYSENKAQLPLRYGANPHQKPAQA
                     FVTEGELPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGL
                     PLSDVEKKIYMVDTIENLSPLANAYARARGADRMSSFGDFIALSNIVDLPTAQIISKE
                     VSDGVIAPGYEPEALELLKAKKKGKYCVLQIDPNYNPPSMEKRQVYGITLEQKRNDAI
                     FNSSTFKEFTSKNTNLTDQAAIDLTVATIVLKYTQSNSVCYAKNGMVIGLGAGQQSRI
                     HCTRLAGDKADNWWLRQHPRVLGFQWAKGVKRPEKSNAIDLYVSNQIPTSEPEKSEFE
                     SKFEVVPTPLTLEERREWLDKLTDVSLSSDAFFPFPDNVYRAVRSGVKYIAAPSGSVM
                     DRAVFDAADAHDVVYLENPIRLFHH"
     gene            complement(<961678..>962292)
                     /locus_tag="C5L36_0E04570"
                     /db_xref="GeneID:40386261"
     mRNA            complement(<961678..>962292)
                     /locus_tag="C5L36_0E04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468018.1"
                     /db_xref="GeneID:40386261"
     CDS             complement(961678..962292)
                     /locus_tag="C5L36_0E04570"
                     /inference="similar to AA sequence:RefSeq:NP_013129.1"
                     /note="PKUD0E04570; similar to Saccharomyces cerevisiae
                     YLR029C (RPL15A) and YMR121C (RPL15B); ancestral locus
                     Anc_2.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323878.1"
                     /db_xref="GeneID:40386261"
                     /translation="MGAYKYMEELQRKKQSDVMRFLLRVRCWEYRQKNVIHRASKPSR
                     PEKARKLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNHLKYQKSLRVTA
                     EERVGRRASNLRVLNSYWINEDSTYKYYEVILVDPSHNAIRNDAAYNWICNPVHKHRE
                     NRGLTAAGRQSRGINKGHLYNKTSKGRRHTWKKHNTLSLWRYRK"
     gene            <963646..>965526
                     /locus_tag="C5L36_0E04575"
                     /db_xref="GeneID:40386262"
     mRNA            join(<963646..963656,964254..>965526)
                     /locus_tag="C5L36_0E04575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468019.1"
                     /db_xref="GeneID:40386262"
     CDS             join(963646..963656,964254..965526)
                     /locus_tag="C5L36_0E04575"
                     /note="PKUD0E04575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323879.1"
                     /db_xref="GeneID:40386262"
                     /translation="MTFLSDIKSKTRKLTKSSSSLHSSEHLESSAASISSVSSSNSIA
                     SFTENIKKSLSTRKKHFPSLKKLKRSLSSASFHSNHSNTSDLSLEYNQNEYYSPAQHE
                     PLYRDQEEYCLSYQIQEKDTYIDNPVSDASEEALKEEAEEAEAEEAEAEEGSPLFDSL
                     LPCLPLTAVPLSANNETINTVLSISTTLIDSHQASRQEIEHFPLDLSNSSPPTSRFQS
                     SPSTNHLEVETQERNEQDFEHELDQDRTFCISPPSVKSYTFPVEKLDLPDPLLDIIQS
                     SKLFPPHSIHLSQSLESIKMVDEKQTEEKIGSFFQILKSYLYNAFTKTKETLSFTSAK
                     TVDYVHYYYLGTIKKLKQYPLTTYNALYVASLAAAAYAIKYLHNERVITTFNRLNRHD
                     RDVQIASAVGIAFLVGGIGNYVYLRNNRTIKGSSP"
     gene            complement(<965715..>970820)
                     /locus_tag="C5L36_0E04580"
                     /db_xref="GeneID:40386263"
     mRNA            complement(<965715..>970820)
                     /locus_tag="C5L36_0E04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468020.1"
                     /db_xref="GeneID:40386263"
     CDS             complement(965715..970820)
                     /locus_tag="C5L36_0E04580"
                     /note="PKUD0E04580; Pfam Domains:
                     E1-E2_ATPase(1.4e-15)|Hydrolase(1.3e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323880.1"
                     /db_xref="GeneID:40386263"
                     /translation="MPVQDIKGAKQSFDSKSLDFNGLNMDQNGAGYTSMQSPSTENPN
                     VLSLYKDITSSGELPIRPSSQPVRTRNRGYSLRTQLLNTHLVKQSENYLEDRNNEQDI
                     ELASVGNTYTPDGYTRNKEEYNENDQFGTDFVNDSMLDFSEDLKNIKDAKFISGKNGV
                     KLSNEFDDKFDRDDDYRLKSKTKLMMNNNAINFFKKMYILLSGGRIELSSVGGREIPI
                     SINLNNTDFPKILDKQNKPLLIDNRQNKPYVDNLITSSKYTLWSFLPRQLYAQFSKLA
                     NCYFMTIAIFQLIPNWSTTGTSTTIIPLSIFITIAMLREGWDDMKRHKLDKEENHRHT
                     KVLKELESPKSLFESDMRFSKSTASFSRLRPSGQSFDLEFEDDLELEREAESKNSYDS
                     ERLLHSMGVSANKIKWKDVKVGDIVKLECDEWVPADMILLTSTNELGEAFVETMALDG
                     ETNLKSKIPNIELHKKANRAKSLFNLTGKVLSEDPNNDLYNYEGSIDLPNMETQEMET
                     YPLGPDQILYRGSILRNTDSCLGLVIFTGEETKIRMNAIKNPRIKAPKLQKKINMIVG
                     FMVFVVITLSLFSFMAQNIFQKKYGSNMWYTLGTQAGVVPTIMGFIIMYNTLIPLSLY
                     ITMEMIKVVQLQLLQWDIDMYHLPSDTPAEARTATILEELGQVSYIFSDKTGTLTDNV
                     MIFRKFSVCGVPWLHNVDVLLKGEQHNDPNDISDVFKDSEEKPGMLITDGRPSMASLN
                     QIRKQQGQEEEEKKKHDSIKTSFEFIQFIQSNPSSVFAEKATLFLLSLALCHTCLPRR
                     FMKDTPQSGDNDSIDSIDRTSALNPFASDQEEGEESIEYQAASPDELALVQAACDMGF
                     ILFDKKLKTVTLKTFPKGFDNESKLTKYEILDVIEFSSARKRMSVIVKFPNDEIIMFC
                     KGADNVILERLHNSAIVSEKQREIDRSIEGRKKAEAEFILNKRSIDQINSATSPRSSF
                     GTVRRSLSLSRKSMANDAYGNIDSMLENENDVDELVKMSRKSIEVESRKKYNLSKNQY
                     IPPVKLLKNEKFLIERTLRHIDDFSSEGLRTLLYSYRKLNENEYKEWSRRYAEAKTSL
                     VDRADNIAKVGTEFENNLILLGCTAIEDKLQEGVPEAIEKLRRAGIRMWMLTGDKRET
                     AINIGYSCKLIKDYSKVVILSLDRENQMDDIVSTIKETEMEIYEESIAHCVVVIDGST
                     LTEVEKDEAILSLFIRLGVQADSVIVCRASPSQKANMVTKVRNLDKSKVTLAIGDGAN
                     DIAMIQSADVGIGITGKEGLQAARTSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCT
                     FYKELMFYLSQLIYQRYTMFTGSSMYESWSLSMFNTLFTSLPVLCIGMYDRDLNQSTL
                     IAVPELYHKGVKNETFNLPVFIQWVLLATSQSVTVSFVLFQIYGFPALLDNTTYPLGV
                     VLFTTFIIIINVKLNIVEMHTITKVSIISAGVSIGGWILWCMLLVGLYKTKLSTIYYV
                     EHGLFEHFGKDFTFWASILILTVVGIWIDLIFYLVSHLFYTTETEKYQILEKDERLQK
                     RFEIESYNELKQGWLWLHESQIKEGKIDELKGFKRFIFNLKSFLKKGSLHPTEKTQSR
                     KRKGTMINPNELPPDTPSIVVVSSNDEYTEEMLPSGKTVKVPKNQGNGEESRYRRFFK
                     SRKSSFDEFNDGRSIDEILRDRQRGLEYDESHR"
     gene            <971151..>972641
                     /locus_tag="C5L36_0E04590"
                     /db_xref="GeneID:40386264"
     mRNA            <971151..>972641
                     /locus_tag="C5L36_0E04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468021.1"
                     /db_xref="GeneID:40386264"
     CDS             971151..972641
                     /locus_tag="C5L36_0E04590"
                     /inference="similar to AA sequence:RefSeq:NP_011068.1"
                     /note="PKUD0E04590; similar to Saccharomyces cerevisiae
                     YER141W (COX15); ancestral locus Anc_8.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323881.1"
                     /db_xref="GeneID:40386264"
                     /translation="MVFFARTQMFFTRNPVLLQSRFTNFFTKSTSKRLSTFDFVKSIR
                     SANSVRTAGIPVSNVSKYFAAGFTQQSRQFSTASRLYNGVEASTAAANIRKSSWPANS
                     HKAVGYLCIGTSVLVFAIVVLGGLTRLTESGLSITEWKPVTGALPPMNEQDWIEEFEK
                     YKDSPEFKLLNSDMDLEDFKFIYSMEWSHRLLGRIIGMVFVLPTLYFIARKKVSLRTS
                     AKLLGICGLIGLQGAIGWWMVYSGIDSELLEERRSKPTVSQYRLATHLGAAFLVYCAM
                     ISTGFSVLRNQWIMKNPQEYAKYFQQIQSKSLSKFRFFNKGLLGIVFLTAMSGAFVAG
                     LDAGLIYNTFPEMGENYIPSFHELFDPVHSRLKDQSDLWWRNMLENQATVQLEHRILA
                     TTTAILVFATHMYSHKIKTIIPRPAYKWLNISMGVVTMQYILGMCTLLYLVPTDLAAT
                     HQAGALTLLTTVLLVVNNLKKPSRANMLILKKSLEETAKKSGGKLN"
     gene            <972970..>973361
                     /locus_tag="C5L36_0E04600"
                     /db_xref="GeneID:40386265"
     mRNA            join(<972970..973011,973101..>973361)
                     /locus_tag="C5L36_0E04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468022.1"
                     /db_xref="GeneID:40386265"
     CDS             join(972970..973011,973101..973361)
                     /locus_tag="C5L36_0E04600"
                     /inference="similar to AA sequence:RefSeq:NP_009527.1"
                     /note="PKUD0E04600; similar to Saccharomyces cerevisiae
                     YBL026W (LSM2); ancestral locus Anc_8.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323882.1"
                     /db_xref="GeneID:40386265"
                     /translation="MLFFSFFKTLVDQEITVDLKSDIKITGTLKSVDQYLNLKLDNIQ
                     VDTEKYPHFIAVKNLFLRGTNIRYIHINPACVDTNLLQDASRREAMASAGEKIAGR"
     gene            complement(<973530..>973985)
                     /locus_tag="C5L36_0E04610"
                     /db_xref="GeneID:40386266"
     mRNA            complement(<973530..>973985)
                     /locus_tag="C5L36_0E04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468023.1"
                     /db_xref="GeneID:40386266"
     CDS             complement(973530..973985)
                     /locus_tag="C5L36_0E04610"
                     /inference="similar to AA sequence:RefSeq:NP_011063.3"
                     /note="PKUD0E04610; similar to Saccharomyces cerevisiae
                     YER137C; ancestral locus Anc_8.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323883.1"
                     /db_xref="GeneID:40386266"
                     /translation="MPNQSTEEQIKLLNDRIAELALIVSLKTREMDAIEKKYNDRLQT
                     LNKYIENLHVALGTQPQEGSIRDVDLVEKLQSLQLQNESGDDFIIIPTKKVILTPAQD
                     KTNPKEHRKVFVIPKETTHHRRKNITCSYCKETGHKRSQCPKILYGGHT"
     gene            <974183..>975535
                     /locus_tag="C5L36_0E04620"
                     /db_xref="GeneID:40386267"
     mRNA            <974183..>975535
                     /locus_tag="C5L36_0E04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468024.1"
                     /db_xref="GeneID:40386267"
     CDS             974183..975535
                     /locus_tag="C5L36_0E04620"
                     /inference="similar to AA sequence:RefSeq:NP_009528.1"
                     /note="PKUD0E04620; similar to Saccharomyces cerevisiae
                     YBL025W (RRN10); ancestral locus Anc_8.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323884.1"
                     /db_xref="GeneID:40386267"
                     /translation="MSDRDDQKRELENTWDNLESQNSKRQKLLSSPPPSSPPLAQYSE
                     SESPPFTPIFNGIRNSSADINDDSHLTEDGTTSGEVEETIDLKNNLILSPSHEPENAS
                     KSPQKASSGSSDTSEYPSDAERGVSIVDDKDQLDESEESGKSVKSEQSDSSVMLGEPG
                     ETDESDKSDESSESDETDSSGESDGKSPERKKSQLEYIDFCKLYKNPTIYSSANLEVL
                     SAGKLEFERGTHIEGDSMYVNNSEVPKLRPEFKEMNRFKEPTGINQVYYKPPDEILTD
                     KYGFEPNELVYLSREDIQRHTKVELPGEEIANAIHYYVAERIRTSLGISDEEYNANYA
                     KIFDGSALLALSALVTKWVEDSCGDSTFKSYMEKVKTKKMSSIERFIRVHDDSASSES
                     SDEEIKHSTRGDEKNRPFSKHAEQSRRQNFRASSTNSGSETEEEIRPVNIGTKNGNVY
                     "
     gene            <975546..>977837
                     /locus_tag="C5L36_0E04630"
                     /db_xref="GeneID:40386268"
     mRNA            <975546..>977837
                     /locus_tag="C5L36_0E04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468025.1"
                     /db_xref="GeneID:40386268"
     CDS             975546..977837
                     /locus_tag="C5L36_0E04630"
                     /inference="similar to AA sequence:RefSeq:NP_009529.1"
                     /note="PKUD0E04630; similar to Saccharomyces cerevisiae
                     YBL024W (NCL1); ancestral locus Anc_8.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323885.1"
                     /db_xref="GeneID:40386268"
                     /translation="MVKVRRLLANSYTQKLEKEEKNFTRIFLKYEVFHENFVLKYTLL
                     YTTSTLNSRELYMNRFFHTTVLRFIKMGKKGRRGNRNGNKLGKRDDREPWSQIKQENE
                     SWENYYRGLGIIPNGDFDLFKKTCQETLPLTFRVTGSRKHAKIIAELFQNKIMPLLEN
                     AEGTENYKKPYALPWYPDNLAFQIDLPKQVIKKVPEYAKVQKFLMVENEVGNISRQEA
                     VSMIPPLVLDVEPHHHVLDMCAAPGSKTAQLIEALHTFKDSNDDTQQPTGFVMANDSD
                     YRRAYMLVHQIKRLNSANVVVVNHDAQMFPKMKLEENGQYVKFDRILCDVPCSGDATM
                     RKNIMVWKEWRFGNAIGLHPLQLNILKRGLQLLKPGGRLVYSTCSLNPLENEAVVAAA
                     LKLWGGKVKLVDSSDRLPGLIRHNGIKTWNVYGKDGEIKARGEDEKLPESLFPPSDEE
                     SKDMNLDYCMRVYPQDQNTGGFFITVFEKEAEVEVPAKSVSENKREASEQLESEAKKQ
                     KVEETNVTEVVKQRKEKLPIDANEEPFIFIDPKNEVLQNCWKFYNVLDEFPKDCTLVR
                     NATGEPLRSIYYVSPIVKKILENNDKKLRIIYTGIKLFVAQKSDICPWRFQNECLHVV
                     RKYLPTSRQIELNLEMLKLLLTELSPSLQQVRDSNADPRFIEEVAKMGEGSCFVKVKT
                     NNPNEELFFPLWKGKSSFNLMVNKHETAELLYRLFDIDKAALDKEKAEKKAVEEVVQE
                     AAKKQEETAVDQTEAKTEEKTEN"
     gene            <978079..>978834
                     /locus_tag="C5L36_0E04635"
                     /db_xref="GeneID:40386269"
     mRNA            join(<978079..978132,978271..>978834)
                     /locus_tag="C5L36_0E04635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468026.1"
                     /db_xref="GeneID:40386269"
     CDS             join(978079..978132,978271..978834)
                     /locus_tag="C5L36_0E04635"
                     /note="PKUD0E04635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323886.1"
                     /db_xref="GeneID:40386269"
                     /translation="MSSSQSVGISRWQLGLGAFTGALIYFTDASKRHNLQNYLYHTIS
                     NVLSELGNVHIILLIGVLIVSFFRINHSFLNLTSGLASAFTKSTINIIFLLLRCVSAL
                     KLIIVVTRHLIRTRRMTILENNCELLIRQCEQPIHALENQCVICLEELFDKTSSKSEL
                     SCNSKGKTLKKNIILDCRHILHVECFKQWYLNSDTCPHCRSKVNF"
     gene            982486..982557
                     /locus_tag="C5L36_0Etrna13G"
                     /db_xref="GeneID:40386405"
     tRNA            982486..982557
                     /locus_tag="C5L36_0Etrna13G"
                     /product="tRNA-Gly"
                     /note="PKUD0Etrna13G; codon recognized: GGA"
                     /db_xref="GeneID:40386405"
     gene            complement(<982750..>983769)
                     /locus_tag="C5L36_0E04640"
                     /db_xref="GeneID:40386270"
     mRNA            complement(<982750..>983769)
                     /locus_tag="C5L36_0E04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468027.1"
                     /db_xref="GeneID:40386270"
     CDS             complement(982750..983769)
                     /locus_tag="C5L36_0E04640"
                     /note="PKUD0E04640; Pfam Domains: PALP(5.6e-08)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323887.1"
                     /db_xref="GeneID:40386270"
                     /translation="MTKLLDKFEKYPLLFGPSPISKFDNLASNLGNKVNIYAKREDRN
                     SGLAFAGNKLRKFEYIVPDILAGDYTHIVSIGGIQSNQTLMTVATASKLGLKAVTVQE
                     NWVPIPEEEKDTYDKVGNIEAARIMGGDVRLVPDGFDIGMRKSFEDAMNELKEQGYKP
                     YPVPAGCSEHKYGGLGFVGFADEVIEQEKELGIKFDKIVVCCVTGSTAAGIFVGMAQY
                     GRENDVIAIDASGKPEKTFEQTLRIINDTSKLIGLNKKFDTFNFDTRFGGPVYGIPNE
                     GTIEAIKLLGQTEGTLTDPVYEGKSMQGLIQLVREDAFEKGSNILYVHLGGASALSAY
                     KSYFK"
     gene            complement(<984115..>985686)
                     /locus_tag="C5L36_0E04650"
                     /db_xref="GeneID:40386271"
     mRNA            complement(<984115..>985686)
                     /locus_tag="C5L36_0E04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468028.1"
                     /db_xref="GeneID:40386271"
     CDS             complement(984115..985686)
                     /locus_tag="C5L36_0E04650"
                     /note="PKUD0E04650; Pfam Domains: MFS_1(1.4e-28)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323888.1"
                     /db_xref="GeneID:40386271"
                     /translation="MSDDFDHSSQDSSKRALSMGNETSLDVKDQDVDLMYPDEYIPTE
                     KEMHPIYRHLDYRIIPACWVLYFLASYGSSAYGNTLTMNYEKGHSLAHSLNLTTHDTS
                     TATALYYVAYIIFDLPMNLIMTRASPQIWLSRIIISVGIVYMCYAALHNGRGLMAIRF
                     MTGFADAGTWPGLSYYISLWYPEHRTARRIGYYFTAAQLSAAAAGLVAAGFQRMDMDR
                     GLYGWKWYYIVYGAITVFVGILLIWWLPDRPSYLKSSEANMLSFRRYLPDGLMKYFRP
                     IQPLNKRERRLHHLDMQYRYKNVKWGVKDVVNIIIDFRTWPLVMMYFGVVGTGFGLAV
                     FATTLIRANHPGLSGIDVSLLYAPIWLFDFASIIITTPIADRYKKWRHFIFCFFSMLI
                     ITGLLITSYAHGPWNRYAGLLIAGFGLGPTVPITMTLTSQIMTARYGDVGSAAAAAIV
                     SGLGNLGTVAATYALYSGWPADKARLYRDSNMMLILILGVSIVSAIVCWYIMEKIDNG
                     MYNEKRKYVEAQTEL"
     gene            complement(<986209..>988101)
                     /locus_tag="C5L36_0E04660"
                     /db_xref="GeneID:40386272"
     mRNA            complement(<986209..>988101)
                     /locus_tag="C5L36_0E04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468029.1"
                     /db_xref="GeneID:40386272"
     CDS             complement(986209..988101)
                     /locus_tag="C5L36_0E04660"
                     /note="PKUD0E04660; Pfam Domains: MFS_1(9.5e-45)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323889.1"
                     /db_xref="GeneID:40386272"
                     /translation="MSQESGREIESLDSDIRSFDSTQVDQYLAGTNNDANESANANAN
                     ANADTENSTIHKTQSRLSQLIESITHNDEAEDSQVLKKLLTQNSEGIKKLQTNLEQDG
                     YGEMGPLEEPIDMVKTTTAFEMDPNTKFHDADPWRYPTDLDTQMRLVVFTDDDKEDPR
                     NWSSTKKWFITVLLGTVCFDVALGSAIVTGDIEGPGKTFGVSQEVVILTVTLFVLGFG
                     FGPLLFAPLSEEFGRKVVYVITLGVAVIFIIPCADAKNIGTLLVCRLIDGLAFSAPMC
                     LIGGNLADMFEGSDRGVAMSIFSAAPFLGPVIGPLIGGYIGDNAGWRWLYWVLLIFSG
                     VVYAAVVIFLPETSHSQILKRRAKNLRKLTGDNTYRALCELKQRSLSETAKETLARPL
                     VLLSELIVFLITMYMSVIYGLLYMFFFAYPVVYMEGKGWSASKTGLMFIPIAVGVLLS
