GenomeNet

Database: RefSeq
Entry: NC_049561
LinkDB: NC_049561
Original site: NC_049561 
LOCUS       NC_049561            7273914 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome I, complete sequence.
ACCESSION   NC_049561
VERSION     NC_049561.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 7273914)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7273914)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7273914)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055898.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..7273914
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="I"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            complement(<2148..>6758)
                     /locus_tag="TRUGW13939_00001"
                     /db_xref="GeneID:55987518"
     mRNA            complement(<2148..>6758)
                     /locus_tag="TRUGW13939_00001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483216.1"
                     /db_xref="GeneID:55987518"
     CDS             complement(2148..6758)
                     /locus_tag="TRUGW13939_00001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339109.1"
                     /db_xref="GeneID:55987518"
                     /translation="MEQKQIQHEQDQACRPVQCQRLFPVKANSQYFAIIPETDEAVAP
                     DGDACETLIQNMQAHWRSVQEAADRKIQAGQVDEANPWLRRTEWVKYLGEFDIPDLIQ
                     SVSPPPADIDGQPSIEPEAHAIWTAMARLATISQLSVIHQIGVFVRLEAIRTEQHQTR
                     YTPLEAYQDEESIVKQVRPWQEMLMFFWRTQQPHEWTSPPYRFTRRQRMAWERLVDAV
                     RIPPTRQVSKGKVITRSGATRAPWVEEEEEEEGEEEEEEEEERDTMSIDSLSVDSNEP
                     DFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPLSPVERACLD
                     FCIELLNQRITRREYDSALVCAAAVLGVREGGFRTPEDYPPILSRVIKVARFMVVKKA
                     VELSDEPEEEDAAELPSSMDHTDWDSAYGGSPPPSSPGRKGCLQWVTQMMDRFMVRGS
                     QGPTQWMLDLRTYGLKIHYNTTSAGHVQWQNGDELCYKDRQFTMNEFRGMVHAVVQDA
                     RRILIDDILGCPSDAVPAIPWDRLYDDPSNNQARWSFLQDTRTQWPVDGEHWMWHRIR
                     QDPAVRRRFIQADGQGFHPARWMAYQNRITAFLEKLLVAIQFTWGQPARAPELLSIRH
                     ENSPMGGIRNMFIEDGMVVLVAQYHKGYQLSGDVKIIHRYLPREVGELLVWYLWLVQP
                     FERVVSGNIYQRDQVSSHIWTAHPHQAKWNSERLRHILQRESAMGLRGQSLHIASYRE
                     VAIAISRRYLRNKYRFAADDGDDPEAMDEVQLLADAADRQAGHDPHTAGGIYARESRE
                     LFGAMASMRERYRGSSQDWHTWLGFASCQPPSDPDADPFSAPPASSTSWFTDEAQRSR
                     EERWQRMQRMDVDQALRDMMGPDAAFRGPQKQIVQAVIQGQSPVIGVMPTGGGKSLLF
                     MLPAWMARGGTTVVIIPLVSLRDDLQRRCAELDIQCVAWNNRQPADGASIVLITPESA
                     VRDETFSTFLNRKQFTGQLDRIVIDECHIALHDQYDFRKSMTQLGQLVRYRAPMLLLT
                     ATMPREDEERLCQRMYFPPSTVHWIRARTSRHNIAYRVVRIARPQEHGRRGDVGAAIM
                     AWIEQEIPRYSPGKVVVYANSRHQTEQVAEALGCGAYHSHTIDRAGMLSTFRQTPSGV
                     IVATSALGMGIDIPDIRCVIHVGRPRSLLDYAQESGRAGRDGQGSTAVMVLDGSGGGW
                     GDPVTDRDAGSLRALEQVQRYIDQPCRRGVFDPYLDGEVDGYQRQQCEEGEAACDGCC
                     AAAIPVETQATSPTTQSETPAISPARRVQVQARSPVPAPARSPKRKLSEAFTMVTMPH
                     ARRRGYNEPWEQLRSHIEREARTVDSIREHFDRWVGRCRICAMHEAPSEHFTYQCPRA
                     EGQQAAAWIEETIRKVTGNQREDGRNGYEDYAVCFQCHSPQWICPRWVRVDHGGYQRT
                     KEACRYLETAAHTMAQLLHGPMREVIQPAWERRLAQMPGGGVPHENQAALIRHFQRKF
                     GKRGEERSGLVEEMTWMCSWVDDTMQVDVESSEDSNSIISHM"
     gene            complement(<12152..>12580)
                     /locus_tag="TRUGW13939_00002"
                     /db_xref="GeneID:55987519"
     mRNA            complement(<12152..>12580)
                     /locus_tag="TRUGW13939_00002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483217.1"
                     /db_xref="GeneID:55987519"
     CDS             complement(12152..12580)
                     /locus_tag="TRUGW13939_00002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339110.1"
                     /db_xref="GeneID:55987519"
                     /translation="MAWERLVDAVWILSTCQVSKGKVITRSGATRAPWVEEEEEEEEE
                     EEEEEEEEEEEEEEEEERDTMSIDSLSVDSNEPDFFNDRSDGIEKMMEEIAIGRMVNV
                     DAIFDIECPLENEEEASNIIVLLLSSVERACLDFCIELLN"
     gene            <23361..>25974
                     /locus_tag="TRUGW13939_00003"
                     /db_xref="GeneID:55987520"
     mRNA            join(<23361..23888,23946..25389,25442..>25974)
                     /locus_tag="TRUGW13939_00003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483218.1"
                     /db_xref="GeneID:55987520"
     CDS             join(23361..23888,23946..25389,25442..25974)
                     /locus_tag="TRUGW13939_00003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339111.1"
                     /db_xref="GeneID:55987520"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTSLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <44921..>45400
                     /locus_tag="TRUGW13939_00004"
                     /db_xref="GeneID:55987521"
     mRNA            <44921..>45400
                     /locus_tag="TRUGW13939_00004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483219.1"
                     /db_xref="GeneID:55987521"
     CDS             44921..45400
                     /locus_tag="TRUGW13939_00004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339112.1"
                     /db_xref="GeneID:55987521"
                     /translation="MLLEGIQGFAMAPGLPNIDNHPLDPGGQALGLVNPVGAYIGTPA
                     GTAPPAPPEASATVPQSEGFLPSLEINPRELFPPLSSVPGSQEAPKTLGKRLQEHSPN
                     RAERAPMKALIGPAYKDMEQALLGHFASSNSALHAEMAAMKAYITFLVEAMEQRLTG"
     gene            48948..>50882
                     /locus_tag="TRUGW13939_00005"
                     /db_xref="GeneID:55987522"
     mRNA            join(48948..49035,49117..>50882)
                     /locus_tag="TRUGW13939_00005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483220.1"
                     /db_xref="GeneID:55987522"
     CDS             49488..50882
                     /locus_tag="TRUGW13939_00005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339113.1"
                     /db_xref="GeneID:55987522"
                     /translation="MLKSTPLGPLIREAALEPAEALLDSKQRRYALRLLGLPQGHPAA
                     EILPITLREGDAHAQPGEQPLEDRAWATPTRRGPWKLGMGLARRLREALTADPSQGFE
                     RTIEPGNRSIPLDFRIDSPETAMQLASDPLSGIGNTDLYSDGSRLDDQRVGAAVAYKP
                     LIGPWRSRLAPLGAGFEVFDAELIGVVEALEWALAENLIGPIRVFLDAQAAISRLQHT
                     RPGPGQALALRAHDLAGELQATGRRVTICWVPGHKGVPGNEEADKAAKKAAGRPCTGK
                     YSGISLAHARRACTETYSAIKANWLTAKLARRTQQVGQAYQPPRGWKLDPIVASTPKH
                     LARRYYQFKTGHTPIGAYLHRIKARDSPNCLGCSRGTETVRHLLTNCRQWCHQREKLY
                     AGLAEAGVKAPQDSEQCPEARLFQDPKATTALLAFIGAIREREDNQQAWEQAYKTDNW
                     GIEALDEGEREGEG"
     gene            <54469..>55578
                     /locus_tag="TRUGW13939_00006"
                     /db_xref="GeneID:55987523"
     mRNA            join(<54469..54920,54975..>55578)
                     /locus_tag="TRUGW13939_00006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483221.1"
                     /db_xref="GeneID:55987523"
     CDS             join(54469..54920,54975..55578)
                     /locus_tag="TRUGW13939_00006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339114.1"
                     /db_xref="GeneID:55987523"
                     /translation="MGASDLQYSVDQEIGHFFEKTSTTRIACDTYTKEHLGGDVIPVA
                     VQGVCSYTVYAGPNSEFVAQFRLKSLQLRMETMNLARAIYGHLAPQVTFRGQVGEDTE
                     GKEPLYIYFMSRIRGISYLDFILAHNSQVPENSPGFSFWRKNLIIDIARFFALSWKSP
                     QDVEQAYRDGLHCQYEKELKLLLSTLPDRFHPLIRKSIESLSAILSLPMVLLHKDFGV
                     CNIMVNKESCNLVGVIDWAEAEVAPFGLYLHSHQRLISKVHLKNGWVRYDDYILLEEV
                     FWNTFSEEAGGLSNEIIGIIKSARIVGLLLSRGFTSRLANMPKSVPIRDDESGAYNMR
                     DLDGLLINPATRFTELV"
     gene            complement(<55686..>56381)
                     /locus_tag="TRUGW13939_00007"
                     /db_xref="GeneID:55987524"
     mRNA            complement(<55686..>56381)
                     /locus_tag="TRUGW13939_00007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483222.1"
                     /db_xref="GeneID:55987524"
     CDS             complement(55686..56381)
                     /locus_tag="TRUGW13939_00007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339115.1"
                     /db_xref="GeneID:55987524"
                     /translation="MNYIQRLTLYRYNELLDDGDQPPVADEHITNLAEIFVRHNAEKL
                     LGIHLIHGHFKIPKSTVMLGTNFENPYLRWTKVTDIKKINPAGVHGHIFALTKDGLCA
                     YEIQDGPLPDFSGIGQGFLDEFIHYIVENNLISLVGLQVLGCGDCPMSELILDQGTVM
                     LDSSAVKNTKPTRITGWKFESVNGKPRVCSANETHATMTSGNHKVFNAEKPHPKLESA
                     EDLKDALVSVGDL"
     gene            complement(<56886..>57319)
                     /locus_tag="TRUGW13939_00008"
                     /db_xref="GeneID:55987525"
     mRNA            complement(join(<56886..57207,57291..>57319))
                     /locus_tag="TRUGW13939_00008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483223.1"
                     /db_xref="GeneID:55987525"
     CDS             complement(join(56886..57207,57291..57319))
                     /locus_tag="TRUGW13939_00008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339116.1"
                     /db_xref="GeneID:55987525"
                     /translation="MPSSTPQKHRVFNANIINPILFCIHAGPSILFYFVMTIVFAFVF
                     AVAVIPLHVIGWLKISKLRLLLKVGVKLLGKVDNMCNKSEGPIFLKRAVAVVLNIEGS
                     LNQILELTAQSTQE"
     gene            complement(<60521..>61894)
                     /locus_tag="TRUGW13939_00009"
                     /db_xref="GeneID:55987526"
     mRNA            complement(<60521..>61894)
                     /locus_tag="TRUGW13939_00009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483224.1"
                     /db_xref="GeneID:55987526"
     CDS             complement(60521..61894)
                     /locus_tag="TRUGW13939_00009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339117.1"
                     /db_xref="GeneID:55987526"
                     /translation="MAGTISMYDLVIVGHGVAGLAAAVSAAELVPAAQIAVLERTPEA
                     ASGGNTRYSPANMRMRSVNEILPGFVDDMMTISGVDGDRAYFEKLADQAPQAVQWLER
                     QGVQFHAMDYFLKSWPNRIQPVGKGAAIIETLQRSARAKGIQLVYECRAKQLHLGKEG
                     ATIEAADGRRFIAKSVVLASGGFQGNPDLLHTYFGTGAESLRPISPGTRWNTGDGIQM
                     ALNNGAAVNGNWNGMHSEIIDPRSDMPAPLVLVYPYGIVVNRNGKRFVDEGAGLVHDT
                     WEQLSRTIHFNAPGQSAWVVCDSRLSEVEGYEAAIRTDIPPLTADTVSGLAVQMKVPE
                     QALLDTISSYNAACDTDVSLFSAGRLDGLATGPHLEPPKSNWARPLNSPPYLAFPLAA
                     AIVYTFGGLATDTEARVLTQQGAIPNLYAAGEITGHFHDTAPNAVAVLRALVFGRIAG
                     LNAMSSK"
     gene            <62330..>62809
                     /locus_tag="TRUGW13939_00010"
                     /db_xref="GeneID:55987527"
     mRNA            join(<62330..62382,62500..>62809)
                     /locus_tag="TRUGW13939_00010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483225.1"
                     /db_xref="GeneID:55987527"
     CDS             join(62330..62382,62500..62809)
                     /locus_tag="TRUGW13939_00010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339118.1"
                     /db_xref="GeneID:55987527"
                     /translation="MPLRQRSERLLWFRSEREQARVAIDNPVDAAANPTDLVRVVDFA
                     NNSGPSMRTQCSRSAVVALAAEFDCIERTKTTQPVSEVIKELPTDQAVDGVVPEILVS
                     DIDPILITQDKDDDHNKD"
     gene            complement(<69816..>72798)
                     /locus_tag="TRUGW13939_00011"
                     /db_xref="GeneID:55987528"
     mRNA            complement(join(<69816..69854,69904..>72798))
                     /locus_tag="TRUGW13939_00011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483226.1"
                     /db_xref="GeneID:55987528"
     CDS             complement(join(69816..69854,69904..72798))
                     /locus_tag="TRUGW13939_00011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339119.1"
                     /db_xref="GeneID:55987528"
                     /translation="MAGNSNAPAAGPATPRPPARQARPVDQDSDDEPDEQTQQRFTTL
                     ERVIDQMNEHIQRLQAAVAERDDHVNQLEAQVMAIPPGEAGTAGNRVKLPKPMTFDGT
                     RSKLKTFLVNMEMHIEANQITHDKKKMIFVASCFTDAAAEWIQPMLSELYTTDRSSWG
                     TITRELFSNYGMFKQKLGEAFGNIDELRTAERQLRYLRQTGSAQQLATKFRQIVTPLH
                     YDDAIQIATFENMLKEEVQTELIKLDRPDNIDRFIEMAVKIDNKLFEIKQKRQEFQRW
                     KKVGGFPQYANTSAKRGTQYDKDGDVKMQLNNVISKEEMAKRKENKACYKCGRKGHFA
                     RQCRSGQGRQNGNASPQKITTVHQQIAAIHQTIVTPSDSEEEESENEQVDEVKDFWGP
                     ILEKEIYESLKNFEHEDTPGQSKGRLRQSSEREPPQEEDANPEEAQPHLRQGQEKGPI
                     REPRREDQYSKTAGRRIDDLSSGSESQHPLTFRDGGKDKEVDHEDSDRESDTPQQSQL
                     AKTTNLREDAARAINQANETIRLFQKQPPITRKEWDSVLGTSTTVPGTRIEIPETNSE
                     DSETTEEFPEIDYEEPKRECSCEPPKPVCWEDSIQTYRQHILECEKCHEWTFHKCDMH
                     GKKNIALANEFEYVSLTKGTQLCHPMLGHTERCSCMYYPQYGGHHHKKIHWTQCYESK
                     CPTHLEEKEKNKWKPTAPMIIYQPIPDCPKGWNECWCYAEEIWHPFHNSIETDQCYAK
                     KCPYHEGRVIYTDEDWTEIVLSQKRYLERHRKGHHLIATTIKTGETVIIIKGTINGHE
                     AKLLLDSGASTNYISEAYVKKNRIQTHETNLWHTVQNFEGQITIEGFVRRTGNITLKS
                     GEHEESIQLDLSPFERKDFDIILGMTWLRKHNPVIDWKHETVSIDLKTLQTEQMGIKP
                     NQQLKVKHAEEINEIGRQIETRKKPKEIYEKELKEVLDKLPEKYRDFTELFRYRSRKE
                     HRYHK"
     gene            <80665..>81282
                     /locus_tag="TRUGW13939_00012"
                     /db_xref="GeneID:55987529"
     mRNA            <80665..>81282
                     /locus_tag="TRUGW13939_00012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483227.1"
                     /db_xref="GeneID:55987529"
     CDS             80665..81282
                     /locus_tag="TRUGW13939_00012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339120.1"
                     /db_xref="GeneID:55987529"
                     /translation="MGFKQQILLTLATATCALAVSPVGSGSWTSVDPEFDVQECAGGT
                     VSGSTFKLPESPNGSTSGSGCSNGHLRAERRYKNDYSSGVHQFGGQFKITSMGGNKVD
                     LKQTFNGDDGPWFMMAVKDSGDLYNVEGGDTIASGVATVGQTVTINTVHDADSSSFDV
                     YVNGNKTYSTSSVGGSYYDKFGAYTTDSGSGPITVEWTDISFWTQ"
     gene            <83550..>86163
                     /locus_tag="TRUGW13939_00013"
                     /db_xref="GeneID:55987530"
     mRNA            join(<83550..84077,84135..85578,85631..>86163)
                     /locus_tag="TRUGW13939_00013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483228.1"
                     /db_xref="GeneID:55987530"
     CDS             join(83550..84077,84135..85578,85631..86163)
                     /locus_tag="TRUGW13939_00013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339121.1"
                     /db_xref="GeneID:55987530"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTFLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <96555..>97374
                     /locus_tag="TRUGW13939_00014"
                     /db_xref="GeneID:55987531"
     mRNA            join(<96555..96569,96631..>97374)
                     /locus_tag="TRUGW13939_00014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483229.1"
                     /db_xref="GeneID:55987531"
     CDS             join(96555..96569,96631..97374)
                     /locus_tag="TRUGW13939_00014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339122.1"
                     /db_xref="GeneID:55987531"
                     /translation="MPSNCEAQNSEDIVTCQGLGKTILLSTGGYTYSEGGFNSTSEAL
                     QFANLMWELFGPVSNNSSALRPFGTAVIDGFDFDFENLVMNNMPTYANQLRSLYSTDK
                     SKTYYMTAAPQCAYPDTADDSMLDGAVYFDAIFVQFYNNACGLVYFDPSSATQRFFNF
                     NTWDNWAKNVSKNPNVKVYMGIEGNVGAGAGYEGLSIVEPAITYVSQFSSFGGVMMWD
                     ASQVWSNTGFLSSVYKTLPTSTNSSTTHTLQDAD"
     gene            complement(<100068..>102093)
                     /locus_tag="TRUGW13939_00015"
                     /db_xref="GeneID:55987532"
     mRNA            complement(join(<100068..100644,100727..101106,
                     101169..101181,101252..101306,101356..101371,
                     101425..101532,101602..>102093))
                     /locus_tag="TRUGW13939_00015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483230.1"
                     /db_xref="GeneID:55987532"
     CDS             complement(join(100068..100644,100727..101106,
                     101169..101181,101252..101306,101356..101371,
                     101425..101532,101602..102093))
                     /locus_tag="TRUGW13939_00015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339123.1"
                     /db_xref="GeneID:55987532"
                     /translation="MDSEKDALKRPDEEMNRDNVKPEALLASPVPAHPNETDKGQQWP
                     SEPPKHEKEDVYSVFTPGQKNFIVLMSGLGGFFSPLSANTYLPAIPMLSKDLNVSWTL
                     INLTITAFMIFQGLAPSVYGDLADMMGRRPAYLIAFIVYIAANIGLGLQTSYPALFIL
                     RCLQSAGSGGLYSLNSGVVADISTTAERGKYMGMAQSGIMLGPAIGPIIGGLLAQYQG
                     WRAIFWFLVIFGGVYIIVLGMAFPETARKVVGNGSLPPTAWWSRSLVGEWVRRRQEIA
                     NPSLRDERKSASRNLAQKRILRWPNPLKTLLIIVEKDVSVILFYNAIIYASWYTVTAS
                     LATQFTVVYGLDTLQVGLCYVPFGLGAAVSIFVNGKLLDWNYRRVALANGCTVDKKKG
                     DDLAKFPIEHARLAIVWPLVYVGGIVMIGYGWTIEKHTHIAAPLVLTFVMALTMTACY
                     NSMNILLVDLYPQSPSTASAANNLTRCLMGAGGSAMINPMINGIGSGWSYTVVGLVVI
                     LLSPMLYVVTQWGPKWREERRIRFAEKKRHQEANKSKV"
     gene            <103138..>104225
                     /locus_tag="TRUGW13939_00016"
                     /db_xref="GeneID:55987533"
     mRNA            join(<103138..103683,103734..>104225)
                     /locus_tag="TRUGW13939_00016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483231.1"
                     /db_xref="GeneID:55987533"
     CDS             join(103138..103683,103734..104225)
                     /locus_tag="TRUGW13939_00016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339124.1"
                     /db_xref="GeneID:55987533"
                     /translation="MFRRVVQPSPKLWVPWTPVSRAYIHKVAQLQSVAQQTVSPVAEA
                     GAGEFSKQKPFDHVPWKEPVSTTGTVRFFGKTTDNKAHTLNFKKGEELQSNLGKGEEL
                     DVKITDLRTYEPPVSLSLEGVEWVQHPTVLTEEKLLDANKAESDAFVRSHYFDECAAL
                     VKEKSGAATAIAYNYRHRRIETGTNLFDPLNFSNKPLSTMHMDNDAKTAEVNLRRVLG
                     DAEAERWLSKHWGIINVWRPVGVTVHQWPLALVDSTTFSRGDGATTPIYTKNNYKSHF
                     TGLTFNPEYKFYYVSNLGTDEALLFVDFDSEPKGNLIGMAHGAFEDHNGPADAPLRRS
                     IEVRCLVLYDD"
     gene            complement(<105655..>106458)
                     /locus_tag="TRUGW13939_00017"
                     /db_xref="GeneID:55987534"
     mRNA            complement(join(<105655..105833,105930..106302,
                     106354..>106458))
                     /locus_tag="TRUGW13939_00017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483232.1"
                     /db_xref="GeneID:55987534"
     CDS             complement(join(105655..105833,105930..106302,
                     106354..106458))
                     /locus_tag="TRUGW13939_00017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339125.1"
                     /db_xref="GeneID:55987534"
                     /translation="MPSFDILVLPGDHIGPQVVGEAVNVLRAAEAHPAVCIDAHGIPL
                     ARMAAYLSCKHGSPENPSKITSIDKANVLAVWRLWRDAVTKVHDPEFPEIPLHHQLSD
                     SLALIMVKNPRSLNGIVLCDNIFGDLFSDEAAAVSGPLASVHLPASPASPVRRRRLAS
                     VTWTSWPMPSMRLPAWPWATKRNAALRCALVDIGGTASTTEMGDAVVKALVQILDKQA
                     "
     gene            <106664..>108337
                     /locus_tag="TRUGW13939_00018"
                     /db_xref="GeneID:55987535"
     mRNA            join(<106664..106734,106858..>108337)
                     /locus_tag="TRUGW13939_00018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483233.1"
                     /db_xref="GeneID:55987535"
     CDS             join(106664..106734,106858..108337)
                     /locus_tag="TRUGW13939_00018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339126.1"
                     /db_xref="GeneID:55987535"
                     /translation="MSAVMRDGYSHARELPWTWTVYARPDDIHLEQYGAGLSADQSTK
                     KAGEVNKLEALSFQYTKEEEKRLLPKIDIIVVGYVSGAYLLAYMDRGNIGNANTAGMS
                     KDLGIDDSQYQWLLTVLYLGYILFDWQTIFYNNFPARYYVSTVVMIWGIIASDYATAQ
                     NFGGMLVLGLLLGIFELSYSPGLGYFFSFFYLRGEMGRRLGWYVSIAPLAASFAGAFA
                     FFVTEYKHAIAGWRALFLVEGFPAILVGLFGYCWLPSNLQDCQFLTEREKKIALARMV
                     RSFGDKDRGHSINVMEFFWSLMDMKNWIPTLMYFSFNISYSSLPIYVPTILTGMGLTN
                     LNAQGLSAPPYVFAAIVVLIVGYMSDYYNRQGIFLAICKWRCRNRLPDPVPCGAGCGQ
                     VLCHLPGDGRTVPVHRADSLVGVNNGDDSKRGAGFVLMNFVGQCGPLVGTHIFPASEG
                     PFYQEGFYISFRFCLFAVLLAGVHIWWLNRLNKQLDDKYGPVTSLINAEDEIDEEMYQ
                     SETFRYVL"
     gene            complement(<109127..>111703)
                     /locus_tag="TRUGW13939_00019"
                     /db_xref="GeneID:55987536"
     mRNA            complement(join(<109127..109549,110005..110017,
                     110073..110132,110193..110638,110689..111268,
                     111321..>111703))
                     /locus_tag="TRUGW13939_00019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483234.1"
                     /db_xref="GeneID:55987536"
     CDS             complement(join(109127..109549,110005..110017,
                     110073..110132,110193..110638,110689..111268,
                     111321..111703))
                     /locus_tag="TRUGW13939_00019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339127.1"
                     /db_xref="GeneID:55987536"
                     /translation="MTSPRVSVSEAASSADREKNPSKTGIEIGTQVPVELDSTHATEY
                     ADYLRLKGHYASDPKAHRRLLLLLDLQILPLLFIYYILNSLDKSNAGNVKVYTFLEDT
                     HMTSRQFNLALTWYFFTYAGLEAPSNMLMRKYGPRLWLSMIVICWGAVTLGSAWVKGY
                     SDYCAARIILGVFEAGLFQGCFFTLSCWYLPSELQTRSAWWYSATMLSGAFGGLLAYA
                     VGPLQGHLGLKQWQYLFIIEGSATIFFGLIGLWLCPDFPERWASSWFSADEKTFLRLR
                     VKYKDGPIPPDDTFRWSAFIEAVKDWKTYFIASLLGFGGSVPTYSMVKSMGYSSVEAQ
                     ALTAPPYMFAFVCVILIAKYSDKYQCRARSLLISYTVGTIGIVILWATRHYSHLSGVS
                     YFALFFVVAGFNMQAPAVGSWLGTNVRNPGKRAAAMGWQSTWGQLFGGCIGANIFFDN
                     EAPTYTTGFSILLVLVIVGGMLSEEYEGKYDDQELANMGEVRRTPGHDHGGDRRGHVA
                     ALRNARRYAQVLNARIGARADEYAVDFDVGGRHVGLEAHIIWRAPYGSRVRHTLVDAD
                     DVVWGSPLRDFVAGINVQRVILVRIDIATQTAPVRHCLVPGTTGGASGRPCRYSNVVS
                     SSATLGLSLS"
     gene            <112155..>113255
                     /locus_tag="TRUGW13939_00020"
                     /db_xref="GeneID:55987537"
     mRNA            <112155..>113255
                     /locus_tag="TRUGW13939_00020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483235.1"
                     /db_xref="GeneID:55987537"
     CDS             112155..113255
                     /locus_tag="TRUGW13939_00020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339128.1"
                     /db_xref="GeneID:55987537"
                     /translation="MGSQVLREFGPDAEIPCRTVAKTRRTAKACLQCRSRKQKCGGQS
                     IHNRRRSCSRCLHLGFTCSFLTQPYDNDTNYTAYSPETAEAVEKLRTGFDEHETRLRY
                     LESLINDFKDNTDPTQETPSVSNIQSNHSVSEGPQGTQELLDSYSGNQHIIDPIGGPA
                     EITADRVALRTVNLDAPITTLRHLHPYGTNSDIGNSMVDPVSCGFIHMGEAQEACDVF
                     FANCHRWGPVLCPRSQRSAEVVRKENPVLFTSICAVGFRFMGEPRRDVYKHIVALLDA
                     MLSRLLLQPTSADVKLDHIKALLLYIQWMPLDSSQYGASSSRYNDISSWSMLGLAIRY
                     ALLMGMHQSAVVPFSNQGHQVVTQEDILRLRV"
     gene            <114798..>115092
                     /locus_tag="TRUGW13939_00021"
                     /db_xref="GeneID:55987538"
     mRNA            join(<114798..114917,114976..>115092)
                     /locus_tag="TRUGW13939_00021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483236.1"
                     /db_xref="GeneID:55987538"
     CDS             join(114798..114917,114976..115092)
                     /locus_tag="TRUGW13939_00021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339129.1"
                     /db_xref="GeneID:55987538"
                     /translation="MEPFSIDGLTVRPILGTGFGAEIEGVDWTRVPLSEKDIQNLVSL
                     QNRFGVLIFRNTGLDNDRHVKFAAQLGELEMNPT"
     gene            <115138..>115969
                     /locus_tag="TRUGW13939_00022"
                     /db_xref="GeneID:55987539"
     mRNA            join(<115138..115176,115235..115440,115663..115797,
                     115876..>115969)
                     /locus_tag="TRUGW13939_00022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483237.1"
                     /db_xref="GeneID:55987539"
     CDS             join(<115138..115176,115235..115440,115663..115797,
                     115876..115969)
                     /locus_tag="TRUGW13939_00022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339130.1"
                     /db_xref="GeneID:55987539"
                     /translation="NVESDGSIVRKGSRRWAHALGNALWHTDSSFNQHRSKYSLLLAH
                     KIPEGGQANTEFADTRQAWKDLSDTRKEELRGMIVEHELCSTNNRNTIPDSQEIIWDL
                     IHHCSQGKVHFLSHRFSKRITNSLYPYDENMGVRDVRRATVFDDGDEAFGTPIKK"
     gene            <118336..>118980
                     /locus_tag="TRUGW13939_00023"
                     /db_xref="GeneID:55987540"
     mRNA            <118336..>118980
                     /locus_tag="TRUGW13939_00023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483238.1"
                     /db_xref="GeneID:55987540"
     CDS             <118336..118980
                     /locus_tag="TRUGW13939_00023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339131.1"
                     /db_xref="GeneID:55987540"
                     /translation="EEEDDDDDENEELRQYSSASRLISWTWWCLLNTGLVVVTFLNIW
                     KVATPPHTSLHDLTLTNDSKSFPSGQLTWSQKFTPLPCGKSPAEALARGCHFDIVATA
                     WLPPKCIDYELVSEFIASYPWQYFPNANGTDPYSDDPDTLGSETGLIWTTHRWHYAHC
                     LFMWKKLNRALVRGWMTDGETIKLGHTNHCSTTILKMKDPNVIGSIVEVIYPPC"
     gene            complement(<119367..>121367)
                     /locus_tag="TRUGW13939_00024"
                     /db_xref="GeneID:55987541"
     mRNA            complement(join(<119367..119999,120051..>121367))
                     /locus_tag="TRUGW13939_00024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483239.1"
                     /db_xref="GeneID:55987541"
     CDS             complement(join(119367..119999,120051..121367))
                     /locus_tag="TRUGW13939_00024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339132.1"
                     /db_xref="GeneID:55987541"
                     /translation="MAHQMKRNPPQQPPSFTANPVSITQDTKYLIVHAREGQNQIKRN
                     VQPSTATFTNVILPLAHIDNALASKSHILVFYRAVSTSPELRNASMEAQNILDSYNVE
                     TSMDDDLFALVDAVFHNNADLEPESYRLLKKIYMGYIRHGLKLSAGCQRDRFQEIQLR
                     LSCIKAEFQRNLAQANSAGIWFTAGELDGLPGEFLSKLMGGEVGKVNGDKVQVALNDS
                     DLFQTLRYARDGETRKRIYIANENKCGQNVSLFREAILLRDEAARLLGYPSHAALRIE
                     DKMAKCPETVNSFLGDLQARLRDNGMKEVDKLKQLKKADLESRGESFDERYFLWDHQY
                     YHRMMLEKQYSVNRQKIAEYFPFQSTIMGMLRICETLFGLFFSEFNRDEMTKLDSPGV
                     AHVWHEDVQAFSVWNSDEDGDFVGHLYLDLFHREGKYANAANFNLIPGFILENGKRRY
                     PATALVCNFSKPSSETPCLLKHDEVVTLFHELGHGIHDLVSKTTYSHFHGTETEVDFG
                     EAPSQMLENWCWTPTVLQSLSRHYSYISSEYLDHWKEQAYREPQPQEQMPDAMVESLL
                     QAKHINGALFHLRQLHFGIFDMVVHESDDRHAIEGLDVSAKYNELLARILPMDSPEGD
                     DWGHGQTRFQHLLGEYDAGYYSYLL"
     gene            <122077..>123375
                     /locus_tag="TRUGW13939_00025"
                     /db_xref="GeneID:55987542"
     mRNA            <122077..>123375
                     /locus_tag="TRUGW13939_00025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483240.1"
                     /db_xref="GeneID:55987542"
     CDS             122077..123375
                     /locus_tag="TRUGW13939_00025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339133.1"
                     /db_xref="GeneID:55987542"
                     /translation="MSQSEWQQVRTYADHLGHRVVLEQYVTPDYEPDPDHIIPIQVYN
                     LVPLDDDHENLRRYLMQSFWDDEVKPLFEIYSYCPPDDFACIEHNRIEIAHRKQLHRS
                     GVENPLPLIPRFIRPGDYSTVGFCVLLRSHSYRLVYVEDSNELAKLGEGPDLLYFNRS
                     FSSTRSYVDEAQRESEDDESLSSEGFELAIQRVTDQIYIGQILMVDIFNGVSPPQDRY
                     ALDVDECETPRSDLPSEEQIRDQLGLETSVSGFSLHPEFQVSQDANIVTVTNTPEGKA
                     PDIQYLVHALFLSSIRDTAGLSLLESTAHLFTASMFSHLPANKTLTLKFIIPNSSSLS
                     AICPTQNEVLEILSGKTQEEDRENSFPIGALHNISTGDDQPPTSKRITPQIPDKHIIS
                     GQGKFCEVFRLFTVVLDRAKFVSACCCWLVFPGVNFSKVR"
     gene            complement(<127279..>128536)
                     /locus_tag="TRUGW13939_00026"
                     /db_xref="GeneID:55987543"
     mRNA            complement(join(<127279..127423,127511..128294,
                     128491..>128536))
                     /locus_tag="TRUGW13939_00026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483241.1"
                     /db_xref="GeneID:55987543"
     CDS             complement(join(127279..127423,127511..128294,
                     128491..128536))
                     /locus_tag="TRUGW13939_00026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339134.1"
                     /db_xref="GeneID:55987543"
                     /translation="MGDFIGRRLGLIASTFPLYQSETAPKWIRGFIVGSYQLAITVGL
                     LLSAVLNNATHNRNDTGSYRIPIAVQFAWALILIGGMLVLPETPRYMIKRDNQEAAAQ
                     SLTKLRRLPTDHPAIVEELAEIYANHEYEISLGSGGYLECFQGNLGKRLLTGCFLQGL
                     QQLTGINFIFYYGTQFFKNSGFKNEFVISLITSCVNTGSTFPGLYAIDKWGRRPVLLW
                     GAIGMTISQLIVAVVGTTTTSQNETGTIIVHNFAAQKAAIAFICIYIFFFAASWGPSA
                     WVVTGENFPLKTRAKCLTITTATNWLLNWVLSFATPYLVNYGPGNANL"
     gene            complement(<131737..>132135)
                     /locus_tag="TRUGW13939_00027"
                     /db_xref="GeneID:55987544"
     mRNA            complement(<131737..>132135)
                     /locus_tag="TRUGW13939_00027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483242.1"
                     /db_xref="GeneID:55987544"
     CDS             complement(131737..132135)
                     /locus_tag="TRUGW13939_00027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339135.1"
                     /db_xref="GeneID:55987544"
                     /translation="MAAHDDPLHPGPIRSLTNATTPFLVQLQHDTDPVVLTNTFVVPE
                     GKMDYMIALWRKDSLIMKAQPGFISAQLYKGIAGSNILINVAVWESTADLRGGFMSEP
                     FQETLKEYPDGALSYPQILQKVAVSNVCTA"
     gene            <132626..>133708
                     /locus_tag="TRUGW13939_00028"
                     /db_xref="GeneID:55987545"
     mRNA            <132626..>133708
                     /locus_tag="TRUGW13939_00028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483243.1"
                     /db_xref="GeneID:55987545"
     CDS             132626..133708
                     /locus_tag="TRUGW13939_00028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339136.1"
                     /db_xref="GeneID:55987545"
                     /translation="MLAVRAHANSLELQLDTIPVPAPGPHDVLIKVASAGIAPGIFNP
                     FLRKFMSLPTTLGHEVSGTVVSVGGDVLTAAVGDRVRVHANLSCLNCKYCLSDREQMC
                     AQAAILGFRGFGDKVPLYETYHDGGLAEYVKVPHWLVDKLPDNVSFDVGAKVHDVANA
                     MRTLKCANLEPGSTIIITAPTGGMGTATLKLAQFFPISRIILVGRSSERMSAVANLTH
                     VPTEIVALEELGDDWPRTKALVKVLRHLSPEGVDAILDYMPSGADIWQAMWALAHGGT
                     IVHMGGNPSLFPIPVVVIMTNCWRIVGTRGCTRSDTNKILEWLGDGRLQLDELITHKF
                     ELKDTLVAVSKLQARSLPIWMGVIHP"
     gene            complement(<134079..>134764)
                     /locus_tag="TRUGW13939_00029"
                     /db_xref="GeneID:55987546"
     mRNA            complement(join(<134079..134444,134575..134672,
                     134728..>134764))
                     /locus_tag="TRUGW13939_00029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483244.1"
                     /db_xref="GeneID:55987546"
     CDS             complement(join(134079..134444,134575..134672,
                     134728..134764))
                     /locus_tag="TRUGW13939_00029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339137.1"
                     /db_xref="GeneID:55987546"
                     /translation="MADQNDKQPSPQDVLGCQAAAFEWAESFDSKDWDRLFKCLAPTL
                     HIDYRAVMDKFWESLPAEDFQALASSKNFLGDPRVKTQHFIGVSKFVQVADDEITGYH
                     QMRVAHQKFKDEEQTEVLHKGHAHGRGKFWYRRVDGVWKFAGLQPEIRWTEYDYGKVF
                     QADNEG"
     gene            complement(<135254..>136156)
                     /locus_tag="TRUGW13939_00030"
                     /db_xref="GeneID:55987547"
     mRNA            complement(join(<135254..135388,135440..135766,
                     135821..>136156))
                     /locus_tag="TRUGW13939_00030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483245.1"
                     /db_xref="GeneID:55987547"
     CDS             complement(join(135254..135388,135440..135766,
                     135821..136156))
                     /locus_tag="TRUGW13939_00030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339138.1"
                     /db_xref="GeneID:55987547"
                     /translation="MATTPYIPFRLDGKVALVTGSGRGIGAAIAIELGRNGAKVVVNY
                     ANAQDSAEKVVAEIKSQGSDAVAFKADIRQVPQITKLMDDAVKHFGGLDIVCSNSGVV
                     SFGHLGDVTEEEFDRVFSLNTRGQFFVAREAYRHLNEGGRIILMSSNTSKDFSVPKHS
                     LYSGSKGAIDSFVRVMSKDCGSKKITVNAVAPGGTVTDMFHAVAHHYIPNGEKYSVEE
                     LQQMAAHASPLTRNGYPVDIARVVSFLASKEGEWINGKIITLDGGAA"
     gene            <136737..>137274
                     /locus_tag="TRUGW13939_00031"
                     /db_xref="GeneID:55987548"
     mRNA            join(<136737..136928,137008..>137274)
                     /locus_tag="TRUGW13939_00031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483246.1"
                     /db_xref="GeneID:55987548"
     CDS             join(136737..136928,137008..137274)
                     /locus_tag="TRUGW13939_00031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339139.1"
                     /db_xref="GeneID:55987548"
                     /translation="MADSLDPPPPPATGDPRNQFLCLTICGYRRPGMSESDYRDHMMN
                     VSAPMTKDLMVKYGVKRWTVIYNTTETRLLMNQLFDHQMLNLADFDCFSQVVFKSVEH
                     YKKMKEDPWYKEHLVGDHEKFADTQKSMMTIGWITEHIRDGEVVEGMKDY"
     gene            complement(<137491..>138843)
                     /locus_tag="TRUGW13939_00032"
                     /db_xref="GeneID:55987549"
     mRNA            complement(<137491..>138843)
                     /locus_tag="TRUGW13939_00032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483247.1"
                     /db_xref="GeneID:55987549"
     CDS             complement(137491..138843)
                     /locus_tag="TRUGW13939_00032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339140.1"
                     /db_xref="GeneID:55987549"
                     /translation="MSSPRKPINIAIVGGGFAGLALLIGLQKYPHIDAHVYESQDEFT
                     EIGAGAVLGPNAQQAMSLIDPRILEGFQRRAIFGFQEPNAEGFHSWATVVKGQTPDVD
                     EIVMHYKHKLKDSTIHRAHFIDELNKLVEPHRAHFGKRLSEVREGTGGDSDPITLVFG
                     DGSTAEADIVIGSDGIHSVVRKHILGVNHPATNAFFTGAIAYRCTVPMAKAKDTLGER
                     AIQPQFAMKCGKDGMVFGFPMSNFSLYYIAVVTFNNAPVPHDQWKVKPNVSDLRARFA
                     DFEDFVRKQVELVPDDSSTLGWSIWEMPPAPTYFNGRVAIVGDAAHASPPFQGAGAGQ
                     SIEDALVMEQLLGKYLDPARESIHPLTTTEATLMIFQAYDTVRRFRSQKVVTTSAETG
                     RLLSGNEPGVSLHAKDIHARLTDREQWIFEHDQVQQVKDAKHVFEEAELALARGSNRL
                     "
     gene            complement(<139336..>140646)
                     /locus_tag="TRUGW13939_00033"
                     /db_xref="GeneID:55987550"
     mRNA            complement(join(<139336..140063,140136..>140646))
                     /locus_tag="TRUGW13939_00033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483248.1"
                     /db_xref="GeneID:55987550"
     CDS             complement(join(139336..140063,140136..140646))
                     /locus_tag="TRUGW13939_00033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339141.1"
                     /db_xref="GeneID:55987550"
                     /translation="MATQKPIIIIGAGLSGLAAARLLTDQGIPVIVFEQSQPDRSQGY
                     GLTLRDWAYNALLEELGNPIGVSDFQRAVATDGAIGRTGWVDLTFRNNGTGETLFNPD
                     PPKPGQPNTIFRANRSFLRNWLAEGVDVRYEHKLEGFQGEPGHVSAFFENGVVQEGSI
                     LVAADGVHSTVRGVAFPGNQTLNILPVILFHGKVNIPRAKYETAVSTALGPSNVAAGV
                     GDSFNTFITVASANKEDVHLDWSYSRARQGDNDPLWMPDRGELIKVPQHLLKEIRSRD
                     LVPPFSTLVNADDIKKDKVYNWRIRSVYISRAQLDQAAKRGVVFIGDSVHAMPIFGGE
                     GGNHAILDGVDLFRAIQAASDGRDKNDLRAGEVEVIAQTFYDTALGRSQDAVKRCVQR
                     FSAFHRPIQEWKKIAGMSKT"
     gene            <141244..>146756
                     /locus_tag="TRUGW13939_00034"
                     /db_xref="GeneID:55987551"
     mRNA            join(<141244..141590,141645..141945,142004..145444,
                     145500..>146756)
                     /locus_tag="TRUGW13939_00034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483249.1"
                     /db_xref="GeneID:55987551"
     CDS             join(141244..141590,141645..141945,142004..145444,
                     145500..146756)
                     /locus_tag="TRUGW13939_00034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339142.1"
                     /db_xref="GeneID:55987551"
                     /translation="MSSSSTSVVVMDDVKDLKQTILFFGNDFPPEANTVFRSLYRSSK
                     DQRCSTLAYFLSLSNDAIKDEVALLPRSWQKHVPPVTDFLALVNNTAFRKGPLGGAME
                     GVFLAVFQIGSIIAHHEVEGIFYEFDKPGTTLAGLGCGLLAASAVAVSPTLVDLAVAG
                     AQSIRIAFRLGIHVYEISSMLEAPLADPESESWAYVVPGLSEDVVQTEIDDYNQRTSN
                     TGLTSVFISASDKTSVSISGPPSRLRVCLKDSDVLRYSNFFTLPVHHGLCHAPHIYSQ
                     VDVDTIIGNIQLVNGESPRVLLPLLSSETGNAFTCRNFEELSAEVVDQLLTRKIHVDN
                     ITRGLLSTLPPAPSTCVLWSFKKSLILSAIIQKIEASPDSPQIELKDLVKWVSQEFNT
                     TIPRSPKQAKLAIVGMSCRLPGGANNLELYWQLLAEGRNACSTVPPDRFDLSTHYDPA
                     RKIENTTPTPFMNFMENPGFFDAGFFNMSPREALETDPMHRLALVTAYEALEMAGYSP
                     DRTRSTNRTRIGTYYGQASDDYRELNGSQNIGTYAVPGGERGFANGRIQYFFKFSGPS
                     FNIDAACSSSLAAVNAACTALWAGEADTVLAGGLNVITDPDNFCQLGNGHFLSTTGQC
                     KVWDEAADGYCRADGVGCVVIKRLEDAEADNDNILGVILSAATNHNSDAASITQPHAP
                     TQMLNYENVMFSAGVDPLNVSYVELHGTGTQVGDREESRSVAEVFAPLTPQKRRKSQK
                     LLVGAVKSNIGHGEAAAGIASLIKVLLMYQNGLIPAHIGMKKMNPLIPQDLAERNMGL
                     NLELSEWPKPAKGPRYAVVNNFGAHGGNTTLLLEDAPGRQLRGHDPRTSYPITVSARS
                     RVSLKMNIEALIEYLDENENVNLGDLSYTLCARRIHHPFRVSSCVNSISDLRNFLVRQ
                     VEAAPSTEAIPLKSPGIAFVFTGQGSFYNGIGSDLYNHYPAFTAEVNRLNRLVEGLGF
                     PSVVPYIKGSDTADVSPIISQLSIVVIQIALIRFWGALGVQPVAVLGHSLGEFAAFVA
                     SGTLSEVDSIFLAGCRAAMVTKSCEQGKHRMLAVRASLTELQSLLSEADNTYEVSCIN
                     TENDTVISGPTESIEKINMDLKSKGLKCLLLDVPFAFHSKQMDPILEPFERLAENATF
                     KAPNIPVISPLLAECIFDGKTLNASYLKRATREVVDFVGALDAAQELGIVEADTIWME
                     LGPHFVTGHFVKNILSSQRVLPSLQRDVNNFATIGSSLAWLHNNGVDVSWNEYYRPYE
                     TAHNLLTLKSYKWNEKNYWIPYLGTWTLDKALLKYNLQKDSSKSTDISLSVKLKTSLV
                     HGILSETIGESTASISTLSNMIDPAFLEAMEGHVMNGHGVATQSIWADMAFTVGKYLH
                     DQVDPKSKEFVMSVNNMIILEGQVANPTRGSKQLLQLEAQLDLTTRAMPVQLYNASDD
                     GVRAAEPFGSCVVTFEDGAVWQEEWRRLQHLVIGQIRSLETLVSQGKANRLTRNMAYT
                     LFKNVVDYADRYRGMQSVIISDYEASAEITLSSDEAGIWHTPPHWIDSVAHLAGLIVN
                     GSDASNTADYFYVTSGWESMRFGKPLVAGASYRNYVKMIPSTEKGVWTGDVYILQGEI
                     IVGMVGQIKFRQFPRLLMDRFFSPNKGGHAPTETKPTASVVQPAREIQPVPVPKTVVA
                     PVPATAVAPAAPAVLEAAKPVPPPTPAPAPVADPKIEENALIANIMDLIAAETGLGSS
                     ELTDSTQLASIGVDSLMALVLVEKFKAQLQLDINSSLFLECSTIGEFKEWIEENR"
     gene            complement(<147278..>149047)
                     /locus_tag="TRUGW13939_00035"
                     /db_xref="GeneID:55987552"
     mRNA            complement(join(<147278..147515,147568..148621,
                     148684..>149047))
                     /locus_tag="TRUGW13939_00035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483250.1"
                     /db_xref="GeneID:55987552"
     CDS             complement(join(147278..147515,147568..148621,
                     148684..149047))
                     /locus_tag="TRUGW13939_00035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339143.1"
                     /db_xref="GeneID:55987552"
                     /translation="MAIDEKATASQEVVQGAEQPESVAISNERSKKVFESSAGSRETP
                     GPAQTEAPPDANPKPASVLSQTIIVVPRSKRRGLLGNLTVIPEIERPYNYANSTKWVI
                     TLVVAISSAAAPLGSAIFFPALSQLSQDFHSSPTVVNLTVALYLLSMSIFPLWWSAAS
                     EGLGRRTVYLVSFTLFTIWNIIAAVSTSMAMLVVMRVLGGGAASSVLAIGAGTIADIW
                     EPKERGRAMGIFILGPMLGPLLAPIIGGVLSQAWGWRSTQWFQTIYGGVLLLVLTFCL
                     PETLARRATPAEQQAPADNVHSSAAPTIAQRAKKVMLVLKRCIIDPLKILSYLRFPVV
                     FVTVWLSSVTFGTLYILNIAVQWTFEKPPYKFSEIIVGLTYIPGSLGYMVAGILGGRW
                     ADAIMHREARAAGRYDASGKLILRPEDRMRENALLAAAIYPAAVIWFGWTAEKGVFWI
                     VPLIANFFFGFGTMIIFGTANTMLTEFLPKRSSSGVAVSTFVRTIFSSVGAVIAQPIL
                     AAIGDGWLFTILGIVGWISAFSVVWAMKKFGPRWQNEMKQRVA"
     gene            <149593..>150740
                     /locus_tag="TRUGW13939_00036"
                     /db_xref="GeneID:55987553"
     mRNA            join(<149593..149686,149773..149867,149947..150032,
                     150095..150313,150405..150531,150612..>150740)
                     /locus_tag="TRUGW13939_00036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483251.1"
                     /db_xref="GeneID:55987553"
     CDS             join(149593..149686,149773..149867,149947..150032,
                     150095..150313,150405..150531,150612..150740)
                     /locus_tag="TRUGW13939_00036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339144.1"
                     /db_xref="GeneID:55987553"
                     /translation="MTCEACNTIAPVMAVGYEPKGDWVEVAALKTYIAGDKSTATKAI
                     VEVYDIFGPSNQTLQGADLLAAALNAIVLVPDLLKGEYAQYTWFANPTPENTALKNAF
                     MGKVMMAFGPYVELLASVVIDAKAKFDGISSWGGLGLCWGGKVTVLLSGPESVYNTSA
                     QVHPGALAKADAEKISIPHILLASNGEDPEVVKEYKAILEGEGKPGVVETYPTMHHGW
                     MGTRANLNNPENLREYERGYNQVAAYFSKYL"
     gene            complement(<151090..>153437)
                     /locus_tag="TRUGW13939_00037"
                     /db_xref="GeneID:55987554"
     mRNA            complement(join(<151090..151798,151858..153355,
                     153404..>153437))
                     /locus_tag="TRUGW13939_00037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483252.1"
                     /db_xref="GeneID:55987554"
     CDS             complement(join(151090..151798,151858..153355,
                     153404..153437))
                     /locus_tag="TRUGW13939_00037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339145.1"
                     /db_xref="GeneID:55987554"
                     /translation="MTAHFIPAHFCLCGPCEKRSRSDTACTWTTDSSRIPHASTEYIR
                     QLEDRIRLLEGQNSRGHQIQGSNGRDSVSEESIPRTTGRQIAPSSTSPRSITWQTSVP
                     WMGPSLFSTPGTSADFHPSTSATSLESTDSIFISNNHSDHEMIIDDSHGQEFLDGPVP
                     RNFMQDFEKAITEKLGGAPQPASSGRDRSRENLSSIAPSYGSGQKNLDHGLPARDHAD
                     RLLNSYWNDVHVLYPFLDKPQVEEDYNKIFNQENSIPDKNSFLCLLNCIFAISSQQVR
                     LAVPHHEHLAATFCLRARELLDIKSYSIRSVQSYLLLALYFQSISDPRTCWMFTGLAI
                     RTAQILQLHVIETSQREPESRTRDLVRRVWHGCVLMDREISMMFNQSCMIDPKTAAAI
                     PLPLMVEENIQLGHVQSHTTQTQPSRTADFYISCLGLYDILHDILVYLHSSKSQRHSK
                     NGCSDSEHISPSDTNTSIVELEERLSKWEQNIPSHYKVGLHTPYNSMNGVLARRAVIL
                     RQRHIHAHLLLLRPMLQSFITSELQNKGEALPVGSLLSHRVSLQCAIVCVKMAQEAID
                     TIYINEGISSNEMRDLSAWWCNTIFLYTSATVLIAASLCPSVVAEVSENSVYDSFHKA
                     IAVLRQYTNFNSSILRLTTALHVLSSIIPKHYSKLKQAAAQQTETSADVVTSGDTFTA
                     ATFQYWCPIRPNRRQPSPLSDPPKGNSTSEINNHNHVSSPSLSNLELMFDSDDFSWLT
                     KIPFYT"
     gene            <153941..>154773
                     /locus_tag="TRUGW13939_00038"
                     /db_xref="GeneID:55987555"
     mRNA            join(<153941..154196,154254..154343,154403..>154773)
                     /locus_tag="TRUGW13939_00038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483253.1"
                     /db_xref="GeneID:55987555"
     CDS             join(153941..154196,154254..154343,154403..154773)
                     /locus_tag="TRUGW13939_00038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339146.1"
                     /db_xref="GeneID:55987555"
                     /translation="METVLVVGATGNIGIAAILGALRAKRNVLAIVRNQASAAKLFQN
                     VPSKDGITIVEADIVSEEGVKGVVNQVRAGKLPAFQHVYAAAGGAYGATPLLDLSTSE
                     LRRFLTLNFETNFIAYRETIPYLLEQKGSTSFTLCTGSQGDIGARAAPAISQGPLFSL
                     SNVACRDNEKTSVRFNEVYLGARVEIDSVAEGTGAIKSSEFADVYTELLSRPEIKSSR
                     ISVATKDDLKDLKHNKKIVY"
     gene            <155719..>156781
                     /locus_tag="TRUGW13939_00039"
                     /db_xref="GeneID:55987556"
     mRNA            join(<155719..155931,155999..>156781)
                     /locus_tag="TRUGW13939_00039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483254.1"
                     /db_xref="GeneID:55987556"
     CDS             join(155719..155931,155999..156781)
                     /locus_tag="TRUGW13939_00039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339147.1"
                     /db_xref="GeneID:55987556"
                     /translation="MPSALAKLNLSVWSDYLEAQASRIPVLPDVEHLSNRVVRVLGGN
                     PSIMTLQGTNTYVVGTGRSRILIDTGQGEEFWIQHIKEVLESLSINISHVLLTHWHSD
                     HTGGVPHFIEYRPEYSDRIYKSNPARDQKEIYDGQVFSVEGATVRAVFTPGHSHDHMC
                     FKLDEENALFTGDNVLGHGQSVFEDLGLFTKSLSIMADLGCQLGYPGHGDIIRNLPRK
                     MQEIVKQREYHERQICETLTMSKSKATLGASKSKGSLSIPGIARELYGAVKPEVYKLA
                     IEPSLTGTLGKLAEDRKVAFEVVNGEKQWFIRERYARQVANKFLKQSSFDTAATS"
     gene            complement(<157369..>158658)
                     /locus_tag="TRUGW13939_00040"
                     /db_xref="GeneID:55987557"
     mRNA            complement(<157369..>158658)
                     /locus_tag="TRUGW13939_00040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483255.1"
                     /db_xref="GeneID:55987557"
     CDS             complement(157369..158658)
                     /locus_tag="TRUGW13939_00040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339148.1"
                     /db_xref="GeneID:55987557"
                     /translation="MSAVYAPNPPARPARRSTAPTAPKLRDTCDACAASKVKCNKEKP
                     TCARCAKRGVVCEYVVTKRSGRKHERRQSDARTTPQASSSSTTNTLSQLADFQPPPRL
                     RVIGDDLDNSPNMLSSGDQTLLWIPNDLSPEFNELFNFPITSQTTEGPKSSQALHYSQ
                     IGTEGINIPPNSDGTATINPNHVPVTMDDVSESPALSIPRSLSESRSTGLNDALTFED
                     PRSDASCCCLLQALDLLKRSLRISPTLCMCSRGQESSPSNHQLRTVQSVFEENEEAIS
                     TITNMLQCPCSRDGYLLAIVELTVFKILGLYAAAAKPTSEEELTDEIQKRCSPSCHFE
                     RVVQRPDIGNSYYLGDGDHGRIIAQQVLSKLYHVQTLVSELSSRLKAVNSHDEIHAVE
                     FFSPFSPAMLNQLDINLRTRLRALYLEIVDLATRIVS"
     gene            complement(<160279..>160998)
                     /locus_tag="TRUGW13939_00041"
                     /db_xref="GeneID:55987558"
     mRNA            complement(<160279..>160998)
                     /locus_tag="TRUGW13939_00041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483256.1"
                     /db_xref="GeneID:55987558"
     CDS             complement(160279..160998)
                     /locus_tag="TRUGW13939_00041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339149.1"
                     /db_xref="GeneID:55987558"
                     /translation="MAVHAPRIAEKCIIWTQAMIDQALFNEKLKRPVKICFDEWNVWN
                     ADKYPGTEGHEEIYNVSDMLGVAVWLNIFNRHADIVEIACIAQSVNVIAPIYTKPGDL
                     MKQTIWWPYQLTAQNVHGRSVATHVNCSMFEGEVTGQLEKFADMLPELKHLDVASTVD
                     DSNILTISIVNGKLEPVEVDLQIDSEIKHGIEKYEVVGNPEDDNSFEAKDKVIPIQSS
                     LSSSTTVILKRCSYTMLRYQL"
     gene            complement(<161080..>161729)
                     /locus_tag="TRUGW13939_00042"
                     /db_xref="GeneID:55987559"
     mRNA            complement(join(<161080..161555,161636..>161729))
                     /locus_tag="TRUGW13939_00042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483257.1"
                     /db_xref="GeneID:55987559"
     CDS             complement(join(161080..161555,161636..161729))
                     /locus_tag="TRUGW13939_00042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339150.1"
                     /db_xref="GeneID:55987559"
                     /translation="MERAIISITTQHSIGPVDRKIYSGFVEHMGRYVIEAIKEVKPPL
                     VRYPGGNYTANFNWMDGVGPTRNPRVELAWLKTEPNTFGTNEFIEWCRATDVEPFFCL
                     NMGTGDLREALAWIEYCNNDTNSLYANLRRSHGYEKPHNVKYWCLGNEVYGDWQVAQD
                     SKENYAAKAIRLLDPTVKLVLCGKHGYND"
     gene            complement(<163580..>163981)
                     /locus_tag="TRUGW13939_00043"
                     /db_xref="GeneID:55987560"
     mRNA            complement(join(<163580..163656,163717..163782,
                     163861..>163981))
                     /locus_tag="TRUGW13939_00043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483258.1"
                     /db_xref="GeneID:55987560"
     CDS             complement(join(163580..163656,163717..163782,
                     163861..163981))
                     /locus_tag="TRUGW13939_00043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339151.1"
                     /db_xref="GeneID:55987560"
                     /translation="MQFTLAAAALFFSAAFAAKATTEQYQSDITLLEADGCSTAKCIA
                     SLAGVTAACGAAAVEAGLDPLADLACFGSVGASYANDVCTGCF"
     gene            <169551..>170335
                     /locus_tag="TRUGW13939_00044"
                     /db_xref="GeneID:55987561"
     mRNA            join(<169551..169693,169825..>170335)
                     /locus_tag="TRUGW13939_00044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483259.1"
                     /db_xref="GeneID:55987561"
     CDS             join(169551..169693,169825..170335)
                     /locus_tag="TRUGW13939_00044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339152.1"
                     /db_xref="GeneID:55987561"
                     /translation="MPTQLKYHDLSLPNPSRWMNSADTNCWITPATPFPTYQSTNILT
                     RYSPTDSLGGHKKVANVHIIPEGESYTMSFENKSSHTLYLTMFYFQPSWDIGQVHSTT
                     GNFEEISYSAYDRDIGDFVPELLNNLLSASPVIDRFKAFVTKQPTSFRSLVMEDINDR
                     WDPVSISTSRATEHRLLQQLSVRNSIHPVAVPRDNSLPGPRRQLADLRDYEMHGSTR"
     gene            complement(<171373..>172534)
                     /locus_tag="TRUGW13939_00045"
                     /db_xref="GeneID:55987562"
     mRNA            complement(join(<171373..171502,171577..171736,
                     171797..171988,172039..172057,172137..172263,
                     172317..>172534))
                     /locus_tag="TRUGW13939_00045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483260.1"
                     /db_xref="GeneID:55987562"
     CDS             complement(join(171373..171502,171577..171736,
                     171797..171988,172039..172057,172137..172263,
                     172317..172534))
                     /locus_tag="TRUGW13939_00045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339153.1"