                     TAVAPFFNKQYNQRAQAYRDRGELPPAELRLIPMMIGCWFVPVGLFAFAWSSYPRLSW
                     AGPCFSGFACGFGFNCLYNPANNYIVDSYQHYAASALAAKTFVRSLWGASVPLFTIQM
                     YHRLGYEWATTLMAFISLACCIIPYMFYIFGARIRKKSRYAYSPEKKGGVSSDSTSEG
                     KQSLSE"
     gene            complement(<988533..>990089)
                     /locus_tag="C5L36_0E04670"
                     /db_xref="GeneID:40386273"
     mRNA            complement(<988533..>990089)
                     /locus_tag="C5L36_0E04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468030.1"
                     /db_xref="GeneID:40386273"
     CDS             complement(988533..990089)
                     /locus_tag="C5L36_0E04670"
                     /note="PKUD0E04670; Pfam Domains: DUF580(4.6e-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323890.1"
                     /db_xref="GeneID:40386273"
                     /translation="MNASLEDNTMSDPLGAKEPISSDPNNDIGAQAYEADFDFQDGNL
                     GDDEVDSFAIDEDRFTTETPVWNDTKFAIFFLIVFVLFIVKSFSLIVKHMKTLADEIP
                     PSQTVPNSLFFSLKSIFLILVTIALSTAVTMKLFFLAGKKSIRLVETGIKFITGFFML
                     ATVAAFFIRQYIQGFLFGIVTAILFTIIIKFKQLITLAGNILSIVISVLMKYPATAFA
                     AGGGYISTSFFTGLLSIVNGCTYIAYGFHGDGTPRFDDQGNKISQVSTGFVLTLLFLN
                     FAGLYIVDVARNVMHVTIGGIYGTWYYTEQTFNGMPKNEGTGSFKRAMTYNFGSLCFG
                     SLCVVIFQCIAVTVLLIDRNQGYVGQIGDLILRLTSTGVGYFNLYVFSFVALYGSSMM
                     RSVKATYKFFKDRGLQAFCNDFIISLALGFYCLIAAFISGIFIAIFLYIFKAIVGIRE
                     EFFAPLLTSSLVVSFNITTVLILTIVSGSSVFFYALNKDPSVYQESHQFEFQEISRCF
                     PRVLQRVNLQ"
     gene            complement(<990683..>992254)
                     /locus_tag="C5L36_0E04680"
                     /db_xref="GeneID:40386274"
     mRNA            complement(<990683..>992254)
                     /locus_tag="C5L36_0E04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468031.1"
                     /db_xref="GeneID:40386274"
     CDS             complement(990683..992254)
                     /locus_tag="C5L36_0E04680"
                     /note="PKUD0E04680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323891.1"
                     /db_xref="GeneID:40386274"
                     /translation="MSSITGSVFAPHSKPISKNSLLEMIFVQDSGGETDLPRHAAQEG
                     TPLEKIQYYESRRPPCEEIGSTVYPQINEQQKMPWEYNQDKNGFQDLPFVLVFVVVLL
                     CFCVAALQSFLCVSQFHQQGVTTFWGILVTKFNLGSITISKGFILATAIISCSILLGF
                     LQLLGLVFFYKIFIIGGFIGSTILALSLTIYFYLNLKLKPMYLSIAMLILCIFLGWIL
                     RSKVAFSTQLIRIGSRFMRSNPSIWIIYTVMILLNTLGVVVYFYVFTLSVLSLEMETG
                     HNVQYVKVSFLLFCGYYFAQIFENAVKVTVGTICCKWYFNSSIDTSTAICHMLSRCSG
                     SICLGSLIMGGLTIVREFSMISKSKRRLTSNPFSKIVWTMVTTLMSIVQFTMKYFNEY
                     AFAYMVLHATGYITSSYKMYNLYIRKGYSTLISESIVKVTLQLYVVYSGIAASTLAFF
                     YIAVAVPQQEIYNTEVVAIVLVSGLVALQITRMVSMLVNAYVHLMLVCLTEYRETLQW
                     LHPQEFELIQKHLVH"
     gene            <992591..>995157
                     /locus_tag="C5L36_0E04690"
                     /db_xref="GeneID:40386275"
     mRNA            join(<992591..992615,992699..>995157)
                     /locus_tag="C5L36_0E04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468032.1"
                     /db_xref="GeneID:40386275"
     CDS             join(992591..992615,992699..995157)
                     /locus_tag="C5L36_0E04690"
                     /inference="similar to AA sequence:RefSeq:NP_014913.3"
                     /note="PKUD0E04690; similar to Saccharomyces cerevisiae
                     YOR270C (VPH1); ancestral locus Anc_8.718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323892.1"
                     /db_xref="GeneID:40386275"
                     /translation="MPENEAIFRSAEMSMVQLYIPTEISRESIYSLGKLGKVEFRDLN
                     KNVNQFQRLFVDEIRKLDNVERQYRYLIKVMEEHGINPIENLAVDYEANIKNPLSTAQ
                     LEEICSSAELFEKRVSELSDSADDLMKKQADLKQHQQVLFAAEEYFNSEDTRNLIDLS
                     EAPYSPQMSGETLEGGVFAEVESNFITGVIPREKVPILEKILWRVLRGNLLFKTTEIE
                     SKMYDSKAKEFVDKNSFIIFSHGELILSRIRKICESLDADLYSVNVDSKLRLNQQKQT
                     NDKLTDITNVLETTNLTLLTELRVLSSEIDNWVKCIKLEKSVYTTMNKCHYDLGRKCL
                     ISEGWVPSDEVAVVQETLEDCSTRFSGDAESVFPIVMNVVATTKTPPTYHRTNKFTEA
                     YQAMCDSYGIATYREVNAALPTSATFPFLFAVMFGDMGHGFIMFLSALVLVLNEKTIS
                     RMKRDEIFDMAYSGRYILLMMGFFSMYTGFLYNDIFSISMTLFKSGWAWPSKWKEGEL
                     IEAHQVGTYIAGLDPAWHGAENALLFSNSYKMKLSILLGFIHMSYSYVFSLVNALHFK
                     SLIDIVGNFIPGFIFMHGIFGYLTICIVYKWCIDWVAIEKPAPSLLNMLINMFLSPGK
                     VDDELYPGQATVQVFLLLAALVCVPCLLLIKPLWFKHQESKKRYISLSNTEIDEENTS
                     DENNLLSNVDITEDEEHEEHTFGDVMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHA
                     QLSSVLWSMTIGGSFKITGFGGSIFIFFMFGMWFVLTVCILVVMEGTSAMLHALRLHW
                     VESMSKFFEGEGTPFEPYSFSSILAEDAA"
     gene            <996478..>998172
                     /locus_tag="C5L36_0E04700"
                     /db_xref="GeneID:40386276"
     mRNA            <996478..>998172
                     /locus_tag="C5L36_0E04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468033.1"
                     /db_xref="GeneID:40386276"
     CDS             996478..998172
                     /locus_tag="C5L36_0E04700"
                     /inference="similar to AA sequence:RefSeq:NP_010071.1"
                     /note="PKUD0E04700; similar to Saccharomyces cerevisiae
                     YDL210W (UGA4)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323893.1"
                     /db_xref="GeneID:40386276"
                     /translation="MGFEEFAHTTSHRPHPLRSMSSRFDDIKSQENSLRNIDATHTAG
                     DVDLLAEIGYKQELKRTFSTFQVFGIAYSIMGLLPSIASLTGLGLSAGPAGFLWGWFS
                     SCVMIVSVGLSMAELASSIPTSGGLYYWTYYYSPERYRVISSYFIGFCNALALCAGLV
                     SICYGNAEEIIAAVYLSHEGFEINRGKIYGVFVGCVITQAFATCLSSKHIAWLQSTSA
                     ICNTGLILLFFIAVPIGQKVNNGGFNDGKFMFGKVENFSDWPIGFQFVLSLFPAIWTI
                     GAFDSCVHMSEEAKNASHGVPIGIISSISFCSMLGFFIIIVINACVSKDLLAVINTDS
                     GFPLAQLISDSMGKRWAVAFMSLISFCQWLMGASILTALSRQIWAFARDDGLPFSSYI
                     KVVHPTYKVPFRAVIFAACVSIALGCLCLAGSTAASALFSLTISGNYTAWCVPVFLRL
                     TFGKSRFKPGPFYLGPTLSVLNGWITVSWGLFVFVVAMIPSTKVVDKTSMNYTVVITF
                     GVWILSMIYFFVYRYKVYHGPKSNLSPEDEIISEHESINDVHVQPLPKNLENFSAA"
     gene            <998454..>999557
                     /locus_tag="C5L36_0E04710"
                     /db_xref="GeneID:40386277"
     mRNA            <998454..>999557
                     /locus_tag="C5L36_0E04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468034.1"
                     /db_xref="GeneID:40386277"
     CDS             998454..999557
                     /locus_tag="C5L36_0E04710"
                     /note="PKUD0E04710; Pfam Domains: PTPA(2.7e-120)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323894.1"
                     /db_xref="GeneID:40386277"
                     /translation="MSDIIEPKSRLRSIEDLEAFQSSQTYNDVYTYVERLALSVHGLE
                     LTDPTLPKPKEIQSLVSLLDSIDSIIDSHPVKQESNSRFGKIEFHDFYDDLHNTSVEL
                     ISKLPFNFSEQHTTDLSAYLNNSFGDRQRIDYGSGHELNFLCFLLGLDKLKYFPESHE
                     LDKSVVLIIFAKYLKIMRRLQLLYWLEPAGSHGVWGLDDYHFLPFLFGAAQLSPMNRP
                     RPLSIHNEDYVEEFKDKYFYFGCVDFINKVKTGAQSLRWTSPMLDDISGVKAWKKIEE
                     GMFKMYKAEVLGKLAVVQHFIFTTILPCPELKENGEADDTHTHDHDHNHHGHCHSLDN
                     PLISTWGDCCGIKVPSAIAAKAAQQNKHKIPFD"
     gene            complement(<999620..>1001017)
                     /locus_tag="C5L36_0E04720"
                     /db_xref="GeneID:40386278"
     mRNA            complement(<999620..>1001017)
                     /locus_tag="C5L36_0E04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468035.1"
                     /db_xref="GeneID:40386278"
     CDS             complement(999620..1001017)
                     /locus_tag="C5L36_0E04720"
                     /inference="similar to AA sequence:RefSeq:NP_014887.3"
                     /note="PKUD0E04720; similar to Saccharomyces cerevisiae
                     YOR244W (ESA1); ancestral locus Anc_8.673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323895.1"
                     /db_xref="GeneID:40386278"
                     /translation="MTSDTEQTLDTLDAASLVPPERAKTPLFKAKQITPGSKVFVLKD
                     DTYRLADILAFQLKKGKPKYYVHYVEFNKRLDEWIGEEVIDFHRPLLLPKEPSQKKDT
                     KKQKKRSSSSNQKEKSGTPDVDKKLSVQSENKLEDDEMDLDNLNVQGLVKEGEELTRE
                     EEIKKLRTSGSMTQNNVHALAKIRNFTKVIIGNHEVEPWYFSPYPQEFTEEEQLYICD
                     FSLNYFASKKQFERFRSKCTLQHPPGNEIYRDDYVSFFEIDGRNQRTWCRNLCLLSKL
                     FLDHKTLYYDVDPFLFYCMTRRDEYGHHLVGYFSKEKESADGYNVACILTLPQYQRHG
                     YGKLLIQFSYELSKKEGKVGSPEKPLSDLGLLSYRAFWAETIAALLIDQKPSEISVEE
                     ISQQTAMTTTDILHTLQTMNMLRYYKGQHIICITDQVQQAHEKLKKKKKHKLDPKKLQ
                     WKPPVFSAAQLRFGW"
     gene            <1003040..>1004377
                     /locus_tag="C5L36_0E04730"
                     /db_xref="GeneID:40386279"
     mRNA            <1003040..>1004377
                     /locus_tag="C5L36_0E04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468036.1"
                     /db_xref="GeneID:40386279"
     CDS             1003040..1004377
                     /locus_tag="C5L36_0E04730"
                     /inference="similar to AA sequence:RefSeq:NP_012612.3"
                     /note="PKUD0E04730; similar to Saccharomyces cerevisiae
                     YJR078W (BNA2); ancestral locus Anc_7.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323896.1"
                     /db_xref="GeneID:40386279"
                     /translation="MSYTYPLPELKTYGISEKTGFLPEEVPLTRLPSYFDSWENTAAV
                     LPALLLTKRIREVIDKFDILDVSKLENEREYRRAYSILGYLGHAYIWGVDEPINKLPI
                     QIAEPWIKVSEHLRIPPIATYAGLCLWNWQELFPVEHYANDEGFLDNLKTITTFTGSI
                     DESWFYLVSVYFEYKVAPCIRIGLDAIRGARNDQPEKVIECLEALAEKIDYLGSLFMK
                     MEEMCDPHVFYFRLRPYLAGWKNMKGVGLEDGVYYGREDKPRTYCGGSNAQSSSIQML
                     DLFLNVEHHATGESNKEGGNPFMSEMRKYMPGPHADFLEHLSKVNVIRDYVMKNASKN
                     DELVLAYDACVAMLKAFRDKHIRLVTRYIVIQARKESDLGSASVQKSTLRAGLAKGGK
                     DKVLRGTGGTALLPFLKQCRDETGNTAAGSWGKRILSVQEKGEAEASKRVRRN"
     gene            complement(<1004632..>1005930)
                     /locus_tag="C5L36_0E04740"
                     /db_xref="GeneID:40386280"
     mRNA            complement(<1004632..>1005930)
                     /locus_tag="C5L36_0E04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468037.1"
                     /db_xref="GeneID:40386280"
     CDS             complement(1004632..1005930)
                     /locus_tag="C5L36_0E04740"
                     /inference="similar to AA sequence:RefSeq:NP_013484.3"
                     /note="PKUD0E04740; similar to Saccharomyces cerevisiae
                     YLR380W (CSR1); ancestral locus Anc_4.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323897.1"
                     /db_xref="GeneID:40386280"
                     /translation="MTNAMPSGRVQNLSPDQELVLKEFWMYILHFSGYKVTPHGPLSR
                     SNSVKAVPVEKHAHKSGGGSSSSGGGLFGRFKRNSKKEEEHLAKTLSNQAAIDPSVKH
                     STDVRVHEALASLDPKKVLDAFWLAIRQDYPDNLILRFIRARKWDVDHSLLMFANSIE
                     WRMKESHVDSLLHGGELECQRKGLDGVISQFKSGKCLIHGKDRRGRPLVIVRPRFHHK
                     ADQTPEEIEKFTLLMIEYSRLTLHEPVDSCTVIFDLQGFTMANMDYDPVKFMIKAFEA
                     HYPESLGVLLIHRAPWIFNGIWKIVKNWLDPVVASKINFTKNISDLEKFIEKDQLMKF
                     LDGDDDYEYEYLQPNEKDNGLAITDKEITEKLFLERSKLQEEFISKTIAWIETPDNET
                     SKSLLQERLEIQRKLTDNYHSYDGAVRNRSIYDRLSVIKL"
     gene            complement(<1006266..>1007147)
                     /locus_tag="C5L36_0E04750"
                     /db_xref="GeneID:40386281"
     mRNA            complement(<1006266..>1007147)
                     /locus_tag="C5L36_0E04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468038.1"
                     /db_xref="GeneID:40386281"
     CDS             complement(1006266..1007147)
                     /locus_tag="C5L36_0E04750"
                     /inference="similar to AA sequence:RefSeq:NP_010356.1"
                     /note="PKUD0E04750; similar to Saccharomyces cerevisiae
                     YDR071C (PAA1); ancestral locus Anc_8.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323898.1"
                     /db_xref="GeneID:40386281"
                     /translation="MSRPQHTYIRPLNLRDLPQVVLLERLCFPPPEQASPLKLEYRLT
                     VCPELCSGLFVREFDDSKLKGSELPLRSTVKRETLIGAVIGTKTNSPLVTDASMGVGE
                     GFHSVMCENGQLKEAYLTRELRELMEKQRDESLQSDTTSNVNANANVNANANVNANAN
                     ANANANDNDNATIGHDDSGSTIAIHGVIVHPEFRGRRLGSLMVKDYIQKMAQQDVAET
                     VCLLCKESLVPFYAGLGFTDKGESQCRFAGVVWHDMVLKLEHPDDDDNDNNDNNDDGS
                     GESSNNSTVDYNNVRNL"
     gene            <1007573..>1007863
                     /locus_tag="C5L36_0E04760"
                     /db_xref="GeneID:40386282"
     mRNA            <1007573..>1007863
                     /locus_tag="C5L36_0E04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468039.1"
                     /db_xref="GeneID:40386282"
     CDS             1007573..1007863
                     /locus_tag="C5L36_0E04760"
                     /inference="similar to AA sequence:RefSeq:NP_011073.1"
                     /note="PKUD0E04760; similar to Saccharomyces cerevisiae
                     YER146W (LSM5); ancestral locus Anc_8.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323899.1"
                     /db_xref="GeneID:40386282"
                     /translation="MTNSHDRADQQLPSEEASECMTLPLELIDECVGKRLRAYLRDRH
                     VFEGTLVGFDELVNLVLEDVVEVGPNRDGTGTVPSKRMLLSSRTLAILAPLE"
     gene            complement(<1008548..>1009150)
                     /locus_tag="C5L36_0E04770"
                     /db_xref="GeneID:40386283"
     mRNA            complement(<1008548..>1009150)
                     /locus_tag="C5L36_0E04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468040.1"
                     /db_xref="GeneID:40386283"
     CDS             complement(1008548..1009150)
                     /locus_tag="C5L36_0E04770"
                     /inference="similar to AA sequence:RefSeq:NP_010352.1"
                     /note="PKUD0E04770; similar to Saccharomyces cerevisiae
                     YDR067C (OCA6); ancestral locus Anc_8.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323900.1"
                     /db_xref="GeneID:40386283"
                     /translation="MDDKNTFIPPANFNRVQTTLVRGGRPKRNNIPFLKFLGIDTMVA
                     LTERSLFDGDGENGDALREYIRENGVRYVHFPVDTSVRDKGKNREIPITHGQVMEILE
                     IILNKEYGNVYIYCYNGGQITSLVVACLRKLQLWSTVSIFDEFIHYGSNVTHNDRTFV
                     QDFVPQLELSRGKLVEWIWSGLNENIIVRHPGFKNVRFIG"
     gene            <1009586..>1010626
                     /locus_tag="C5L36_0E04780"
                     /db_xref="GeneID:40386284"
     mRNA            <1009586..>1010626
                     /locus_tag="C5L36_0E04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468041.1"
                     /db_xref="GeneID:40386284"
     CDS             1009586..1010626
                     /locus_tag="C5L36_0E04780"
                     /inference="similar to AA sequence:RefSeq:NP_010353.3"
                     /note="PKUD0E04780; similar to Saccharomyces cerevisiae
                     YDR068W (DOS2); ancestral locus Anc_8.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323901.1"
                     /db_xref="GeneID:40386284"
                     /translation="MDPEVVDAQVPVVADLENKGENTTSAGFPNGNVENEKTEQLVAS
                     LENGVEKAYAALQQSAATNLAKLQGIVGQVHVNVPVPKLDNSGELLSKASERTNQVLD
                     SIDEDLEKLENLTLDYAQQIGKSIGSFINTSKTEVAKESRWGWLSGLVGGGEGGGDDT
                     RVSTGDTNGEKTAKVGSVASQGKDGKLLFLLPSGILPGTRAETQMHELQSDATFYIQA
                     DKDGEFAEYKLTEEDEAEREKLGGNQSLHLMATFNDVVTSKKVLTESKFWQIYFGRKQ
                     AIIDADQRRRELIQDKSDVRETGVADTDNTNTKEGQAGHAGHAAQGSVSESGNAGTAG
                     DDDDDENFDWDE"
     gene            <1010737..>1012884
                     /locus_tag="C5L36_0E04790"
                     /db_xref="GeneID:40386285"
     mRNA            <1010737..>1012884
                     /locus_tag="C5L36_0E04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468042.1"
                     /db_xref="GeneID:40386285"
     CDS             1010737..1012884
                     /locus_tag="C5L36_0E04790"
                     /inference="similar to AA sequence:RefSeq:NP_010354.3"
                     /note="PKUD0E04790; similar to Saccharomyces cerevisiae
                     YDR069C (DOA4) and YER144C (UBP5); ancestral locus
                     Anc_8.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323902.1"
                     /db_xref="GeneID:40386285"
                     /translation="MTMMWLFIIWMPLFQVVQLCRFTYNGCKNTPKVVLERISCFFMT
                     THTGSTSHPVEEPLVLRQLDKEVEHYVSQHESIASMKAESRRRIRRFQEARLNDLDTV
                     KSAYRDYMFCYMVSAALDDELRMKFEKVKDYIVKYTSIEFQESIESRFKSLLNGTIKS
                     KTNAPVRLDGLETGKSGRQPYKSVQLFIDIRQLMDIYHDFDCETLVIDFRPPILFRKN
                     HISLFTNIINIDPISIKEHYTIEDIRDHSFLLASREELELFGRIREFQYVVLYDQASR
                     ESDEFDHGKNTALINFKREIGKHVKNFSILEGGFEEWVRFMDDENETRHVPKVGLQRY
                     SRPLAISTNAKVPCKVSIPIISGLYNLGNSCYMNSVIQVLIGTRELTDYILEGKYEEF
                     VAKESKYGTRGGITKSYERLAKEMRKNSRKKHATKPDGFKREIGKGNKMFDNTEQQDA
                     GEFLQFLLDAIHEDLNLSSRNKHVHVSEEDEANRERLPIRLASTIEWERYLQTDYSII
                     VDTFSGQYASRLECDSCHCTSTTFIPFNMLSIPIPVLKPGHTKTVALDDCLREFTKRE
                     TLKGDDVWECPKLCKGPNVTTSKKLTITRLPPVLIIHLERFTYKGGAFEKDNKVVDIP
                     HMISMDKYWPSPRDDNEVQQLNRFPVRGQRGKFKYVHYGTIRHYGTLHGGHYTSDVDV
                     GSQWIGFDDERVGIKDKVTERDGSSYIVLYRRV"
     gene            <1013057..>1013473
                     /locus_tag="C5L36_0E04800"
                     /db_xref="GeneID:40386286"
     mRNA            <1013057..>1013473
                     /locus_tag="C5L36_0E04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468043.1"
                     /db_xref="GeneID:40386286"
     CDS             1013057..1013473
                     /locus_tag="C5L36_0E04800"
                     /inference="similar to AA sequence:RefSeq:NP_012270.1"
                     /note="PKUD0E04800; similar to Saccharomyces cerevisiae
                     YIR005W (IST3); ancestral locus Anc_7.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323903.1"
                     /db_xref="GeneID:40386286"
                     /translation="MSVSRLNAIELAKRTPISASWHRDYEDTNTVYVGGLPLEANEHD
                     LLILMSQFGVPTACVLARDRESGESKGYAWITFEAWESCVLAVDNLDQWEMAPGSVLR
                     VNHAYYRGCVEDGQMGVWQRAVREELLAKDFVQEED"
     gene            <1013981..>1014481
                     /locus_tag="C5L36_0E04810"
                     /db_xref="GeneID:40386287"
     mRNA            <1013981..>1014481
                     /locus_tag="C5L36_0E04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468044.1"
                     /db_xref="GeneID:40386287"
     CDS             1013981..1014481
                     /locus_tag="C5L36_0E04810"
                     /inference="similar to AA sequence:RefSeq:NP_014758.3"
                     /note="PKUD0E04810; similar to Saccharomyces cerevisiae
                     YOR115C (TRS33); ancestral locus Anc_2.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323904.1"
                     /db_xref="GeneID:40386287"
                     /translation="MATGSTTSMKNVSITTLEYLLNEHCARHSEAELHALGIAVGTKA
                     ALRLLEGGAPQGGPPQGDPPVLRTPLECVKFVCRDVWAALEGRAMDSLRTNHAGTFLL
                     RDAGALCYRRCWAGAPEETLGSSGRFLAFSGGVLVGALAATGVAAKVEVAGTETGGAE
                     YTVEVA"
     gene            <1014784..>1016406
                     /locus_tag="C5L36_0E04820"
                     /db_xref="GeneID:40386288"
     mRNA            <1014784..>1016406
                     /locus_tag="C5L36_0E04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468045.1"
                     /db_xref="GeneID:40386288"
     CDS             1014784..1016406
                     /locus_tag="C5L36_0E04820"
                     /inference="similar to AA sequence:RefSeq:NP_010082.1"
                     /note="PKUD0E04820; similar to Saccharomyces cerevisiae
                     YDL199C; ancestral locus Anc_8.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323905.1"
                     /db_xref="GeneID:40386288"
                     /translation="MNVHLLQQQQQQQQQHDETIEIAPGDIPGSILVGRPLLVFMSVF
                     VSICVFLFGYDQGYFSSIIVNPHFKLEFNDPSALQIGTVVAILEIGALLTSLSLTHIA
                     ERRGRRRTTRLGALLFSLGGLVQTFAWNLTILGLGRFVSGMGVGLLSGTAPMYMIEIS
                     GADQRGFLGCVQFTGNILGYSSSIWLDYACSYIDGNLSFRIPLASQVFFGLILWLGSY
                     LLVESPRWLLEHDHDEEGLVVLADLFANGEVHSPIAIQEFSSIKENVILNRFQGKLDL
                     WSTVITYPHRVFIACSAQFFAQFNGINVISYYAPLVFENAGWEGRDALKMTGLNSIIY
                     LISTLIPWKLSESWGRKPLLIFGGAGMGISLILISITSLLKHSKLVVLFVSVYNSMFG
                     ISWGPIGWLIGPEVLPNKARSGGSSLATATNWISNFIVGQLAPILLEKIQWRLYLIHS
                     ISCFTSMCVVYFVYPETKGLSLEEMESLFNDGTSSMTKSSRAPSTVESATLGIDPMQP
                     PQEPNINVQVPSLKSIHKFKTDDSRSIRSWVA"
     gene            complement(<1016536..>1017336)
                     /locus_tag="C5L36_0E04830"
                     /db_xref="GeneID:40386289"
     mRNA            complement(<1016536..>1017336)
                     /locus_tag="C5L36_0E04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468046.1"
                     /db_xref="GeneID:40386289"
     CDS             complement(1016536..1017336)
                     /locus_tag="C5L36_0E04830"
                     /inference="similar to AA sequence:RefSeq:NP_010080.1"
                     /note="PKUD0E04830; similar to Saccharomyces cerevisiae
                     YDL201W (TRM8); ancestral locus Anc_8.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323906.1"
                     /db_xref="GeneID:40386289"
                     /translation="MSDSTESISKRREYRLAKKAEKQVTFTSEAGVGKALPKKRYYRQ
                     RAHSNPFSDHRLEYPTSPSDMDWDKLFTNKDGEQEVKIADIGCGYGGLTVALAEKYPS
                     KRILGMEIRVQVTEYVEERIRALRESKKGHYGNCAVIRANSMKFLPNFFKRGQLEKMF
                     FCFPDPHFKQRKHKARIITNTLLSEYAFVLQEGGILYTITDVLDLHEWMKRHLDEHPL
                     FERLTEEEESVDPCVNIMTHATEEGKKVARNNGSKYVACYRRRANPEL"
     gene            complement(<1017685..>1018377)
                     /locus_tag="C5L36_0E04840"
                     /db_xref="GeneID:40386290"
     mRNA            complement(<1017685..>1018377)
                     /locus_tag="C5L36_0E04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468047.1"
                     /db_xref="GeneID:40386290"
     CDS             complement(1017685..1018377)
                     /locus_tag="C5L36_0E04840"
                     /inference="similar to AA sequence:RefSeq:NP_010079.1"
                     /note="PKUD0E04840; similar to Saccharomyces cerevisiae
                     YDL202W (MRPL11); ancestral locus Anc_8.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323907.1"
                     /db_xref="GeneID:40386290"
                     /translation="MFRGLFFARGLATSVRNVESVRNTLKASDSRKTFLIDMYTHFWR
                     ENEIVLLAHHNNLLSTENESIRKQLRKIDSKHTENRLEFRKLKGSLFRYFLRANGHQD
                     PASKAAARWIKRHNIRHPLENLCKGPTAAIIIKELDPKLVKDVIKFLSTQKDRLFVMG
                     GKVGDEIMTLENLEEFKNMSSLPELRAELVGLLNMASGGGVTRTLEAASSTLAMTLES
                     RVNELEKGEIKE"
     gene            complement(1018591..1018663)
                     /locus_tag="C5L36_0Etrna11R"
                     /db_xref="GeneID:40386401"
     tRNA            complement(1018591..1018663)
                     /locus_tag="C5L36_0Etrna11R"
                     /product="tRNA-Arg"
                     /note="PKUD0Etrna11R; codon recognized: AGA"
                     /db_xref="GeneID:40386401"
     gene            complement(<1020302..>1020823)
                     /locus_tag="C5L36_0E04850"
                     /db_xref="GeneID:40386291"
     mRNA            complement(<1020302..>1020823)
                     /locus_tag="C5L36_0E04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468048.1"
                     /db_xref="GeneID:40386291"
     CDS             complement(1020302..1020823)
                     /locus_tag="C5L36_0E04850"
                     /note="PKUD0E04850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323908.1"
                     /db_xref="GeneID:40386291"
                     /translation="MNKYQQQVSIQSEDMCMRPTHTYTSPAVQSVDIYDTPNNNELIA
                     YNEVRMEDQFHGDVIYEDEKDIDEKDYDEKDLDEKDLDEKDLDEKDFDEKDLDEKDLL
                     NFIEKHYYEKAYVDYDDLTKNKEDYDWFMPDDKEELQNRAGVFKKCKSLLKYAAVIYG
                     VVFMIGYFAMYRN"
     gene            complement(1021173..1021245)
                     /locus_tag="C5L36_0Etrna11V"
                     /db_xref="GeneID:40386403"
     tRNA            complement(1021173..1021245)
                     /locus_tag="C5L36_0Etrna11V"
                     /product="tRNA-Val"
                     /note="PKUD0Etrna11V; codon recognized: GUG"
                     /db_xref="GeneID:40386403"
     gene            <1022623..>1024173
                     /locus_tag="C5L36_0E04860"
                     /db_xref="GeneID:40386292"
     mRNA            <1022623..>1024173
                     /locus_tag="C5L36_0E04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468049.1"
                     /db_xref="GeneID:40386292"
     CDS             1022623..1024173
                     /locus_tag="C5L36_0E04860"
                     /inference="similar to AA sequence:RefSeq:NP_011503.1"
                     /note="PKUD0E04860; similar to Saccharomyces cerevisiae
                     YGL012W (ERG4); ancestral locus Anc_4.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323909.1"
                     /db_xref="GeneID:40386292"
                     /translation="MLLLRFGSRFKTMHYKFGTRGTRGNEKLFIFENFIKHYFNSSVN
                     SFYSPSVLFVQILLNYPRRMSEKQEESPSLYEPTTEYEFGGPVGALGMMLGFPLLMYY
                     MWISQRFYNGAVAWPTDGQTWPEFLLQMKEYVVKYAIPSKFSFIIYTSFIVTQGIFYV
                     TLPGVWTKGQPLKHLKNKQLPYFCNAYASFYTTLALVIALHWSGIFKIYYIMDNFGEI
                     MTCSIFYGFVFSISLYFYTLFISKDYHRMSGNHIYDLFMGAPLNPRIGIIDLKMFFEV
                     RLPWYTLALLGLGTSLKQYETYGYVSKECCFLTFCYYIYANACSKGEELIVPTWDMAY
                     EKFGFMLIFWNISGVPYSYCQGALYMYYHDPSEYSFSNGYMLLLVGMLLTAYYFFDTT
                     NGQKNSFRKIMAGDTNIRKTFPFLPYQVLKNPKYIKCKNGSTLLTDGWYRYARKIHYT
                     ADWIQSLTWGLCCGTSSILPYFFPAFFFVVLIHRANRDLNKCRKKYGDDWVRYEKECP
                     WLFIPYVY"
     gene            complement(<1024301..>1025059)
                     /locus_tag="C5L36_0E04870"
                     /db_xref="GeneID:40386293"
     mRNA            complement(<1024301..>1025059)
                     /locus_tag="C5L36_0E04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468050.1"
                     /db_xref="GeneID:40386293"
     CDS             complement(1024301..1025059)
                     /locus_tag="C5L36_0E04870"
                     /inference="similar to AA sequence:RefSeq:NP_011504.3"
                     /note="PKUD0E04870; similar to Saccharomyces cerevisiae
                     YGL011C (SCL1); ancestral locus Anc_4.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323910.1"
                     /db_xref="GeneID:40386293"
                     /translation="MSGSAGFDRHITVFSPEGRLYQVEYAFKAINSTNLTSVGLVGED
                     SVCFINQKKVGDKLLDPASVSYIFDISPNVGMLATGSIADARSLATRARSESAEYKYK
                     YGYEMPVDVLTKRMANLSQIYTQRAYMRPMGVALTFISYDEENGPSLLKTDPAGYYFS
                     AKAIATGPKQSEVSTVVERDFKKAKKKDPEANVIVKGDWKQLIEYGIITLSNALSTDF
                     RKNDLEIGFATKDGFKVLTPDEIDERLVAIAEKD"
     gene            <1025351..>1026751
                     /locus_tag="C5L36_0E04880"
                     /db_xref="GeneID:40386294"
     mRNA            <1025351..>1026751
                     /locus_tag="C5L36_0E04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468051.1"
                     /db_xref="GeneID:40386294"
     CDS             1025351..1026751
                     /locus_tag="C5L36_0E04880"
                     /inference="similar to AA sequence:RefSeq:NP_011321.1"
                     /note="PKUD0E04880; similar to Saccharomyces cerevisiae
                     YGL194C (HOS2); ancestral locus Anc_8.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323911.1"
                     /db_xref="GeneID:40386294"
                     /translation="MTLASWMDESQTFSPDAKMAKHTPFFEPIINTFNDGGYNPSVSY
                     HYNPNVASYHYGVRHPMKPFRLMLTDHLVSGYKLHEQMDLYETRRATKEELLSFHSAD
                     YIDFLKRITPENSAKFANDLKKFNIGDDCPVFDGIYDYCQYYAGASLDASRKLISGMS
                     DIAINWSGGLHHAKKDEPSGFCYVNDIVMAILNLLRVHPRVLYIDIDLHHGDGVQEAF
                     YLTDRVMTVSFHKYDGAFFPGTGNYEEVGVGKGKHFALNVPLQDGIDDESYIRLFKSI
                     MEPVITKFRPTAIIQQCGADSLGGDRLGVFNLNIRAHGECVKFIKSFGIPMLCVGGGG
                     YTPRNVSRLWCYETSVMTNVELNSKLPETPYKSWFEPDYSLHPKLGDRFENKNSKKYL
                     EDLRIQLLENLRYLNQAPSVQMQEIPPDIQNITDDDEAKIVERLKRESKIDKYRDEER
                     YYINKKDESRRGELLD"
     gene            complement(<1026894..>1030049)
                     /locus_tag="C5L36_0E04890"
                     /db_xref="GeneID:40386295"
     mRNA            complement(<1026894..>1030049)
                     /locus_tag="C5L36_0E04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468052.1"
                     /db_xref="GeneID:40386295"
     CDS             complement(1026894..1030049)
                     /locus_tag="C5L36_0E04890"
                     /inference="similar to AA sequence:RefSeq:NP_009548.1"
                     /note="PKUD0E04890; similar to Saccharomyces cerevisiae
                     YBL005W (PDR3) and YGL013C (PDR1); ancestral locus
                     Anc_4.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323912.1"
                     /db_xref="GeneID:40386295"
                     /translation="MYLRFSTCLFYLFDGEEGGFNCRKSMSQSSPDAMDGPRKKRNYS
                     RKGCIPCKQKKWKCDEQKPSCLNCLKNNRECSYRQILKFDDNRSFTLKGSRLANFKNV
                     HVVEKSVKSELGKKQDGQHKFSKLNVIPVSKPSDDPFNYKIPRVVQNSDDVDENIINP
                     LEFFSSTNTDVGPDKVQPSVAQMDRSPGIISQSDMENTLFDGASNLITDLNGLINSFQ
                     MDFSSLDFENQFKHYSGVDIEKKQQQQQQQDNSSNFHQTFTPSLSQIRFEGISPTNYS
                     VESLETNYSRVTSANSLASQNNLIPDVHTSSQTIRQISAGKTDEKIHDVEGGLLEAMG
                     KGGREDSNESGRVNVEKEDDEEEEEDDDDDQYSSNTPYIETLTKSLEDYGTPKHIPEI
                     ESPADSPLGYNTLVSNYSLKSGLARLNVDHLKAFPPPNKDILKPFDYIEIMNKTLTDA
                     DIEFIANFFSWSLDSVHTEYLKVFITHIHLNIIPFSTNYTQNAYVKIFLQQAKQSPHL
                     LFAILAIAARYEVYQIEQHPEIHQYEEKLNYHRTYRTYYISSCLKALESILHSRQTTL
                     DNIESLLLTIQVLASDFSGHKGSQWRTHLHGAKDLLIKYCRYRPLSLELTIVWLWFHS
                     MEVLAALTSPYGGTVHDFDELDEFLSVLCPQMPQYMKDLGRAHEIFRGESKLLKPGKL
                     TYALRYMGILVDSNKNSVDSRFNMYLGYDETLLEAFNALIYAIECIRGRESEAKLSDT
                     FQRYEGKIMNVSGKSLNSDFLLSLFSLIKKARNFQYINNQPPYIVPLGMGSHPFEIMK
                     DLEDNGENANSRLKDVLISTYIHPCKAHRSNDETVDGGVKMRGRSTQHPTELRKEVFF
                     SWIDLAQQLNTDAAFLRLLTLHKGICEYGMSIKSSLVQEVVGRMIMGLYGLVRFKEDV
                     AEDIDSDSKLKELNDRYQIREYKQDNELNEKSLKGLADWPSFQFDKYLNYQFDNRLVM
                     VQWPLYVCGLCCIEPKQKIIIECCFDGLVGLGVGSAELSFKKLRKIWKLQNLGKFDFE
                     RYNLFAYGFDDDEEDDYVPFM"
     gene            <1030700..>1034458
                     /locus_tag="C5L36_0E04900"
                     /db_xref="GeneID:40386296"
     mRNA            <1030700..>1034458
                     /locus_tag="C5L36_0E04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468053.1"
                     /db_xref="GeneID:40386296"
     CDS             1030700..1034458
                     /locus_tag="C5L36_0E04900"
                     /inference="similar to AA sequence:RefSeq:NP_010041.2"
                     /note="PKUD0E04900; similar to Saccharomyces cerevisiae
                     YDL240W (LRG1); ancestral locus Anc_2.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323913.1"
                     /db_xref="GeneID:40386296"
                     /translation="MHKHTGSITSDSSRPTIQSSPRKHLYHNLYSSPSKKDFQKFIPP
                     LNNNQENIDASLIQPLFDNRNVDNSVYAEKSMVNATNPNLYTSPSKKPTVIKKPKICK
                     VCSKQIIGTLVRAMGNIYHIDCFTCYDCHKPCSDKFFAADIEVMDNKTNEKHTINVPL
                     CEYDYFKRIDLICHTCNSAIRGSYITALGHKYHSEHFFCDVCHKVFESDNYYANEGKI
                     YCHFHYSKLYAYHCQGCKCAILKQYVEINRGGKQQQWHPECFMTHKFWKVDINVDAIG
                     LGVDTIDDVTSDPEQLYKVSTTLENLTISIWTTLSEFEESCASLISEMLHAATTNSKS
                     KGLSFTSKLIFKIYCLFKCLDCLSSFSSTYNISIDHSLPKYQGFSKLTKEPRSLTSKL
                     MSYLTFLRDIDPEKLSMNKYSQELLSLISSIAHFIKLISRNALMYSLEYNRLSNSMKP
                     TEILLNEIANHEKYKKDLFHVSSKSNDTCSHCHQSIEDDCILYKIDESNEKRWHLNCF
                     VCSKCSGNTVISITDVSEAAYNRKTGAVLCPSCASDDVNSATGFTVVTRFIQLAYLLE
                     IALFRSKVVINKRVKSGHSKQHSSVSATTTPTSFSDNSRKPSDASNKHSILRKSSHSR
                     QDRESIKREQQQQSEQHQIPKNDSTDSYENNVSEIARRRSLREARTLNNVDQEIRKSV
                     ILEAPIAWSADTENIPEPSAASDKYQPKNEAEKVEKMVSNSQSRVGTTGSMKLRVKDL
                     SIKKRAFQNRQQPVSSYDYRENNHHTKSPSDDKIGASINAAITSKLLQNESSLTLDDI
                     PRIVSSEQAREHRPNAFKFQKRDYSSAISNMPVPKTIETTSNNQLEISEKKDSKQTPT
                     HRPKLSINDIEDSAEKKPVNNVVRYSELSYNAHEIIRHIAAIALYEIFPNQVTIEYCT
                     TLIDVHKAPSFWGKIFGGGGNSSSIHSSSPSTSSNDFKSGSATISGSGKGVFGVPLDA
                     VVKKFGTDSDLGVGTRKVRIPLLVDELINVMRKQDVSTEGVFRLNGNIKRLRQLVEEI
                     DSHPDRTPKLDAETPIQLAALLKKYLRDLPVPLLTFKLYDLFLLSQKLGSDPDSSDDD
                     AIARKRERVLKLAYAMLPKPNRDLAEVLFAFLSWVATFAEIGDEDNGGGGSKMDTHNL
                     ATVITPNILYSNESIHRSQSEAINDGFKLINSEGGENQFLAIEVINDMIEMNEELSIV
                     PQDIVELYKLAGFDRKLDEKDKKNSLITKDILAKLKQVIETNPTVLTK"
     gene            complement(<1034556..>1037546)
                     /locus_tag="C5L36_0E04910"
                     /db_xref="GeneID:40386297"
     mRNA            complement(<1034556..>1037546)
                     /locus_tag="C5L36_0E04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468054.1"
                     /db_xref="GeneID:40386297"
     CDS             complement(1034556..1037546)
                     /locus_tag="C5L36_0E04910"
                     /inference="similar to AA sequence:RefSeq:NP_013958.1"
                     /note="PKUD0E04910; similar to Saccharomyces cerevisiae
                     YMR231W (PEP5); ancestral locus Anc_8.761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323914.1"
                     /db_xref="GeneID:40386297"
                     /translation="MSLLSWRHFPFFEGTPIKDPHFGSEQHALYSDASLSAICAAGRY
                     IAIATRQTTVQLIDQNIEKAFSFPCYHEGWTITKLAYCQYEESPFLVTIAERQGYPLY