                     /db_xref="GeneID:55987562"
                     /translation="MGSLQVYPSTSALPSLSPISTTETRVTRKQVLAALRTQRIPVPD
                     LIPLFSHWPSKVSPELDKLRKDVDTWLNTFSLPSKALDAFRSSDFGHFGATWWPYASD
                     FTRLRIVTYVAIWLFIWDDEIDNATGSMWEDWESAQKFRLDTIQYVEYCLGLAPEDQK
                     DPEPRSSIIRGFEVIGVTIRDSCSLTQRKMVFDEMKEFMKQSEQEQHIRLNNDRLPSV
                     AEFWNYRLGASAVFICLAINEYAYGDMELPVEIFGDADMKEIWQLTNIIISASGSFLL
                     ASSTG"
     gene            complement(<173740..>175830)
                     /locus_tag="TRUGW13939_00046"
                     /db_xref="GeneID:55987563"
     mRNA            complement(join(<173740..173914,173995..174161,
                     174215..174322,174478..174819,174879..175072,
                     175131..175343,175394..175528,175590..>175830))
                     /locus_tag="TRUGW13939_00046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483261.1"
                     /db_xref="GeneID:55987563"
     CDS             complement(join(173740..173914,173995..174161,
                     174215..174322,174478..174819,174879..175072,
                     175131..175343,175394..175528,175590..175830))
                     /locus_tag="TRUGW13939_00046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339154.1"
                     /db_xref="GeneID:55987563"
                     /translation="MEFFKTTCPVSIGAAVGLAFAAALLYGVGLVIYRLTLHPLARFP
                     GPKLAAATKWYEFYYDCIKAPGGQFLWETYRMHKKYGPIVRINPDELQVADPNWYDTL
                     NAAGGAIRHKYPPAANLVGTPLGVFGTIDHHVHRVRKAPVASYFGRGNVVQAQSVMRT
                     SVEKLSSQFHELYVSGKAINLRATLLAFATDLLGIYGFGGSLGLSDSEDKAMEFMHTM
                     NAVAVVTPFFKQFPDALPWLFMLKPWMVKLIYPSVLPMLMLHRQMHARSEDSWSRWNK
                     TVKSERKDPVKQTRAPDVFNGILYSGLPEDEKSVDRLSQDGFLAITAGGDPIARTLAI
                     GTYYLLTKPEDLRLLCKELDTIMPDRNKLPELAELETLPFLTAVVKETMRIVGLAASR
                     LPLISDTPLQYKEWVIPAGTPVGMSIHQVMHDEKYFPDADVFKPERWLEKREDGVQLE
                     RYYVPFGRGTRMCVGQHFAQAEIYLAMAAIFRRFDLQLFDTTFKRDVETVRDCFLTEA
                     RLESQGIRVKVVGERS"
     gene            <177519..>179325
                     /locus_tag="TRUGW13939_00047"
                     /db_xref="GeneID:55987564"
     mRNA            join(<177519..177828,177888..179170,179230..>179325)
                     /locus_tag="TRUGW13939_00047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483262.1"
                     /db_xref="GeneID:55987564"
     CDS             join(<177519..177828,177888..179170,179230..179325)
                     /locus_tag="TRUGW13939_00047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339155.1"
                     /db_xref="GeneID:55987564"
                     /translation="YYSEIMATLDSQVFDIIVVGGGTAGCVVASRLQQRKPTLSILVL
                     EAGEDLSKNPDVYSPQVGVQLLGSDADWKYSSVPQANLNGRSIYYQAGKGLSGSAAVN
                     TGGWVRGDAQDYDEWARLVSDQRWSYQGLLPYFRRTEHHYDENDDRLQHGFEGPIHTS
                     SVSSSGRQYPLREISCKAWSSIGLKVVDDANNGHPQGIAELVSNWADGRRQLPSEVYP
                     QNGVKFLTGVLVRRIVLDHSQNATGVEMADGKTYSVRVGGEVIVSAGALRTPQVLLLS
                     GIGNTKELSKYDIPVNIHLPEVGHNLHDHLMVFRYWKLREPEKGVALGSPLFDGPNFE
                     KGVPPEDWLVTTTVPSAGLQSALEKDEGGSVGPSHPLVAGPRSHLELATIYAAFGGEV
                     VGLDIPMDGTAIMNFYMICLPTSRGNVSLNSSDPADAPVIDPKFCGTETDRYVMREGW
                     RLLSKLMFETPEGTNLVAGEIVPQGHEPLASDAPDHLIDARVRMGGMTAPHPAGTASM
                     GTVVDSSLRVRGARNVRVVDASVIPVPLASHYQAAVYAIAEQAADIILEENQTL"
     gene            <181082..>182372
                     /locus_tag="TRUGW13939_00048"
                     /db_xref="GeneID:55987565"
     mRNA            join(<181082..181322,181394..181476,181542..>182372)
                     /locus_tag="TRUGW13939_00048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483263.1"
                     /db_xref="GeneID:55987565"
     CDS             join(181082..181322,181394..181476,181542..182372)
                     /locus_tag="TRUGW13939_00048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339156.1"
                     /db_xref="GeneID:55987565"
                     /translation="MVPPAPVGGDRAVAMPTATNISAIAMKLVIVSIILPVVALVATG
                     LRFWARRMMRVTPAVEDWLVVAGFIWTVGYAIVNILLVTLGGVGWSTTLLAEAGQAAR
                     ITAQLKLTLAGQVVYALAMGCIKASICLQLVRLFWVDKLFRYLGITVFALSIGWALQT
                     MLIGFLICRPLSHNWDTTSDGTCGDLHAAYVSIGIVDAITDGMIFVLPLPMIHGLRMP
                     TRTKFATCAIFALGLVTIVAGIVRTIQVSHLQFDPTDIAAEVDLCVWSVVEPSVGITV
                     ACMIVMRPLFLRFGERFLSWAPWTTRRSGVGKSYDSSKAANTNHSINRSHQFVKLEPK
                     SDAILLNSMSSPQEEYHSTTVRQGEDRVSEYSDYQPTNPSDQKQSPVHVV"
     gene            complement(<182908..>184813)
                     /locus_tag="TRUGW13939_00049"
                     /db_xref="GeneID:55987566"
     mRNA            complement(join(<182908..183743,183794..184666,
                     184726..>184813))
                     /locus_tag="TRUGW13939_00049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483264.1"
                     /db_xref="GeneID:55987566"
     CDS             complement(join(182908..183743,183794..184666,
                     184726..184813))
                     /locus_tag="TRUGW13939_00049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339157.1"
                     /db_xref="GeneID:55987566"
                     /translation="MLAVLGSTASSANSTRSNHTVEILDYDYIVIGGGTAGLVMASRL
                     SGLARVAVIEAGGLYEVDNGNYSIVPGLAQSTPFLATTESYPADPKMDWGYLSVPQTD
                     AAGRIIHYPQGKTLGGSSALNTMAYHRGTKGSYQRWADLVDDQSFTFSNLLHYFQKST
                     HFTPPDQEKRDMPNATVKYDANAFNNSLGGPLQISYANYVDTTATWMAVALQSLGLAE
                     SSLGFNSGILSGFGAWVTMTIDPTHATRSSSQTSYLNHAEKPHNLDVYAHTNATRIIV
                     DPFVNTARAVEFVRPNGQVGIMIANKEVILSAGPFGSPHLLMLSGIGPAAALKEHGIH
                     VVSDLPGVGQNLWDQILFPVETAVNTPSGAQLEENPETNAAALLEYYRNAAGPYSSPG
                     AYIAFEKIPEQLRSNFSFEAQSALDWFPSDWPEVEYVGGSTVDTNGISQGVCTALLVA
                     PVSRGNVTLASSNFLVQPTINMGWLSHTADREVAIAAIKRCREALASPDVASVVTGPE
                     AVPGSSVQTDEEILAYVQTAATPIFHAVGTCAMGKRGDANAVVDVHGRVFGVGHLRVV
                     DSSVFPISLPGHPQSSVYMLAEKIADDIKNGK"
     gene            complement(<186083..>187827)
                     /locus_tag="TRUGW13939_00050"
                     /db_xref="GeneID:55987567"
     mRNA            complement(join(<186083..186598,186651..186847,
                     186898..186950,187004..>187827))
                     /locus_tag="TRUGW13939_00050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483265.1"
                     /db_xref="GeneID:55987567"
     CDS             complement(join(186083..186598,186651..186847,
                     186898..186950,187004..187827))
                     /locus_tag="TRUGW13939_00050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339158.1"
                     /db_xref="GeneID:55987567"
                     /translation="MVFSLFNLGMILLLQSGHAQRHTIDIPPPFNASLAVYQDFQSFS
                     IEFSFFPDYAGNQSNPNTFSKNLLENFKNVTGVYPKIRVGGTSQYVITMQDALVGAAS
                     YIYVNRDHADYFPEQEEAVKLIFEHPTDDQPIQINYGPAYFESYHTLGNVKFFHGLNL
                     NQNHSIQQLTEAATVSCTNIGSHLELYELGNEWNFAHQNYRPGNYSMDDYVHEWNYKS
                     AAVVAAVQKACPGKFPGFMAPSFVLLDFITSNGWTADGLYQLGYDRNNLTKILSFHNY
                     MGVNSPPNPPVDLDLQRTLMNHTSIVENLAPQIQRAQNLAYLGLPFTLGETNSIANQG
                     ITGETSVFGDALWLVDFSLWAAANNIRRLHFHQGLDYRYDSWQPILSKGQAPTTRPPY
                     YGQIMVASVLGKTQDTRIVNIPLSGDTEATYGIYNGNKVSKVVALNLRERNATSKENR
                     PSQQFKFHVPGQHRANIERLTAPGSDSATGVTFGGISYDYARNNGLPVIVDGRKETLD
                     VEDEVLSVDVPDSSAVLISFV"
     gene            <189246..>190876
                     /locus_tag="TRUGW13939_00051"
                     /db_xref="GeneID:55987568"
     mRNA            join(<189246..189315,189378..>190876)
                     /locus_tag="TRUGW13939_00051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483266.1"
                     /db_xref="GeneID:55987568"
     CDS             join(189246..189315,189378..190876)
                     /locus_tag="TRUGW13939_00051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339159.1"
                     /db_xref="GeneID:55987568"
                     /translation="MYPIKNLRVYVLATVAYTGSFLFGYDTGVMGSVLNLESFKADFG
                     LLSGSTGFSDPKNAQVSSNVVSLLTAGCFFGAILGSILNEKYGRRYSIMGFLLIFLVG
                     ASVQTAAHNELSYMYSGRVIAGFGIGGMSSITPVFVSESCPPGIRGRISGLFQEFLVI
                     GVTIAYWLCYGVSETIAPTTKQWRIPIGFQLVPGGLMMVGMCFLTESPRWLVKENRLA
                     EAIESLAYMRAEPITSLTVQAEIAEIKTAVEHEVESTQGLTWRELLQPGNRLRFLNCF
                     FIMFWQQWTGTNSIGYYAPQLFETVGVSGGNTSLFTTGIYGIVKVIATGVFLLAGIDK
                     IGRRWSLIAGAVWMCSMMFILGALLASYPPDPDGSGGISSASIAMIVMIYLYVIGYSA
                     SWGPIPWVYISEIFPTRIRAYGVGWGSATQWLFNFVVTYITPSAIGNIGWHTFIMFGV
                     FCAAMAVWVFVAVRETKGRSLEEMGVLFEKFHAFGSLRDIEATNATKVCLDGADTSDH
                     KEVQATGIENRTTR"
     gene            <191713..>192706
                     /locus_tag="TRUGW13939_00052"
                     /db_xref="GeneID:55987569"
     mRNA            join(<191713..191962,192023..192539,192592..>192706)
                     /locus_tag="TRUGW13939_00052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483267.1"
                     /db_xref="GeneID:55987569"
     CDS             join(191713..191962,192023..192539,192592..192706)
                     /locus_tag="TRUGW13939_00052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339160.1"
                     /db_xref="GeneID:55987569"
                     /translation="MSTNPIQGGNFIHATERRAEAPPIWERFSLRGKTAIVTGATSGI
                     GWSVVQAFAEMGANVVIWYNTSTRGPEQAALIEQKYGVKCKAYQVDIQNAAAVEAAVD
                     EHVREFNGRLDIFVANAGIPWTKGAMVDGDLDHYHQVMTTDLDGPYYCAKAAAKHWRR
                     QKEEGTDLNGRKLDNYVGGSFIATASMSGVVVNIPQLQASYNAAKAGVIHLCKSLAVE
                     WARYARANSISPGYIITEISNFVPQETKDIWKDKIPIGREGESHELQGAFLYLASDAA
                     TYTTGTNILVDGGYCLP"
     gene            complement(<194080..>195865)
                     /locus_tag="TRUGW13939_00053"
                     /db_xref="GeneID:55987570"
     mRNA            complement(join(<194080..194549,194608..194848,
                     194908..195605,195661..>195865))
                     /locus_tag="TRUGW13939_00053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483268.1"
                     /db_xref="GeneID:55987570"
     CDS             complement(join(194080..194549,194608..194848,
                     194908..195605,195661..195865))
                     /locus_tag="TRUGW13939_00053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339161.1"
                     /db_xref="GeneID:55987570"
                     /translation="MHSSGTPAVTERDRSLAIVTQAREQQGWLEKNLKPKKITARYPF
                     KGKALLFATCGFGSLGDTLFGYNSGLMSGLLVNPVFVSRFFKNFGGADGNIDAVNPSI
                     TGISVACLQASAAVGAIVAGRLGDVIGRKKCVRIGAFIYFFSAFIQVFAPGFSTFVAG
                     RTIQGLGVGFLSMTVPIIQTEIAAPNHRGLMVGIEYTCQIAGYMLSCWVDYGFYFALP
                     NDISWQGPLFIQIILSFILLAMSFFLPETPRWLAMNGFSTESLQTVADLHSGGDTEAE
                     HVQKVFLEIKEAVTYETNLGKCNWSEMFTRYRKRTIVGITAQMYAQINGINIISFYLP
                     STLSSAGYDDEKSLLLTAANALPYTAATVATWWLADRWGRKPLLMMGGLGMALLLSIV
                     CVFTQAHLDVKTKADGQYAFVMLYNILYGFTWGPMPWLLPAEIFPLRGRSKGMALATA
                     SNWVFNFIIGMVSPDAFAGIHGYFYLVIAGFCLSSAALTYFYYVETANHSLEEIAVAF
                     GEQAFADCDTEVMEVIADDANSDKGRGSV"
     gene            <196438..>197705
                     /locus_tag="TRUGW13939_00054"
                     /db_xref="GeneID:55987571"
     mRNA            join(<196438..196464,196524..196652,196749..>197705)
                     /locus_tag="TRUGW13939_00054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483269.1"
                     /db_xref="GeneID:55987571"
     CDS             join(196438..196464,196524..196652,196749..197705)
                     /locus_tag="TRUGW13939_00054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339162.1"
                     /db_xref="GeneID:55987571"
                     /translation="MSATQDDALSANRAFVLHPGGQFTFESRSVPTLDSDRDVLVRVV
                     ATGLCGSDVHYWQHGRIGRYIVEAPIVLGHESSGVVVKCGSAVGGLSIGDRVMLEPGF
                     ACNTCHYCRGGRYNLCEAMHFAATPPYDGTLVKYYRAPSEYCYKLPSHVSLRDGTLIE
                     PLSVAVHSCRQAGIMQEKSVAVFGAGPVGLLCCAVARAFGASTVVAIDVVPSRLESAM
                     KYGATHTYQMGSASPEQNAIDMLAATGLEDGFDIALDATGAEACLACGIHALTRGGVF
                     VQVGLGKPNLSLPVGQICDKEVMFKGSFRYGPGDFKLAIGLLNSRRVRLDGLVTHEFP
                     FSRAEDAFKNVAARAGIKSVIYGPDADEEEASRGSD"
     gene            complement(<197764..>199614)
                     /locus_tag="TRUGW13939_00055"
                     /db_xref="GeneID:55987572"
     mRNA            complement(<197764..>199614)
                     /locus_tag="TRUGW13939_00055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483270.1"
                     /db_xref="GeneID:55987572"
     CDS             complement(197764..199614)
                     /locus_tag="TRUGW13939_00055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339163.1"
                     /db_xref="GeneID:55987572"
                     /translation="MEILYVLLEEYFDAIHWFSLAIYEPKFRQMLHSISDGFAHHSQK
                     PFLLLLAVMLGMASWYRAQRSGVDLADHSDEWWVWSTDLLKLVESNIVEIMDKPSITA
                     VQTCILLGSHHVYHGRPNLSFSLLGATVKMSQSLGLHRQTSRGPLEDIEERKRIWWTI
                     YTWDRFASITYGRPLGINDEDCDVIMPADVLENPSFVTPTSDQGNLILYSSYQRELNR
                     LYLIASPALKAIFGSRTLGTSNQLTGDTYYELAKNATQDLQRWYRLLPSHLSLDLEQD
                     FHADGSLKSRAYALQSLSLQLTYDNVLIILHRPLLNRQVDILSTDNERAALGDGNSIN
                     HSGSAAFSVASSELWSNAAVRTSRVTELPVLAQLATESHLVAFLAINLFNAAVVLAVM
                     ALSEPLSDTAQDIKRTITRILRLQDLLGKRSALSKQCATILKNVVILLLRRESETIFA
                     PLFSTSQRTQAQTQQTPAEISLMSVEDTLRLPLDFTLNSPSFVGYQTWPDLSRSHRLN
                     ESLISVQHGNYLDSWERTPCVLTLLMWLFFPVLGPGNDGQSSIPTEGPERRGFSEQGM
                     QPHSNYQLPAEYDSSMYGGSQDGVHDSHMENIDGGLYWLWDTTWNGIDRE"
     gene            complement(<201128..>201694)
                     /locus_tag="TRUGW13939_00056"
                     /db_xref="GeneID:55987573"
     mRNA            complement(<201128..>201694)
                     /locus_tag="TRUGW13939_00056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483271.1"
                     /db_xref="GeneID:55987573"
     CDS             complement(201128..201694)
                     /locus_tag="TRUGW13939_00056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339164.1"
                     /db_xref="GeneID:55987573"
                     /translation="MTSLITPVRRVLTASDSQGKGYFASDDVLTPYDPTTAPEFSPPT
                     EKSGFGVVQIHRSRSFPADNQRPLDDDPHRTLVPLADTKGPSARIIDLPPHQEGGWMH
                     RTISLDYCVVLSGSVVFIIDGGEEKILNQNDIIVTRGVDHAWVNRGDTMARVFVVVVP
                     SLPIVTADGSKLEKTPAGPIYDPEEKDD"
     gene            <203818..>205034
                     /locus_tag="TRUGW13939_00057"
                     /db_xref="GeneID:55987574"
     mRNA            join(<203818..204834,204888..>205034)
                     /locus_tag="TRUGW13939_00057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483272.1"
                     /db_xref="GeneID:55987574"
     CDS             join(203818..204834,204888..205034)
                     /locus_tag="TRUGW13939_00057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339165.1"
                     /db_xref="GeneID:55987574"
                     /translation="MDTSTDWLAQLPLEIISMILSQLSIHSLVSFGATSRNNFRYHIL
                     GVKRLHLAVFNRPLDAHIAFMDRGLSNDSKTSDDLSQVHQIQVVLPGSSTQFDVPLRD
                     YFEKNSGTKRGKQKYAALMSDKQFGDLLSVEQTIRAQNEKFSQMVYRYGASLMELEFL
                     AHDLSNEGAMALGASCGSKLRHLGLRFQHPHVRDGCLISGRYWANPAPASSAWNYLIG
                     IGPGAKEISMSNLESLVLERAGITPWQLRMLIKRNRTLEVLKLRTCAAVKPEFVNWLG
                     GMGIPDYEGEIPRQEGEPAPGASLKILWLENCNGIYSKNKKFHGKSQDVDSGLDWVRG
                     LVGLQSLSFRECKNIDANAVQRANEAIWHIPELHAPRIASLSDSLIEVDPEYA"
     gene            <205508..>206964
                     /locus_tag="TRUGW13939_00058"
                     /db_xref="GeneID:55987575"
     mRNA            join(<205508..205876,205930..>206964)
                     /locus_tag="TRUGW13939_00058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483273.1"
                     /db_xref="GeneID:55987575"
     CDS             join(205508..205876,205930..206964)
                     /locus_tag="TRUGW13939_00058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339166.1"
                     /db_xref="GeneID:55987575"
                     /translation="MSTQTGLVSPALNFHPNFYSSLHPAKGLGELSFMGSMAHQQLEI
                     SRKSSHRNFLHPSKTHTLFRINSKSWYDENYSPTDKQGQSFYGISGGQEGAWETVYTT
                     SGLVLGVAKTFVALCNNFRVDLLIPAANILSYIEKAEMLLQSGSVIDFVFAVEDLYFS
                     LFARLEIEIAFLHFCISFGMKGSRIRRRTDHALPEPSHVYTILTACKEILNDKNVCSG
                     FDARLVDYHQRRFVEEMTRKYQVDGTLPPDATGYRAHVEEAIQNPSSYTYQQWRQDFP
                     ELRSLPIDILAFLSEKYLPIYPRTISKNSQMKFNLPFVSPEAANPAMWEKDMIRAHRL
                     CALAQLEGKAVGELRREEEPFNVLRYASEQKCVCLEICTCSKSCSKSGSTLCPCSSRW
                     VRGIMIHRPEYEISYPDKSTIMGELAYESLACLKRDEPEEVMCRELYGSINVIRTEMA
                     KQRSAYQTEEVDIMLIS"
     gene            <207373..>208852
                     /locus_tag="TRUGW13939_00059"
                     /db_xref="GeneID:55987576"
     mRNA            join(<207373..207827,207889..208532,208587..208622,
                     208680..>208852)
                     /locus_tag="TRUGW13939_00059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483274.1"
                     /db_xref="GeneID:55987576"
     CDS             join(207373..207827,207889..208532,208587..208622,
                     208680..208852)
                     /locus_tag="TRUGW13939_00059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339167.1"
                     /db_xref="GeneID:55987576"
                     /translation="MVTAISAHPSALRALAASPLTRRPQLQPLHSLPILSRPSHQYHT
                     ATFGSKTPSPENVESSLSKTIFRFETGYALRPKRPSRPFPPPFVSIPSTSFSDPLTTH
                     FKSQDRRPKVGGELIRGLTNGDDAILAADNFLGVNDGVGAWATKPQGHAALWSRLILH
                     FWALECERRTSCKSTPDTVEFLQHAYEETLNSTNQWLGTTTSATALLYSTSNNNNNAK
                     PLLYVTNIGDCQIIVIRPSDGKILFKSREQWHWFDCPYQLGTNSVDQPLSNAVLNTLE
                     LAEDDIVLAVSDGVIDNLWDHEVLANVLESLDKWESGDIGNWEAAGLSSAGSMVFVAR
                     RLLHAALAVAQDPFAESPYMEKAIDEGLTIEGGKMDDISVVIGQSSFPDSVSTNSTTT
                     TLQQTANVGRKRESKYDLLNNHHMPENLQDIEKLKCFEEEGNF"
     gene            <209443..>212687
                     /locus_tag="TRUGW13939_00060"
                     /db_xref="GeneID:55987577"
     mRNA            join(<209443..209577,209638..209784,209836..210235,
                     210300..210442,210492..210669,210720..211202,
                     211427..211642,211705..211794,211858..>212687)
                     /locus_tag="TRUGW13939_00060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483275.1"
                     /db_xref="GeneID:55987577"
     CDS             join(209443..209577,209638..209784,209836..210235,
                     210300..210442,210492..210669,210720..211202,
                     211427..211642,211705..211794,211858..212687)
                     /locus_tag="TRUGW13939_00060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339168.1"
                     /db_xref="GeneID:55987577"
                     /translation="MSTKAETESGAESPVESGYGNSSSLKVRGAIILVPRPSDDSRDP
                     LNWGQAKKYIVLSILTLAAFTGHTLALANQLGLIAQANLYHKSLTEISYTISTAVAGI
                     AVGPIFVIPLTHIFGRCSVLFWSCIGCIAFSIWSALMTEPDQYIKFTISRLFVGIFSA
                     TPMIVGPQLLVDTFFLHERGRVFNTFFVISSLGTVVGPTLGGFIVAHVPWPWQFWWTI
                     ILQGVVIGLVFFFIEETGFTRKDGRVYPSQPSTFIPNRIATFFPGTAVAHVGGFKEAF
                     HSAIAQFLIGISPVTVLGGLYLVSMCGWFVSLNTLLAVFLQNSVEEGGYGFTPQQTAA
                     FTFTLWIGMLAAQVWGYFINDRVPLLMSKRASGAWKPEYRLHALWIPSLVLMPTGLAL
                     FGSGLQYHLHYMVLAAGAFLVTTSSNIAVPVMLNYLVECFMSHPIEVNCISTIYRLGL
                     GLGIPFFINAWVAQVGVGWVFGMMAFFSLASFVPIVVLMMYGHSLRGGGGARATQLCR
                     GRKSFKAERGNTTPSNKSSQQQASRFPAVTMRAKRSKKYRKLMHQYEMTFGFHEPYQV
                     LVDSNFLRAVHQFKMDLIPALERTLQGKVKPLLSKCSLAAIMAAQPINPRTNNPFRPY
                     HLPAPTVLPLRHCSHNADNTPIDEVECLLSLLCPNTDTMRNKEHYTLATAEPIALAHD
                     ELDSPDAKKRKRAQSAMAERTQKASALRSGARAVPGVPIIYVKRSVMVLEPLSVSSDR
                     VRMGVEKSKFKSGVEAALDIVSGLKRKREDEDDDEDEDGEKQHAPKNRGLKKAKAPNP
                     LSMRKPKSRAKQKPEEQGETRKSKPKENEDAGNADAADGDAASTVKQKRKRRHKSAKN
                     DADGAEASIPHGDVDMD"
     gene            complement(<212947..>213262)
                     /locus_tag="TRUGW13939_00061"
                     /db_xref="GeneID:55987578"
     mRNA            complement(join(<212947..213176,213229..>213262))
                     /locus_tag="TRUGW13939_00061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483276.1"
                     /db_xref="GeneID:55987578"
     CDS             complement(join(212947..213176,213229..213262))
                     /locus_tag="TRUGW13939_00061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339169.1"
                     /db_xref="GeneID:55987578"
                     /translation="MHSHLHTAENANCEGIMNALDECHAHGFLWKAVGQCNDIKRDVN
                     RCLSAERLQRAKNNREQAMEKRSRIEKIWADERAREQGEVKQE"
     gene            <213705..>215389
                     /locus_tag="TRUGW13939_00062"
                     /db_xref="GeneID:55987579"
     mRNA            join(<213705..213952,214012..>215389)
                     /locus_tag="TRUGW13939_00062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483277.1"
                     /db_xref="GeneID:55987579"
     CDS             join(213705..213952,214012..215389)
                     /locus_tag="TRUGW13939_00062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339170.1"
                     /db_xref="GeneID:55987579"
                     /translation="MNSMITTTTWVRRGVAAQFPTKYDIDEDEINRISKLARLQLEDA
                     QGDLKAAESAGNDEDEDDDAMDDDEEEEKAGTGSNKGAADEKDDDDLKEYNLDHYDSD
                     EVDEDGEEATMFGNVKSLAYHKPGEKDPYLEIPEDEENEDREELQILGTDNLLIAGKV
                     EDEVAHLEVYVYEDSADNLYVHHDIMLPAIPLSVEWLDFPVGKPEENRTSGNFVAVGT
                     MDPDIEIWDLDIVDCMYPNAILGEGSAEQDTKPSKKKKKAKKANDEYHVDSVLALSAN
                     RQHRNLLASASADLTVKLWDLTTQKCAKSYTHHTDKVCALDWHPRESTVLLSGSYDRT
                     IVAADMRAPEAKAARWGVPADVENLRWDIHDPNFFYVTTDSGLVCRYDIRNAPASPKD
                     SKPVWTLQAHDDSVSSFDINPTIPGFIVTGSTDKQVKLWNTVDNKPSMVISRKLEVGK
                     IFSTSFAPDPEVSFRLAVAGSKGVVQIWDTSTNAAVRRAFAGRVPDVAPGDNGEVKEK
                     ITGVSQNDDESDSSEGEDDGDEKKDGWESMEED"
     gene            <217457..>218206
                     /locus_tag="TRUGW13939_00063"
                     /db_xref="GeneID:55987580"
     mRNA            <217457..>218206
                     /locus_tag="TRUGW13939_00063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483278.1"
                     /db_xref="GeneID:55987580"
     CDS             217457..218206
                     /locus_tag="TRUGW13939_00063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339171.1"
                     /db_xref="GeneID:55987580"
                     /translation="MAMAIGRAFTKRTKRPEISTPMPYREGAVKYSTGTIRRGQISGP
                     VELLSATNPLVYNAPDLNGLSSSSSASSLRSSNDSDLTPTTPATPPSESLPGPNHLSG
                     YFPKRSATISSTARSSTSSTGADAPNVPKRALSHTKKSHQDLARQRSVSRLSPPPTSM
                     HAPASRRPAQDVFAPVPESAEHPFSRELDKVNEVAEDFGALRVLDEEEQILLSRGLKK
                     FTVDDYLCEIEELYGGVFDDHLGPLASNAWL"
     gene            <219297..>221427
                     /locus_tag="TRUGW13939_00064"
                     /db_xref="GeneID:55987581"
     mRNA            join(<219297..219918,219977..>221427)
                     /locus_tag="TRUGW13939_00064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483279.1"
                     /db_xref="GeneID:55987581"
     CDS             join(219297..219918,219977..221427)
                     /locus_tag="TRUGW13939_00064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339172.1"
                     /db_xref="GeneID:55987581"
                     /translation="MPHSSSPATSILKSSKLAAKAQVSAMAGKKRKMIDMDMSSQPPS
                     SSPPWDAGTSSPVKRPRVQFDPAVETRLLPHSPDEGKSTEKGTALIREEIRRAIQRHT
                     TGADSEAYDRVREVFVIDPRKRDSDESDYLPTPTSMKRHLMGLLSNISLLDSNCSSLV
                     HAVLGSEWLGRDESYVKTFVRFLGNLSAAQSVYLRSVLKMLVNYLGEIPRGTGRLPGY
                     SVVTHGDIYDRIHMALRYIMQLLPAGSGALSPILSAQFPFDTDSAKANVSYTRNLIRI
                     IEYAPELRSEILALITEKLVKIDVQIQVDMEDFEDEVGEGLLEDLSRPIDLEAGEDED
                     DSDNDSVISDDDSTDPPTQRLKTVKENIRKIDSMIDNLFEFYSPPFAHGTDDEKNNAL
                     DLLIAHFESIILPTYRSRHTQFLLFHFSQCSTKLVERFAATCIHIILSKTQPAITRQS
                     AAAYLGSFVARGKHVSPRVVRDVFDMLGEHLDSLRAQHEKSCRGPDLRRYGPFYATAQ
                     AVLYIFCFRWRDLTTASEEADGAENDDLDIEDVNFPPSIKEVLHRAIYSKLNPLKVCS
                     PAIVSEFARITHHLRFLYVYPLLESNKRLRVSSFRSITTLSDPRFTIVEREIRAGNDG
                     GHQLDAYFPFDPYQLPQSRRWLEGDYVEWRGIPGLDEDGGDSDSAAEDQDAGNFDDDE
                     PTATDEEY"
     gene            complement(<221882..>222919)
                     /locus_tag="TRUGW13939_00065"
                     /db_xref="GeneID:55987582"
     mRNA            complement(<221882..>222919)
                     /locus_tag="TRUGW13939_00065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483280.1"
                     /db_xref="GeneID:55987582"
     CDS             complement(221882..222919)
                     /locus_tag="TRUGW13939_00065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339173.1"
                     /db_xref="GeneID:55987582"
                     /translation="MDNARWWLHVQAVFWRFLMGIGMFLHTAGVSRPPPPSFVRYIPF
                     DKNNRKRNVKLYFYCPPAYYRYRATHQGRPLPVVVNFHGGGFTLGSATDDSFWAQCVM
                     QETDAVYVSVDYRRAPEHPFPAAVDDCVETLLYLAAHAGELGIDASRIVLTGFSAGGN
                     LAITVPLRLQNRIQNDTGSDIIDIGPFDSTQNLVSGQGNLQILATFAWYPLLDFVASR
                     EHRRATSVFPGKTMPAFFTNLFDEAYIPNHDLRSSPFASPERASDQMLEEGLPQHIFL
                     YTCEWDMLLDEGQRFVRRLEAMGKKVRAMMIEKAPHAWDKSPNPFRDQGRINIIYQTA
                     CAEMKAIFDQN"
     gene            <224222..>227095
                     /locus_tag="TRUGW13939_00066"
                     /db_xref="GeneID:55987583"
     mRNA            <224222..>227095
                     /locus_tag="TRUGW13939_00066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483281.1"
                     /db_xref="GeneID:55987583"
     CDS             224222..227095
                     /locus_tag="TRUGW13939_00066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339174.1"
                     /db_xref="GeneID:55987583"
                     /translation="MSGIRRALSKIRHKGDNGSETDSHGPSSTNHSRSNSASNPASPR
                     RSLVNFLRERDYISSSDDMSDDSSAPLSKNQQKRIARQHRRQVKSRLSEEHRNDSEQR
                     RLDKEDEKYRTETPEMKARYGNLPLVQSQERQNLPRIRLDDISKDMIGQEVCFTARLH
                     IVRNMSSKLVFVVFRQQLVTFQGVLHALDGKVSTGMISWVEHLRTGTIVRVRGIMQTP
                     AVPVLGCTHHDVELSIEQFHVVVRREDPVPFSVYEAEVRTEEEDRVEGRFSHISDRTR
                     LSNRILDLRTGTAQAIFRLQSAVGNLFRAALDERRFIEIHSPKLQGAATESGASVFEV
                     NYFGRPAFLAQSPQLAKQMAIASDFDRVYEIGAVFRAENSNTHRHLTEYTGLDIEMAI
                     EEHYHEMLETIDATLKHIIKGLYSKFRREIETVKHQFPSEDIVLLDETPIIPFKDAVK
                     LLNDSGWRNEDGELVPDDEDLHTRDEIRVGQLVKEKYGADYYIIDKFPVSARPFYTMP
                     DPHDAAYTNSFDMFVRGQEIVSGGQRIHDPTMLEENMRKVGIDPAAMDDYLEGFRWGA
                     PPHAGAGVGLERFLMLVLKLGNIRLASMFHRDPKSFPAKPAVANLRHPEASTLEPAWL
                     KENHTPRAESEDEMPRLVDLIANYGDATSTSWTDERYKIWRDPSTGAAISYIPSYNHA
                     IIPGDPLCDPSQYHRVITSFLHWLKRETKLKPIWLLLSPAVEELLGEKLGWRSLSCIA
                     EEVVDPSRNMMASDTEIARKIRHAENEGVKIFSVPPGQLPSEEIRSKIDQRVKDWLAN
                     RKGTQIHLSEIAPWRDYEHRWYFYAQDKEGNIPSFVALAMLAPQRGMQVKYSLDFPGA
                     PNGTIEYIVTHAIQTAAKSGIKSLTFGAGATSRLTPGHHMKGAKVRMLQHTYEAVAKQ
                     FHLTRKSEFRMKLGAHEEPLYIAYPPHGLGSRGIRAIMNFFED"
     gene            <228091..>231025
                     /locus_tag="TRUGW13939_00067"
                     /db_xref="GeneID:55987584"
     mRNA            join(<228091..228166,228353..228755,228820..>231025)
                     /locus_tag="TRUGW13939_00067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483282.1"
                     /db_xref="GeneID:55987584"
     CDS             join(228091..228166,228353..228755,228820..231025)
                     /locus_tag="TRUGW13939_00067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339175.1"
                     /db_xref="GeneID:55987584"
                     /translation="MNGMQTAQQLREKGNALYKSGKLTEAIKSYQDAAHHAGNDDYLP
                     WSNLSAAYFEAGQYEQSAESALRALALCSKNDSNQNEATNLERKLAPRVIRAYLHTHQ
                     YAMARLWLKRYGASAAADESLQYQASLDQAEAVREAAPDEKRFRRDLQAKVPRYRPQY
                     DVYHEFYNVGHDEIIDMLDFSMLSDLKKDVSMFFAGIGDARHFYGQLVILNMTSERMA
                     APSPVKRRYHFSMNDRKAGTFARNLVLFVLLDELAVNKNMPQAQRTELYTVVYFLFLG
                     AIIPRFVVARLDSVIDMVIERLENSDPGTTTAVLPWVQVYAPDRPEILRALKSWKSDG
                     SLTPQFSTARTMELTVMGLGMHRAMMSEHRAPPGCQKEMETFFEVPFLQPPRSMLKEH
                     EPELLKLLDGAASVQKLETYLTANWATNPTLLDEDWHVKAGCDIYTGWDPFDTYQALH
                     QILSLQEKGGPRKTKLFDHVSYFFQSIVVALRRIRGRLTTEFLLGDAADVIDAVRHGL
                     IESRDATAPAAFDMVHLSNVPDYIGGSFFTFTTAAKILKNSQAAKLNTTCLRNTSLWQ
                     SQDEFHCEYMAVSDTKMLSRVTDLHLTGKEDDDPLDPMSGYMEWRRSRLVKPVLPYED
                     LLPRAELTRFLHMHFFKLALPRGRKSSDDNYHAFIHPNLNLTCFFRLLIHLHELGYPA
                     HWLADVLGKILDNQVVTTARPPRSLPLQPRELSHHSNAPAEVCVGPFVGEMSTLTVLF
                     QRILPFTPFSNALPSVDMVHQYSMQLNWLGPPKNNDAAAMVLFFFDLETHYPGDNIRD
                     DLDSSYSSFSSASRSNALKQFREHGSVVITSFTYTGLQNSRTVRFWMREDIMDRICEQ
                     NEHWSCAVWRVDDWQRLTTFPEDVSLLVKEKKWVDGKS"
     gene            complement(<231659..>233179)
                     /locus_tag="TRUGW13939_00068"
                     /db_xref="GeneID:55987585"
     mRNA            complement(join(<231659..231953,232061..232338,
                     232391..>233179))
                     /locus_tag="TRUGW13939_00068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483283.1"
                     /db_xref="GeneID:55987585"
     CDS             complement(join(231659..231953,232061..232338,
                     232391..233179))
                     /locus_tag="TRUGW13939_00068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339176.1"
                     /db_xref="GeneID:55987585"
                     /translation="MSELTPNKTWLFKKPPTTLPMPGINTAIEDRPLRLISPPGGLVM
                     RLLIAGFDPHQRDRMREPSALDYVPCYEIDEPISSFSIGQVIRSNHERFVEGSLIAGL
                     LPISQYGVIPGEMIDIGDAAAPILWRVTNDYNLDLKHYVGTLGLAGMTAWNSFYGLVK
                     PVSGETIWINAASSSVGQLVVQLAKIEGMRVIASVSSDDKLDYVLNELGADVGFNYRQ
                     EPIQDALKRLAPDGLDVVFDNIGGDHFQAAIENMKWFGRIICCGMASQYNQPVNKSYG
                     VTNLGEIVRRRIKIQGFVYSDENIFGNVDNFWKTVPRWISEGKIKSRYTEFEGIKNVD
                     QAFISMFTGGSFGKTIVRINDLKDLAKAIAAGLTSNYSNAPTKPEEWWQISLMYTALI
                     DYWALTGDDQYNAMTKQNIVGQIASKSDFMSANQTSYKTNSEQASWALAAMNAAEAGL
                     DSS"
     gene            <233862..>235253
                     /locus_tag="TRUGW13939_00069"
                     /db_xref="GeneID:55987586"
     mRNA            <233862..>235253
                     /locus_tag="TRUGW13939_00069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483284.1"
                     /db_xref="GeneID:55987586"
     CDS             233862..235253
                     /locus_tag="TRUGW13939_00069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339177.1"
                     /db_xref="GeneID:55987586"
                     /translation="MSEDWNWTETRPGHWERHVDHIEDYFVTIADLTRPVGGDHFSTS
                     FGAQIKFQPEKALGEIESALKQAWTALRFDLPQLASIVEDRRMIYESLPDDSTRQEWL
                     SRTVVIDTSSNSSAELFPRLNQSPKQAMLYYLPKSSEVVIHTAHWRLDGYGATLLLSQ
                     LLQHVVELPTSTITFGSEPARLYPSHFVLLKAPENPPESSQKITDQSIFDYITHLPSI
                     QIPSVTGPTPKLVPTTHRQEITINQQQTADLVASAKARGVSLTVVAHAAMIRATKAMN
                     PDITLDESAKYACIVPVSIRDLLPTPYDGPAYAASVAMTGVPVGFTSTTFDKDMDRLQ
                     DLYHNELKHPSRIEGLRAFQNKMTESLKQPPVVDIPTPTHPTLNSLGLIERYLKPSYY
                     GKDGDVKVDKFWVGTGVVDHTVWVYIWTWKEQLTISATYNTGMYDDHTIRDFLGRFSE
                     VLTQKLIPTASTS"
     gene            complement(<235710..>237002)
                     /locus_tag="TRUGW13939_00070"
                     /db_xref="GeneID:55987587"
     mRNA            complement(join(<235710..236014,236075..236142,
                     236215..236588,236652..236750,236811..>237002))
                     /locus_tag="TRUGW13939_00070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483285.1"
                     /db_xref="GeneID:55987587"
     CDS             complement(join(235710..236014,236075..236142,
                     236215..236588,236652..236750,236811..237002))
                     /locus_tag="TRUGW13939_00070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339178.1"
                     /db_xref="GeneID:55987587"
                     /translation="MTSITPAELQHMKEHAGDTKVPNIIATVITCGCISYVAVALRLY
                     ARNTAKFGIGLDDFGILIALVFFTSYFVMLALVTRWGLGRHAIMITNAEAFGKTNVTN
                     EITYTMSLAFVKFSILLFYDRIFPNKGLRKAFLATALFIIAWIITSIFGSIFACVPVN
                     KQWDPAVPGKCMAFGSFVLGISIINIITDFTLLILPMPVIWGLNMKRTKKILTILTLV
                     AGSFACIVSIVRLASVQAVGSTTDPSWDDVGGGILSCVEVCVGIVAASLPTYRPLLNR
                     FIKNRDYGYHPRSDGIVQTTDIQMHSAPRSAHRDDDDDTPYGHSIPKSFGGKISPASS
                     DKERLYTKLSE"
     gene            <237629..>243902
                     /locus_tag="TRUGW13939_00071"
                     /db_xref="GeneID:55987588"
     mRNA            join(<237629..237835,237890..238040,238100..238557,
                     238757..239153,239361..239475,240508..241355,
                     242194..242412,242503..243044,243123..>243902)
                     /locus_tag="TRUGW13939_00071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483286.1"
                     /db_xref="GeneID:55987588"
     CDS             join(<237629..237835,237890..238040,238100..238557,
                     238757..239153,239361..239475,240508..241355,
                     242194..242412,242503..243044,243123..243902)
                     /locus_tag="TRUGW13939_00071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339179.1"
                     /db_xref="GeneID:55987588"
                     /translation="HNNYTSFPNEPSQVPTSFTSSIGIMQHPIALSLLVLSFGCVLSQ
                     IITRLIFHDGRLHVWVVAGWVFLECFLVHAIYRLQFYPLAKYPGPWWAAITDWYTVLH
                     LAKGDRHLDFYRLHLKHGKFVRFGPHRLSINSAEALHDIFGVRANTQKSTVYGSFKYF
                     FNGVNMSMTEIDRDKHAFKRRVNASALNTAAVRNVQEQILTNTRYFCTQLTDEKPSCQ
                     DGWSAPRNISRLIGYLVSDIMGDVTFSKNWDVQRDKERRHFVDDSALGTAGIHLGANL
                     KGKDLFSALLEAVDPVTGKRFTQGELISEAGLLIVGGSDTTVTAMSATIFYLLHNPAA
                     LARAQSEVRNAFSSLEEITMGKSLDGCRYLVACIDESIRLSPPVGSILPRQVLTGGLR
                     VEGEYLPEGTDVGRMLFEYDMQLDTQSTLGEGGPGKGWGRHRKDEYQLMDRKSDFKTV
                     IFPTAAFAVFNTLAGDFTENYTQSTDNKRLPFAGRMLISVAWTWLHLLMENIANQRLP
                     HSIVEDRLNKPWRPICSGRMDSEGGRQLLLTVLILSCGLSFFLGVLGPSVALVVFTYM
                     YNDLGGANSSILRNILNACGLLSFGAGATAICGGSGLGAAPLTSLAYNWLWVIATVIS
                     TTVSVQDLEDYKGDLATGRKTLPLILGDTPTRYLLSILIVGWSTACPLFWSVTPMAYI
                     PPVTLGLGLAFNLLGRRNLDSDKMSWKMWCVWIMALYSLPCLRAMDFSILPTVVAGVA
                     IGVVYTVGLVLYRLAFHPLAGFPGPWLAAATWWYEFYHDTRRGGGLYIWRIEELHKKY
                     GPIVRINPEELHIIDPEFHEAIYAGASSARDKWDLAEKSAQSFGATGHTPSHKLHRIR
                     KDSLSPFFSKRTVTERESQIREKVDRLVSRIREHAGTNRPVNVTVAYIALCMDIITEY
                     AFGQAYGLLEEEDFNEQWKNTIMGIVSSITVLTHLPWIPALMRSLPESVQKMLSPNVA
                     LLLEYEKRIREKIQSALKIHPGVKNDTPSAESTIFDAVRDNPKLPDSEKRLQRMSDEG
                     NVLLIAATETPGKVLALLTYHILADSVKLARLRSELESINPKPSVKELESLPYLVAVV
                     KEGLRLHGGVVTRSKRIAPYDALQCGQFIIPPGTPLSCSIYFMHYDRSLFPDPFEFRP
                     ERWIDVDDATKKRMERQFAPFGRGTRSCLGYNLGMVEVYMALAAVITEFEMTPYKTTR
                     KDVDLERDWLIPQPSKDSKGVQVLVTAVRGKSDS"
     gene            <244928..>245888
                     /locus_tag="TRUGW13939_00072"
                     /db_xref="GeneID:55987589"
     mRNA            join(<244928..245602,245670..>245888)
                     /locus_tag="TRUGW13939_00072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483287.1"
                     /db_xref="GeneID:55987589"
     CDS             join(244928..245602,245670..245888)
                     /locus_tag="TRUGW13939_00072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339180.1"
                     /db_xref="GeneID:55987589"
                     /translation="MGKSIYFYEPSLAASIIFTILYVIPFLYHFYMTVIAPCTGQYSR
                     TGYFIPIVIGAAMEVAAYGVRAASVKKPDNVGLYATSSTLVVIAPVLVCASLYILIGR
                     LIRSSLERHSNDPTAKRLPAPLAGKISSAWIPRIFVISDILSFLTQASGSGIASSNDW
                     QGTSKDAGIGVLIAGLVLQLVTFSIFLILVIWYHIRIIPLSSTDTRSSEARLLLNGMY
                     IAGFFITVRLIYRVVEFSIGIGGYTWTHEWPLYVFEAVPMFVAMVVMGRYHPTSILED
                     KPTELQSRGKDSEGQPLGRPL"
     gene            complement(<246093..>247175)
                     /locus_tag="TRUGW13939_00073"
                     /db_xref="GeneID:55987590"
     mRNA            complement(join(<246093..246956,247023..>247175))
                     /locus_tag="TRUGW13939_00073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483288.1"
                     /db_xref="GeneID:55987590"
     CDS             complement(join(246093..246956,247023..247175))
                     /locus_tag="TRUGW13939_00073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339181.1"
                     /db_xref="GeneID:55987590"
                     /translation="MESGSPSHMSPETFTGHDLRFLHHFLITAYPHLPFGSEDLWKTS
                     LPAYAHQCPHLMHAILSLGASHLSLISPRADEYTPLALSHRGRALKYLGDALATVDQC
                     TKTDLDLILATTYALTFQANYMTDGLVDFAVMVRGCTTVTRKIRSQDQERDMFRLLMS
                     EVIYARVCSQLPSTPCWDIDILEMSIEALEGIRPLLEANGHRINYHAILNIYRCMRIS
                     GRQGFIALSEFYNGWGSMDYQEFMDFLDPGNHVSRLLLIHYVAVTIMMKPVFSTFKPS
                     MRETPKDTLANHQWGIGIYRGLNAKFRGLVELQYRFIVTDKAWIEAGGTMSASENETD
                     VLQL"
     gene            complement(<248692..>250917)
                     /locus_tag="TRUGW13939_00074"
                     /db_xref="GeneID:55987591"
     mRNA            complement(join(<248692..249179,249241..250252,
                     250315..>250917))
                     /locus_tag="TRUGW13939_00074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483289.1"
                     /db_xref="GeneID:55987591"
     CDS             complement(join(248692..249179,249241..250252,
                     250315..250917))
                     /locus_tag="TRUGW13939_00074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339182.1"
                     /db_xref="GeneID:55987591"
                     /translation="MAMDHDTSVSWSEQLPGETLMAHANEDDFSTFLEFGLDFADLEG
                     HGSPAVQQHQHQHQRAAMQHPDHSITTSMAEDARIAPGHASPYAPVVSGHLPVGIPNN
                     GPVEDHAFHFSHEQQQAQQHHHHQQQQQHMASHNHPQLALQHQDKYPPHTATHSFPNG
                     QHVIPPTPNSIELHGGAARYPQRVDMGSEIYDRYGQMNDDQAAFYTPLISPAMTPLET
                     QFRLPEYTIPGEYFTPLTSPALEPQGSNNNNGFPFQQTKQPPSTQAPGDPATSMGMTS
                     APSSPAVLRRQRRRPSTATRTGGRAAKASPSIQPKNWRKQAMTTQFVADDLANNGLGQ
                     DARLATGGGSSLRYSGHESSQDSVSPEPISEPLMPPPAIPSARRSPAFRPQVMESDSS
                     APATPATLMRINNRPQEPTGQFSGFASLVPNDVQDELMEDVVLPEAAATDIRPRPSRI
                     DTAINSKEQHSVHSTPVDPKSATERPASGSLTPAPHSGAMPSPSGPIPKKSDSKAVNG
                     RKRHSVSSSHASPALRPRISPSIQPLVRGEGMTGESSALYLASKSNYQHILDGTLLPG
                     VSYPESLAENLSSKRTNHKLAEQGRRNRINTALKEIEALLPPGFTRERAAKESKEAGA
                     AKSGEKEKDKNAQQTISKASTVEMAIDYIKALQQELDSTKSQLNIAVSKLAAQSSNSP
                     NSAANSTDAATENSVSPA"
     gene            <252343..>254596
                     /locus_tag="TRUGW13939_00075"
                     /db_xref="GeneID:55987592"
     mRNA            join(<252343..253036,253091..253537,253599..>254596)
                     /locus_tag="TRUGW13939_00075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483290.1"
                     /db_xref="GeneID:55987592"
     CDS             join(252343..253036,253091..253537,253599..254596)
                     /locus_tag="TRUGW13939_00075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339183.1"
                     /db_xref="GeneID:55987592"
                     /translation="MRPVVPEYPPSPARKSSSTEQPLPPWAEAQQPTTFFLARDADDD
                     LVSSTHNASPRDSMYGVQSLEETISTANGSFSAKDDVHCSAKDYDTSSTRRTTLKPSD
                     LLHHVDRTDLSVTGSHGRPSPIVAPSRPLTPFGLTDDPSSLPSSPKSTSLRSFKPLDD
                     LSVTDDISSQALVSSGEEDEETPEAAEKLTDGDTDGSSQLIMPSIRMPSRRPFTDRGK
                     RFGRFKIMVAGAKGSGKSSLIKSIVQACDDIVHVDPVEKPILPDNSRPRSTITSKNPV
                     ALSLSEIYASTKPYPPWWSDLEDSRVLRRRKNSGEVVLERNLCFVDTLAASKNRLHQT
                     EAIIQYMKQQLSRAVASIRQPCLDFQNMLGGNGGSQVDVLLYLISEDTLSSDVECIQK
                     LSEFTNVIPLISKSDLLSAPQIAELKKSFHSHIDSRGIRPFSFESSGSPEDSPLQTPF
                     AVSSTRSSDDDNMDASVLMSPDYIQPLVQSELDELLDKVFDGDNMSWLRHSAAKKVIQ
                     NRNWVPSEASGPKALLQRSTSPGVPPYTNALFSVGAPGYTLARVSDYTQSEEKLARVR
                     LAKWAADLQQSLENERERYAALARGERAVWLTERLGECVVDGSLVPINQTPGFPAWTV
                     DIDQTTGGTVVRTCSGQKGQYRLTKLSPQDPLGLVRWNDDLRRRGWIMVQVVGSFGIV
                     GGLALWLAKFWGLPSQSLYEWRFDWLSSED"
     gene            <255679..>257854
                     /locus_tag="TRUGW13939_00076"
                     /db_xref="GeneID:55987593"
     mRNA            join(<255679..255936,256007..>257854)
                     /locus_tag="TRUGW13939_00076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483291.1"
                     /db_xref="GeneID:55987593"
     CDS             join(255679..255936,256007..257854)
                     /locus_tag="TRUGW13939_00076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339184.1"
                     /db_xref="GeneID:55987593"
                     /translation="MSETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKI
                     RYESLSDPSKLDSGKDLRIDIIPDKENKTITIRDTGIGMTKADLINNLGTIARSGTKQ
                     FMEALTAGADISMIGQFGVGFYSAYLVADKVTVVSKHNDDEQYVWESSAGGTFTLTAD
                     TEGEQLGRGSKMILHLKDEQLDYLNEAKIKEVVKKHSEFISYPIYLHVLKETEKEVPD
                     EDAEEKEEEEDEEKKPKVEEVDDEEEEKKKKTKTIKESKIEEEELNKTKPIWTRNPAD
                     ITQEEYAAFYKSLSNDWEDHLGVKHFSVEGQLEFRAILYVPKRAPFDLFETKKTKNNI
                     KLYVRRVFITDDATDLIPEWLSFIKGVVDSEDLPLNLSRETLQQNKIMKVIRKNIVKK
                     TLELFNEIAEDREQFDKFYSAFSKNIKLGIHEDSQNRQALAKLLRFNSTKSGDEITSL
                     TDYITRMQEHQKQIYYITGESLKAVQKSPFLDTLKQKNFEVLFLVDPIDEYAFTQLKE
                     FDGKKLVDITKDFELEETEEEKAEREKEEQEYEGLAKTLKNILGDKVEKVVVSHKLSG
                     APCAIRTGQFGWSANMERIMKAQALRDTSMSSYMASKKTFEISPKSSIVKELKKKVEA
                     DGENDRTVKSITQLLFETSLLVSGFTIDEPASFAERIHKLVSLGLNVDEDAETAEEKA
                     EEEAPAAEATGESAMEEVD"
     gene            complement(<259179..>260931)
                     /locus_tag="TRUGW13939_00077"
                     /db_xref="GeneID:55987594"
     mRNA            complement(join(<259179..259478,259531..260547,
                     260611..>260931))
                     /locus_tag="TRUGW13939_00077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483292.1"
                     /db_xref="GeneID:55987594"
     CDS             complement(join(259179..259478,259531..260547,
                     260611..260931))
                     /locus_tag="TRUGW13939_00077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339185.1"
                     /db_xref="GeneID:55987594"
                     /translation="MADTTQPPINGTYAAPHPYPDPYVSHAPVNTMGNNYHPASTSTP
                     SNGPAGSEPKNEIPKDEVGWYFVEQYYTTMSRNPDRLHLFYSRHSHFVFGTEAESVPV
                     AVGQKAINEKIRALDFHDCKVRVLNVDTQGSMDNILVAVIGEISNRSEPSRKFSQTFV
                     LAQQPNGYYVLNDIFRYLADEAEEFVADETVAAQPKSVSELQDTSVAQQETTSELEQP
                     IAAQGTDDDAISEVDTKLAAATTNGELDKIPQAATQEKAAVPVTPAVPAVPAEPEVLQ
                     PEKPQTAEPSPATSTPKESTPAAKKEPVVPTKAVPMSWASVAAKNRAAAAAAAAAATA
                     ATATATAAAPTAPAKSSAAAPAPSAAPAQLQPEQPAAAVPAEASTSSQQSSTDGSGWQ
                     TAGHDHGKKQSRAGDDHKHPAYIKNVNEKVDASLLKTVLSRFGKLTHFDVNRSRSCAF
                     VDFADQASYNAAVAANPHQIGSEQVTVEERRVRTGNFSNAFPNGRGGANRGRSDGRAG
                     SQGRGGNYQREQGRGGFSSRGGRGGNVNKGRSQAQAA"
     gene            complement(<262048..>262469)
                     /locus_tag="TRUGW13939_00078"
                     /db_xref="GeneID:55987595"
     mRNA            complement(join(<262048..262359,262422..>262469))
                     /locus_tag="TRUGW13939_00078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483293.1"
                     /db_xref="GeneID:55987595"
     CDS             complement(join(262048..262359,262422..262469))
                     /locus_tag="TRUGW13939_00078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339186.1"
                     /db_xref="GeneID:55987595"
                     /translation="MARASLDSERPIMAPSHTDPKRFSTYSGVPSLAASDLTTSTLPS
                     GDSRMADIKDYSEGVERLENKPLDKQRFVPSAEKSDNLNKLALGAKVERALGRRMTSQ
                     DAVMRKPVILDEKKALD"
     gene            <263561..>265278
                     /locus_tag="TRUGW13939_00079"
                     /db_xref="GeneID:55987596"
     mRNA            join(<263561..263647,263703..263733,263811..263952,
                     264012..>265278)
                     /locus_tag="TRUGW13939_00079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483294.1"
                     /db_xref="GeneID:55987596"
     CDS             join(263561..263647,263703..263733,263811..263952,
                     264012..265278)
                     /locus_tag="TRUGW13939_00079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339187.1"
                     /db_xref="GeneID:55987596"
                     /translation="MPKPKFLLKEAGAGGKNKQKKKKGRLQHSDPETADEFLAAGVDQ
                     EEGGEKWRAGDPVKAMRFFMRAIEIYDNGLKEYTQSFDLAYNKARVQYEITQHPKLAA
                     QLPAPQVKILHIALQSHRDALVLEQDNADALFNTAQVLTSIAEILTESKRPKETHLQE
                     ALKYLQEALELFQRCLVLQELRYTESQEQIKSMELGELDIPPDADRADVSQNTPEETE
                     TEESPGEEQWAAVIEPVTKDTLVDTAVAQLETLSTLCGLLALDGGNGLAWVEEYSYEL
                     LKTKIAAYVEGTDRHNEVALARAQFVAALTEILYRGGRVDVETYQRELSSAFPPELDL
                     SDDPEGLCSKAEALTSFNSAIADNPPIASDEELQRSVTLRWQGLTTALEALTAASKLA
                     TTDNVCKVHIARGDTEMSRWRLAGPPWDYKVAQEYAATLLKNAQTYYRGAATLARRDG
                     AAEEQEASCKEAFAAALAGDESKLKQLKSAGSDKVLTVVQDMVEDGLVAPTDAEPLVY
                     "
     gene            complement(<265297..>267885)
                     /locus_tag="TRUGW13939_00080"
                     /db_xref="GeneID:55987597"
     mRNA            complement(join(<265297..265591,265678..266062,
                     266450..266732,266799..267302,267362..267563,
                     267629..>267885))
                     /locus_tag="TRUGW13939_00080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483295.1"
                     /db_xref="GeneID:55987597"
     CDS             complement(join(265297..265591,265678..266062,
                     266450..266732,266799..267302,267362..267563,
                     267629..267885))
                     /locus_tag="TRUGW13939_00080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339188.1"
                     /db_xref="GeneID:55987597"
                     /translation="MSLSDSALSAIMVAERTTSILSLVTTTFVIGTFLCSRSFRKPIT
                     RLVFYASWGNVMTNAATLVSRSGVLAGQYSALCLFQGFFIQWFMPADALWTFAMACNV
                     YLTFFRKYDASRLRSIEWKYAIMCYGVPFIPSFVYFFIKSDSKGPIYGSAVLWCWVST
                     PWDVLRIAVFYGPTWFIILLTFTIYIRVGLHIYRNRRLLHNFSSADQQGTIDSAFEIH
                     ASKVVRITSEAAHANGPKDTTAQAHGHGHGDLESERISGAAENYVRYSVTVERGDGIP
                     MAPIKQPVPPASAAGQNARNALTSAAAWAYCKYAILYFIALLVTWVPSTINRVYSLAR
                     PNSVSFGLELASAIVLPLQGFWNSIIYIAISWSLITKFLRRDRGRRSYAAGRRPLNFR
                     QMNRKHLKQSSGLASVGSSEESENFEMPSPAPDDRPSQQAANDNTPSAPVAVTPGPRA
                     SRFQDIYHKALRATVKANSYENFATCFPTPARYVPASLESVHRQLNAKLEEGATAEFN
                     EILKEREVVKGLNELDRLVGDARRRKDGGESESSVPPHMLGADGLYQAHLAPFLEHAQ
                     DSLNAKLETTQSQNAELADRIIAQRKEMESLLSGLEAVMADLEGSAKASTQYSKEHSL
                     RQKSMQVDEDIKKRTAV"
     gene            complement(<269641..>271047)
                     /locus_tag="TRUGW13939_00081"
                     /db_xref="GeneID:55987598"
     mRNA            complement(join(<269641..270527,270631..270919,
                     270982..>271047))
                     /locus_tag="TRUGW13939_00081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483296.1"
                     /db_xref="GeneID:55987598"
     CDS             complement(join(269641..270527,270631..270919,
                     270982..271047))
                     /locus_tag="TRUGW13939_00081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339189.1"
                     /db_xref="GeneID:55987598"
                     /translation="MSNTTSKFLPPFAPQQTVPTTTAKLSLEYFPPEVLALVLHQIPD
                     FDSLKSLVFSSPKFYYVYCRVRQEVLSSLLKRQYGDLLDIADGITAVRSKGLWLNFHE
                     EEAIALLDAWRRKEEIQDYAKNAPRPRWIQLEPTQWHQKILPLDLSDTEKPRFMRGLC
                     RLQIFFNIFGIREQCWFDKSPALEEENDWHLHTDYENHTLFWDIMFPWECEELGCVWS
                     YLTDKYKPISKEIATDLRNLVPNIECHLHWQSMSEEERPKRNTFVDVECYEAEYDGYF
                     EILMSVGLGFLYRVLNADRLLRRNLVIANSAFYSEDIAIPQWCSCWVNKRPRIPLNQH
                     DILEFEQLWSTLPSHEQPNIGWKVSWLVSHTPRRRLYWSFKENRERCKDWDWGYALWD
                     EERLEGWGEDWKATLFEPSAE"
     gene            <272316..>273162
                     /locus_tag="TRUGW13939_00082"
                     /db_xref="GeneID:55987599"
     mRNA            join(<272316..272593,272669..272917,272976..>273162)
                     /locus_tag="TRUGW13939_00082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483297.1"
                     /db_xref="GeneID:55987599"
     CDS             join(272316..272593,272669..272917,272976..273162)
                     /locus_tag="TRUGW13939_00082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339190.1"
                     /db_xref="GeneID:55987599"
                     /translation="MDVYRWNRGPKPKHHLSDTEGDLAGRPRGRKAEKGYLLHLKADN
                     HTIGYEIPSATKSTIALDISESTGHYAPIPAPDHHGPNFEKGPLQAEIRGRAHSVHGP
                     IFHHRLQSRYKIIPEKWTPQMDAEYHEYKRLSNAERVHKKAIGEANRDLPADDREKAI
                     IEAISHAKAAENQGKLTAQARLGFAQKYPQSYLKNGIGSHKEEIENREKSIKRLAERR
                     KVLNDILYRWVLADFEGWK"
     gene            complement(<273870..>274980)
                     /locus_tag="TRUGW13939_00083"
                     /db_xref="GeneID:55987600"
     mRNA            complement(join(<273870..274790,274857..274880,
                     274936..>274980))
                     /locus_tag="TRUGW13939_00083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483298.1"
                     /db_xref="GeneID:55987600"
     CDS             complement(join(273870..274790,274857..274880,
                     274936..274980))
                     /locus_tag="TRUGW13939_00083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339191.1"
                     /db_xref="GeneID:55987600"
                     /translation="MDKPQQPSSFQQLEKLGEGTYATVFKGRNRQTGEMVALKEIHLD
                     SEEGTPSTAIREISLMKELKHESIVSLYDVIHTENKLMLVFEFMDRDLKRYMDTKGDH
                     GSLDYITIKSFMHQLLRGIAFCHDNRVLHRDLKPQNLLINKKGQLKLADFGLARAFGI