                     LKIWNLNKVMNMKSDKFDLDSSYLTQCSVNNEKNNYPMTCFAHINDLSILAFGFSNGS
                     VIIVRGDLIHDRGSRQRIIYQDKEPITSVTFKSNDLLYASTFSKIFTLSTSGRNDRKI
                     ERLLDDNEGADLDCTCLYGSSLLVSRESCFQFYDTKGKTRSIQLSIPKKKTHLYHDRY
                     LVCISETSTTDFSESSISSNKLLILDLKNNFVVFNQLITSAVSDIFEIWEDLYVLVMD
                     GSLLRLHEKNIKENIEILVKSDLFPLALKLINENRKAFTDNEVMNIEKLYGFYLYNRN
                     DFGAAIDQFIACIPLGKTSEIISMFKGSSKIQYLIRYILKMVELKISTPNHIDLLLTS
                     YCKLKMLPEFERFIRDIETDDDYDIIPTETHKSFDIDSIIQLCKDNEYYSLALVIAEK
                     FQLASKVVSIQIHDLKDPFSALDYINSLPIDDLLRVLVDNVSTLLNMLPNETTQLLID
                     VFTGKYTIKSRTSERGKETDNSSTFSYPIFTSYKQFSKFMNTGQGDDEIEEEKIPTYQ
                     PPRPRMVFSSFMNHNYQFVIFLEACVESYEKYDGNSQDKSDIINTLYELYLTLAQSDK
                     ANKQDWEEKAKFLLYQRKEWSEEEKSKLILISNIYEFSEGEMIIREQTESISDLNIEG
                     YELDLFRSSIFASDIEKSYDIVLKYGHKEKELYRLALLTYTSSNAYYEKIGDKRLQNL
                     LEIIEQENCLTLLEVLDCLTNEDTNVRLGVVKNYLLRNIEKQKLEIQKNEELKNAYES
                     RLSNLKSNIADLMNDPKILNSTKCSVCNNPLEFPMVCYKCGHQIHEHCLIESTSGKSS
                     LKGMSSNFVLGDTDEGFIPCPICVTDQDALILSKKQQEDFSLRQDLFKSTVRVSSDKF
                     KSMFSFLGRGGMETSKLVYDGSSV"
     gene            <1037876..>1039543
                     /locus_tag="C5L36_0E04920"
                     /db_xref="GeneID:40386298"
     mRNA            <1037876..>1039543
                     /locus_tag="C5L36_0E04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468055.1"
                     /db_xref="GeneID:40386298"
     CDS             1037876..1039543
                     /locus_tag="C5L36_0E04920"
                     /note="PKUD0E04920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323915.1"
                     /db_xref="GeneID:40386298"
                     /translation="MLPDTSSSISQLETFKTPASIEEVLHDDVYKPYITPPTPFEEHT
                     KRKSEMGEPNPYAQSLWWASRGEDGSTDIQRRRTIKKATVESVSSLGDYSVAEKPLNV
                     ETGVPFIETVKRSQLLPSLMGERENIDDMAINQDCDYDSKETIKKLRPLNDPPPFTLI
                     NILSKMVKKLRCLVKIRSSFEVYTDKNQLFINPKVKLYLFSNIQTLLIIHEQFLNSVL
                     GPYPLEDTIYDNLLRLHHVYPSYLNSTALRQHFTKLVIQNNAFKAFIGDLDTETAEDN
                     EFYLLVLSPALDFHTLINYIDTYLGESSPRIHHLINKFYACYKPSGPIMSFDRNEPIY
                     LVIPDNWKEANLNEWKGISNKSVESQLAYYLNWRLERLLKSYKNITGNVEQQADIVSH
                     LAINNKLLSQSIEKLSTHLAFDTRRGQFQIPAMELHDTNKRIYHIVNEFVTFLRDGVL
                     EETVQMVINAVEVCRNVISDGYGEIMEVYTTLVLFEEHIALISEKYGCFIKEYLDCIP
                     SKPVNINQLISRYVKSRERELHREEIGGSEWEKRFMRYRLVRRLFHV"
     gene            <1039703..>1041634
                     /locus_tag="C5L36_0E04930"
                     /db_xref="GeneID:40386299"
     mRNA            <1039703..>1041634
                     /locus_tag="C5L36_0E04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468056.1"
                     /db_xref="GeneID:40386299"
     CDS             1039703..1041634
                     /locus_tag="C5L36_0E04930"
                     /inference="similar to AA sequence:RefSeq:NP_013466.1"
                     /note="PKUD0E04930; similar to Saccharomyces cerevisiae
                     YLR362W (STE11); ancestral locus Anc_4.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323916.1"
                     /db_xref="GeneID:40386299"
                     /translation="MRETERSTLLELLKSVDCAEYLPLFNTQEITPDLLASMDKDAIQ
                     ELGVWKVGDRLRIQLLVKLLRIENIKGELNVRTLRKSIQVSSSSIQNTMKAINIDSMK
                     PKPVHISLILPDGKTLGLDVSTIDGIKKICELVNIPNGRLSFIDYSNSGRVHEIKTDH
                     ELAEILNADTDRSNIKHRLIVSKNADLTVDSINTSNKIHMRGNTTFSKGQSIKPFMGG
                     RPPSELISTNLRDYFPDLNHEEIEDIRRRSIRMSINGQKLIEKLGNTPVGNRFTLSST
                     NVRNSVYSRLSNISLASNRLSMASMMSGISDVSSYGIGQAVKIEQVNSRKLEEAHAPA
                     EDQNDTMIELMDESEDEEYFDIDNDLLEKEVTDGPSVWHRGPKIGQGSFGDVYLGLNG
                     LTGELMAVKQVDVNIGGNKTPSEGNETKITALKREISFLRDMAHERVVRYLGCAQDVN
                     RMYIFLEYVPGGSVASLLGLYGAFAPPLVRSFTNQVLIGVQYLHSKGVVHRDIKGGNI
                     LVDNTGGVKIGDFGISQRINEEADAKNKKSESLQGSVYWMAPEVVKQQSKDTGPAADV
                     WAIGALVVEMFTGTHPFPTLAPMQALFQLGTGKVCPDTPDAANENARAFLKRTFALQC
                     HERATIEELLEMKWFKESM"
     gene            <1042151..>1043770
                     /locus_tag="C5L36_0E04940"
                     /db_xref="GeneID:40386300"
     mRNA            <1042151..>1043770
                     /locus_tag="C5L36_0E04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468057.1"
                     /db_xref="GeneID:40386300"
     CDS             1042151..1043770
                     /locus_tag="C5L36_0E04940"
                     /inference="similar to AA sequence:RefSeq:NP_013465.1"
                     /note="PKUD0E04940; similar to Saccharomyces cerevisiae
                     YLR361C (DCR2); ancestral locus Anc_4.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323917.1"
                     /db_xref="GeneID:40386300"
                     /translation="MLNKKILRAILYLLVAMVATCIVIYTRHRNETIPLSSLLSPSPE
                     HGHVVIDVGFKTCWVSTICTDSIKRTYTFLENISKEKELTDSLQINHLGKDLLGSSSY
                     IKKIFPYEVKIPVEIANKYKVTPISQFYVENVNNDDTLTSDFIDAGYGLHFKRSVTIS
                     PYTDINFIFSSLQTNPTPGWEQVSKFPLVIHKSDFYTNGTDTNLIDFKSTNYHSLDHQ
                     VYLHAKKGGSDKTNVSLKPKNGKFKVAQVADLHLLTGFGKCMDPFPELDYPVENCLAD
                     RDTMSFVDELLEMEKPDLVILTGDQVFGPYTYDTETALFKAVEPMVKREIPYAAILGN
                     HDHEGSLTKSEIMELFEKFEYSLTKSTPDLNYLINIGDPERPDVTLYMLEAANIRNPK
                     QLVKNFTPQGDFIRNHHSEAEFKMGVFHIPTKEFQDVRFRDPNSYLGSYREWVMARNM
                     EEGLFQALNEEGVKLITIGHDHVNDFCFENQGINLCYGGASGYGGYAGFGGYERRIRL
                     FEFDTQKKEVSTWKRVHHDIDKIVDFETFAY"
     gene            complement(1044569..1044667)
                     /locus_tag="C5L36_0Etrna11K"
                     /db_xref="GeneID:40386400"
     tRNA            complement(join(1044569..1044605,1044630..1044667))
                     /locus_tag="C5L36_0Etrna11K"
                     /product="tRNA-Lys"
                     /note="PKUD0Etrna11K; codon recognized: AAG"
                     /db_xref="GeneID:40386400"
     gene            complement(1044676..1044747)
                     /locus_tag="C5L36_0Etrna10E"
                     /db_xref="GeneID:40386396"
     tRNA            complement(1044676..1044747)
                     /locus_tag="C5L36_0Etrna10E"
                     /product="tRNA-Glu"
                     /note="PKUD0Etrna10E; codon recognized: GAA"
                     /db_xref="GeneID:40386396"
     gene            complement(<1047325..>1049865)
                     /locus_tag="C5L36_0E04950"
                     /db_xref="GeneID:40386301"
     mRNA            complement(<1047325..>1049865)
                     /locus_tag="C5L36_0E04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468058.1"
                     /db_xref="GeneID:40386301"
     CDS             complement(1047325..1049865)
                     /locus_tag="C5L36_0E04950"
                     /inference="similar to AA sequence:RefSeq:NP_011501.1"
                     /note="PKUD0E04950; similar to Saccharomyces cerevisiae
                     YGL014W (PUF4); ancestral locus Anc_4.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323918.1"
                     /db_xref="GeneID:40386301"
                     /translation="MSDQTTISSFEDSLSQINVNANLTTNTTPPIGDYHGNNSSVGNT
                     TSRQSNSTSSIVAPSSSSIPVTDVNFNTLPNVLSSLNLDENTIFKNATAPTTATATST
                     NTNTTNTPPINWTSNPTNPSSNSYNGFSVMQDLPVNVGHISSTSKHQHTASSASGNSS
                     LKDENYDSSFNNGNTSAMRIADENNANRNSFILPDSYLFEQPITNTPNSSVLSPNKTR
                     TATFTTPVLGETSRRLNYNLASPNNQGINQLNAQSMGNEALGMGIAPGILNPNDPSSI
                     FSNCMPNQFGFPNNTSTPPLNGLPTGLMNPNQPALNLFNAGFPQQVINNGYPQHILQQ
                     NYSFENGTNPNIIRPSGIEPNFSGTTPNNGAANTKGNNVNNNNSSNNNNNNGNLLSHR
                     SNLGINSTANVHRKHSSNNKRGEDAARFVNATLNDFINEIYYLCKDQHGCRFLQRQLE
                     LNSELAATKIFNEIQLNVIELMIDPFGNYLIQKLLERVDESQRTTLVRNASSQFVRIA
                     LDPHGTRALQKLVECISTETEYKIIINSLSSYVVLLSRDLNGNHVIQKCLQKLPPNYC
                     DFIFEAACENCVKIAKHRHGCCVLQRCFDHGTPKQCEQLSLKVGENAVELSIDPYGNY
                     VVQYVLSMEENRLRLQNDPSSATKIPDTSKSIDLIISSLANNLTKLSTHKFGSNVIEK
                     SLRIPTLSPILIKQLLSHPESLKLLLHDAYGNYVLQTSLDVADDSSFKELSEQLKPYL
                     SDVRNTPHGRRILSKLISRGGNAAILNANLGENFSLESLEQPNNHNNGHRRHHNNNNN
                     HYYHHNHNNNNNNYSHSQNQNHHHHNNNNTGNYNLGYNSGSGYNNKSW"
     gene            complement(<1052905..>1053831)
                     /locus_tag="C5L36_0E04960"
                     /db_xref="GeneID:40386302"
     mRNA            complement(<1052905..>1053831)
                     /locus_tag="C5L36_0E04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468059.1"
                     /db_xref="GeneID:40386302"
     CDS             complement(1052905..1053831)
                     /locus_tag="C5L36_0E04960"
                     /inference="similar to AA sequence:RefSeq:NP_010716.3"
                     /note="PKUD0E04960; similar to Saccharomyces cerevisiae
                     YDR428C (BNA7); ancestral locus Anc_5.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323919.1"
                     /db_xref="GeneID:40386302"
                     /translation="MLAVETEILSYGEHTQRERIKRYLIPGERPIYRGVIAIHGGAWR
                     DPNNTCSDFDEYVQKWAEMNDIEEGRKRGLGMVVYSVDYKLSCERGVFPQIVFDIMGA
                     LEVIKGDSRQFWAEEEDGGNVSSYNDNDNNNDNDNNNNNECHGDPQSKELDFTIVGHS
                     VGCTIITQILEIDSVRCGNDIGLLPLISRAVFLDGIYNVESMLSEYPEYEFFILEEFG
                     SIENSKRCNSITQGCVCISPLVLQKWQQLQDILIIHSSRDELLSFKQADEFRDWLKAN
                     GLYQFQCIYKDFGMHNNVYVNPEVAAVVYRYI"
     gene            <1054746..>1055666
                     /locus_tag="C5L36_0E04970"
                     /db_xref="GeneID:40386303"
     mRNA            <1054746..>1055666
                     /locus_tag="C5L36_0E04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468060.1"
                     /db_xref="GeneID:40386303"
     CDS             1054746..1055666
                     /locus_tag="C5L36_0E04970"
                     /inference="similar to AA sequence:RefSeq:NP_013971.1"
                     /note="PKUD0E04970; similar to Saccharomyces cerevisiae
                     YMR244W; ancestral locus Anc_8.793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323920.1"
                     /db_xref="GeneID:40386303"
                     /translation="MLSIKAVSLIVLSCFVSESISAPTPAHFHHAHKRDNGKTCSFPN
                     SNGMVQVFNNKDSSSEGWAQDGPCKAGSYCQYACQPGYLMGQWNPQVDTYSYPGSQDG
                     GLYCNEDGELSKPISNNDYCYKGKGTAQAINKTGQNVAFCQTVLPGNEEMLIPTDVSA
                     GSSNDLAVPGTDYWAKTASHFYINPPGVSAEEGCRWGSTANPYGNWSPYVAGFNMDDS
                     GNTYAKIGWNPIYFEDSSPFKNEKPSFGVRLKCDDSSKCNGNTCEINPNTYGLNKVSN
                     SGEQQDSDGAAWCVLTASGNSGVSIEVFDL"
     gene            <1056798..>1058510
                     /locus_tag="C5L36_0E04980"
                     /db_xref="GeneID:40386304"
     mRNA            <1056798..>1058510
                     /locus_tag="C5L36_0E04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468061.1"
                     /db_xref="GeneID:40386304"
     CDS             1056798..1058510
                     /locus_tag="C5L36_0E04980"
                     /note="PKUD0E04980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323921.1"
                     /db_xref="GeneID:40386304"
                     /translation="MRIIIDLKGFDSTCISVNLKSYAPSAFALQSTVQFEEARKGGYK
                     GFDRADLEYRAYYLLQRQTFIYYQLSMLRYLLSKPHRETFFPRKLYYVGPHSFIPSKE
                     DIDDYIEKPRVVYLFSRHNYNQFVSIVMSRKNETELQLLKIEEDHSGIKEFVQSNWRS
                     FKDGIYKVLLIKEPGFTVFDWEKFDRFYDKFSCSLQWFETLDIRNSPEVYLHELRDGL
                     ALSEYLSFVITGQCRGGNRSMLYDRVKSIEETNHEKRKVYGIEHGAINLLLKGFELRE
                     KIHRHRQRRREWNDLKIEDNAAGKEVRKASGVEGRYNSCTMNASTITEVGSTTSSVNG
                     LGTESVDFFEKLCSTLRAEKNKHSWCIHTPQKTKEPKEKEKEKKKSKEGFILNEVADA
                     YGRKTPNSKNIGPWLSRVVANRRSRRDESACHTNKIVKDALLTDSAHPYPFFKFVQGV
                     YGSDCELDQPVMVGEEYVRYGWTFYREAALWDEVVATYQEITPEEDRYFGYNTRTKRW
                     SSWWNRYDRRVCSALQQLQKRYLDVNSGTSKLQQLSDQEARDRDNVLQVTSMNVNTGK
                     SSES"
     gene            <1061005..>1062468
                     /locus_tag="C5L36_0E04990"
                     /db_xref="GeneID:40386305"
     mRNA            <1061005..>1062468
                     /locus_tag="C5L36_0E04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468062.1"
                     /db_xref="GeneID:40386305"
     CDS             1061005..1062468
                     /locus_tag="C5L36_0E04990"
                     /inference="similar to AA sequence:RefSeq:NP_013970.1"
                     /note="PKUD0E04990; similar to Saccharomyces cerevisiae
                     YMR243C (ZRC1) and YOR316C (COT1); ancestral locus
                     Anc_8.792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323922.1"
                     /db_xref="GeneID:40386305"
                     /translation="MGLSKKEIKILTLLFIDTAFFFLEIIVGYMVNSLALIADSFHML
                     NDIISLVVALWAVNVAKNRSADAEYTYGWLRAEILGALINAVFLIALCFTILIEALQR
                     LLDPPTITNPKLILVVGTLGLISNIVGLFLFHEHGHSHGGGVDSGDGHSHSHGGFFTP
                     QDEESEIEDVHGHNHNHNHSHADDGAHADTHADVHGHSHAERPRSKSVYSKHATNETT
                     PLMDSAFGESEEDLRKIMPSYVVGQLDRPATKKPRGNKNEAHQKSMNMEGVFLHVLGD
                     ALGNIGVMASAIFIWKTDYSWKYYFDPFISLVITCIIFSSALPLCKRSSRILLQGTPS
                     TVVTSDVIQDVLQIPSVIGVHDFHIWNLTEKLMIASLHIELDCSPDDFLKVASDIKAC
                     LHDYGVHSATIQPEFSAYYNKQHMLPHSFSSSSNLKQDAANSALTSAPPIFNISSNVQ
                     SDAPASSSTDRTQVDKKNDIHCLIDASVNCTTTNCLK"
     gene            complement(<1062612..>1064294)
                     /locus_tag="C5L36_0E05000"
                     /db_xref="GeneID:40386306"
     mRNA            complement(<1062612..>1064294)
                     /locus_tag="C5L36_0E05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468063.1"
                     /db_xref="GeneID:40386306"
     CDS             complement(1062612..1064294)
                     /locus_tag="C5L36_0E05000"
                     /inference="similar to AA sequence:RefSeq:NP_014960.1"
                     /note="PKUD0E05000; similar to Saccharomyces cerevisiae
                     YOR315W (SFG1); ancestral locus Anc_8.791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323923.1"
                     /db_xref="GeneID:40386306"
                     /translation="MSHDTTDNKTIFQSPFLGPSSASMNIPKLLPPKKNVSSPMKRIH
                     RRKNSRGAMELEALHSQTRQPLLFNKSSHGETFSILDDFQNQASSEPIDLFTPLLPPP
                     TKLPQNATENRSDTPNKKMKHDVQDRSFFDIGFANQPEGGCSIFSMVPQIGTSRPFNF
                     SSYLKSVTSQMNIPQETGNYKNTLLDFTHPTKIDITETNNGSLMDDLELDCVMRSNTW
                     DSDVETEDELELDLNLQTETNDLSIESPNTGLQSLHSNSLKRPIDSNIPSLYDPYSNV
                     FTTKRNSIIKARNNTTSGIPLKIHSDLNSKVRSSISSQESDETLNEDNHLKRGNSHHQ
                     VTIINDKHSKCLPHHHIFVENLKSAMKPIPSSLLNLIVESSDGSLDDATKYATEINAQ
                     NSNGIPIPEKTTEVVNIPTSGPAINGVRKSAIIKGFRAKANPSRRKQQSASAKPAIHN
                     TLSERREALMNQSSSDQNINSNVTNFKGFYSLQEKQQFYKRNGMNTVDEGKENRHSHL
                     GNSNIYEIKDPGTLNLNTSAFKRPRVGESFYVKEGINNKGQKKVYWADSLEW"
     gene            <1064924..>1066087
                     /locus_tag="C5L36_0E05010"
                     /db_xref="GeneID:40386307"
     mRNA            <1064924..>1066087
                     /locus_tag="C5L36_0E05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468064.1"
                     /db_xref="GeneID:40386307"
     CDS             1064924..1066087
                     /locus_tag="C5L36_0E05010"
                     /inference="similar to AA sequence:RefSeq:NP_014958.3"
                     /note="PKUD0E05010; similar to Saccharomyces cerevisiae
                     YOR313C (SPS4); ancestral locus Anc_8.790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323924.1"
                     /db_xref="GeneID:40386307"
                     /translation="MYTYTNNGKVCVAETEFPKTMSGLSEKVASNGEFANIVTLSKRL
                     SNEMHVAEAVSIGRNGNLGTSPVSKGKDSGSPCKETEQSASVPQLHETNEDTEIKTCR
                     RLQTYPIVVSWVRINHWIPAFHIVRPRLLRMAYSDLLLPVTIATDTFLNQLLIQLEEM
                     VPSIKTLRMRDIRNKITDNPIKKLLQETSTILAKASIVSGKVSILSSGNGIGKLRRFR
                     RKNIAFTKRSLQSQPPSQLQLKKSENYSRLPLDIDEALIVKDTRLSSRSVQSGEATNE
                     VSHSSQRLDTAISEPRPVLDGMLSQISKTHSTAVKYMTSTYYISKKNRGHGKVVVVIA
                     TLETIRRLMSDGRKLATSSTITGFLCKEPIPREHGSNKEETRRQLKFDKEGRN"
     gene            <1066522..>1067508
                     /locus_tag="C5L36_0E05020"
                     /db_xref="GeneID:40386308"
     mRNA            <1066522..>1067508
                     /locus_tag="C5L36_0E05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468065.1"
                     /db_xref="GeneID:40386308"
     CDS             1066522..1067508
                     /locus_tag="C5L36_0E05020"
                     /inference="similar to AA sequence:RefSeq:NP_014935.3"
                     /note="PKUD0E05020; similar to Saccharomyces cerevisiae
                     YOR292C; ancestral locus Anc_8.759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323925.1"
                     /db_xref="GeneID:40386308"
                     /translation="MAIKLFGHDNIIAGTADSVSLVGDTVRDARLSDSFNAMRLEVVR
                     AIHRIGKVVGNDARILNVPLINYGVLSIFGCLLIKLTSKYNHLYTRSSLLATIATNVV
                     LYGISDTCAQSITQFLQGRNGRRTRNDSRNIITLHNNIDGYRDNDEYDESNIFVDYGD
                     SYESEYENENPTDLETGGQLEPPIMDTITRTGFEFKRFFGFVTWGFIMAFVQVVWYMF
                     LNAMFNDMPTIVSVLERDLTDQLLFSPISLACFFAYTTIVIEGGDMDAYKEKMLKLYV
                     TTYVISFSVWFPVQFINFSIMPKHFQVPFSSSVGVIWNCFLSFRNAAAKTDN"
     gene            <1067627..>1069369
                     /locus_tag="C5L36_0E05030"
                     /db_xref="GeneID:40386309"
     mRNA            <1067627..>1069369
                     /locus_tag="C5L36_0E05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468066.1"
                     /db_xref="GeneID:40386309"
     CDS             1067627..1069369
                     /locus_tag="C5L36_0E05030"
                     /inference="similar to AA sequence:RefSeq:NP_011573.3"
                     /note="PKUD0E05030; similar to Saccharomyces cerevisiae
                     YGR059W (SPR3); ancestral locus Anc_4.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323926.1"
                     /db_xref="GeneID:40386309"
                     /translation="MSVVVEISSLSLSLFGQSFFRSSKTITIVCAISIPMQQNTIVGK
                     DQINIGKIVRKDLNAHYSLNRSLSGFEFCLEAKVDEFSEGQLNQRSLNVDSEGDNNIN
                     TSYEGNILNKEDNITLDAYPVGDDLKEKKNNYNYGTPVTDISPNEIGLACIPVQRSHK
                     VRKNGTNLTIMCVGMSGVGKTSFINTLFNSLRDDRQTLNTEELEAIPSETCYMQHHKM
                     DLVEGEFTMTLNVVDTPGFGSFIENKHCWYAIVRYIDEQYRKLFYQENQPNRSNLVRC
                     EVHACLYFIVPSAKGLSQIDIEAMKSISPRVNLIPIVSKADGFANNEMTIIKQRIREI
                     LQEQNIRICGLTDVKSEMTSSIDVMPFSTINSIERHKSGNGKLVHDRKYKWGLSEVEN
                     YSHCDFLLLRDFLIKNHMDELISSTENYYEKFRIDFMVYILGKALTMGVYENEEEQLG
                     IKNTSKGTIVPCSRNRWNGGKMNNNHSHSSIEQLIETKTSNQVLSLLNNVPFDEIEEE
                     LADCDPVYLEKGKLVKKQLAEAVQIKNQKLKNWKRKLYEKQDQFNEDIRSLLQKLDSL
                     QHSIETLDHIVWSL"
     gene            <1069767..>1070568
                     /locus_tag="C5L36_0E05040"
                     /db_xref="GeneID:40386310"
     mRNA            join(<1069767..1069818,1070255..>1070568)
                     /locus_tag="C5L36_0E05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468067.1"
                     /db_xref="GeneID:40386310"
     CDS             join(1069767..1069818,1070255..1070568)
                     /locus_tag="C5L36_0E05040"
                     /inference="similar to AA sequence:RefSeq:NP_013957.1"
                     /note="PKUD0E05040; similar to Saccharomyces cerevisiae
                     YMR230W (RPS10B) and YOR293W (RPS10A); ancestral locus
                     Anc_8.760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323927.1"
                     /db_xref="GeneID:40386310"
                     /translation="MIIPKADRRQIFMALFKDGVLTAKKDYEIQHDEIPTKNLYVIKA
                     MQSLTSKGFVKTQFSWQYYYYTLTDEGLEFLREFLGVPEGIVPQTLMEQPIPQREQPR
                     REGGRRFGGNNEYRKRNRD"
     gene            <1071285..>1072442
                     /locus_tag="C5L36_0E05050"
                     /db_xref="GeneID:40386311"
     mRNA            <1071285..>1072442
                     /locus_tag="C5L36_0E05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468068.1"
                     /db_xref="GeneID:40386311"
     CDS             1071285..1072442
                     /locus_tag="C5L36_0E05050"
                     /note="PKUD0E05050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323928.1"
                     /db_xref="GeneID:40386311"
                     /translation="MPTIINNYYYVQPNQVGIPPTSSGPNFPVVSSQSNPIKESPNNQ
                     SRRQYPQQYKGSRYYEHDNRHVDSLSSCSEPHSIHSSESTRIGSYDDSRDCRHQHHHH
                     QNYSQSQNLPAKGSSIHSKHSPTKYTHSGVSSPKTSQSNERRLNDEDTYNMFITKSSS
                     QLKNPVAYSTSRKENIDSVYNSDRDIYSSTSVMETPRLKGSDLDMKAKIPDIEPDGIL
                     DNFEKLSLKNNFNLIFELMKFSDEDINVHNNQFYSVFKSCCDEGRLMSLETLGSILYD
                     PYDLKSRFSFKSLKLITQTFVSKTSQELDFRGFVKMCKFVKGCYVSFNYHDKRGTGHV
                     LDFEEFQLALLSNGIEISDRLLAKIFENTEYVDFEHYIAAIILIRTSEKKS"
     gene            complement(<1072485..>1074170)
                     /locus_tag="C5L36_0E05060"
                     /db_xref="GeneID:40386312"
     mRNA            complement(<1072485..>1074170)
                     /locus_tag="C5L36_0E05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468069.1"
                     /db_xref="GeneID:40386312"
     CDS             complement(1072485..1074170)
                     /locus_tag="C5L36_0E05060"
                     /inference="similar to AA sequence:RefSeq:NP_013954.1"
                     /note="PKUD0E05060; similar to Saccharomyces cerevisiae
                     YMR227C (TAF7); ancestral locus Anc_8.754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323929.1"
                     /db_xref="GeneID:40386312"
                     /translation="MAKIKLKLSSKPEEDVGAESPKITIKPLKSKKTVALPKIKLKTP
                     SSTSTPDVKFKTLETGATTNSFIPDTEIKLKTPKIKVKPAKLPGNGYDSEDPDREEDP
                     LVEEAIVVRFLPDENLDIVRSDESQVSITWKDKRRAVVSIGDALYAAKLVNLPTVSEV
                     HKSVDRKNLYKTVDVSQMLLVIKRISDRSEISSLKVDKEAGETYPDGLTTPMEGIKEK
                     FDKKYETLVIQNVEDEVAKLLKMDEEAESSVFEFIDAEEENLTPVGIIEDRLRNKRAK
                     KEKKKRKREMEKQQRVNQQSSNLPGISESGSVLKDDEELNLNDQFEDIDDELDRLMEE
                     GGKEDDAEEGDEDDDDEDDDDDEEEEEEEEEVEEEEIDAAPTPASVKAESDDEDDEDD
                     EDDDDVVGPAIRNGDGEADEVAQHSALLHEEISELESTIAQKEKDLAKAFNPIMKNRI
                     TDVISRLQQELEMKRTQVAEVDAEKKREEDAKTISGNTQKNANQDAEEGEEEEEEEEE
                     AEDVDVDVDEKNDETDDNAGAEEDEDEDGVGDKDTSIHETGEDNDEDEYDDLF"
     gene            <1074373..>1075422
                     /locus_tag="C5L36_0E05070"
                     /db_xref="GeneID:40386313"
     mRNA            <1074373..>1075422
                     /locus_tag="C5L36_0E05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468070.1"
                     /db_xref="GeneID:40386313"
     CDS             1074373..1075422
                     /locus_tag="C5L36_0E05070"
                     /inference="similar to AA sequence:RefSeq:NP_013955.1"
                     /note="PKUD0E05070; similar to Saccharomyces cerevisiae
                     YMR228W (MTF1); ancestral locus Anc_8.755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323930.1"
                     /db_xref="GeneID:40386313"
                     /translation="MQKFYTSQKTIRGALDLLGEKKIKGFRFLYDDETYNQILQKLGL
                     EEVYGKNKVNIIDYNARISPLTYYLNTKLKPIHHLIYPDGQSSQKFWERIQKTETEMA
                     NFHVLKNSVSSTVKANLLTKPLEQKLIEPRFTEEPVNDSLLFVGDFMSTTQASALRTC
                     IYYNEVRTSIFRYGGVKFLAWTTPMEVLKYLGPLGSLHRRTNSMMANLYSDIRVIACS
                     EQLKNAKAQRLLGGMDYVPLPYNDYEGEVCLVELQSNHRKYKIDHQDELHLIIHKLFC
                     TPGALIREKLHVLGPGAEDYFVDIIPEEVLNKKVSMVTNEEWVALSNDYYYWPFKPDT
                     RLETYATADSYFDDV"
     gene            <1075672..>1076733
                     /locus_tag="C5L36_0E05080"
                     /db_xref="GeneID:40386314"
     mRNA            <1075672..>1076733
                     /locus_tag="C5L36_0E05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468071.1"
                     /db_xref="GeneID:40386314"
     CDS             1075672..1076733
                     /locus_tag="C5L36_0E05080"
                     /inference="similar to AA sequence:RefSeq:NP_013467.3"
                     /note="PKUD0E05080; similar to Saccharomyces cerevisiae
                     YLR363C (NMD4); ancestral locus Anc_4.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323931.1"
                     /db_xref="GeneID:40386314"
                     /translation="MTVYHYILDPSALVYGGVGKIKEWVATAQRQNQFQIVFYVPLYT
                     LKELDFLKKVFNPLISANARESIRFIDEQISGVFDGFENEKDFTDFETYNQMKSQSTT
                     TDGPLTGKTPSPVTFILETENNVGPSWQIASGYRRSTPLVKDMPKPINGSSTQGQLGV
                     DTQKKVIGVFGNNIPGTFNVSKQDKHQLNNVQVQTKDKAVVPIRLKYLIRSCIQKQYI
                     ENKRSPKIQWQVICEDATTAIWLKSFGLTVKSVNEITKEFDEYSGTATSKVLFDPVSG
                     KLVESTETKKKKNAGTKKKKYRRNPRGGKPGHGNGKEVQQQGQENSKINGQTNTEVKP
                     LESTSIEEIRSTEGVLWTA"
     gene            complement(<1077514..>1078560)
                     /locus_tag="C5L36_0E05090"
                     /db_xref="GeneID:40386315"
     mRNA            complement(<1077514..>1078560)
                     /locus_tag="C5L36_0E05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468072.1"
                     /db_xref="GeneID:40386315"
     CDS             complement(1077514..1078560)
                     /locus_tag="C5L36_0E05090"
                     /inference="similar to AA sequence:RefSeq:NP_011381.1"
                     /note="PKUD0E05090; similar to Saccharomyces cerevisiae
                     YGL134W (PCL10) and YPL219W (PCL8); ancestral locus
                     Anc_6.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323932.1"
                     /db_xref="GeneID:40386315"
                     /translation="MEDDPELRLKVQDPTFTYSPGAEALSTKPQRESMVDKARQAGKD
                     PPSSVTSVDIERLMSAKELTLDVSGTEAMALLYRMVESLISLSNRIEDGELSESVVVE
                     SIFNVWESKHLPAAFLEEAIGYSHRKNEMERMKIISKSQEELGVSLRKKSMIMSNFEE
                     ASGPEGGSPRLREYIAAEVGSYEPCCDEETRKWLSKKFYLKNAPNMEISAYIDRINRN
                     LDISGAVALCAGWFLFKFVFNIRSMEKKIRDVPLVPHGGGTMERVSKRNAFRLILTSI
                     RLASKLIEDKNYKQGYYCRVTGLQKTSDLFRLELAMGYGLEWGLFVNEKVLKRYLIHL
                     DQLLLVSANSEMGE"
     gene            complement(<1078832..>1080847)
                     /locus_tag="C5L36_0E05100"
                     /db_xref="GeneID:40386316"
     mRNA            complement(<1078832..>1080847)
                     /locus_tag="C5L36_0E05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468073.1"
                     /db_xref="GeneID:40386316"
     CDS             complement(1078832..1080847)
                     /locus_tag="C5L36_0E05100"
                     /inference="similar to AA sequence:RefSeq:NP_012500.3"
                     /note="PKUD0E05100; similar to Saccharomyces cerevisiae
                     YJL034W (KAR2); ancestral locus Anc_5.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323933.1"
                     /db_xref="GeneID:40386316"
                     /translation="MFKKQYSVLAVLLYAIVLFVLPFASNVQVDADSENYGTVVGIDL
                     GTTYSCVGVMKNGRVEILANDQGNRITPSYVAFTENNERLVGDAAKNQAASNPHNTIF
                     DIKRLIGQRFSDKVIQREIKHLPYKIVDQDDRPVVKVEYNGEEKTFTAEEISAMILGK
                     MKSIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLTVLRIVNEPTAAAIAYG
                     LDKGEEERQIIVYDLGGGTFDVSLLSIAGGAFEVLATSGDTHLGGEDFDYRVVKHFIK
                     VFKKKHNIDISSNPRALAKLKREVEKAKRTLSSQMSTRIEIDSFVDGIDFSEQLTRAK
                     FEELNIELFKKTLKPVQQVLDDAKVKASEIDDIVLVGGSTRIPKVQELLEKFFNGKKI
                     SKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLIDVNPLTLGIETTGGVMTTLIKRNTP
                     IPTKKSQIFSTAVDNQNAVLIQIYEGERAMVKDNNLLGKFELTGIPPAPRGVPQIEVT
                     FTLDSNGILKVSALDKGTGKSNSITISNDKSRLTQEEIERMVEEGEKYAEQDEELRKT
                     ILAKNELENQAHNLKNQINDEDGWGAKLDAEDKETLLEAVEEAISFIEENGETASLEE
                     FQEEQEKLTKVVSPIVSKMYASEGGASEGYHDEEEDDDEDDWDHDEL"
     gene            <1081458..>1084604
                     /locus_tag="C5L36_0E05110"
                     /db_xref="GeneID:40386317"
     mRNA            <1081458..>1084604
                     /locus_tag="C5L36_0E05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468074.1"
                     /db_xref="GeneID:40386317"
     CDS             1081458..1084604
                     /locus_tag="C5L36_0E05110"
                     /inference="similar to AA sequence:RefSeq:NP_010310.1"
                     /note="PKUD0E05110; similar to Saccharomyces cerevisiae
                     YDR027C (VPS54); ancestral locus Anc_3.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323934.1"
                     /db_xref="GeneID:40386317"
                     /translation="MPLTDTLSVASLSFSATETGDHTDIITSEDHLLPDSVNAIHNLV
                     KNVNYKRKSTTTGLLSLNSTSTVVSLNGPTARDIPRTKLTPLDTVDNDVFDGYSSRIA
                     EDYDYFISNKSLTTQSLKTLSGNEALLDINSLSHVPEFYFHDDFRLDDPRIFNKVTGN
                     AQFLSLIEPQNGKRVLDHEELQDKLSSYMDIVEIHLVHEISNSSDDFFSALDDLKQIV
                     NSSKQLNSNLDEMQHLLEQAQESKIERGEKIIHMLQKYQNIGKFNQVVLQIKAILKQS
                     DIAEENYYRGDYDKCLYVIDSVFAMIRGNVPPHPLITNLTQDWKYPLRDLNKLPALIP
                     LKRQLSNLVSDTGKSYAKLFANYLLDDLRSTYDTIDREDVLQRLLGNKKVDNYNIVSD
                     EFKSTILIYLKGLARCGELSSAFKLYEERFSNELKNIFKENLPSDSHNVNENQSTDSR
                     SISATTTAHMNSTLILADLLKNMTPKEFENLLVSDFTQFSESFRRLTVHKNILLTTAI
                     DVLNNVDPQILKAQPDIIMDLDITNAISSVINSIQRRISKVIKIREQQNAFLSLNYFL
                     RFHRLTTSFLTECEIVSKGMVNEPILKDIIQRQLFLFIQQFHKSNLKNCIDLIEAEVW
                     KDDGLPLESQKTIELINSASEGNFDMSEWVRGLNIDFDQPQQSYTHNVTEKRKTLNLH
                     GQHYILPTSVASILNIIKAYLFLIYYFRMNMAVVSQSYLPELLKAINLKIHQSVLGAQ
                     ATKTAGLKHVTTKHLALAGEVCRFWSYLVSDIERACLSELDLSESSRQSLMKEYDEVK
                     ALFGDQVSDIYDKLVAIMKDTTQAIIAPVAATGDSFVCDGLNPYMESIVKKTLTIARS
                     VQRYLPTHEYDGVMLRIFNVYEKILIDKYSEILDNSSDKTAVRNQIRKDIMFFKEKLD
                     DVDNGRLVSRVLQECGCITDETELPGDSKIERPPNSQETPDPEHTSEIETKDSTGGES
                     TQEVKSSGSKSGRSTPNGESGDTSVKSGETSTLNGGDLVVPEAKNNILSDQETNVQDA
                     SQAPIKPKTSNAGQASAI"
     gene            <1084921..>1086933
                     /locus_tag="C5L36_0E05120"
                     /db_xref="GeneID:40386318"
     mRNA            <1084921..>1086933
                     /locus_tag="C5L36_0E05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468075.1"
                     /db_xref="GeneID:40386318"
     CDS             1084921..1086933
                     /locus_tag="C5L36_0E05120"
                     /inference="similar to AA sequence:RefSeq:NP_013094.1"
                     /note="PKUD0E05120; similar to Saccharomyces cerevisiae
                     YLL007C; ancestral locus Anc_5.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323935.1"
                     /db_xref="GeneID:40386318"
                     /translation="MSVDYNTIHAHLKKLKAQAGSGAGAGASANSGAGASAGGQNTTQ
                     LDEATAVTYISALRQDLIALVALNKDSSPISTKVLNEIIIFTKTLDYVPKSDQLFQLF
                     DSQLFKSLFDLLLVENIPIEILRGVLRICLTYLAGVLPKTRKQGMFRVLLGVLCEQVS
                     KDVNRCDVLFANLTARVTFADSRMNLNIVDFVAKVLYRLMETIGSVSNDANSLILEEQ
                     WLLNVVRSLYNSNFFGILSCVKGIGEIEGMTGLRGSMDLTYKWLRAKKFTDDTNPIVK
                     ELISMYKEVGIVSAPSDTEMLSILTLVGILKQPKRSLKKMLVECNMTSKFPILKFISK
                     INDEITTTKSFDKIFGNWNTDLLFSLLNVSTRCWLFSGAKIEDGDTEKVLNMVNIVIH
                     WLSEQLQIEKTGDYDDDEYDIVTLLETVDSFNYQKIKSLQLKEIHSNLNKKWETEMEP
                     FENLIHHQVVALVKDLRFFQLSKGSWVYSSNPLEYSDSHHYFLTVNSNSQSIVYKEFA
                     KRPEKSSFTPNLDKDGIHIEFKSILAIEATNLNPNVSNTSLINIQSERMDVNHVEVIT
                     KTGIFSFYTDTKILKDTWVDGLRILVADSKPESPENIPMNLSVSEEFFAKNSVSEEVK
                     KQVKTLEDIRIRTQMLNLEDTEKDNQQYISETSIDWASLSSNFVYE"
     gene            <1087274..>1089652
                     /locus_tag="C5L36_0E05130"
                     /db_xref="GeneID:40386319"
     mRNA            <1087274..>1089652
                     /locus_tag="C5L36_0E05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468076.1"
                     /db_xref="GeneID:40386319"
     CDS             1087274..1089652
                     /locus_tag="C5L36_0E05130"
                     /inference="similar to AA sequence:RefSeq:NP_013093.1"
                     /note="PKUD0E05130; similar to Saccharomyces cerevisiae
                     YLL008W (DRS1); ancestral locus Anc_5.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323936.1"
                     /db_xref="GeneID:40386319"
                     /translation="MVQKKTTHKKFNTDFIPTISDSESDVPDLDSEDEIVQDKEVEKV
                     QEKNSKKAKNKKEKKAKKSKSKNTATDEEDEDDKENQVSKDLNPDFIFSVEDLGSTTN
                     FDGWDFDLNKDQSKDGLKKDVDLDDIIRRKGGLSGKVKINKDDESGNHDDDEEADEHD
                     EETNKESEDEDNDEDDDDDDDDDDELALDGFGMGATPKDIDVSENTNNDDSDDSNGEN
                     DSDGSSDTENTGEGAIDKENGSDLDLGNSDNEENENEDSAEAISKYFDEDEGQVAKEQ
                     AHKSFQSLQLSRPILKSLTALNYSSPTPIQSASIPIALLGRDIVAGAVTGSGKTAAYM
                     IPIIERLLYKPAKVAKTRVIVLTPTRELAIQVADVGKKLGQYVSNLSFGLAVGGLNLR
                     QQEQQLKTRPDVVIATPGRLIDHIRNSPSFSVDDVEIVIMDEADRMLEEGFEKEMQEI
                     VELLPRKRQTMLFSATMNSSIKQLIAWSLQKPVRIMIDPPKTAASGLVQEFVRIRKRE
                     ELKPALLYSILSRFDPKQRVIVFVSTKDMCHKLRIKLGLLGLRVGELHGGLSQEQRLK
                     SVTLFKNSTVPVLLCTDLAARGLDIPKIEVVVNFDMPKTHEIYLHRVGRTARAGREGM
                     SISFVGEAKRERAIVREVIKNVEESKKGKAVGRNADWDEIDRVNEILDAKKDLINEII
                     DEEKQEKAVLAAEMELKKGENMLKYKDEIQSRPKRTWFMSEKEKREEKNKLKSTLGKT
                     SKLNSKKRKREEALAEAGNTRSYKKTSKDRSDNNTKRINKASSKGKKGKRRS"
     gene            complement(<1089970..>1091013)
                     /locus_tag="C5L36_0E05140"
                     /db_xref="GeneID:40386320"
     mRNA            complement(<1089970..>1091013)
                     /locus_tag="C5L36_0E05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468077.1"
                     /db_xref="GeneID:40386320"
     CDS             complement(1089970..1091013)
                     /locus_tag="C5L36_0E05140"
                     /note="PKUD0E05140; Pfam Domains: PIR(6.2e-13)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323937.1"
                     /db_xref="GeneID:40386320"