                     PVNTFSNEVVTLWYRAPDVLLGSRTYNTSIDIWSAGCIMAEMYTGRPLFPGTTNEDQL
                     QKIFRLMGTPSERSWPGISQFPEYKPNFHVYATQDLRLILPQIDQLGLDLLTRMLQLR
                     PEMRISAADALRHPWFNDLPQLQAQLQQQQQHQHQQSQMAAGYGKIVAAQPGY"
     gene            complement(<275399..>276538)
                     /locus_tag="TRUGW13939_00084"
                     /db_xref="GeneID:55987601"
     mRNA            complement(<275399..>276538)
                     /locus_tag="TRUGW13939_00084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483299.1"
                     /db_xref="GeneID:55987601"
     CDS             complement(275399..276538)
                     /locus_tag="TRUGW13939_00084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339192.1"
                     /db_xref="GeneID:55987601"
                     /translation="MSPLRIPYTNPLPPAIVFPKTASSVAGAIDAVAAFFSAPPSPFL
                     QGVDVGKNGQTVFLTGAGISVASGLSDYRGENGTYVRNKTYRPTYYHEFVTRHESRKR
                     YWARSFVGWPGLVKAKPNSTHRAIAELAAKGYISCVVTQNVDSFHPAAHPGLATIELH
                     GFLRSVVCINCHNQLPRHEFQQALTRLNPAWADFLHEMLESGALDTNNREEQQRRGLK
                     LNPDGDVDLPHAPYSHFRYPACPHCLAHPPVLKDGSRGLVETESDGAWASPSTAGILK
                     PAVIMFGESTSPVVRTAAEEAIDDAGRLLVMGSSLATYSAWRLVERAHHRGMAIGIVN
                     VGGVRNESRLFGELLGERYMQNHVRCDHKSEMVLPEVVSRLPPLV"
     gene            <277373..>278598
                     /locus_tag="TRUGW13939_00085"
                     /db_xref="GeneID:55987602"
     mRNA            join(<277373..277925,277976..>278598)
                     /locus_tag="TRUGW13939_00085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483300.1"
                     /db_xref="GeneID:55987602"
     CDS             join(277373..277925,277976..278598)
                     /locus_tag="TRUGW13939_00085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339193.1"
                     /db_xref="GeneID:55987602"
                     /translation="MTAQKRGHAGHGHHHHHHDNVYLTSKNKNDAGVRITRIGLLVNL
                     AMAIGKFLGGYIFHSQALIADAYHALTDMVSDFMTLGTVAWSLKPPSERFPNGYGKVE
                     SLGALGVSSLLLCGGVFMGLNAGQVLLSQFYPEAFETLQHAGLLVHAHSHSHSHDSEV
                     VGPNINAAWLAAGSIVVKEWLYRATIKIAKERKSSVLASNAMHHRIDSLTSVVALATI
                     AGAHVFTNASWLDPVGGLVISLMVIQAGWGNTKTALLELADTTVDDEIKDSVRRAASK
                     ALAQSPVPGHVEIRDIQGMKSGQNYLVEIEVAVPGSWSVQQFRQLEETLRERVGSKVR
                     GVRRLKVRAVPQELQGISFTEEFIPGDVSPRSSPEPEEDENHSHQHNSNSHESHKRR"
     gene            <279092..>280898
                     /locus_tag="TRUGW13939_00086"
                     /db_xref="GeneID:55987603"
     mRNA            join(<279092..279592,279663..>280898)
                     /locus_tag="TRUGW13939_00086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483301.1"
                     /db_xref="GeneID:55987603"
     CDS             join(279092..279592,279663..280898)
                     /locus_tag="TRUGW13939_00086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339194.1"
                     /db_xref="GeneID:55987603"
                     /translation="MASKGPLYIGFDLSTQQLKGLVVSSDLKVEYEAKFDFDAHSHGF
                     DIKKGVMTNEAEHEVFAPVALWLQALDWVLSTLKDQGLDFARVKGISGAGQQHGSVYW
                     SRDAAGLLQGLDKTKTLQDQLEGAFSHPFSPNWQDASTQKECNEFDAYLGGPEELAQV
                     TGSKAHHRFTGPQILRFQRKYPEQYKQTSRISLVSSFLASLFLGTIAPFDISDVCGMN
                     LWNIKQGAWDGRLLKLCADTSGVDDLKQKLGDVPEDGGLHLGKIHKYFVERYSFNPDC
                     TIIPFTGDNPSTILALPLKPSDAMVSLGTSTTFLMSTPSYQPDPATHFFNHPTTPGLY
                     MFMLCYKNGGLAREHVRDAIDKKVGESVPSGSWANFDKALLEAPAMGQKSASDLMKMG
                     LFFPRPEIVPNLPSGQWRFNYQPQDKSVTETTAGWDQPLGEARAIVESQFLSLRLRSR
                     GLTTPPAKGLPAQPKRVYLVGGGSRNKAIAKVAGEILGGHDGVYKLDVGENACALGAA
                     YKAVWGIERQGNETFEDLIGKRWREEEFVEKIADGYQPALFDQYGSAVEGFDRMEKQV
                     VQEEESRRRRGN"
     gene            <281630..>284913
                     /locus_tag="TRUGW13939_00087"
                     /db_xref="GeneID:55987604"
     mRNA            join(<281630..283250,283311..284336,284388..284833,
                     284887..>284913)
                     /locus_tag="TRUGW13939_00087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483302.1"
                     /db_xref="GeneID:55987604"
     CDS             join(281630..283250,283311..284336,284388..284833,
                     284887..284913)
                     /locus_tag="TRUGW13939_00087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339195.1"
                     /db_xref="GeneID:55987604"
                     /translation="MPPSSVPRLTPSKKIQVANAIEIASNPASEHSFKTQAFEYLNQL
                     RSDPSGWQVCLAIFTKTPRHSDIVRHVALEVVNSAAQAGIIDLPGLQYIKDGLMEYLR
                     QAYGSEGSTSDGAAIQNKIAQTITYLFSALYSNGWESFFDDLLGLASTNPSANLRDNA
                     LGIIFYLRVVNSIHDEIGDVLVSRSRVEQEKANTLKDLIRQRDMQKIVGSWQDILTQW
                     QDSNDQVVELSLKAVGSWVSWIDIGLVVNQTMLDLLFQQLSRAQKSDLRDGEEKLRDG
                     AIDVFTEIVGKKMKPEDKIDMIIFLNLDGIVSQLSGSPPLNENRFTSKYDTDLAETVA
                     KLVNIIVSDIVRVMDNDGVNIETKEKANTLLQSFLVHVLRFFSDDYDEICSTIIPCLV
                     DLLSHVRKVAKSHPETKNQHAPMLLPILKAIIAKMRYDETSSWGDEDDQTEEAEFQEL
                     RKRLHVMQQIIAAANEELYMDALSEVVGTTFENLRQTGGQLDWRDLDLALQEMYLFGD
                     LAVKSGGLYNKNKPNSPAAERLIEMMTRMAGSDIRCFTHPATQLQFMENCVRYSSFFE
                     HNTHLIPSVLESFLQFAHHPMKRVRTRSWYLFHRLVKSVRFHIGDVAQTVIEAVRDLL
                     AIHAELPSETEDGDDMSSADHEGSADAFFTSQLYLFEAVGSLCSSQAIPGDKQVLYAQ
                     SVMNPIFADMEQILAIAKTGDERSLLQIHHDIMALGTLARGFLDWVPGTMASNRPSTV
                     EISDAFGQVAEATLVALESLKTYFNIRTAARFAFSRLIGIVGLRILPQLPRWIDGLLT
                     ETSSKDEMALFLRLLDQIVFGFKTEIYSILDTLLTPFLQRVFAGISDTTSGTDDEIQL
                     AELKREYLSFLLALLSNDLGSVIVSQSNQSIFDTVISTIEHFIRDVDDYTTAKMAFTV
                     LSRMAVVWGGSETAQNGVTASQGAIPGFNQFMFTRFSSLCWVLPSSSGFNPKDALARQ
                     VLGEAGGLQQTIYTKAGTEYADYLRSQELPGVGMGPELVEEYVNALSQFDAKGFRAFF
                     LSFIQRFSS"
     gene            complement(<285650..>301444)
                     /locus_tag="TRUGW13939_00088"
                     /db_xref="GeneID:55987605"
     mRNA            complement(join(<285650..285835,285902..286380,
                     286452..286718,288896..288907,295102..296730,
                     296785..>301444))
                     /locus_tag="TRUGW13939_00088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483303.1"
                     /db_xref="GeneID:55987605"
     CDS             complement(join(285650..285835,285902..286380,
                     286452..286718,288896..288907,295102..296730,
                     296785..301444))
                     /locus_tag="TRUGW13939_00088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339196.1"
                     /db_xref="GeneID:55987605"
                     /translation="MALKTAPADASLVDSVKEAVKSAASCTPSTVSSLQSLLRCAKPV
                     VEKGRPNNKTTKSSNVTTASATNTVTRTKSTRQIAAKVAVYQSSDDVKNDDELSVQER
                     LVLATEVFNAASKALSDALASQKSPLKPASPNQIVSTPTKSKTNKTATDSSAEGVVSV
                     SECASLALANLRTLKNDKTGANGYPNIQLEQGACVVAGRLIALGLNKLAYRELKGLKK
                     RLQDFLQSKPTNSAKKATSRSVGDAQREALGTEQSAELLVFQNIGNAGPVLNVLVPFQ
                     STVLKLVLSEAKTSTVEQTCSVLALSNSSSPANIILRSLETGNLKEEKAALQLLSLSN
                     SISSLSSLMQKSNGTNTSSAKRNTQSLLTLTLQLSSMEVRLIAWELSGHNIEQKREFW
                     DPVLRSLEAFSKSGLKIQRSDFVTIYTTVQRLKSKMKKDKVEKGATPWKINLALGRIA
                     QDASCLEDALKLFSNAIDSAAVEQPLAINVIQCRVAFIHLCLCRNMQGYSLDVVSKSL
                     SAAAAGLKSSNKGSAHDLEELVVESAKLKKLAMANVGEFISSNSKSNDDVIGSTVDFL
                     HAFIRFLRRYIGRQAPDEDGDKSQLQAMLCRMKTIILAAVDSAVALGKTSVLRQVPHW
                     EYLQPILSDSRRLLNNLENIDDDSPDDEASWSTAIVKLSNVYWSRYLKEKEAGQGYKE
                     LIPLLDQSASLLQTCPPAQRAAGFAALKFERLGHLYLEARMGAKSMACLERSTQEHID
                     SGVLQQHMEYLTGKPPLNPHDSQSPGFILGRVLSSYLKVQVRRPENDEKCVFDNKALS
                     PEERGTLFEWQMAILAETHSHEADTTPFREIFQTLVSETLCLYSAEHYPVRRLRVIRF
                     VLRFILDHPNSVENVVTESLIRDAELNMYSHSTLEEDAELEPFLPHIQNSLTLAVSFH
                     KGEPELDELRDIVASWASTMRKCRNPESFGSAVDDCDHWIAQVKALSDYLDARGYWKL
                     YLATSEIILHVLELQPILDESSILMTLSHCALQYCRRGDCKTSIELLDRAQQYIDSHR
                     VSIYASVSYHLARSEYYLEIGDADSSEQALASAQQLYQSRGSETDPSGSRSQSKIGWE
                     RLVVDGTLLFSRIAYHRQNLETALYYAKLSVRLSMRLWAKLERLSDRKRESDQLATKE
                     TSEMDLVIDRVANLDIGTVTTPSYNFVEGAVYWSHVASHNACFLNLMRLSAHNGLFQD
                     AIYYGEQALKVNKALGASFRLITCQAELGLEWIRGNHLSEAKEVLQAAMELSENLVNS
                     IEMVKLKISLAALSRGEGEHDKALRLLQDASTLLDRVSEVKLDSSLLIKPLTTSLEGK
                     MANLKIRQASVQKESELLKTRRSQRTKTPSKSALKEELDTVASKTSVYSQSIINLKNE
                     IVRQQIHNLLAIQDLDEASRLLEAARASPFPTASQISIQIEEVEHIVADAMKNIATHA
                     VYCVLPESTLSVPSIEAVIEAMKSPATKQTAPVKRSKSTAKQPRGRNTKTVNEEADIA
                     KIMSHAKIAISETVKSAVASGSTIEGHAASCLMGRISMLLHATTPGLVDKDILTPVNA
                     NELGRITAFDRERLAIGIDKKLSAFIDTTSWPSFTSDVFEGRSDIITNFSRDYVDILP
                     NDWNVLSVSLNSDRTEFVISRMRQGDTPFLLRLPLKRGDEGDADEDDFTFDWGKNEMK
                     EIIKLANASAHDAKTRVDRQSKKDWWTTRETLDRRLETLLENMENIWLGGFRGIFDPT
                     PRDSSRLSRFARSFEAVLDKHLPSRRKHGNKKEKIKVHENVLGLFVGLKDLDEQENPE
                     DSLTDLLYFVVDILQFQGERNAYDEIDFDMMVIDTLDALNAYKSSTPQTIEPPNHTIL
                     VLDKSLHSFPWESLPCLQGLPISRMPSLECLRQRIAQFRTTMEEPSEEFYVNRNSGSS
                     ILNPSGDLKTTQNTFDKELSKLSGWSSITERAPSEQEFKSALKDKDIFLYFGHGSGAQ
                     YIRGRTIKRLDKCAVTFLMGCSSGCLTETGELEPYGTPMNYMQAGSPALVATLWDVTD
                     KDIDRFANCTLEKWGLLERDASEPKEEETRKDARSKKSSKGKEVARAQPTSESHALDE
                     AIATSRDSCLLKYLNGAAPVIYVLLEAMAVTTKASIASFGGKLLKLSHNATTTKCEMN
                     FNLYLPPQAIAQPDKKVPLLIYLSGLTCTADNCSEKGFFQHGASKHGIAVLYPDTSPR
                     GLKIQGEDDAYDFGTGAGFYVDATKAPYDQGYNMYSYVTEELPQTVFEAFKEIDSSRV
                     SITGHSMGGHGALTLVSFLITCKLGFNEYVENNILAKFLRNPGKYKSVSAFAPITNPS
                     NCPWGQKAFNGYFGEDNQEKWKEHDASELVKKWKGPLNVLIDVGTADNFYKQGQLLPE
                     TFEKAAQEAGVTGLNVRYQPDYDHSYFFMATFSDDHVEHAAKYLFA"
     gene            <301716..>302457
                     /locus_tag="TRUGW13939_00089"
                     /db_xref="GeneID:55987606"
     mRNA            join(<301716..302187,302267..>302457)
                     /locus_tag="TRUGW13939_00089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483304.1"
                     /db_xref="GeneID:55987606"
     CDS             join(301716..302187,302267..302457)
                     /locus_tag="TRUGW13939_00089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339197.1"
                     /db_xref="GeneID:55987606"
                     /translation="MSALTITGRRSAFLLPSISPWRTLQPCKITIPSPATHARLRSTT
                     ESLPRIAQTSLWTSMVPKFLRNRGSQSTTEQKQSATSAEWNPATFYIIIFILIGSQAI
                     QMLVLRKDVENFGRQADAKIRLLNEVIQRVKNGEEVDVEKLLGTGNESKEREWEEVLR
                     EIEEEDSLWRQKSGKSSNPTTENKSQDKSPKSTRNDSDQPQSANSAHSSADTTAKEAR
                     FY"
     gene            complement(<303143..>305400)
                     /locus_tag="TRUGW13939_00090"
                     /db_xref="GeneID:55987607"
     mRNA            complement(join(<303143..303690,303739..303901,
                     303955..305148,305221..>305400))
                     /locus_tag="TRUGW13939_00090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483305.1"
                     /db_xref="GeneID:55987607"
     CDS             complement(join(303143..303690,303739..303901,
                     303955..305148,305221..305400))
                     /locus_tag="TRUGW13939_00090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339198.1"
                     /db_xref="GeneID:55987607"
                     /translation="MTKVTEAVKATLVGTEEELGLSHQIKANFIQHAQKDETSGELYM
                     TEDNFVNAIAPNNQDYHKIRRDQYGILFQVADRRKTGRINITDWAAFENLLAKPDAEY
                     EIAFRLFDVDGTGAVKFDSFKQLYDQNKGNESIPFDWNSEWASLYIGRKKTRHDMTYP
                     QFAQMLRGLQGERIRQAFHLFDKDGDGYIAPEDFQRIILETSRHKLSDYLLEHLPTLC
                     NISTGSKISYANVRAFQNIIREMDIIDVIIREATKKSPDGKITRTEFLNEAARITRFS
                     QFTPMEADILFHFAGLDAPSGRLSLKDFAKVIDASWQTAETSLSLATDTAAKQVAKKT
                     SSLLHSVLESAHHFALGSIAGAFGAFVVYPIDLVKTRMQNQRSGRPGERLYNNSLDCA
                     KKVIRNEGFLGLYSGVLPQLIGVAPEKAIKLTVNDLVRGYSTDKGSGKITLPWEVISG
                     ASAGACQVVFTNPLEIVKIRLQVQGELAKSVEGAPRRSAMWIVRNLGLMGLYKGASAC
                     LLRDVPFSAIYFPTYAHLKSDFFGESPSKKLGVVQLLTAGAIAGMPAAYLTTPCDVIK
                     TRLQVEARKGETKYTSLRHAASTIWKEEGLKAFFKGGPARVVRSSPQFGFTLASYEVL
                     QKLLPLPGSEDTSPPLSTVETSSVPSTSAPLPYLRSRNALKLILDLDENFGRIRIPEG
                     ASLPKLFGRPQN"
     gene            <305557..>306039
                     /locus_tag="TRUGW13939_00091"
                     /db_xref="GeneID:55987608"
     mRNA            <305557..>306039
                     /locus_tag="TRUGW13939_00091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483306.1"
                     /db_xref="GeneID:55987608"
     CDS             305557..306039
                     /locus_tag="TRUGW13939_00091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339199.1"
                     /db_xref="GeneID:55987608"
                     /translation="MEKRLTGAQTKARQIQGRRRKNCVEKKKKEKGAQTISTRIAWGG
                     GEERGQNLFRAAGGDAAAASLGGHRLARLAFLAASTSASSPGPVWSWLLPPAVYDATT
                     DHAVCLQPTTAPRSRPLHDFSHGHRANNAETKQRKTTRNDRTGCRESAVSPTAPAIDS
                     "
     gene            complement(<306876..>308235)
                     /locus_tag="TRUGW13939_00092"
                     /db_xref="GeneID:55987609"
     mRNA            complement(join(<306876..307237,307292..308088,
                     308144..>308235))
                     /locus_tag="TRUGW13939_00092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483307.1"
                     /db_xref="GeneID:55987609"
     CDS             complement(join(306876..307237,307292..308088,
                     308144..308235))
                     /locus_tag="TRUGW13939_00092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339200.1"
                     /db_xref="GeneID:55987609"
                     /translation="MSPAFSEWRKLPISLSELCINTTLRCGQSFRWRQLPESDEWRCV
                     LRGRIISLKQDPSHLYYRSYAPQPTLPTPPASTPSSHAGLKSDSPVKDSNADETLAIV
                     THYLNLTSNLTELYTQWSDSDPNFKKKAPNFTGIRILRQDAWEALVSFICSSNNNIAR
                     ISQMVEKLCINYGDPVGTIDGYSYHDFPRPEALTGEDVEGRLRGLGFGYRAKYIYQTA
                     VMVAKDREKGWLDSLRNPESPAFGVEPSPGGDMKPEGREGYRDAHEKLLELQGVGPKV
                     ADCVSLMGLGWGEAVPVDTHVWQIAQRDYKFGKGGNKSLTKATYDAVGNHFRKLWGQE
                     AGWAHSVLFTADLRSFSERLTSKVEVKIKQEDDAAPVESQRASASIVTTKRPPDDDSD
                     TKEELVVEAAETTGTRRRSKRRRT"
     gene            <308678..>310760
                     /locus_tag="TRUGW13939_00093"
                     /db_xref="GeneID:55987610"
     mRNA            join(<308678..308705,308767..308792,308853..309432,
                     309485..310089,310140..310401,310458..310669,
                     310734..>310760)
                     /locus_tag="TRUGW13939_00093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483308.1"
                     /db_xref="GeneID:55987610"
     CDS             join(308678..308705,308767..308792,308853..309432,
                     309485..310089,310140..310401,310458..310669,
                     310734..310760)
                     /locus_tag="TRUGW13939_00093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339201.1"
                     /db_xref="GeneID:55987610"
                     /translation="MNGDAYSSRDSGRPRDYYRDERRDRGDRGDRGERGGRGDRERGE
                     RRRSRSPHYGSARGSRREQEADSYSSSRDYRAREREDRYSGRRDEREWDRDRGDRSER
                     GDRGGGRGDRGDRRRRDFDDRASRRDRERGDRGDLFEERPRRREREGRGGGGGGGDRE
                     QRRSNSPPRKREPTPDLTDVVSILSRKRRLTQWDIKPPGYDNVTAEQAKLSGMFPLPG
                     APRQQAVDPSRLQAFINQPGSADNSALKPANSRQAKRLFAHNFPSTVTEDGIVSFFNL
                     QLNGLNVILGTDPCISAQIAKDRSFALLEFKTPNDATVALALDGITMAEHDAMETANG
                     SAKGLELRRPKDYIVPSLPEDQQVQEGVISNDVPDSANKICVTNIPTYLPEEPVTMLL
                     KSFGELKSFVLVKDSGTDESRGIAFCEYIDPTATTIAVEALNSMELAEKHLKVTRASI
                     GATQASGLDMGVNAMSMFAKTTSSDLETSRVLQLLNMVTPEELINNDDYEEILEDVQE
                     ECSKYGQILDLKIPRPTGGSRQSAGVGKIFVKFGDVDSATKALKTLAGRKFSDRTVVT
                     TYFSEESFEVDAW"
     gene            complement(<313994..>315591)
                     /locus_tag="TRUGW13939_00094"
                     /db_xref="GeneID:55987611"
     mRNA            complement(join(<313994..315315,315374..315457,
                     315519..>315591))
                     /locus_tag="TRUGW13939_00094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483309.1"
                     /db_xref="GeneID:55987611"
     CDS             complement(join(313994..315315,315374..315457,
                     315519..315591))
                     /locus_tag="TRUGW13939_00094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339202.1"
                     /db_xref="GeneID:55987611"
                     /translation="MTSSSKNGICPAPFLQESLFNTTGYANGRFCKDYGGQVCCLPCP
                     LQDWRYPDGVNAKVEAAGWIAVALLPFSAFLLLTYAVLPVKYTNRHYITVCFTLAVIC
                     MQVAFIIPLGTKPETCYDEITPHDMYTDLSCAFTGAILLFGGIAVVTWSLLRTIALHL
                     QVCWEIVIGPVFMWCAVVAGLGVPVLITALMLHFTGVSYRFGGVCHINSENSLGDYWI
                     PLLVFSGLALFLQFATIGYCIHIYVRSLFDPDPTSTNHSGLPSYSGSVRTATARQAYK
                     RVRRVLKMQWRSIALVMTILANVIYFSVIFVQLNNSLTLSSENKAKAIPWLLCLAAYQ
                     DPTKCTAESAPVAISEAKLVATMVLLAIANFWNFLFTVRWSMVQGWIALFKGFFVERV
                     EFVSVDARSRPADTSNYEMLNPRQNMKTPETVVEVRSPSPAYGLGPSEVDFVGRDVSY
                     HQPTMSFSSPRPPSSSQHNPGYTWDATTSFARSNSQMEQRNL"
     gene            <318227..>318520
                     /locus_tag="TRUGW13939_00095"
                     /db_xref="GeneID:55987612"
     mRNA            <318227..>318520
                     /locus_tag="TRUGW13939_00095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483310.1"
                     /db_xref="GeneID:55987612"
     CDS             318227..318520
                     /locus_tag="TRUGW13939_00095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339203.1"
                     /db_xref="GeneID:55987612"
                     /translation="MLTRAFNLVSAAADRPHEVTGDADDPQTRGSSGGLVAASTDPFG
                     NTDDLRCFGTCLKSTWLIDRAIRRRQIATNADAVVRSNDFYIGLDRPACAGST"
     gene            complement(<318673..>320235)
                     /locus_tag="TRUGW13939_00096"
                     /db_xref="GeneID:55987613"
     mRNA            complement(join(<318673..318888,318946..319086,
                     319154..319873,319930..>320235))
                     /locus_tag="TRUGW13939_00096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483311.1"
                     /db_xref="GeneID:55987613"
     CDS             complement(join(318673..318888,318946..319086,
                     319154..319873,319930..320235))
                     /locus_tag="TRUGW13939_00096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339204.1"
                     /db_xref="GeneID:55987613"
                     /translation="MSDAIPFHPSDPSRTRVIIVGAGLGGLACAMAMHHAGFEVVIFE
                     KVREFLRLGDSLGLGENALKLLQRWGLYEELIAIGNKSPNMNIRRWNDGRILATQPLM
                     DMAGYIGHRGDYHVAFINRVKQLGIEINMGYEVVAFDEDAPSITLQDGRTYYADLIVG
                     ADGIKSKARELVLGFSDAPRSSGYACYRAFFKGDILKDIQPCQPLLQKDCVNIWIGED
                     KHLVQNTLQDGKEFNWIITHKDTEDIQESWFQPGNMDDVRELVQGWDETIASAIKATP
                     SCLDWKICYRAPLPTWVSKSGKIALLGDSCHPHLPTSAQGASQATESSAVLAFCMKLA
                     GKGNVPLATRVYEKLRFDRVRQAQLSGEDLRNRWHNALKHLNDGEEFDPDDIKIKNRW
                     LYPYDAEADTLARWSEVSARTQVELDSGKITPLFGEEGPPRVLTVRDAYGKIKDAASG
                     ENSVLPGLTV"
     gene            complement(<320911..>322233)
                     /locus_tag="TRUGW13939_00097"
                     /db_xref="GeneID:55987614"
     mRNA            complement(<320911..>322233)
                     /locus_tag="TRUGW13939_00097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483312.1"
                     /db_xref="GeneID:55987614"
     CDS             complement(320911..322233)
                     /locus_tag="TRUGW13939_00097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339205.1"
                     /db_xref="GeneID:55987614"
                     /translation="MRGFISFISLLLATRVCSYVVTYNNTCEIYPESLHHDGKDIDDA
                     PSILQAFDICGKDGNVIFTNHTFNVNSVLNTTNLVNCDVSLQGELKFSTNITYWRENV
                     FSVIYQNQSTAWLFGGENVTLRGEGGWINGNGQTWYTWNKNKGNQFGRPISITFFNST
                     NLLADGLTILQPQFWATLVWQSQNVSLTNFFVNATSDDEWDTTNTDGYDSWRSDNLRI
                     ENATITNGDDCIAAKGNTTNLLVRNVTCHGSAGITVGSIGQYPDWPDYVQNVTFDNVH
                     CLGCADGAYIKTWQGVPTDHDSNGDSGGGGGGLVKNVTFSNFDLEHVGLPIQISQCIY
                     SESDSKNCNTSKLQIEDVSWVNFTGTSRYNIAASLYCSDEVPCPGIKFDNVSIQSVNE
                     TLGLPLWNTTLQDEVYQCTNLVGQNSSGIPCNHVAPNNYSQTVRENVK"
     gene            complement(<322932..>325453)
                     /locus_tag="TRUGW13939_00098"
                     /db_xref="GeneID:55987615"
     mRNA            complement(join(<322932..323508,323568..323781,
                     323844..324099,324164..324270,324332..324591,
                     324656..325283,325348..>325453))
                     /locus_tag="TRUGW13939_00098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483313.1"
                     /db_xref="GeneID:55987615"
     CDS             complement(join(322932..323508,323568..323781,
                     323844..324099,324164..324270,324332..324591,
                     324656..325283,325348..325453))
                     /locus_tag="TRUGW13939_00098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339206.1"
                     /db_xref="GeneID:55987615"
                     /translation="MADTPADFGAAKGSSPAPTRRDSQTAEKVSRACDNCSYSGSKSK
                     SKCLLRPGSKTCENCRFLDVACTFNRTVKKRGPPKGYVNTLEQRLASLESIVTELRGG
                     HAVASDNSPEELLLPTPTSNNGYKNKQQVHEEDFNQPMDQPGIPIPTKSLVQKIDSTS
                     EKSTVLGYLSIDENTTMRYHGPSSGLYLMTASRVFASPFWQFSNPGFWPRSKNTTFRT
                     EDEIVSAADAILGGILPSLAVQNKLLDAFWAYVHPYFPTVHKETFLFQLSKDRRGIPR
                     QGSSALDQLERRIPQVLLLSMFALSARFVEHRGGREDSDPGDEYAIKAETLIAQHKQS
                     SINCCLALLMMAYREIGTGGSISWMYVGNAIRMSQDLGLHRDPTVWKNTNCFRNMSTV
                     EIQIRRLIWWGTFVLDRYISAWQGRPCAIHEDDFDTQLPNDSPHGTRDVPLACFAQVI
                     KLSIIQGRIHREFYSVGSKGLDWSKLHEFENNLNEWEAQIPDFLAIRQGVRLPVPVIV
                     MHSQFWNCKVLLHRPFITHDSNEPQTNNSSLLAATSAAVAIANLLEHFTSSYSASFAP
                     PFFNYYSFTAIIMHLFNRATYPVLFSPSALTHCTDCCRKMSSIWSSAVRTLHIVEGID
                     HEIDHILPGSTAMYTAATAGNQHMASASASASGPSSGMTAVLNPENHTGADDQDAANF
                     CFTSWPSPIVDPDWLSLETWRADGADVDEVTML"
     gene            <325749..>329437
                     /locus_tag="TRUGW13939_00099"
                     /db_xref="GeneID:55987616"
     mRNA            join(<325749..326035,326109..326515,326568..326593,
                     326648..327080,327131..327773,328210..328283,
                     328444..328732,328785..328855,328925..328957,
                     329217..>329437)
                     /locus_tag="TRUGW13939_00099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483314.1"
                     /db_xref="GeneID:55987616"
     CDS             join(325749..326035,326109..326515,326568..326593,
                     326648..327080,327131..327773,328210..328283,
                     328444..328732,328785..328855,328925..328957,
                     329217..329437)
                     /locus_tag="TRUGW13939_00099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339207.1"
                     /db_xref="GeneID:55987616"
                     /translation="MAPKNTVPPVPVLTDSHHSGVSSRLAEGANAAKERVWYNKTASG
                     VTARHGELPVLPPGIERSRFNTAIDELRSILGPQHVAINDMPLDDGWYLEHPNTHDAF
                     HLLDPNDTVSSAAAYPGSTEEVSSVVKWANKYEIPLWPISMGRNLGYGGAAPRVRGSI
                     VLDLGKRMNQVLNIDGEQCSCLVEPGVSYYKLYEEVQKTGHPLWIDPPDLGGGSVLGN
                     AVDRGVGYTPMGDHFANHCGFEVVLPTGEVIRTGMGALPGPNGSDNPTWQSFQYGYGP
                     YIDGIFTQSNFGIVTKMGLWLMPKTEHLTYMVTFPRDDDFEEIIEIIRNLMVNKVLGN
                     VPQLRHVIQELAVSGKNREEFYRGKGQIPRDVIREHAKKLACGDCSWVFYGTLYGSTQ
                     KQIQETLDIVKKAFGAIQGTRFLFPEDVPADHYLHSRVNVCSGVPEIRELEWLNWKKN
                     GAHLFFSPICPTKKRDARKITDIAIRVHEEFGLDLFPTFCIAPREMHLIVNIVYDKSD
                     PDEKRRSVAAIRKMINECAAAGYGEYRTHILLADQVANTYSWNNQALLRFHENLKDSL
                     DPKGILAPGRNGIWPKQYRGQGWELLGDSRNTSGLNLNSISIVEFFRRWMALKKVEVI
                     IPQSTSRPTFSGNTEQIVHNGSVSVYRIRSLSRVTSLLSRHPVLHLVAGANYHLSLHS
                     KGKGIAASAIPYSRTPPAWLKTTPDQVTDQICKLARKGATPSQIGVVLRDSHGIAQVR
                     NVTGNKILRILKSSGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDGKFRLILIESRI
                     HRLSRYYKTVGVLPPTWRYESATASTLVA"
     gene            complement(<329758..>332369)
                     /locus_tag="TRUGW13939_00100"
                     /db_xref="GeneID:55987617"
     mRNA            complement(join(<329758..330267,330334..331780,
                     331855..>332369))
                     /locus_tag="TRUGW13939_00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483315.1"
                     /db_xref="GeneID:55987617"
     CDS             complement(join(329758..330267,330334..331780,
                     331855..332369))
                     /locus_tag="TRUGW13939_00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339208.1"
                     /db_xref="GeneID:55987617"
                     /translation="MPSLLDFFETRRPAPKRVRLSDEGPQDSTLSSDGSHSTDRPKSE
                     DSPAPLIGSEHLTLLADATVGNDVGNEDSGLPKGSQTELETSLPLIETGQEAIEQYES
                     SKATAFEEKQPTLQQRLGERKWQKGRSSIYVDAFNLALETVLEDEAHLFDEPELEVFN
                     KWKNLSFEAQYLYVRLFLRKTAAWHRINRLGYYQDIADMPQAVADLRHVHALPPSTSP
                     GYENLTTSKPPTENKLDSSFRFAEGIEQINTLEEALSLLLLDELKTLAKEAKVQGKNK
                     AELLMALRQASQTQGGLAWDSDNCNRDDHFQQKILDITGDCIRLSPGPLKLFERVHLV
                     FYRSTEWTEKSLTTIILAKISRKNFPEYIVSRSTSIFPSRAALLEFEAALRIQFDIDN
                     ILEFSGTPTAERLNKIKDLSDNVYPRWQNLLEEEQQKEDSIYLSGEGAYLRRFSPAWV
                     YTRIIHKGLHPLARFKEHKREHELLIELLAQRFFHTSRRGSWYQRKALLEEHYMWALT
                     PNDDRSDESQKKFWKRAALKTCETGLQDPDCHIIFHYDLQKRVMKLEKSLKVVKREQH
                     DFGHVLLVKPEERKIEGIRIEKEEVLTRSEQKPNGDTSNATTRRGRPTVWVDEREDSG
                     ECRVENMCLSWYRDNGWKGYHSEGGIVRTLFGYLFYDILFTYVPNVFQTPFQTCPLDL
                     HTDAFYPSRASEINHRLVQIANGEAESIVLDVHEREFSKQTCVVGVDWTFPIDDLVEI
                     VQCFRGFALATVCKVMAQEYQQRGGGIPDLFLWSTEKKEVLFVEVKSENDRLSDTQRL
                     WIHVLTGAGIRVELCNAVAREVRYV"
     gene            <333182..>333522
                     /locus_tag="TRUGW13939_00101"
                     /db_xref="GeneID:55987618"
     mRNA            join(<333182..333363,333438..>333522)
                     /locus_tag="TRUGW13939_00101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483316.1"
                     /db_xref="GeneID:55987618"
     CDS             join(333182..333363,333438..333522)
                     /locus_tag="TRUGW13939_00101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339209.1"
                     /db_xref="GeneID:55987618"
                     /translation="MSSSATPIGNHADSHNPATSATGSLDTGLPTVAGGAPARLYMNE
                     KIVPYLLEGMKNVARDQPPNPLKVLGEFLIQKSNELEQGQNSAQ"
     gene            complement(<334775..>340148)
                     /locus_tag="TRUGW13939_00102"
                     /db_xref="GeneID:55987619"
     mRNA            complement(join(<334775..335346,335409..335755,
                     335828..335927,335987..336113,336618..337659,
                     337714..>340148))
                     /locus_tag="TRUGW13939_00102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483317.1"
                     /db_xref="GeneID:55987619"
     CDS             complement(join(334775..335346,335409..335755,
                     335828..335927,335987..336113,336618..337659,
                     337714..340148))
                     /locus_tag="TRUGW13939_00102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339210.1"
                     /db_xref="GeneID:55987619"
                     /translation="MAPLLQRKSSSARSMAPLRNPRGGNPVPTDGPPPKKRKYVPGGP
                     GGGGRFIEVDAVVEKKPPPTPALASIVQPNSVQSHSSPRPRREVTTINTPLPMTTPPS
                     TRPRRDRTQSRGRYSSSTAAALAIQQGDGYKPREERGWEEFHEDLDIEAKLMVFSAEE
                     VDGTTPQPLPNGQSLNSSPLPVDGNNPAAVAAAASSLSTPLGSQTPVKRKPGRPPRRP
                     DAMLRALLTPEQPKAVPLPGPNPREKLTLPTPNFHLRDPFDRYEHKGIGQQNYVDRTM
                     ASVGYQETDLFVRHDRRLIRMAEGAIEEDLDLDPPTTDGETNAAIGSLGVGRVEYDMD
                     EQDEKWLEDYNFKRRDDQLEPIKPAVFEITLTKIEKEWYALEKKIPKPNPKPPQTQRP
                     RSSSAAAVNGEPVGAGEEQDSKCAVCDDGDCENSNAIVFCDGCDLAVHQECYGVPYIP
                     EGQWLCRKCQLIGRGSPNCIFCPNTEGAFKQTNTSKWSHLLCAIWIPEVGIGNQSLME
                     PVTDVEKVPKSRWKLQCYICKQRMGASIQCSNKNCFVAFHVTCARRAQLYLKMKAGHG
                     NSAIMDSHLLKAFCHKHVPPDWRKEHGTDMAYAEAVDYYKNTMDGKRWGDSQASALAL
                     GPSLPDGAELAESQLYPGPNLHLTFNAAGNKRKRAAVPRTIWKLPSGAPVIPQTVLNS
                     VVASLQRFAVRQRKQYAEDACKYWTLKREARRGAALLKRLQLQLETFSSMEITRRNFV
                     AMGPIGRSRLQRRIDFAERLSFDVDKVRVLSENVKTRETQKLEDVEMLRNIVDTVYFP
                     IPPLLWPIFEKVYALDPRGVFAPSLQAVKARLESRFYTTVATFSADLAHIFTNEIGVQ
                     PAEDTAELQMQMGGRAPELSLDQREKRKLAKRIIKSIQPSLEDAIRKESELSGRPFEK
                     ELKELDAIFESGVLSRRVSVIEATDLEFHSGDASANGTLEAEAADQLSVTKAQSPEDS
                     VVVKKDVDVPMPDADTQEGVPFANDESEKKQTEPNGITVAAPSHEPSSNGDVPAGVSA
                     TAPEPTSHGLVKKDNGPRNRVIGPNNPLTPPLSSQGDQQQGPLAQGGIQWYMQPFDPI
                     GTTIHEERWTGRDVMRGMSEELSELDEDELEGLVDNEGKTGLGLSNGVSSMANGTASE
                     PVKVHRTRHRRRERGLFSLAIISALLCSIFPSTQPPSHPSKMSAMEYENENGHYDDDR
                     RYDRDRSASPRGDSRADRDRSLSPNGRADDRAPVGEPRKDEDEEGAVNPGSNLFVTGI
                     HPRLTEADISRLFEKYGDVENCSIMLDPHTKESRGFGFVKMVTGEQADAAKEGLQGEV
                     IEGRTLSIEKARRSRPRTPTPGKYFGPPKREVRRGPSRGGRDRYDDRRGYGGGGGGGS
                     RRYDDYRYGRYDSYGRRGGDYRDEYGYRGGGGSGGGGRDYGRDYNRDYGRRDEYRDDY
                     AYRGGGSSGGDRYASREERYPRGEERRGGGGGGSGGGGSGAGSGAPAAAGSGEERRSG
                     GSGGGYYDRDASAPSYEQAPRENRDQYSGGGGRSYEGRGEERYSAR"
     gene            <340588..>341327
                     /locus_tag="TRUGW13939_00103"
                     /db_xref="GeneID:55987620"
     mRNA            join(<340588..340610,340715..340935,340998..341180,
                     341236..>341327)
                     /locus_tag="TRUGW13939_00103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483318.1"
                     /db_xref="GeneID:55987620"
     CDS             join(340588..340610,340715..340935,340998..341180,
                     341236..341327)
                     /locus_tag="TRUGW13939_00103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339211.1"
                     /db_xref="GeneID:55987620"
                     /translation="MSGPGEDRWRGGRPFDNRQPTQRNATLGSRDRAAGSRGAQNANQ
                     SSAWSGPREQNAPGLSQERHVSVKSFNAAECKAALKPAPSRAFSLPTFQSPVFRPEMM
                     ASVTDIDNRQLEPAPLKYKPTGPSGKDTASNRASAPWATKPNSMANNKDFFLELRKQV
                     TILRQGGSIPGG"
     gene            <344242..>344592
                     /locus_tag="TRUGW13939_00104"
                     /db_xref="GeneID:55987621"
     mRNA            <344242..>344592
                     /locus_tag="TRUGW13939_00104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483319.1"
                     /db_xref="GeneID:55987621"
     CDS             344242..344592
                     /locus_tag="TRUGW13939_00104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339212.1"
                     /db_xref="GeneID:55987621"
                     /translation="MATSLPSSSCLTRHSLPVLLGACDEYTCAEMRYRRGNGGPGERE
                     AAKGALGGGEGDVSRTTPISILEMKRTSIAQFGPASICIAPTAVPAHQPSVPVILLRP
                     EMASIVDRSGFSAN"
     gene            <345276..>346017
                     /locus_tag="TRUGW13939_00105"
                     /db_xref="GeneID:55987622"
     mRNA            join(<345276..345806,345865..>346017)
                     /locus_tag="TRUGW13939_00105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483320.1"
                     /db_xref="GeneID:55987622"
     CDS             join(345276..345806,345865..346017)
                     /locus_tag="TRUGW13939_00105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339213.1"
                     /db_xref="GeneID:55987622"
                     /translation="MRHVSYPQHPTSPSLTPSGQDCDLAEITEGFINGGPLSFTPPLL
                     EQSQSPQDMGPFQYSPRQPEDAHRGHTNSSHRSRLESGGANISSTWTVHDDSILMQAR
                     AHSHGWGQIQKEHFPKKTANACRKRYERLVAKRRGPEWDQEKLERLSVEYNRLREQTW
                     QPLAFAVGEKWQDVEKACFDRGLKSLTSPTRRVPPQPQQSEVTNTPVTQPHPRRVSAL
                     PLKDILTND"
     gene            complement(<346653..>348177)
                     /locus_tag="TRUGW13939_00106"
                     /db_xref="GeneID:55987623"
     mRNA            complement(join(<346653..347985,348056..>348177))
                     /locus_tag="TRUGW13939_00106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483321.1"
                     /db_xref="GeneID:55987623"
     CDS             complement(join(346653..347985,348056..348177))
                     /locus_tag="TRUGW13939_00106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339214.1"
                     /db_xref="GeneID:55987623"
                     /translation="MLLLRQARIATRHRQCAGLRYAVSSSTWRRNLLTLAIESSCDDT
                     SVALVEKINNPDQSVTAKVHFLQNITANTQKYRGIHPIETLLSHQEHLAKLIQSSLES
                     LPLEQQQQSPSGNGEQSAVMRRLPDFISATRGPGMRSNLSVGLDTAKGLAVAWQIPLV
                     GVHHMQAHLLTPRLVSAMEGGGDASPTTTQPEFPFISMLISGGHSIIANSKSLLDHDI
                     LATTVDIGMGTALDKAARPILPQSMLESTTGTMYGKLLEQFAFPNGPSDYADYQPPKS
                     RGEETEQRENKWGWSITSPFANTRELKLSFSNVESTVTRILAAKKEAGVEMSDDEKID
                     LAREVMRVCFEHLASRMVIALEGLKGQPHVPSSKIKLLTIKQRLYRSSKRHDKIRTLV
                     LSGGVASNGFLMKVLRSFLDARGFNHIQIISPPPVLCTDNAAMIGWAGLEMYEAGWRT
                     DLSAKAIRNWTLDSQEPDGGILGPGGWINKDAAT"
     gene            <348765..>349913
                     /locus_tag="TRUGW13939_00107"
                     /db_xref="GeneID:55987624"
     mRNA            join(<348765..349201,349265..349804,349859..>349913)
                     /locus_tag="TRUGW13939_00107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483322.1"
                     /db_xref="GeneID:55987624"
     CDS             join(348765..349201,349265..349804,349859..349913)
                     /locus_tag="TRUGW13939_00107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339215.1"
                     /db_xref="GeneID:55987624"
                     /translation="MPLPLRALGRDGPQVPAVGLGFGSIGGFYGPPGTLDERLSLLDH
                     AYAAGLRFWDMADIYGDSEDVVGEWVKRSGKRDDVILTTKFGLQRQPDGKHSFRSDPE
                     YVRAACEKSLQRLGMDAIDLYYCHRVDGVTPIEKTIQAMVELKKQGKIRYLGLSEVSA
                     STLRRAHAVHPIAAIQMEYSLFTLDIESSTSEVLKTCRELGVTVVAYSPIGRGVLTGQ
                     FQSHADIPERDLRRMLPKYSEENFPSIMELVQTLKDVATVHGSTPAQVALAWLLAQGQ
                     DIIPIPGTKSTAKMDENAASARLQLSEEEVQKIRTMTERTEIKGSRYSAAVMATLSAE
                     TPPLQEDEN"
     gene            <351354..>351728
                     /locus_tag="TRUGW13939_00108"
                     /db_xref="GeneID:55987625"
     mRNA            <351354..>351728
                     /locus_tag="TRUGW13939_00108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483323.1"
                     /db_xref="GeneID:55987625"
     CDS             351354..351728
                     /locus_tag="TRUGW13939_00108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339216.1"
                     /db_xref="GeneID:55987625"
                     /translation="MYAARTAKPKLSLSISATASAPRPVLSLRSPGPMPRTPISPSPM
                     SPAYSRDMGLQAPQAYAYTNSSTAKSILKKGTNSASSGKKAIQFKNTPTVYCVTPIEN
                     KDEYYGGYGKVSRDEKRWGLRS"
     gene            <352719..>356435
                     /locus_tag="TRUGW13939_00109"
                     /db_xref="GeneID:55987626"
     mRNA            join(<352719..352728,352783..>356435)
                     /locus_tag="TRUGW13939_00109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483324.1"
                     /db_xref="GeneID:55987626"
     CDS             join(352719..352728,352783..356435)
                     /locus_tag="TRUGW13939_00109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339217.1"
                     /db_xref="GeneID:55987626"
                     /translation="MSDADFEQVRRLQAERNAAAAAKKGSKTFDPSSQRTDNSTKASM
                     TESFDTDLYERNGADKYAGYNTSIAIDGDEDMEDADSGHRLVGQYTASKDLINEMASG
                     NGVEEEDILLGREKSARIADRETDYQKRRFNRGPLTPTRADPFAANTHANVEPEGQTY
                     RDVMALREIEKEEERIEKLISDKQAETGDVEYQATLKDDADKENVEAGSTVTVAAGRK
                     RKQRWDVASADETTAVEQDEPSSKAKRSRWDQTPAVPAPGEQAAKRRSRWDQAPSAPG
                     IGATPVGQPGLATPAHPSAPGFGTDVSGRGGIWSDEELDMMLPSEGYQILDPPPGYEP
                     VRNPARKLMSTPAPVASTGGYGGFMMQEPESARTLGKQLPTEIPGVGDLQFFKAEDMA
                     YFGKLVDGADENALSVEDLKERKIMRLLLKVKNGTPPMRKTALRQLTDNARQFGAGAL
                     FNQILPLLMEKSLEDQERHLLVKVIDRVLYKLDDLVRPYTHKILVVIEPLLIDQDYYA
                     RVEGREIISNLSKAAGLAHMISTMRPDIDHVDEYVRNTTARAFAVVASALGIPALLPF
                     LRAVCRSKKSWQARHTGVKIVQQIPILMGCAILPHLKGLVDCIADNLSDEQAKVRTVT
                     SLAIAALAEAANPYGIESFDDILNPLWTGARKQRGKGLAGFLKAVGFIIPLMDEEYAN
                     YYTSQIMEILLREFSSPDEEMKKVVLKVVSQCSQTDGVTAQYLKENVLQDFFKNFWVR
                     RMALDKRNYRQVVETTVDLGQKVGVGEILERIVTNLKDESEAYRKMTVETVEKLIASL
                     GAADISERLEERLIDGVLLAFQEQSIEDIVILNGFGTVVNALGTRCKPYLPQIVSTIL
                     WRLNHKSATVRQQAADLVSRITMVMKQCGEDALMGKLSVLLYEYLGEEYPEVLGSILG
                     ALRSIVTVVGISQMQPPIRDLLPRLTPILRNRHEKVQENTIDLVGRIADRGPESVNAR
                     EWMRICFELLDMLKAHKKGIRRAANNTFGFIAKAIGPQDVLATLLNNLRVQERQSRVC
                     TAVAIGIVAETCAPFTVLPALMNEYRVPELNVQNGVLKAMSFLFEYIGEMAKDYVYAV
                     TPLLEDALIDRDQVHRQTAASVVKHIALGVVGLGCEDAMVHLLNLLYPNIFETSPHVI
                     DRIIEAIDAIRMAVGTGVVMNYVWAGLFHPARKVRGPYWRLYNDAYVQSADAMIPYYP
                     DLDNDGLSRPELAIVL"
     gene            <360990..>362163
                     /locus_tag="TRUGW13939_00110"
                     /db_xref="GeneID:55987627"
     mRNA            join(<360990..361459,361513..361985,362045..>362163)
                     /locus_tag="TRUGW13939_00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483325.1"
                     /db_xref="GeneID:55987627"
     CDS             join(360990..361459,361513..361985,362045..362163)
                     /locus_tag="TRUGW13939_00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339218.1"
                     /db_xref="GeneID:55987627"
                     /translation="MVIENQNRQYGGMGFDHVYQNNLPHTQTPQFTDPWAAHTSSHST
                     PPVYTSTSMGSSQLAMNPVKHADVTRPTAISLPYSSIPVSAPSLVAGSNYPTSAYAGT
                     EMMNMQHDMPRSTMDGAPSYTAAAPIGGFTPANYPPLNYSHGMHPHQDARRMSHSADA
                     RVSQPAATYSDAIDASRGMVALSQDLTPRNIYAPRNSRGSADSYGFPSTHSSVSSMSS
                     TGNYPYYSASVGSVESSVTDYSSTSESYDGLPSRTLPRPNTLLGAAAPAGPQSMMSQF
                     SSKMPSNAQKKHKCKVCDKRFTRPSSLQTHMYSHTGEKPYACDVEGCGRHFSVVSNLR
                     RHKKVHKGEKEAGSGEDEE"
     gene            <364334..>365127
                     /locus_tag="TRUGW13939_00111"
                     /db_xref="GeneID:55987628"
     mRNA            join(<364334..364960,365020..>365127)
                     /locus_tag="TRUGW13939_00111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483326.1"
                     /db_xref="GeneID:55987628"
     CDS             join(364334..364960,365020..365127)
                     /locus_tag="TRUGW13939_00111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339219.1"
                     /db_xref="GeneID:55987628"
                     /translation="MFIQSLALFSLYLHAVVDAAPTTGGILSDTLALVSSSTELSQLK
                     VTGCSLKDISPPLNETSVSLSGPETNGTLAYVALGRGTQNYTCADNSSSSVPTATGAV
                     ATMFDASCLAGDVDLLADLTMAIAKLPHDATVLAGLSLKQLTASSESLVLAEHFFSDS
                     TTPKFDFRPFDHSQWVQTKKLESVDAPSTAMPGSVKWLKLGYKDGVGIHQVYRTLTAG
                     GNAPATCEGQQPDIEVQYAAAYYFYS"
     gene            <369649..>370628
                     /locus_tag="TRUGW13939_00112"
                     /db_xref="GeneID:55987629"
     mRNA            join(<369649..369694,369755..370001,370061..370120,
                     370198..370312,370416..>370628)
                     /locus_tag="TRUGW13939_00112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483327.1"
                     /db_xref="GeneID:55987629"
     CDS             join(369649..369694,369755..370001,370061..370120,
                     370198..370312,370416..370628)
                     /locus_tag="TRUGW13939_00112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339220.1"
                     /db_xref="GeneID:55987629"
                     /translation="MEQPSASDPMGNPVLGQGTTTGGVNWVGFLAEQYNKTLVLAYDL
                     AVGGATIDNAIVSGFMYDMVCQINTFNSVYKGSPPSAPWTSSDSVFAFWIGVNDAGGS
                     YTNADPQSITTTLTARPMYQAEGETVVQEMANYLTVFNQAIANIVTNFEQTYTSTTVV
                     LYDTFTFMSAILASPTAYGYASDDAASCYNADGITCVWWNNLHPDQVYHQLMASDMAS
                     HISPLGGW"
     gene            complement(<371049..>372561)
                     /locus_tag="TRUGW13939_00113"
                     /db_xref="GeneID:55987630"
     mRNA            complement(join(<371049..371652,371720..371862,
                     371920..372147,372238..>372561))
                     /locus_tag="TRUGW13939_00113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483328.1"
                     /db_xref="GeneID:55987630"
     CDS             complement(join(371049..371652,371720..371862,
                     371920..372147,372238..372561))
                     /locus_tag="TRUGW13939_00113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339221.1"
                     /db_xref="GeneID:55987630"
                     /translation="MVYEKISTPHIRSEIPPNDNDALLYIIVSLCIIIIVIELVFRAY
                     SAYSWQRQRNYVKCDDVVFFVAAGLAICQFTLVIVQVKHGWGKSHIRVWGVYRRSQTD
                     TEVMNKTAYAADLFYVTILACSKVCAILFNRDIFRYVKRVSEWMSYGILLLCGATWIV
                     SVVVLAVRCTSAPWADINQQCSSFFSHWQVVTALDIITETVILSYPIVCLYKVQMSNR
                     QKFRVLVAMNCRILLIPLSALHLHFIHRQYMSLDPSVDGIFSTSMAVIHILFSLVVLI
                     GSSLKGVVSINNRHCDDFVAPLPPKTTSSVAELAISRQKLDRPRSTHSFLPATSSDVN
                     EDPKLGMLDLPQAPYACKPLALSHETWPRWSVIEEEDEEEGEEAVTPAITHDEQDREE
                     IQIQLLPPPPVLRRDNPPFYFAHERGNSVAVGESSELMRV"
     gene            complement(<374214..>375274)
                     /locus_tag="TRUGW13939_00114"
                     /db_xref="GeneID:55987631"
     mRNA            complement(join(<374214..374827,375226..>375274))
                     /locus_tag="TRUGW13939_00114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483329.1"
                     /db_xref="GeneID:55987631"
     CDS             complement(join(374214..374827,375226..375274))
                     /locus_tag="TRUGW13939_00114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339222.1"
                     /db_xref="GeneID:55987631"
                     /translation="MAETVLEFQGVFGHVDVDTKASTNTAWGGEVPLYFDRPEFFSHQ
                     RVKTKTGAQCGLKVNGITHGQFSPDGPPATLLVLNSNFKGINEPNRIENTKITFRFSD
                     LTDSLEQCPEVYGFPPEGEHIVDISNTARTVVQKKVSLFCFEFFRVITRNEHFTGTLS
                     SIEPCTNSVTDTVCGDGVIFLQENKGTKQGVANEFSTAILFEAKISGFPLPTPGDHST
                     GW"
     gene            <375480..>376292
                     /locus_tag="TRUGW13939_00115"
                     /db_xref="GeneID:55987632"
     mRNA            <375480..>376292
                     /locus_tag="TRUGW13939_00115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483330.1"
                     /db_xref="GeneID:55987632"
     CDS             375480..376292
                     /locus_tag="TRUGW13939_00115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339223.1"
                     /db_xref="GeneID:55987632"
                     /translation="MTSEYEKKTVAQLQELLKARTLATNGKKAELIARLQNADKSAAE
                     APAKEAKADAAEDVIDWDDDAPAGEAPPKEVTEPTTEASAATIAAGGQGPVSNPVAVP
                     NQELAVDPAKTSELHVESQAGTSEDQKAEEKPAVDYSIGLQATDLDVELEKRKARAAK
                     FGIVSEAGDNTTESDKTLERAKRFGTSESAPAINGLDQALPEKSHKRGRGDDQGGRGG
                     KRRNFGGRNRQRGRNNGPSDKQAGRGNAPKPVYSDKDKAALEARKKRFTAAA"
     gene            complement(<377280..>378310)
                     /locus_tag="TRUGW13939_00116"
                     /db_xref="GeneID:55987633"
     mRNA            complement(join(<377280..377457,377685..378001,
                     378227..>378310))
                     /locus_tag="TRUGW13939_00116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483331.1"
                     /db_xref="GeneID:55987633"
     CDS             complement(join(377280..377457,377685..378001,
                     378227..378310))
                     /locus_tag="TRUGW13939_00116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339224.1"
                     /db_xref="GeneID:55987633"
                     /translation="MPNKRGFSLDESPYPKPVRASWAPSNGRQRTTQESEQSARGAGW
                     RLRRWAVQLMDNNNVACMHCACVVALTVDAARRLGDGQKRLLRQSGDAAASSFLGVPF
                     APAEYDAESRDLDYCLKPSPPAQLLRQVPTDSASVFQAVGSRYQYFRPVRVAATARRG
                     RFSPTSEIAQAMLSHLIRLLTCISATRDELRA"
     gene            <379176..>383729
                     /locus_tag="TRUGW13939_00117"
                     /db_xref="GeneID:55987634"
     mRNA            <379176..>383729
                     /locus_tag="TRUGW13939_00117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483332.1"
                     /db_xref="GeneID:55987634"
     CDS             379176..383729
                     /locus_tag="TRUGW13939_00117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339225.1"
                     /db_xref="GeneID:55987634"
                     /translation="MSSHRFERIRPSRVVGGKPLIHDATPSSLQASAISKSAVVSSFK
                     SHIPTPVNGSVDHRSESRQDEHPVHPLAKTSRSFSSDDARPTGIPRINGNHSSARRPS
                     APSVFASRPSNSPASATPAIPAPSTAKVENVENTRGRPRNVLRRKANFRKPKVDTDVA
                     VEQQSSTSPGAHDDQNEHGSIDQRSQDTSRSEKSSTSLARLPKMKIPKPAEQPAPQQI
                     PKELIGLRTVVNTQNLPPPPTPIYAPSASPSTRYSGSPGMWSSRGSTPTSLSSYSPGI
                     TQPATTGYRFKQSPIQTRQPTLQRTTTTPVSQTEGDEPTFLGPIAGESYTRQIKIDAY
                     AGDQRQTLPRSPPPRKSSMKFKAPHTSVDETTSQHADVHIPQSRGENETSSINIDTAS
                     ETRSAANSSPVRPRRPSRQGTDHLEKATSPIIRSNMTALRTTGHTRRESADKLTSPER
                     VRGIPIRSAATSVESFQSATSSKIPSRGQSPLRIPKRPTRTLVKSPKPQNEIGDANTT
                     RKFGLFSKKSKTNLSVSKGDAADKSSRKGPAAGTGHEGYGKYAHRGRKPSVGNNGGPR
                     ARSSSTTGGRSVTSSKSGKQQPDIDDFLLDRLEPVVISGGGVDRDQLFRTHSGQSMSS
                     LSVTSAPDSSSIHAGAIMNGYSSESLGTSATDYTKQSSSFGSDSYLPSQLENLHGMKS
                     SVRNDSSPSLLSNTTGRRRGSNDTRTVPEETKISALPQISKASQKPDSTKKSTNKVSR
                     KWNNFFHRSQKSDQKEHAAVNKVTTDAHLHAKIAVLPNSRPVAHYALLDTDSETLEDI
                     LNHVEDSPLSDDETVSPRADPNLQVRHGTSVLLPSPPALWTEFANVNNTNTNTKSQQT
                     RPASPKVFFHKEEQNEPTEGGKRSRLTSVGRIPQVVSREDRGHKPSSQSYSRPFGHDE
                     GPLFSIGGQYSTSRPQLDLRTEFSRNQFANTESGTPKPASAPVISESTKFASGAYADN
                     EFLHFPARKQSQVSSSTSEADSIMAAVASMGPRLDTACEEDIWTEYDDLLDIVLTSTD
                     DATAKGQNTEPFEMVTKASKTLQAELNASKEKPRVSTPSDTLSVPISDLPQRSSDASV
                     RLRRSQIATALHTSMSISPQTSYSELIAGYAERNTSTTDLTMPESPAVLPTIEDQSDE
                     PQSPTPTKTDFEITRRRNTMLFDMAERDREGAAAQTNLRSASLMTSRWLSFGRVLFSP
                     AHNRIKESESDRMLIIDGLGNDDWSYYCALTYPNATIYSLSIRPGSSVLPPHPEAWKP
                     PMNHHLIHQPSTSAAFPFPKNFFAVCILRFPPAYSEDGQRNILSECKRVLRPGGYLEM
                     SVIDLDLVNVGSRGRKAVRTLKERIFLTDSNISLKPASDNIQRLLGTCGYDNLNRCMV
                     SVPVAGMVGGSAHSSISNRSMAERSLSSRTSPSQPISTTDSQPHTRTPSDETGRSLGD
                     LLSDPSPSATNDESITKMVARVGRWWYTRCYEIPVLVDPSNDRSIWAERKLLRECQKH
                     GTGFRLLIAYAQKPSEKRRTVSV"
     gene            complement(<384666..>386617)
                     /locus_tag="TRUGW13939_00118"
                     /db_xref="GeneID:55987635"
     mRNA            complement(join(<384666..384953,385005..385077,
                     385131..385496,385562..385801,385861..386399,
                     386465..>386617))
                     /locus_tag="TRUGW13939_00118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483333.1"
                     /db_xref="GeneID:55987635"
     CDS             complement(join(384666..384953,385005..385077,
                     385131..385496,385562..385801,385861..386399,
                     386465..386617))
                     /locus_tag="TRUGW13939_00118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339226.1"
                     /db_xref="GeneID:55987635"
                     /translation="MGWRPAGGGDTFTLDSSNIGAAQWSRAAKAYELKILSRTSGVIQ
                     LDGFEQEDFERLSKAFKVWYGVAVEQREHALRGWNWGKAEFTKAELAFNVQNRPAFEI
                     PYSEISNTNLAGKNEVAVEFALPTDEKTNGHIEGSTKNRGRKAAAGTDELVEMRFYIP
                     GTILKKEKTEGDDVKKEGSGGEEEPEQEEEGAEEQNAANLFYETLMDKAEIGDVAGDT
                     FATFLDVLHLTPRGRFDIDMYESSFRLRGKTYDYKIQYSSIKKFFLLPKNDETHTLIV
                     FGLDPPLRQGQTRYPFLVMQLKLDEEVSIELNMTEELLKDRYKDKLEPRYEEPIHQVI
                     TKIFRGLAGKKVIMPSKDFISHHGHSGVKCSIKANEGLLYFLDKSLMFVPKPATYIQI
                     ENVSVVTMSRVGGAISASRTFDITISLKGGLGEHQFSNINREEQQPLEEFFKAKNIRL
                     KNEMVDESSALIAAALDNDDLSSEDDARPDRGSADEDEESVDEDFRADSDSDVAEEYD
                     SAHESSGSESGSDAEMADADGDDAAEGDDGEEEDRPKKKSKVGK"
     gene            <387733..>390407
                     /locus_tag="TRUGW13939_00119"
                     /db_xref="GeneID:55987636"
     mRNA            join(<387733..388339,388402..>390407)
                     /locus_tag="TRUGW13939_00119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483334.1"
                     /db_xref="GeneID:55987636"
     CDS             join(387733..388339,388402..390407)
                     /locus_tag="TRUGW13939_00119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339227.1"
                     /db_xref="GeneID:55987636"
                     /translation="MSENAGKGSTRQIIRPPSDNNLQGWKRSRIRPQNLPWTTLFKGE
                     NTNKDKKTTMVSHEKNALFTCSQCHRRYSTQSALLRHQKSHDRSAWHSCEICNLKFSR
                     TDILQRHKQLHGNGNGQSERKRAIKACDGCRRNKIRCTGDNPCQTCSKLGKKCTYLTH
                     VARPSVQGLHKERKQIVASREENPSDVFAPKDIISTADPVPTVPIGANSNNKKNNEFV
                     APDLVAAAMTDNYNTARLAENPQLFTDIDRLLAQSPNLVALTSKGDRNIDFLLPRSPD
                     ANTGGSPSFFEFTLGSGLDQPMFPVTQTPYLLNEKLPDPVMQNIFLPHNVVRDMVHQA
                     AVDFLELGTKDAVFRSRKRRNFSQAIEKFFNLSNYMEGKPTHVLHTFLSSFFENFSVL
                     WPITWHQGADHDTVEPLLYLTMTAIGAMHAESPNAAAYGLALHQELCAVLPNSCLLCP
                     DEEIKLEIIFEALLLSETMALYRGDSQACGFVQQARAVLVSHARRLGLFHELPAQESN
                     DSAMEVCHNQTEKELQQWIRMERRRRMAFGFFRCEVFSSLLFNTRPLIGSDDLRLRIP
                     CDHETWMYVGPEWREKLLLVAEEAISYPLYSELMRAATEGENSQLPPLNASAHELVLY
                     GLQIPLLASFHDNGKPYQEVPEFGNPYAADSSFSFSGLQESRLASGMALPEILRLIDG
                     WRATHDRLLSTDRLNGKAPSGEGFSPRLLYHMGYIRSNADLMALQSVASYNSNKEEGS
                     PPMADFSQDQLILQQVRLWTTTDSAKVALSHACQIWALAEKHLAQSKTKDTSSLKYDQ
                     DINIVSMISLYYAAIVIWVMAELCPDISIRNIRQGVRQIGDVVERASTSSWQMASSLI
                     MNTKALAYKGLYYF"
     gene            complement(<392221..>393252)
                     /locus_tag="TRUGW13939_00120"
                     /db_xref="GeneID:55987637"