                     /translation="MKLSSLFIITSFIAAVKGDGYTPGENFSTLSPDGKVPDGATTQF
                     TSKFGIAINPITSSVDLTSVNSGSEGMHAVTQIGDGQLQAATGTIKTENRPVITQIGD
                     GQIQGSTETNTAKQAINVVTQIGDGQIQATTLTTVTRSSTTNDADVVTTKITKVVKSY
                     VVVPYTENDTASSSTESVETSDKHTSSSSEATSASDEPTTYITVTPTATVTQAITTLN
                     LPTLAPTTVIVEKRLVEETATVLFDKRELPFTCSSDSALTMTLEDSILRDAKGRIGAI
                     VSNRQFQFDGPPPQAGSIYAAGWSIIDGKLALGDSTTFYQCLSGDFYNLYDQSVAPQC
                     TAVELDIILYEDC"
     gene            complement(<1091556..>1093487)
                     /locus_tag="C5L36_0E05150"
                     /db_xref="GeneID:40386321"
     mRNA            complement(<1091556..>1093487)
                     /locus_tag="C5L36_0E05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468078.1"
                     /db_xref="GeneID:40386321"
     CDS             complement(1091556..1093487)
                     /locus_tag="C5L36_0E05150"
                     /inference="similar to AA sequence:RefSeq:NP_010625.1"
                     /note="PKUD0E05150; similar to Saccharomyces cerevisiae
                     YDR338C; ancestral locus Anc_5.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323938.1"
                     /db_xref="GeneID:40386321"
                     /translation="MRRKPELQAETSNGHNKKHLTGIFSKTIRQLPKSLLTSNNVAIN
                     SKRRKIPLTFLPPSTNSPLFVYSNDYDQRSFLSLCSGSHIDNQTVHSNDSNAESVSTF
                     RSLPSTLEVTDDEIQSINQWIDEERERRSLLDNEEEVESYGAINASNDGYDALERIDT
                     MFPPSRTASRRSSVLSLEGLIKDEEDEDFSHTDTTLHREVRKLFRYSVPLLITFFLEQ
                     MFSLVCVVFVGHLGKEELAAVSMASMTSTIVLTIFEGIATSLDTLCPQAYGAGQYKHV
                     GIHTQRCSLFSLVLFVPAALIWFFSGYLLSFILEDEKVILLTQKFLRVLILGGPPYIL
                     FENGKRFLQAQGIFDAGTYILFITAPLHILLSWTLIYSERFGLGFIGAPIASVINFWA
                     MLLLLVAYVVFVDGNECWDGFTLDAFKHWNDLSKLAIPGIVMLLAESLAYEILTLFAS
                     KFGTSMLATQSALSSVVSLLYMVPFAISVASSTRIANFVGGCNIKGAEMAINVGFLSS
                     IVSGMFNCIIIYFGSARIAQLFTQDEEVISMFVSLSPLVAIFVIFDCLACTGNGVLRA
                     LAMQLTGGTLSLIGYYIIAVPLALFLGFKMNLELMGLWIGNGAGLLFVGVSEIIVIYN
                     IKWDSILERSKKLAMHEGI"
     gene            complement(1094501..1094598)
                     /locus_tag="C5L36_0Etrna12K"
                     /db_xref="GeneID:40386404"
     tRNA            complement(join(1094501..1094537,1094561..1094598))
                     /locus_tag="C5L36_0Etrna12K"
                     /product="tRNA-Lys"
                     /note="PKUD0Etrna12K; codon recognized: AAG"
                     /db_xref="GeneID:40386404"
     gene            complement(1094607..1094678)
                     /locus_tag="C5L36_0Etrna11E"
                     /db_xref="GeneID:40386399"
     tRNA            complement(1094607..1094678)
                     /locus_tag="C5L36_0Etrna11E"
                     /product="tRNA-Glu"
                     /note="PKUD0Etrna11E; codon recognized: GAA"
                     /db_xref="GeneID:40386399"
     repeat_region   1094806..1108059
                     /note="IRL5"
                     /rpt_type=inverted
     gene            complement(<1097599..>1098588)
                     /locus_tag="C5L36_0E05160"
                     /db_xref="GeneID:40386322"
     mRNA            complement(<1097599..>1098588)
                     /locus_tag="C5L36_0E05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468079.1"
                     /db_xref="GeneID:40386322"
     CDS             complement(1097599..1098588)
                     /locus_tag="C5L36_0E05160"
                     /note="PKUD0E05160; Pfam Domains: RVT_1(1.6e-40)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323939.1"
                     /db_xref="GeneID:40386322"
                     /translation="MLPCLTLMSSLWKKQYPLSFSEKLELTKQVEVLIKQGFIKTSSK
                     PFNSPVLFVKKKDGTMRMCVDYRILNNNAVKNKFPLPDIDQLISRFGKTKVYSKLELT
                     PGYYQVRIADEDVEKTAFSTDFGHYEWMVMPAGLTSASATFPQMMNNVLSKKINGFVQ
                     VYLDDIFIYSEDVETHGKHVKEVLSTLRKHKLITKKSKCRFFYQEFRFLGHVVTPICI
                     QTALEKIKKVKSWPTLNKIKEAQSFIGLTSYYRRFIKGHSKIANPIHKFMTKQIKWTS
                     EQDEAFNKLKKALISSPILVHPSWSGNCKFVLNTDACGVSLGYTLEKLDETGK"
     gene            1114145..1114218
                     /locus_tag="C5L36_0Etrna7N"
                     /db_xref="GeneID:40386415"
     tRNA            1114145..1114218
                     /locus_tag="C5L36_0Etrna7N"
                     /product="tRNA-Asn"
                     /note="PKUD0Etrna7N; codon recognized: AAC"
                     /db_xref="GeneID:40386415"
     repeat_region   complement(1118444..1131691)
                     /note="IRR5"
                     /rpt_type=inverted
     gene            1131823..1131893
                     /locus_tag="C5L36_0Etrna14G"
                     /db_xref="GeneID:40386407"
     tRNA            1131823..1131893
                     /locus_tag="C5L36_0Etrna14G"
                     /product="tRNA-Gly"
                     /note="PKUD0Etrna14G; codon recognized: GGC"
                     /db_xref="GeneID:40386407"
     gene            1131898..1131969
                     /locus_tag="C5L36_0Etrna8D"
                     /db_xref="GeneID:40386416"
     tRNA            1131898..1131969
                     /locus_tag="C5L36_0Etrna8D"
                     /product="tRNA-Asp"
                     /note="PKUD0Etrna8D; codon recognized: GAC"
                     /db_xref="GeneID:40386416"
     gene            complement(<1132091..>1135330)
                     /locus_tag="C5L36_0E05210"
                     /db_xref="GeneID:40386323"
     mRNA            complement(<1132091..>1135330)
                     /locus_tag="C5L36_0E05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468080.1"
                     /db_xref="GeneID:40386323"
     CDS             complement(1132091..1135330)
                     /locus_tag="C5L36_0E05210"
                     /inference="similar to AA sequence:RefSeq:NP_013008.3"
                     /note="PKUD0E05210; similar to Saccharomyces cerevisiae
                     YKR082W (NUP133); ancestral locus Anc_5.675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323940.1"
                     /db_xref="GeneID:40386323"
                     /translation="MQELSFTANRFKAKQSPLTDEHPTPTDVPQKQGISCKDNILFDS
                     EYYTLSNEYKSIPKLDEFETILDLKAVSPLVSVLTTNSRILVYNHESCSSVTHTFEIP
                     YSPNSYNLMPLSAIISNPLNALKPDLVVIDPISGEFQFFESIKLVPSLSVLQNVVKDR
                     ITLYNAEFLTGVQLFQENSILVTTSQKRVIEVTFKDQLGNVSIKLNQVYNNRPLISSI
                     LSKTHSISEIENSSHIVSIKTYDASPIMKSIIVLESTGRVVFINHLKGSSSFNLVAQH
                     DMELILSNVGLRFLDFEFLKNSKIGVFLTIDLKENNLVSNVFYFENSHSVPNMISNKS
                     VPCLSLDEEIIDPKVFSFNLEKTLLVKNDKKLIIFDPNFENLASPWVEVLALNHSLII
                     YSAEKLPGLNDKLFLATNEGLLTFSFKESGKSGDINGFLKEHINQYLQYNKSDGPLIF
                     DLKETSLAIATTNIRDVLSEIYDELLENKSNASGFRSFADSNLERRVFLVKNLTAYTQ
                     RNYDIQNDEVLRTKILKSCELLALAKNFLHLNTNYSLINDSDMLDHLKIGVPLTDYLQ
                     NNTKNVLTLISKYVNYILNSGTENQVIQLSSLLKELFINSIIKLDDDVKQLLGGSSLS
                     SVFVDHFELINNVNVITRKIYNLASETTDENVLAGYNQTLIGLSCFLYYSVNEIVEYL
                     STRGGSALVLFDELLTKEKDKWVHVFVVMKKQRDILPLVNKYKDFAGLSALLESMRED
                     IQTLFESEEISEIEFANMATDVEIEFDRYFEYYGYEFAEALFSYYKQNHKVNIMLQNF
                     DKHSVHLERFLESDLSNYSFGWIHDIMNHKVGNVSNKMIEVALEYSTSLREKKFQSSL
                     GKLATVLQMNNSSEQNSNNLMDCYNANLSITDVQECIYYCMQELGMFSNSHALDALID
                     SPYIRSNNFNEFRERLKEIYFKLERKGSLDILEIVDFVSLGCFQPNILTNEVPKNGGC
                     DSTGRIVLEIYCKTLHLLKTLTNCGNISLIVGSLSMSVLLKLFLKRIFMNRDYVPLEQ
                     IVLELEKESLNISFNDHSLMLSEDEIYTLQRRSNSQIKDYEKENRVSIS"
     gene            <1135679..>1136680
                     /locus_tag="C5L36_0E05220"
                     /db_xref="GeneID:40386324"
     mRNA            <1135679..>1136680
                     /locus_tag="C5L36_0E05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468081.1"
                     /db_xref="GeneID:40386324"
     CDS             1135679..1136680
                     /locus_tag="C5L36_0E05220"
                     /inference="similar to AA sequence:RefSeq:NP_013007.1"
                     /note="PKUD0E05220; similar to Saccharomyces cerevisiae
                     YKR081C (RPF2); ancestral locus Anc_5.674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323941.1"
                     /db_xref="GeneID:40386324"
                     /translation="MIRSTKPKNARAKRALEKKESKIVENTKTALFIPGNSSNQALHD
                     ITVDLGSMKKPYIKRFTKKNNILPFEEASSIEFLSEKNDASIVVLSTNNKKRPNNLTF
                     IRTFDYKVYDMIELQVLSDFKLFKDFKKMTFQVGLRPLFSFQGHIFDINPTFIHVKSL
                     FLDMFHGETSNLQDVAGLQYVISVSAIEEDDNDTAISKLPLVYFRVYKLKTLKSNEPK
                     LARIELEETGPRINFKIGRVHSADPEMEKEALKVPKQLQPKERKNIQTDSMGDQVAKI
                     HVGKQDLSRLQTRKMKGLKSRFDQDVSDDDLEEGESNEDFADSVSDDDEPSQKKRKL"
     gene            complement(<1136861..>1139140)
                     /locus_tag="C5L36_0E05230"
                     /db_xref="GeneID:40386325"
     mRNA            complement(<1136861..>1139140)
                     /locus_tag="C5L36_0E05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468082.1"
                     /db_xref="GeneID:40386325"
     CDS             complement(1136861..1139140)
                     /locus_tag="C5L36_0E05230"
                     /inference="similar to AA sequence:RefSeq:NP_010974.1"
                     /note="PKUD0E05230; similar to Saccharomyces cerevisiae
                     YER054C (GIP2) and YIL045W (PIG2); ancestral locus
                     Anc_7.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323942.1"
                     /db_xref="GeneID:40386325"
                     /translation="MPYVPSPKSRRSSAPSLSTFSLSSSPSSVSEFAKHEHASPSPVN
                     RDNGHLSCIGRKLSEMNISSREGSSGDSEYNDGHFIQRNNQANVSSSFTTPASNPPVP
                     QVSPLAEDALPLSLSFIRRPSRSASMDLDVDIERIMKHNTLINSRSFTSQNPPSSPEL
                     SEPSSPRQSSFDDDMASPISPLVSQTESNHQTCRIPAGYTSPLVRKKSGELLKSSLRL
                     NAAFKSSGAVSMPTTPTYKQVHFGTNIHVKYFDEKDKPSSISAGNSPFNSDDDLLGED
                     DEEDVNTGDEDEDDNDNDNDNDDDTQTLVEGSEFDTSEMECRVQLCKKFYKYSKKLVE
                     QDSLSHLEKFKKVARIWDLDLSEFSMISYRDQIDCEVPVFVERCFLNLHKTKVIGQIA
                     VKNISFDKSVKVRYTYDNWNTVINVDAEYTSDIPRVLKRAGYDRFVFELSTPFLISMF
                     FQKNSYRSEPAIYFCIQYTSGNQEFWDNNHSKNYTLRFLIDTRQNSSFPDQEPLKKCA
                     NDPNCPNDSYFHHTGSTKVIRNRDKTTSENIPHPTAEKNKNSAYSIDPSFGKLKRSRS
                     FDKRTNVSKLIKSPEFIAKGGTNQDLLKTRSCSPTSLRNTGLKDNFLNQGIDPIDSSG
                     LKDENEYILFRLREVKNEEPSDFERTDSKAALDEIHRITDTKTYQVNEDTHTDSKDNN
                     KNYKNHQDNCVDAKTDSKKEENLLKSKNSTNEYKGIDNESYKALVNKYCFFNGPSTVS
                     SFLAEEETNTSNLYDSKFY"
     gene            <1139767..>1141416
                     /locus_tag="C5L36_0E05240"
                     /db_xref="GeneID:40386326"
     mRNA            <1139767..>1141416
                     /locus_tag="C5L36_0E05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468083.1"
                     /db_xref="GeneID:40386326"
     CDS             1139767..1141416
                     /locus_tag="C5L36_0E05240"
                     /inference="similar to AA sequence:RefSeq:NP_014710.1"
                     /note="PKUD0E05240; similar to Saccharomyces cerevisiae
                     YOR067C (ALG8); ancestral locus Anc_5.669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323943.1"
                     /db_xref="GeneID:40386326"
                     /translation="MATSTKKTAHGYNYSLWNIWVASTLLKVLLFPSYHSTDFDVHRN
                     WLSITSLLPLKDWYIDSTSQWTLDYPPFFAYFEWVLSRFVSKSVADDGCIALVPAGNY
                     GTRTIFFQRSTVIVSEIVLFVALQWFINTARTNREKRRNFVISASIVLSPGLFIIDHI
                     HFQYNGFLFGIFVLSIINAKMGNHVACGFWFSVLLCFKHIFLYVSPAYFIFLLSGYCL
                     NPPPAKINMSSLIQIIRWKNLFKLGVTVLGVFFVAFAPFIYYGVFPQLVERLFPFSRG
                     LTHAYWAPNVWAIYSFLDRLLVQIAKKMPILYRIFNTSPLLVNDSLTRGIVGDVKFTF
                     LPQIEPNHTFILTLFYQLMSLIPLFIQPTFERFVGSLSLCAFSSFLFGWHVHEKAIML
                     IIVPLTFVVCQDRKLLPPFQLLTSAGYVSLFPLLYGSAEWMFKSLITFAWFIVFQTSF
                     SGVVHKSRRISTRVVVLDRLNLVYMLLFTPMCIINQVLDIQSRNFQILKKLEFFQLMM
                     FSVYCSFGVISSWSSISWLYFLDDSIWVNKEGEDLRDVKVV"
     gene            <1141630..>1142020
                     /locus_tag="C5L36_0E05250"
                     /db_xref="GeneID:40386327"
     mRNA            join(<1141630..1141725,1141847..>1142020)
                     /locus_tag="C5L36_0E05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468084.1"
                     /db_xref="GeneID:40386327"
     CDS             join(1141630..1141725,1141847..1142020)
                     /locus_tag="C5L36_0E05250"
                     /inference="similar to AA sequence:RefSeq:NP_010979.1"
                     /note="PKUD0E05250; similar to Saccharomyces cerevisiae
                     YER058W (PET117); ancestral locus Anc_7.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323944.1"
                     /db_xref="GeneID:40386327"
                     /translation="MSRASKITLALSTVFSIATIGAVYYMAEYEKDQLQTGPIRDKER
                     LEKRSFNQKQRANLEEYEEQKKLFTEMQKEQPLSGEVVEGIDRSK"
     gene            <1142468..>1142875
                     /locus_tag="C5L36_0E05260"
                     /db_xref="GeneID:40386328"
     mRNA            <1142468..>1142875
                     /locus_tag="C5L36_0E05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468085.1"
                     /db_xref="GeneID:40386328"
     CDS             1142468..1142875
                     /locus_tag="C5L36_0E05260"
                     /inference="similar to AA sequence:RefSeq:NP_010978.3"
                     /note="PKUD0E05260; similar to Saccharomyces cerevisiae
                     YER057C (HMF1) and YIL051C (MMF1); ancestral locus
                     Anc_7.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323945.1"
                     /db_xref="GeneID:40386328"
                     /translation="MLRFARAMSTKVTPVISANAPPAAASYSHAIKANGFIYVSGQIP
                     YTTENKLVDGDFQARSEQVIKNALSIVKDSNSQLENIVKVNIFLTDMNNFGKFNEIYA
                     KYFNAHKPARSCVAVKELPLGVDVEMEVIAVEN"
     gene            <1143542..>1144451
                     /locus_tag="C5L36_0E05270"
                     /db_xref="GeneID:40386329"
     mRNA            join(<1143542..1143578,1144150..>1144451)
                     /locus_tag="C5L36_0E05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468086.1"
                     /db_xref="GeneID:40386329"
     CDS             join(1143542..1143578,1144150..1144451)
                     /locus_tag="C5L36_0E05270"
                     /inference="similar to AA sequence:RefSeq:NP_012212.1"
                     /note="PKUD0E05270; similar to Saccharomyces cerevisiae
                     YIL052C (RPL34B) and YER056C-A (RPL34A); ancestral locus
                     Anc_7.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323946.1"
                     /db_xref="GeneID:40386329"
                     /translation="MAQRVTFRRRNPYNTKSNQIKVVKTPGGKLVAQHVKKQATRPKC
                     GDCGIPLPGIATLRPRGYASISKTQKTVSRAYGGSRCANCVKERVVRAFLIEEQKVVK
                     KVLKEAAAKK"
     gene            complement(<1144601..>1145056)
                     /locus_tag="C5L36_0E05280"
                     /db_xref="GeneID:40386330"
     mRNA            complement(<1144601..>1145056)
                     /locus_tag="C5L36_0E05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468087.1"
                     /db_xref="GeneID:40386330"
     CDS             complement(1144601..1145056)
                     /locus_tag="C5L36_0E05280"
                     /inference="similar to AA sequence:RefSeq:NP_011649.1"
                     /note="PKUD0E05280; similar to Saccharomyces cerevisiae
                     YGR133W (PEX4); ancestral locus Anc_3.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323947.1"
                     /db_xref="GeneID:40386330"
                     /translation="MTTRRLLTELRNSKQLPESILELTPKGEDSLYEWTALIQPNKSS
                     IYGGNNYRLSIHLPLEYPLEPPKIKFANPIPHSNIDLKTGDICLDILKSENWSPAWTL
                     QTALLAVLVLLDHQEPDSPLNVDMANLCRLNDRLAMVSLINYYNLNHKE"
     gene            <1145292..>1145768
                     /locus_tag="C5L36_0E05290"
                     /db_xref="GeneID:40386331"
     mRNA            <1145292..>1145768
                     /locus_tag="C5L36_0E05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468088.1"
                     /db_xref="GeneID:40386331"
     CDS             1145292..1145768
                     /locus_tag="C5L36_0E05290"
                     /note="PKUD0E05290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323948.1"
                     /db_xref="GeneID:40386331"
                     /translation="MCNTAFAIVEFPQIRDMQRETYNPYMYTSIGCSCWLFCFFFFEL
                     CSAPIVFHHLKDNTGERGMSTTAMATTKVTVPCRHLPRPSKTIHLSERQRLSALHTIQ
                     LLRRGRPVPSSLSLSLPSFISTLSVHRCHQEWQMLQCKHHQTCSAFIRFTNLKAYH"
     gene            <1146236..>1147999
                     /locus_tag="C5L36_0E05300"
                     /db_xref="GeneID:40386332"
     mRNA            <1146236..>1147999
                     /locus_tag="C5L36_0E05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468089.1"
                     /db_xref="GeneID:40386332"
     CDS             1146236..1147999
                     /locus_tag="C5L36_0E05300"
                     /inference="similar to AA sequence:RefSeq:NP_010980.1"