     mRNA            complement(<392221..>393252)
                     /locus_tag="TRUGW13939_00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483335.1"
                     /db_xref="GeneID:55987637"
     CDS             complement(392221..393252)
                     /locus_tag="TRUGW13939_00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339228.1"
                     /db_xref="GeneID:55987637"
                     /translation="MVTARAMITHADDAPAYWQIGNLWRTMATGVQTDNVFTLLDQIV
                     HSGGGGGPCTHTHTQDEGLYVVSGKCTFNAGGNDGLPAGPGTFVAIPRLTEHSFTVDE
                     EDTQLLNFYLPAGFEVLLTGIAHPADRNEPPPPGVPLPPPHLVRKLASDYGQTAVLGM
                     PFIDKARPGIMSTRPTPGATIFPFTAHAKGVPSYWYKDGLWSVLGSSKQTGESYTMLQ
                     LNLRKGVISSPHIYNDHDEVFYILSGDCTFLLGDRIERCSKGALVFIPKGTPSSHRVD
                     SETALMLNIHTPGGFDEALEQLGQKATEFRLPNIGDSAEVKQTDARLRNMLLNGLGIK
                     NIAVTDPLS"
     gene            <394010..>395294
                     /locus_tag="TRUGW13939_00121"
                     /db_xref="GeneID:55987638"
     mRNA            join(<394010..394170,394230..394564,394621..>395294)
                     /locus_tag="TRUGW13939_00121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483336.1"
                     /db_xref="GeneID:55987638"
     CDS             join(394010..394170,394230..394564,394621..395294)
                     /locus_tag="TRUGW13939_00121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339229.1"
                     /db_xref="GeneID:55987638"
                     /translation="MVVPEFHEAHILIIGAGPGGLVLAQCLKRMGISFEIFEREDGPR
                     MQGWAVALIESLEDLKEMLPSDIYANLPTCSVNYGSGLTDRLALIDGITGETAGVVGD
                     GKPFLRAGRQGLRAVLREGLDVQMAKVFTHYEVIPGQGVIAHFEDGTTAKGTLLVGAD
                     GSRSHVRSQLLQNENPLIQSQFVNVVGELDLSPDVYKPIEELGSAGVLVYRPGLRYLI
                     GRLGIDSELQISKYYWAACAASDTPVKDSEWVANAPKEELYKRGVETTKGLPSFLTDI
                     VRATSANQMLQPPLRFVEFHFNGDESLPLADHVTVLGDAAHTMVPFFLAGANSAVKDA
                     CDLAKALQKFPGRAGLRRAQETYESIMVKRSKEMVLKSRAQGELDNLNQVLERVK"
     gene            complement(<395944..>396471)
                     /locus_tag="TRUGW13939_00122"
                     /db_xref="GeneID:55987639"
     mRNA            complement(join(<395944..396189,396469..>396471))
                     /locus_tag="TRUGW13939_00122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483337.1"
                     /db_xref="GeneID:55987639"
     CDS             complement(join(395944..396189,396469..396471))
                     /locus_tag="TRUGW13939_00122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339230.1"
                     /db_xref="GeneID:55987639"
                     /translation="MGEGACVFVFGACLTRSGEIATARSTDTGPISSVYSGAKWGRVA
                     PPETTMDAWANHGPWSENPPAEPQREKTTFFHAQLMVK"
     gene            <396784..>400515
                     /locus_tag="TRUGW13939_00123"
                     /db_xref="GeneID:55987640"
     mRNA            join(<396784..400216,400277..>400515)
                     /locus_tag="TRUGW13939_00123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483338.1"
                     /db_xref="GeneID:55987640"
     CDS             join(396784..400216,400277..400515)
                     /locus_tag="TRUGW13939_00123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339231.1"
                     /db_xref="GeneID:55987640"
                     /translation="MRASSVFRPATAAAITLAQISAIHAFTATPVSIPDLDLSPLGRL
                     ALTGDFDSISLYSYLQQSESVPSTNGSQSLLTSLPNGVLTTLSSADADILAMCPWTRK
                     DGTFAGLIVGGNFTSFGDTKAVGIASYDPATNTVHDMPGLSGTVRSLVCDQDSDSVYV
                     GGNFTVKNSTNAMVWKGSTGWQALPFGGFNGPISAIVQNPDGHLIFGGSFDALGNTTT
                     PKQNFSQIVNLSTANISSDAQTTLSGFIDPRNIICSAEKSDSAGNTWLLDDYSPGFWR
                     ADMGFTFYPTKVRLYNTHYQGRGTKSFRFQALPDTGIMNLTYTDPSTGKTVSCDAECP
                     LSSDTSEAYQDFELVNPVGMSSFMIQILDWYGQGAGLDGVEIFQNEIYTYAINDYNEP
                     TCAGIDYPSAALTTGDWAVTPAGSSAVASTSYLTAKASGSSSLSVTFRPDITQSGNYT
                     ILFYTPGCSLDGTCDSRGRVNVTATLSSSTQPVEKFFWQTNEDENYNFVHTGYVEASS
                     DSFRPEVTMTLADGQGEATMVAYRVAFKLISSTGGLNALYDYDPTKKTTDTDFASDDI
                     DLIGTNLNTGAIIHSMVQSGDTTFVGGNFSDSSFRNIMSFTSGNATSLSDGGLNSYVQ
                     SLLLLDDIIYVGGNFTDTAQSGTKDLNYIAAYSPSSKSWSSLGAGVNGPVTSVVSFPV
                     NGTNGTTETAIAVNGQFDQILAFGSNSSVTVTGFAVWVPSQKNWLQNVDSYPMAYYGQ
                     LMATADIGNNTTILAGSLTSDGISSRGVVSLDDSNQLALQPLPVDILASKTGSSVSKR
                     DTTSQDSTEVVIGLFDTTNGRNLTIFGGQFTAKTSDGSTIQNLLFVNGSDSDSVTGIP
                     SGVNSSSTFTTLAVAEDTLFAGGIVTGKVGSSSLNGLVVYDLVNSAFASSQPPALTGD
                     NVVANSIAVRPSSTEVYVGGAFDAAGALPCPAVCVWDTSSGQWSRPGANMQGVVTSLQ
                     WVGKDELYVFGNLTVQDNTTSIATYDASSQKWSAVDGASSPAIPGPVTAFGAAATDLS
                     SYWVAGQSSNGSTFLVQYDGSQFNSAGQIFGKSTSILGLQVIGLSTAHTSTDVLDDDQ
                     ILLVTGQLEIPGFGNASAALYNGTTLTPFILSSRSDGQPGSIQQMFTENKNTFKGDTS
                     HHLSVGLVILISFCIALGCVFLIVVIGVILNKIQRRRQGYVRAPTAYNSDRPTSMRRV
                     PPEYLLDSLRQRTGGVPTI"
     gene            <401525..>404183
                     /locus_tag="TRUGW13939_00124"
                     /db_xref="GeneID:55987641"
     mRNA            join(<401525..401682,401743..402008,402070..402628,
                     402684..403327,403387..>404183)
                     /locus_tag="TRUGW13939_00124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483339.1"
                     /db_xref="GeneID:55987641"
     CDS             join(401525..401682,401743..402008,402070..402628,
                     402684..403327,403387..404183)
                     /locus_tag="TRUGW13939_00124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339232.1"
                     /db_xref="GeneID:55987641"
                     /translation="MPASAFTGGAHSPTASTSFSSSPSRSLSTAVDAVASSTLSRPSS
                     VGMRSRTGCLTCRARKLKCDEQYQRVGDNGKLQCAHCRKASRECQPSEGIVFRHQQNA
                     SMNKEGHSSGAMNSGGLKGFYSYKNTFNEDSVWLDIPKDVIFVDNFDPDLEELEASLL
                     TEAADSSFLGEKNWSHEYSLTPMDENTHGLAALSTAATQNHYTYHETSTSLTGNNSSS
                     LPTLSGAPPPSHTISSPARSRSTMPPPASPSASITSSNNNINFLLNPPSSMSPSSEPR
                     LPTPLGGKDSPYTPKTPTSRNTAVSLKPERRVETSHEIAFLLRHFAEGPGYWMDLFDL
                     EIYFSSLVPAKAISNPLLKYAACAYAAKQLSRVQGSKAVMGGRCSKQASMELWPDAEQ
                     VDWEFHGAKYYDKAIQLLMKELQHDGEGPAPLSTLEAFGQWEALELTEGGEPARKRRR
                     RLSNSRFSTSHSDEVLAATAILSVYEFLDATGLAWNRHLSGVKSLLDIAEVGIMPLEQ
                     ETSPEGSVLPRKGPERSLRTATFWNFARQDYLSAFISECQTRLNPEDLLVWTEAGLQL
                     DGHGFARASNTEGENIMKEDMISNTLIWLLSKIVNFIGAGDQIHLTPTGNPVEQGPLG
                     VSQNTLLERWYRLHRELDAWYTGLPETFQPCARIEPLRNIHHPGSDVDDIPFVEVWYS
                     MPMCASTMQHYHMARVLLLINKPHESTARRTTVTNRLQSYRSIESEVRYHSHEICNIS
                     MSRMDSSARIHSLQPLFVSGQCLTEPRERRTIIGLLRGIEADTGWATEYRVKQLLREW
                     GWEEVNIIL"
     gene            <405360..>407272
                     /locus_tag="TRUGW13939_00125"
                     /db_xref="GeneID:55987642"
     mRNA            join(<405360..405915,405972..406570,406622..>407272)
                     /locus_tag="TRUGW13939_00125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483340.1"
                     /db_xref="GeneID:55987642"
     CDS             join(405360..405915,405972..406570,406622..407272)
                     /locus_tag="TRUGW13939_00125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339233.1"
                     /db_xref="GeneID:55987642"
                     /translation="MSQSQIDTDVIIIGAGMSGLNFAIRLQQDYPDASYHIIESSADL
                     AGTWSINTYPGCGCDVASHFYSYSFALKPDWSQKFALQREILQYFRDVATKHDIVRHI
                     QYQADIAKATWDEQFGIWVVEVLDRKTGTSRVLRSRAVVSAVGALSIPRPCEIKGTEQ
                     FRGKLFHSARWDHEFDWSDKDVVVIGNGCSATQFVPILSNGSTTENYTTTCSPARRVT
                     QFARQPHWIAERPNPVYSPLFKWTMRYVPLAMRLYRFLLYADMEKDFLGFYLATGGHI
                     RRGLTDERLEYLKRTAPAKYHAALTPSTEIGCKRKVNDTDYFDCLHNANMELVAEDPI
                     TEITETGVKTKTGREVKADAIILANGFQTQKVLYPLSADIRGEGGVSLDEHWNKLSDG
                     LPQAYYGTCVSSFPNFFVLMGPNTTTGHLSVIYSTECQVNFSLRILQPVLQQPSLVSS
                     LIGSNPPTSVAVTLAAEQRDNAWIQDSSKNLVWASGCTSWYIDTKTRKNTMLYPDWQF
                     NYWWRSVFVPKNKDFVYKKSPKIAAPAKGRKSGETNRTGSWNGVVLASIVLGAATGIA
                     IGGAKIGDVDDVLADGFGQIRRLTEDVIQSVKGAL"
     gene            complement(<407375..>411022)
                     /locus_tag="TRUGW13939_00126"
                     /db_xref="GeneID:55987643"
     mRNA            complement(join(<407375..407680,407749..408195,
                     408246..410152,410202..410872,410928..>411022))
                     /locus_tag="TRUGW13939_00126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483341.1"
                     /db_xref="GeneID:55987643"
     CDS             complement(join(407375..407680,407749..408195,
                     408246..410152,410202..410872,410928..411022))
                     /locus_tag="TRUGW13939_00126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339234.1"
                     /db_xref="GeneID:55987643"
                     /translation="MAYVVPIHRASSVRHALKLQFFQPEEECLVVAKGGRLEFYQLTP
                     DGLTLATSRALYAKVSMLAKLPLPANSTTDHLFVGTDQNTYFTLSWDSEKKSVRTERS
                     YVDLADKASRETQNGDRCLIDPSGKYMTLEIFEGIITVVPIIQAHKRRGKPPVVGTTH
                     FSNPDEPPIQIGELGEPMMTRIDELMVRSSAFLHVESKAAPRLALLHEDNQRKVQLKV
                     RELHFEAPSEPVFQEAENFAQELDLGAAHLIPVPAPLGGLLVLGETSIKYIDDTNNET
                     ISKPLDESTVFVAWEQVDGQRWLLADDYGRLFFLMLVLDSQNEVEGWKIDYLGETSRA
                     SVLVYLGAGVTFIGSHQGDSQVIRIGDGSFEVIQTLSNIAPILDFTIMDLGTREGDNY
                     THEFSSGQARIITGSGAFNDGTLRSVRSGVGLEELGVLGEMDHITDMWSLQVASSGDF
                     TDTLVATFVNETRVFRFSSEGEVEELDEFFGFNLSENTLLSCNLLGGRILHVTENAVC
                     IADIESGMTTSRWLPSGQAITSASSNDENLVLVVGGQTMFVMDIKSDLKVTSQKDFGK
                     DNQVSGVTIPSSPSQICITAFPQKAQVSVLSLQDLTELQSESLGTTREAFPRAVVLAA
                     ILADSPATLFISMADGSVVTFSYDADNHSLTGMNKLILGSEQPTFKKLPRGDGLFNVF
                     ATCEHPSLIYGSEGRIIYSAVNSEGAARVCYFNTEAYPDAIAVATASDLKIALVDKER
                     TTQIQTLPIGATVRRVAYSPAEKAFGIGTIRRTLRNGAEIVESQFVLADEIMFRQLDA
                     FDLREDELVESVIRAEMSPQKSQSGEPAPRDRFIVGTAYLDDDDEEGPIRGRILVFEV
                     DANRKLNLKTQQPVKGACRALAMMDNKIVAALVKTVVVFKVQEDMLGSPIGLVKSAVY
                     RTSTAPVDLSVSGNTIVVADLMKSISVVETGRNQEFQDEAKEVARHFATVWTTAVADI
                     GLNQWLVGDAEGNLIVLQRNVDGVTDEDRRRLEVTSELLLGEMVNRIRPVNIPQTSTV
                     AVTPKAFLGTVEGSIYLFAQINPEHQDFLMRLQTTIAAYVDSPGQMSFNKFRAFRSTV
                     REAEEPFRFVDGELIERFLDCDNAVQEEILGLLGTNVNLETVQKMVEALRRLH"
     gene            complement(<411586..>412867)
                     /locus_tag="TRUGW13939_00127"
                     /db_xref="GeneID:55987644"
     mRNA            complement(join(<411586..412320,412393..412565,
                     412744..>412867))
                     /locus_tag="TRUGW13939_00127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483342.1"
                     /db_xref="GeneID:55987644"
     CDS             complement(join(411586..412320,412393..412565,
                     412744..412867))
                     /locus_tag="TRUGW13939_00127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339235.1"
                     /db_xref="GeneID:55987644"
                     /translation="MLPARALPLRQLANRPLPLQRCFSTTAQRDRAWGFIGLGRMGYP
                     MARNLRARIPASDTLVVHDVNEEAMRKLVDEVKAAGGNAQAVEITDSPRALAEKADTI
                     ITSLPEPVHVKHVFHSILKPGPLPVLKEERLFIDTSTIDPVTSREVAYAVQAPNQGRF
                     VDAPMSGGVVGAEAGTLSFMFGASSKTGALVERVESALSFLGKNAWHMGEQGTGVSAK
                     LANNYILAINNIAVAEAMNLGVRWGLDPKKLASMINSSTGRCWPSEINNPVPGVVEKA
                     PASRDYEGGFGTSLMRKDLKLAIAAALESGTPLELAATARGLYDAVDDVYPGKDFSVV
                     YKYLKRNSC"
     gene            complement(<413973..>421925)
                     /locus_tag="TRUGW13939_00128"
                     /db_xref="GeneID:55987645"
     mRNA            complement(join(<413973..416441,416503..417540,
                     417617..420940,420994..421197,421254..>421925))
                     /locus_tag="TRUGW13939_00128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483343.1"
                     /db_xref="GeneID:55987645"
     CDS             complement(join(413973..416441,416503..417540,
                     417617..420940,420994..421197,421254..421925))
                     /locus_tag="TRUGW13939_00128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339236.1"
                     /db_xref="GeneID:55987645"
                     /translation="MPLGSQESPIMSHHNPTSPPDRLARNGPSPSLSGLHSREPSVTL
                     ARGRPADASTRNLSTLQAQSRSPGQSHSKSPESNPSRLEGAIERKPSLSSYGHHRKAS
                     IVHGIQHIRNQSYSSTASPLSPESISSAGVGALSSNSDVSLASRVEQPEISMYAGNGN
                     NGTAHGLSTIQDDEIGRPVKEKSTTQHSMPPNGERRRDRSNSRSNPKLEARTVGEFSI
                     HHLFNLFVAHADSKINQSIIMVGEVAAPVEAVCGKGKDPVFDQLISALGHISRQKPKI
                     LIDTIMLWRKRKGEAAKKSPAPENIPMVRRNTEPIHAGILDNENNSESPQPETHKQED
                     IQLAERQATVSVYLVCRVLIEIYDQSSVAAIGPDIAERLEDIVFGQLKTVDPEQIAAS
                     PLRMANWRIYGQLLGKMSEISFTTVAARFFIELERYQKEAAVRGQSREMDAKAELLIL
                     GMRDINIKTYPEDAWTRTCDFMRSLARLFVNSHGQRVKQAYCYIIEKVLRLVAANPAC
                     DLAHPRWKEFLDLITPRLSEMLAKPRHWMTVFPIYTILLCVSSKDAFSSQWISLALSL
                     PTRLKDRPTRGLALQSLCWLLWTYLFRYPDPPNVTLRRVEEVIKIALPPGKRTYLTTE
                     PAVAEPLVQLIRMTGFKLPDMCFRNIIFPLINSDLFMSGRELKIEQMEPEKMVIGIRS
                     FLAIMTDLENGDQLYPPFPVGPISTHFVDIPNFILPPRPYLLADPEFSLDVNSEALSR
                     PVNTSKLNEVAKGYYIRFCEVLGKITLLCDNTFGGQAALDEKFSGSTPKTPISEAFSF
                     GRRDRDDHSTIMDQRQSFYDLLHVAVQTIPRCLSDHIPFNSLINLLCTGTAHVQFNIA
                     RSSAESLKSIARQMHAQQVIMGFTRFIFNFDARYSTMSDEGMLGPGHIESTLTLYVEL
                     LRIWIEEIKRKTKGVASDHPESSIGSGTRALQLDLSGVLAYVEEIEAHGLFFLCSQSR
                     RVRGFAISVLRLVTEFDSALGKENTRIIRILEADSHQIMDLNDEQLTVAERSRLQKGK
                     RRSASQNTLIELCNSEVSYDSTLWIKVFPNIIRVTFDTCPVAITLAREIVCARLVHMH
                     KTISTLAEIPRHQHYASLDVVQGRSLGRANTPAEIMIEQWKLYLVMACTTLNSVGAQS
                     QSQLANAQHARKTSRGTQTAQDKIGSARALFAFVIPLLSASLDSIRDAIVAALGSINK
                     NLYRTLLESLQYAVTTCNEEAKLRIGTHTRTPSSPRRSRKTDRLRTEVTHVYKLTSTF
                     LKEQDVYSDDWIVNNLVTYAKDLRIFLSDAEVQIDWGFQRLRCNYCGFMEELFEGINR
                     TQEPSRWLSFESRKSAFSLMEDWCGYSPSQKEIAQREEHMRRIAIAQQQETGELRNTA
                     AAMEIEKKNLRVAALSAMASLCAGPISTTTEGGSILQFDVSRMLKWIDSIFETMSDKL
                     HAIGRRALKNLIIHNKEYLYLLERTVGKCYMSEPRKTYTSDPHKPLESYFEVVAQVLI
                     EEPNCSLAFWTILAAVLYTLGNEKREIRMKSAKLLRTMEKRQQKSSRLQDFDISISDK
                     TTAVYKLAQFEISKRLASRHSDLAFVIFSEYCMHFRTFPPDGQRNIVTAILPWIQTIE
                     LQIDPSNQLTAKSYMLLSNLFEITISRSSILPNEVQALWQALATGPHGGNVQVVLDFI
                     IDLCLNRKEQNFVEFAKQIVVFLSSTPAGSKVVEFFLLHVAPKHMVQDKKESIANQPD
                     ARGLPYVADLDEILPLGNKQTGLSLGQLSMIFLVDLMVAPVSLAKGDVAKLLHTVLIL
                     WDHYNITVQEQAREMLVHLLHELVASKIQDEAISEGRQGIEDFVESIRKSEASMIWEY
                     EDNTSKYEEDEGAKVPTAMALVTREVVSFFSLTFDDIGDLWSKEALSWATSCPVRHLA
                     CRSFQIFRCISTSLEPRMLADMLARLSNTIADKETDYKTFSMEILTTLEVIISSLAPG
                     DLMRYPQLFWTTCACLNTTHEIEFIESIGMLEKLLDRIDISDANVVATLIENQPPLWH
                     GDFVGIQDLVYKGLKSSEALYGTLNLLHRLTALPDNAIVGSSSRMLYAMLANLPHFLY
                     QFDLEVHDPKILDRANLLGQMAERYEIEGLAACLIGLANSQWKKEQDFLQHIVSEIRS
                     HCFPQQEVQSLIFVMGLLTNATTWFRVKVMSILCALIPEMNMRRPEITCHGPDLISPL
                     LRLLQTDLCPQALKVMDYIMEVSGNPNERQHLRMSMASSSSSRAIRKQYDQVQSLYGI
                     PEPTGWSIPIPAEQSSTTRHNVHAVFYTCAEADRMETQRVATPEVEFHADEYGDSYFP
                     SMRADTMQSIDTQTDGNMGDIVQKLDSLDDFFDEDDSSDPSFVMVSEMRGFPGNFADA
                     PASLYDQQTAPILRKSLARTPSSSSFHNGLAETSRPPTRLDGMLNLGTPSVPQSTSPV
                     PGLGATIRPTMHSRSVTSPANHLANHKSSLSTTIPTMEATFFSDSEADEGFSDVDERG
                     GPIPTSSRGPPSTMARKGSETGPSLESMIRSGMRRLTGGTASGRDKERQRDLLRAQQR
                     AAVQTANSPRVPKVPAEFLTGSVNSPTSPG"
     gene            <423681..>425829
                     /locus_tag="TRUGW13939_00129"
                     /db_xref="GeneID:55987646"
     mRNA            join(<423681..425471,425533..>425829)
                     /locus_tag="TRUGW13939_00129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483344.1"
                     /db_xref="GeneID:55987646"
     CDS             join(423681..425471,425533..425829)
                     /locus_tag="TRUGW13939_00129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339237.1"
                     /db_xref="GeneID:55987646"
                     /translation="MAQIDTLDLVVLIALLVGSVAYFTKGTYWAVEKDPYSSSVYASA
                     NGAKAGKTRNILEKMDESGKNCVIFYGSQTGTAEDYASRLSKEGSQRFGLKTMVADLE
                     EYDYENLDQFPEDKVAFFVLATYGEGEPTDNAVDFYQFITGDEVAFESGASTEDKPLS
                     SLKYVAFGLGNNTYEKYNYMVREVDAALTKLGAKRVGVHGEGDDGAGTMEEDFLAWKE
                     PMWAALVENMGLEEREASYEPVFSVTEQETLTAEDSTVYLGEPNLSHLESGGKGPYSA
                     HNPYIAPVSESRELFTVKNRNCLHMEIDVAGSGLHYQTGDHIAVWPSNAGVEVDRFLR
                     VFGLDGKRDTVIKLKGLDVTAKVPFPTPTTYDAAIRYYMEVSGPVSRQFVNTLAAFAP
                     DEASKTELVRLGSDKDYFHEKVSNQCFNIAQALESVTKTPFTAVPFSCLVEGINRIQP
                     RYYSISSSSLVQKDKISITAVVESVRIPGATHIVKGVTTNYLLALKQKQHGDPSPDPH
                     GLTYSITGPRNKYDGIHVPVHVRHSNFKLPSDPSKPIIMIGPGTGVAPFRGFVQERAA
                     LAAKGEKVGTTVLFFGCRNSKEDFLYEDEWKTYQEQLGDSFKLFTAFSREGPQKVYVQ
                     HRLRENAALVNDLLQQKANFYVCGDAAHMAREVNTVLGQIVAEKRGISSEKAEDVVKH
                     MRSNGTYQEDVWS"
     gene            <427660..>429697
                     /locus_tag="TRUGW13939_00130"
                     /db_xref="GeneID:55987647"
     mRNA            join(<427660..427714,427766..428543,428601..428691,
                     428753..428842,428894..428988,429048..429350,
                     429400..>429697)
                     /locus_tag="TRUGW13939_00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483345.1"
                     /db_xref="GeneID:55987647"
     CDS             join(427660..427714,427766..428543,428601..428691,
                     428753..428842,428894..428988,429048..429350,
                     429400..429697)
                     /locus_tag="TRUGW13939_00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339238.1"
                     /db_xref="GeneID:55987647"
                     /translation="MNPAVSVPEIHKDPAFDPGKYVPPNGKLNLPLRLRPKTEDGSGS
                     SSHHNPDFSALPREVLYNTPVMVGGMNAVNHFGQRQVTPPGPAIPGMSLQSSVPSGVY
                     YPGFVNGAPITPVNFPTLPWGAHGPGMNSASTPSWSIDDGKHALLDYANPTGCHPYTP
                     MMDRGAMASYPMMSNIHVQQPCLQYQMMKTPTGYIIQDMEILTQQDPPIPRAIPAMWT
                     NQSDLTLAKCLENREGITNVYIRGFPPETTDDMLHAYASRFGEIDRCKAILDLETGSC
                     KGFAFVQFYNFDSCENCIRGFYYLGYQASFAQKSRNSRLKDLEDRNSTNIYCTNVPID
                     WSEADLRRHFEPYRVVSEKISRDEKTGVSKEVGFARFESREVAERVIEEFHNVVAKDG
                     NKLLLRFADTKAQKLLKQQSNERRAYRAGEYNYSVEIVQGSTPSPATSRLGNGPASPM
                     SFQSPAAPGSAWTPATTISPSIPVMKNGGTRRGVHVFGARPLNNAENTPVASRGRAAS
                     ASATVLPENGLSVSLSKTVTVDIGATPRTPTKKMTGTRKSSSVSPVTSRNVIEKVSEP
                     ASN"
     gene            complement(<430601..>431377)
                     /locus_tag="TRUGW13939_00131"
                     /db_xref="GeneID:55987648"
     mRNA            complement(join(<430601..431135,431208..431251,
                     431315..>431377))
                     /locus_tag="TRUGW13939_00131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483346.1"
                     /db_xref="GeneID:55987648"
     CDS             complement(join(430601..431135,431208..431251,
                     431315..431377))
                     /locus_tag="TRUGW13939_00131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339239.1"
                     /db_xref="GeneID:55987648"
                     /translation="MADDELDALNALEKEASEFNKDAEIDRIRKAFPLDAYAVLDLQP
                     GVPDSDIKLQYRKKSLLIHPDKTKNPLAPDAFDRLKKAQTTLLEEKARENLDECIADA
                     RRLLIREHKYTLDSPELKTEEFKVEWRKKTVEVLLDEEARRRRQAKARMQEEGREQRK
                     EEEELEARKRKRDADKAWEETRDERIGSWRDWQKGTKKDKEGGKKKKKMKVLG"
     gene            <431568..>434075
                     /locus_tag="TRUGW13939_00132"
                     /db_xref="GeneID:55987649"
     mRNA            <431568..>434075
                     /locus_tag="TRUGW13939_00132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483347.1"
                     /db_xref="GeneID:55987649"
     CDS             431568..434075
                     /locus_tag="TRUGW13939_00132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339240.1"
                     /db_xref="GeneID:55987649"
                     /translation="MAPTKGPRQERKPVDSSARKLKKTRAATELTTITQRVQELDTKV
                     RLEAFSDLPLSDPTTSGLSASHYKTLTDIQSRAIPHALKGRDILGAAKTGSGKTLAFL
                     IPVLENLYRKKWAEHDGLGALILSPTRELAIQIFEVLRKVGRFHAFSAGLVIGGKSLK
                     EEQERLGRMNILVCTPGRMLQHLDQTADLDVYNLQMLVLDEADRILDMGFQQTVDAIV
                     EHLPQTRQTLLFSATQTKKVSDLARLSLQDPEYVAVHEAASSATPSTLQQHYIVTPLP
                     EKLDTLYSFIRSNLKSKTMVFMSSGKQVRFVYESLRHLQPGIPLLHLHGRQKQGGRLD
                     ITTRFSQAKHAVLFSTDIAARGLDFPAVDWVIQLDCPEDTDTYIHRVGRTARYERNGR
                     AVLFLDPSEEAGMLKNLEQKKVPIERINVRTKKQQTVKHQLQNMCFKDAELKYLGQKA
                     FISYVKSVYVQKDKEIFKVKELALDEFAASLGLPGTPRIKFIKGEDSKIQKNQPRALR
                     YISSDESDQEEDGTKKTKKKEVVRTKYDRMFERRNQDVLADHYSKLINDDGTMVDQDG
                     GINGDADEDDNFLTVKRRFDAGDQALGDEDSDVSLSADGGDDEEEEEAITKDIKVVKI
                     SDAAEPLVIDSKRREKLLKSKKKLLKYKGHGTKIVFDEEGNAHNAYELEDEDKFHAHG
                     DADTQRVKFLETEAEKTRLADLEDKEVAKQKKREKKEKKKDRERELAEEEAEDAEQGG
                     RVAFLAPPDEGEFGADAAMSDYEDDRSELDEPEAATKKKNKKRVSFSDDDSDDDDDKA
                     RKTKRSKRSHKTRSAPDEPVEVNTLEDLEALATGLLG"
     gene            <434780..>436707
                     /locus_tag="TRUGW13939_00133"
                     /db_xref="GeneID:55987650"
     mRNA            join(<434780..435114,435174..435375,435434..435475,
                     435533..435681,435740..436204,436254..>436707)
                     /locus_tag="TRUGW13939_00133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483348.1"
                     /db_xref="GeneID:55987650"
     CDS             join(434780..435114,435174..435375,435434..435475,
                     435533..435681,435740..436204,436254..436707)
                     /locus_tag="TRUGW13939_00133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339241.1"
                     /db_xref="GeneID:55987650"
                     /translation="MSKADGEKRQLGREVVEDYGHHHLADDNVQHIVVADKLSRKLSA
                     RQVQMIAIGGTIGTGLFLGTGKSLSTGGPASMLISYAIVGAIVFITMLSLGEMAAFVP
                     VAGSFCTFAGRFVDDAFGFALTWNYWFNDAVSTASDLIALQLLLEYWTDNFPGWAISL
                     IFLFVVIGLNVFSVKAYGEAEYWLSLLKVVTIVIFIIIGVAVNCGGNTNHQYIGGKNW
                     HIGDAPFVGGIGGFASVFVTASFAYGGTESIAVTAGETKDPARTLPRVVKNVFWRILL
                     FYILSVLIVGLNVPYNFPGLSSGDTTTSPFTIVFQQVGSSVAGSFINAVIMTSVISAS
                     NHALFAGSRLLYTLAIEGYAPSVFGKLNRFQVPWVAVLSTSVISGLCFGASYIGAGQL
                     WTWLQNIVGVSNQLSWISIGFASLRFRAAIKKQGLEHLLPFKNWTYPYGPILAVVLNI
                     VLVLVQGWSAFSPSFAAVDFVSYYIEIPVMIVMFIAWKLFKRTHFVRLDEMDLVSDRY
                     DGGFTPDERAQLLDVAHRSPFSQDQSWKGRATAIGTWLFF"
     gene            <437440..>437706
                     /locus_tag="TRUGW13939_00134"
                     /db_xref="GeneID:55987651"
     mRNA            <437440..>437706
                     /locus_tag="TRUGW13939_00134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483349.1"
                     /db_xref="GeneID:55987651"
     CDS             437440..437706
                     /locus_tag="TRUGW13939_00134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339242.1"
                     /db_xref="GeneID:55987651"
                     /translation="MITSDKDIPKLLGTPTKQVEWAKKPVAEHLCSTAKRVYNPPMQG
                     LFSKTLFITLADDCETVIQFRTERLDINGFLTAKGELNAYVLGR"
     gene            <446941..>448618
                     /locus_tag="TRUGW13939_00135"
                     /db_xref="GeneID:55987652"
     mRNA            join(<446941..447528,447581..>448618)
                     /locus_tag="TRUGW13939_00135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483350.1"
                     /db_xref="GeneID:55987652"
     CDS             join(446941..447528,447581..448618)
                     /locus_tag="TRUGW13939_00135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339243.1"
                     /db_xref="GeneID:55987652"
                     /translation="MQSLLLPAPWFSNSHFGPHRFEFDTGHIPIHSRAPSTGPKPSLR
                     ADHPPPPMSGLLPTSTQSERAITTQHQRPSGFERPTSIDAARTNLPPTLPTFTSIGAA
                     SVTQAPRFVSPLQTGPSGSSSVQIPSINAGLSHTLTEPPQAYGLTASNSIRSLPPRST
                     RRAKAHVASACVNCKRKHLGCDSARPCRRCVLSGKASTCVDVTHKKRGRPPLKAEEAP
                     VRTFASAEGSMASREQFQISTARGHGHSRTSSREIRPITDLQYARPRGHSTAGPTVGA
                     ESIASHPPRWQPLVSPQVGPGSGSQRPLASPTAAPPPPSFTRANYPPSPFTHSPVTTF
                     TNPAPGSEFRPLLMYNDRPHAITPPTVSPQQYHQHYPAPLPSHINPQTPNRPGDTTGP
                     PIDSQDPSRDHGIRLPPILPSPTAFTHGSPAHSHQRSGSYSDLSGYQGPRSPRQGTQA
                     HVVPHESPRSFFDPSSRVELRSPFPPMPRPRTMMSALDQKSPLSQAQQLQGGTETATE
                     PGLDRRRKSEADTEENPQPAKRRRMAVDDIVNG"
     gene            complement(<449415..>450066)
                     /locus_tag="TRUGW13939_00136"
                     /db_xref="GeneID:55987653"
     mRNA            complement(join(<449415..449832,449978..>450066))
                     /locus_tag="TRUGW13939_00136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483351.1"
                     /db_xref="GeneID:55987653"
     CDS             complement(join(449415..449832,449978..450066))
                     /locus_tag="TRUGW13939_00136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339244.1"
                     /db_xref="GeneID:55987653"
                     /translation="MPGNEPSPTVHRRFNPIVNPTNVKPIMVEDHPSTDSLFFARPLL
                     GALIFENTASDARDHLANERTFLSWLRLSIYLAVVSSAITVSFHLRSSPTAIERKISL
                     PLGIVFWCMSLACLLSGFSIYVTTVTKYSRRAALVQSGWKTQLFFTVVATVIIGSCVL
                     FLATDPKK"
     gene            <450875..>452800
                     /locus_tag="TRUGW13939_00137"
                     /db_xref="GeneID:55987654"
     mRNA            <450875..>452800
                     /locus_tag="TRUGW13939_00137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483352.1"
                     /db_xref="GeneID:55987654"
     CDS             450875..452800
                     /locus_tag="TRUGW13939_00137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339245.1"
                     /db_xref="GeneID:55987654"
                     /translation="MAFNKAAPHGAGPSDEYSRSFTSSSPIARNAIARDLAYYDEDDG
                     ADIDDDGAPLVRATSDVLGTTPHSLAGSYRRPGFYTAGPRGTVVPHDSEPEQYLSKRE
                     LERAYSEERDLLSDSNVLGIRQSGSGSVSTLTNQLSSSLLHRAQSREAHEESQPPTET
                     EPTETSTLLGNQGRLDENAIDRKWEEAVTAGLIQSSWKREAQVIGTYSLPLMVTFLLQ
                     YSLTVASIFTVGHLGTIELGAVSLASMSVTITGWAVYQGLATSLDTLCAQAYGSGKKK
                     LVGLQMQRMVFFLWVVTIPIGLLWFFADKILVAIIPEKEVALLAAQYLKILILGAPGY
                     ACFESGKRFVQAQGIFTASLYVLLFCAPLNAFMNWYFVWKLNLGFIGAPIAVAITENL
                     LPICLFLYVYFIDGLECWNGFTWRAFENWGPMIRLALPGFIMVEAECLAFEILTLTSS
                     YLGTEALAAQSILSTISSITFQIPFPLSIAGSTRVANLIGATLVDAARTAAKVNLSGA
                     VIVGVLNMILLSCLRYSLAGLFTSDEQVIGMVAAVLPLCAAFQLFDALAASCNGILRG
                     IGRQEIGGYVQVFCYYVVAMPISMGTTFGLGWGLWGLWTGVAIALGLVFFIEVVFLSR
                     TSWEKSVEDAKSRNDVA"
     gene            complement(<453072..>454069)
                     /locus_tag="TRUGW13939_00138"
                     /db_xref="GeneID:55987655"
     mRNA            complement(join(<453072..453803,453912..454015,
                     454066..>454069))
                     /locus_tag="TRUGW13939_00138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483353.1"
                     /db_xref="GeneID:55987655"
     CDS             complement(join(453072..453803,453912..454015,
                     454066..454069))
                     /locus_tag="TRUGW13939_00138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339246.1"
                     /db_xref="GeneID:55987655"
                     /translation="MEGGYGNYTTTSYGGQGGMGGGGFMPGETNSPATGRQQENKSLR
                     PVTIKQLLEATQSHPEAPYQIDDADINVVFCIGQVRNISTQSTNITYKIDDGTGEIEA
                     KQWIDSTRMDDDMDVDGQGAKQSTRKKIELDGYVKAFGTIKDFSNKRYLGAHSVRPLA
                     DINELHVHFLEATAVHLFFKNGPPPSKSEDGGYGAPAKGAADDYNAGGMGGRPLPPMS
                     ATARRVYNLLKNEPQSNEGLHMQNISAKLGLSSTEVIKAGDELSSASLIFPTIDEYTW
                     AIL"
     gene            <454345..>457158
                     /locus_tag="TRUGW13939_00139"
                     /db_xref="GeneID:55987656"
     mRNA            <454345..>457158
                     /locus_tag="TRUGW13939_00139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483354.1"
                     /db_xref="GeneID:55987656"
     CDS             454345..457158
                     /locus_tag="TRUGW13939_00139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339247.1"
                     /db_xref="GeneID:55987656"
                     /translation="MPHRAASPALSESEFDISKALFKDDANSDVEDGWALSKPKQRPI
                     PAANLNLLDGDDEGEDDAAFIAATQAAANRKASNLKGRTVKKGGGFQAMGLNAQLLKA
                     IARKGFSVPTPIQRKTIPVILDEQDVVGMARTGSGKTAAFVIPMIEKLKSHSNQVGLR
                     GLILSPSRELALQTLKVVKELGRGTDLKAVLLVGGDSLEEQFGLMVGNPDIVIATPGR
                     FLHLKVEMGLDLGSVKYVVFDEADRLFEMGFAAQLTEILHGLPPTRQTLLFSATLPKS
                     LVEFARAGLQDPTLIRLDTEGKISPDLQNAFFTVKSAEKEGALLYILHDVIKIPAGPP
                     EAARRRIENRADNKNWSKKRKRPDTQKAINTTESPTKHSTIVFTATKHHVDYLVSVLR
                     EAGFWVSHAYGSLDQTARNIEVERFRSGITSILVVTDVAARGIDIPILANVINYDFPS
                     QPKVFVHRVGRTARAGQKGWSYSLVRDTDAPYLIDLQLFLGRKLVLGRQTEQVNYAEE
                     VVVGGFLRDTLSTHCEWVTKVLGDKSDLQAQKGVSNRGEKLYMRTRNAASLESAKRAK
                     EVVASDNWTSLHALFNDESSQMEAEREKMLARLGGFRPQETIFEIGGRRNGKKGNDEK
                     YETIKRVRSTLDKKKKRTAPEAKPEDETNISAEGNNGNVETAAFSDEDEAAENEPDNM
                     SMASESDLEVTFSQYSQSGKSKSKNAAESFQNAEYFMAYTPANTSLAEDRAYGVHSGS
                     NSNFAQASRDATMDLNIDEKVGFGEHRSGMRWDKRHSKYVSRRNDEDGSRGGAALVRG
                     ESGTKIASSFRSGRFDAWKKGKRMGRMPRVGDTENTTLSGDLNSSMSGRKYKHNKQQV
                     PKQLDKYRGDYEKKKKKLSLAKEAAASEGDGGAMKGKYNSGRAPKNELRNNEDIRRAR
                     KLKDNRREKNARPSKRGRGRGRR"
     gene            complement(<457382..>458398)
                     /locus_tag="TRUGW13939_00140"
                     /db_xref="GeneID:55987657"
     mRNA            complement(join(<457382..457617,457675..457867,
                     458222..>458398))
                     /locus_tag="TRUGW13939_00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483355.1"
                     /db_xref="GeneID:55987657"
     CDS             complement(join(457382..457617,457675..457867,
                     458222..458398))
                     /locus_tag="TRUGW13939_00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339248.1"
                     /db_xref="GeneID:55987657"
                     /translation="MSSTATVTETVPETVAITAENVATLFPDVDTSLARSILPATGGG
                     STHEGSELEGYDEEQHPLGIAGETGAELSAAIEGVKRAAQRKLEQELGIKAEQVPIDK
                     FEFLTRIHYLAPSDGKWGEHEVDYILFIQADVDVNPNPNEVQDTKYVTSDELKSMFSD
                     PALKFTPWFKLICNSMLFEWWSHFGSATFNKYKGEQDIRRM"
     gene            complement(<458839..>459258)
                     /locus_tag="TRUGW13939_00141"
                     /db_xref="GeneID:55987658"
     mRNA            complement(<458839..>459258)
                     /locus_tag="TRUGW13939_00141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483356.1"
                     /db_xref="GeneID:55987658"
     CDS             complement(458839..459258)
                     /locus_tag="TRUGW13939_00141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339249.1"
                     /db_xref="GeneID:55987658"
                     /translation="MHFPINTAIVLAITAALGASQTLTLTPYPTSGCSGSAGPVFTTA
                     ISDYSNFCADSAGWQAYQVDGDDSLFPVGMAGCDDDSCGSCDIDEACSSISASGCLNL
                     AHPDGEYKDSQSVQLSDGTLCDPGYLKMRRAVERSLH"
     gene            complement(<466002..>467033)
                     /locus_tag="TRUGW13939_00142"
                     /db_xref="GeneID:55987659"
     mRNA            complement(join(<466002..466159,466226..>467033))
                     /locus_tag="TRUGW13939_00142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483357.1"
                     /db_xref="GeneID:55987659"
     CDS             complement(join(<466002..466159,466226..467033))
                     /locus_tag="TRUGW13939_00142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339250.1"
                     /db_xref="GeneID:55987659"
                     /translation="MLKHQLPSRNLVPIPLYIAPHPINTMHNTSVTPKQGRQASSETA
                     YGLNDPYLDLTRSASVKMEPQDYSPPTTIGLGIFQNVPAGVPVTQSLSIQNWPNQPVI
                     GTSACFHSAMGAPDYSTLPYFQQQYPSGPVIGQPTMPFSGLVPHDQNSPVYYSSDISA
                     RSCDSPIYGEASSWSITPQSQMETPLRYPKQEPHINSPIWEASLSPTRPTLSSTPIAL
                     GQQHVDSTVGRVNTKPLDQSPSLDGTESVAESDACLHVSAEGSTSPDPFTSGLCCKIC
                     GKRFTRKANCLDHAKRHDPKQRSEFPCHECGKSFGRKTDLKRHFST"
     gene            complement(<468847..>471996)
                     /locus_tag="TRUGW13939_00143"
                     /db_xref="GeneID:55987660"
     mRNA            complement(join(<468847..469221,469401..469490,
                     469572..469647,469896..469924,470009..470023,
                     470094..470112,470175..470259,470454..470496,
                     470788..471061,471112..471636,471694..471831,
                     471881..>471996))
                     /locus_tag="TRUGW13939_00143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483358.1"
                     /db_xref="GeneID:55987660"
     CDS             complement(join(468847..469221,469401..469490,
                     469572..469647,469896..469924,470009..470023,
                     470094..470112,470175..470259,470454..470496,
                     470788..471061,471112..471636,471694..471831,
                     471881..471996))
                     /locus_tag="TRUGW13939_00143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339251.1"
                     /db_xref="GeneID:55987660"
                     /translation="MVARLSQSFSSRMLDDDELDMPEIGNENSMEEVARKIARYIIAA
                     IPDVPCTFDDMRSSVVGQRLRPLVKYLSETVHNQNLIRALMVLKWHFDNLPDDEIGLN
                     ESRGYACEFVAWQFLTSLSHRETIEFLLQDLLDSRQHSINIGDAERGSSGYAAITEEP
                     RISHERTPLLSASASSGHGFFESNRSFSTGVTFDATSIYGTHSEFDGVNALEIAAIVH
                     AKKFLSQKVVQKIIDDIWRGEIIFWDSLNVHAKKMPHVLRKKNIDPYCRLRIPIYRKA
                     FEAVFFISFLVIYYAVLAQRDPNSINMLEILMYIWITAFAYDELSGITDAGMLFYQLD
                     FWSLWNVGIIGVGIAFLDLFPSQPEFLFWELGFLTTFTMLARDRLTLSQMSWILVKVF
                     FGSATLGLDVAQEISPVFGYGLMIIFVCMTNILLISSVISLMSLSLEGVMAHAREEYL
                     FQWVSLLSFVAQKSEKLADMNLIPLLCLRPLRLILSSEALRRLRIVLLKITHAPFVMI
                     ILAYEARGRRSRQTFEMRPPPSPATLSSIWRESQPRRTFAGRATIPRQPSPRSLGAGK
                     KRDDGVDSVEDRSEDGGSAVGSWRERVG"
     gene            <472488..>477459
                     /locus_tag="TRUGW13939_00144"
                     /db_xref="GeneID:55987661"
     mRNA            join(<472488..472701,472753..472873,472929..>477459)
                     /locus_tag="TRUGW13939_00144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483359.1"
                     /db_xref="GeneID:55987661"
     CDS             join(472488..472701,472753..472873,472929..477459)
                     /locus_tag="TRUGW13939_00144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339252.1"
                     /db_xref="GeneID:55987661"
                     /translation="MGQGYSLTTLSAGSAGIDVPELSDLVYEKSLGSARFMKSIRARQ
                     PNGLAFVKVIMKPYPSLQLDPYVKTITRERELLASVPNALPYQRILETSTSGYLVRQY
                     VYSSLYDRLSTRPFLEHIEKKWIAFQLLCALRDCHSQDVFHGDIKTENVLVTSWNWLY
                     LSDFSSSFKPTFLPEDNPADFSFYFDTSGRRTCYLAPERFLEAEEEPEGRQVNWAMDI
                     FSAGCVIAELFLEAPIFTLSQLYKYRKGEYSPEHSHLSKIEDRDVRDLILHMIQIDPE
                     SRYSAEEYLNFWKHKTFPEYFYSFLHQYMSLITEPASGRTHVDGAEARTMSEPDERID
                     RIYFDFDKVSYFLGSPPNHPGDGSKLTTPQLTSQILPVQLDLSNTQLEGSKMEPQEGA
                     LLFLTVVVSNLRNTAKASAKVKACDLLLAFAERIPDESKLDRILPYVMILLNDRSDIV
                     KMAATRTLAQLLSIVKVVSPVNAYLFQEYIFPRLKFLVADSASRPSPMVRATYASCIA
                     SLAQSSLRFLDMVQALRTDARLRSVIPAGSEGDWTEDASFHNLYDVARGDHLDFFEEQ
                     TKALLTDSDSSVRRAFLGSVPGLCVFFGNTKTNEVILSHLNTYLNDKDWILKCAFFEA
                     VVGVAAYVGSVSLEEFILPLMVPSMTDSEDFVVERAIRSIAAMADLGLFQRSVTWELL
                     HIVVRFFSHPNGWIREAAVHFVATCSKYLSFADKHSILTPLVRPFLKTSIIAISECEI
                     LDALKRPLPKGVYDMAMVWAQKSEKGVFWKAANRDSVFSLSTNDGLVGRNFPRHVSLS
                     ALSRNEEDEQWISRLKSLGMTPEDEFKLFVLREYIWRVAMRSSRVSDATGPSHLNSFI
                     TLTQSGITPQTVFFDKTQGIKQRRQSTGHISPQDDKSAKPHTIADALLDASTSIDSQT
                     TMSRKHQRALTNRAKESGSERQAPSSAAIESLKTDSQARSASSSPVHQTSQESSTPST
                     DIEQGLTGKPQDTDKGSDRGSIATTTDTNLTPTGSLNRIERKTSAMSLLNRKDTGKAY
                     AETSMNSMNAFGKVDIPSQRKTPTSPLAMARENSTEQNAPQKYQVGHSYNGNDPMILK
                     LLDNVFAENYPTDLFDLGPFVKEADSRRAIKRASGENTDKPWRPEGVLVAMFGEHTGP
                     VNRVVVAPDHSFFVTGSDDGTVKVWDTTRLEKNLTPRSRQTYRHGAGTKVKCLTFVEN
                     TYTVISGATDGSIHAIKIDYHKVNETVRYGKLQIVRQYQLPIAQDGSAEYATWVEHFR
                     YEAQSTLLIATNLCRVLALDMKTMRPVYTLQNPVHHGTPTVFCYDRKHSWLLVGTSHG
                     ILDLWDLRFRVRLKAWGLPGGTAIHRLQIHPTKGRGRWVCVTGGSGHGSEVTVWDVEK
                     TQCREVYRAASPSTGANNQGLANGNPSSHRTSVVNNLAAMNTVTKSYEPWRVDEDRPE
                     GMLSRFASTSAAGIEPNANSAPSSAAFGDRNGICALNVGYDSPMDGKDSTKCGFAISA
                     GSDRKIRFWDLARPEFSNIVSGFDAASDAGIAATPRYESVQPTPSLTVTTEHMPNIPG
                     TNGRGEGRGSGKKGSSASASRPPRSTVISLQQQQLLKSHLDSILDVAILREPYGMTVS
                     VDRAGMVYVFQ"
     gene            <480576..>483513
                     /locus_tag="TRUGW13939_00145"
                     /db_xref="GeneID:55987662"
     mRNA            join(<480576..480956,481015..482034,482087..482323,
                     482374..>483513)
                     /locus_tag="TRUGW13939_00145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483360.1"
                     /db_xref="GeneID:55987662"
     CDS             join(480576..480956,481015..482034,482087..482323,
                     482374..483513)
                     /locus_tag="TRUGW13939_00145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339253.1"
                     /db_xref="GeneID:55987662"
                     /translation="MAPSLRDHSSFVRPSTRDRPVTRDQVDTSLIVPSRTSSLHSRIT
                     QPIPSTLNLKPAQRTPKTLTHAYMVCGVGREPAQWVKAPAPVQGKVQHMKGAVGQFWL
                     PEILGSSPRLEQDNEIARSLHAAMRTCFPHDVEICTGKSQPHCVHHSFVLQQDSSHTL
                     YGIALKVWSRADEKRADTIRELRKKTEPDYYDNPDETYWIPYCLSFLSRYPLYDLLGD
                     YLRGMWIHWNKATNLFHAEEVSRILSFPAPRLNDLVRIDMKDYALCYQFPSSPTGFQN
                     FSMWPLFSCLSIPNIVGVIEAAVSPTRRIILSSHHPAILTVAAETIRFCVRVYEWSGL
                     YVPVVHARHAKELVEEPGPYILGISVECRSLFTAPSDALVVDLDRNFVLTSSPPNVLN
                     PKQRTKFVNRLTQALSGDVTPSGVPSHLRSAYGGGKLVPAGQIIVMKGEVESVQDPSW
                     WNQDGVMSVMDHVCEKLGRNTGVKALFGGSVKKPLMTKVSMRHLNEIVRERNQYSRDA
                     MEAWQDFINLKGRLDTELSKVTKRNNFLVEELETWKQQFLKFQAFAEQLTKETSDLKI
                     KIEGHKRENRRLSGLIDQQKDDVARLTLRLSGTEKQRDDALEALVLQQEIAEELERER
                     KRNHKDLSTMEHRSASLSRQRDEAQRIVVHLRSLIEGQTHHMEHIIRNLAVSPDVSEY
                     IEQQTMENSQPQNESLSARTQTESPQSMKRLSRPGSRVRLSSAFSSRSNSFNDTSNNV
                     SPEMENHLQNMDKSQRRLSQMSSTDVSDRYLRDKTDAIAAIIRNISEQCAAAVEGLHL
                     AQDAENEEGSIKQEGHAAPSEQSRDEGSEMGEGDSNYSADNRTSSIPPTPDLVHNRSS
                     TSMSMVSTSTLAERSSQQYNPGDIPTKIVEDEDEHLHETEGYGDHNEPSAVSKQRSQD
                     IVLPSGPHVVS"
     gene            <484354..>485510
                     /locus_tag="TRUGW13939_00146"
                     /db_xref="GeneID:55987663"
     mRNA            join(<484354..484478,484549..484580,484637..484967,
                     485054..>485510)
                     /locus_tag="TRUGW13939_00146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483361.1"
                     /db_xref="GeneID:55987663"
     CDS             join(484354..484478,484549..484580,484637..484967,
                     485054..485510)
                     /locus_tag="TRUGW13939_00146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339254.1"
                     /db_xref="GeneID:55987663"
                     /translation="MTATAKRRLQALSQQLVEGIPDAGTFEDIPRIRTVAGDSVGPRL
                     KDKVAIITGANSPLGIGRASAHQFAHNGAKAVYVCDYDETYLATHKREIESLYPGVDV
                     HTRQFDAGDADAVKAVVDDAIARYGRLDVMFANAGIIGTPKVFTDIDSDGFMNTLRTN
                     TLGVFLAVKYAAPAMKITSEAKPFPSGSIICTASVAGLRSNAGPTDYSASKAAVVNIA
                     QTTSYQLSGTGVRVNAICPGVIETGMTKVMYDAARARGTQQKIGQLNPLQRGAVPDEV
                     ARVALFLGSDESSYMNGQAVTVCGGLSAGHPFVPGKLG"
     gene            <486065..>489442
                     /locus_tag="TRUGW13939_00147"
                     /db_xref="GeneID:55987664"
     mRNA            <486065..>489442
                     /locus_tag="TRUGW13939_00147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483362.1"
                     /db_xref="GeneID:55987664"
     CDS             486065..489442
                     /locus_tag="TRUGW13939_00147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339255.1"
                     /db_xref="GeneID:55987664"
                     /translation="MADSIFVTPQRRSSSQASSSSRRSQRINNNNSSNKSLRPKQAKR
                     LSGLSIASSTTTNTSTTTTADLTSFPSLSPNGSPEASRTQPPQSYGLSQTLSEEPGNL
                     EDGSADVRRGRKAALDRLTSSLSQQSGRSALFDDSLLSTEMPGALHLADSAHIERLLE
                     RSGAVAVVRQYARDLAIRDAEISKLRRRADARERELKKMLRESGVSSQDTERRLYDLE
                     NPASKAASVAGDVEDSKQPLPKPSINGLMDQAMLDPVGEDEPDHADLHATLRPHRNDD
                     DSKSGSSSIESNTKRKSGTVRMWQDYIFGSTNTSRKTSRASSVVTDADDLEDSTGRAN
                     LSNNSHGRRKGLDDRLFQPPVSRATSPARAADSKNADASSVHSRKSSRSVTSWTVKLF
                     AGGSQNKDTPAPSSNDRSRASSLGQDKLKSNAKSAVNSSNKGSLSAVAALKRINSYNG
                     SNTLPSTSSATPAANRASQRRATGASPLNPPNADRSNETAASNLGPVEMDAILPMESR
                     PPTLTSIYGNYQPGDLLTDRFGFIYDQRRKKRQREATLLKNKANRNSMAETISSYRSE
                     DPTDDIDGVYGSIQPGSETRPSSAGTPVSIEEADNDGPITRRWQDYLRIATRPTELLS
                     HTPSAAPIVGIATSEGAPKRQASSVALDKDGALSVGSSSQPTASTSAIVADSPEFANA
                     AVRPPATTTFTVVNEQEPVKMLLEQLTELHDVLQRDRTTKWNEFLRKVRAERRREGEA
                     AAAMDPDRANLSLSTPEAALVDGEVVGIAGLGNKGKVGRNKWREFRSLVLSGIPVAHR
                     PKVWAECSGASAMRVPGYYDDLVKGVSAVDVDAAIVSQIDMDIHRTLTDNVFFRKGPG
                     VAKLRDVLLAYSRRNPEVGYCQGMNLIAASLLLITPTAEDAFWILTSMIENILPQHYY
                     DHGLLASRADQQVLRQYITEVLPRLSAHLEELGIELEALTFQWFLSIFTDCLSAEALY
                     RVWDVVLCLNATSTIHNGAPGAAKTGNRDKGTSAATGNGANKAAEEEEVASASGGGST
                     FLFQVALALLKLNEQQLLTTCSTPAAVYTYVNHQMTNHAISIDGLIQASEALRNVVQR
                     EDVVARRAAALRHMKANSFSYDNSGSGDERVSQGGAS"
     gene            <489947..>495892
                     /locus_tag="TRUGW13939_00148"
                     /db_xref="GeneID:55987665"
     mRNA            join(<489947..489984,490065..490802,491950..495461,
                     495546..>495892)
                     /locus_tag="TRUGW13939_00148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483363.1"
                     /db_xref="GeneID:55987665"
     CDS             join(489947..489984,490065..490802,491950..495461,
                     495546..495892)
                     /locus_tag="TRUGW13939_00148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339256.1"
                     /db_xref="GeneID:55987665"
                     /translation="MASSSRPSSSLLYSCIAHGTTILAEHSSPGASSTSASSLASIIL
                     PKITHDKPQKLTYTHDRLFVHYIADSPSGRTHDDGNSSNQQEISSYSSLSYLVVATAE
                     QGRRIPFAFLLEMKRKFLAAYPPSTTQFSALPAYGCAAYNAELRALLQQYNTAPPSDS
                     LASARREIDSVRDIMTENIERVLERGERIDLLVDKTDRLGGSAHDFRMRSRGLRRRMW
                     WKNVKVMVLLFVVIVFLIYLFVGMGCGLPGWDRCVGGKESDEYVIWLRRSKFCRSMSS
                     YPNFYNSYQHSNNNGGKRNLNNNYAGTRQPIQPRPQGYMEATYDWNNQGASSTTGYNN
                     QQLNNSRTTTDNNDVYSSSHSYPSQPGDLSNPLNTYNNHNNQVAQTQEDKLQSSGLNS
                     LVYASALESAVRNIPDQPGYNSSRQDGRGPYPAARRTVSQNYTSSTSNHTSLASGRTG
                     SYDSQSQRPGFLAQPSTASHGHPAKQTSNNVPRQQPANNISQMSQQQRNPPSRANPQT
                     HTQQWSNDQRTPPLPHSMANMPSAQTHTHSSFPLDTSAQNKNSSRISNSRTTPASTTY
                     GHPPGHGNRPGTSPPSSGAETAGSHQISPPKVQFINPNELYNQQYLLAQERARASEAE
                     AAAARQRQEAEAKAQAEAAAAATATKDTTTGNGSTPTKKKPAKRRAPKKKAGDKAQEG
                     GNDMAAEMQLMLEKLKGMRAKDPSLFSKLWDDIKKTPAGSQPAPTQRQQDTNSNPSAT
                     GTAAEAASITTNETPKSTSKKKGIPQNHLIDGMPDLGRFPAQRRRRKDKNEESGSALA
                     TEANVNSMLNQAPESFSAVEQLVSITHPAAALENQTGSTSTQPATQDATWPASTQQKL
                     ARAASEYLAKNPTNLEKQCSPEALMLLLRNNPSYPDLCMQLESRGFDLDRQALARYLL
                     AAVPALASGNNACQEPKKGDANGQPSASGLTLAQPTQQAPQPTPLPGTAAPAKPKAKP
                     KKNPQTPGPPPLQHPPQLPRAEVLVWDGNAGPTSSMPMENGTPSTSAPPKNKASSYRR
                     KPAVQSTLIPPVLGLGPKAEKAKKRLFSEIVDLSQLSSDEEDIDEPSEDETFPRLSKL
                     SRLEGPSVERQLNHTLDQDSMDIDTTSPPPFEGQRSGSPVTGDSHVAEPDTEDFDPDD
                     EQCLNSLKSFPRISKLLEPSAALQRVYYNPKSAARDILIAAGRHPSERPLNYHLAKFL
                     DIFTGVSVKSDLESFRWDLVDPGGPSMPVVQAEDILAEPPRVPRKRRRDKKSRADTGD
                     DKSGPTSDSLNNAQAPSDPLQSHSFTFSTPQNARSMAGAPTSGRGSGRRGRPPGAKNK
                     NTTKTALKAAVAGSARNAAAAPVRQAVPEPSYPVFTCEWASCPAQLHDVHTLERHVDK
                     VHVVGQTSCEWSSCPNANTQYVGDGLGEHVQQAHIEPLAWKYGDGPAVKATVTELDRY
                     LTADGSIVTPDASMAGESDSLIYPVESKSSIKAFYKVHGTEKPDKQAQEVLLAVRRRQ
                     QRVGIGLEQEGCEFSNPKRNKAIVNDEEFYQVVSEEEADGDNWFQREDSS"
     gene            complement(<495929..>496415)
                     /locus_tag="TRUGW13939_00149"
                     /db_xref="GeneID:55987666"
     mRNA            complement(join(<495929..495964,496209..>496415))
                     /locus_tag="TRUGW13939_00149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483364.1"
                     /db_xref="GeneID:55987666"
     CDS             complement(join(495929..495964,496209..496415))
                     /locus_tag="TRUGW13939_00149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339257.1"
                     /db_xref="GeneID:55987666"
                     /translation="MISDDDLFSLAIFLGSVAMLLIVLYHFLEVNAKSDGQSDSSAAD
                     STAAKKIPLGADPVAFTPGSAVASKSLMLSSQLKTP"
     gene            <497907..>499739
                     /locus_tag="TRUGW13939_00150"
                     /db_xref="GeneID:55987667"
     mRNA            <497907..>499739
                     /locus_tag="TRUGW13939_00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483365.1"
                     /db_xref="GeneID:55987667"
     CDS             497907..499739
                     /locus_tag="TRUGW13939_00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339258.1"
                     /db_xref="GeneID:55987667"
                     /translation="MNTSPYSYTLDSTSMSSAGHNASNMSNGNAAPASGKGAGGSKPS
                     GPSPLACLTCRQKHLKCDGQQPVCGRCMSNQLFCEYTPSRRGYKGPSKKRRADPPPTD
                     PSQMMSDPRLFALDGRNPEIPSNWNMPSSGAGPISTIPPAQTTPPEMAQTPAHPSGIQ
                     SQVVNARSPLTPDSSSTVGADGYLVDVYYSNFHAAHPILPPLHKLFRNSPPHYLEQVI
                     KFIGAHFTTAASPETYRPYVVAEVVDQPPSPEKVQALLLLTIVLHSRNEREEAGSMLA
                     QAMDLAYDIGLNRRSFAETVGEADPIREESLRRTWWELFVIEGMLTALGVRASFTANT
                     IPLEVPLPCEERIYQDGGLFPLASPPTIAQFDDRVFADEDIDFSSFSYRIEAVRILGR
                     VVSLSEMVTGQQELVESVDARIVSWFHHLPESKMELMLADGTVDEMMFQAKMIVNGAS
                     IYLHFPRSDLLSSPAVAAEVICGHSGLCLMPAFSHHSHAMKAVKAASEISNLAAIRMP
                     ETKHTPFFICALVLSSIVQLAAYSVKAGQVPDPRRDRLSLTVGVFRSLGKTWAISQSV
                     NRQIRAVARDVLDIGVRPATDQNSLDFTAFLEGNQFWLSNAQVV"
     gene            complement(<501139..>503574)
                     /locus_tag="TRUGW13939_00151"
                     /db_xref="GeneID:55987668"
     mRNA            complement(<501139..>503574)
                     /locus_tag="TRUGW13939_00151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483366.1"
                     /db_xref="GeneID:55987668"
     CDS             complement(501139..503574)
                     /locus_tag="TRUGW13939_00151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339259.1"
                     /db_xref="GeneID:55987668"
                     /translation="MAAPQDAIAPSQTAGYPAFLSQETVGTAMDSPHRNSINPLASAR
                     QKSDKLMSNLRMPLLLFTDDEADTLVYIDAAESEKAQQHRWAALSQSNGNNVVPQRMH
                     SRKILGAGSPVLNMHFEPRKQARVRRRYGLTNNMPAGIAHVIDLTPPSEGEDAVIFMT
                     ELSCPLGVRKWAQYATTWRLPSLCVGGQDEVEWITVTEPEPEPQETLPLKKKKSSPAK
                     ENKKKKQAAKQQQPPRILNWSGNLPTLREDPPEKKVVVPKVEKLPPRVTTVPGLPLDY
                     SPIRHRTCLERILHALEELNPELDTPPKLWTFFALAKILGVAENPLIGDHVVAWLYAG
                     SNPLFVEINPELAYKIACGLKNSQLCQDSFAILVGEEALSLLNSSVQGQVPKRETETM
                     HGRTREQLDDTEIQRIEYASKAFLDKMLNEFVELAGNEMLWLDKLVRRHIKGKLEPRH
                     KSMVDDFVKFCKECVRDGIYRVLRESKPTINSFDYPIVSDSGYPNLKYRSAMDNMPFI
                     CRILTRTFWKSLQECPIFLDGTSRAMSDHWHTSLKELGPMLPNLKHQDSATIRWISGM
                     EYANTERRFHINANNFHDSMWSSAAMQGYLEMHPDLTDIIVRFDSSRCETDITHYLSQ
                     FANRVTSAFTERLPRNDGVKFELIDTLVSLGEEELKFLPLWAGGNDDGTGGVFVDHDL
                     PIVESGGFSTAGPSIHTGSTVPSEGSMSSFDSIRPDDAVSTVQRASHEATDSQATTTV
                     RSAFSTASSSFEIVGGVRGMDIQSDHSIADDMDYEIGVPDDVDDFVFDGYDDNDDNDD
                     ANDTIGDSDGELI"
     gene            <504225..>504548
                     /locus_tag="TRUGW13939_00152"
                     /db_xref="GeneID:55987669"
     mRNA            join(<504225..504280,504338..>504548)
                     /locus_tag="TRUGW13939_00152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483367.1"
                     /db_xref="GeneID:55987669"
     CDS             join(504225..504280,504338..504548)
                     /locus_tag="TRUGW13939_00152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339260.1"
                     /db_xref="GeneID:55987669"
                     /translation="MAVTSEGSLVGFIRRATVSSRNRALISIVSVVGGTVLLFRSLRT
                     DKKLVTSQERSAMHGGNASPTAQTDQGTLRSSPRPNLEIRRKKD"
     gene            complement(<505137..>510586)
                     /locus_tag="TRUGW13939_00153"
                     /db_xref="GeneID:55987670"
     mRNA            complement(join(<505137..505346,505399..505707,
                     505764..506691,506750..507370,507431..507766,
                     507825..508583,508653..509539,509632..510442,
                     510510..>510586))
                     /locus_tag="TRUGW13939_00153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483368.1"
                     /db_xref="GeneID:55987670"
     CDS             complement(join(505137..505346,505399..505707,
                     505764..506691,506750..507370,507431..507766,
                     507825..508583,508653..509539,509632..510442,
                     510510..510586))
                     /locus_tag="TRUGW13939_00153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339261.1"