                     /note="PKUD0E05300; similar to Saccharomyces cerevisiae
                     YER059W (PCL6) and YIL050W (PCL7); ancestral locus
                     Anc_7.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323949.1"
                     /db_xref="GeneID:40386332"
                     /translation="MQDMPQNNTHVEETLHPNKTRFNNSNNPNSSISINNGDPKAILI
                     NTQLSHLNQLNHLSHANRVSSTSSSYTSTTSPSNFTSFSYNNSNSPSVQPPVSLSLQR
                     NSLSSRSGSIENLSNSIPNGILIPPPTQQQQQQQQQQQQQQQPQPQLQHSLSFNHSYT
                     SSITPAGRRSLLTSKLKEESLRRPHQLPQFQKQHQLHHLQQNQLQHQQLQLQQAYQQQ
                     QQYHHHHHQQQQRQQQQQQQQYQEDTQFPTPARATATTNVSKDLVFSTNNSSNSTLYQ
                     DAPTDSSFSTGRSNVGNLSQNINHQFLSVSAPAHAPIHHQHQHQQLQQQEQTLIPPPN
                     YQSHHEPESTKSINIAEFPPNDLLVMLSALLQKIIEANDILHTDGNLNPVIPSSSVNA
                     TSTSSSFSNETTHLFNDKYNANVMAFRGRNIPAISIYSYLKRIIKYCPATNDVFLSLL
                     VYFDRIAKRANNTVHTQEDAIMQDDTTESPSESPFQVFVMDSYNIHRLIIAGVIVASK
                     FLSDVFYKNSRYAKVGGLPLEELNHLELQFLLLLDFQLMIQKEELEKYAELLSRFWKR
                     QQLQQQQQQQQQQQPQQPPPT"
     gene            <1148262..>1151531
                     /locus_tag="C5L36_0E05310"
                     /db_xref="GeneID:40386333"
     mRNA            <1148262..>1151531
                     /locus_tag="C5L36_0E05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468090.1"
                     /db_xref="GeneID:40386333"
     CDS             1148262..1151531
                     /locus_tag="C5L36_0E05310"
                     /inference="similar to AA sequence:RefSeq:NP_011650.3"
                     /note="PKUD0E05310; similar to Saccharomyces cerevisiae
                     YGR134W (CAF130); ancestral locus Anc_3.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323950.1"
                     /db_xref="GeneID:40386333"
                     /translation="MTRKSSRNRSTELSDLPFDEETIALAGGDMQLLRNVRSLFSHMN
                     DEELWQCLEDIKSGILSPDHLLDLMNHKDEEEPDSEPEREGIIEIHHDDGDDGDDGDN
                     VIDGSDANNGREKDTEIEREISIDLELSNNFFNPYKFHDALFKTLRICKPDDYDDRIK
                     NLFVCLAALCDPYTQPSSTGERNEMILSADLVTDIIIGIMYPSYEIDDNGIGVFNMGY
                     DLGKIIIRIMNVLNADDENVLMYIKNDENNWIKELSKWIPRNTFSNIVNIASDYHHLN
                     LLYTILTASLLIIHKLYSELGNICLNPFLSLYLQIWKNLTRIIYMGIEIDRRDEENGF
                     PGYPEVIRYVIKGSSAVRSMISIILNDDFDRRVHDLRHESLINFMRPWGRKFTNGSIN
                     RDIRIFVAALLGLGSELDNVTELLFNFDPEDRYDEDIKYMFEMELEDMHIDEKNLNGE
                     YNIKHKENIKKYLGMNNYLEIERHGDPSDRSDDSSGAYNENGENDSNVREINPHSNFD
                     LHPDCECNFEDFESDYEDYEDDQEDDHAVNDAVELSDANATMERLASLNLNSLDSDTI
                     KDLHLEVVRNINNGPAAIRSINNDEFDSKGRDWRDIPRGDNNILSREFINLLKISIND
                     TNIFITSIGNLINAIGRMREETLDSNTCEKIIRSVAWVVQYEHESSLMTEDEVTKHNN
                     DDSINADKIYNYLKEDDNFIKMIEFNPSSSFSIIDELLMAKGYRRVLIWFLTHLPLNQ
                     WLINYFHDLLVGLRGEVQDSQSRFKFSRVGPLILSEVEKSMLLHEFLSNAVIYLSRGS
                     SYEFEDIIYNQLELEKSKDDNVSSYITSRSNAQKLIKMICLMLKSLEKHKILRPGDDE
                     YRIEIQTLLVQWVGVGFVPEARELFFKYQKCEDIKDGEINDTNESQAENEDELIQNEI
                     KNLRNNLPDEKLSSVLTRSKLHILLSNLTTFKKLDIFMILLNMSSFYTSRKDRCVNFI
                     SDLNVFNPQYDTREEIELACNALFLPLYIAIIEGDVQIIIEIGIASHLLDVEDIDNAR
                     EMITIYLNSLMDGKNNDMDFFREHFLTAMGGVEDLLGGVNEDGDTKKKKKKKKKKKGK
                     K"
     gene            <1152298..>1153659
                     /locus_tag="C5L36_0E05320"
                     /db_xref="GeneID:40386334"
     mRNA            <1152298..>1153659
                     /locus_tag="C5L36_0E05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468091.1"
                     /db_xref="GeneID:40386334"
     CDS             1152298..1153659
                     /locus_tag="C5L36_0E05320"
                     /inference="similar to AA sequence:RefSeq:NP_013783.1"
                     /note="PKUD0E05320; similar to Saccharomyces cerevisiae
                     YMR067C (UBX4); ancestral locus Anc_2.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323951.1"
                     /db_xref="GeneID:40386334"
                     /translation="MPTVNLASGFRTYRTNVNAGTIMSNVLEEGCKHFQLSQGRKYKL
                     MHNDKRVDESVPYRLSNLPQGATLAIEPSDEDNGDQDGHEERQEVIIRGHVCGETVVK
                     KYKNKETLRDVVYGIMRDAQKEGDVVDVQVLMKVISGDSLHQKLKDVGIISGNHSLRI
                     RVREIIKSDTAPEGEMDEDQSENLEENNDNNNGTVEGVGDVVTGETLVYIPQSEGSAK
                     FKSRLARDVAPDGDTDTESDGSPEMSLSQLQKYREMLQRQYSEQPLMTRAMREKSLLE
                     KEKEKEKERAQYYRPVCEMRIKFPNNEVVQITIDKNKTLGDLARTFEEHVLRDELFRH
                     LQASNNGTQIYYMVYLARPFQCILHQDADLQQSIASLQLGNRVSLFFKVDPQYRDYVD
                     TSKGYLKEGISQVTKTGMHHRGTIDPKELELEELDITHNGGGSASSKKMKKVPAWMKL
                     SRR"
     gene            <1155455..>1161406
                     /locus_tag="C5L36_0E05330"
                     /db_xref="GeneID:40386335"
     mRNA            <1155455..>1161406
                     /locus_tag="C5L36_0E05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468092.1"
                     /db_xref="GeneID:40386335"
     CDS             1155455..1161406
                     /locus_tag="C5L36_0E05330"
                     /note="PKUD0E05330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323952.1"
                     /db_xref="GeneID:40386335"
                     /translation="MIWLGTGGFDCCNPQMSQLGSPSNAVLFATKSEQDVQKSYVYLE
                     GGNLYPIRIAYINAVSDSALSFNIVTPSGSNADLSSLVYQLDGATAGMQCTKVTASTT
                     LGSTTVYVTNVPQGSTYHVPVTITSSGSAVIVDEAQVGIVSMVDTLSITSTKTWSEST
                     TSTTTITTAFTSSDGQVYGENLVEVFVPPLPTITTTWTGNFVNSVKTTMPITLTDGSV
                     VTTEVVLVEEPPLSTTYSAWDKTSYLTTTVETTLAWGPSTTYVEVFGPALSTTSTWGS
                     GVSTETVTTQAVITDDDNTITTSYVEIILPGLTRTTSEWTAYSTATSYWTTTIDGKEQ
                     VTGEVIVYQPPRETIYTWDSANPWPHTSTSSNAVVTESDGSVKTEDIVYVYRSLSTSY
                     TFGTDTTFATSTVTTTINDKATTYLVVDAPTPFTTKVVESNTWGTATEIATTTDANGN
                     PAVEEILIIPSYSRSISEWNKSYSSSYTTWSNLGWTTSTYVVEFAPSYSTSISYWSRT
                     YASTETLALTLTDGLSVYTTTYYYAHEPQVSTVTENWNKPFTTTYTTYGVISTNNKHY
                     TSSEIIVEIPSDPVSSWTTTTSYISDCNSDAVTSTTISTTTISGVETSIGYEYVTAPA
                     PSCYLPPASTGTLTTSSVTVTTDCSSTAVTSTVATTNAKGSATTYVLVETHSPAPSCA
                     KPSGVAPEHHTVTVTTDCLSTTISSTVTTTDSAGKPTTYVDIEVHSPAASCATLSTST
                     MTVSTDCSSTVVTSTVTSSNSAGVATTYVVVETHKPAASCATLSTSTVTVSTDCSSTV
                     VTSTVTSSNSAGVATTYVVVETHKPAASCATLSTSTVTVSTDCSSTVVTSTVTSSNSA
                     GVATTYVVVETHKPAASCATLSTSTVTVSTDCSSTVVTSTVTSSNSAGVATTYVVVET
                     HKPAASCATLSTSTTVITTDCESTTATSTVATTNSQGASTTYVVVEKHVPAESCVPLR
                     TTTSTVTTDCLSTTLTSTLKTTNAAGVTSTYVVVEKHVPNPTCAKTSGVAPNHHTVTV
                     TTDCLSTTISSTVTTTDSAGKPTTYVDIEVHSPAASCATLSTSTVTVSTDCSSTVVTS
                     TVATTDAQGSATTYVVVETHKPAASCATLSTSTVTVSTDCSSTVVTSTVATTDAQGSA
                     TTYVVVETHKPAASCATLSTSTVTVSTDCSSTVVTSTVATTDAQGSATTYVVVESHSP
                     AASCATLSTSTVTVSTDCSSTVVTSTVTSSNSAGVATTYVVVETHKPAASCATLSTST
                     VTVSTDCSSTVVTSTVATTDAQGSATTYVVVESHSPAPSCEPSQVSTTTSYVSTCGDS
                     SVYTSSVTTTDANGSSTVSGIVVVQTPISYCFLTSIDPRHQYVTVETPGSRCTVETIE
                     AYSTVITVSGVAVPTEAVVIATPPASCYSTVTSTSTNPLCASSAYTTSAGTTLADGSV
                     SSVVVVVEEVPGTLCFPGAITTTEVAYDCEYTAYTTNVATTDVSGRYVNATLVVVETP
                     AASCAQLPTLSTTLVAPDCQSTSFVSSYVSVNSYGIPITGSLVVVETPAASCGTTPVP
                     TAPGSTAPGSTTTAPGSTAPGSTTTAPGSTTTIPGSTTTVPASDCVSTTYTSYSYVTN
                     ASGVTTASYLVVVETPDVTCVPRTSIDPNHTLHVTTEASDCQPETITTTTSTTNASGI
                     VVIFSEVIVETPAASCGTTSASTATASTATASTAPVSTTTIPASDCGSSSYTSTYVTV
                     EGDVTVTGDLVVVETPDATCQPGYTSTAHVTSTSTVTCHKCDHKTYNTEITTVTDGIT
                     VTTTVCIEQTPASDNTPTTLETKTAQPTGTTTQPGNGPAGTTTQPGNGPAGTTTQPGN
                     GPVGTTTQPGNGPAGTTTQPGNGPAGTTTQPGNGPAGTTTQPGNGPAGTTTQPGNGPA
                     GTTTQPGNGPAGTTTQPGNGEGSSNVAPTNDVVTEQPAESSTTSPESISVATASNSEI
                     TYYGGAHKVGSGIAPLAIILVSFLF"
     gene            <1161784..>1163358
                     /locus_tag="C5L36_0E05340"
                     /db_xref="GeneID:40386336"
     mRNA            <1161784..>1163358
                     /locus_tag="C5L36_0E05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468093.1"
                     /db_xref="GeneID:40386336"
     CDS             1161784..1163358
                     /locus_tag="C5L36_0E05340"
                     /inference="similar to AA sequence:RefSeq:NP_012844.1"
                     /note="PKUD0E05340; similar to Saccharomyces cerevisiae
                     YKL079W (SMY1); ancestral locus Anc_2.633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323953.1"
                     /db_xref="GeneID:40386336"
                     /translation="MEETVKVYLRFRPTSGPHADYEINDNSVRIDSPQPLKQIRGGNT
                     TVTQATTYTFDRIFGIEATEEEINLHIVANALNYVMSGHNSLILCCGQTGGGKTYTMN
                     GITLGFFDMIFQEIEKADEKMLYTIGLSYFQIYNDEVGDLLKVANQPIIRDSGVIEGL
                     EKIYAGCKEDILEVLEIGSMNRKLADSKQYKMGSKSHTILRIEFSVDDGEIVRESTLF
                     LVDLASPKKINRCFASIEEKLTIDPSFSALKSVINNLAAQGNEDPYRDSKLTRILQDS
                     LAAHTKKFIIITCSPDSRYFNETVSFFQLLQRLKQVDNYVNKKDLIRKEPENWKSKYF
                     DALNRIVEVEAQIESLLHLDRNCTDLCELKDENLIFKKDLSVLMSSFNDHTTKLGNTL
                     PSSSLWALTSLRKELDVYKRLLVSKTDEILYLRSQINRNSNGDDITKELTSTIQRQNE
                     DILVQIKRAEKQLWDSEEKYKLANDKWTERNQMVELEQLQIESKLTNLGERLRSIPKE
                     SKTQTSKGLNLSILKQ"
     gene            complement(<1163413..>1164774)
                     /locus_tag="C5L36_0E05350"
                     /db_xref="GeneID:40386337"
     mRNA            complement(<1163413..>1164774)
                     /locus_tag="C5L36_0E05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468094.1"
                     /db_xref="GeneID:40386337"
     CDS             complement(1163413..1164774)
                     /locus_tag="C5L36_0E05350"
                     /inference="similar to AA sequence:RefSeq:NP_011867.1"
                     /note="PKUD0E05350; similar to Saccharomyces cerevisiae
                     YHR004C (NEM1); ancestral locus Anc_2.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323954.1"
                     /db_xref="GeneID:40386337"
                     /translation="MNSLSYVSSLYRRKEKQEPDFTVKEIMVSASENQSPQVGVLPNK
                     TFADHIYSVLVFVPKYTIYYPLYYVKCILFLTMAYPFRLVVMLLHCFFIQEENDEFSD
                     QHFSETGIENDRGEEEPSRVNGDDGCDESLLEELQKNVQEQQPLASAKGRYTSQYTIP
                     TIVEEDMGLENDDYFKSPLDSNPKEAKSSDTDKLLLQKKKTRRKKKFVFPKLLFDFDI
                     NNPPQLPRKTLVLDLDETLIHSLSRYNSSTYSKKGRAIEVKVKGSIPTLYHIYKRPYV
                     EEFLSVVYQWFDLVCFTASIKEYADPVIDYLEEQVLAKDMLKKSIKRSKMEMPTRIFS
                     KRFYRDSCIFVDGKGYIKDLSVLVKSGRMRSSSLSSNVSGRSTSKGISKEKDYSKVII
                     IDNSPISYVKHQDNGLMIEGWINDPDDTELMNLLPLLHSLRFVSDVRCILGLKSGQQA
                     FRQ"
     gene            <1165106..>1166386
                     /locus_tag="C5L36_0E05355"
                     /db_xref="GeneID:40386338"
     mRNA            <1165106..>1166386
                     /locus_tag="C5L36_0E05355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468095.1"
                     /db_xref="GeneID:40386338"
     CDS             1165106..1166386
                     /locus_tag="C5L36_0E05355"
                     /note="PKUD0E05355; Pfam Domains: DUF2433(1.9e-07)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323955.1"
                     /db_xref="GeneID:40386338"
                     /translation="MTMETVRTHVLEQHGIVILCVADVRGNLSLFNELADQYHPDVII
                     HTGNFGFLDSESIERIHESYLRHIVEFSPLLSPDLILKISELSKVSGDAVQHLSNDNM
                     NLKTLLQGQDISELSKFLSGELKLNVPVYAIYGMCEDSYVINKFRYGEYSIPNLYIID
                     DSKLHVVQIKDQPILLSGIGGSLSYHKLFHQGTTHGAHRSNEIIPISGDPGNIWITML
                     QLGKLMDSLVRYSQEYPHMYNKAIKFFVTHQSPTREPLLEHLSIFFKMDYTISNSLHF
                     KYISSYNALTVSLSFESYKLKFAEARTKLAKIWGKVQKKYERLLLQLPQLVSYIDLAL
                     CIYDKIPTKPLDDLPLLALSPTVKESLEVETPLQSLNSVIRHLNDLYYVSFQHAWHYN
                     ICDVGCGSLILELDNGTMKMNAISKGFNFSFRKE"
     gene            <1167819..>1170254
                     /locus_tag="C5L36_0E05360"
                     /db_xref="GeneID:40386339"
     mRNA            <1167819..>1170254
                     /locus_tag="C5L36_0E05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468096.1"
                     /db_xref="GeneID:40386339"
     CDS             1167819..1170254
                     /locus_tag="C5L36_0E05360"
                     /note="PKUD0E05360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323956.1"
                     /db_xref="GeneID:40386339"
                     /translation="MHFTYNGELVHSVDVDVGVDGAGLGAGSSVNTISSTRPAVGASL
                     GTSATVGAKTETCTYPITSVILYGTAQFVDAWRGGYEGFELLDLECAARLVLQRQAYL
                     IYRWSLTRLLLLDESLVCGVARCFDVSPDNFVPQEEEVQFYLKEPCFLWRFSRHNYDT
                     VVSSIREGRLLMLSDKGHDSSPPVGYEYDIEKHLLIGALEEKFKCQLNQWEVLEYRHS
                     LDFYLHSMDKETTYQEFVSVLLTGGCGRYTSELYRQLKRKEATSRVSHKGQRGILQKI
                     YMRIAPGRTKSKIYNVPESTTMGKQASGGVYPFLQRGAASISEELVTSLPEFVLERGK
                     IHLWDSDWINEALFDHEHPFSLYRFAVAIDDGYLATKYKHINARGETVRTGWGNGKPV
                     AIGRKRLLEMWMQCVPTKYTHQRYCHRLETSKWHQIEESCMRQIELFKDSKVNLVTDI
                     TAANLDSCVHLDPDDKEAYIIRNAEISGCLYRPTEGHHNLPTPLLLGDKSLPSSDYKR
                     KVGVMSAPNPCLQIEREQFLENGLTYNLQMFNTDVINPSKDVYIPPRVCNLEKLALNA
                     ISNQNALIGERYHVDLGPYVEKIDFSCLFLRDGKTKPFRRSHNLYIDKVSARFERLYP
                     RLVEVLQVADNLKSFLYSSQDMAQHVVEDSIKLSCFVSTQVIPFPHVHYVNSSQTKIN
                     IANYLTFYFTKHNRDALGRDAQTYFDSRLKIQFKSSKHSRFLFSFARDRYLSELYTAV
                     QVLQMEAGQREHLRWPVHEFEFDSEYMDLIKLFFPHRHNDIATIIECASKERHPRQVH
                     SACTPPTVLKEVL"
     gene            complement(<1175965..>1182114)
                     /locus_tag="C5L36_0E05370"
                     /db_xref="GeneID:40386340"
     mRNA            complement(<1175965..>1182114)
                     /locus_tag="C5L36_0E05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468097.1"
                     /db_xref="GeneID:40386340"
     CDS             complement(1175965..1182114)
                     /locus_tag="C5L36_0E05370"
                     /inference="similar to AA sequence:RefSeq:NP_010110.1"
                     /note="PKUD0E05370; similar to Saccharomyces cerevisiae
                     YDL171C (GLT1); ancestral locus Anc_7.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323957.1"
                     /db_xref="GeneID:40386340"
                     /translation="MTHRGAVGSDARDGDGAGVMTSIPHKFMKREFQYYCNVELPSYG
                     QYAVGNLFFKKDNEVYEKSKTTFENIASSLGLRVLGWRKVPVDDTILGPAALSREPKI
                     YQPAVVLEEAYGSGVSPVEISDEDFESKYQKHFEKQLYILRKQSTHTIGLHNWFYICS
                     LSNKNIVYKGQLVPAQVYQYYYDLVNADYECHFALVHSRFSTNTFPSWDRAQPLRWAA
                     HNGEINTLRGNKNWMRAREGVMASKLFGEDIDKLYPIIEEGGSDSAALDNVLELLVIN
                     GVLTLPEAVMLLVPEAWQNNEHMNPKKRAFYEWVACLMEPWDGPALFTFSDGRFCGAN
                     LDRNGLRPCRYYLTDDDIMICASEVGVIPIESKKIVEKGRLHPGRMLLVDTKEGRIVD
                     DRELKKQVSNRFDFKAWTLSNMITIPELITKLENRGISLQTKVDSDTKIKDDPKLLAN
                     GYTLEQVLSILVPMVNTSKEPLGSMGNDSALACLSEQPKLIYDYFRQLFAQVTNPPID
                     PIREKIVMSLECYVGPQGNLLEMNPNQCNRLKLKSPILSNDELLALKEINKVHPSWSV
                     TNIDITFDKSEGLTGYTEALDRICEEATQAILDDSQVIILSDRNLSESRVAVSALIAA
                     GAVHHHLVRQKQRSKVAIIVETAEAREVHHFCCLVGYGVDGINPYLAMDTLIKLNNDN
                     LLSKSYTNKEIIHNYKYAIDDGLLKVMSKMGISTLASYKGAQIFEALGVDNSVIDRCF
                     SGTASRIRGITFEYIAQDAFSLHELGYPSRDTIKPKGLPESGEYHWRDGGESHVNEPA
                     AVASIQDAVRNKNSKAYEAYSKKEYDAIKNCTLRGLLDFDFESSTPVPIDQVEPWTEI
                     VRRFCTGAMSYGSISMEAHSTLAVAMNRLGGKSNTGEGGEDVERSKASENGDSMRSSI
                     KQIASGRFGVTSYYLSDADELQIKMAQGAKPGEGGELPGYKVSESIAKTRHSTPGVGL
                     ISPPPHHDIYSIEDLKQLIYDLKCANPRARVSVKLVSEVGVGIIAAGVAKAKADHILV
                     SGHDGGTGAARWTGIKNAGLPWELGLAETHQTLVLNDLRGRVVVQTDGQLKTGRDIAV
                     ACLLGAEEWGFATAPLIAMGCVYNRKCHTNTCPVGIATQDPYLRKQFKGTPEHVINFF
                     YYVANELRAIMAKLGFRTIDEMVGRAEKLYVRDDLRTTKNANIDLSPILTPAHSIRPG
                     VATKCEKKQDHRLHVRLDNKLIDESEVTLDRGLPVTIEANAINTDRAIGTTLSYRCSK
                     RFGPNSLPHDTIHVNIKGSAGQSFGAFLAAGITLELEGDCNDYVGKGLSGGRLIVYPP
                     KDSKFKAEENIIIGNTCLYGATSGTAFFRGIAAERFAVRNSGAHAVVEGTGDHGCEYM
                     TGGRIVVLGSVGRNFAAGMSGGIAYVLDMAQDFEEKVNKELVELTTLSDPLEIAFVRG
                     LLEDHRHYTDSEIALRILNDFNRFLKKFVKVIPYDYKKVLEAEAKKAEELRKKEVSNY
                     FSTIREDPEADITGGEFSKPKKPVKTEPKLVDLEDTIVDVKTEEIKAKKLDKLGGFMK
                     YSRRHEKYRPVKSRIGDWKELSTRLTKDDLKVQTARCIDCGIPFCQSDTGCPVSNIIP
                     KWNELVFKDRWYDALQRLLMTNNFPEFTGRICPAPCEAACVVNVSGNAPVGIKSIEAG
                     IIDHAFAEGWIVPNPPKVRTGKKVAVIGSGPAGLAAADQLNKAGHNVTVYEREDRFGG
                     LLMYGIPNMKLDKGVVQRRIDLMAAEGISFIAKTTIGEDILLDELKAQNDAVILAIGS
                     TIPRDLKIPGRELKNIDYAMTLLSANTKALLADDLDTIRATLSGKNVIVIGGGDTGND
                     CLGTATRHGAKSVVNFELLPYPPMERTKDNPWPQWPRIFRVDYGHAEVKEHYGKDPRE
                     YSILSKEFVGDDDGNVKGIKTVRVEWKRSDSGAWQMQEIPGSDEFFPADVVLLSMGFI
                     GPESDNLNVERTKRGTVATAEATSYQTSKESNLFTAGDCRRGQSLVVWGIQEGRQCAR