                     /db_xref="GeneID:55987670"
                     /translation="MTPEARRQVEEAMLIKDELIGSSVITLAKNLYKSSARFVFELLQ
                     NADDNSYTRAKTSSTDPYVSFHVYNRRIVVESNEDGFAYQNLVAICNVGKSSKTGAQG
                     YIGEKGIGFKSVFMVAWKAVIQSGDLSFCFQHRKGDSGMGMISPIWEDVEDVVPSHMT
                     RITLFLHGSILDDDMETTLRQFQEIESTFLLFMKNLKKIYVTMYDENDEQHSCAIYSI
                     NHQSGTLVDLKSEILKNGETEVHSKHYHLTKGIAHGLPMSDNRKYTDDDISRGAYKTA
                     EIVLAYPLDDRSIPIIQPQHFLIHTDFDTDASRQDILKSSARNIRLLDGIAETFIKAT
                     LQFCKHSTLRYQWMRYLPQESDYPWDDFWGKLLEKINLSLQETPVLWTRSHNSLHRIQ
                     AIRRLRHDMLDEEGNPLFPDSTPERYLAAEYSITDLKRLKSYGLTSMQVKAFLEKVRL
                     DLDMDSDSYVKASSTDEGWHSRLAKFLISAGKDYPFTVQTLGIVPLVEGIWTRSRNIS
                     IYYSHAKGYPIPTDLGLNLVDPQAEKNPQRKQLFDSLGVENSKISDIRNLILDKYRYT
                     SITVQDLATSRNHLNFLYLTMHLDMAPRNDMVYFSDDKPYGAWDLFQAVGCDTISQRV
                     DPGFDVSFIHDEYMENPPSQPEGEHRSWRTWLRDFLHVRNFIPLFTNNGLSTPDYHLS
                     GECLYVAKHRPEKFIGFLLENWKESDSEELHKTPGPATDLLQLEVLCEDGTRYPLSET
                     YLPIDEHKHAKKFLDDTDFFPWLRIEDSLNNEANLSKLRVLATRFGFGYPKSDVEFYL
                     RILLYVYLSDIDATDVNRETRIYELYSRIEARYRESVDRDSCRRQVKHAFLSSLIYVP
                     AIGSQAACWAEPEKCLWDAPVHMRTKFSLQPRYENVQNNSYVKYLFCKIIEIPDANVD
                     DLIEELRNIQDIETPDFDHISNIYGEIHTMAANMDNSECDRLRKEFETKKLIYVSADE
                     STTCGWYSVSECLWSTTTGIKGMTTISEQYEEMFDFFVEYLGVPTLTLEMVVDKLAHQ
                     GAEETSVKDIKDTIWRLNALLQKEDKHPSSDRILKRTVFPVRYPGEGVGLCSSETDFA
                     IADREHLSGLFSGESKTLDFEVNDIIRLGPFLRWTNLESRYLSCCVKELSALCSGDSQ
                     KLVAHDRDIAPKAHGLLRIAVHFGSPRVRSGEQPFYDELQKIEVHETDGISSQLHLSQ
                     DGKVIKVDLSSSELHLQDHKDGLKIYVLRDEEIQYQCFLDRMPKALLEWIMTNPKTGI
                     CERFNDKAINVISTVIQAQNKFISMAMTRAGIMSVETPDNSVNDEQNETPTPLSRPTE
                     EGDNSTESEGDSDWDRDTLVQDIRHPSSHDDLVGVSNEESETYTTTARSESSSSRALN
                     PLTITPQRGIASSHIPSPLSVAQSGQVDLEYLRILSSVVTAARRALFPSRGIFDMEAL
                     ARSLPTVLPENNGEYFGLRSSEKIERDKKIGAAGELYVFEVLSRLTPALPGFSRSNWE
                     SNIRKYVTIHHDYTTLDSWSGIETADITYYDSESILTNFLVDKGYLNGSEWSGKRPRY
                     FLEVKSTIGPCENAFFMSGSQYELMQANSNGPSRSGQQNSIYIIFRVFNVGKDSAQMK
                     VYVDPEAMRERNELRFTAKAWSIVPGSSQIREPIN"
     gene            complement(<511189..>512353)
                     /locus_tag="TRUGW13939_00154"
                     /db_xref="GeneID:55987671"
     mRNA            complement(join(<511189..512261,512317..>512353))
                     /locus_tag="TRUGW13939_00154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483369.1"
                     /db_xref="GeneID:55987671"
     CDS             complement(join(511189..512261,512317..512353))
                     /locus_tag="TRUGW13939_00154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339262.1"
                     /db_xref="GeneID:55987671"
                     /translation="MAALPTVRWGIVATGMISSWFVEDIVLERQDAKVEHVIQAIGSS
                     KLEKGQDFKNTFCPKQNPRIYSSYEEVYGDADVDIVYIGTPHGYHYRDCMQAIAAGKN
                     VLCEKSLTINAKQAKEIFEAARAKNVYVAEAMWLRHRPLFRDLGRLLHQEKAIGDVTR
                     IFSDFASGVDIDSLPPTSRYRDLTLGAGSLLDIGVYALTYTILALEGDAPGRSEFPHI
                     LATQTHEAGIEITTSAILHYPSTGRQGITTCTTKTFGPPGEVFAVVHGTDGFIEIEGT
                     APSIPLAFTVYSKQTGIPERAYFPKESFQGKRYEFPNVGRGFVWEAENTALDVLNGRK
                     ESEIVPWAGSIRIMEIMDEIRRQGNTVYPGERRRD"
     gene            complement(<513949..>529287)
                     /locus_tag="TRUGW13939_00155"
                     /db_xref="GeneID:55987672"
     mRNA            complement(join(<513949..515297,515353..523167,
                     523229..523557,524344..525682,525744..>529287))
                     /locus_tag="TRUGW13939_00155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483370.1"
                     /db_xref="GeneID:55987672"
     CDS             complement(join(513949..515297,515353..523167,
                     523229..523557,524344..525682,525744..529287))
                     /locus_tag="TRUGW13939_00155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339263.1"
                     /db_xref="GeneID:55987672"
                     /translation="MKDPSRLARIAHEAGASKYSHIQRLRPLQPLEPRPQWASPADAA
                     AAREILVQQRTQNLTWRDPTKQKRRFLRTKAKNESLANPENWSFSRAERSVALDDWIR
                     QLGSVGVAQALLDFGEPLDVNLIETESRDKDFSELEVPQENDWLEYVACTGSLEHVVL
                     LASYPTRQSAKDRALSVALSGRRMSVVKELLRYGANPNNGLCDAYFLPAVVEGDLELV
                     GLFLSALNPLTNAAISTALVKAVETCNSHMVSLMLAHGADASHDEGKALESAVLKNRF
                     QDLALICWKTQRQLSSAGFSKAISTSCTVQDKYERNSTLNLLLCAGADPNHSALEDLL
                     LQAARIGSTSTVSLLIAHGTSPNRRDGEPLQVAVQSRRIDLVEIILQSTSVSSNSTSK
                     ALQQIPEEASDSEFHELATCLINKGVTEEALNVCLARVVGTQRLNFFVPTLVKQGACL
                     DYDDAASVRFALREQNMTLLETLLIAPCAAYNLAKAIPDAMAIPSGLVRRNTMDLLLR
                     KGVSGPELHRALRTAVGEADGRRVDYELAELLIRYKASVDFVGSNGNCLYIAAQRRDL
                     TAIELLCRGQPSSDTTSAALSLVLTGSGSSSSFDHADTYKILSVLLRHGACGEPLAQA
                     LIDAVQQGCDVRTIGLLLDKGADVNYKNGKAAEYALSASDIISLKLICESGRLEQGPL
                     ERLVPQALEPLLFSIDKAGYLLRCCVKYSAILDSTLLLEVASMGRRREVIQLLLELGA
                     SVDHMEAAALGHAVTEGDIDTTKMLLLKNPARNHLPALLKVASKIDSSKRQRLSMMQL
                     FLSHGGPGIGQDDVLVQEIELVSTREDDLSCIKLLLDNGASVDYQQGAPVQAALDRNQ
                     IPIFDLFISQRPARVSLANAFSSGRRNTALTIQERWHVFDSLFKAGMGGNNSDTESAC
                     LALIEAVERDPSDTTIPTLLVKNGASAEYEQGRALQSAVLSASAALVELFLCQQEQRP
                     NINLINRAFGSMISSRSIDLPGGFKTAKLLLEHGVQKSLIDNAMGKAFSTTTGYTSKK
                     EVSLFLSHGADVNSGSGTYFVHAVEKEDMELFHTLVASGQPNISLIIPALIQSIAPEK
                     VLVRYLRVLLASKPSNVPIEPSTLFMAIKRFPRGEELVRLLFEYGCVSNSTTVATISP
                     VVGSENINLVIWALLRGNPKVSDEVIVAILQAGNEDPSFMTPKTRLSATILAAQSQRH
                     TVLIELVVQKADVSCRDHQNQSALFYAGRNGDRESVKILIHAGARPDDGSLHEAAREV
                     HPKVVSLLLSADHDASFPSLLHSDEACFGRTALEELCLKAYRTSDDNGNWNTRIREII
                     GMLLPRSYQGTEMKKNGNKKSILHVALDNAYPFDVTEALLEFPQIWKFINEPIHQFES
                     PDGLVYSPTKYVEHFYRGPQNVTKELIRLLRGKRCQDVYYSTRPDNQPDDAVGMPEEI
                     AKEIANKKRMEREQQYEMERVNALAAHQREVRMQDHHLDLRMSDERHEKTMKQAQDRE
                     TWEQRVLQDKHNLVIIHEQSLGRQRRNESQEDSHLRLRLLSDESIHKQSLLEVERNGE
                     IQYKGRLMIQERDAEQAKMEIQRKLMWERDQIDEKQHGRQLQWIERQDLSVKNRATEM
                     KAIAEAARTANMPPTMLQLVLSKLVTENMASTKDFKLNASQLEYIFNHVFLPPNVPQN
                     DDYQDSNEKVLLRVVGYAINKFKNHVSHDMALVIEQVGSMIDRLSMLLDRDGITDGKR
                     LQDALANLGTEGGFLLLHIRAQNCGILMSRVEDSIDIEAFEVSPLNSNVISTLGRLRR
                     TFPGPALSMSVEKFKNNDFQVAVAETLAKMSHQTAPKTKPQVRKKGMLQDEGRDTTHP
                     KLVTELFFNFLRPQCTENKPFTIVKNTREEVMWLDCKQPWHRSSLWLLVRVGTQLALS
                     RSSKESSMPNESYKVFMVFFLTTILDLSCQAGGPCEMIYAMQAKICRRLLKLDSLGKS
                     VKLDYIEHILQKSSAYLQSKWDSIISDSEPKISLHLGESNLTLDTMHNLPEVDDFIQE
                     LSQLKSNQTTKGLFSPPSKLAKFYESHIPSLDGIAEDDYIVYNLKAFESWVEKSLNVW
                     VSNNMNEQTACGKLSKLMRRYHKLAALLYAENPEATSEMLLIITELWIACDRCTISID
                     DTIRQYDVGVPDKLFQCFILRSRPQMQRLYEAENYIRSRRDEAYHKPSETFQGFGSSN
                     CYSVKYFNRSDELQNLKRDIEAHAEQKKTLKIQELHEKKELYKKLMGEHKASYHDQEE
                     VVVDYYQDIRENRCKSYCRKCVCLQRAVSMKIDIHEWPLPAEDMEAKSVVFELRVPQW
                     YGYWRDTAMYLLYDVYGMNYQTESKPRAIYKPSTYLGLQKYFKAYCPDPRFSLLSEIK
                     PHTNTHRKQMPIVDVVTESEICLLNALHYRCFDNGRGIFISEFHIEADHIPPSCIYIL
                     PQKSSALQQYLQRPESDPNGPPPNKIIAHQCDCPQDMQLEEYKALAQLPLGVRIQWQN
                     ILVQLAMPAVNFKKCETTLFILQAIYQAGPRTGNTCILREGHQVIDDENFTWTLLRRI
                     QDMIISIQENWEGYQALNTLTSLTVRVVSLNSNVEIQGEGLRILQRLRSVACSWIEIL
                     KEKVQESTSDQRRKELSEKSVLLSLICASSFSVDQDHLQSILSNSEGLSTLIQSSITI
                     EEGRNCITSSLDPLAPVLHLSWKQLLFRASLIIIENINGVTSLALNHAIRRSWSAYNQ
                     DTDWKKASKEENDWIFTMTTSRGGVNALPVHYNILTGELLVDGDRLSSLPPKYEQHST
                     YGILFGRSSLEIMPSGISGMRYSTKKAYAGHTVHFGISGENTVECDLRIRAVNPDQTL
                     ELVPSRLLCNKLPSAFIESFVHWYDSATRQIEFRPINNAWRPSSEAWILARNAHGQSW
                     QLTRGESSLMNMESLKVLKISKILAPLELPHRLHVSLKSLTSTIEIDIPCLDLGFQIE
                     RGSQEIRSREFRGFLIDEDQSLGSLINFKNKLVLTHEKQESQLALLLGGPLRTQKSGD
                     HVTVQVDQKVTARAYAFQIDPWLGRLVDSGNLQSKLFLCLVHALTSFCLPDPLTKKTG
                     TEQAISILNSASLNSFDSLSEENLCTLHEIAHLAPGRRYYPENEKEMQTVIWRPELGF
                     LAQDGAFFKTVQCLINDKVRQKFLWPESCQKLPKFDFVQSELLTRDLIRSSSFRVSGF
                     GAELHTTSHDRYYHGRDRDQASEPGWRVFVTADLIYHERQEIYHALQGNMTSHMWDFF
                     SKTPTIHGLDGSFPEFEFEYDSQLLIDPYLAIRSHWLSLHGILRNKPPVDKFRFTLWL
                     SALSFGEQKEQNNMLAIQTLILFYISQKMTNIQFPSSPTYDLSQGYEYKTGIIKSIIE
                     YSCYQIYYSPEGNMTKRVDESNNSFKVRQNRLFRDNKSYAVSFLASLLRDMWPTRTPS
                     IDGNPECVTNYIAVGAAMESVSTKFRVWLDNLSFYQYLDEIMQVLACCPRYTPALPWN
                     SRGDSSSLQQRNGGYITMTDILSLPAPELPNVMENVPNPIPKEASSHSSTESLNRLIK
                     NLAHGAESRYEKSYINYLQKSLEMLQNKSTNETLWLKEQGLFQTLQQNLVFHREHVAT
                     CFELILSAVAQEFGGSNSRKKWMQIIMHAGHGPRLSPSLILEQLSKRLWYSLPPPWKK
                     TVVEYGLALSAMQRAGKMFECKESQRELIKEIQNGGHENWDPHKYPDSLLLEVESDIR
                     IRKVQEEIACEMRHRPARENVVMQLNMGEGKSSVIVPIVAAALADGSRLVRVIVSKPQ
                     SKQMFEMLLLKLSGMLGRRIYRLPFSRALKISSEEAEFILKMCQECMRTNGVLLVQPE
                     QILSLKLMCLECLITGKTDVAKSLLKTQRLFDQYARDIVDESDENFSVKFELIYTMGD
                     QKPIQLSPERWTVVHKILDMVRKESPEVKRVFPLVEIGSCPDGGFPRTRIAHTDAQQE
                     LVFRIARTICQQGVVGLPIARQGKTVRDSIYTYITKWELDDQEIEAVENESLGFWGES
                     TRDILLLLRGILAGGVLSFTLGSKRWRVNYGPNKSRIPPTKLAVPYRAKDNPTARSEF
                     SHPDVVMVFTSLSYYYSGLDDDDLFETFQHLLKGDQSDAEYQIWVKDADRLPEAFRQL
                     VGVNLQDRYLCVEKLFPPFRFAKSVIDYFLSHLVFSKEMREFPHKLSASGWDIGQLTG
                     QPTTGFSGTNDSRQHLPIDVKQLDLEEQTHTNALVLNYLLQPENDVVEVQLAGGNETS
                     NAETFLTLVMKLSPPVQVILDVGAQVLELSNVDVAREWLNRSSSQTVPPQGVVFFDDD
                     DNLYVVDRKGQVELLQTSPLGKHLDVCYIFLDEAHTRGTDLRLPDFYRAAVTLGAGIT
                     KDRLVQACMRMRKLGNGQSVVFCVPEDIQHQIRERTNETSLQKITLSDVLTWAIHGTW
                     DDAKKSMPLWATQGERFVRQKRLWDNLCTENDDAAVSSEQARKFLEDEAQSLEQRYRP
                     GWKKSSPYLSFEVRGDAYSEILARCNEFDNISHRTAKMNEEQERELSPEIQHERQVQR
                     PPKETPEKHCIHPDLKAFISTGKLLRDSSAFRPAFQSLRETSAAHHLDVAEFPFDLLV
                     TTDFCRTVRPQDTWSFVSDAYQRSVQWILTGRDRCTQNDTVNVTSQMVIISPFEAQEL
                     YGLIEDSKYVTMHLYGPRSNLGKPALDKLELYNISKVGCNGLDIPLTLTIQLNLFAGQ
                     LYFGCFEEYVRACELLGIASEPREDVRVGSDGFIFSDKQTSTFHNSPVKFLKVLMSKI
                     RRNGEGIDRTHMGQLCNGMFLEASDFISSLEISPETDQSLVLRSKSTRL"
     gene            complement(<529976..>533102)
                     /locus_tag="TRUGW13939_00156"
                     /db_xref="GeneID:55987673"
     mRNA            complement(join(<529976..532734,532826..>533102))
                     /locus_tag="TRUGW13939_00156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483371.1"
                     /db_xref="GeneID:55987673"
     CDS             complement(join(529976..532734,532826..533102))
                     /locus_tag="TRUGW13939_00156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339264.1"
                     /db_xref="GeneID:55987673"
                     /translation="MLASLLRPRKPRWHSFHPYHPAMSASGLPAAQETTPFLQSILRD
                     DNSLAPTAPFDWNEHLDDENGDDEQDELVLDDDSVHGPLLPIFSSPHLDLIPVYTTTH
                     SIRLLIEVRCETTLTWDQLRSPQISQFLLKPIQQQIRECHFDRSTLYALMANCLQFNK
                     EAETNPGNSGTCRTRALVAELLAIKLLREYTTRELIDALSYDFYPLQGQDPRLFPTAL
                     RASTWNGSSKNKQAMGHARISCLEISIRAQAKRFIAHPLVVQHLEAIWAGTIVFHSAA
                     DNLHRPQRTAASRSHALYGSTNPTGVQQHNKHPSSSVLSPEYPRRTATLYDPRDASLF
                     KLSRLRVPRYRQFLSTISFAVLLGLYLAVLAERSMHITTVEVIFWFWSAGFILDEIVG
                     FNEQGFGLYLMSFWNLFDLGILLLLFCYAILRLYGMAMPDPDHLKVVRQAYDILSASA
                     ILLFPRLFSVLDHYRYFSQLLIAFRIMAADLMAVFLLIVVACSGFLVAFSFSPDSSQS
                     PPEVVYALFQILMGFTPTAWSIWEESNIIGRVILTLFLFICHFVVVTILITVLTNSFM
                     AIVKNANEEHQFVFAINTISMVKSDALFSYIAPSNIIGWLVSPLRYCIPFRDFVKLNR
                     TLIKMTHFPILWSICFYEKIILCPRIIDPADLIQGAPRANGRSTTVLRARNKRLSRFD
                     SFNRLTREPSIATHQQDRVLEELFRTPFRQEPLQGTSESRTRSRKSTMVNHWMQGMDA
                     EDHIPKFNPALRKMGSTLRRNYTETTRSAASDPEEFISYSSLRPVPEHSILYGSATHM
                     ARRASHATDVEGDDEKSSDENNDDESDLGQSSMHGSKTESKKPERTPRSSEKNSNKTP
                     PKFFSSRPSTAVYTSRKNSPHRPRHHERNPSGVTVLHRAPGDADHSSDDSLPGPSSPL
                     KRTETRRPGLPPRQEFMSVPNIHRIGSDMGEPGVLPSSLATQLAPDNDILGRLVLARM
                     SNIEEGFREVLKEVKDMRGRSAREPKMVFRNDIDNEIYP"
     gene            <534813..>541718
                     /locus_tag="TRUGW13939_00157"
                     /db_xref="GeneID:55987674"
     mRNA            join(<534813..535563,535625..541608,541662..>541718)
                     /locus_tag="TRUGW13939_00157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483372.1"
                     /db_xref="GeneID:55987674"
     CDS             join(534813..535563,535625..541608,541662..541718)
                     /locus_tag="TRUGW13939_00157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339265.1"
                     /db_xref="GeneID:55987674"
                     /translation="MSQPKALDTVLSNAARVTDDAAPVSPSAGGAVSYNSTRDLKPLP
                     VMPATANGSPIPPASSPIVGNSEKQVVLELEDGISYQGYSFGAEKSVAGELVFQTGMV
                     GYPESITDPSYRGQILVVTFPLVGNYGVPSRDTMDEVLKDLPKYFESSQIHIAALVVA
                     TYSGEGYSHFLAQSSLGQWLKEQGVPGIYGVDTRSLTKRIREKGSMLGRLLLETSTGS
                     DGIASDLTSAQWRSHCEQIEWEDPNKKNLVAEVSIREPRLFTPPEAVALKHTSGRPVR
                     VLCLDVGMKYNQLRCLLSRGVEVLVIPWDYDFHTLAGNEYDGLFISNGPGDPATISTA
                     VANISKTVYEGRIPIFGICLGHQLLARAVGASTTKMKFGNRGHNIPCTSMVTGKCHIT
                     SQNHGYAVDATTLPEGWEELFVNANDGSNEGIRHVGRPFFSVQFHPESTPGPRDTEFL
                     FDVFINTIKTTLASSEALKQPVAFPGGSREENEKKTPRVSVKKVLVLGSGGLSIGQAG
                     EFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVNADFVRKVIKHER
                     PDAIYVTFGGQTALQVGIQLKDEFEALGVKVLGTPIDTIITTEDRELFARSMESIGEK
                     CAKSASASNIDEAMRVVEDIGFPVIVRAAYALGGLGSGFAEDPTELRELCTKAFAASP
                     QVLIEKSMKGWKEIEYEVVRDARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDED
                     YNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL
                     AFIAAKLGLNIPLNEISNSVTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSM
                     KSVGEVMSIGRTFEEAIQKAIRSVDFHNLGFNETSALMSIDTELQTPSDQRLFAIANA
                     MHSGYSVDDIWKLTQIDKWFLRKLKGLSDFGKTLATNYNATNVPINLIRQAKQLGFSD
                     RQLAKFLSSNELAVRRQRVEAGIIPVVKQIDTVAAEFPAFTNYLYLTYNGSEHDIDFE
                     DHGFMVLGSGVYRIGSSVEFDWCSVRTIRTLREQGHKTVMVNYNPETVSTDYDEADRL
                     YFENINLETVLDIYQLESSSGVIMSMGGQTPNNIALPLHRLNVKIMGTSPEMIDNAEN
                     RYKFSRMLDHIGVDQPAWKELTSIEEATSFCNKVNYPVLVRPSYVLSGAAMNTVYSQD
                     DLANYLNQAAEVSREHPVVITKYIENAKEIEMDAVARNGVMVGHFISEHVENAGVHSG
                     DATLILPPQDLDPETVRRIEDATRRIGNALNVTGPYNIQFIAKDNDIKVIECNVRASR
                     SFPFVSKVMGVDLIEMATKAMIGIPFQEYPPTSIPKDYVGVKVPQFSFSRLSGADPVL
                     GVEMASTGEVACFGRDRAEAYLKALVSTGFRLPKKNILLSIGSFKEKLEMLPSIQKLH
                     KMGYNLFATAGTADYLKEHGIPVKYLELLAGEEEDLKSEYSLTQHLANNLIDLYINLP
                     SSNRYRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEALSRKFELEVLTIDHQT
                     SHRTIVLPGMINIASFVPGIVTPGSKDFELVSKASVASGFTMIRVLPVGVDVSVTDAV
                     ALNIAQQNSKSGMFCDFNLSVAATATNAEQIEQVTSEVGALYIPFNHLSGNINKVAAV
                     TSHFGAWPSNKPMITDARATDLASILLLASLHNRNVHVLNVSSKEDINLIALSKEKGL
                     KVTCDVSIYSLFLSQQDYPECAALPSVEDQKSLWEHLSTIDVFSIGTIPYQLAGKEAS
                     PTVGIADALPLLLTAVAQNKLTVDDISNRLYHNPKSIFELHDQQDAFVEVEVDRPYTF
                     QSDVWSPFNGKPMKGSVHRVVFQGKTSCLDREIQPEAAKGIDMSGHRIAPPSPSVKAF
                     SPRVQPTIGRRFSTSTPSRQTRAKIGDTVPHVSELGPPLFSSPSQVSPSLVELISRST
                     FKQKNILSVEQFNRSDLHLLFTVAQEMRLGVERQGVLDILKGRVLCTLFYEPSTRTSA
                     SFDAAMQRLGGRTVVISTDHSSTQKGETLQDTIRTLACYGDAVVLRHPDENSAHTAAR
                     FSPVPIINGGNGSREHPTQAFLDLFTIREELGTVTGITVTFTGDLRYGRTVHSLIKLL
                     QFYDVRIQLVAPKALSLPEEVRKLIVSSGQLIYEAEELTPDIVARSDVLYCTRVQKER
                     FADLEEYERLKDSFVIDNSVLKNAKSHMVVMHPLPRNAEIGEEVDFDQRAAYFRQMRY
                     GLYCRMALLALVLAP"
     gene            <542861..>544587
                     /locus_tag="TRUGW13939_00158"
                     /db_xref="GeneID:55987675"
     mRNA            join(<542861..543062,543128..543510,543569..543628,
                     543686..543940,543994..>544587)
                     /locus_tag="TRUGW13939_00158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483373.1"
                     /db_xref="GeneID:55987675"
     CDS             join(542861..543062,543128..543510,543569..543628,
                     543686..543940,543994..544587)
                     /locus_tag="TRUGW13939_00158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339266.1"
                     /db_xref="GeneID:55987675"
                     /translation="MASLIEKDGEPPSSSPTAEQKVPSSDITRDAEKQFDINEKALLR
                     KLDWKLLPPLTLLYLLSFLDRSNVGNAKLEGLTEDVKMTGDQYLTGLTLYFIGYVLFE
                     IPCNIILKRTTPRLWLPTITLFWGIVATLLGVVHNYAGYLVSRFFLGVTESGLFPGVV
                     FYLSMWYKRNEQHFRISLFFSAASLAGAFGGVLAWGIGHMKNVGGYQGWRWIFILEGL
                     FTVLVSAISYFLVYNYPATAEFLTEKEREFIQFRLKYDSDATIDEGFTWTAVLNAFKD
                     PKVWLYGLGFHTVSLPLYTLSLFLPTIISGLGYSSASAQLLSVPPYAVAFVLVVTVAI
                     LSERTHRRAPFIMATSALGIIGYIILLSAPSPGSSYVGIIFAAAGIYPSTAIVLSWPA
                     NNVSGQTKRAVANAMQISIGNLGAVMGTQLYRSEWSPRYFVGHGVALAYLAANIAVTG
                     TLWLVLNRENKKKEEIRRSQGISPLEEVGAAEGAFLGDEDPRWVFQT"
     gene            complement(<544694..>548104)
                     /locus_tag="TRUGW13939_00159"
                     /db_xref="GeneID:55987676"
     mRNA            complement(join(<544694..545420,545492..545979,
                     546389..546505,546562..547703,547765..>548104))
                     /locus_tag="TRUGW13939_00159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483374.1"
                     /db_xref="GeneID:55987676"
     CDS             complement(join(544694..545420,545492..545979,
                     546389..546505,546562..547703,547765..548104))
                     /locus_tag="TRUGW13939_00159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339267.1"
                     /db_xref="GeneID:55987676"
                     /translation="MTAAIVTATDVAASRLSADHSPASIPSLPLFVAAREQATSDPAK
                     VAVVDRTKAQDFTYRQLLADVSTTKKWLLESLSVSDLDERRITFLVPNGYDYVVTQWA
                     VWAAGGVAVPLCTTHPVKELLYTITDSLPSLVIIHPAFEKVEPALREAIADIPFTRFT
                     PLSSSQDAAATTLPPFHDSWSLDRRALMIYTSGTTSNPKGCVTTHKNITFQASCLVEA
                     WKYSPSDRLIHVLPLHHVHGIINGLTASFLSGATVEMYPKFDPKIIWERWQDKGSSTM
                     FMAVPTIYSRLVDYFDSHIRSTDAEACSREGTKALRLIVSGSAALPTPIKTKFAEITG
                     QVLLERYGMTEIGMGLSCGLDVSQRLDGSVGWPLPGVQVRLTEKETGAIVEALDEDGM
                     IEIKGDNVFLEYWNKPEATAKEFTSDGWFKTGDVARRENNGAYYIQGRASVDLIKTGG
                     YKVSALEVERKLLSLASIQEVAVVGVADEEWGQRVAAVIKPRADADTIQLATLRKELK
                     EEMAPYKIPSILKLVDNIERNAMGKQAFTTNPMATKRQQHDMYESETGDATTPSQTHR
                     HNHDRNLAWWKSNPQPCCASASSSVYSTSSEKGQALEHVLSSPMTSVCVAASNGPFLD
                     LEETTVTQTTGSVTSVTSACNSNIPTPDHHPEQGQQQSRHKQETNSERWSQYSSASAA
                     SSLKKMFKTRNPLKWLHRRSESRSSTQYQQREQGIAHSPIEPKETNLSDEIIRDFGTD
                     LVEKMDMLERKVDALSCSPNFTPQPRRDEKGVNFGIQADLDNRKQQENHNDEDKSYYN
                     KLEEKITHLTNTNTNLSSLNALLSSDLYRLQNDIHNLQDEVCLLREEKFSLERRHGSY
                     DEQRVQIELQIDLIRRLGVLLGRREEQLDSERRMMKLYRDRINGLEDEVEMLRTEWER
                     VLPLVMPRDKGPVLTTVEIDKNK"
     gene            <548848..>551412
                     /locus_tag="TRUGW13939_00160"
                     /db_xref="GeneID:55987677"
     mRNA            join(<548848..549817,549869..>551412)
                     /locus_tag="TRUGW13939_00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483375.1"
                     /db_xref="GeneID:55987677"
     CDS             join(548848..549817,549869..551412)
                     /locus_tag="TRUGW13939_00160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339268.1"
                     /db_xref="GeneID:55987677"
                     /translation="MIAPTLSAGATVEARIGSDMLRWRPWACRVSAPSQFVRYAQTEA
                     KSKSKKQAAVKPKRTNKKKPPTPPDGLPPPLIEITKGVFYRTYPSSSEPNAKIPPLFK
                     KFDFSLSARVAPHFTTPPLPSPSLDMTMRKKVQTARAIRKAQKVVEKENEIQKFYGPF
                     HWAVMGTGSTDFLDILRGQYVAVPPNSRSYPYLSSDQFSPSNPKLRHPSNAIQYVGFR
                     GEGSQATGGTRGAYLSARYESLREETDWTVRQYLCNQMELNPLEGEQAQSNPYSQDHW
                     DAILQSFQLSHLLDMPTAKLSNGQTRRTRIAKALLTQPELLLLDQPFMGLDPLTSDSI
                     SSLLRDVALKSSPRVIIALRAQDSIPEWISHIAIVNTDSVAFQGTKEDFFNIVDLIHK
                     GHLPFKKDVMTLGPVMREGGALHGYREILAKDYPEHFQPDHSHFDEPQTNRKLPRPKS
                     TMPALMDGEPQIEMNGVRVQYGDKVVLGNWTQTESSTPGLHWKVRRGQRWAVLGANGS
                     GKTTLLSLITSDHPQAYALPIRLFGRSRLPEPPKPGISIFDLQARIGHSSPEIQAFFP
                     SHLTIREAVESAWADTFLSKPKLNFQIDTLIDRVLAHFRPDLAKPRLLKPGKEHEIDM
                     SIIPGGFLQRFATPPPESADISKGSATTAEYDTTYDNLNLPIGFDTYAYADDMTFGQL
                     DVAQQRLVLFIRAIIKKQEVIVLDEAFSAMPPSMRQKCFALLEGPPAQTVKGKKSEQL
                     PYVDETQSVVFVSHQRQEIPDSVRFWMRLPSQVGDDQKLDFAMGVLPDGETLASSKEI
                     WQNIWSKNSFPPYEHKEASSKETPNDAELYGFVLAKSEH"
     gene            complement(<551832..>553911)
                     /locus_tag="TRUGW13939_00161"
                     /db_xref="GeneID:55987678"
     mRNA            complement(join(<551832..553465,553524..>553911))
                     /locus_tag="TRUGW13939_00161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483376.1"
                     /db_xref="GeneID:55987678"
     CDS             complement(join(551832..553465,553524..553911))
                     /locus_tag="TRUGW13939_00161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339269.1"
                     /db_xref="GeneID:55987678"
                     /translation="MASQLEKMKEGRGLTLRNKNKSRRRPQISAPKPISVQAPNKELE
                     SSVPLATQQGGATSDLVKRRYSARFNHIPDAPFDAPPVPSLPPDVQGYGGLGAGPAAA
                     STPQTGSGQPLEVNLKALRDPSLPVDKYVASLLANASEEDIQDYQQRLRKVKNRTSTD
                     LQQNVYQNRTQFIKISEEAEKLKGEMRTLRTLMSELTTALGQTNNTSGSSLLSPTDDR
                     SSKRSNRSSVANLENMWNMQLQSLWKTVEGSQKFLPAIPGRHIVLESGHWVELDSATW
                     KPRRPVHIVLLNDHLLVAAKKRKRIDPNSPNQHRGPAPTKLVAEECWQLQDIDMIDLG
                     ANLGSGAARAEAEDRGVAHAINVRVGSKSYTYRYDQRTSSAKNELLATFRKTVEDLRK
                     ALRSEIDASNKPSDALRSLTQLEGNRKSGILDNPDDKDKPEIRIDVDGKQHNLRWVEG
                     QVDDIDIDIALHHFEEAVASVERLRKLAQGLKGNSVAQDVINQKVDERASKLASILTR
                     TLVNTNSFPTATKTNVGWLTRLGFEDRARGAYLRARTEVIHKRARQCIFEGDLRIYIF
                     QISFVYFTLIKNTISIYQQCFPPVMSSACIKWAKEHLDEFNAALSRQLSSVQRDTAVW
                     QDCMGIVDEQASMLIEVGVDFKDLIASGLENGHAQQEGDNGEPGDAEVQ"
     gene            <554229..>554861
                     /locus_tag="TRUGW13939_00162"
                     /db_xref="GeneID:55987679"
     mRNA            join(<554229..554286,554352..554597,554659..>554861)
                     /locus_tag="TRUGW13939_00162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483377.1"
                     /db_xref="GeneID:55987679"
     CDS             join(554229..554286,554352..554597,554659..554861)
                     /locus_tag="TRUGW13939_00162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339270.1"
                     /db_xref="GeneID:55987679"
                     /translation="MKTSTLVALSTGTVLTGFLAYAVWFDYKRQSDPDFRKNLKRSNR
                     RMARAEKEEAEAQGAAQREEIKKAVSRAKDEGFPTDLEEKEAYFMGQVAKGEGLCAEG
                     ADNVEAALAFYKALKVYPQPKDLISIYDKTVPKEVLEVLAEMVALDSGLKLGSFGETG
                     SSDGHGVE"
     gene            complement(<555485..>556229)
                     /locus_tag="TRUGW13939_00163"
                     /db_xref="GeneID:55987680"
     mRNA            complement(join(<555485..555895,555948..>556229))
                     /locus_tag="TRUGW13939_00163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483378.1"
                     /db_xref="GeneID:55987680"
     CDS             complement(join(<555485..555895,555948..556229))
                     /locus_tag="TRUGW13939_00163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339271.1"
                     /db_xref="GeneID:55987680"
                     /translation="MPTKSSLLVPYFLLLVFATIELALVSRMVAFLHIQKTQVKTYQA
                     LGSDSLGFKIHVLPEKLSLNQGHTTNGAAGYGLVLSIALLAITFSFRNDTKHKRKLLA
                     MTILLGLLVLFIMSAFIYVFAVTYLTSDNRINTRYAQSMNGAPYPIDSWTPETWYKAL
                     LLLPLANVDLTGAYQEMVAWRWWIFPYLMASILAFGWTAIVWIDERVPKRPSHGYVVY
                     GNGDDGLQRKIAT"
     gene            <557815..>558604
                     /locus_tag="TRUGW13939_00164"
                     /db_xref="GeneID:55987681"
     mRNA            join(<557815..557916,557973..558076,558130..>558604)
                     /locus_tag="TRUGW13939_00164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483379.1"
                     /db_xref="GeneID:55987681"
     CDS             join(557815..557916,557973..558076,558130..558604)
                     /locus_tag="TRUGW13939_00164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339272.1"
                     /db_xref="GeneID:55987681"
                     /translation="MPGTEEAQKLIKEFSDKNIDDCCRSSTFTVEVEESVRGHIHQEL
                     VTWLLYRKLAADCGRANIALHGFGLLFEKSAVECLADACWLERYLIQRGGRCKPTSLE
                     VPKCEFPDNPVEPIIPLSKAVETERKILEDLERLMHLADKAGCYSLCTALDKRFLGKQ
                     THHIKDMADLLQQTVRVSKHAGHGIFHLDRELRRAKGNLPWGKVNDPDSIALGIDNIS
                     SQLDNVEV"
     gene            complement(<558872..>560983)
                     /locus_tag="TRUGW13939_00165"
                     /db_xref="GeneID:55987682"
     mRNA            complement(<558872..>560983)
                     /locus_tag="TRUGW13939_00165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483380.1"
                     /db_xref="GeneID:55987682"
     CDS             complement(558872..560983)
                     /locus_tag="TRUGW13939_00165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339273.1"
                     /db_xref="GeneID:55987682"
                     /translation="MITPQSLKPIRLSKDSPTPRVSIEEITNVKRPQNPRKHSEQHLQ
                     PLSPLEDRAAPASDSDLGAIFALIPTPTLVLDAKLRVIQVSDSHLKFTGFDREECLGH
                     SIFDFPPHKVPAPDITTLHRVITTAITTTSPQVIDGVEVAVGAVISLYHLRITPVLEG
                     GKLRNVLVAAHDVTSEQPIRQSKKELVYMNETYRILVDTIKEYAIFMLDTSGHVATWN
                     SAAAILKGYSSDEIIGRHFSIFYGDDARAAEKPGKQLEVCLREGKVEDEGWRFRKDGS
                     RFWANVLMTPVYTAGLHIGFAKVTRDLTERKATEERLIAAYEESSKLKSDFLANMSHE
                     IRTPMHGMLMAIQMLSETAMDEKQEEYVSIIEDTGSLLLRIINDVLDYSKLSSGTFSI
                     SSGVVDIKEVVTAVYRNCHPSLKRGVDFRIQFPDKLPKHVKGDPLRYRQIIQNLVGNA
                     AKFTDHGSIQIDVTCQQHPEDETAYEVTTKVTDTGVGIPEDGVSSLFTPFSRFADTNQ
                     KKYQGTGLGLSICKSLAEVMDGQIGFHSHPSETGSVFWLSVKMGKVDTTRPETHTLQL
                     RPKPDLNEAIKKIAPHRQILLVEDNMVNQTIMLKMLKMIGFEKVDTAWDGAEAVRKVK
                     QKPLSFSTILMDVNMPVMDGMDATVAIRGMNRDIPIIAMTGNALKGDAETYLAKGMND
                     YIAKPVHRQHLVSVLLKWIGS"
     gene            complement(<562904..>563417)
                     /locus_tag="TRUGW13939_00167"
                     /db_xref="GeneID:55987683"
     mRNA            complement(join(<562904..563023,563076..>563417))
                     /locus_tag="TRUGW13939_00167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483381.1"
                     /db_xref="GeneID:55987683"
     CDS             complement(join(562904..563023,563076..563417))
                     /locus_tag="TRUGW13939_00167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339274.1"
                     /db_xref="GeneID:55987683"
                     /translation="MPRTIYLAVFSNGARPAHQSAFIPTGDSGDAGKIIHVTGNPATG
                     FFLEFKRNYDFALTQRTFQRIPLGHVEDRHVTDTVGDGTASQDTIARDRLESVATIVP
                     PPGRSPNPFDPLALNCQNWLQDYIEKLVAEGYLAESAISVLQNAPKVLPTR"
     gene            complement(<563863..>564471)
                     /locus_tag="TRUGW13939_00168"
                     /db_xref="GeneID:55987684"
     mRNA            complement(<563863..>564471)
                     /locus_tag="TRUGW13939_00168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483382.1"
                     /db_xref="GeneID:55987684"
     CDS             complement(563863..564471)
                     /locus_tag="TRUGW13939_00168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339275.1"
                     /db_xref="GeneID:55987684"
                     /translation="MSAKALLICDIQKGILGRITTAYSEEVTKSYVSLLASTIKSAHA
                     ASVPVIYVKTAFRTGYPETGNRNPTFSRVQGTGLFLEGHESAEIDPSVIINDGNREEE
                     IAVVTKRRVSALYGTDLDVLLKGMGIKEIVMAGLATSGVILSTLRQASDLDYDIVVLK
                     DGCMDTNEEVHTVLMDLVFPKQGRVLLAGDWVKEIFGGGEKQ"
     gene            <565341..>566021
                     /locus_tag="TRUGW13939_00169"
                     /db_xref="GeneID:55987685"
     mRNA            <565341..>566021
                     /locus_tag="TRUGW13939_00169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483383.1"
                     /db_xref="GeneID:55987685"
     CDS             565341..566021
                     /locus_tag="TRUGW13939_00169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339276.1"
                     /db_xref="GeneID:55987685"
                     /translation="MAPSKAGSDAYNYTVAPHLEAKFDIPMDKFEAAHPEIDRFIVGG
                     FVFTNRSLDDLPFSSSATAHETTSSNTASGLLPLVLIMQRAATDSNGGCFDFPGGSAE
                     PTDATLLDGVAREVLEETGFHVSHFRELVRVDNWEKVYPEEGLVRAAKFSFLVDVHEA
                     EKPGWEDSVELAADEHTFWAWATREEIEKSVQLWRDGKKDDARYTFIGVQGETAAEAW
                     KVYSDLTT"
     gene            <566520..>568745
                     /locus_tag="TRUGW13939_00170"
                     /db_xref="GeneID:55987686"
     mRNA            <566520..>568745
                     /locus_tag="TRUGW13939_00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483384.1"
                     /db_xref="GeneID:55987686"
     CDS             566520..568745
                     /locus_tag="TRUGW13939_00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339277.1"
                     /db_xref="GeneID:55987686"
                     /translation="MTVSGPEPTEQQAAPRRRQRRTQVARACDGCRIRRIKCDNKVPC
                     SNCLGKAKICSNSGAPPASTLTQAHEEIGWLKQKVQQLEAELEQRSNGAANMPTPTHS
                     LSSPAQQVHHVPTGNYAEYGSSKEYSVGRGVRLRPARSMNDAWFGASSLFSFLQRLSV
                     FLSINLQQTHSTHNLLPISASDNKLLDRPLAGSDGDPVRRLMSSTGEFPTTGVYLSPT
                     QEEYFLDFFWQTYHTTLSPILNEAQFKKHYQSLWMDGGKERRPSALVDIVIAMCMQYV
                     ISTLHCDAQGLLVEGKDALVAGRWHYWRGQTLLTYELESPSITTLQCHILCGVYLCGG
                     SFHNMMDTSVTLAVRTAYILGLHADPPPDMSDEDVEMRRRLWWAVYLMDSKSGMKLGR
                     PFALQDSSVMPSLPGDTLEAARVSGSTFAPIGNNATWLSFNLYQTKLYIKIRAAYTHF
                     YHTDLHLENDQSIWDDSRALQVGAEILDSHNQSFQEWTDEVPEALRLKRQENGRPLSV
                     DGTRLSMEQFAPLWLQRQRVILELTYHHLIVNLYRPLISFSASPPPETPAAEVAMRCA
                     AHAIMLTKITQQVLTETSILDGWHEAFHWQWNAAMTLIGFIMVFPNAHLTAEAHTAIE
                     LAVSVFDNFGAKFSVAANAASIVRDLRIKVEFLARHKVEDTESAQNLQHNSTFNDIPV
                     SGDFTMPDLMNGSELNLFDMAVDIDFWSDFDTLWPEIDNLPQDVQVDNSHSVENMRGL
                     C"
     gene            <569367..>570141
                     /locus_tag="TRUGW13939_00171"
                     /db_xref="GeneID:55987687"
     mRNA            join(<569367..569961,570017..>570141)
                     /locus_tag="TRUGW13939_00171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483385.1"
                     /db_xref="GeneID:55987687"
     CDS             join(569367..569961,570017..570141)
                     /locus_tag="TRUGW13939_00171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339278.1"
                     /db_xref="GeneID:55987687"
                     /translation="MSPSRKALISITSAQATLFQGKETTGLFISEALHPYNVLVAAGF
                     EVDLASETGSYTADWLSQQPDFLNGSDLTTWNNTTSEFRKKLDNMPKAADVDGSQYGV
                     FYASAGHAALIDYPKASSLQKIAEQVWANGGVVASVCHGPAIFANILDRATGEPIIKG
                     KRITGFTTEAENTMGIMDELRGWGSEMVEELADRLGAKYERAPGIWDDFHIVDGRLVT
                     GQNPASARSTAEAVVEVFEKL"
     gene            complement(<570323..>571753)
                     /locus_tag="TRUGW13939_00172"
                     /db_xref="GeneID:55987688"
     mRNA            complement(join(<570323..571449,571504..>571753))
                     /locus_tag="TRUGW13939_00172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483386.1"
                     /db_xref="GeneID:55987688"
     CDS             complement(join(570323..571449,571504..571753))
                     /locus_tag="TRUGW13939_00172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339279.1"
                     /db_xref="GeneID:55987688"
                     /translation="MSEEKLALLEGDDEFVSDIAPRRTLIATRRPVIRAWSVTLAGLL
                     TVIALGLWSTTSFTNCHRVQPQKTVKDRVRKILTDTPLIDGHNDLPILVRAKYGNRIY
                     SSDFIERFTFGNLTGDVDAPRLAEGQVGGTFWSVYVPCPNNVSDFSKENYAESVRMTY
                     EQVDVMTRIQQEFSTILSPSPNGTTALEHFRDGKVISPLGIEGLHSIGNSFSHLRSFY
                     NLGVRYATLTHNCHNIYADAALIQLPGGGVRKSDPLWNGISERGKELVSEMNRLGMIV
                     DLAHVSEQTMRDVLGAGKDEWIGSQAPVIFSHSSAHALCPHPRNPTDAVLKLVKKRDS
                     IVMVNFYPQFISCTASTREDGLPDFYPGNATLSHVASHIIHIGDAIGYDHVGLGSDFD
                     GIESRPEGLEDVSKYPDLIAELLHRGVSDEDAAKVAGGNLLRVWKKVDEVALKLQAGG
                     VLPVEDDL"
     gene            <572114..>574480
                     /locus_tag="TRUGW13939_00173"
                     /db_xref="GeneID:55987689"
     mRNA            join(<572114..572138,572193..>574480)
                     /locus_tag="TRUGW13939_00173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483387.1"
                     /db_xref="GeneID:55987689"
     CDS             join(572114..572138,572193..574480)
                     /locus_tag="TRUGW13939_00173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339280.1"
                     /db_xref="GeneID:55987689"
                     /translation="MTESAAESGILAAWHAFRIPTIVVLTAIVLFVRFYSQPKAKTPS
                     SSSLPPSPRLEKAVGLEDKTRPVVPAVDAEKDQPKDKSIASGPKRIVGTRQPRGANKR
                     QDADPSARPSFIKPVIFFASLTTSTERRAQWLEEELRTAAQATSKGVDTEYGLLPPEI
                     YDLAAIDFEDHFVSAPKPPPNSPHTRYFYCFVIPTYNIDTIIDTFLSHLDETHNDFRI
                     DTAPLSGLAGYSVFGFGDTEGWPTEEEGFCSQAKDLDRWMAKLTGKRRAYPMGMGDTK
                     ADPDQALKEWTTGLTEVLGEIVETGGLGEGVLGSGDPVESDEEDTDDDEESEQKPKKS
                     KKAQAVVDLEDINIGGSAKKRRGDPLPVDFTTKSEKASSNQPTVKEMVPSTSPTYASL
                     TKQGYTIVGSHSGVKICRWTKSAMRGRGSCYKYSFYGIKSHLCMETTPSLSCSNKCVF
                     CWRHGTNPVGTTWRWKVDPPDLIFKGVKEGHYKKIKLMKGVPGVRAERFAEAMRIRHC
                     ALSLVGEPIFYPHINEFVGMLHDEEISSFLVCNAQHPDQLATLDRVTQLYVSIDASNR
                     DSLKKIDRPLHRDFWERFQRCLDIIREKRNVQRTVFRLTLVKGFNVEDEVKGYADLVE
                     KALPCFVEVKGVTYCGTSSSASVGLTMKNVPFYEEVVAFVEALNEELQKRGLKYGIGA
                     EHAHSCCILLASERFYVNDKWHTRIDYERFFELLQKEKSEGISFRPEDYMRETEEWAL
                     WGNGGFDPNDTRVRKKGKNKDKPAVEQGCS"
     gene            complement(<574597..>576546)
                     /locus_tag="TRUGW13939_00174"
                     /db_xref="GeneID:55987690"
     mRNA            complement(<574597..>576546)
                     /locus_tag="TRUGW13939_00174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483388.1"
                     /db_xref="GeneID:55987690"
     CDS             complement(574597..576546)
                     /locus_tag="TRUGW13939_00174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339281.1"
                     /db_xref="GeneID:55987690"
                     /translation="MLRLPSELLLIIAAELEKENYIGALAQTNHRFFSLLNDFLYRRN
                     VRHSSGSALRWAAIHGQKTTAKKAISAGAQEIGVAEQARWVGEALRDSLENGHADVAR
                     ILLLDVDEVDGNFCLSDDPTTPLHFAATGGYAGIVKLLLDMKTVDINSRDKHGRTPLS
                     RAAAHGRESVAKLLLISGADSNSRDLDGRTPLSWAASCGRQSVVSLLLNFGADVNSRD
                     NKGRSPLSFSAATKGSEAISKIKSRESIIKLLLAFGGEIDAMDQNGWSPLSWAADSKG
                     CQAIVKLLLDSGAEINNHGVTPLSRAAERGYEPILEQLLHLGAKVDLRLGHNPTALLA
                     AAKKGCISIFERLLDNGADISSRDNDGRTPLSWAAEKGRETICKILLDMGAEINSRDN
                     NRRTPLSWAIGEPTFKLLLDLGAEINSRDKHGCTALSWAAKKGHESTCKTLLTAGAAV
                     DSKALSAAAGEGHESIVKLLVESGAEIDTREEYYEKKTPLSLAAEGGHEGIVKLLFDS
                     GAKIDSRDDCARTPLILAANKGHKNVVSFLLSSGAEVDARGGFFNYTALSQAAWRGHA
                     DVVALLLASGADDDCNSGGMTPLGRAAVKGHTRAVKLLLETRSVDLRGNENMLPLMLA
                     TVRGYDSIVKLFLDHGAVYPSYFYS"
     gene            <577429..>578534
                     /locus_tag="TRUGW13939_00175"
                     /db_xref="GeneID:55987691"
     mRNA            join(<577429..577744,577816..>578534)
                     /locus_tag="TRUGW13939_00175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483389.1"
                     /db_xref="GeneID:55987691"
     CDS             join(577429..577744,577816..578534)
                     /locus_tag="TRUGW13939_00175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339282.1"
                     /db_xref="GeneID:55987691"
                     /translation="MASKPIVLHIGDPVKFNTSLYEQLSQQFTIIRPSEAERQREPFL
                     QALREKKWGDFSAVLRPWWATGGEMGRWDKELIPLLPSSMKVYASAGAGFDWADVDLM
                     AEAGILYCNGASASSEAVADMALYHILSVFRNMQWSNMAARSQDRAQFVDAHTNAPFT
                     AHNPRGHTLGVVGLGNIGYTIATKAFAAFGMKIIYSDPFPKMPEQEAAIGARRVEMDD
                     LLAQADCVVLAAPGAGGKKILDAEKIRKMKRGSRLVNIARGSLVDQEAVADALEEGIL
                     FAAGLDVHENEPEVSVRLVKNRNATLTCHTAGGALETTIGFEELSMKNVLAVLTGQNP
                     LTPVNKHLFK"
     gene            complement(<578796..>579997)
                     /locus_tag="TRUGW13939_00176"
                     /db_xref="GeneID:55987692"
     mRNA            complement(join(<578796..579009,579059..579124,
                     579178..579562,579614..579690,579765..>579997))
                     /locus_tag="TRUGW13939_00176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483390.1"
                     /db_xref="GeneID:55987692"
     CDS             complement(join(578796..579009,579059..579124,
                     579178..579562,579614..579690,579765..579997))
                     /locus_tag="TRUGW13939_00176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339283.1"
                     /db_xref="GeneID:55987692"
                     /translation="MSSPAKNDGPQVIVLTDEERDSGVMGDKSLYDAIEAFFTDGCVV
                     VENAIDLTLVDKLNERMLQDTKKLLSGEGEPFFIHLNANFETKGAAAGGNISQVPPLE
                     KEWLFPEVFANKHGARIVSNILGPRPEVHFIRSNTLIHSDDRQKVHADIRFEHPEHPF
                     AIALNTCLVDVGPENGTTELWLGTQNTNNDYHIELGEPFITQEKLDERRKVGPPCYPR
                     IKKGSFVLRDLRLWHAGMPNPTHDIRTLLSIVYYASWYKNGATISMPESLRPTIEMLE
                     EYAQSKIAAEWVPDEGYDYLNIKFSNNFSSTLTPWVWERVQHIKGVKN"
     gene            <580683..>584673
                     /locus_tag="TRUGW13939_00177"
                     /db_xref="GeneID:55987693"
     mRNA            join(<580683..580885,580938..581010,581065..581134,
                     581190..581229,581287..581472,581525..581565,
                     581630..581669,581727..582011,582687..582946,
                     583009..583110,583176..583241,583308..583602,
                     583654..583914,583969..584077,584149..584446,
                     584507..>584673)
                     /locus_tag="TRUGW13939_00177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483391.1"
                     /db_xref="GeneID:55987693"
     CDS             join(580683..580885,580938..581010,581065..581134,
                     581190..581229,581287..581472,581525..581565,
                     581630..581669,581727..582011,582687..582946,
                     583009..583110,583176..583241,583308..583602,
                     583654..583914,583969..584077,584149..584446,
                     584507..584673)
                     /locus_tag="TRUGW13939_00177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339284.1"
                     /db_xref="GeneID:55987693"
                     /translation="MAQQHVSFKIEELFSVKNKVVVVTGGGSGLGKAIAEGFAVNGAK
                     VYISGRRGEVLEAAAKEIGGDVHVIQGDVQTKEGCEKIVEAVKSQETHIDTLINCAGV
                     NSPWRVKANDHNDADQVENLLVNGLIEEDFNRSNQSEWMQSFETYQTLIIPVNVNGVY
                     FLTVNFISLLRKSADPNVCVISSIAGLSNQRSVASLTYSVSKAATIQLAKLLAGRLHP
                     MKIRVNTICPGIFPSEMTGVTSGKHEYNLNHQAEKAALRSTAGRPGRPEEIVAPVLLL
                     SSPGGGYMNCALLTVDGGRLMGVSINDGIRMPENTYTAGQRYTTTKQATNNNMATALS
                     ADDDLKSGADHIEVEDYGKQVNDIIVKPESLRHLSADELKSLETKMVRKIDMVIMPIM
                     AVLYILNYVDRSALAAAKVYGIMEDLNMSTQDFATAISILFAGYIPFQIPSNLIMTKI
                     PRPGFYICSAATIWGTVSGCTAAVKSYHGLLAIRVMLGVTEAVFFPGVIYLMSAWYTK
                     NELGKRLAFLFICQMLGSAFGGFVAAACLTLDGRYGIAGWRWLFIVEGVTTVGCGLIS
                     AMFMPEYPHKARLLKPVERDYAVWRLEVEAGAGEAHEESTVFNGFKLAILDPKIWALV
                     WCMGMSQAMGGTTSFFPSIVETLGYNRNITLLLTAPPYVLASIVFWFISYFSDRKNII
                     YPIITSALAVSVVAYVVAMSTLEMGPRYFAMMLMPTVCAGPQILLYKTLNIHMARPYP
                     KRAAGVAMINAIGGISNVWVSYLFYDPPHYYAAFGAILGCAISFFIVITGYLMHVRKM
                     NKCLSGTPEDQLRAMKGGVTQQQVDLGWRYVGY"
     gene            complement(<584914..>586797)
                     /locus_tag="TRUGW13939_00178"
                     /db_xref="GeneID:55987694"
     mRNA            complement(join(<584914..586011,586059..586526,
                     586588..>586797))
                     /locus_tag="TRUGW13939_00178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483392.1"
                     /db_xref="GeneID:55987694"
     CDS             complement(join(584914..586011,586059..586526,
                     586588..586797))
                     /locus_tag="TRUGW13939_00178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339285.1"
                     /db_xref="GeneID:55987694"
                     /translation="MAARISSLEKSATRAREKPESKPSVSNSDAESNAYAHSTSMSEG
                     LRENVVVQKGSSTQYFNEIMLSTMIEGQDMKAVLTPPNTGPLQPQIISPFNAHGILSS
                     PSLSIVPSTLHPPQELAVKLWKIYVDNVESCVGLKFLHLPTDDIKIYSTINDPATASL
                     ENLALCYAVYFASATSMDDTEAAAILREDKNTAMLRFKVGLEQALAHGDFLDRPTITG
                     LCAFAIYLSAVRIHNRGKGIWILNGLAIRIAQSLGLHRNGEKLGLSPFESEIRRRIWW
                     HLLCREWRSGEDYGLENINNFLLMADVSLPINIEDTDLYPEMQRLPAPRNGWTAISFS
                     LICIDFAQCMQKLGVISASSSASSPPSENSRAQLVKECKERVDRWLRHCNPVLPPQRL
                     ALYISSFLLRKLDFVSRMQWILLRCDGESADFVSEENLVEALEILESRVYETDGLLKQ
                     FSWVRKAFPQYHVTMYVLWHLSVKPEGPNIERAWTTTKTMFSPEIWDETTMGFGSKSA
                     VLTALRAKAVSAREKLQRMSTGKLNGPGSLVGENLSSQAEDQTTSSVLAGTNTGEIDL
                     EGGMEEWPDWEALVENFQFNSSDVF"
     gene            <587453..>588976
                     /locus_tag="TRUGW13939_00179"
                     /db_xref="GeneID:55987695"
     mRNA            join(<587453..587687,587743..587849,587908..588082,
                     588138..>588976)
                     /locus_tag="TRUGW13939_00179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483393.1"
                     /db_xref="GeneID:55987695"
     CDS             join(587453..587687,587743..587849,587908..588082,
                     588138..588976)
                     /locus_tag="TRUGW13939_00179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339286.1"
                     /db_xref="GeneID:55987695"
                     /translation="MSSSEQASTIAEDLSIKKETEANPQTDNSNTNAGSSDLDAEKAP
                     FNPPGSDAPDGGAAAWLVVFGAWCTSFCSFGWLNSVGVFQEYYEDTLLSDYSAGTISW
                     IPSLQIFFMMGMGPVVGAIYDRYGPRHLLFFGSILHIFGIMMASLGTEYYQIILAQGL
                     CSAIGVSAIFQPSVNCTAGWFNQNRGAALGVLFTGSSIGGIVLPIALTHLINEVGFGW
                     SMRICAFIMLFLLILANLTIRPYRPPQQTQKITWAQLAKPFRETQFILIVIGFFLFSY
                     GFFAVVNYLPVQAVSTGMNSNLVQYIVPILNAGSLFGRLFSGFLGDKLGRYNIFIVVC
                     YLSGIWILALWLPDTSTAALIAFSALFGFFSGAYVSLITPLLIQISPMAEIGFRTGIV
                     LFLISLGGLTTNPVNGAIIDSSAGWSGLKIFSGVLCLAGTSFVLVARIRQTGWKVLAR
                     F"
     gene            complement(<589375..>591069)
                     /locus_tag="TRUGW13939_00180"
                     /db_xref="GeneID:55987696"
     mRNA            complement(<589375..>591069)
                     /locus_tag="TRUGW13939_00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483394.1"
                     /db_xref="GeneID:55987696"
     CDS             complement(589375..591069)
                     /locus_tag="TRUGW13939_00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339287.1"
                     /db_xref="GeneID:55987696"
                     /translation="MATSVLASLAAFVYLQAPLSAASSHHGLRHRSLGHSSAPKMCSA
                     SSAEVVNNSTEIFPYQTFHSFTGTPPRLNITANGEELAEGLIFFGPNTESGAGKPKEV
                     TNFIMTDTGDLVYAHPPTRAPTDFKAQTLNGKPVVTYYTPVGTQPFVGIGWGNVHILD
                     DTYKEIHTVCPKLNLHKGDGTIAECGSDLHEHYITEDNTLLTTAFNVTQYDLTPLGGT
                     ADDWILNAIVLELDIESGEVLWQWSLIDHIPILQSHAGVPKNGVKQTGAIDLYHMNSI
                     QSIGDYIFINCRHTWSSYLINRKTGEIEWTIDGETGGDFGKLPENGTFVSTTRHSQSV
                     IHTDRICIQSWEHHGRLHNMTESSVVLSYFANNNNAATKEAVSKGIVLELTLPPNPDS
                     PPKLLADLYDATDLQNAWAEGSTDILSNGNYFMGYGSASVIKEYGPGAANGQDVRWTG
                     LFDAIGGGDSYRAFKQVWHATPASPPSLVISSGNIPESLSKCTNSSDSALAYVSWNGA
                     TDVTSYDVYAGSSEDDLELIGTVDKQGFETVFPIHSTYAAVMVSALDRNSSVVKIN"
     gene            complement(<594742..>596538)
                     /locus_tag="TRUGW13939_00181"
                     /db_xref="GeneID:55987697"
     mRNA            complement(join(<594742..596227,596285..>596538))
                     /locus_tag="TRUGW13939_00181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483395.1"
                     /db_xref="GeneID:55987697"
     CDS             complement(join(594742..596227,596285..596538))
                     /locus_tag="TRUGW13939_00181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339288.1"
                     /db_xref="GeneID:55987697"
                     /translation="MASAGGKPAGVLQIPVSATQKGSPAPAPATKSAAKPPAPRLKLI
                     VRRLPPGLTQGEFETNLGDDWKVGSGQVDWFQYKPGKVSKDPAKPSRPARAYLHLLSE
                     TLIPSLFEKVKATSFHDARSTSNDPVLMGPPSVEFAPYARVPGSRTRKDGRQGGIDQD
                     PDFVAFLESLTNPVKKSAATEGEAEKDDDQVTVTPLVQYIKEKKASKAKDGASGKSSK
                     RGKDKEAKAEKADAKKLLKRPEKESTLASTPGSPDKKSTSSPAKVEKATKEAVKAANK
                     QAAAAAASTKLKQPATKEPSQASPTRTPASDRKRERGDVTAAAKILQRDLGLAPSGGR
                     RRGKAAAAADNESAKKEAGQDSATSSPTVPTGPKSSKQGPKAAKESASKGAASKGSPS
                     PAAQATETITNTGSPVPSTGSAASTPKPPKQPKPKQPAVSPTATQAFLKHANPSQGVT
                     EELLDTAFGVFGKVTKVEIDRKKGFGYVDFAEADSLQKAIAASPVTVAQSQVVVLERK
                     NPPSQQKAAKTGDAAPQASSGTPPQAGVSREKRSRGTRSRGGRGQKKAGAGAAEGEKG
                     EKAEKATPVSEAQ"
     gene            <597109..>598454
                     /locus_tag="TRUGW13939_00182"
                     /db_xref="GeneID:55987698"
     mRNA            join(<597109..597262,597315..597720,597772..598103,
                     598165..>598454)
                     /locus_tag="TRUGW13939_00182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483396.1"
                     /db_xref="GeneID:55987698"
     CDS             join(597109..597262,597315..597720,597772..598103,
                     598165..598454)
                     /locus_tag="TRUGW13939_00182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339289.1"
                     /db_xref="GeneID:55987698"
                     /translation="MAEKGVPAPGPAKLKRNAGPDEWLEASKNCKYLSEYHMKQLCDI
                     VKEYMMEESNIQPVSSPVTICGDIHGQFYDLLELFRVAGGMPNETNVEAPINAPSVIT
                     SDDIEPPSTITDPKLRKKMKNADGLDEIDDDASASGRGRSGSALSGEGNTNTGSPTGN
                     FVFLGDYVDRGYFSLETLTLLLCLKAKYPDRITLVRGNHESRQITQVYGFYEECFQKY
                     GNASVWKACCQVFDFMTLGAIIDGKVLCVHGGLSPEIRTLDQVRVVARAQEIPHEGAF
                     CDLVWSDPEDVETWAVSPRGAGWLFGDKVAEEFCHVNDLSLIARAHQLVNEGYKYHFD
                     KQNVATVWSAPNYCYRCGNLASVCEVREDLKPTFKLFSAVGDDQRHLPASRPGRSEYF
                     L"
     gene            <599115..>600320
                     /locus_tag="TRUGW13939_00183"
                     /db_xref="GeneID:55987699"
     mRNA            <599115..>600320
                     /locus_tag="TRUGW13939_00183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483397.1"
                     /db_xref="GeneID:55987699"
     CDS             599115..600320
                     /locus_tag="TRUGW13939_00183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339290.1"
                     /db_xref="GeneID:55987699"
                     /translation="MNLETGRRLQEASSHGISVVAKATLKEEDTAAYSGSLLALCAEK
                     DRGGGVSLACKGVASRTFAIYTTAILPRLWRDIILHERGSDLYVTRLNILAEKVSMLL
                     PIYTAFDDLADTSNGTRSPHLESLPASPILETGQFSRNSLAESKPSFLLNAALHKQHC
                     IIGQGSMTETLLVALRRPWCVLEICVGSTQEEYGNSGQKAAEFLKDILSFARLAYEKD
                     ESGYVMAVFLLEHELDKRHAVKTSHPMISTLQRHGRGQFETREASTWNCQFDTTQSSQ
                     PHRWPRTSYAYASCNKAVFLPSLTSFNAFWIRLICVSAVEAELSFSALVGMLAASIPG
                     QIGLSDSRISRTTVFSQRGKQARRQSDSEVHLSRIFNDSVQCQSIDKLVRDMLQLYRG
                     VVQIAEDYI"
     gene            <601674..>602201
                     /locus_tag="TRUGW13939_00184"
                     /db_xref="GeneID:55987700"
     mRNA            <601674..>602201
                     /locus_tag="TRUGW13939_00184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483398.1"
                     /db_xref="GeneID:55987700"
     CDS             601674..602201
                     /locus_tag="TRUGW13939_00184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339291.1"
                     /db_xref="GeneID:55987700"
                     /translation="MYGFQTLLGASATILAILSPTTARLTRKNEQSATACCEEIEDCY
                     TLSGKTDDGLNWCAGYWTGTTNWTQGDADTAKCLTNLHYVQNDKCITKSGSSCDNGDS
                     SPDVAKAYDTFLYGNYQLSSNDSRAIQAAMDAMVGKQIDLDVDAGSDGYIVFVHVADN
                     GSGINGIEVYNSGGC"
     gene            602940..603015
                     /locus_tag="TRUGW13939_00185"
                     /db_xref="GeneID:55987701"
     tRNA            602940..603015
                     /locus_tag="TRUGW13939_00185"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:55987701"
     gene            <606094..>607526
                     /locus_tag="TRUGW13939_00187"
                     /db_xref="GeneID:55987702"
     mRNA            join(<606094..606117,606168..606236,606396..606455,
                     606578..607336,607407..>607526)
                     /locus_tag="TRUGW13939_00187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483399.1"
                     /db_xref="GeneID:55987702"
     CDS             join(606094..606117,606168..606236,606396..606455,
                     606578..607336,607407..607526)
                     /locus_tag="TRUGW13939_00187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339292.1"
                     /db_xref="GeneID:55987702"
                     /translation="MAPRAPKPKTPTRRGPSGSTRRGRGARRPALENVFTPPAVTTEE
                     LDALLAVEDSDLSSLEPDADMTDRLESGPAGDATSAPLAENMVEDADETPRHTQAASE
                     TPVPVASAPGIPDVLLSGDQPDFSGYYDPQSGAPLCALGARGLHRLTSQESARLARVP
                     PAYFGAVPVADERLVLWQSHPCLRCAKLVGRHQNFCVRRLPTEKCCRCSCLGVKCDSI
                     PDSQLASFRIVQAMFRLGVSPEAIRAAADWVRVVEGTLRREPSSSPSQSRIRSLGPSE
                     SDRVAALEARLDRIEGTMGQILQILNRQNEYFGIAPAAVPAAPASPAARRHGGVLWSP
                     PAWGGPSGQ"
     gene            complement(<611149..>612291)
                     /locus_tag="TRUGW13939_00188"
                     /db_xref="GeneID:55987703"
     mRNA            complement(<611149..>612291)
                     /locus_tag="TRUGW13939_00188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483400.1"
                     /db_xref="GeneID:55987703"
     CDS             complement(611149..612291)
                     /locus_tag="TRUGW13939_00188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339293.1"
                     /db_xref="GeneID:55987703"
                     /translation="MVTTRGMTSPTPDEPGTVPVPNPGFVHEEEEAQDHTSTEPAQDA
                     TSEELPPQAVPQVNMTMEMLQALIQGLRTTGPSHATTSERRDTKVPDPKRFASKSIKE
                     FEEWIEDVENNISSRPRSYPDEASKVQYAAAWLDGDHRIQWREKKNSINLQSFTFDDF
                     RTWLEDQIESPQNRGINSAMALLSLTQSNGQDPEAFYSKFSILYEKAREGSGGPPPAE
                     DLFKYRIFLAKLLPKIRSDITRMGTLPAKLPDLITTAQRLYQIEKQERRLERKAENEN
                     NNRSGGQGPTRNQEGSDSKPTRKRKYRSDHNDREKSQKKQKSFSKNKDKSTVTCYRCN
                     RTGHYATECKATKTAEGNPISPPKLNATHTKKEKETEKQSDKEQTQ"
     gene            <614240..>616853
                     /locus_tag="TRUGW13939_00189"
                     /db_xref="GeneID:55987704"
     mRNA            join(<614240..614767,614825..616268,616321..>616853)
                     /locus_tag="TRUGW13939_00189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483401.1"
                     /db_xref="GeneID:55987704"
     CDS             join(614240..614767,614825..616268,616321..616853)
                     /locus_tag="TRUGW13939_00189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339294.1"
                     /db_xref="GeneID:55987704"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTSLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            complement(<624749..>626319)
                     /locus_tag="TRUGW13939_00190"
                     /db_xref="GeneID:55987705"
     mRNA            complement(join(<624749..626180,626258..>626319))
                     /locus_tag="TRUGW13939_00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483402.1"
                     /db_xref="GeneID:55987705"
     CDS             complement(join(624749..626180,626258..626319))
                     /locus_tag="TRUGW13939_00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339295.1"
                     /db_xref="GeneID:55987705"
                     /translation="MSLSQQITLPNGVSYEQPLGLFINNEFVKGADGKTFETINPHDE
                     KVITAVHEGTEKDVDIAVKAARTALEGEWKHVTPSQRGRLLTKLADLLEENIETLAAI
                     ESLDNGKTVFWSKVDINNAAGCIRYYGGWADKIVGQTIDTDEKNFTFTRHEPVGVCGQ
                     IIPWNFPMLMWSWKIGPALATGNTIVLKTAEQTPLSALFAATLVKKAGFPPGVVNIVS
                     GFGKTAGAAISNHMDIDKVAFTGSTLVGRQILQAAAKSNLKKVTLELGGKSPNIVFAD
                     ADLDNAISWVNFGIYYNHGQCCCAGSRVLVHEAIYDKFIEAFKKRTQANKVGDPFGKD
                     TFQGPQISQIQYDRIMGYIEEGKKAGATVVTGGERVGDKGYYIAPTIFSDVTSDMKIV
                     QEEIFGPVCTVQKFKDEEEAIKLSNTGTYGLASAVHTTNLNTALRVSGALRAGTVWVN
                     NYNMLHYQMPFGGYKESGLGRELGSYALENYTQVKSIRVYLGDALFS"
     gene            <628083..>630775
                     /locus_tag="TRUGW13939_00191"
                     /db_xref="GeneID:55987706"
     mRNA            join(<628083..628091,628140..628199,628256..628264,
                     628312..628342,628401..628416,628468..628502,
                     628560..628590,628646..628851,628901..628908,
                     628970..628983,629040..629147,629209..629287,
                     629343..629672,629752..629911,629977..630199,
                     630260..630505,630566..630625,630685..>630775)
                     /locus_tag="TRUGW13939_00191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483403.1"
                     /db_xref="GeneID:55987706"
     CDS             join(<628083..628091,628140..628199,628256..628264,
                     628312..628342,628401..628416,628468..628502,
                     628560..628590,628646..628851,628901..628908,
                     628970..628983,629040..629147,629209..629287,
                     629343..629672,629752..629911,629977..630199,
                     630260..630505,630566..630625,630685..630775)
                     /locus_tag="TRUGW13939_00191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339296.1"
                     /db_xref="GeneID:55987706"
                     /translation="ELSNTLPASSAGLLLKTTGLRVTAIKIDPYLNIDAGTLGPLEHG
                     ECFVLADGGECDLDLGNYERYLGINLTRDNNITTGKIYQEVISRERKGTYLGRTVQVV
                     PHITDMIQEWIMRVAKVPVDNSGETPDVCIIELGGTIGDIESAPFVEALVQLRHKLTK
                     DPDSSFFNIQVSFVPSIHGEEKTKPTQHAIKQMRSAGLIPDLIACRCDNSLENATIRK
                     IATSCQVDYEQVIGVHDMETVYEVPLLLHEQELLQRLRSGLSLDKLTLTPAIAAQGAS
                     LWELWKKTIIIPKESASVQIALVGKYTQLMDSYLSVVKALEHAAMHCRRKLKLIPVDS
                     EHLEPATQKKEPGKYHKAWQAVCEADGVVVPGGFGHRGTEGMIACAKWARENNKNFLG
                     ICLGMQVATIEVSRSLCGHPEATSEEWGSESQHGENWAIVFMPESSKEHLGGTMRLGL
                     RASNFQPDSEWSKLRALYGGGASFTERHRHRYEVNPDLVEELEKAGLHFIAKDESGKR
                     MEAFELKDHPFYVGLQAHPELTSKVTQCSPPFLGLVAASAGMLDKIIDEAKNQKKVVT
                     GAGHF"
     gene            <631200..>632630
                     /locus_tag="TRUGW13939_00192"
                     /db_xref="GeneID:55987707"
     mRNA            <631200..>632630
                     /locus_tag="TRUGW13939_00192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483404.1"
                     /db_xref="GeneID:55987707"
     CDS             631200..632630
                     /locus_tag="TRUGW13939_00192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339297.1"
                     /db_xref="GeneID:55987707"
                     /translation="MTLSPYLVGIALNVGAVRAALPDHPSAIATLKDDNEVTFDPLGV
                     AAVLHNPRASLSAARLYTQYDHSIFTWPHTMMMGAALIPVKVLVEHLTATFQSIHPAI
                     SLCTRDTQTLAVVSNMVFKEFPLDFSKMWVGDVIAYKSSTKPVNDFMIVCMDEELAQD
                     RQHQGPSKATRWLGRRVLDAIMIMNGMILAVGAILGSLYIDIWAITLFCFYLIHCVAG
                     FAISHTPLVVPQKMTIKDDSTVRYAIYQRPAGGTVVFKGRQDTMERWARITWEFKRSF
                     YNDCLHWFWMISGTLSAIASVACMVNMQGFIQLIFLGQLVYASLAEIVATRVARILGG
                     QANASNRTYLVSGNTFRTNGIIRATIEADAQFRLVGLDWVGLKRMPADRIFIDMQDLL
                     LKQINEVQERIEAGNDVDSVPESDPASHPDVMAAFEAFRANRTDDEDPVLVQRIQDET
                     RTALQTWWEKRRKTADGGARNGRPPV"
     gene            complement(<638011..>643071)
                     /locus_tag="TRUGW13939_00193"
                     /db_xref="GeneID:55987708"
     mRNA            complement(join(<638011..638934,639006..639290,
                     639349..639448,639506..639636,640707..643000,
                     643056..>643071))
                     /locus_tag="TRUGW13939_00193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483405.1"
                     /db_xref="GeneID:55987708"
     CDS             complement(join(638011..638934,639006..639290,
                     639349..639448,639506..639636,640707..643000,
                     643056..643071))
                     /locus_tag="TRUGW13939_00193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339298.1"
                     /db_xref="GeneID:55987708"
                     /translation="MPPLGDADTIRILVSTDNHVGYNERDPVRGDDSWKSFHEIMCLA
                     KEQDVDMVLLAGDLFHENKPSRKSMYQVMRSLRMNCLGDRPCELEFLSDASENFQGAF
                     NHVNYEDLDMNVAMPVFSIHGNHDDPSGEGHLAALDILQVSGLINYYGRTPESDNIQV
                     KPVLLQKGRTKLALYGLSNVRDERLYRTFRDGKVKFFQPSVQKEDWFNLICVHQNHHA
                     HTETSYLPEHFLPEFLDLVIWGHEHECLINPRLNPETKFHVMQPGSSVATSLVPGEAV
                     QKQVSLLSITGREFKSEPIPLKSVRPFVMKEIVLSEDKEAKKVARKENNRTEVTRLLM
                     TYVEDLIEQAKSEWIESHQDDIDGDEEPEIPLPLIRLRVETSTPDGGSFDCENPQRFS
                     NRFVGKVANVNDVVQFHRKKKTATTSRKADDAAAEADMSHLATLDTVKVEQLVRELLT
                     AQSLSILPQNSFGDAVSQFVDKDDKHAMEMFVNESLDNQVKYLMGLERDADLDDEDEM
                     HQSLQNAMEKYRTQMEDLFSKGAVRRTRGKKRFKPKPDGWDSEFDGPWEDQPGALIHS
                     DNEGGDPNEEEAGEDGTERPTAATHGRGRGRGGRGAASSTTTRKTAATTTTKTTKKAT
                     PAARGGRRKQAISDEEEEEEDAIMLDDDDSVEEPQAIASDDEDSQALFVQQKRPSRAR
                     QLAASTTTSSRRGGRTAASPAPSSVTAAASSTRRSGRAGAKSTQQTTLSFASQDNSTG
                     AGKRNAPRPARGGFAEMSDIEDDDDDAFEPSYAKLFAAACGLASTAQAVHPLIVEGKD
                     FVNSVTKDRFQIIGVDYQPGGSSAFKKTADPLADKDACLRDAAILQRLGVNAIRVYNL
                     APGLNHDDCASIFNAAGIYMFLDVNSPLTNGALDQTAPWTTYNHFYLQQVFGVIESFK
                     NYPNTAAFFSANEVINEASVEQAGNYIRAVQRDMHDYIEKHANRSIPVGYSAADVRPL
                     LVDTAYYLSCDLSNSTSSRSDFFGLNSYSWCGDATYKSSGYNVLTQDFKDISMPVFFS
                     ETGCNNVRPRVFSEIEAIYGPDMSQSLSGALVYEYSQEKNDYGLVQINSNGSVSLLVD
                     FDNLQKQYNNLDLDAITKANSTQTSMDAPTCNPDEITSNITKSFDIPERVDGIDKMVE
                     DGYTKNIHVGELVDVTSTKLSQDVFDSNGNLISDIKLNILSEDAVNTPSKSSSSSTSS
                     DSSSTSPSGTSSGTAAATSSGAASSLTAGSVTGFGGLVALALMAL"
     gene            <643811..>647302
                     /locus_tag="TRUGW13939_00194"
                     /db_xref="GeneID:55987709"
     mRNA            join(<643811..644204,644265..>647302)
                     /locus_tag="TRUGW13939_00194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483406.1"
                     /db_xref="GeneID:55987709"
     CDS             join(643811..644204,644265..647302)
                     /locus_tag="TRUGW13939_00194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339299.1"
                     /db_xref="GeneID:55987709"
                     /translation="MQPEPLVVSQNSSADANPANPSLSFQHGNDRRCDEPVFDTLPPG
                     DVGDRRVVDDVDSAIASSNSTGDGSHALLLRRLNSADSVGSVPISPVHYGSEFGSPPQ
                     VMQSGSADSKSKIYTFRMKPRQSLAGLPNEVLTHILSHLPPNSLSAISLVSRRFHTLV
                     TTPHAWRVAFARYFPGSGSIQEDCEIDALVLDKRSFTRLTALASWRSEYILRTRLLRS
                     LGRGKPATPSSPGKHHPRAGGVQSGSPVVTYPSKLLYPVSHIDAVFTPTSTKKPPLFI
                     HGAAEQGAATSSDPSAGKSGSWGLAAHQLFQHFADLYTGETEYGLGAGDMVGLPNPMD
                     VSQLYGMIYGEGCPQGRSYFLSSGEQRGRFLTFSELDSEPDRGIPALNMITTAVSSVW
                     IAKSPNVLKMTNGMIGVLSGTSSGILTAYSLGTSVVHDHRFDRGQITARWVLCPGVPI
                     ISIAIDENFSVKRHSNGRAWAIVLNALGEVYYLTDIPALPETTTRRTPEECEKLAWKS
                     GRSVRWEMIEATRRIAQPDPYNRELVDGSYSPRSSTDSMGLSKDQIAAETKEIEKFLA
                     FKPKHFRKVCEGWDMRRQLQVDFAGDDLHGAGELLVVVNCGLNDGQTASIRRYVRQRV
                     SNDRHVAVEHFSRLSSPKPVNSLFGGPSTPMGEDSSTSRSRASSYVENDISTISNTTW
                     KMTDFVFDNPRSLQVTSTTIDVSTLAQLTAAEDPLLGMSGTSTSSSPLSSPLPHMSST
                     GSGSEIPGQRARLMAVGTNTGSVYMWNMRAPLSRTSDEINSVAPVRIIRTESPQVSCL
                     ALTSLYLVHGGNDGLVQAWDPLASTTRPIRTLHSRFSSRARRRLIQAEASMLGIGNNF
                     FAAGAICLDPDPTVLRGVVSLGSHVRFWSYSSSAADEYKSNKRRLRRSHRGSLASGDG
                     QRFSNTGRGALNDFIADEQQEMKRQTVEDQKQKELLSHRFGIDLLGPDATEDELMAYA
                     RMLSEESLNSDTVKQQKEGETSLVASSVSSDTIAAQDSSFPSREFSSSSSPALDTVEE
                     ELAPDIAEAIRLSLLDEASSGGDYYPSPSSSIPIKYAKGARSGSRRLHSPVSSSPEVE
                     GSNRQEMDDLEFAIQLSLAEEQSRGQAAAEQEEFPALMTSSYDGADKGKGKARAW"
     gene            complement(<647443..>648917)
                     /locus_tag="TRUGW13939_00195"
                     /db_xref="GeneID:55987710"
     mRNA            complement(join(<647443..648774,648849..>648917))
                     /locus_tag="TRUGW13939_00195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483407.1"
                     /db_xref="GeneID:55987710"
     CDS             complement(join(647443..648774,648849..648917))
                     /locus_tag="TRUGW13939_00195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339300.1"
                     /db_xref="GeneID:55987710"
                     /translation="MAQRRFHKKSRHGCSQCKHNRTKCDENSPTCGRCERIGLVCSLA
                     SQSSGLIFIPANPAEPENSSNTTIATTSSSRGNHHSSGNRGLSPVPRSSVVRAANTFT
                     SLSPHSLQNNSFGLTTTNAVLKSDSSSSTTAINNNNNTTPNDSPNSNPDGLSATSLAP
                     VVTDIERERLKLMTHYTQHTAQSITDFGVQTGDASLWRDWVVELAFEYDFLLYGLLGL
                     SALHLALQCDSNDSIQKQHYTILAIQHYDRGIALFRPYLNDLDSASQDSLFGFSVIVA
                     LYSFGIQRVPPFLTSNSNSIARLHQALSLLRSSSHIAKKDFEALRRGRWSGMLVPLPD
                     SHYKLPQAMEDMLIKLGQYTSKTITTSTQQEMYMCCIEALRINLALAVEYDRAQVRVS
                     FLAVATPDEFWSMVCIGEPLALAILANFAVILYWLRQTIWLQGWGRETVEAVREALPV
                     EWHDCIAWAVQETELS"
     gene            <649407..>650538
                     /locus_tag="TRUGW13939_00196"
                     /db_xref="GeneID:55987711"
     mRNA            join(<649407..649794,649865..>650538)
                     /locus_tag="TRUGW13939_00196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483408.1"
                     /db_xref="GeneID:55987711"
     CDS             join(649407..649794,649865..650538)
                     /locus_tag="TRUGW13939_00196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339301.1"
                     /db_xref="GeneID:55987711"
                     /translation="MVKLDVVRSANSALVQSQPLVAVFFGGTGGIGSYTLRALATAEA
                     QNGGKGVRAYVVGRKAESAERILSECRDICPEGQFKFVQAGDLSLIQVVDQVCAEILE
                     LEEKEGQDARIDYLMLSQGGSIFLPRKETKEGIDVTMSLMYYSRMRIIMRLLPLLLKS
                     NLPPRVVSVYAAGMEAKLFPEDLSLRDLKHFSYSQARSHMVYMHTLFMEALAEQNASK
                     VGLVHIFPGLVLGPAFSSPELPAWFRFMWRFVFVPLFGRFVTVPTEESGARMLSLASP
                     RYAPQAATDGDIKKSEELATGTNGTPGSGVYALDSQCESSIKTKAYEKFNKDEMRKKV
                     YDHTISAFEVAAQGGVFTE"
     gene            <651623..>653395
                     /locus_tag="TRUGW13939_00197"
                     /db_xref="GeneID:55987712"
     mRNA            join(<651623..651772,651828..652525,652579..>653395)
                     /locus_tag="TRUGW13939_00197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483409.1"
                     /db_xref="GeneID:55987712"
     CDS             join(651623..651772,651828..652525,652579..653395)
                     /locus_tag="TRUGW13939_00197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339302.1"
                     /db_xref="GeneID:55987712"
                     /translation="MSSTTENASVDKTAKAKGANAIELPDKRVVQLDELSANDRALAE
                     QFGYQPVFKREFGYLSTFSFAFSISGLFATISTTFSYPLIAGGSASVIWCWLVSGLGC
                     MCIAASVAELVSAYPTSGGLYFTVSRLAPARWVPSISWLTGWINLLGQIAGVASSEYG
                     SAQMLLAAVSMGRDFKWTPTTGMTVGVMAALTVFCGILNSLPTGWMEKMTRSYVLFHL
                     AVLVTCCIALLAKTDKSMRHDASYVFTHVETTSGWTPIGFSFLFGFLSVSWTMTDYDA
                     TAHIAEEIQDPEIKAPWAIFLAMAAVYVLGWLFNIVLCFTMGDPNAILNSPMEQPVAQ
                     IFYNSLGKSGGIFYTVCACILLQFICLTATQALARTVFAFSRDRLLPLSHVWTKISPI
                     TGTPLYAVWFSVFWCIAINLIALGNYVAIEGVFNITAIALDWSYVIPIVCKLWFGQFE
                     PGPWHMGKFSTAVNYWAIIWTAFVSVIFFFPTSRPVGGDTMNYAIAFMGLILLCALVY
                     WYIRGRKFYVGPLKETVVQGQGLNGGILESTPVESIDREQAEKMTI"
     gene            <653877..>654481
                     /locus_tag="TRUGW13939_00198"
                     /db_xref="GeneID:55987713"
     mRNA            join(<653877..654000,654063..>654481)
                     /locus_tag="TRUGW13939_00198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483410.1"
                     /db_xref="GeneID:55987713"
     CDS             join(653877..654000,654063..654481)
                     /locus_tag="TRUGW13939_00198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339303.1"
                     /db_xref="GeneID:55987713"
                     /translation="MPSYKNIDQYLAEIKDDSSKLLGLSIGSHQNVSPGTKIPKADAQ
                     KPPTLKLPASLASSEQTYILIAIDIDAPFPSWRGLGPILHWVQPGYKHDAASGNLTTS
                     EPFITNYIGPAPPPPSSPHRYCFFLYEQPASLAVKDLAPKDGKTVGNVARMWFDLEKY
                     ETQLGLKGGSIVAGNFFVSN"
     gene            <659058..>661719
                     /locus_tag="TRUGW13939_00199"
                     /db_xref="GeneID:55987714"
     mRNA            join(<659058..659181,659247..659440,659497..659549,
                     659611..659833,659896..660145,660202..660364,
                     660426..>661719)
                     /locus_tag="TRUGW13939_00199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483411.1"
                     /db_xref="GeneID:55987714"
     CDS             join(659058..659181,659247..659440,659497..659549,
                     659611..659833,659896..660145,660202..660364,
                     660426..661719)
                     /locus_tag="TRUGW13939_00199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339304.1"
                     /db_xref="GeneID:55987714"
                     /translation="MWVTGSKSALLLGLACSSAVAQDVITTDSYFYGDSPPVYPSPSG
                     NGAGDWSSAYQKAEDFVSQLTQEEKVSLTTGVTANNGCSGHIQAISRLDFPGMCLADA
                     GNGVRGTDYVNSWASGVHVGASWNRDLALQRGKYLGTEFRAKGVNAMLGPVVGPTGRV
                     ATSGRNWEGFSSDPYLTGALAFQTVQGVQSEGVVACTKHYIGNEQETNRNPKANDQGQ
                     TVESVSSNIDDKTLHEQYLWPFQDAVLAGSASIMCAYNRVNNSYSCQNSKLLNGLLKT
                     ELGFQGYVVTDWGAQHGGIAAANAGLDVVMPDSSLWGSNLTDAIANGTMEASRLDDMI
                     TRLMASWYYLDQASTIPSPGVGMPVDSRAPHQTVVARNSSENLILLQAAIEGHVLVKN
                     ENNTLPLKAPKLLSIFGYDANGDGQSSEQLIFDASTVAYLNETLYVGGGSGANSPAYL
                     DTPFAAMQRQAYKDGTSLLWDFSSQNPTINANSDACLVFVNAYASEGWDRPGLSDDYS
                     DTLITNVANTCKNTIVVIHNAGIRLVGNWIDNDNIKAVIFAHLPGQDVGGPLVDILYG
                     KVNPSGKLPYTVAKNESDYGSLLSPSQPEGQFAIFPQSDFTEGVYVDYKYFDNNTITP
                     QYPFGYGLSYTTFNYSDLSVSTSNESYSAYPANATIVPGGNPHLFDNLATVSVTVQNT
                     GSVYGQEVAQLYLGIPNGPVRQLRGFEKVSIDPSQTKTAQFNLTRRDLSVWDTTAQQW
                     LLQEGTYNVYVGSSSRDLPLTSTLSF"
     gene            <663493..>665247
                     /locus_tag="TRUGW13939_00200"
                     /db_xref="GeneID:55987715"
     mRNA            <663493..>665247
                     /locus_tag="TRUGW13939_00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483412.1"
                     /db_xref="GeneID:55987715"
     CDS             663493..665247
                     /locus_tag="TRUGW13939_00200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339305.1"
                     /db_xref="GeneID:55987715"
                     /translation="MHTYKIATVAALGAAAVTTASSLADLCTVSNVQSALPSNGTLLG
                     INLLPSTVTASALYNQSSGTGSSGTYNYCNVTVSYTHTGKGDAVVLKYAFPSPSDFEN
                     RFYVAGGGGFSLSTDATGGLEYGAAGGATDAGYDAFETSYDDVVLYGNGSLNWDATYM
                     FSYQALGEMTKVGKEISKGFYGLSSDEKIYTYFEGCSDGGREGMSQVQRWGEEYDGVI
                     AGAPAFRFAQQQVTHVFPATVEKTQGYYPPPCELQKIVNATIAACDPLDGRTDGVVSR
                     SDLCKLNFNLSSIIGEHYYCAAETSSSLGFGFSKRQAAGSTTSYQPAQNGTVTAQGVA
                     IAQAVYDGLHNSAGERAYLSWQIAASLDDADTEYNNDTESWGLEIPSTGGEYVTKFVE
                     LLDLDNLSNLDNVTYDTLVDWMNTAIVRYLDSLQTTLPDLTPFQSTGGKLLHYHGESD
                     PSIPTASSVHYWQSVRSIMYNDLTDEESLAALEDWYQFYLIPGAAHCGTNTLQPGPYP
                     ENNMNIMIDWVENGVKPTRLNTTVSSGQYEGETQMLCQWPTRPLWHGNSSNFECVNDQ
                     KSYDSWMYTFPAFKLPVY"
     gene            complement(<665410..>666360)
                     /locus_tag="TRUGW13939_00201"
                     /db_xref="GeneID:55987716"
     mRNA            complement(<665410..>666360)
                     /locus_tag="TRUGW13939_00201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483413.1"
                     /db_xref="GeneID:55987716"
     CDS             complement(665410..666360)
                     /locus_tag="TRUGW13939_00201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339306.1"
                     /db_xref="GeneID:55987716"
                     /translation="MKAACVTSWGSPPEYISVPDLPTPTPTQLQIKVVAVGVSRVVRG
                     RAAGKHPSALNEPLPFDPSTDGVGLDEATGDLYFVNSLDTSLFAERANVERKNLVKLD
                     NGVNPVTIAAVANPAASSWMALKCRAIGGCEGRTVVIVGATSASGRAAAFIARSLGAA
                     RVIGISRSEQTLATVQGLDERIVMSKDETPEAFSLPSSLGPVHIVIDYVGGPASIGVM
                     KSAQIPEGENLQYVYVGGLSGYEKVDLPIRLINTRPIQIMASGFGSWSRQDLNREING
                     LVTALTKMDKFSDVVTAPLADVKAAWDSEKTQTKRLVLIP"
     gene            complement(<667039..>667916)
                     /locus_tag="TRUGW13939_00202"
                     /db_xref="GeneID:55987717"
     mRNA            complement(join(<667039..667160,667217..667762,
                     667817..>667916))
                     /locus_tag="TRUGW13939_00202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483414.1"
                     /db_xref="GeneID:55987717"
     CDS             complement(join(667039..667160,667217..667762,
                     667817..667916))
                     /locus_tag="TRUGW13939_00202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339307.1"
                     /db_xref="GeneID:55987717"
                     /translation="MKSTLFAEISLFGLAARAWRPEGHDWHPPLPEDSRSPCPGLNVL
                     ANHGYLPRTGKNIDLEAVRYGISAAYNFERTSFDTAFQQAVDFKLTTTGNSSTFDLSD
                     LAAHDEIEIDGSLSRNDFYFGDDLHFDHAIWMTVAERLGLYDFGEIGVEQYVTVETAA
                     KARAARVADAKRVNPTFNASANQMVGSPGTTALYLLTLWDEKAGAVPKPWIKAFFEDE
                     RIPWIEGYKLSKNQKTSQDIGDMTKRVMAVNVSSEST"
     gene            <668579..>670021
                     /locus_tag="TRUGW13939_00203"
                     /db_xref="GeneID:55987718"
     mRNA            <668579..>670021
                     /locus_tag="TRUGW13939_00203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483415.1"
                     /db_xref="GeneID:55987718"
     CDS             668579..670021
                     /locus_tag="TRUGW13939_00203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339308.1"
                     /db_xref="GeneID:55987718"
                     /translation="MHSHFGVFLPIALLGAGASIVAGISSSSTCGALCLENVHKGSSW
                     EMDQHASRDFSFYEPPSNFSSKLPPGSLLTVEPVTDLSEYSIPSGLSMSRIIYTTNDL
                     NGTTLPASAYILWPYAPLETPEQQKQGYPMVAWAHGTSGVLRGCAPSNYRNLQYHFMA
                     PFLLALQGMAVVAPDYAGLGIRTLPNGQEIGHPWLTGPAQANDLSNAIIAARKAFPSL
                     LTANGPFVAMGHSQGGGAAWSFAEKQVKEPISGYKGAVAIAPPTRTIDHLKDAFGNVT
                     QTWAQLIIAGQPKLIAAVTAVFPSYNYTGLTSVSYDRWFNVLEPLDGCLPTDSLAFTN
                     VTTDELAVANWYDAPEVQEYARLSESGRKKFKGPLLVISGEADIVVPHDTVEPAVDDT
                     CSMLTHEHWDESLEFVSYSAMDHFPSIQASQIKWLAWIKDRLSGVPASKSGCVKSLVN
                     GFRTDDTFQSAEPNFLEGWASTDESWKYSL"
     gene            <671522..>673355
                     /locus_tag="TRUGW13939_00204"
                     /db_xref="GeneID:55987719"
     mRNA            join(<671522..671641,671700..>673355)
                     /locus_tag="TRUGW13939_00204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483416.1"
                     /db_xref="GeneID:55987719"
     CDS             join(671522..671641,671700..673355)
                     /locus_tag="TRUGW13939_00204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339309.1"
                     /db_xref="GeneID:55987719"
                     /translation="MPLKSLDMNETAGLGSVFKTRRSHKKSRNGCSKCKQRRIKCDEL
                     TPKCSRCKKMNLNCQYPQKSPSSLASEDFWIDPLLLQFEDFRTDCATASSENSDHSSA
                     IGGSPLSSSSSTPPSQSLLAVPKHIKRSDSPLRSQVAQTLAPIEFELLKHYLEHTCRD
                     MTVDDDDQYTLQTGIPNLACQSKPLMKSVLAIAAVCKCCDIIKQPSTSREDRDKVLEL
                     LSLAHGYHMESLRGIQATLSETKHYDHVLANAALMGMYGSGSHCARIWLAKTATSSDQ
                     PLGDFMPKHSQWISLFRAVHLAYGGLLNDTQGMDDNVVQLSPGRPLVDPIASSGSQIQ
                     YEYKISSRVEQQRTPPNHALFSILAATVGSALDTLRQKVRDIAMVQASNEINSHHTST
                     PPASYGNPDLQSCYTALTLLGNIVSETFPTGDSLPSTPGRGHLAFEVDIDPVGRLSEV
                     SPWLRKYTASITSMIPSRLPRRFIMAFIHKAPTKFLNLVEEILSFMQANTDNGEETWT
                     PSTLEPSIAHQLAVEIFAHWLVLVILLDNVWWIGGIGAWELGRVVSLRKDARWRMCMW
                     NRDEDWWPESMFEVNRHFDKHRTKN"
     gene            complement(<673595..>674863)
                     /locus_tag="TRUGW13939_00205"
                     /db_xref="GeneID:55987720"
     mRNA            complement(<673595..>674863)
                     /locus_tag="TRUGW13939_00205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483417.1"
                     /db_xref="GeneID:55987720"
     CDS             complement(673595..674863)
                     /locus_tag="TRUGW13939_00205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339310.1"
                     /db_xref="GeneID:55987720"
                     /translation="MPLNVLVVGAGICGPAFAMLLQRSNPQHKITIIERFPNLRSTGQ
                     QIDLKTQAPIILSKMGLLDEIKSHCVDETGLEMVNSKGKQIAVFGVSPADERRPGLTS
                     EHEIMRGDMVNVIYNASIKQDLNLRDKSANDGGLTYEFDQTITEFDQKPDGVDVTFSD
                     GQRRHYDLIVAADGQASHTRRLAFGREVSDAAFKSLGIHGAYFDMPQIDGEGTLAKGH
                     LSPKSTMVVTRPSGRPVTGVLAFTTRPPPELKASYKQSLDKQKEAFAKVFQNVDWQTE
                     RFTSGLRASLDFYAHEVGQIKMKQLSTGRVVLLGDAGYCPSPFTGLGTNLSLMGAYIL
                     AGELARQSPDIPGAFKSYEQKMQPVIGECQQFSSAILGIFFPSSRFGVWFMHNLVWSV
                     SKLADIFPKPKSEKNHVERLPAYPELNLGS"
     gene            complement(<675468..>677166)
                     /locus_tag="TRUGW13939_00206"
                     /db_xref="GeneID:55987721"
     mRNA            complement(join(<675468..676038,676089..676322,
                     676376..>677166))
                     /locus_tag="TRUGW13939_00206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483418.1"
                     /db_xref="GeneID:55987721"
     CDS             complement(join(675468..676038,676089..676322,
                     676376..677166))
                     /locus_tag="TRUGW13939_00206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339311.1"
                     /db_xref="GeneID:55987721"
                     /translation="MELQPLPVIAFLDPSESKHYNSPEANVSEDISSEGRPLSKLQLA
                     MTILQPSLINFFGSFTTGIITVGLPVIASSISLHRSLYLWPSSVYNLTSGAALLIAGS
                     VADIIGARHVEVCGIFLTGIFVLACGFSQTGIQLVVFRALQGIALAMHIPASVSIIAG
                     AVPAGRARNIGFGCLGLSQPLGFSFGMVASGIMIERIGWRSGFYMSGAAILVAAVASW
                     LTLPKVKAEAGGLTIGNLLKRLWKEIDWVGGTIASSGLALLSYVLAMVSADLSIIRSA
                     TTVSLLAVSLVLLIAFPLWMRYRERKGQSALIPNALWKNVPFASICALVALSYGAMNS
                     MEIFSSLYFQEVQNHSTLTASLYLLPNLMVGVCINLSVGIFVDRLPAGWLVVGSSLLC
                     ALAPLMMALVNPNWKYYYIELWAQMLAPLSADVLYTVGLIIVSDNFPARTQALAGAVF
                     STVAQFGTSLSVGVCQVAALGVMGSDVNSSGDSNSATLEGASDMLRGYRAGFWTMFAS
                     MVCCVLIAIVGLRRTGKVGLKKD"
     gene            <678060..>680276
                     /locus_tag="TRUGW13939_00207"
                     /db_xref="GeneID:55987722"
     mRNA            join(<678060..678201,678261..678774,678920..679091,
                     679211..679554,679628..679957,680030..>680276)
                     /locus_tag="TRUGW13939_00207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483419.1"
                     /db_xref="GeneID:55987722"
     CDS             join(678060..678201,678261..678774,678920..679091,
                     679211..679554,679628..679957,680030..680276)
                     /locus_tag="TRUGW13939_00207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339312.1"
                     /db_xref="GeneID:55987722"
                     /translation="MSPDGSYPYHFFGNLRLENPHKHLNDEELDKLRSLEPLIHQLSH
                     KSKDSCFNIEKEFKAFTEKEVGAWLALGVKRPPQHLLHPSGEIDSPVACHLHNPTFYV
                     KTPESQETDNISNPCIRQLHQAGFSSKNCFIFDDICRRDRTEDVLLFYTSEILQIHQE
                     FMLSIRKAMGAKVEIFFGKNVREKMEKQLELVPLRLWGEFRDVEIFLEMQDQTLLRFV
                     LYGQFDNSSREIVRQLEKNATEQLKMAFPVRYEELELSVKALVDKVEFRNEGQPLKLL
                     YSNRVALMTQSFLEATRKSFGENVSYHAITQGECLSDSIDGWEWLGELDQIPEPLLSW
                     IKSQDGLRIDRKLISSKEELVLAYQFLSPLDEDMLDTNCTQSGHNVHLKSEKGEAVKR
                     VLDDAFACFAVADAKKYVVWYRMNSCGRPDCRVDGQAILVPLSPHQEYRMARHKDLLC
                     LRTAAWERHLVRCLPQELSGLPKQVATTCEACKKQDCFDTRPRWTSENSSRIPTILKC
                     ALSKKWDNLVAAGINADEYPRCPNILWSHKQHKTKLRELIAAKKRAIADDNDEQPTQS
                     VKLRRVFTSKGKFGKL"
     gene            complement(680602..680750)
                     /locus_tag="TRUGW13939_00208"
                     /db_xref="GeneID:55987723"
     tRNA            complement(680602..680750)
                     /locus_tag="TRUGW13939_00208"
                     /product="tRNA-Val"
                     /db_xref="GeneID:55987723"
     gene            complement(681037..681187)
                     /locus_tag="TRUGW13939_00209"
                     /db_xref="GeneID:55987724"
     tRNA            complement(681037..681187)
                     /locus_tag="TRUGW13939_00209"
                     /product="tRNA-Val"
                     /db_xref="GeneID:55987724"
     gene            complement(<681991..>687006)
                     /locus_tag="TRUGW13939_00210"
                     /db_xref="GeneID:55987725"
     mRNA            complement(join(<681991..682609,682708..682788,
                     682850..683042,683137..683562,683647..683762,
                     683813..683884,683941..684052,684111..684425,
                     684474..685640,685697..686732,686791..>687006))
                     /locus_tag="TRUGW13939_00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483420.1"
                     /db_xref="GeneID:55987725"
     CDS             complement(join(681991..682609,682708..682788,
                     682850..683042,683137..683562,683647..683762,
                     683813..683884,683941..684052,684111..684425,
                     684474..685640,685697..686732,686791..687006))
                     /locus_tag="TRUGW13939_00210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339313.1"
                     /db_xref="GeneID:55987725"
                     /translation="MPSGCSLQADNSFGPVIDRECRDGFDFTLLFEQGILGLVPAAAF
                     LLLCPVRLQMLVKRDVRTQPHVMRFAKTITAVVFAAIQLALLVSWAKEIQPYTKLSVA
                     LSAVNLAVAMEIVILSWVEDERSVRPSSLLAIYLLLTLLFDVVQTRTLWLSRGNFLVS
                     SLFTASVAVKAAMVLLESLGKQKYLIGSYHDLPPESTSGILNRSFMWWLNRLFLVGFR
                     SVLTTEDLDRLDKPLESARTAREASKAWALRRHPERRFEFPWQMGRAFKVPLALTVLP
                     RLFLIGFTFSQPFLITSILNWLGNSHSTSNDGYGLIGATVLVYLGMALSTLIYDRMLY
                     RFVTMFRGAASLIIYDHALHIPDGILEDRSATITLMTTDIDRIINCLIILNESWARTI
                     EVAIGIALLALRLGWVCLVPVAIVLISSGGCIYISKHIGGHQKVWVDAVQQRIAITRS
                     MLESIQAVKGTGLAQTFVQLVQRKRAQETHQMANYRWSTVWKNMIQNLPWALAPALTF
                     VVYAAQGKELNVAKAFSSLSIITLLTNPASKLLSAIPSIAAATGSFDRIQAFLLLATR
                     HQEKCETLFGTMETESNAPLQITELQNMTSKCPPDTTDLQTPVIFMERLTIRPSPSAK
                     IVLRDVNLEIPLGALVMIQGPVGSGKSTLLRAILGQGVCETGSTIVTIRQPAFCAQTP
                     WVPSGTIRDAICGVFSEGSMGEHAFDKQWYEAVLHACALNPDLDMLHAGDATRIGHGS
                     GHLLSGGQMHRIALARAVYARRKLLLFDDIFSALDRKTRTTITSRLLGVDGILRKANS
                     TVVLVTHEMDQLSYADQIYVLSDGLLRRKESHDRSSCEGMGTDAVEDEGSKGLLTLGI
                     EDKAAMISEANEIDDLRRATGDSAVYTYYLRYVGWAKAMIFVFFVTMNVFSSTYSQIW
                     LERWADRGGGQKALYVTVYFLLAIGNTVGNGGYVWAILVLISPSTARRLHYVVLKTVM
                     MATPQFLVTTNIGSILNRFSQDMTLIESDLPVGILITVSNLFSSIANAALIATGSKYM
                     AISVPFLLISLFVLQHFYLKTSRQLRLLDLESRSPLYSHILDTIEGLATIQAFGWEAD
                     FRVANSKFLDATQRTYYMLNCIQRWLTLVLNLIVAAEAVIVVSLAVSLRHTTSVGLLG
                     VSLNSILAFNGSLSSLILGWTQLEISLGSIFRVKDFERTVPRESSTEQGEEVPIDWPS
                     QGAINISEITAQYNSEAAILSNVSLKCLPGQKIGIYGRTGSGKSSLLSTLLGMLTVTH
                     GSIVIDDIDLATLSPDTVRERLVTISQAPFIMVGCTIRFNLDPTETLPDVDIIAALDR
                     AGIWDGVLLERGGLDAEINDTLSLSRGEQQLLQIARAMLKIKASNARILLIDEGTSSV
                     DMKTDAGVQDLLQQDPFRACTVLTVAHRVHTLLSHDLVFGLDRGKVVEMDRPGVLASR
                     KDSIFSTLLNSGGY"
     gene            complement(<687953..>688846)
                     /locus_tag="TRUGW13939_00211"
                     /db_xref="GeneID:55987726"
     mRNA            complement(join(<687953..688364,688422..688452,
                     688508..688604,688656..688721,688769..>688846))
                     /locus_tag="TRUGW13939_00211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483421.1"
                     /db_xref="GeneID:55987726"
     CDS             complement(join(687953..688364,688422..688452,
                     688508..688604,688656..688721,688769..688846))
                     /locus_tag="TRUGW13939_00211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339314.1"
                     /db_xref="GeneID:55987726"
                     /translation="MFKYSLPLLAQLGCAGLTLAAPESTITVPWVGYQGDYFNGYEGR
                     VLTEEGDKTTYLVNCPPAVTSCIPFDPDMTFIAGPSTYDLILDMGFSYTSSGCTFSGG
                     ATPTTATCSYTQSYHFGTSTVTRDLTYRVPDTSVYRSIFEATLPIETGTVTTASTDQA
                     TTAAATTGAAPTVTGATATAAAVTGSTTATAATSTSSATPTGMAVSVAAPKVLLGAVF
                     AGVALHLQL"
     gene            complement(<689245..>691106)
                     /locus_tag="TRUGW13939_00212"
                     /db_xref="GeneID:55987727"
     mRNA            complement(join(<689245..690583,690637..>691106))
                     /locus_tag="TRUGW13939_00212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483422.1"
                     /db_xref="GeneID:55987727"
     CDS             complement(join(689245..690583,690637..691106))
                     /locus_tag="TRUGW13939_00212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339315.1"
                     /db_xref="GeneID:55987727"
                     /translation="MAQPASTMLDGGDPRLNEKERDLADAAVARGGTRPQHRSLYDSS
                     VSFEEYHYYAQLTRAEEDNYPDHDKERGWLSVIFPSKSDGGVAQNGDGDSSIKNAAGL
                     NTNNPEVRDVISDDEWANASRALRTATRGAIFYLITTDILGPFGLPYAFGTMGWGPGI
                     ALFTVFAGLAIYSGYLLWDTFLGLDSYQYPIRHFGDIGLRLYGPWLRYLFNVLQSIQL
                     LLNVGLIVISNGEALSQVAKFKLCFIICCLIWAIVGFILGQIRTLQKFGWIANAAVWL
                     NLICMFVTMGAAANQDPNYSAASQAAGSVIDGGVLVQQDAQGNWPPVTTSGGLPISDG
                     FAGSVSGAMQAVFAYGGSMVFPEFMAEMKRPKDFFTAMFAAQMFIYVWYMFYGLFMYG
                     YQGQYTVNPSYLGVSGYPLQTAGNVFAMLSAAIAAALYGNIGVKVLYNNIFVEIFRLP
                     PLTTKGGKIAWVAVIPVYWAIAFIVAAAIPNFSGLTSVVAAFCILHFTYTFPPMLSIA
                     FWIKKHAMQEGEGFNPDSGETVRHDSGVRRVIRGFFFPGFLSSKYFYFSSFNILYFFG
                     ALALAGLGAYSAIEVLIEAYATSVTTSFTCKSPVQS"
     gene            <692876..>693886
                     /locus_tag="TRUGW13939_00213"
                     /db_xref="GeneID:55987728"
     mRNA            <692876..>693886
                     /locus_tag="TRUGW13939_00213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483423.1"
                     /db_xref="GeneID:55987728"
     CDS             692876..693886
                     /locus_tag="TRUGW13939_00213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339316.1"
                     /db_xref="GeneID:55987728"
                     /translation="MMARINLHLYGLAVFAAVTLVYVFLSRPFSFTPRVADLTYGRLR
                     DVRDDRFPRYAIATFLSESSSPGDSLAEDYYFTSARILAYQVLHDGRTKSNHTNIPFL
                     VLVTDEVSDAKRERLQRDGAQVIHGEDIPLNRWTSTGATHWNNQFNKLRLLGMTQYDR
                     ILFLDADTILTRPIDGIFNEPQSQVAAPSLLVERPKQIRWDEGQPPAEYVFAARSDNG
                     LTGQREHPFPPKETDEFSAAFWLAAPSVELYQYFLNVMTQYPRFDPKTMDQALLNYAF
                     RRDGTMPWQELNYTWSASWPSTSDLNGGVASLHDRLWTMGPDSLKDRWWALKKKMEAV
                     MT"
     gene            <694420..>695331
                     /locus_tag="TRUGW13939_00214"
                     /db_xref="GeneID:55987729"
     mRNA            <694420..>695331
                     /locus_tag="TRUGW13939_00214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483424.1"
                     /db_xref="GeneID:55987729"
     CDS             694420..695331
                     /locus_tag="TRUGW13939_00214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339317.1"
                     /db_xref="GeneID:55987729"
                     /translation="MAAVTKSWFITGASSGLGLEMALSALRAGHRVIGTGRDIQRAAV
                     NHPEFETLGGQWLQLDLSQPSAKEVIEQTLAQEDAGLKPTEKRHWVIVNNAGSSLLGA
                     VEDMSENQITAYLQFNIYGPIRVWKAALPILRQHRQGTLITISSIFGFVSKSEHMMYS
                     ACKAATESLTESYADLLSPLGIRVLLVEPGGFRTKFAANASQADLGITDDYAEKIEAW
                     TCIVNSAAKDETIVSGDPEKFGERMLQAVDGLGLFERLWANHEGGKALRVQLGSDSYE
                     LFGARLGELSKVHAETAVVAKSTDVHS"
     gene            <695885..>696983
                     /locus_tag="TRUGW13939_00215"
                     /db_xref="GeneID:55987730"
     mRNA            join(<695885..696269,696331..>696983)
                     /locus_tag="TRUGW13939_00215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483425.1"
                     /db_xref="GeneID:55987730"
     CDS             join(695885..696269,696331..696983)
                     /locus_tag="TRUGW13939_00215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339318.1"
                     /db_xref="GeneID:55987730"
                     /translation="MTDPTNPYKHLYENPNGVGDQRPTALQIVRDQGVVGTYAGKVAL
                     VTGGTNGIGLETARALHATGVDVFITARDATKGDKVRQDILSTSEGKGCFKIIMMDMD
                     SLESVRNAAKSFLNQSDKLNILINNAGIMGTPYSLTKDGFERQFGVNHLAHFLLTNLL
                     LPVLERSATAKLASRVVNVSSSSHRHAVVSWEHFNSHPIIYNGEVAYGQSKTANIWMS
                     NYLDRVYGPRGVHSLSLGPGGIWTGLLAYTPPDLVAAFKESPEIAPNMQSAEQGAATT
                     LWAAVGKGWEGRGGEYLHDCRIAPPETGDLYSVMSSFAAPWVRGREGDEDRLWEMSEK
                     LVGVESHNTSH"
     gene            <697778..>699626
                     /locus_tag="TRUGW13939_00216"
                     /db_xref="GeneID:55987731"
     mRNA            join(<697778..697833,697892..697937,697990..698711,
                     698770..699482,699532..>699626)
                     /locus_tag="TRUGW13939_00216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483426.1"
                     /db_xref="GeneID:55987731"
     CDS             join(697778..697833,697892..697937,697990..698711,
                     698770..699482,699532..699626)
                     /locus_tag="TRUGW13939_00216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339319.1"
                     /db_xref="GeneID:55987731"
                     /translation="MAAVNLDVDLAHHSCLHCRNLKRKCSRELPSCSLCIRLRKRCTY
                     ESSKSAVFSRSPQDETQDDLPEQSLLFHLLPSSLAHHPSIIPARTFLDSESSSPTPIN
                     VYPHVTIPEKVLGMLGSRHEMHSVYVRYFSVLHKWLPILSQKDTSEDIIDIGPRSKIS
                     LVLLALAMKLLTSALKPGEQAMSPLYQETKNLASRIESCGLITLQLVQSIVLLSVYEI
                     GHAIYPAAYLSVSQAARLGTLLGFHNRMKLQIFTKPDTWTLREQERRTWWATLLLDCF
                     VHLGISGLPLASPTPHNGELLPCAEQSWESGSVGFNQPLFLQNLPADAQMGSFAATCQ
                     SAHLLGSVIRHRDQTDIDDRGLVLSEAHQLHRALHTLNLYLRRLCFVDQVALEKSHFT
                     AFALCCSARFVLYEIYACNEHYPSSGPRIPEEIAMQQFSLEGISKSIDDVYLLTEHIL
                     RFASVSDQDSVSRLSPLFCHCLYQSISECAWLYREEKGLHRAAQLKTLIQGLETLGTC
                     WKVVGHYMSILEEENALAVVADETMTYEEDARLSY"
     gene            complement(<699724..>700683)
                     /locus_tag="TRUGW13939_00217"
                     /db_xref="GeneID:55987732"
     mRNA            complement(<699724..>700683)
                     /locus_tag="TRUGW13939_00217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483427.1"
                     /db_xref="GeneID:55987732"
     CDS             complement(699724..700683)
                     /locus_tag="TRUGW13939_00217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339320.1"
                     /db_xref="GeneID:55987732"
                     /translation="MATKVYVLDPYHPDAIAKLLSSPNLSTILPTDPAREQWREDAVA
                     LVIRSDSRISQADIAAAKQLKYILKQGVGVDNIDLDAAKQHNIQVFNTPAMNSEAVAE
                     LALALMLSLARRVPELDRRARAGEKIVRSKMLGRSLFKKTIGIIGMGNIGRVVARKWL
                     GAMEGTVIAFDPYAPEDTWTGSIAHTRVHQLDELLATSDVVSLHVPLTTSTRGMIGAE
                     QLKTMKNEAILLNCARGGIVDEKALLEALRAEEIAGAGLDASDVEPATLEKYGDGLLA
                     CDNVIMTPHVGASTKENQSASGVAVVDTLLKVLGGEEVPNRLV"
     gene            complement(<701677..>703558)
                     /locus_tag="TRUGW13939_00218"
                     /db_xref="GeneID:55987733"
     mRNA            complement(join(<701677..702036,702088..702299,
                     702353..702421,702471..702748,702796..703007,
                     703066..703242,703310..>703558))
                     /locus_tag="TRUGW13939_00218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483428.1"
                     /db_xref="GeneID:55987733"
     CDS             complement(join(701677..702036,702088..702299,
                     702353..702421,702471..702748,702796..703007,
                     703066..703242,703310..703558))
                     /locus_tag="TRUGW13939_00218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339321.1"
                     /db_xref="GeneID:55987733"
                     /translation="MPSDSEKIAPATAASSSTDDREKSTEQAEIAPDDVHRNALEVLN
                     DSPESRARERAYLWKLDTIILPVISALYFFEYIDRGNIANAKLLGISSGHDTSDNGVG
                     SGTTSLSSVQWQTVVMIFYVGLVLFQVPGCLGYRIFPPSKWIAFSVCSWCVVCVLQTV
                     AFNEAGLLVCRIMMGVFEGLFGTGIVYYLSLWYRRDEMGMRVFWFLGPTAVAGAFGGL
                     IAYGVGHINSHVQNWRLLFVIEGIPGFLLGLFCLWCLPDRPLKNSRFNEQQNEVAVAR
                     YHRDAYDRAGKIQWKHALWTLTDWKVYMQASIYVPTAALLSSISGFLPTLIQNLGYHS
                     SSSANLMTVPPYACAFGLMLLTSYSSDRFRDRGLHMVALSTLAGVAYICLATLGEDQL
                     HAKYAMVCIAVACVYSTYPPTHAWTANNFGNETKRAIGMGIYTSIGNLGSIAGSFFFP
                     STDGPQFRKGHWVCFAMCVATAVLSLTNHCILERINRYRDEKYGKPDPNVVIDVSEEA
                     DRNVMFRFIT"
     gene            <704764..>705778
                     /locus_tag="TRUGW13939_00219"
                     /db_xref="GeneID:55987734"
     mRNA            join(<704764..704880,704930..>705778)
                     /locus_tag="TRUGW13939_00219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483429.1"
                     /db_xref="GeneID:55987734"
     CDS             join(704764..704880,704930..705778)
                     /locus_tag="TRUGW13939_00219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339322.1"
                     /db_xref="GeneID:55987734"
                     /translation="MTAARSPVGQPSSSGQTGADLASILPAGSWDSHVHVVDEERYAF
                     HPDHLFRPKKASLDDLLAFEKTLGVSHVCLVQVSVYKTDNRLLVDTLRELRGQARGVV
                     VIDPDTITDAELDEMHAVGVRAVRLNIKTGGQTLAREYFCDLLQKYARRLRPRNWAIQ
                     IYLSLPQFKLIADEIPKLSNAEGTVPVVIDHLGHPDQSRPVSEQEGYSELMGALRRKE
                     IYLKLSATYRFPNLPALGTYAKEVIRTAPTQIVWASDWPHTGSIEYNPGGNRKIHQDY
                     RRVDDVGYVKQCIDWCDGNEDLIRQIWVENPRRLWQYNEPIEQKL"
     gene            complement(<705879..>708124)
                     /locus_tag="TRUGW13939_00220"
                     /db_xref="GeneID:55987735"
     mRNA            complement(join(<705879..706380,706446..706752,
                     706799..706866,706923..707277,707333..707594,
                     707653..707937,707999..>708124))
                     /locus_tag="TRUGW13939_00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483430.1"
                     /db_xref="GeneID:55987735"
     CDS             complement(join(705879..706380,706446..706752,
                     706799..706866,706923..707277,707333..707594,
                     707653..707937,707999..708124))
                     /locus_tag="TRUGW13939_00220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339323.1"
                     /db_xref="GeneID:55987735"
                     /translation="MASRPTLSPRDRLSSVSSSATARKRHRRSGYILTCANCRRRKTR
                     CDGGQPSCLICQAYHDECCYDKAPPMSQITWMAKRLQELELLVSDSRSVIDSAETPAP
                     KLAPSPVSPESTSNSVEAQGPAPELPDLNVDANGRYIYYGSTSALEHPFSEVDADHSS
                     EYEKSEARTNLVTSALHSRRMEEISLGNAALRVDIPRELVDQLLNTHWTWIHPVFMFI
                     YRPAFMRDMGSGGKYFSQLLLSVMCCHSTRFTKKELAAQLLMRVHLLLGEQIQDNISI
                     PTVQALLQLSARQVGQGAVSQGWLYSGIAFRMAIDLGLFNKTDPTTCSAEDREIRKRL
                     AWSCFSWDKAMSLYLGRMPALREPPMVDLTLLDDFAEHELWQPYYGADGDSLKNYPET
                     PCYTVSCFISLCRLSVIINDIILGLYSGRKPENVGTLVRNIRHQLELWWVTLPAHLRI
                     DTSNIPAILPPPHIISLNIFYHTSIILLHRPFRSAPDCRTNCRQASQAVESIVVGYGN
                     TFGFNRIPYLMSYCIYTAATIVMEDLKDGFSGDRERIEMFLEALECAKVSCPGIQQSI
                     DIIRRNLSPTMPTSNPVMIPSYIQAHPVMDPSIPTFPFLSMEGMAAGDYGMLSSNQPY
                     FATFTNSFQE"
     gene            <710422..>711393
                     /locus_tag="TRUGW13939_00221"
                     /db_xref="GeneID:55987736"
     mRNA            join(<710422..710482,710534..>711393)
                     /locus_tag="TRUGW13939_00221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483431.1"
                     /db_xref="GeneID:55987736"
     CDS             join(710422..710482,710534..711393)
                     /locus_tag="TRUGW13939_00221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339324.1"
                     /db_xref="GeneID:55987736"
                     /translation="MSASYRPYDGKLGIVTGGSRGIGEAVTRRLAAKGCNLLLIYTSD
                     SSRALTEGIAAELTAAHSIRVSHVQADLNEPVTATPKIVDAAKAFYKSYHPNSPKELQ
                     IDILINNAGVGSNQLLNDPVKGAIDVTEYTRVYNVNVLAPLLLTQAAAPYLPTDRSGR
                     IVNVSSVSSSIGYEGQSVYAGTKAALEAMTRCWSRELYDKATVNAVNPGPAWGDMYAQ
                     AGEKFWKINQPYVDAAPLAAYDGEQDVLKAAGDDAERFDKTVRQGMGSRRPGFTSEIA
                     GTIDMLCTEESGWTTGSVVCANGGMKMSIA"
     gene            complement(<711461..>714285)
                     /locus_tag="TRUGW13939_00222"
                     /db_xref="GeneID:55987737"
     mRNA            complement(join(<711461..711660,711714..711994,
                     712493..713739,713797..>714285))
                     /locus_tag="TRUGW13939_00222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483432.1"
                     /db_xref="GeneID:55987737"
     CDS             complement(join(711461..711660,711714..711994,
                     712493..713739,713797..714285))
                     /locus_tag="TRUGW13939_00222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339325.1"
                     /db_xref="GeneID:55987737"
                     /translation="MTAPTYLSQKGPVQQQPPHGLPRPWQRAALIRGIIIGFFLSILF
                     LSRGHYHGLDMKRLQDLWRHPSELSWSDLRLSSSMRRYVSFDLELPLLESLRSDARCE
                     PEYIFFTPGGRSPMILNNLGELVWAAQSSAATQNFRVQRYRQQDYLTYWAGKPFGPGY
                     YYMLDSSYNERYVVSPVGDIYGHPHDFTITSRDTALITAHDKRRADLSSVGGPQDGWI
                     FDGVFQEIDIASGKLIFEWRSSEHVPVAHTYKRFEQGEGTEHHPFDYFHINNVDQDAV
                     GNYIISAGHTHTVSCIERSTGEVLWNLGGKGNSFLDFGERPIVQFKWPHAARWHDNDT
                     LTVLESDGDHHPRSLPSESRGMLIQLDVPNRFAKVRQTYSNPEGIRTRFEGSMQLLED
                     TGNVFVGWGGDAGYTEFNADGTTLCDVRFGRSHLLSGKHGGPSQISKGPWTGKPLTKP
                     VALATGGKIFAHWNGATEVTEWQVQAQLHSSPEALSELPEFHGVGRFRKTGFETAIDT
                     HLFDRNTQFRIAALDRNGNELGHTTVFDLKESWVEATGLSPSQLGVVAGVCLVGCLVT
                     AASTLHLRLKRRESSILSTFGINTGVNHSAGFLLAHWFFAYGVLSTRPAKARAGIDDN
                     RNPRHDLAKYGERAVSEGKITRRQLDRMTRLQSAHENAVEGFAFFAAAIILANVAKVD
                     TETIDLIGVWYSASRVAYALAYYSIEDKSLSYLRSAAWWSGNWSCIMGIWWASKKL"
     gene            complement(<715333..>717001)
                     /locus_tag="TRUGW13939_00223"
                     /db_xref="GeneID:55987738"
     mRNA            complement(join(<715333..716553,716600..>717001))
                     /locus_tag="TRUGW13939_00223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483433.1"
                     /db_xref="GeneID:55987738"
     CDS             complement(join(715333..716553,716600..717001))
                     /locus_tag="TRUGW13939_00223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339326.1"
                     /db_xref="GeneID:55987738"
                     /translation="MAQLPESKTATDPGEVEKSQPYDGHGTEEDPFVVEFQSDDPENP
                     MNWSQLRKWFVTTIVTLSVFAVTLTSSAYSVSANEVFQDFDIGNEVFILGLSLFVLGF
                     AIGPAVWGPLVRMFPAWLRYLFDHELTIYLFLVAIRSELYGRRILWIISHVAMVAFLG
                     GSAGSQNVATLLVLRLFAGTFGGSPLVNSGGAIADLFPPAQRGLAMTIYCVAPFLGPV
                     LGPVIGGFVSENIGWRWVQGVCCIFIGVIGILGTVFVPETYGPVLLTRKASSLSMADG
                     MVYISVLEKGQGKKKPSEVFQRALVRPWVLLFREPIVLVASLYMAIIYGTVYMFMGAM
                     PIVYNEGRGWSEGIGGLSFMGITVGIILGVVYAIYDNNGRYMKLSRSKTATAESRLPP
                     AIVGGVALPVGMFAFAWTNYPSIHWSVSIVLSAPFGFGCVLVILPVINYLIDSYTIYA
                     ASVLAAAAIFRSIVGAVFPLFTTQMYDKLGIHWASSIPAFLTLVCMPFPLVMYRYGAA
                     LRVKCKYAFEAAEMMRKMQQARVSAEQGYESE"
     gene            <717568..>719626
                     /locus_tag="TRUGW13939_00224"
                     /db_xref="GeneID:55987739"
     mRNA            join(<717568..717600,717651..718522,718577..718945,
                     719080..>719626)
                     /locus_tag="TRUGW13939_00224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483434.1"
                     /db_xref="GeneID:55987739"
     CDS             join(<717568..717600,717651..718522,718577..718945,
                     719080..719626)
                     /locus_tag="TRUGW13939_00224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339327.1"
                     /db_xref="GeneID:55987739"
                     /translation="HVVDAREEGRRRQSLATHISPIRRPVSLPISPPAARSPPLEAKI
                     DTASIIATPPGSGESSISEPPDKSQDPNQGQDQTYYTAHGRFASEVIATIDVRTGIAP
                     ASTSNLVPFVDAPLFGELDLDSPQNAIGSSMELPSRAYADSLVAIYWQHPEPVEPILD
                     RERFLRSYDALYTSPDAFTHTDREIWLCILNIVFALAVQIYELTPLKRRQEEANRYFQ
                     RAWAVLRPETILWKPGSIELVQCLMLMNRYLHCTNNQHKTWITAGLAIRIAQSMCFNL
                     PEGSKDSSNDRRLKQRVWASCVALDRCVSWSLGRTLAPSLILLPNSVDSMSLTGNYQQ
                     DKDAERLRRGLEFHEIGNQIQLAQTQTRLGVAAKLGLPRLYQQEEYHAVAVQLDTSLN
                     KWEKSLPTHLKRQNLASIVDKESRTKGYLLHLRPMLARFYSLKSRVVTAETFEPPSLS
                     DRLLRQWAGMCVEAAQRAASLIIETLEPDEPIGIIPWWYRIFYLHIAGINFLAAMFDP
                     DLFTESVSQSWNDVMSALRAHEHLSTYVSQCIRTFETLSTRILHLQTRHANPDPSGDF
                     PYDEGISGSLFDDLFQNLGSDFDNFLFGADDSLSAVAEKP"
     gene            complement(<719825..>721498)
                     /locus_tag="TRUGW13939_00225"
                     /db_xref="GeneID:55987740"
     mRNA            complement(join(<719825..720529,720587..720733,
                     720791..721372,721451..>721498))
                     /locus_tag="TRUGW13939_00225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483435.1"
                     /db_xref="GeneID:55987740"
     CDS             complement(join(719825..720529,720587..720733,
                     720791..721372,721451..721498))
                     /locus_tag="TRUGW13939_00225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339328.1"
                     /db_xref="GeneID:55987740"
                     /translation="MSVGQAVTVVLVENGACDLARPACGQCLRKGLQCPGYRDEATTR
                     FRIENASSLMTSLSRRKHKRKTGGHGVSNTINKDQNQSTIGYYVANGYQMGASSISIP
                     HPLSESWDVHFLPLFLAGVGPANYISRDIYGVIPRLVAQANPTSALYHACNAVAGSFL
                     ARKTRSISAVPNHARAYGTALAKIRTALHHPHDVKSDNTLLAIWILGLYEFIQNRQDN
                     ICSSAWLSHIRVTRHLIGLRGPEQFSRQDARDLFLAILSNTEIQAYMLGKEWEEAPIW
                     FKHFHKYCDASEYPSFQTCDFCHQCSRLCGRIQSLLKRGQPDEILANVPSILRDVEAV
                     ENNMPRLSNLQTVINSQLVSYHGRYCGGALILQIVFRMRVSYHLLAFLQRVSHLSLYL
                     GNQKDIYKDIQTRCIQEMHALAERILRLYSDRVAPPLAHENGTNLDHLTKSSATERAG
                     QTEKFQTVRFAIDFDNLADGNSTLLVSYHHSGIDVTRLTFDCL"
     gene            <726798..>729216
                     /locus_tag="TRUGW13939_00226"
                     /db_xref="GeneID:55987741"
     mRNA            join(<726798..727836,727894..728317,728392..728680,
                     728743..>729216)
                     /locus_tag="TRUGW13939_00226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483436.1"
                     /db_xref="GeneID:55987741"
     CDS             join(726798..727836,727894..728317,728392..728680,
                     728743..729216)
                     /locus_tag="TRUGW13939_00226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339329.1"