                     EVDMYLMGKTRLPGNGSIERRDYHLLEELAAKV"
     gene            complement(<1183047..>1184834)
                     /locus_tag="C5L36_0E05380"
                     /db_xref="GeneID:40386341"
     mRNA            complement(<1183047..>1184834)
                     /locus_tag="C5L36_0E05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468098.1"
                     /db_xref="GeneID:40386341"
     CDS             complement(1183047..1184834)
                     /locus_tag="C5L36_0E05380"
                     /inference="similar to AA sequence:RefSeq:NP_013297.1"
                     /note="PKUD0E05380; similar to Saccharomyces cerevisiae
                     YLR196W (PWP1); ancestral locus Anc_7.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323958.1"
                     /db_xref="GeneID:40386341"
                     /translation="MISATSWVPRGIASEFPETYELNDEEMARIEAMSKLNLGEAKAD
                     LDEAMEEENGGSEDDKKVDSEKLKSQLDIDDELKEYDFEHYDDDEELAGEKIEMFPGL
                     TNTRATYVKRVKKVGDGEIVEEGVELDEGEDVEEEHYLQLPTEEEELEARAELQVYPT
                     DNLVLATRTEDEVSYLDVYIYDDGAGALGPEDEEAAEEEKKIDPDVKRGMVREGNLYI
                     HHDLMLPSFPLCVEWLSFRPKGENEVSNVGNFAAIGTFEPTIELWNLDCIDKAFPDVI
                     LGENEYHEWSSKNSGSSKKKGSKKKKKLGSKVSSTCHTDAVVSLSHNRIFRNVLASTS
                     ADTTVKLWDLSRCKVDRAIDEGLHEGKAVSSSMWFGETTLLTGGYDGKIRLSDVRLDD
                     VISNSKSFSCGSGYGEEVESIGKVGEHLVIGGCDSGNVYCYDTRMDQGDKPLWTLHAH
                     DSGISTLSSNSEIPGLIVTGAMGEKVVKVWNVKDNKPRMILSKDFGCGNVLTSSFANE
                     LEVSGHLVIGGSSNSGLKMWDVFSNKTVQNSFKDELKSLQGRAVEEAHKYGRVSRIAR
                     KYKHGYGESVVEPEAGGLEKKEEDEDFEE"
     gene            complement(<1186419..>1187096)
                     /locus_tag="C5L36_0E05390"
                     /db_xref="GeneID:40386342"
     mRNA            complement(<1186419..>1187096)
                     /locus_tag="C5L36_0E05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468099.1"
                     /db_xref="GeneID:40386342"
     CDS             complement(1186419..1187096)
                     /locus_tag="C5L36_0E05390"
                     /note="PKUD0E05390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323959.1"
                     /db_xref="GeneID:40386342"
                     /translation="MVNVENSIKRSPQKRRLFKTAETIFSETIKSNSKTEKPICPKPR
                     GYALTKSEPCLRPCLSVTGKPELSSRDEDAECKAAFSAEFEANGSVNVDPLRYKVNHD
                     QTKKSQDTPVWNDNGIHSFRGSSTPISNAAIETLGFVDTKNVLRGLEPLNIELPMLDQ
                     LAKDKLKPEFKSSNSVIANPKLTNVNNTNEKEKYKEETTKSLATTVAYKAIGNETTKL
                     NENQNLS"
     gene            complement(<1187990..>1193053)
                     /locus_tag="C5L36_0E05400"
                     /db_xref="GeneID:40386343"
     mRNA            complement(<1187990..>1193053)
                     /locus_tag="C5L36_0E05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468100.1"
                     /db_xref="GeneID:40386343"
     CDS             complement(1187990..1193053)
                     /locus_tag="C5L36_0E05400"
                     /inference="similar to AA sequence:RefSeq:NP_013956.1"
                     /note="PKUD0E05400; similar to Saccharomyces cerevisiae
                     YMR229C (RRP5); ancestral locus Anc_8.757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323960.1"
                     /db_xref="GeneID:40386343"
                     /translation="MAPKRTREDPDAKEQKSLLSSAAEISFPRGGASVLTPIEMKEVA
                     NQAKSDVLFESQAKSDLSEPSKKKAKKSKKSKVSLLNKDEENEEEKAKKITIDTLSYN
                     ILNPGSYVLGMIKQINKMEIIMALADNLVGFVPITNISSELVKLLHEYDDQEESDSDS
                     DNEESSSRETERQFPSLSNRFKVGQYLRAKVVSNINDKGKKRIELSIEPEKVNSPMEE
                     KEDLVENAIVQASVTSIEDHGAILNFGKNTHLSGFISKKELDSTASVVQAGSVLLVSI
                     SKINSRTATCKFPVAVVKKQPIVAAVSSIDALLPGMLVDAIIEGVLPQGLTCKVHSLC
                     DATITLQHMNSLLSPDEIKHNYSVGSVLKARIIATYTKNGTTKLAISILPNHQTLTYT
                     GKDALEAFPIGHIFDTVTIRGKSPNFLFVDVMSGEIPAQVHNSRVTKGKDLDLNYKIG
                     STHQARVLDYSMFDNYYILTMDKEQIDASFLKATEIPVGQKVTCKVEKVSPEGIIVNL
                     ENNFQATVPDIHISDIKLVYPERKFKIGASVKGRVLNVRAYGSKSFITVTLKRSLVNA
                     DDEEIVTSYDMLDIGKKVPATVQKILPSGCVVSFFGNVSAFLPNAEISETYVRNANDF
                     VKVGQTVKVRVISVDKALSKCMVSLRVSSDMTDEQVNALSKLVPGKSIVNAEVLEKER
                     DSVIVKLDDCEVRGIVHVGHLADGLPDVARSQLKKLKIGEKIEALVLVLDKRHRAVTL
                     SCKPSLLSDAKAGSLPTEFTDISISDKVLHGYVKTVIPTGVFVSFGNNLTGLVIPRFA
                     SGKKINDLTAAFTPDQSVNCSVVNVDQNSQRFLLSLLVGSNDSKENIINPVDKSVKKL
                     GDYSVGKVTKCIIKSIENTHLLVKLADNQEGIVDITQTFDDIKRVENLAEPLSSFTVG
                     KKLEARVIGYFDVEKQKFLHSKKDKSNLIELSIRPSVLKSKEVVYPLSFHDIKEGQSV
                     TGYISSINNGYFWYHISASQKAKLSFIDVTDDVSKFENFKENYKVGAVVPAKVTNINT
                     EHYAITVSGRFNNVVSGKDIKVGDVLPSLVLNVRGNSVLVSLGNNVTAVSMATDALDD
                     YTLHLEDVYHIGDLPVATVVSTEGKIYVSLRGKNPKDKLINSIADIKRGDVVRGYINK
                     INNTGLFVDLGRSVYALVKVSDISDSFIKDWKKDFHINQPVRGRILEADSEGRVLMTL
                     KDSVVNGEISNLKSFKDLKVGDIFEGSIKKVEEYGVFVKLDGTENISGLCHRSEITDS
                     PIKDAQEIFKAGERVKVKILDINSNKRQLSLGMKASYFKNADSDIDEDGDVIMEKASD
                     NEDSDDEEMIDADSVSSDSEEDSHLQSDEEEKEEVAKDSPNGLSAGFDWTASILEQAK
                     EEESSDEEEDFNNEVNRKAKKQSKKSKSEETEDKTGDLNTRAPQSVSDFERLLVGNPD
                     SSILWIQYMSFQLQLSEIEKAREIAERALKTINFREEQQKMNIWIALLNLENSFGDDE
                     SLKDVFKRACQYMDSFTMHQKLATIYIASEKYRKADELLAVLCKKFGSKQPSAWVTYG
                     SFLIDRRQNEEAHKILAKALQILPKREHVDVVRKFAQLEFQKGDPEQGRSLFEGLLSD
                     VPKRIDIWNVYIDQEIKANEKSKVDDLFERVVERKLSRKQAKFFFAKWLSFEESQNDE
                     KAQDYVKAKAAEYAQKLSK"
     gene            <1193764..>1196472
                     /locus_tag="C5L36_0E05410"
                     /db_xref="GeneID:40386344"
     mRNA            <1193764..>1196472
                     /locus_tag="C5L36_0E05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468101.1"
                     /db_xref="GeneID:40386344"
     CDS             1193764..1196472
                     /locus_tag="C5L36_0E05410"
                     /inference="similar to AA sequence:RefSeq:NP_013005.1"
                     /note="PKUD0E05410; similar to Saccharomyces cerevisiae
                     YKR079C (TRZ1); ancestral locus Anc_5.671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323961.1"
                     /db_xref="GeneID:40386344"
                     /translation="MSFNLTVVSHPTVDVVKPSLMLEDRSTGERSMIGNVPSGLQRKC
                     NEMRLRTSRLSNIFLSGILDWNSLSGLPGLILTVSDQGVKSLSLHHSGNKFLHYMMSC
                     WRYFIFRFGLDLKAEDNSETVKNGSVDYTPVNIASSVDYGNNENKDADHAKLREIING
                     IFPFQKDPSKPVYNKTATNFTLPKSIINPRVSTNWIITPVSIRGKFMVNAAKELGCEV
                     SHFKPLCNFESVTLKDGTVVKPQQVLEPTRHFNPVLILDIPSAEYITNTISHNWSESS
                     PNNLPYSAVYHFLDDSIENPLGIPEYVEFIKSFGPTTIHFISHRSYCPNTLNYHKTLK
                     VSLKWKTLLKDFFPLPKWVNHSDLKLNGELPNVLPLISGQNLIIKSVNGTELEESTKL
                     GSEISKHSAEDSKRLYNEEIRDSDIRGLISQEDFNTMIDDRNSAQSLRRQVDLSKSLK
                     EQVETLILGTGSAIPAQVRNVISNLIRIPYKTGEEVGFRTIVLDAGENSFGTLRRIYL
                     PQEVDMLLDELCMVYLSHLHADHHLGIVDFIREWNKRQDQIYGAKRHKTLVVITPWQY
                     DFFIDELNRVDPFINKEFLFHVSCDEFMLGFTPPSLEQLQIEDITVEEMKNCKPKEMK
                     YLKDSSKSEYVYQVLGMSEILACSAYHCEYSYSTSFSFRLDLSEKDNSEANIFKVSYS
                     GDTRPKSAFSYIGKNSDLLIHESTLEDEKLADAVDKRHSTTSEALQVGILMKAKKIIL
                     THFSQRYKSFTCSETVYKRLRNPVSKIDLIENGKFVPPESEAVTPKSAKSYQSSLQND
                     PDIPLEAKSVIFADDLNEDIKDNAAKIEVLFAFDNMKVQYDQIYMQREVFEKQRKQLE
                     KLFPMDDEEFVDDQPEQPTEKTKSKKVKKQKEIKNPKKRKLTPPGA"
     gene            complement(<1196539..>1197240)
                     /locus_tag="C5L36_0E05420"
                     /db_xref="GeneID:40386345"
     mRNA            complement(<1196539..>1197240)
                     /locus_tag="C5L36_0E05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468102.1"
                     /db_xref="GeneID:40386345"
     CDS             complement(1196539..1197240)
                     /locus_tag="C5L36_0E05420"
                     /inference="similar to AA sequence:RefSeq:NP_012633.1"
                     /note="PKUD0E05420; similar to Saccharomyces cerevisiae
                     YJR099W (YUH1); ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323962.1"
                     /db_xref="GeneID:40386345"
                     /translation="MESATVNAVVPLESNPEIFTKFASDLGLSPLLAFCDIYSLDDPD
                     LLCFLPRPMQAVILLFPVTQKYEEFKNKEQVEPVDYSKVIWMKQVVKNACGLYALLHA
                     LLNIPKGFMVQNSELSKLRLNLLEHTKDPAELVQSIAQTMYSTYSTQGQTEAPPAEDN
                     VDLHFVCFVKKNGAIYELDGRREGPLLLKSTNEAGSDLLSDSVVSERVKKYMSLVEGD
                     NSLQFALMGLAPRMD"
     gene            <1197781..>1198353
                     /locus_tag="C5L36_0E05430"
                     /db_xref="GeneID:40386346"
     mRNA            <1197781..>1198353
                     /locus_tag="C5L36_0E05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468103.1"
                     /db_xref="GeneID:40386346"
     CDS             1197781..1198353
                     /locus_tag="C5L36_0E05430"
                     /inference="similar to AA sequence:RefSeq:NP_014806.1"
                     /note="PKUD0E05430; similar to Saccharomyces cerevisiae
                     YOR163W (DDP1); ancestral locus Anc_6.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323963.1"
                     /db_xref="GeneID:40386346"
                     /translation="MSYTKKETARVGREHQLYTKDNLRLVAGGIVLDGTHEKVLMISS
                     AKHPDKWIIPKGGIEDDEVEDYGTAALREVWEEAGADCEIVKKIGQYKDHRLEKNSTD
                     IGEWALCEFHFYQMKLKQLAIEWPESSTRLRRWCDYSEAKHELLKSKRPELLLALNDS
                     DIVKNVDLLEYEHSNLKDTQLDNDDQYENI"
     gene            complement(<1198393..>1199361)
                     /locus_tag="C5L36_0E05440"
                     /db_xref="GeneID:40386347"
     mRNA            complement(<1198393..>1199361)
                     /locus_tag="C5L36_0E05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468104.1"
                     /db_xref="GeneID:40386347"
     CDS             complement(1198393..1199361)
                     /locus_tag="C5L36_0E05440"
                     /note="PKUD0E05440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323964.1"
                     /db_xref="GeneID:40386347"
                     /translation="MWPIEIVVLVMHYAHVQDLESFVKGMGVQKSPVIKEYMGRRLKT
                     VVSIHGSYFEDEIDRNHCQQLCVIDKDKHGDWNHFDSIYCCLKLKRLHMKTHNVDVLS
                     NLFDHIPPTLEILEILIDGNITGCLRRYKQKNHLALNLKMLTIVNKSHWNQKKIQKIY
                     GYSAQELKRQVDLGRNTETTFLRGYGKYKMKRVGYCFDDPKYGNLQYLGSLLSNIVKD
                     SFKTIQNVGCFGLDICWIFHRYHSAIYGSLRIIKTDCNSMLNLSIWKHLLSQKNLEFV
                     DTRKLKPMVAIFSRSFENNCKIIDSLGNCAYVNGSAMKLLQQYTVV"
     gene            complement(<1199492..>1202470)
                     /locus_tag="C5L36_0E05450"
                     /db_xref="GeneID:40386348"
     mRNA            complement(<1199492..>1202470)
                     /locus_tag="C5L36_0E05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468105.1"
                     /db_xref="GeneID:40386348"
     CDS             complement(1199492..1202470)
                     /locus_tag="C5L36_0E05450"
                     /inference="similar to AA sequence:RefSeq:NP_015200.1"
                     /note="PKUD0E05450; similar to Saccharomyces cerevisiae
                     YPL125W (KAP120); ancestral locus Anc_8.624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323965.1"
                     /db_xref="GeneID:40386348"
                     /translation="MDYNSVLQTLVVASSTVRGAQQQAAEEQLKKWESEKGFYYTLQS
                     IYINQELSLQIRWLAVICLKNGVEKYWRSTRINSITKEEKVEIRKRLFDTLDESNNQL
                     CIQNAHLTSRICRLDFPVEWPTLFEDLVTIMESCDTSSSQSIVRLNNLMIILNQILKI
                     LASVRIGKARVMMQAKAPIVLPHLMKFYTFFFNQWYGNNYDLSLMEVGYITLKVIRRL
                     VVDGYAHPNRDKYVQEFMEVSLQHFQKMLVAHKQNELALLERYIKCYVKLFHNLVSAN
                     TCAFVLMSSSKHILLTLLSLLSQEAEPIYALDNETDFWEKIATKSFIIMKIITNYTFN
                     EKTSLIKQRDDKTEIIQSIEYMKTNFFNTELVESLLELITRYYLRLRPIDLESWNEDP
                     EEWFNEESNVNYEFQVRKAAENYFQDLSIFFNQYISKYIMDKVNNLNNPSLSVIEKDA
                     TLAIFQLSSHSIKEECNFNQLLTDYFIPQGLSGNDLIKRRICLIINEWVDEKTNSQVR
                     IQIYEFLVEIFSASTIVKLTSVQTLKNLIDDWEFRKRDLQPFTTTIIRNFLELINSLS
                     TIECKNFVLNAFSIVIERNTPLLEESILVEIARVVPVLWGNFNNSNETIIKNSLLRIL
                     KDLVIALNKGSSLIHDMVLPLIPICCNPNSEYYTLLCEDGLELWSALMKTTSQIVLAD
                     DAMFDMLINALLVFTEILPLVLTIIRSYTLIDVQILETPKGMKILEILAGYLKTMRDD
                     AVSLTSSIVEVGIMQKSEKSAFYSNLFNSKLIHEIAEYLIGDTDSAYCEVKLSLPLLR
                     LFLDNSQAFLANIPGIKLYALMNNLIKFGRNSYDPKIRKLYVLGLYSLLKPEYLQNGQ
                     TLSNIEYELSQMDSIRAVSSVLLSFVKPVVDLGITFIEEIREDANGDMKAYHKSSSYD
                     DDELKAIEPQSDVEEDNEYYLETLVPPNAERERYTALLKQDPVRNIPIRDFIRNIMGA
                     IFPIIGNLLDSNDLEELQRL"
     gene            complement(<1203412..>1205715)
                     /locus_tag="C5L36_0E05460"
                     /db_xref="GeneID:40386349"
     mRNA            complement(<1203412..>1205715)
                     /locus_tag="C5L36_0E05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468106.1"
                     /db_xref="GeneID:40386349"
     CDS             complement(1203412..1205715)
                     /locus_tag="C5L36_0E05460"
                     /inference="similar to AA sequence:RefSeq:NP_010544.3"
                     /note="PKUD0E05460; similar to Saccharomyces cerevisiae
                     YDR258C (HSP78); ancestral locus Anc_5.618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323966.1"
                     /db_xref="GeneID:40386349"
                     /translation="MLNRRIITNTIRKNARLMNTLPLVTRVTVPTINHAIRRNLSDVQ
                     QQRRGFHYTAINRVELRMNKDQQEEPALKKYATDLTELAKNGKLDPVIGRDEEIKRTI
                     QILSRRTKNNPVLIGNAGTGKTAILEGLAQRIIKGEVPESMKDKKVIALDLGSLISGA
                     KYRGEFEERLKAVLKELNDQTILFIDELHILLGLGKSEGSIDASNLLKPALARGQLQC
                     CGATTIDEYKKYIEKDVALARRFQPILVNEPNVEDAISILRGLKEKYEVHHGVRITDS
                     AIVTAAVYSNRYITDRFLPDKAIDLIDEACSSLRLQHESKPDAIQELDRSIMTIQIEL
                     ESLRKETDEISKERKKKLEETLKIKQEELKELTQIWESQKEELERIKQLKYEIETAKN
                     DLEIKRRENNFAEASKLQYDTIPSLEHKLNELIKEQEKEDKNSLLHESVTSDDIARVI
                     SKATGIPVTNMMKGEKDKLLYIEESLKGRVVGQDDAIASIANAIRLQRAGLTDEKRPI
                     ASFMFLGPTGTGKTELTKAVADFLFDDENAIIRFDMSEFQEKHSIMRLIGAPPSYVGY
                     EEGGELTEQVRRRPYSVVLFDEFEKAHKDVSKLLLQVLDEGKLTDSQGNKIDFRNTLI
                     VMTSNIGQELMLQDNPNKEEVMNLMKSYYSPEFINRIDETVIFNKLSKEALRKIVDLR
                     IDELQSRLVERRIELKLDEAAKEWLTENGYEPRYGARPLNRLIKRKVLNPMSVLLLKG
                     EIKDGSVVDITAKDGDLVITPTNEPVE"
     gene            <1205961..>1206731
                     /locus_tag="C5L36_0E05470"
                     /db_xref="GeneID:40386350"
     mRNA            <1205961..>1206731
                     /locus_tag="C5L36_0E05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468107.1"
                     /db_xref="GeneID:40386350"
     CDS             1205961..1206731
                     /locus_tag="C5L36_0E05470"
                     /note="PKUD0E05470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323967.1"
                     /db_xref="GeneID:40386350"
                     /translation="MRSSLDTADSASICMLNKPAKRKQRTPSKRTLLKKKTAKKVKND
                     PQMYVAEAEWAQDSNKHRNMPSPVDWGNDLRLKRQTRLIQLAAEEEDMEAIDIGIEGI
                     GESNLETKMMVKDPLFSPPSSLDSPLNEESPFVLLNQQQCKPYLDEERHATASTTNAT
                     APTGSVAMVVSNKDSEEDISKNKTTTSINMSDFLNIDTATTSNTTFSHIPEIPRFPIN
                     RYRQNGTFDLSQTITPRHSVNPLKRVAIWSGKADETLI"
     gene            <1207015..>1207782
                     /locus_tag="C5L36_0E05475"
                     /db_xref="GeneID:40386351"
     mRNA            <1207015..>1207782
                     /locus_tag="C5L36_0E05475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468108.1"
                     /db_xref="GeneID:40386351"
     CDS             1207015..1207782
                     /locus_tag="C5L36_0E05475"
                     /note="PKUD0E05475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_029323968.1"
                     /db_xref="GeneID:40386351"
                     /translation="MEHFKLLLRTTSSKLEFKHKKSRLMSTNMIQTDILERLRTLANE
                     PNDSRNFERGLDLLKMKLAQIVRSDRIADVWEDLVGELAYLEGNTSVLVSMMEKQKVI
                     NMARTPQEGWFTRKEPQIVDDQPVDRISKVIRNVIVAQEYLGDEIKELKKLSMALSRC
                     INKDWVLKHEIGDDLEDKIYIEITRKLRGEDESTVVEDYLKELTDIYKIDLFNEGKYP
                     GEEQAETERKTISTGLSSVPKLDDLDDLKSRFEALKK"
     gene            complement(<1208518..>1210029)
                     /locus_tag="C5L36_0E05480"
                     /db_xref="GeneID:40386352"
     mRNA            complement(<1208518..>1210029)
                     /locus_tag="C5L36_0E05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_029468109.1"
                     /db_xref="GeneID:40386352"
     CDS             complement(1208518..1210029)
                     /locus_tag="C5L36_0E05480"
                     /inference="similar to AA sequence:RefSeq:NP_012444.2"
                     /note="PKUD0E05480; similar to Saccharomyces cerevisiae
                     YJL091C (GWT1); ancestral locus Anc_1.275"
                     /codon_start=1