                     /db_xref="GeneID:55987741"
                     /translation="MTSKRRNGQLSSCEPCRKAKLRCDHATPTCGRCAQRQQTEICVY
                     HPAPLTQPKPLEGLSPVPKKRKRGSSIVTEKAIASTNLLSKYRVPPSNSPTARSEEDD
                     NVDETSHIRRTVFSTGFLGPSSYWAPFDKPEESPILDITPEGSPQDDIVTPMEATMKG
                     ALVDLDQIECGAKILALFDDLPLYLQLLKVRYQLCEPWVFGLRLAREVFGPLTELRNQ
                     WMQGTKNKKSQTRMLAWSKRIFDNSASSINMDRSTTVSEYFAIATPRWETIALMFTWV
                     GIATTMMPDNHECLKLDDGTVIDKNKLRLLMVEVVELCLSFCDSVGAMSDPLCWALIQ
                     HTSLLAESHGDSNYRTWRRLGDLSTMVFALGIHCPETNPSIPFFLIEIRRRVLIASYT
                     IDKTLATLLGRPPRMAWQYCDIQDPLDLDYEEIFPASDEQRQDKLLEKIGPDGWNIEG
                     RMTSGSKARLYAMFTPIREKILALSLSPHPGDVAQKISETWSEHRQLRMDLPPFLQWS
                     PSSINGTSTICFSTDFLANLHLESLNNEFILYHVLVKRTGQGKTEFLNLAREILSAVL
                     LTFLRSSVPRMDFHLTWNLCYLGLPCAGVLARELLERSQHQQQKRTSNDQQRSPPIPA
                     PFPRSEVIQNLSVFASHLESTLDIRDGNYGIAQKGLHAIRSVLDRILSDDDDIPSSAA
                     ADTDTTARSEPTDTMAITSGPGDWPPTIPTFYSEDGNAAEFMTWLDNIDWAQESLLTF
                     S"
     gene            <729642..>730958
                     /locus_tag="TRUGW13939_00227"
                     /db_xref="GeneID:55987742"
     mRNA            join(<729642..729891,729948..730090,730150..730236,
                     730311..>730958)
                     /locus_tag="TRUGW13939_00227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483437.1"
                     /db_xref="GeneID:55987742"
     CDS             join(729642..729891,729948..730090,730150..730236,
                     730311..730958)
                     /locus_tag="TRUGW13939_00227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339330.1"
                     /db_xref="GeneID:55987742"
                     /translation="MEKHNPEASAAAGQLSPAARDMEKQPDEPQQKHSAFKKLGILDQ
                     FLALWIFLAMAIGIILGNFVPNTGPALQKGKFVGVSVPIAVGLLVMMYPILCKVRYET
                     LHHAFRTRQVWIQIAFSIVINWIIAPFFMLALAWAFLPDEQELRQGLILVGLGRCIAM
                     VLIWTGLAGGDGEYCAILVAINSLLQMVLFAPLAILCITVIDGDSTQFKYSTAAQSVA
                     VFLGIPLGAAVLTRFTLRRLSPRWYDEVFLKWASPWSLIGLLFTILILFASQGRQVVH
                     QIVSVVRVAAPLIVYFAIIFFTTLFIAYKMGFGYKLAATQSFTAASNNFELAIAVAVA
                     TFGADSNQALASTVGPLIEVPVLLGLVYAVKFVAKRLNWHD"
     gene            <731437..>735127
                     /locus_tag="TRUGW13939_00228"
                     /db_xref="GeneID:55987743"
     mRNA            join(<731437..731664,731720..>735127)
                     /locus_tag="TRUGW13939_00228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483438.1"
                     /db_xref="GeneID:55987743"
     CDS             join(731437..731664,731720..735127)
                     /locus_tag="TRUGW13939_00228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339331.1"
                     /db_xref="GeneID:55987743"
                     /translation="MLDPLSALGLASNVIQLVEFAARLVKKGTEIHLRGETVDNAKLQ
                     DVTVNLVCQSKNITASVGRAGLPNTPRSQEEQILLDTSRNCAIAANELVDCLENLKRK
                     HGRNAVWRSFRQAIKTEWSKETISAMAAKLDTYRSDLTLHTLFFLNTKVGQQIDSQEK
                     RFNQLERKGNEIIEAILISNETSTHDSDAGDISQNKIQEQFQDAIAAIFTHRDGLITT
                     MSPPFSSSVPLSGIVNPNPAKKGVMTLQNRGSSNESQDARVTFGNFASIQQRVLRLLL
                     FRQIRDRMDEVAPAHKATFKWIFEDPKPSQRPWENFLGWLQNGSHCYWVNGKAGSGKS
                     TLMKYIYDSPQTRQALQQWAGGTRLIFSSFFSWNIGSTLQKSQVGLLRSLLHDILQQV
                     PDLIPGVLPRLCRAASQGEDFQPTLAELKSGFEKLATQTITPLKICILIDGIDEFDGD
                     HAEISEFIFSTTSPNFRAIVSSRPIPECVDAFGECPSLRLQDLTYGDIRSYTNERVLS
                     HRRWKELMEEEGVQAIQLLDDIVNKAEGVFLWVILVIASLLEGLRNYDRVSDLRRRLD
                     VLPSDLENLYSHMLNKLQPLYRRQGSQLLQIVQKHIEIEPDQLLSPLQLSFADEEDPD
                     YALRQELEPLSANQKLARCRAIEGRVRSRCCGLVEIWQDWSIPDSSTRITNARVSFLH
                     RTVVDFLRKSHVSKEVIQSMVDKDFDPSISLAKCFLADIKAGENIKSMDFIRGNSWNS
                     MQRCLNCCRFTTPSTSEQLMHIVDDLDKTMSRRWKSIDRWEESFAEPDHTTVIVTQKF
                     DWSLSELRQTYRLGNFDEFSDLQASILVLAATMGLTDYVRYKCSSEEFSTDSSQLQQA
                     MLAVVYSACRVIEIESDLLSQQYSNIASIEKRGTMESYFGVIQSLLDAGASPDKPVGR
                     KGSTPWMLALQETEQMAFNCEILAWADILRLFLVSGADPHGSAIEKTPRLIRYRSALG
                     VMVTKIKDCHSSKIPPHLRSYAAQFCDKLVEIKTMLAEKGAEQHDWAEIPDHIRPERD
                     GTPAPWSSKSTRLNEIFNPSAERTRRRESPKRTRRNRAPGNINEYPPVSYNRHSGLEN
                     PPMGHSRRHSGLEENRGRRGRSPRVDRSPRPRQSSRSDELNLRSHSRPSLDDEESPLQ
                     VEPATVTLPNSDFSSGFDFEFDNPALIKPDSGNIDKEYVHTVQRRRHRWLSWLGLRSK
                     SASVNFR"
     gene            complement(<735279..>735925)
                     /locus_tag="TRUGW13939_00229"
                     /db_xref="GeneID:55987744"
     mRNA            complement(join(<735279..735751,735805..>735925))
                     /locus_tag="TRUGW13939_00229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483439.1"
                     /db_xref="GeneID:55987744"
     CDS             complement(join(735279..735751,735805..735925))
                     /locus_tag="TRUGW13939_00229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339332.1"
                     /db_xref="GeneID:55987744"
                     /translation="MPTRVHDCHQPWVVSQKFEWTVSGLITAAEFHFLNVFVGTTINF
                     VGGPYSGAIKEPDLLIQPDNQHLPSVIIESGWSESVPRLRDDMNLWLVGGGGKVRAAI
                     ILSWQRLSNTNQVRGNLELYTLDRNGMPQHNTDLAIFPSPTPAVAAAQQLILTRREVF
                     GDHVPPGRNPTDQLPFSINILRGEARDALQLMGLIPA"
     gene            complement(<737577..>739512)
                     /locus_tag="TRUGW13939_00230"
                     /db_xref="GeneID:55987745"
     mRNA            complement(join(<737577..738009,738071..739206,
                     739285..>739512))
                     /locus_tag="TRUGW13939_00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483440.1"
                     /db_xref="GeneID:55987745"
     CDS             complement(join(737577..738009,738071..739206,
                     739285..739512))
                     /locus_tag="TRUGW13939_00230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339333.1"
                     /db_xref="GeneID:55987745"
                     /translation="MSIKACGQHDAVDLLTFAFGGSTSYDPTQPLYIDAEDPSCCLNA
                     EEFKSLVRSLIAGLKAAGIQPGDCVLLHLPNSILYSALFFAIIGAGAVYMGSNPASPA
                     YELNHVFTTAQPRLVITSADALLTVLEVCPERGLSKDQIYLLDSNTVKSIVRDVRDCQ
                     LHTDQVKKCNTNTPRSLLHLLNNGESNWHTFEETTASKTTPAVMFLTSGTSGTPKAAV
                     LSHNSVIAQHLSAQYDVPYKPTRLMCLPIFHSFGAQWAHISPIRYGQPSYVLPRFDPV
                     LFLEMVRRYNITETYMVPTMVHILNRSALASTANVAGFLTSMRYIGVAGASIDAPSMR
                     QFQDLLDLQATVGPIWGMTETGIAFINRFGESQIPGSIGKPTPMFEARVVTLDTTAQI
                     IDRDDCPGELEVRGPGTLLEYKGGTQERIKDENGWFKTGDTVYVKDGNYFMFGRTKEL
                     IKVYGWHVAPAEIEAVLLKHPSIKDAAVIGIPLKDSNTEAPRAFIVRCNTQRPFLTSE
                     EVYSFAQKHLASYKALDGGVVFVTEIPRTASGKVLRRKLAEMNSHREKLSSLLGKSIR
                     KMPGTGLPEKKIAIESFHRSSPREDCESFCYC"
     gene            <741289..>741902
                     /locus_tag="TRUGW13939_00231"
                     /db_xref="GeneID:55987746"
     mRNA            join(<741289..741297,741440..741747,741812..>741902)
                     /locus_tag="TRUGW13939_00231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483441.1"
                     /db_xref="GeneID:55987746"
     CDS             join(741289..741297,741440..741747,741812..741902)
                     /locus_tag="TRUGW13939_00231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339334.1"
                     /db_xref="GeneID:55987746"
                     /translation="MAAPAVGSLFAVEIPVTNIERSIKFYSELFAWEFAGEIPKGVEN
                     IKSLHFFSDASKSIKGALMLLDEGHLPKTAGKEEWAVYSTFVVADVGETLKKAESLGG
                     SIRVHRTELPNGLGVAGHVVDPDSNVLGVWSQK"
     gene            complement(<742331..>742843)
                     /locus_tag="TRUGW13939_00232"
                     /db_xref="GeneID:55987747"
     mRNA            complement(<742331..>742843)
                     /locus_tag="TRUGW13939_00232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483442.1"
                     /db_xref="GeneID:55987747"
     CDS             complement(742331..742843)
                     /locus_tag="TRUGW13939_00232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339335.1"
                     /db_xref="GeneID:55987747"
                     /translation="MRASILVGFSALASLALATTPEPAADFKSCKRSQSNDIVGTWTL
                     SYANQTANGQTTLPFGPNPHGFLFITDAPDLTWIEEVEPTDPSESQQPAQSSAGYYKV
                     DDKGDYLGRGIVSSTVANADGVYSPASVLDLIRIDHNTLLQQYYPAQGVHITAIWTKW
                     TPGTTTYPSK"
     gene            complement(<744158..>746358)
                     /locus_tag="TRUGW13939_00233"
                     /db_xref="GeneID:55987748"
     mRNA            complement(join(<744158..744540,744649..744813,
                     744875..745378,745436..745507,745567..745590,
                     745640..745814,745879..745930,745987..746063,
                     746128..>746358))
                     /locus_tag="TRUGW13939_00233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483443.1"
                     /db_xref="GeneID:55987748"
     CDS             complement(join(744158..744540,744649..744813,
                     744875..745378,745436..745507,745567..745590,
                     745640..745814,745879..745930,745987..746063,
                     746128..746358))
                     /locus_tag="TRUGW13939_00233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339336.1"
                     /db_xref="GeneID:55987748"
                     /translation="MENTTAESLDKTPVDQTTSTSTSSQHGDGDAVKETEAAPADGQD
                     AREYVEGFKLAIVIASVALSCFLMLLDTMIISTAIPRITDTFNSLPDVGWYASAYQFG
                     SAAPQPLTGRIYQRFRTKWVFLSFFAIFEIGSLLCATATSSNMLIVGRAVAGFGAAGI
                     IVGAITIISSCVPLEKRPGLLGITMGFNQLGLVAGPLVGGAFTSYTTWRWCFYVNLPA
                     GAFAVVAISLLRIPEQTKKDKALAVLPKLHKYLDLVGFVLFAAAVLQLLLALQYGGNQ
                     YAWNNSRVIGLFCGAAVTGIVWFCWNIHKGDDGLLPHSMLSRTAVWSSGVYQACLMSA
                     IYGAVYYLPIYFQSIHNTSPMMSGVYLLPIILPQLAMAASSGAIISKIGYVIPLALFS
                     TVLVSIATGLYSILRPDSPKGEWIGFMIIGGLGSGAGLQVACAELASGMAWMVFAQSL
                     APSIELSLANVIFSSSLKSQLALHAPNANAAEIIHAGATGFRAIVNEDDLPGILLAYA
                     NSLNRVFYLIVSIGALCGIWVWGMGWTDIRKKTAATGDMADKAEKADDKTNE"
     gene            complement(<747496..>748713)
                     /locus_tag="TRUGW13939_00234"
                     /db_xref="GeneID:55987749"
     mRNA            complement(join(<747496..748485,748573..>748713))
                     /locus_tag="TRUGW13939_00234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483444.1"
                     /db_xref="GeneID:55987749"
     CDS             complement(join(747496..748485,748573..748713))
                     /locus_tag="TRUGW13939_00234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339337.1"
                     /db_xref="GeneID:55987749"
                     /translation="MADRATLIIGLLWALTIIAVIVVATRFAVQHKFGGLFAEDWLML
                     AAMVMQLIDMGFLSKSSSWGLGKHDRDMTPEQLINAGKWAWLYMIPGCFVAVLARVSG
                     GVFLIRLFGIHEWLKRYLIVFTVLQAIGGMLVLLTNFLAITPIEALWDPTITDKRARY
                     SPQVASITAYTTQSLFTMADLTYVLFPSIIIWNLHLNIKKKIGIILLMCTSLITMAVS
                     IMKAITLAKVSGVAEPAYMSSLSALWAGLEQTLVIIMASVPALSAITKLNLGFRRMTS
                     SIAKSLNLSGGRTGNDSKGSKFTDSSAGSMAGMKPARYQDLEKNSFGSHNNRRSNQVT
                     GSPFGTTVAYYDESNEMVPLKSAAPVRVRRTDEYTVEYDPRS"
     gene            complement(<750605..>751534)
                     /locus_tag="TRUGW13939_00235"
                     /db_xref="GeneID:55987750"
     mRNA            complement(<750605..>751534)
                     /locus_tag="TRUGW13939_00235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483445.1"
                     /db_xref="GeneID:55987750"
     CDS             complement(750605..751534)
                     /locus_tag="TRUGW13939_00235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339338.1"
                     /db_xref="GeneID:55987750"
                     /translation="MAEATSVPTVFVCSATGSQGGSVARQLRSLNWNVRATARNLDSP
                     VAIALKAAGVQLSQGDWDNAEALAAGIAGCDKLFLCLFPNMADLSAETKQAQRIASIA
                     KAAGVKQVVSSTSLGVSQLEAKIHVVEGSFMEKHLLGKKAVEQAVLDAGFESHTFLRP
                     SFFMANFMEPKCVRYPEVRDKGTWTTSLTPETQFPLVDHQDIASLAVAVFQRPEELNG
                     RAFNVASQILPIQRILDELADAAGRPGAFKAIFVRDDAEALGSPNALINSAKTMRSMS
                     EYIDLDELSKYTPLTTFKDYLVREQASVKQTYP"
     gene            <752293..>755202
                     /locus_tag="TRUGW13939_00236"
                     /db_xref="GeneID:55987751"
     mRNA            <752293..>755202
                     /locus_tag="TRUGW13939_00236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483446.1"
                     /db_xref="GeneID:55987751"
     CDS             752293..755202
                     /locus_tag="TRUGW13939_00236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339339.1"
                     /db_xref="GeneID:55987751"
                     /translation="MSTWQCLQDVLRSRAESEAGGRLLFYSNGDSTTAREVSYHSLYN
                     QAKQVGGRIRRLPGFQSKAPIFLHVDDHWDTILWFWSILLADGLPVLSTPFSNVEEHR
                     RRHIDGLSALLQSPLCITRTKALPLFGANHGMQMHTIESLLEKDEPSSSSISQDEQAD
                     GLISVSSSSLAMLMLTSGSTGNSKAVQISHRQALASVAGKSLACQLPLDRPFLNWIGL
                     DHVGALMEIHMHALWYGVDQIHVATGDIISSPKTFLQLLSRHQVSRTFAPNFFLARLV
                     STVDDPSDSSEPSETEELLDLSNLRFLVSGGEANDINTCLAVSSLLSKFGAPHNVVAP
                     GFGMTETCAGCIYNTNCPEYDVQNDHAVASLGKCVKGISMRVALLGSDSDFVAAAPGE
                     PGALQVSGPIVFQGYYRNEAATAKAFTEDGWFITGDRAAIDANGNLNMIGRTDDVINI
                     NGIKIATADLQTSLEVAVGSRVSRVVVFGSRAAHTEQVTIAYVPPGEWPMAPEAMAEI
                     ETIAGQVCLMAASTRPLVFAIGAESQPIIPISALGKISRAKMRSLLEAGRFDRDVSYH
                     QETLTAFKKNKQNQRRRDGGGAAPVMNKVEEFLMDDIASARDLSPEDFDVDTPFFDLG
                     FSSMDLIKLKHKIDRRFGITVPLIKLLKNPTAQSLAAVLGPEVDPDYASTTNGGAAVP
                     VQPAVYDPIVTLRSGGSKAPLWLVHPGVGEVLVFVGLAKQMVDDDRPVYALRARGFDK
                     GQSYFANIEEAVDTYVGAIRQRQPQGPYAIAGYSYGTMLAFEISKKLNTQLGPSSVQF
                     LGSFNLPPHIKFRMRQLSWNMCLLSLSYFIGLTTQEYADGIDQDAYQSLSRPEALKQV
                     LSATDYSRMEEFGLTEPELVLWADLAFGLQSMAVDYDPSGLVDSIDIFHAEPLKIVAA
                     SQEIWVRDHLSKWADFSDSPPKFHHVKGAHYTMIDADHVVDFANTLKLAIKERGL"
     gene            complement(<755550..>756962)
                     /locus_tag="TRUGW13939_00237"
                     /db_xref="GeneID:55987752"
     mRNA            complement(join(<755550..755872,755938..756377,
                     756437..756560,756623..756749,756825..>756962))
                     /locus_tag="TRUGW13939_00237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483447.1"
                     /db_xref="GeneID:55987752"
     CDS             complement(join(755550..755872,755938..756377,
                     756437..756560,756623..756749,756825..756962))
                     /locus_tag="TRUGW13939_00237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339340.1"
                     /db_xref="GeneID:55987752"
                     /translation="MEKAFDEIKQVAAQDDQTRRSTITALRDLANSLETTNDTIHRYG
                     HMNLQTATVKIGIDLGLFKLLAQSSSPLSVEELSQKLGTDPVLANRIIRFLTSIGAVH
                     EAGRNQFTANHVTKNLSENLAEAGLSHYFGTASPMYQTLPAFLKKTEYKDPADELNTS
                     FQDAFNTDLPVFPWFASHPGHLAPFNDYMRLRRKPDVSWLTVYPVADEIKDWSPEKAI
                     FVNIGGGVGHQCAEFKQKFPDAPGKVILQDLPASIAKALPTPGVDNTVHNFFEPQPVK
                     GAKFYHLRGVLHNHPPHKVRKLLENTKSAMTEDSVILIDEMIFPESGVHYDAASIDVT
                     MLTAFASMERTEAQWRKTLADVGLELVKTYTYNPVSYESVMDVRLPKSS"
     gene            <758276..>759970
                     /locus_tag="TRUGW13939_00238"
                     /db_xref="GeneID:55987753"
     mRNA            join(<758276..759160,759224..>759970)
                     /locus_tag="TRUGW13939_00238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483448.1"
                     /db_xref="GeneID:55987753"
     CDS             join(758276..759160,759224..759970)
                     /locus_tag="TRUGW13939_00238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339341.1"
                     /db_xref="GeneID:55987753"
                     /translation="MAPATAFLMDHIPYALALALLGLYLAQLVIANLIRNRVQEKQWA
                     EVESKLETVGASRGPFRWTRRFTSAVFSMPSTATAGYNKFCKALNRPFVLPTTWTGRA
                     IVVAPPSALHKLMTRPDKGLAGTGSDITHIIGLIEAIQLPYIISDPDIYMNALHFDVV
                     RRQMTKKHMPFFAAMTADEIEAAFGDIWGTSKEWTTINGWDMCGRIIARTAERMMLGL
                     PWGRDETLLEASRLYANSVLLGGAVMNCFPPFLRGVAGPLIALRAKYYQKRCVKILIP
                     IIEERMAIYRGEKKVEEVPEDFIQWLIATCDKDGPHQMFADRIANRLIALMTPLIFAV
                     CYVFAHTVLDIYGNPDREEFIQGLEDEAKRVSSLHNGLATAEAVDELYRFDSAIRESM
                     RKSDVSVTSLHRDVTSGEMDLGNGIIIGEGVRVGFPTQNIHMDPDNYHEPGRYDAFRF
                     SRPFEGIDEASRKTDEAPERELITTPTQSFLPLGYGRHACPGRWFAANTMKQALAFIV
                     MNYDLELIGKPIKRQSLLNTMVPPVDAQIRIRRKS"
     gene            complement(<760457..>761558)
                     /locus_tag="TRUGW13939_00239"
                     /db_xref="GeneID:55987754"
     mRNA            complement(join(<760457..760594,760664..760708,
                     760771..760784,760845..761237,761295..761335,
                     761404..>761558))
                     /locus_tag="TRUGW13939_00239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483449.1"
                     /db_xref="GeneID:55987754"
     CDS             complement(join(760457..760594,760664..760708,
                     760771..760784,760845..761237,761295..761335,
                     761404..761558))
                     /locus_tag="TRUGW13939_00239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339342.1"
                     /db_xref="GeneID:55987754"
                     /translation="MSPRSLLDVSLALRDKIDTFLAHEADSPILRRVQAQLRISIAVV
                     DEALAKYRPEEIALSYNGGKDCLVLLVVILARYAVSSAANPNNSTATSNGTVKSSHTP
                     EKLQSVYIVPPHPFPEVDEFVASSGAEYHLDIDRYSLPMKEGLEAYLADRPSVKAVFV
                     GTRRTDPHGEKLSHFDPTDAGWPAFMRIHPVIDWHYAEIWAFIRHLQIPYCPLYDQGY
                     TSLGGIRDTHPNPQLKTQGENGKEFRPAYELTEDDEERLGRDR"
     gene            <762047..>769563
                     /locus_tag="TRUGW13939_00240"
                     /db_xref="GeneID:55987755"
     mRNA            join(<762047..768555,768612..>769563)
                     /locus_tag="TRUGW13939_00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483450.1"
                     /db_xref="GeneID:55987755"
     CDS             join(762047..768555,768612..769563)
                     /locus_tag="TRUGW13939_00240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339343.1"
                     /db_xref="GeneID:55987755"
                     /translation="MAPEAPAVAIIGSACRFAGASSSPARLWQLLRQPRDVASCIPAD
                     RFNIDAFYHPDASNPGTTNTRDAYFLDDNVRAFDASFFNISPNEANAIDPQQRLLLET
                     VYESLETAGLRVDQLHGSDTAVYCGSMSNDYASVTTSDMDAMPQYSAPGTATSMTASR
                     ISYFYDWHGPSVCIDTACSSSLVAMHSAVEALRSGQCSLAVTAASSLILSPYMFVAES
                     KLHMISPTGRCHMWDDRADGYARGEGVASIVLKRLSDALRDGDPIECVVRGIGINADG
                     RGKGLTIPNSTAQQQLIRSTYQRAGLDATRAEDRCQFFEAHGTGTPAGDPEEAAAIYK
                     VFFEDSSLDRQNDSSDVMHVGSIKTVIGHTEAAAGLAGVIKASLCLQNNTIAPNLHFN
                     RFNPNIEPLSTRLIVPTEELPWPPLPPGVPRRVSINSFGLGGTNAHVILESFDHDNSS
                     HKDLSLTSRATLPVILPFIFTAASPSSLLAVLGQYKEYLEKNPDTDLLNLAASLITHK
                     SQLKHQVIFTAVSADDLASKLQDKLNQSDALSLDLITPINHTRPKQTLGIFTGQGAQW
                     PQMCLDLISASTDAFSWLQDMQNSLDELPPQYRPEFSMIEQLSAPDSSSRLHEAMISL
                     PIRTAVQIIQVNILRELGISFDVVVGHSSGEIAAAYAAGILTFSDAIRIAYLRGFVVE
                     QNKSAGGMLAVDLSWDQATEICTNEFSGKIEIAACNSPSNITLSGDLDALDELKWLLE
                     SLGQSPRTLHVDTAYHSRHMLPCAEPYCRALNECDIKVTQTSTKWFSSVLNGDCIDWD
                     IHSKSFTSEYWKDNMIRPVMFSQALSTALTECPEIDALFEIGPHPALKGPSLQILSTL
                     EGKSDLPYIALAERKKSSIESLSMAVGLSVAHLGADAINIANYIAIFDKSWAFKPIRN
                     LPSYPFDHTQSYWAHSRLTSDFLHRTLPPNPLLGNSIARNCPGEWRWRNFLSIQRLPW
                     LSSHCVESRIVFPAAGYISMVVEAAAIITGTHRSLCSIEIEDLKIDRAIVIPAHSTDG
                     VEILFHLEGTDGTDDFFAGTFNCLANFGEKMKSCASGRVTMTFGELDPDLLPLRAGVE
                     QDLRKVDVEDFYSSLSRLGLNYSGPFQAITNLVRKMDMCSGTIKIADDPNDGSSLRLH
                     PANLDAGLHSLNAASRAPGDGQQYPLTVPIGIDRITINPLLWKFDTNNQLSFDSYITV
                     NNAAVSTGDVHMFDQDGLGLISVENVKLCPIIEPTPTDDDLLFADIVWGPLEPHPLLI
                     DGTTPKPNIDWQLVDRVALRYTKDAHEQLVTNGSKDLTKGSCILAWMDHVLMGVHEGK
                     NKSISREWLNDSWDYLLDSISSSASQVELQVVQDMGRDLIPFLRREDTTITKKQHKSS
                     LEKLYKDSEHINPLLKRLTGLVRQIVFRFPSLKILEIGTGNGSAMRSMLDQIGRAYHS
                     YTYTDNINDGFESIRSCVDKQDDRLIFKSLNVELPPLDQGFEHHFYDLIIDPGCVLHT
                     LQSQDALQNVRTLLKPGGFLISSILDGSDSLCAPLIFGALASDAWWSSRILKDNPESP
                     FQMRDRWESLLLRNGFTGIETATPSQEDELGLLITVSRAADDRLLLLKVPLGSTRVLD
                     HGLVLVGGTSDQAPHLISSLVDLLTPYFKSIVHFASIEASDIQDSTPTIFMLLDDMDK
                     AIFYNIPEQRLLRLQQILNVAGTLLWVSPARDTEDPFIGMSKGFLRSAAFEYPLSKIQ
                     HLQVEKVQSGTATKLAQILMRLVHSDSQNDYKLSKRVDNYEFELMLTDNGHIMIPRMQ
                     WSESLNQRHLSGRYAVKPYQVDIQSAVHVVGPERMKDGNLQYCFEQACEREDEQDQTN
                     QSSATINVGCSTLQALPINGNNFFHIVAGRNAVSGQQILALSDQHASVVTAPLSRCHT
                     LLDDVPTHSKATLMKNVAAALLALHIVTKADLGTAILVHEPGTIGEELQAALSYFSQD
                     NETRVIFSASGPSSVRSDPDTIYFHEKSSLRQVSRLLPGNISLVIGMGEKDVLSSHIK
                     ASLGKNAIYLDLEDIYRSSSACRGDPDEQAMKVFERAINFSKDRATSWKPFDSVPAHS
                     LPDIPFKDKAQLDIVDWTLTTSVPVQVRTASSLITLSTHKTYLLVGMTGDLGRSLAEW
                     MIGHGARTIVLASRSPRVNSWWIEKMSNMGARILYMAMDVGNRDSVLGVHNAICEQQL
                     PPVGGVVNGAMVLNDSLFSNMSIGTMESNFKPKVQGSILLNELYRDPKQLDFFILVGS
                     LTGPIGNPGQTAYGAAATFMASLVRQRRERFNLPGSVIHPGAIIGLGYLENVTRGFIK
                     SLTDRMGPTHLSERDFHELFAEGILAGRPGSGRDPEVIAGSRQINPRDYPDALCYAVP
                     KIWPIINYSAQFSVPEERFSAHNTLSIKGQLEKTTSNEEILEIISTGLIAKLRTKLGL
                     SQDQGNLSQKTQLAELGVDSLIALDLRSWFSKEIGVDVSILEILSGVSIGDLTHSAAS
                     RCSTIV"
     gene            <770177..>770796
                     /locus_tag="TRUGW13939_00241"
                     /db_xref="GeneID:55987756"
     mRNA            join(<770177..770724,770778..>770796)
                     /locus_tag="TRUGW13939_00241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483451.1"
                     /db_xref="GeneID:55987756"
     CDS             join(770177..770724,770778..770796)
                     /locus_tag="TRUGW13939_00241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339344.1"
                     /db_xref="GeneID:55987756"
                     /translation="MESTTKKICRSRSWARFDVALSENEGNASSPTCPPHETMNEQPL
                     DEKKPVDKTTLDAKPVRQKAAEPQPVYNFGNEQPSYDADAEGKAKKLKYKKRRYITRQ
                     DPTEPETKVQVPALEPSELGRVLHDIYLKQDDYGRMVSHPNYIHKYIPKKFIEPYDVE
                     KADALFQQFVTLNIDRLLYKEDPVNQTL"
     gene            complement(<771246..>773051)
                     /locus_tag="TRUGW13939_00242"
                     /db_xref="GeneID:55987757"
     mRNA            complement(<771246..>773051)
                     /locus_tag="TRUGW13939_00242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483452.1"
                     /db_xref="GeneID:55987757"
     CDS             complement(771246..773051)
                     /locus_tag="TRUGW13939_00242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339345.1"
                     /db_xref="GeneID:55987757"
                     /translation="MATMLHRQIHNNLLKSEDYQSVDDLSRFVRLRNAHVAHRNTYAD
                     YQDRSRRTNLAELLHICHRLSRLLSIASSSLPDSPKSPDKDEPQVIPYPQHIRNWDDL
                     PTLQETVWNFLGERSTFSNAHVFPSDFQCSLVEHSIHPICSSKDVYNFRHQTVHRFLH
                     LIWSQLLCDETIITSCLREAYDCLADPCGIATSTLEFELQADSADCCVYLLADRHEFP
                     IFFVQYISTQDLPTAQIRQQPTNLHFEKDVLNSGGTQTAFIAAVARAYAQMLSTGNRS
                     CLLDNGESLVFLQADETRPDTLNVLKYIPADELGEDAEGDSDKTVVAQYLTFALLSLQ
                     ATAPSQKWYDAAAKLPTCLLDSKGVRSQPDSTGYPHRSQDLGNIYAPIFVSAKTDRPF
                     CTSKCLLSLSRDEEIDQKCPNARDHGDQYHEIEPAVLLNILYNQLARSDQPYAFRPIH
                     LHGKHHHYLKGTIPGYGYTFLVKAVEQGHVEALENEFHFYERIPASQGFEIPICLGMI
                     DLKACIGRSHTYYGKKCEKMLLLSCSGVSAAIVVDKGSIDHLTEDRKVLEMELKEIHE
                     LVEMGMRNLDLSWCNLVWNQQEERLVWINFLFWQE"
     gene            complement(<773372..>774251)
                     /locus_tag="TRUGW13939_00243"
                     /db_xref="GeneID:55987758"
     mRNA            complement(join(<773372..774007,774059..774127,
                     774180..>774251))
                     /locus_tag="TRUGW13939_00243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483453.1"
                     /db_xref="GeneID:55987758"
     CDS             complement(join(773372..774007,774059..774127,
                     774180..774251))
                     /locus_tag="TRUGW13939_00243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339346.1"
                     /db_xref="GeneID:55987758"
                     /translation="MDRLQLIQEQNWHSMNEDPGCVLQSIEVEEEDPDNDISETESSP
                     VDTESNRAEASFSDFLSSSSRNLTLLQETPSYSLEQYEYESREPSPAFSEAPTVVESR
                     WTGLLRDIFILTSGYKIEEEDLDEESDEGDCITTVRELKDGQFPTRLVVIDLDPHLFE
                     DGLWDSGRQLLASRLAEAVDEMKRVRGPERTRRRKAKVGGVLSIGEFSQFYHMSDKKE
                     GLQEDMWVFGGKSLLHWEEDEQDIRDMLTYWTQQRLLFDA"
     gene            complement(<774723..>776471)
                     /locus_tag="TRUGW13939_00244"
                     /db_xref="GeneID:55987759"
     mRNA            complement(<774723..>776471)
                     /locus_tag="TRUGW13939_00244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483454.1"
                     /db_xref="GeneID:55987759"
     CDS             complement(774723..776471)
                     /locus_tag="TRUGW13939_00244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339347.1"
                     /db_xref="GeneID:55987759"
                     /translation="MDNGTSPTDIITYVGVPLAVLGVLPILYSFVRAILTQRSIRLSL
                     KRHGLLDSAITRGSLMSGIVEVELPRCTITPFDRDLDAEYWKLNAYQSTLKGGSWSIF
                     YWNRLVTGRRLYRCQFKDELRLPQAEIDFEELVAFLMDRGAVPDPKGWHMLKTIGLWT
                     PTATALLKPPNDLPGTVLKIAPPDDSEGVLSLQVYWHTNWDFRDTTSLPPFWMRLGQP
                     KFDKVMVESETTISLSPRLSKENVNEPVNSLNENETKPLAREDTLVAGSSTESNTLPT
                     SSLLGSIEQAKNTLTTSASDSVRFKIDAEIVRKLSFESDGILTGETRDMANVGGDNGS
                     LWFVCAASTICQGQNSGLWNFTIPDQIATFTRRKSIPCGVMVVLDLLDGKDVPPWASP
                     PPKTQESHTEIHQRLQERDDEMRMERLMTPTQADESRRSRMLREARRFHQQNVNRMQL
                     QREYEERRLIEAIQSPRLDNNTVANATLAYLIREKVIPDHFSLQELAHAVLYLMILDQ
                     THAKLIADILERWALWAQFGGMQSSQLTHLTDNKVAFCYASALVAVVLQANSSSNNLS
                     SDMLDCMRVWKRVNLG"
     gene            <777296..>778543
                     /locus_tag="TRUGW13939_00245"
                     /db_xref="GeneID:55987760"
     mRNA            <777296..>778543
                     /locus_tag="TRUGW13939_00245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483455.1"
                     /db_xref="GeneID:55987760"
     CDS             777296..778543
                     /locus_tag="TRUGW13939_00245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339348.1"
                     /db_xref="GeneID:55987760"
                     /translation="MVSSASVPTQYTLTWDARTSSDTSGSSPAVSPHHRDFGLPSQRR
                     LREACDGCRHSRVRCGGGHPCSRCRTRSMDCHYGFSRRSGRLRASPLREMQPPAPITT
                     PSSTSSSMAAHIREETNTNYNSNTNNNNHINNTRVNNHSTMLDPAAILNPGSQPPVGD
                     LSDNSWLNFSTFMGASSAIDDMNLYPNFTFDVPPTQAFDPPNGHLNHNHNQNQNAFSP
                     PHTPPFTNPPPTTCTCLASQLSCITAMVNYRDLNNVGIDTILNNARETIKALNGQLKC
                     ADCTKGTWSFLLTIIILQRLLYMFCSLASCRFVDVKSAKIGIGNYELSDEEDLAHKRM
                     LALSSLKGFEDFVSHFWDAVKKFIRLTETMKSQCKTPLKTDCTNLKWASEGLEYITAR
                     LEQIRVTIESDQWRKGQGQACCN"
     gene            <779472..>780876
                     /locus_tag="TRUGW13939_00246"
                     /db_xref="GeneID:55987761"
     mRNA            join(<779472..779683,779736..>780876)
                     /locus_tag="TRUGW13939_00246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483456.1"
                     /db_xref="GeneID:55987761"
     CDS             join(779472..779683,779736..780876)
                     /locus_tag="TRUGW13939_00246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339349.1"
                     /db_xref="GeneID:55987761"
                     /translation="MAPNEPIFASNTTGDPEATSSSTAVSVQTPDFRVQDEDKEKQPS
                     PADPIPNGGFKAWLQVFGAFLLFFNSWGIINTFGAFQAYYEFTLLKSTSSSSISWIGT
                     FQAFLLIVFGLVGGPAFDKGFYRELIAGGTFFLVFGIMMTSLCTEYYQFFLAQGLCVG
                     LGAGAVFLPSVALVATYFSTKRALATGITAAGGSVGSVIYTIVFRQLQPRLGFPWATR
                     VIGFIALGTLLVSLAIMRSRSPRDAAKKARKLVDLSAFQSVPFNICVTGMFIAFIGLY
                     IPFFDIITYAQTHANVNENMSFYLLSIMNAASALGRIIPGLLADRFGAPIILATLTIF
                     SAVLVFAWIAIDSLAGLVVFSILYGFMSGGVVSLPVSIIASFTNHLGQVGTWMGMAFC
                     FNGLGILIGNPIAGTLINTEKDDYVRALVFAGTTIVGGGVAWWVLWAYITFVKPKPKA
                     "
     gene            <781528..>782473
                     /locus_tag="TRUGW13939_00247"
                     /db_xref="GeneID:55987762"
     mRNA            join(<781528..781700,781804..>782473)
                     /locus_tag="TRUGW13939_00247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483457.1"
                     /db_xref="GeneID:55987762"
     CDS             join(781528..781700,781804..782473)
                     /locus_tag="TRUGW13939_00247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339350.1"
                     /db_xref="GeneID:55987762"
                     /translation="MKHPALNYDPEDANGADQMPNRADAPLFMLVHQENMPFRPNPYG
                     YRLFDYMTSVIQIGLLEPTTVLVRSQESKNLFRMHEQLFEITFIYIPLAYNFLPGISE
                     PVYTFHIGSDLTVARFVKWVYYNEYPVHLDLDSPAKTRMPTSRYSRLDEYLLQLARPR
                     VSSLTSAINIAVDREPIPYGEGEPVVYSEAQEESITDTYPFVAHLRVYIFATQQGLPL
                     LQLHAFKMAEKCCEDARTLQMRVDRQTLIRNCINNLTIFIRTEDPMRGLIRYISQLFH
                     PQPR"
     gene            <783306..>784764
                     /locus_tag="TRUGW13939_00248"
                     /db_xref="GeneID:55987763"
     mRNA            join(<783306..783335,783394..>784764)
                     /locus_tag="TRUGW13939_00248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483458.1"
                     /db_xref="GeneID:55987763"
     CDS             join(783306..783335,783394..784764)
                     /locus_tag="TRUGW13939_00248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339351.1"
                     /db_xref="GeneID:55987763"
                     /translation="MPAIPLDCGFIYNELTPIVYSRRVFIILYDNTNGLASLQNLSDH
                     GLKHMRDLTVVLSHERCVHKKDDSWLFTRREETYCFTRPLLLEKSQNPNEHGTKVLRE
                     WKRASEMLAARITPGRLHLQLICYVENFNTGETMVAPLAKLPVLKNCSISLGSNNGLA
                     ELARISRLRAKGVLLRNVEYVEKPFRYEYLPCEIRLIILENTGLVPGGGKICWTTKHG
                     YSLQNSDWCLNHHDLRNSVYYYCYCNTYHASAVSKQCLCWEPPVALWQVSRAFREDAL
                     RVFFGKNRFIIMHDDKKSCMSQPSSFLSWAVPRDGLKYIRSLEVVLNGDGNSYNEDPS
                     QYRYPHQDLVEYLERTRDDWTPLGLTLSVYIATVTPINELQSTENAISYEGKIMYDCY
                     YSFFTALSGFRSLNRLFVYALEQWWGEVRFDIGDIEYDSGGTWDHLEKSLEQLTMGRQ
                     YGSNDVGKWPDIHEIN"
     gene            <785283..>786402
                     /locus_tag="TRUGW13939_00249"
                     /db_xref="GeneID:55987764"
     mRNA            join(<785283..785350,785426..785549,785600..785728,
                     785789..786014,786071..786187,786248..>786402)
                     /locus_tag="TRUGW13939_00249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483459.1"
                     /db_xref="GeneID:55987764"
     CDS             join(785283..785350,785426..785549,785600..785728,
                     785789..786014,786071..786187,786248..786402)
                     /locus_tag="TRUGW13939_00249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339352.1"
                     /db_xref="GeneID:55987764"
                     /translation="MPFDTAIRSALQKDSPAFGFWLCLNSASAAKTFLRSGAQSPTGG
                     FSWVLVDAEHGLITDRDYYELNNAIASEGASPIIRVPWGEEWMIKRALDAGAHGVMTP
                     MCHSEEDAARIVKYSKYPPRGTRGYGPMFAPHAMPGVAAGEQHDAHADDSLIVAVQIE
                     SRPGVENVEKIAAVDGLDVLLIGPFDLAKQLGVTRGGDEHEAAIQRILKAAKSAGKTA
                     AIFCTDGNDARNRIAQGFNMVSIITDVGVLAEGMSRQLAFAAGTAQGGEKRDGY"
     gene            complement(<786919..>788133)
                     /locus_tag="TRUGW13939_00250"
                     /db_xref="GeneID:55987765"
     mRNA            complement(join(<786919..787091,787155..787591,
                     787658..787873,787934..>788133))
                     /locus_tag="TRUGW13939_00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483460.1"
                     /db_xref="GeneID:55987765"
     CDS             complement(join(786919..787091,787155..787591,
                     787658..787873,787934..788133))
                     /locus_tag="TRUGW13939_00250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339353.1"
                     /db_xref="GeneID:55987765"
                     /translation="MSTTTQTQSQTTLQGPEVGMALDGRPTHYNDFRDQLNRDGYAVI
                     KGAIPRERAEGYADKFLSYIEDFGLGFNRNDPSTVKRDMLPVINEKGMILNYGVTHEQ
                     WVWDIRGEPGVVDTFAKVYEDDDLIVSFDVVNVGFANRADLPENKPWPHQDQDPSKPG
                     FRCLQGLVNLNPCGPNDGGLIVCKGGHISSERFHAEMANEPRIPAWTPEWYGFTDAGM
                     KWLSDHGLQWEKVCAEPGDLIVWDSRTPHYNVPPTSKQDRLAVYTCYMPARVVSQEDL
                     VRKKGAFEKRLGTTHWPNARHVAPNNDAMRDGKLCPKNRTGPVQDPVLDERTFKLTGI
                     PYIKASA"
     gene            <788708..>790100
                     /locus_tag="TRUGW13939_00251"
                     /db_xref="GeneID:55987766"
     mRNA            join(<788708..788764,788832..>790100)
                     /locus_tag="TRUGW13939_00251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483461.1"
                     /db_xref="GeneID:55987766"
     CDS             join(788708..788764,788832..790100)
                     /locus_tag="TRUGW13939_00251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339354.1"
                     /db_xref="GeneID:55987766"
                     /translation="MSKQFKIIIVGGGIAGLATAIALRASNRKIIVLEQSSLNREIGA
                     VISLQPNASKIVEMTWNLAKTLQAKGSMVDEGFQVYNLDGELQMRIPLSTMEKYGAER
                     MLYHRVDLHDALKKRATSKEWAGEPAEILVSKRVTHCDCEEGVVYTQTGEKFHADLII
                     GADGIKSIIRDSILGTKIPALRTGHSAYRMILPVDKLLSDCKAFCDVVDPRAPYTTMV
                     MAHNRRMIMGPSRNGSVYSIVAMVPDEDMNENTTDTSWTTHGDIPKMCELFADFPEWA
                     RGPLSCVKDGEVGLWQLRDIDPLPTWMKGRVILVGDAAHAMLPTQGQGASQTIEDAEA
                     VGTFYTDILDGNDAPLEQIKAINEKIFACRYRRATTIQQYSRQAAKPATEEGSVKIKM
                     SPSEFMDYNCSYNGALKWARQQTEQERVADDFRKMSIAEREVKTQEVAL"
     gene            complement(<790045..>794251)
                     /locus_tag="TRUGW13939_00252"
                     /db_xref="GeneID:55987767"
     mRNA            complement(join(<790045..790094,790621..791194,
                     791257..791854,791907..792036,792085..792141,
                     793118..793239,793291..793917,793971..>794251))
                     /locus_tag="TRUGW13939_00252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483462.1"
                     /db_xref="GeneID:55987767"
     CDS             complement(join(790045..790094,790621..791194,
                     791257..791854,791907..792036,792085..792141,
                     793118..793239,793291..793917,793971..794251))
                     /locus_tag="TRUGW13939_00252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339355.1"
                     /db_xref="GeneID:55987767"
                     /translation="MSLTETEIQAKAALQKSLRESEDLIHFEPRVYGDWRDEFHENGC
                     VVIKNVISREKAKYYCDKQIEWLHKFDLGFDENDESTWAAEHLPVNFKGGMYYAYAAP
                     HEKMAWEARMEPAVFEIFEKLWETKELISSFDGLNVSLPRRKDLAGTPWPHCDQNPAR
                     KGMQAVQGLLNFAPNGPKDGGLVLMKGSAKLFNEYFAQDREPYAHEDAPPPELRYQDL
                     FLFNPRDLKWFEERGCELVKINMEPGDFVLWDSRTIHYAELPQGDQIRHVQYICMTPR
                     RFATKEALELKKECFNSWLGTTHWPHCNIRPSAEKPMRNGKVCPKYRTEPFEKPELTD
                     RLLQLAGIEDPLNLPMWQKFVILAIISIFSTIGLTLVSGFGGLLGFYIPEYSAAGKDY
                     NAITKLMTYPTLFMGIGNLIGMPLAIGVGRRVVFLGSTVVLVIGAALCAAAKTYEWQL
                     ACRMVIGLAAGQSESVVPMVSQEIFFLHERSTAITVQLAVQTILSCVLTLFASPIAGA
                     ITPQWWYGLGAILSGLQFILTFFFLPETKYERPLSSYQEASSTEDSTPENAEGASVKQ
                     EVPVYTSRPPLDYANYEQRTWRSDLRLWVGTPDWAGTWIQTGELLLFPNVIWALLING
                     VTLGTNVAIGTTYSAIVTGAPYNWPNNSASYANIGQIVTAVVALPLLGQGSDWLIKRM
                     AKRNGGLHEPEVRLIPLIIPIIVGTFTVVLYGQGAAHPEKYHWFLYVWTIAAYYFAFV
                     GANITAVTYLLDSYPARAGPLLVIVCAFRGFISFGTSYGTAPFIASYGYDGTFGTFEP
                     LPVSSPLSQQYSSS"
     gene            <794906..>796761
                     /locus_tag="TRUGW13939_00253"
                     /db_xref="GeneID:55987768"
     mRNA            join(<794906..796549,796618..>796761)
                     /locus_tag="TRUGW13939_00253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483463.1"
                     /db_xref="GeneID:55987768"
     CDS             join(794906..796549,796618..796761)
                     /locus_tag="TRUGW13939_00253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339356.1"
                     /db_xref="GeneID:55987768"
                     /translation="MPLPPLQVAYKRVKQPTVGENGYVGFQSGKKEVLPKGWNGFNAK
                     PLKSDILVEHDIEIVVRDGARLYVDIYRPANTTEKVPVVLSWSFYGKKYSALEMLPMT
                     VWKCCVPREDLSGIEKFEGLDPQTWCPRGYAIVSVDTRGVGHSDGSIGVMGTQDAEDG
                     YDVVEALAKMDWCNGHVGMAGNSALAISQWFIASQQPPSLKAIAPWEGSGDIYREQFC
                     RGGWFFMSNFDLIANAIVRGQVNSGLEDFEEMYRRSNVSNAFWEDKRADMTKIQCPVY
                     IRGSDVSSIHTMGSVRAWLELPHDNKWIRWGSKQEWYELYSEPESEKELFLFFDRYLR
                     EEVGNGWEKTPKVRWSALRFGDRTAIDDILLEDFPAPNTEYCELFLAKDGSLRTEAPS
                     NTDIATVSYNSEQRESIAEFSHTFEKATQLIGLPKAVLYVSNEKQDDFTVFVILRKRD
                     RNGKLLMHLNFPIETTPVKSIDEIPEKDRQSTNLHLGSTGILRASHRAYDSTKSIHPQ
                     FPFHPHTKQEKVRPGEIVKLEIGLWAMGYDFEEGETISLQVSGQYPSIAEFKSFSQPR
                     PEHELNKGLHTIHIGKQYPSSIILPFIKQ"
     gene            <801480..>803095
                     /locus_tag="TRUGW13939_00254"
                     /db_xref="GeneID:55987769"
     mRNA            join(<801480..802053,802104..>803095)
                     /locus_tag="TRUGW13939_00254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483464.1"
                     /db_xref="GeneID:55987769"
     CDS             join(801480..802053,802104..803095)
                     /locus_tag="TRUGW13939_00254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339357.1"
                     /db_xref="GeneID:55987769"
                     /translation="MEEVKQRSPSVNDEIVNNNAASDDVVTPVGVRLYLVIISLLLTL
                     FLSAINVTVVATALPTIAAHLNASTSEYTWIGSAYTLASTASTPLWARLSDICGRKEI
                     LMVTNVTFLIGSLICALSVSPGMLIGGRVAQGLGSGGISVVVTIVIGDLFPLRERAKY
                     YALTGIVWAISSGVGPMLGGVFTQTIGWRWCFYINLPFDGISLAFLFLALNLPTKKQK
                     QPRQTLFFSFDWIGSILIVGGTICFLYGLEVGASKQHPWGSAYTLGLLIAGIVVLVIF
                     GLYETFYANNPNVPIRVLKDRSILACLSTAFFHSFIFIAYDYFNPLYFQTVLGVSPIQ
                     SGLYTLACVLPLSAMTLASGLVVKRTGAYRPVIWIGGTIMVLGTGLFIDFGPNRVVAK
                     IVVYQLIAGLGAGPLFQAPMIAFQSQLIGKENLLAAAIAAYTFLRNLSTALSLVVGGV
                     ILQHGLSSDEASYLNNGSSLSASGSSEEGGIGDGIVDGLKTMWIFYTVVGGVMLISSL
                     RIGRKDLDHDSDQ"
     gene            complement(<806363..>807055)
                     /locus_tag="TRUGW13939_00255"
                     /db_xref="GeneID:55987770"
     mRNA            complement(join(<806363..806962,807014..>807055))
                     /locus_tag="TRUGW13939_00255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483465.1"
                     /db_xref="GeneID:55987770"
     CDS             complement(join(806363..806962,807014..807055))
                     /locus_tag="TRUGW13939_00255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339358.1"
                     /db_xref="GeneID:55987770"
                     /translation="MSKIIAVIGATGVQGGSVARTFSGIPGWEVRGITRNPASPAARK
                     LEEAGVTLVQADLDNVNSLIAAFQGVNAIFGVTDFWQFAEKQSTLDIARSKGITWNEA
                     SYLQELEHGKNLVDAAAHVVKEGKLEKMVYSSLSDAKKASKGKYTWVYHFDGKAKVVQ
                     YLEEKSHESAEHRALFEKTSYVQMGYYLDNWNKNPILFPKKVGRATYIHPLLI"
     gene            <807908..>808852
                     /locus_tag="TRUGW13939_00256"
                     /db_xref="GeneID:55987771"
     mRNA            <807908..>808852
                     /locus_tag="TRUGW13939_00256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483466.1"
                     /db_xref="GeneID:55987771"
     CDS             807908..808852
                     /locus_tag="TRUGW13939_00256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339359.1"
                     /db_xref="GeneID:55987771"
                     /translation="MALPHLTSAIPFLTEAGLETTAYHTYKIDLPCSSGTTLLTSESG
                     RELVRSLYKSYANIAASSGTGILLATRTWRASSAWAKPLNYSEDELRDLNYAAVHFLK
                     QVRNEVNKTNPAVRIVLDGVVGPLRDAYEDYSSDEISVDSAKEAYRGQIRTLVEEGVE
                     IISLMTVTNLHEAIAVVELSKEMQIPVAVSFSLESDGKLLSGLSLENAIQTVDKATDG
                     YTTYFGINCVHPARILQPLENMDLDVRQRIGLIRGNASLKSHEELDNSDTLDRGHIPT
                     FVSALKQVLLLLPGIRVVGGCCGTDEEHLTALAQQCLS"
     gene            complement(<809015..>810334)
                     /locus_tag="TRUGW13939_00257"
                     /db_xref="GeneID:55987772"
     mRNA            complement(<809015..>810334)
                     /locus_tag="TRUGW13939_00257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483467.1"
                     /db_xref="GeneID:55987772"
     CDS             complement(809015..810334)
                     /locus_tag="TRUGW13939_00257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339360.1"
                     /db_xref="GeneID:55987772"
                     /translation="MSLLSLPVELLLGIAGYLNNVCDFNSLVQACRALRDTLSQELYV
                     FDARHRQSRAFFWGMDSGLVPTMRRSILASGGFPDSFSLDDMDEKIGKIVERGHVSMA
                     SYWFGHRVSANTPATVHRGRFKQKTPDRPLLHVAIDQRNTKMVKILLQKGAFPNETYW
                     GKPPLYRATRKGRRKTEIVRLLLEAGADVHYTSHNGHTVLHSAAVGCDSKAIELLLGR
                     GADLNAKNNFGQTAIDRAFFCGNYEVIEYILDRKCSLTTNDEVNYQTTITYDEKLFHV
                     LCASGYDLNQRYGAVSKTLLHHAADKNNVKWVELLLRWGVNVDACTTFGYTPLHLAVR
                     HREVKVARMLLEHGADVNRLQKQKGTPLHIAVRSRRLETMKLLIAKGACREKKDKNSQ
                     TPLMIADRMKLKGGNTILTTIGWLYNNPRAMNSLFRVPRNKRGSTTR"
     gene            <811217..>812663
                     /locus_tag="TRUGW13939_00258"
                     /db_xref="GeneID:55987773"
     mRNA            join(<811217..811296,811352..811443,811504..811649,
                     811702..811764,811817..812134,812195..812330,
                     812401..812409,812478..812542,812604..>812663)
                     /locus_tag="TRUGW13939_00258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483468.1"
                     /db_xref="GeneID:55987773"
     CDS             join(811217..811296,811352..811443,811504..811649,
                     811702..811764,811817..812134,812195..812330,
                     812401..812409,812478..812542,812604..812663)
                     /locus_tag="TRUGW13939_00258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339361.1"
                     /db_xref="GeneID:55987773"
                     /translation="MATSSANEIKLVSGRSHPELSEKVASRLGIKLATTVSLNYSNLE
                     TSVTIGESVRDQDVYIIQSTAPGMVNDGLMELLIMIHACRTASARSITAVIPNYPYAR
                     QDKKDKSRAPISARLVANMLQSSGANHVITMDLHASQIQGFFNVPVDNLYAEPCVLGW
                     VKENLDTQNCVIVSPDAGGAKRVASLADKLDIGFALIHKERPRPNVVGRMVLVGDVKD
                     KTAILVDDMADTCGTLAKAAQTVKEHGAKEVYAIATHGILSGPAIETINNSCLAGLVV
                     TNTVPLGDKIERCPKLKIIDVSSTLAEAIRRTHNGESVSYLFHNAP"
     gene            complement(<813098..>814151)
                     /locus_tag="TRUGW13939_00259"
                     /db_xref="GeneID:55987774"
     mRNA            complement(join(<813098..814030,814080..>814151))
                     /locus_tag="TRUGW13939_00259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483469.1"
                     /db_xref="GeneID:55987774"
     CDS             complement(join(813098..814030,814080..814151))
                     /locus_tag="TRUGW13939_00259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339362.1"
                     /db_xref="GeneID:55987774"
                     /translation="MGQQYASDQPSGYNNHVEKIALVGAGGRIRKHITQALLNTGKHT
                     IIAITRQDSDNTLPGGVTVIKVDYNNQESLVEALKGQHVLIITMNVMAPPDTQTRLIY
                     AAATAGVPWVLLNEFGGDPYDVEKGKDGIVGAMKVPFRDQIERLGKSSYIGLVCSFWY
                     EFSFGGGSNRYGFDFEDRSLVIMDDGKTKINTSTMPQVGRAVASLLRLKTLPDDKDDK
                     SPSLVDFKDKAVYISSFTVSQQDMLESVLRVTGTKLEDWKITHTTAKDYWKSGQEVFK
                     TGDAAGFVRLLYARAFFPDDPENYERTRGLHNELLGLPQENLDEFTKIGMETRLTLAA
                     "
     gene            <815193..>816059
                     /locus_tag="TRUGW13939_00260"
                     /db_xref="GeneID:55987775"
     mRNA            <815193..>816059
                     /locus_tag="TRUGW13939_00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483470.1"
                     /db_xref="GeneID:55987775"
     CDS             815193..816059
                     /locus_tag="TRUGW13939_00260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339363.1"
                     /db_xref="GeneID:55987775"
                     /translation="MAHNVYSLRVFAAGPKGGNPLPVVVDAQGLSPAEMQAVAASHGH
                     ESGFVFPASKASGCDFEFVFWVPEHEMEMCGHATVGAVWLLEKLKKLKHPDIRIMTKS
                     GIIKAHVSKNAQGTWVEVSQPAGVVDTVVDPDDIEALVSVLGISKQELADLPIHNSKT
                     SRVKTLIPLKSASQLNSLKPKFNLVKEFCERIRSTGLYPYALSDAENQVFDARQFPKS
                     SGYNEDAATGIAAAALSYGLLKNGLVNNTEKPIRIRQGWAMGCPSEISVRFRQDGSGC
                     WIGGTAVEETGL"
     gene            complement(<816889..>817620)
                     /locus_tag="TRUGW13939_00261"
                     /db_xref="GeneID:55987776"
     mRNA            complement(<816889..>817620)
                     /locus_tag="TRUGW13939_00261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483471.1"
                     /db_xref="GeneID:55987776"
     CDS             complement(816889..817620)
                     /locus_tag="TRUGW13939_00261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339364.1"
                     /db_xref="GeneID:55987776"
                     /translation="MSGAQGAQELLHAATVASEIFELRPDYRVLLMVVEGVPPGPSDD
                     YSEALLRDAEQSAKDLLLKYPVTQFPHIAAWREAYKSFGVKPQKIRNSLEALTRRVES
                     GLPRINRLTDIYNAVSVKHQIPLGGEDLDKYNGSAFLTRASGKEPFLTFSGGEPQTEL
                     AAPGEPIWCDNTGITCRRWNWRQGPRTALTGDTTRVLFILDALEPLSNDSLTEAADEL
                     ASALKGLSPEVQTSYRIIGPPTSTE"
     gene            <818453..>819223
                     /locus_tag="TRUGW13939_00262"
                     /db_xref="GeneID:55987777"
     mRNA            <818453..>819223
                     /locus_tag="TRUGW13939_00262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483472.1"
                     /db_xref="GeneID:55987777"
     CDS             818453..819223
                     /locus_tag="TRUGW13939_00262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339365.1"
                     /db_xref="GeneID:55987777"
                     /translation="MYLRTVHAEPSIKALFEFVKENPLGILTTAIASPHFPFLQSSHI
                     PWVLDTISDDPDAPVKGRLRGHLARQNPQSKALIEAASNSSTGSFEHDVMVLFTSPYH
                     HYVTPKFYTETKPATAKVVPTWNYAAVQVYGKATIYHDSSSLETSLYLSQQIDDLSKE
                     CETSIMGHSGHEGKPEPWSVSDAPDRYIDIMKKNIIGIEVSIESIGGKFKMSQEMGEG
                     DRKGVIEGFQGLESDTGAHLADMVKMRGDMKDAEKKTG"
     gene            <823726..>824484
                     /locus_tag="TRUGW13939_00263"
                     /db_xref="GeneID:55987778"
     mRNA            <823726..>824484
                     /locus_tag="TRUGW13939_00263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483473.1"
                     /db_xref="GeneID:55987778"
     CDS             823726..824484
                     /locus_tag="TRUGW13939_00263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339366.1"
                     /db_xref="GeneID:55987778"
                     /translation="MKTSTLFSGLSLAALGTSTNVLLPLYIYPTADAFDPVYSAISSN
                     PNVTYYVVLDPDSGPGGSQYPNSDYISAVAKLNSYSNVQAIGYVHTSYMAETTDAVNA
                     NVTTYAGWSKYTDSDISVKGIFFDEATNEESQTAYDYMSTVASNARDQGLNYVIFNPG
                     TAVTASQFFDAADLIVISEVAYSTYTESTVHSVPQQYWNQSAIILHDTPSGTDLTSVT
                     SGLESDGLGAFYATGDCCYQSVSMLGDLSSAMAA"
     gene            <824931..>826498
                     /locus_tag="TRUGW13939_00264"
                     /db_xref="GeneID:55987779"
     mRNA            join(<824931..825275,825354..825831,825885..825975,
                     826032..826362,826418..>826498)
                     /locus_tag="TRUGW13939_00264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483474.1"
                     /db_xref="GeneID:55987779"
     CDS             join(824931..825275,825354..825831,825885..825975,
                     826032..826362,826418..826498)
                     /locus_tag="TRUGW13939_00264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339367.1"
                     /db_xref="GeneID:55987779"
                     /translation="MANNTDIDHQRRSVETRVVSDTESNDVASQLQHAHRQSQDEGSI
                     DAWLAIAGSFLVYFSSFGIMNSFGYFQYLYLSGFLRDYATSEIALIGTMQLALMYLTG
                     PVVGSLYDAYGTKYLYPVGALGCCLSLITLSFTQPNHIWQQFLCQGLLFGLTVACGVQ
                     PALTVIAKLFKRRKALAMGLVASGSSAGGVCYPIMFSRLVPRIGFAWSLRVGALTSLF
                     CYTVAWCITKTDHTSKPLSSLSCLFDYSGFKDVRYVCLSLGSFLANLGLYGPYYYAEP
                     FCAFLDPTAKIKPYLLPLINASSFVGRIIGGHFADTIGRLNLLYPMTVLSGLLSLLMW
                     RSALNVGTLTAFVCLYGFCSGVFISVMPAATSQIVPDDKLGAQLGAFSSLTAIAVFVG
                     TPIAGSLIKDDSVPGYMPLVTYSGSTMLAGGVMLLIGRVLHGRDLRKKW"
     gene            complement(<826915..>827740)
                     /locus_tag="TRUGW13939_00265"
                     /db_xref="GeneID:55987780"
     mRNA            complement(join(<826915..827574,827630..>827740))
                     /locus_tag="TRUGW13939_00265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483475.1"
                     /db_xref="GeneID:55987780"
     CDS             complement(join(826915..827574,827630..827740))
                     /locus_tag="TRUGW13939_00265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339368.1"
                     /db_xref="GeneID:55987780"
                     /translation="MSSQGALKGKLAIVTGSGKVNGIGFAVATALGELGADIVLHYNT
                     NKESALKNVKTLESLHVKAIAVQGDASGTTFGKDIISATTAAFPGRNIDIIVNNSGIG
                     IFHPDTTSIPVEDFDTLFQANARGPFLLVQAALPHLSSPGGRIINISSVVARSGSQFA
                     ALYAGSKAALSAMALGWAEELGSKGITVNTIVPGPIDTDLAPPEEHPLVQKFRVEQSI
                     KRNGTVKEVADVVAFIASPASSFVTGQDLSVDGGLAYV"
     gene            <828527..>829670
                     /locus_tag="TRUGW13939_00266"
                     /db_xref="GeneID:55987781"
     mRNA            join(<828527..828568,828627..829157,829212..829550,
                     829599..>829670)
                     /locus_tag="TRUGW13939_00266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483476.1"
                     /db_xref="GeneID:55987781"
     CDS             join(828527..828568,828627..829157,829212..829550,
                     829599..829670)
                     /locus_tag="TRUGW13939_00266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339369.1"
                     /db_xref="GeneID:55987781"
                     /translation="MSKLIVVAGITGVQGGSVARTYLNAPGWKVRGVTRNKSSDSAKS
                     WEFKGVEMVEANLDDVTSLKSAFQGADIIFGVTDFWTIFKDPESITKKKPGQDITEYC
                     FEVELQQGKNLADSAASIPALDRYIFSSMANATHWSKGKYRELYHMDSKALAVDYAKS
                     LPGLKEKFSQIQAPIYFNLLWEWSLPTTPVKNLDGTYRIKGIGSGDLPISFGHVAKDF
                     GPCVQAVANAKPNTNLFAVGDEISWNQYLDTWCESQSVLKGGYDEHSLDWWMETLPGL
                     GREFGENVLFSMEFGYDGKDPSVIRPPQLGLKMTTFKEYCAETDFSRILQR"
     gene            complement(<829920..>831996)
                     /locus_tag="TRUGW13939_00267"
                     /db_xref="GeneID:55987782"
     mRNA            complement(join(<829920..831470,831532..>831996))
                     /locus_tag="TRUGW13939_00267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483477.1"
                     /db_xref="GeneID:55987782"
     CDS             complement(join(829920..831470,831532..831996))
                     /locus_tag="TRUGW13939_00267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339370.1"
                     /db_xref="GeneID:55987782"
                     /translation="METTANRLPCATCRRRKVRCSKTQPCTNCARTGIDCYYESNSSG
                     DAGPVNTDLMERLLHLQDSIQRLTKVPDNSTQAHRDDPVEIIKPINGGRVAGSSEGQS
                     GLENIIKMMEDSLQGLNSANGREKQPSHTGKLCFRDAQARYIRETFWAGLYEEVENLT
                     FLLDKASPGQILHDTSSLFANHEQSLDFSMKTISRKMSDFLIDQFLSNVDPFIRLFHK
                     PRFNLDLEQFYRQEESFASHRGDFETLLFSIYAFSAYSLHDGDILVYFGEPKDIIVGQ
                     FVAATQKALERINILSTHSLTALTAFSLYITLLSEIDSSNLEWTSLSGLSLSIATRLG
                     LHKDGEQFSLNPYAVEIRRRLWHHLCLINVRALQVHGIELFPVSAFRHGATKLPQNSP
                     DNAWDACEFSRRLPAAVSGWTEMAPALVSFELSTLTRTILEIGIPEHGSEHSYLANCD
                     QLLLDAKSRIGACYSLNALDEPIQKITKDLIVLNLQNLWFIARQYLLKHREWATNELR
                     TELFQKALHISEITQSLQKQYVGQHWDWVFRSFHESTKWHFASTILIYLRHNTEQEDP
                     EVQRAWNQINIIFSERKDDQGALWKPLLALKREAELRRAEAMVEGNGNLLTNSGSGLW
                     EAQSVSTLHGIDPMFAQFGDPGLPLSPDSNILGEFYNPMLGDYSQPG"
     gene            <833041..>833544
                     /locus_tag="TRUGW13939_00268"
                     /db_xref="GeneID:55987783"
     mRNA            <833041..>833544
                     /locus_tag="TRUGW13939_00268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483478.1"
                     /db_xref="GeneID:55987783"
     CDS             833041..833544
                     /locus_tag="TRUGW13939_00268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339371.1"
                     /db_xref="GeneID:55987783"
                     /translation="MSGKRPESRSDFEIAIVCALPVEFDAVEASLDEHYGPYGKQRGD
                     LNFYRTGRIDKYNIVLAHLPEMGKRSAASVASSLLVSFPRIDLKILTGICGGVPFPSA
                     DTEIILGDAIISSKVADYDFGKLYPDGFQQRHDFTDTLGRADRDIRSLLSALKTRRLQ
                     EQFQENI"
     gene            <838132..>839584
                     /locus_tag="TRUGW13939_00269"
                     /db_xref="GeneID:55987784"
     mRNA            join(<838132..838758,838826..>839584)
                     /locus_tag="TRUGW13939_00269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483479.1"
                     /db_xref="GeneID:55987784"
     CDS             join(<838132..838758,838826..839584)
                     /locus_tag="TRUGW13939_00269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339372.1"
                     /db_xref="GeneID:55987784"
                     /translation="DILMKMFQRALLFSTSLYFAAQAQQVGNNTAESHPALTWEKCTA
                     AGSCTSVSGSVVVDANWRWLHSVEGTTNCYTGNTWDATLCPDDETCASNCALEGADYK
                     GTYGVTASDSSLTLNFVTQASQKNIGSRLYLLEDDETYQSFKLLGQEFTFDVDVSNLP
                     CGLNGALYFVSMDLDGGIAKYPTNKAGAKYGTGYCDSQCPRDLKFINGEANVDGWVPS
                     TNDDNAGVGGHGSCCSEMDIWEANSISNAVTPHPCETIGQTLCEGDECGGTYSAERYA
                     GECDPDGCDFNPYRMGNTTFYGSGSDFVVDTSRVFTVVTQFIETDGALSSIKRFFVQD
                     GKVIPQSDSDIDGVTGNEITQDFCDAQKKTFGDQNVFDDKGGLSQMGEALAGDMVLVM
                     SLWDDHYADMLWLDSTYPTNATSSTLGAARGSCATDSGAPSDVESTNADASVVYSNIK
                     LGPINSTFTSS"
     gene            <840164..>840997
                     /locus_tag="TRUGW13939_00270"
                     /db_xref="GeneID:55987785"
     mRNA            <840164..>840997
                     /locus_tag="TRUGW13939_00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483480.1"
                     /db_xref="GeneID:55987785"
     CDS             840164..840997
                     /locus_tag="TRUGW13939_00270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339373.1"
                     /db_xref="GeneID:55987785"
                     /translation="MAAVRSLLGKTAIVTGSSSGNGRAIALTLAKAGANVVCSDLTPN
                     PRSEGYEEDGQHQTHQLIASRIGKDGGSNNTIFQACDVQYPKQISDLIKRTTSEFGRL
                     DIMVNNAGILAHLGTIVDSTEDDYDRTMAVNVKGTYFGCKYAIEQFIAQKKFDSSSHS
                     IGKIVNFSSIGGVIGLKEEPAYCASKGAVVNLTKQLAVDFGKKGVNVNAICPGFLQTA
                     MVRPFLDDPERKKFLDEVTPWPTLGVAQDVANATLWLSNPESDYVTGSALTIDGGYTA
                     R"
     gene            complement(<841031..>841858)
                     /locus_tag="TRUGW13939_00271"
                     /db_xref="GeneID:55987786"
     mRNA            complement(<841031..>841858)
                     /locus_tag="TRUGW13939_00271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483481.1"
                     /db_xref="GeneID:55987786"
     CDS             complement(841031..841858)
                     /locus_tag="TRUGW13939_00271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339374.1"
                     /db_xref="GeneID:55987786"
                     /translation="MATCTRISAPGLHPDIWCALRGIEISLFCDVRYDLPESFKRDNY
                     ALIDKILRRRNGRRHLGPLLSAENLNKSPLLVDKYAKMETAPELWISTLKENAESYFD
                     RRVMSRLVDELHWACKVVPFGEFIPDPRVWILRNLSTMEYVRCCRDAGGGGKVLRGEK
                     PSQLTVEDVIFWRIQCSDAPTGYYGQEYSITTPRQGSWSGHCLDIVLLDDVAGELLTS
                     EETSAAIIWKDVTEEVLLDMQHLSTAISRYKARVNEYRGLWYALKSDMGRFMKHKNS"
     gene            <842794..>844168
                     /locus_tag="TRUGW13939_00272"
                     /db_xref="GeneID:55987787"
     mRNA            join(<842794..843636,843692..>844168)
                     /locus_tag="TRUGW13939_00272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483482.1"
                     /db_xref="GeneID:55987787"
     CDS             join(842794..843636,843692..844168)
                     /locus_tag="TRUGW13939_00272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339375.1"
                     /db_xref="GeneID:55987787"
                     /translation="MIGWTTILFSLLCPYTRALPFGTLETDTFQPPGTMDNRSTTPNG
                     GYICVTVTYPNTTTYTSTIFSTITANPAGNHSIFTITKTAVGLPATLPATPAAAGVTN
                     GVNQLNAKQTPKQNSSPHVLTTFYLTKTKTRKQYSSLNFPGDYQALDQNDNAAASDIV
                     ETATHTIFNTVSATKQPDLVTNFITVTHTTVITGKPATILTTVMTIRTTLTSVTPTKT
                     VTTKMKVSTESDGKRDVFIWKRDHPEIEYFEDGSTTTSALSPEKTMKPRAVPTAPQQT
                     SITVTKTYTPSTTVYTTKTITVSGTWVPWVNSTTTMTIPATVRGGGSEAVQQHINAVS
                     VATQTVVEPIVSTVVPPPPPPPPTTTAPPPPPTTTAPPPTTSIKTVDVTKVVTISNQH
                     TSTITKTTTHIVTSTTIPASSVVTQMTTIMDTVTSFGIYTLFLIQAA"
     gene            complement(<844583..>846130)
                     /locus_tag="TRUGW13939_00273"
                     /db_xref="GeneID:55987788"
     mRNA            complement(join(<844583..845203,845268..845729,
                     845795..>846130))
                     /locus_tag="TRUGW13939_00273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483483.1"
                     /db_xref="GeneID:55987788"
     CDS             complement(join(844583..845203,845268..845729,
                     845795..846130))
                     /locus_tag="TRUGW13939_00273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339376.1"
                     /db_xref="GeneID:55987788"
                     /translation="MRLITSVLLAQLLSTPLVSAAITVNAQNADSLKSAAKTAAASSV
                     KFYNDRASKLIPGKFDGTWWEAGAFFTFLINYWHWTGDDQYNDIVTEGMSWQGGPNND
                     FFTSNYSSYLGNDDQEFWALGAMTAAEQKFPDNSAPGSASWLALAQGSYNDFADRWNV
                     DKESCKGGLRWQISPILSGYDAKNAISNGAFFQLAARLYRYTGNQSYADMAETVWDWS
                     VQSVLFDNQTWFINDLTHISENCQDKSDMQWTYNYGSYLAGAAFMYNKTNGATKWKSG
                     VEGLLGSVWATFFPSKYDNVLTEVACDPIKTCNRDQLCFKGLMADWLSKTAMLVPEQA
                     AAIIPKLQASAVAAGKQCSGSGNQCGMQWYSSTYDGTSGIEQEMSALSIFANTLVSFA
                     TNGGSSPGYTPPSMPGPVTADDGGNSTSNPSGGQSSGDEYQPPKQTPITGGDRAGAAI
                     LTLLFSTSWLAGMAWLVVGGII"
     gene            <847170..>847673
                     /locus_tag="TRUGW13939_00274"
                     /db_xref="GeneID:55987789"
     mRNA            <847170..>847673
                     /locus_tag="TRUGW13939_00274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483484.1"
                     /db_xref="GeneID:55987789"
     CDS             847170..847673
                     /locus_tag="TRUGW13939_00274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339377.1"
                     /db_xref="GeneID:55987789"
                     /translation="MAAQVQVRVGVGVFVLESSNEPTDNPRFLIGKRINSHGSGTYSL
                     PGGHMEFGETPEQCAARELLEETGLQASNLHSLTFTNDYMPAEDKHYVTLFTVCVRQN
                     ENKSPQVLEPNKCEGWEWVSWEELKTWAQKQIDTPQAAEKELQRKLFLPLLNIIRERP
                     GVIPAIG"
     gene            complement(<848874..>849541)
                     /locus_tag="TRUGW13939_00275"
                     /db_xref="GeneID:55987790"
     mRNA            complement(join(<848874..849241,849313..849372,
                     849424..>849541))
                     /locus_tag="TRUGW13939_00275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483485.1"
                     /db_xref="GeneID:55987790"
     CDS             complement(join(848874..849241,849313..849372,
                     849424..849541))
                     /locus_tag="TRUGW13939_00275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339378.1"
                     /db_xref="GeneID:55987790"
                     /translation="MTIPFVLCVLMSTVLAAQNTFTLYAYGTNISGSQVFYSQGIAQI
                     GDVRYANSSNVSNVYFYEESGKFIANPNITSTTASLKASESNTTWTDLSFYIPKSSGQ
                     PLGFTTNINSAEVTTGSWHFYGEYAFIENSAGQLESHFFAQPTDVDGVYNILWSLSDQ
                     AQLASPEIKSISIRTIPPASG"
     gene            <851346..>853082
                     /locus_tag="TRUGW13939_00276"
                     /db_xref="GeneID:55987791"
     mRNA            join(<851346..852228,852283..>853082)
                     /locus_tag="TRUGW13939_00276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483486.1"
                     /db_xref="GeneID:55987791"
     CDS             join(851346..852228,852283..853082)
                     /locus_tag="TRUGW13939_00276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339379.1"
                     /db_xref="GeneID:55987791"
                     /translation="MKYLHLLLPLSAAIKLGSTAPNKGTPCSNKANNRADWCRYNIHT
                     DYYTVVPDTGVTREYWWVLEDGILSPDGVPRYTQTINGSYPGPTLFADWGDNVIVHVT
                     NKLTQSNNGTSVHFHGIRQQNNSPNDGVPSITQCPVAPNDTITYKWRATQYGTTWYHS
                     HFGLQAWEGLAGGIIINGPASSNYDEDKGVIFLSDWTHPTPDSLFDYIETVGPPTVNN
                     SLINGTNVWSEDGSTNQVGSRFTTKFESGTSYRLRLINGAIDTHFKFSIDNHDMTVIA
                     SDLVPINPYTTEYIDIGIGQRYDVIVNADQSDVAENFWMRAIPQSACATEPYPGNIRG
                     IIYYGDSPDTPTTTNFSIPDSCGDETENLSPIVEKNVSAHPKWSESENVTIIDSGNGI
                     FKWAVNNVSMAVDWKDPSLMQVYKKESNWSTTAGVIELDEANDWAYILVDSTLPIPHP
                     IHLHGHDFFVLAQGTGVYNSSDIGSLSNPPRRDTAMLPSDGYLLLAFQTDNPGAWLMH
                     CHIGWHTSEGLAIQFIERYSEIRGTIKDYSSMKSTCDNWDAWQTFPDIDSGF"
     gene            complement(<855106..>858210)
                     /locus_tag="TRUGW13939_00277"
                     /db_xref="GeneID:55987792"
     mRNA            complement(join(<855106..855461,855531..856394,
                     856446..857357,857408..858035,858088..>858210))
                     /locus_tag="TRUGW13939_00277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483487.1"
                     /db_xref="GeneID:55987792"
     CDS             complement(join(<855106..855461,855531..856394,
                     856446..857357,857408..858035,858088..858210))
                     /locus_tag="TRUGW13939_00277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339380.1"
                     /db_xref="GeneID:55987792"
                     /translation="MFRSFISAAIVLVTTIAQVAASSAPSNPNDPSLQNIVTWDSQSI
                     FVHGQRVMFFSGEFHPFRLPAPGLWLDVFQKIKALGFNGVSFYTNWALHEGKQGTFSA
                     EGVFALEPFFEAAQTAGIYLLARPGPYINAEVSGGGFPGWLARNPAALRTREPGYLEA
                     TQNYVSHIGEIIAKAQITKGGPVILLQVENEYSSGDPPFPDPEYFLDVEYQYRNAGIV
                     VPFISNDNGPHGYFYDQGPPKWPIYGHDSYQIGFDDNIYEWADDLLPTNYHALHEEMA
                     PNTPYAVVEFQGGSWDPWGGYGYNKSAARMGPEYERIFGKNLYSSGVTIFNTYMTAGG
                     TNWGNMGYPEGYTSYDYGAAITELRTVEREKYSELKLEAMFFQSSPAYLTAVPQDNSH
                     ANGSYTGNTALATTALLGNETNFFVVRHAAYNSIDTTSYNIEIPTSQGNISIPQLGGS
                     LTLQGRDSKIHVTDYAVDDITLLYSSAEIFTWRKYGQKRVLIVYGGPGETHEIAVSQG
                     GQPRLAEGSSEEVQFGNKSNATIIKYKASSTRNVVTLSCGLDIYLIDRYAAYNYWSID
                     LPSDPVFMNFSNPSSHSAIIVNGGYLLRSVSVANNGIHLSGDFNTTTDIEVIGASAGV
                     QSLFVNGNKTPFKQDSNGTLTAVVNFARPKYSLPDLSKIGWKVIDSLPEIKTDYDDTM
                     WTTATLTTSNNTARNLTTPVSLYASDYGYNTGCLLYRAHFRAKGNESLFLETQGGSAF
                     GHSVWVNETFVGSFSGAITASNWKQNFTLPSLTVGQNYVITVLVDQMGFEENGAAGSS
                     SMKTPRGILEYSLSGHNKSDTVWKLTGNLGGEDYQDHTRGPLNEGGLYAERQGYHLPG
                     APISSWKSSELGPMEGLKGAGVAFYATRFDLDMPNDYDIPIQISFANTTNTTSSLRCQ
                     IYVNGYQFGKWVHNIGPQSLFPVPEGIWDYHGSNYLAMTFWALEQNG"
     gene            complement(<859611..>861352)
                     /locus_tag="TRUGW13939_00278"
                     /db_xref="GeneID:55987793"
     mRNA            complement(join(<859611..859873,859958..860166,
                     860234..860667,860714..861181,861350..>861352))
                     /locus_tag="TRUGW13939_00278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483488.1"
                     /db_xref="GeneID:55987793"
     CDS             complement(join(859611..859873,859958..860166,
                     860234..860667,860714..861181,861350..861352))
                     /locus_tag="TRUGW13939_00278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339381.1"
                     /db_xref="GeneID:55987793"
                     /translation="MCAHLSREFGSALHYPGSDNFTIWDAKQQEVHPACRVEPSSAND
                     ISKILNTLVDHWCYFSVKGGGHSRNPGDSNSARGVTVDLDRMRSVDILDNGTKARVGG
                     GANTFQVYQALESRNLSFVGGRVGTVGLGGYTLGGGTSPFSNKYGLALDNVYEYEVVL
                     ANGTITTASESRNPDLYFALRGGSNNFGIVTAFTVRAFPQGPVFTSMTSYAANQSEQV
                     LDKVYSLYTDRNLTSDVELGYDLYYTYMADSDELVLMGTQRYGKPVQNPPVFRAIDQI
                     PTLSRTTTITTLSNVVNDPGPLGTTRHLFATLSVSPSRSLLSQGLQIFQEEVEAIKTV
                     SGLVPNFISYPLQRNAIALMKQRGGNSLGIDRDEPLFTWSSASDDAAVDRMTANVVRR
                     PKEAAEDLGVANRYMYINYASAAQGDEVFAGYGDENVQKLKDVQRAVDPRGIFTSKGL
                     WRGFFKLL"
     gene            complement(<862523..>863849)
                     /locus_tag="TRUGW13939_00279"
                     /db_xref="GeneID:55987794"
     mRNA            complement(join(<862523..862818,862890..863084,
                     863138..863339,863462..863484,863546..863624,
                     863691..>863849))
                     /locus_tag="TRUGW13939_00279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483489.1"
                     /db_xref="GeneID:55987794"
     CDS             complement(join(862523..862818,862890..863084,
                     863138..863339,863462..863484,863546..863624,
                     863691..863849))
                     /locus_tag="TRUGW13939_00279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339382.1"
                     /db_xref="GeneID:55987794"
                     /translation="MVKTLPLGDQQVPVPGFGAMGLNSAMGTDLNLEQSEPVLLKAIE
                     LGCTFWDTAVAYKNGENEKLLGEFIKKYTVRDKLFVASKCGFDFVEPPHQRATVLSLS
                     CLFFWNRYLTLHLEDTPLEQSIGALDEIRRAGKTKYIGLSECSAATLRKANAIAKIDA
                     VQAEYSAFETLHETTGLIETAKELGVAFVAFSPLGHGWLVDDFPFESPDDFAPNDFRR
                     TVPKFQGENFYKNKTIVDEIKKLAARKGCTTAQIGLAWVAAQGLITIPGTTKALRLEE
                     NWASRDIELTEDELKEMRKIVDAAKPVGERFSPIFQSMVGH"
     gene            complement(<864616..>865604)
                     /locus_tag="TRUGW13939_00280"
                     /db_xref="GeneID:55987795"
     mRNA            complement(join(<864616..865406,865475..>865604))
                     /locus_tag="TRUGW13939_00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483490.1"
                     /db_xref="GeneID:55987795"
     CDS             complement(join(864616..865406,865475..865604))
                     /locus_tag="TRUGW13939_00280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339383.1"
                     /db_xref="GeneID:55987795"
                     /translation="MSNGIVLRSFSQRITAWPDGDWSGISDPKLRRRMQNRLNQRVRR
                     LEKKKQTAVSATDNDRSCRGNPHTAREQHPQGALGPSDDNKKQHSEAYPVVDSSATAR
                     GLMEEVEYIHILNPDSVETKRIMQHLGAIARHQYLLSSSHTDILPHLIQFNFTKALME
                     NTRILGLTSEGLHDDAISPFNIAGPWKHDFAVAVPPSLQPTILQRTVPHHPWLDLLPI
                     PQMRDNLIAAGESYDETQLCLDMKGQGSARTGRTGIIVWKDPWDPTGWEVSEAFAQSW
                     GWVLQDCWDLLRSTNSWRAQRNEKRLSRLS"
     gene            <868763..>870367
                     /locus_tag="TRUGW13939_00281"
                     /db_xref="GeneID:55987796"
     mRNA            join(<868763..868908,868962..869523,869579..869953,
                     870026..>870367)
                     /locus_tag="TRUGW13939_00281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483491.1"
                     /db_xref="GeneID:55987796"
     CDS             join(868763..868908,868962..869523,869579..869953,
                     870026..870367)
                     /locus_tag="TRUGW13939_00281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339384.1"
                     /db_xref="GeneID:55987796"
                     /translation="MSHNNPTYRRIAVIGAGPSGYAAAHALSLEKKFDVIRVFERRDK
                     IGGLWHYDSIPDEFPLKENPEVVLPSKFPALAPPATEDVTARTAIYEKLDSNVGAEIM
                     AFSHTPFPLQNSATSVLRLGQNNASRPFQVVQKYLDTLFQKYRHFVSLHTTVERAEKK
                     GDQWVLSLRQPGHAEPDGQLRDFWWQETFDAIVVATGHYNVGAIPNVQGLDETYKTVP
                     TAFEHSKSYRSADNYVAKKVVVVGGNISAADIVTDLHAIVKGPLYTAQRGLNEKLIPA
                     WNLPGVVRKPQLKRVFASPTNGKVGVEFSDGEVVADVDNIIFATGFRVAYPFIQPNNP
                     VTLTNRLDGVYEHIVKIGDPSLAFVGQVKGGLSFRVYEYQAVAVARILAGRGNLPSVV
                     EQKEWEKKRLAQKGDSVAFHEILPDFGLYWNRLREIAGKPAPESDGYELPLWRQEWAD
                     TALAILERKGKWWNDQIQYAKARL"
     gene            complement(<870653..>872082)
                     /locus_tag="TRUGW13939_00282"
                     /db_xref="GeneID:55987797"
     mRNA            complement(join(<870653..870760,870827..871631,
                     871782..871997,872063..>872082))
                     /locus_tag="TRUGW13939_00282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483492.1"
                     /db_xref="GeneID:55987797"
     CDS             complement(join(870653..870760,870827..871631,
                     871782..871997,872063..872082))
                     /locus_tag="TRUGW13939_00282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339385.1"
                     /db_xref="GeneID:55987797"
                     /translation="MNWFRQTLANTVGTAEPEYGPEALQSVTAQAEKTPFTEVTKADL
                     KWKAMQATNVETQVFYLISNDGKVASVQIIYNNVAGLMTTCQLNVKIFNHRGASAADH
                     LWLSDPLENHGFDEEMISFYADGVSVSLNEEGDAYIIKSARNESALIDLVVKRATPGF
                     QVGENGTTYYGTDPQNPWGEMRHRFWPRCDVSGNIITPEQEYNFAGRGIFVHAIQGMK
                     PHHAAAKWNFVTFQTPTYSAIMMEFTTPPSYASTTVNVGGIVKDGEILFAGAKNTVKY
                     PESKEDPETLWPEPVSAEWTWEGESKEGHVSASIKGDLGERTDRVDVLAHIPGLIKSL
                     VGGVVGTKPFVYQFSSPPRDSLVLSLKIGDADAVQEQGTIFSEATFIS"
     gene            <873722..>874663
                     /locus_tag="TRUGW13939_00283"
                     /db_xref="GeneID:55987798"
     mRNA            join(<873722..874139,874203..>874663)
                     /locus_tag="TRUGW13939_00283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483493.1"
                     /db_xref="GeneID:55987798"
     CDS             join(873722..874139,874203..874663)
                     /locus_tag="TRUGW13939_00283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339386.1"
                     /db_xref="GeneID:55987798"
                     /translation="MKPLLHLLFPLLVLGATHVSAICYNPDGSTTSQDVPCSLSHQSN
                     CCHPGWACLSNKLCQNPNAPNDTVAYVRGSCTDKTWRSGNCPNFCVHDTAPWNDSLNK
                     PQHLGKCENTSEDLYYCEDDNVQAVDCAKHSAVVSFVGQPTTVTVIGVTQTAATTAAT
                     APATGSSGSDTSGGSSNSTAVGAGVGVGVGCALLISGAVFFFWRRRRNRRSKAQQPQA
                     SQAALSAAGDQGDYYPRKPDQPYEMESTTTGGQTTVRSAYNDHNVVEAPNDAMVGELP
                     AHRESESPVEMPAERV"
     gene            874992..>878801
                     /locus_tag="TRUGW13939_00284"
                     /db_xref="GeneID:55987799"
     mRNA            join(874992..875512,876036..876097,876149..876291,
                     876372..877258,877610..>878801)
                     /locus_tag="TRUGW13939_00284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483494.1"
                     /db_xref="GeneID:55987799"
     CDS             join(876175..876291,876372..877258,877610..878801)
                     /locus_tag="TRUGW13939_00284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339387.1"
                     /db_xref="GeneID:55987799"
                     /translation="MGQIQYPKLWKVLRRLRAWKVAALAFALFNLKCFPFVWHYRFFI
                     PLLTATLRKPPHQSLVVRNQKNKVPLVFLPIITATRVPLLEGDFNFHKSNSTYFTDLD
                     TSRSHLIAFLCFKGMVKVDRELSADGKKGILTVMLGSTQTSFKREIPTLQPYEIWSRI
                     LTWDQKWMYTVTHFVQRGRITPTASVADVKAGSKESKSKTSPASKDIESSIFATSISK
                     FVFKKGRMTVSPERILGASELLSKVSSSDSPINLSQISKNNMNGDVSNSLADQVPSAA
                     QHDIQMLTDIEAERAKGLRYADFLTGLEELQGQLLKDDEVSHGVVSLGTFNELGRLVS
                     AATNTVRACSIAPRHISTTSRPSMVVLDDYLNITPGHLGEIPAEKLPVTVFQDALPSY
                     AHPQTSRDQKEAIVERLKPYTVISTMRERTPFPGDLLRQLPNLKLLLATGTQFETFDL
                     AAARELGITVAAAPGKGRTDGKRIDRPVRPRLDIKKGGSHPTTQHAWALILSLARNVA
                     NDDAAMKDPARKGWQTQLANGLTGATLGVVGLGRLGAAVARIGALAWGMEVVCWSENL
                     TQEKANQKAEEMGLPAYGGGPNPNAPTFTAVSKEELFRNADVVSLHYVLSERSRGIVG
                     AKELELMKSSALLVNTSRGGLIDDKALYDVLDRGQIGGAALDVFDVEPLPADSPWRSP
                     SWGHQRRSNLLITPHMGYVEEGIMHTWYEETVENVERWIEGKEILHRLV"
     gene            complement(<879107..>880237)
                     /locus_tag="TRUGW13939_00285"
                     /db_xref="GeneID:55987800"
     mRNA            complement(join(<879107..879674,879733..879824,
                     879890..>880237))
                     /locus_tag="TRUGW13939_00285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483495.1"
                     /db_xref="GeneID:55987800"
     CDS             complement(join(879107..879674,879733..879824,
                     879890..880237))
                     /locus_tag="TRUGW13939_00285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339388.1"
                     /db_xref="GeneID:55987800"
                     /translation="MARAIFLLLLLQPLLSCALAVTDIQSANPTIRDTQSLSTEDGEE
                     SLSQERALSSLEPRTSSKPFALRTLPLGASITWGYKSPDGNGYREFLRNNMTAAGWQV
                     NMVGSLRHGSMTDNDNEGHVGLRVDQITKKAELSIPKKPNLILINAGTNDAVQHYKTS
                     TAGERMDDLLDRLYEAIPETTIILSTLLPSKRVPKTAAKISAQYRTIVEQRQNASQRI
                     ILADMSKGVDSLTTKELIDKTHPTGFGYSKMAQVWWNAIQEAESKGFLTAPAAVQGID
                     DANVSHSSDDDKLTEAGKIVIGIVIPLGVITIGSFAFLFYRRWQRKRQGKEQELGSIS
                     S"
     gene            complement(<883312..>885264)
                     /locus_tag="TRUGW13939_00286"
                     /db_xref="GeneID:55987801"
     mRNA            complement(join(<883312..883637,883849..884298,
                     884370..884798,884857..884899,884977..885073,
                     885140..>885264))
                     /locus_tag="TRUGW13939_00286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483496.1"
                     /db_xref="GeneID:55987801"
     CDS             complement(join(883312..883637,883849..884298,
                     884370..884798,884857..884899,884977..885073,
                     885140..885264))
                     /locus_tag="TRUGW13939_00286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339389.1"
                     /db_xref="GeneID:55987801"
                     /translation="MDIPEKCTVLVIGGGPGGSFAASALAREGIDTVVLEGDKFPRYH
                     IGESMLASMRHLLRIVDLDSVFDNYGFTKKVRAAFKLNPKKRPRYTDFLAAGGPENYA
                     WNVIRSEADHLMFKHAANFGAKTFDGVQIKAIKFEDVPYKGPVELPHEYPGRPVSATY
                     TRKEDGITSEIKFDFVVDASGRVGLLSTKYLKNRRYNQGLKNVANWGYWKGCGTYGEG
                     TPRANSPFFEALQDESGWAWAIPLHNGTTSVGIVMNQQMSTDRKVQFGSPDLKTFYLN
                     CLKQLAPDITELLGEGELTSNIKAASDYSYSASGYAIPGARIVGDAGCFIDPYFSSGV
                     HLALVGGLSAATTISASIKGQCTEEAAADWHSKKIADSYTRFLLVVLIIQGTADVSNK
                     LTQDELNETLEFCSNAFNPVTPEDRNSALEKMGKDVTSKGFQVDLSPEEQKVVGHIRA
                     RQMMRTEDTINISSFGTDSINGMVPSLQRGSFGLVKSAA"
     gene            <885906..>886895
                     /locus_tag="TRUGW13939_00287"
                     /db_xref="GeneID:55987802"
     mRNA            <885906..>886895
                     /locus_tag="TRUGW13939_00287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483497.1"
                     /db_xref="GeneID:55987802"
     CDS             885906..886895
                     /locus_tag="TRUGW13939_00287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339390.1"
                     /db_xref="GeneID:55987802"
                     /translation="MPSKKANKAAASAPKYSPPTSGILSYFPSSWVPYAELIRLEKPH
                     GIYMIWYPYIMGLLYSARISENTLSLELLCKRALDLTIWTFILRSTGCAWNDNVDQDY
                     DRKTARCCNRPIARGAISTVQGHIYVAALTGLGFTSIQHFPVECTFDACAILLLAAIY
                     PFGKRFTHFAQVPLGATLSGAIVMAQHSVGIDPLSNENLRPTACLVVSIILLVVFYDV
                     VYARQDTVDDLKSGVKGMAVLFRNWIKTLLLSLVSGIAALLFLAGKFADMRRAFFYSS
                     VGGTALGLLTMIMVINTSQVARYAGRFYILAIGCLLGGFAVECYDKYEAVFTW"
     gene            complement(<887604..>894153)
                     /locus_tag="TRUGW13939_00288"
                     /db_xref="GeneID:55987803"
     mRNA            complement(join(<887604..888053,888125..888207,
                     888273..888638,888699..893496,893557..>894153))
                     /locus_tag="TRUGW13939_00288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483498.1"
                     /db_xref="GeneID:55987803"
     CDS             complement(join(887604..888053,888125..888207,
                     888273..888638,888699..893496,893557..894153))
                     /locus_tag="TRUGW13939_00288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339391.1"
                     /db_xref="GeneID:55987803"
                     /translation="MSDISAVVFSPQNVAPTREHLDLIRASLNRHDTLSPLRDALLNL
                     PKTWELFANIRLEIATLQQGKLYTNMFSKWIQSGETSELEQTRSGIVTLPLLTVLHIV
                     QYYEYLQASGTRHAELLRTIKGGVQGYCIGLMAALVVATSENENDLINNATAAVRITL
                     GIAAFGEIGCDPSNQCSTTMAIRLRKGTEGDETIRAFPQSYVSAISDTQSISITAHAS
                     VIPGVKTYITDLGLPVKMMHLQSNIHNPKNESLAEELILFCNNSTELQIPDSTYLQVP
                     VRSNRTGKQINSGSLTGEIINTVLTACCDWNIVMTQLATDLRNTNRRCHKVAMIGVGD
                     FLPLSSFQKNNLDITKIDTYSVINQFDGPTRGIRLSSQEDFPSDSIAIVGAACRLPGA
                     STLDELWELLSKGESRVESLRESRIKIQESFRASQDRNWVNNREWLGNFIDNVEEFDH
                     TFFGISPKEAVYMDPQQRLLLLTAFEAMDASGYLRHHRREDGDSIGCFIGASYTEYLE
                     NTAAYAPSAFTATGTIRAFISGKISYHFGWTGPSEVIDTACSASLVAIHHACRAIQAG
                     DCPMALAGGVNLITGIQNYMDLGKASFLSKTGQCKPFDESADGYCRGDGVGLVVLKSL
                     CEAIKNHDHIMGVIPATGTNQGSLSPGITVPHDKAQKALYRQVLQKSAIPSEKITYVE
                     AHGTGTQVGDPIEIDSIREVFGGGHRSDMLTVGSLKGNVGHSETAAGVASLLKVLTMF
                     SHRSIPPQVGFKQLNHKIPALELSNMRIASKLLPWEATPRIACVNGYGASGSNSALIC
                     SEWTVKHHKPPKTTTPYPVMLSAHSQESLVAYAEVLASYIQKSEGVLTLADISFTLSE
                     RRKHHKIRWSTTARDLPDLVQQLRSGINNVPEPPATRTGIVLTFSGQAKTNIGLDPLL
                     CETYPKFREYIELCNSILQRNGYPSITPALYQVEPVSDVVVLQTGTFAVQYSCAKCWL
                     DSGLKVDAVLGHSFGELTALTVSGVLSLEEGLRLVAKRASLMKTTWGFETGTMLAVHA
                     DIETVQRVLKLVVTGSSDQSLEIACHNSPNSHIIVGAKTSISKAQTVLQGGPQFYGLR
                     SQLLDVSHGFHSTFTEPLLPHLSQYAETLTFKSPTIPLETCTQFPVDEIKPEYLAKHT
                     RCPVYFVNAVRRLEERLGPCVWVEAGWNTPIIPMTKKALARPKEHHFQHLKESPATIS
                     SAIAFLFRNGVSASWWGFLSPDDSAFQHIWLPPYQFKGPRHWLTHIDRATEALNSQAL
                     RLSSDKRNNIHSPPKLAVYIGPADDNSHQFQINTSTQRYTRIVSGHAVLKQPLCPVSM
                     YMEMAVMCAELNGFKFSGKTIGFQNLVFHSGLGCSNDRDVRLTLSEKNKRDSWKFSVH
                     SSKKTNKPSSNVKHAEGEFDTNEPDFRLYEILISDRVDTLRNDPTAERFMTRTAYSLF
                     SRIVEYNDILQGISSITLGCNQAVADIQVPDTAFDNNESSANHFMDAAAIDTFFQAAG
                     LLINTSGGTTADEAFVAASVEKITLRPCDFHKQKKWTVYAIFLMTDESQASGDIFVFS
                     EQKQLVALGLGVVFSKVRVKSLARLLKGVNTGERSVVETTLVSNRIPVVEISSHEEKT
                     VPTVIPSTSMDNTNENHNAQRKQLKEVISGYTGISTTELCDEESFSSLGLDSLSVMAL
                     ADELKDTFNIEISSDSLMTSDINTLLKFATCSEENMTNDDVSLPGAATPLSSTDDESS
                     GWANTTVKGQNSKYLNRQLDVHESKGVNGTRQKSRGSTRHRVETVTYKEVDGVEIPAD
                     IFVPLEPPSQAMPIALLFHGGGYMTLSRKAVRPVQTQFLLANGILPISFDYRLCPQVN
                     VIDGAISDARDAYAWAIRKLPALIVEKGAVVDPSKIVIVGWSTGGHLAMTLAWTTIVA
                     GLPPPVAILAFYCPTFYDTSDESLRMGKEYPSRTMSMNEISRRLEATTATGHSFSSTD
                     NTGLGWIKPGDPRSELVLALVQEKNGVALLLDGIPAHGNSLEAPDPLKVAKISPITQV
                     NTGNYHTPTFLIIGDHDEIVPFHTAVNFAESLKEHGIHYGFIAVPGAKHIHDLTIYPG
                     STEWDNWVLPGYNFLFDMLDRQA"
     gene            complement(<894731..>897980)
                     /locus_tag="TRUGW13939_00289"
                     /db_xref="GeneID:55987804"
     mRNA            complement(join(<894731..895138,895190..896826,
                     896892..897579,897699..>897980))
                     /locus_tag="TRUGW13939_00289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483499.1"
                     /db_xref="GeneID:55987804"
     CDS             complement(join(894731..895138,895190..896826,
                     896892..897579,897699..897980))
                     /locus_tag="TRUGW13939_00289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339392.1"
                     /db_xref="GeneID:55987804"
                     /translation="MAPSLRPFVRAKVDFFSPEKKDQHVRSLPELIDFNSIHNKDHVF
                     CIQAQPDDSFVKVTCRQFKAAITRCAHWITETIKLPLATVSENGETKRAPPLVLSARL
                     SPEAVFHLVKTTQAAGIVVSQRVSEHPAFSKAKAVMQFHVGRPYSALYTNDDSAPADN
                     HTVYPEDVDRDILLMHSSGTTGLPKPISLTHRQLVFAISHGAFDTEEEAQGVNISTLP
                     LFHGFGLLAPGLSMSIGKTVCFPSPDRFANAQHIVQLIESSNAAGMMTVPFLLEDIVS
                     LPNSEGTTALAKLDFVATGGSALSTGTGKTLTTSGVKLLNLYGTTETDMHFEISELEP
                     YNGERRFRLTIFPFGASKPFEIADQLIRNEEFPETDFAAVGRDDDVIVLATGEKVNPL
                     LLETGLTQSGLVKSAIVFGADRFEIGLIVEPLQPISEESEKEELKNKIWPSIVQANER
                     MDTTARIYSPSSIIVVPPGVVVPRTDKGSMARKEVYQLLEKEIGQVYENADQSAIPVT
                     PLDYENLEKSLKELIQTRLNLHVKDDNWSAETNLFDLGLDSLQGTILRRMLLSAASKT
                     PPEIIGRDFIFVNPSITAIASVLRDPSSAATLADSPTQEIQRLTQQYSPKNIVINQAQ
                     LSSGAVVLLTGSSGSLGSHAVAELASSKEVAKVICLLRKGASDSTTTGHDHKSVLESR
                     GIQLSGEQWAKATIRECDPTKENLGLPDAIYAELAESVTHVLHAAWPMNFHMSLSSFT
                     YQFDFLNNLLRLTLSRNTVLPRQKTKFVFISSIAALANIGLASPGQIIPEASLQVGES
                     ACGIGYADAKLVCEKILEEAAQLHSARIAFSIIRCGQLAGSKKTGAWNTNEQIPMLVK
                     TSQTMGIMPELNGTASWIPVDDAAAAVSEILLAPDTPSLFAHIENPVRQAWSDIVQTL
                     GKELNIQDSLPFDQWLDKLASVDEKDSEAYPAKKLHQFFKLYFRTASCGTVIMGTDNA
                     RRISRSLRGLTVLDDGTVSGYVHYWKKSGYLH"
     gene            complement(<899806..>900711)
                     /locus_tag="TRUGW13939_00290"
                     /db_xref="GeneID:55987805"
     mRNA            complement(<899806..>900711)
                     /locus_tag="TRUGW13939_00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483500.1"
                     /db_xref="GeneID:55987805"
     CDS             complement(899806..900711)
                     /locus_tag="TRUGW13939_00290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339393.1"
                     /db_xref="GeneID:55987805"
                     /translation="MFVPVAHVARSLLSSVVAIFTSTNMPASVVFSQFLPLLAVKIGR
                     FVTNVDEPYQDYCDPDIDFSLKVVEKVDTQYDGLDSKAAQQSFTSELTALLSSTFSKR
                     HKTSIRIITNQIKTYYLDNNGECFRNAVQSESVRRWIEQTVDEGEDIYFVVGYRTIND
                     AYVATRTGAQVGMGGKLVMPVSAGLTAAGVVVPLGSIFDPGLTGSVGYTDEQQRLFVS
                     QGEQIIAVQYRKVSFKWFASKTADRATLAKKTQWEQYDRPRYLHSDGIDRVEVDLEDD
                     LAFEGEREKHSIGSEEIIFSAQIQE"
     gene            <903103..>904701
                     /locus_tag="TRUGW13939_00291"
                     /db_xref="GeneID:55987806"
     mRNA            <903103..>904701
                     /locus_tag="TRUGW13939_00291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483501.1"
                     /db_xref="GeneID:55987806"
     CDS             903103..904701
                     /locus_tag="TRUGW13939_00291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339394.1"
                     /db_xref="GeneID:55987806"
                     /translation="MDYTSAYKISTEAIELLPRVHSRSLDIQDQQYVLSLFSGLATNA
                     CSLALQTGEPPGKAVELLERGRGVILSLLMDDRSDVTGLKAVDPTLYTQYEGFRTEVN
                     RSISDIKDQRLQQVAVKRRPEAIKDLENCIEDIRELPGFGQFQKAPTVEQMKKASEGG
                     NIIFVNITDLRSDALIISGIGISSVPLPRFNASHAKSWIDKDLTTPSAIDGVKNGKKN
                     KLYCKFLSWLWLECVNPILQEARYKLQSTIDQLNIDQLPRIWWIGTGLASSFPFHAAG
                     DNLLGSTERTCYWAISSYTPSIKALMYAKERASTITTSSSNDRKLLIISMPTTPAASK
                     LSKVGEETAAVIKALEGSVSVEVLEQPDVASVLHQIQECTIAHFACHGVSNPIDPSES
                     GLLLQKSTTEPIQDILSIRKVSQTHLAGGEIAYLSACSTAETRAARLVDEVLHIVSGF
                     QIAGFRHVVGCLWPSSDSVCVEVARLFYSELGQGQNGMPYEDRAVAVALHKAVMKVCE
                     SKGYGGRRLGEAPLKWAQYVHYGA"
     gene            <906479..>909583
                     /locus_tag="TRUGW13939_00292"
                     /db_xref="GeneID:55987807"
     mRNA            join(<906479..907182,907247..907585,907647..907960,
                     908360..908856,908913..909053,909131..>909583)
                     /locus_tag="TRUGW13939_00292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483502.1"
                     /db_xref="GeneID:55987807"
     CDS             join(<906479..907182,907247..907585,907647..907960,
                     908360..908856,908913..909053,909131..909583)
                     /locus_tag="TRUGW13939_00292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339395.1"
                     /db_xref="GeneID:55987807"
                     /translation="NCRPVVGVSSTWKLTGPYTIIHIADTQYYRSKNKCAYENSLHER
                     SGFMPIDGLLNGLAGAGGLDALITTQTLQDLATSPLQIVRNYARTIDKWLPIIKLPRL
                     TDRLEAAYRDRPIALRANTTALLLSMQLSMQSPASEGNMGNPGAHNRLYAQCQFNFAL
                     LQVSKPSALETRQCGLLLAVYQLGAGLISDAYITLSTTAGIIRVNKLPLSHLDGPHKE
                     SDNEAKRIWWGVFLLDRLIAQSNWKASYYPLIMEEPAWSAELPNEDSPNKVLIRMQDI
                     DGQECEYFCRELQAAYLAGQVMEYIRHDNDEEKHGLDWNELMAGLTRLLNTLFAQAPG
                     SWRPSCGAIAMVIIATLDLHLSSLGANDPGASQQLPSSVEASASTVRMNTEIVTNSLA
                     DNDQAIYDLLPIAGVIANYRTSQVICRRAEASQSLTIEDRFALTTMTKALQRAKLRWG
                     LAGPARRTFDTSQSQLKQSTLINKCKTRQFLSHCLLPQCHLIKTSHLLGYGLAPCYLF
                     FEQTLTDEQAAGNVGQAILNALLASPANFNITLLVRAESTSTIPQASNSAIKILKGDF
                     NNRAFLQSSVTGQDALVFALSSTPTSFELQNTLSDVAAKAGVKRIIPSDFGSDVTNPA
                     IVEAVPPYQAKVDATKYLETVVAENPSTSWTAVINGPFYDWCLERNLYGFNPKARTAV
                     LYDNGVGRFDTTNLSTVGHAVAKVLTIPNKFQNEYVYVSEFTVSQNDIFDALLGITGI
                     KREDWKIEHRTAESLKSQGLDKLAKQDFTGVYDLIFAAIHQPGLGSDFSATRKLDNDV
                     LEVVNGDLFEATRKIVE"
     gene            <910001..>911038
                     /locus_tag="TRUGW13939_00293"
                     /db_xref="GeneID:55987808"
     mRNA            <910001..>911038
                     /locus_tag="TRUGW13939_00293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483503.1"
                     /db_xref="GeneID:55987808"
     CDS             910001..911038
                     /locus_tag="TRUGW13939_00293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339396.1"
                     /db_xref="GeneID:55987808"
                     /translation="MQAVRVHPASASSLAYSPSNPAPSSALHLDQGLPIPKPSKPGEI
                     LVRIKATTVIRDMLTWPETYSHEYAIPGNDLSGVVVETFSQESTFKPGDEVFGMADAD
                     RPCTWAEYCIVLEDEVALKPKGLAWDAAAAMPLSAQTAYEALYDHAGIPVPELRDNLK
                     QETHRSSASERKQRVLITGAAGAVGIYLVQLASISGLHTVTATSSNARNQEFLKSIGA
                     DETIEYSALLSEERGGYDVIIDTVGGDILLACWKNIKEGGKLISVDSASYDFVADHEK
                     RGVSKEGVQALFFIVKGSNRALKFLARLAELDTLRCLVLQKYPISEVQDAYNHAQGRY
                     SGRGKVILTVP"
     gene            <911447..>912510
                     /locus_tag="TRUGW13939_00294"
                     /db_xref="GeneID:55987809"
     mRNA            join(<911447..911863,911917..>912510)
                     /locus_tag="TRUGW13939_00294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483504.1"
                     /db_xref="GeneID:55987809"
     CDS             join(911447..911863,911917..912510)
                     /locus_tag="TRUGW13939_00294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339397.1"
                     /db_xref="GeneID:55987809"
                     /translation="MSDISLPLRVPYKTVDGTDIPTDIFVPYRPLQDDSGLTPVIIMF
                     HGGGFMLGQAKMNNKDQINDCISRGWIVMSVEYRLCPGVDVLEGPMADARDALKWAQI
                     GDLASVLKEAYSERVLPDPKRVMAMGTSAGGHLALSLGWGTANTPLAILDFYGAKSFN
                     DKFWRQPIEQIRTKLPSSTPASDPIFQSLYQEKAIFIGGASLEGQSEGGAGGPPSAPD
                     FSDPRQLFTLNMIAQGQVVESIWPSAPNDLHLIDPVLNVHADWPPTAFVHGTKDFMIP
                     IEMSQYMETQLRSAGVETAFFPVPDEPHTFVGQMLKGSPTWHKQREGFDFLERILKRS
                     YL"
     gene            complement(<912698..>914152)
                     /locus_tag="TRUGW13939_00295"
                     /db_xref="GeneID:55987810"
     mRNA            complement(<912698..>914152)
                     /locus_tag="TRUGW13939_00295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483505.1"
                     /db_xref="GeneID:55987810"
     CDS             complement(912698..914152)
                     /locus_tag="TRUGW13939_00295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339398.1"
                     /db_xref="GeneID:55987810"
                     /translation="MAASSNPLTSGFGPVIPLWLDGEQINTNVTYDVVSPSNEQKIYK
                     SSSASVDDALRAVKSSQAAFETWAQVKPNERRDILLRAADILLRRKEEMRSISKQETG
                     EVDSMFDFEFNLGVQACKSVAGLITAVRGAVPTMTDEGRSAMILREPYGVVLSIAPWN
                     APYALGLRACLAPLAMGNTVVLKGSEFSPGVYWAIASVLHEAGLPKGCLNTIIHRQQD
                     AAEVTSALIASPSIRKVTFTGSAIVGGIIASQAAKLLKPTLMELGGKAPTIVCEDANL
                     QDAALGAALGSFLHSGQICMCTERVIVHAAVADKFKEIFKETIDQVFGDPEGMMLVNA
                     APVLKNKSLVSDAISKGAKLFHGNTEQKASVQSAMHPIVVEDVKEGMTIYHTESFGPT
                     VSLFTVESDDDAIRLANDTEYGLTASIFTEDLRRGLQIAKKIQSGAVHINSMSVHDES
                     TLPHGGHKSSGYGRFNGVEGLEEWVQTKTVTWKD"
     gene            <915000..>916270
                     /locus_tag="TRUGW13939_00296"
                     /db_xref="GeneID:55987811"
     mRNA            join(<915000..915192,915265..916040,916124..>916270)
                     /locus_tag="TRUGW13939_00296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483506.1"
                     /db_xref="GeneID:55987811"
     CDS             join(915000..915192,915265..916040,916124..916270)
                     /locus_tag="TRUGW13939_00296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339399.1"
                     /db_xref="GeneID:55987811"
                     /translation="MSRETTALVLREVNGPFTLETIKVNPLKPDEALVEIQATGLCHT
                     DLSCATGALPAQTPAVFGHEGGGVVVETGAEVDEASVGDKVLLSYAFCNNCKQCTSGR
                     APYCDLMMQLNFGGVRADGTSGLALGDGAPLRAHFFGQSSFSRLAVVHRKSLVKVPQD
                     TPLELFAPLGCGLQTGAGSILNTLNVQEGSTVAIFGVGSVGLSAVMAARIRKAKEIIA
                     VDIQPSRLELARELGATKTINSTEVDDVLQEIRKICPPSGVDYALDCSGIIKVIETMV
                     DSLAPCGRACSAGAPAPGKRASIDVFSHLVMGKEYVGCHQGGSIAKEMIPYLIEQHNQ
                     QKYPLEKIIKTYDINDFDRAIKDAKDGVTIKAVLRWT"
     gene            <916590..>919253
                     /locus_tag="TRUGW13939_00297"
                     /db_xref="GeneID:55987812"
     mRNA            join(<916590..916775,917019..917145,917195..917320,
                     917395..918804,918909..918947,919009..>919253)
                     /locus_tag="TRUGW13939_00297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483507.1"
                     /db_xref="GeneID:55987812"
     CDS             join(<916590..916775,917019..917145,917195..917320,
                     917395..918804,918909..918947,919009..919253)
                     /locus_tag="TRUGW13939_00297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339400.1"
                     /db_xref="GeneID:55987812"
                     /translation="CQGLLRVLDTAIYTRDSHVVTAGILIGGEGESAKIAGAACQDRQ
                     ESPPSGAFMSVITIILLVNVVEVLSQASAFLSLLGVWELCSKKVYLPEAVAGPHHMGF
                     ISGANFEVRGYILTLPFKMTLHEYDYVFAIGTLFAMLDAYNNGANDVANSWATSVSSR
                     SITYRQAMVLGTVFEMLGAITVGARTADTIKNNIIPSSAFRENASVQMLAFTCALAAA
                     SSWVMWCTKHSAHVSSTYSLISAVAGVGVATVGASEVEWGWNNGKGLGAIFAGLGMAP
                     IISGGFAASIFMLVKLIVHMRKNPVPWAIWSSPFFFLIAATLCTLSIVYKGSPSLNLN
                     KKPGWYIAAVTMGTGGGVALLSAIFFVPFVHAKVIKRDHTVKWWMVIQGPLLFRRPAS
                     SESNQAKIPNYAVVQEEDDLSVATSTKSTATNDDAKNPEQGDMAVRYTDDESEKRTVD
                     NEVSQTTYKERLAENKAKFHARLRTKRGPLGWAMRTLHNNPIGPGQIYERRNILILAK
                     RIPAMIVCGALYGLHYDIHSAQTGISGTPEGQRMERVYSHAKKYPNEVEYTYSFIQII
                     TACTASFAHGANDIGNSVGPWAVIYSAWRTGSAAESKAPVPIWQLAVLSGLMGNKITY
                     HSPSRGSSMEMGAAITVLVFSQYSLPVSTSMCITGATVGVGLCNGSLKAVNWQRVGLL
                     LLAWIMTIPIAGTLGGVLMGLFINAPHF"
     gene            <920060..>922189
                     /locus_tag="TRUGW13939_00298"
                     /db_xref="GeneID:55987813"
     mRNA            join(<920060..920074,920146..920199,920263..920591,
                     920656..921049,921107..921138,921199..921416,
                     921472..921683,921742..921788,921854..921923,
                     921980..>922189)
                     /locus_tag="TRUGW13939_00298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483508.1"
                     /db_xref="GeneID:55987813"
     CDS             join(920060..920074,920146..920199,920263..920591,
                     920656..921049,921107..921138,921199..921416,
                     921472..921683,921742..921788,921854..921923,
                     921980..922189)
                     /locus_tag="TRUGW13939_00298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339401.1"
                     /db_xref="GeneID:55987813"
                     /translation="MRFSWTIYLYGIAPCTGGLAFGYDTGSMSGILAMPQFLSYMNSP
                     SNFLQGGITASIQAGAFAGSLLTGALLADRFGRKKTILIGSAIFTIGIIISTVANNVI
                     ALVAGRVINGLGNGCLAMMVPNYQSEISPREIRGRIISAQQCFINLGILIAFWIQYGT
                     SHIDGQASWRIPIGLQMIPTIVLHVTMYFLPESPRWLVSQDRQSDALHVLARLHSKGD
                     IENPYVRAELAEIVAKIQWEKSNPPPTYGSMLFGSDSRRTWLAIGVQFWQQVTGINVI
                     MYYAVFLFQQAGLNDTSASLLANGLQGVVLNVFTWPDMYYMDTWGRRTPMILGGFGMG
                     VAMMLIGVIMKTKGDPIYDPVTKKTNFHFADKNASNATIAFVYIYVMAFALSWACVAW
                     VYPAELFSTNMRGRGTSFSSATNWFVNFWFALYIPTAMDKISWKLYIIFMALCYLMAV
                     VIFLFYPESAGKTLEEMDFLFAKNRTAFVFLDKSATRIGAIFDRDMTHGEALTAFDSA
                     KALDTEQGVHLEHARSSV"
     gene            complement(<922913..>923910)
                     /locus_tag="TRUGW13939_00299"
                     /db_xref="GeneID:55987814"
     mRNA            complement(join(<922913..923076,923146..923577,
                     923650..923733,923801..923819,923869..>923910))
                     /locus_tag="TRUGW13939_00299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483509.1"
                     /db_xref="GeneID:55987814"
     CDS             complement(join(922913..923076,923146..923577,
                     923650..923733,923801..923819,923869..923910))
                     /locus_tag="TRUGW13939_00299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339402.1"
                     /db_xref="GeneID:55987814"
                     /translation="MQFLCLHGALGNRDTIRIQLEPLQKELASGQVAEFHYTNAPFEA
                     NPPPGFREYFGLGPYFRWVDDEGAAEDSMLARIRELPVRRTPEDVMRHLMNKEIKWKN
                     RNSVIQFLDDLLDKHPEIEGIVGYSEGSAMAATYIIDEQRRLKETGRTRRIKCAIFFT
                     GWPPISNGNGPILSDESDVVVDVPTLHVVGANDPYCQGALALYNVCDPDVAMMFDTGK
                     GHTVPRDAVVISELANEVKELIENTNSM"
     gene            <924882..>932005
                     /locus_tag="TRUGW13939_00300"
                     /db_xref="GeneID:55987815"
     mRNA            join(<924882..925621,925678..926206,926266..927981,
                     928037..930757,930808..931128,931187..>932005)
                     /locus_tag="TRUGW13939_00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483510.1"
                     /db_xref="GeneID:55987815"
     CDS             join(924882..925621,925678..926206,926266..927981,
                     928037..930757,930808..931128,931187..932005)
                     /locus_tag="TRUGW13939_00300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339403.1"
                     /db_xref="GeneID:55987815"
                     /translation="MNSISDDPHMAGSDAISENGRGTSQDHDYTRQPIAIIGYGCRLP
                     GQVSSPNDLWELCTRKRSGWSPIPKERFSSGAFHHPNASKLGTFNPAGGYFLHDDIAR
                     FDAPFFNITAQEATSMDPQQRLLLECSYEALESAGIAKESLAGRNVGVFVGGNFADYE
                     LNNVRDVETIPMYQSTGCAPSLQSNRISYFFDFRGPSFTVDTACSSSLVALHAAVQSL
                     RTGESTETLVAGCRLNVMPDLFVSMSTSQLFNDEGRTYAFEERAKSGFARGEGAGVVL
                     LKPLDAALRDKDPIRAVILNSGISQDGRTQGITMPNGHAQEELIRRVYREANIRPEDC
                     GFVEMHGTGTKVGDPIEARAAHAALGAGRSAKNPLYIGSVKSNIGHLEGASGVIALIK
                     AAMMLDNGLLLPNADFKKPNEDIPLQEWNMKVVTSTRPWPQGKKYISVSNYGFGGTNA
                     HVVLERSPLISKEAATQKPSNTSSMEDPENKLIVISANDKESLQARIKDYGIYFEQRP
                     EAFEKMLFGNFAYTVGSKLSHLSYRVALPATSLDELGIRLAQMKINPSRVLGDPRIGF
                     VFTGQGAQWAEMGMSLVDKYPVFASAISQADLYLRHLGASFSLFEELRKVAAVSEIDS
                     PHLSQPACTALQIALVVLLESWGIRPSSVVGHSSGEIAASFAAGVYDFECAISLAYHR
                     GRMTSLLKQRYPNLQGGMIAVGASPEILRPILKMLRDGYANIACVNSPSSVTVSGDLA
                     AVQELEQILQQKQLFNRRLKINVAYHSDHMKVIGEAYLQSIASIHPRSGSNCVKFYSS
                     VLCKLVDHTMLDASYWVQNLTSPVLFPDALGQMCCGDEERPNLLVEVGPHSALKGPIM
                     DTLKYLGSTGSKIGYTPTIVRNMNAHESLLNVAATAYVRGVAIDMNAINFPRSAAKNN
                     WFLTDLPRYPWQHATRYWHEPRIAKKHRTRDGTLRNDILGVVANYSNDMEPTWRNIIR
                     LDDIPWLRDHKMQGMVVYPLAGYVVMALEAAKVRAQQRNLSFTAYELREVVVESALIL
                     VDDVDMETTISLRPYDEGTRGSSDVWDEFKIHSWSSERGWTQHCRGHIKVRSKLGGDD
                     IGVLPGRYSNDYTLSKQKDIEEASVNHIHKQHLYKVLSDLGASYGPTFQGLENCHADS
                     HHSHADLYIRNTAALMPKGFQPQLTLQPAFLDGLLHLVWPILGQGRMDLETLYMPTLI
                     KNATISCGCPSAPGDHVRIYGTGSPHLPSPEPTHFDLFATDTISSETLVILNGLVMTP
                     IRDFGSQTTEMRKLCYKFQWQRLSTAHPHAMSLCNEPTQSHITIPVNHSLSDITIVSD
                     TNTTTTRLETTNSIGPLRSDINMNRPTNGIMAIDDYPINHCSEAGIILNGYHDDGKRE
                     VDNLHHTLEDSKFIVVTFGLSDTGIATELVKFLNIGANYQQRMDTIEKSECVHKSVII
                     IQSPTTSLRNVTNDEFNSIQFILLNAASTLWVYQSSSPDSQMTIGLVRSVRSESMTKV
                     ATLGLETQDSCTALGMISHVLGLMWPSNGTEACPDFEFKAQGTELLVPRVVEDEVSNS
                     FIHRETSNLAIATQQFYQPGRRFKLNIQNPGSLDTLYFADDSASPLSGTFVEVEVKAT
                     GINFKDIVVSMGQLNQPYIGVECSGIVTSIGREVIDVKVGQHVMCITEGSYSTYARCL
                     STSAAPVPDCLSLHEAATVPIVFCTAYYGLFDLGRLSTAERVLIHAGAGGVGQAAIQL
                     AQTAGADIFVTVGNQEKKEFLMERYLIPEDRIFYSRDTSFGSAIRNATHNEGVDVVLN
                     SLAGDLLRETWECIAPFGRFIEIGKADITKNTRLDMFKFEENVTFSSVDLTKVAKFRP
                     RLMKRLLNDVCKLINGGSIKPIFPITKYRISEIETAFRTLQTGKNIGKAVVIPHPDDQ
                     VKAVLPKSSSRLLRPDATYILVGGTGGIGRSMAKWMSSKGARHIVLTSRNATSSNVIQ
                     TLMDQVAVAGTHIYVKACDISDSVSVEKLVKEGLIGLPPIRGVVHGAMVLRDTLFEQM
                     TLEYFQDVAACKVEGAWNLHYSLANSPLDFFIALSSVAGVIGNRGQAAYSAANVFLDG
                     FMDYRRSQNLPGTSIDLAAVTNAGYLANSDSTRQQEVLKNIGSATIDESEVLALLALA
                     ITGELTKTPLGHSITGLEVNGSLDSFWVHDAKFSVLRNAAESQQNNSTSQDVSLRAAL
                     KSATSTEDAVEQCYQRLVVKLADVLGLSPEDMDCSTRVSSLGLDSLVAIEVRNWIARE
                     AEANVQVLELLSSESLMKLASLILAKSKLSLSV"
     gene            complement(<932582..>934186)
                     /locus_tag="TRUGW13939_00301"
                     /db_xref="GeneID:55987816"
     mRNA            complement(join(<932582..933062,933132..>934186))
                     /locus_tag="TRUGW13939_00301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483511.1"
                     /db_xref="GeneID:55987816"
     CDS             complement(join(932582..933062,933132..934186))
                     /locus_tag="TRUGW13939_00301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339404.1"
                     /db_xref="GeneID:55987816"
                     /translation="MGLIRSTEDGRRASSRSSDEKPTSQTKDGNEGTGTTSGPATTDE
                     MMKILTRGSSSRLPPLKEVNKYPADIEAEYPRDIKLLNYLNLRPRRLVRLNSKQSIPA
                     NVLVTIVFFLWGFAYGFLNVLNENVALSIYGSWRTRALSGAYFLGYLVVPCTIGRYIL
                     RRFGFTAGFTSGLYIFALGTLLIWPSTVLLSFAISMVANAVIGSGLGIIETTANLFIA
                     MCGPLEYAEARLCAAQGCQGIGSLLSRLIAGYVVAPEVNNPQDIINLQWAYLAICFYD
                     VVLAIAFYYLPLPEAPDDDMRQLGERRSEENNAPVLGIPVFLVTLILGVWSQFFYIGA
                     QETFVSGFHNFRRQVMPTTKLTDLDLDNIGTTAFAVCRFAVAVLQWKGFKPRYVLLIF
                     YLGSVIVFAVCMNTSGTTSIVFALLSWLTLAPIFPIIFAISLRGTGVHAKTAAAFLAT
                     AVGSGTFSALLQHAVELSIGNPTAYVVTVAFASAGAIFPLYMNIVPAARRQVDPINDE
                     YVH"
     gene            complement(<936002..>938292)
                     /locus_tag="TRUGW13939_00302"
                     /db_xref="GeneID:55987817"
     mRNA            complement(join(<936002..936812,936871..937493,
                     937572..937652,937704..938005,938073..>938292))
                     /locus_tag="TRUGW13939_00302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483512.1"
                     /db_xref="GeneID:55987817"
     CDS             complement(join(936002..936812,936871..937493,
                     937572..937652,937704..938005,938073..938292))
                     /locus_tag="TRUGW13939_00302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339405.1"
                     /db_xref="GeneID:55987817"
                     /translation="MPASGIKRIRGACSTCRHRKVRCDAAILDSPCTNCRRNGLFCDT
                     VRPPKDKRPTSSADTSITADITGHLTAIQTSKNRGRYQPFTNFGFFAIPKLQNLCSED
                     MICLKMQKSLYVPEHPVLESFLRHYFLYVHPCMPVVDEARFWEMYHGDDEHSSSTQEF
                     SLLLFQTMLFAASSYIPNELAKSFGYDSIVAARNSLYRSAKALYDFDTEDSSLSIAQA
                     ALLLTYHNSSVNQLTNSTWLSIAIQHARASDAHLYDAQNRTHHQISLLKRIWWSCIVR
                     DRIIAIGMRRPLQITQHDFDFSKPSIGQADFEYENPISEVYSQLVKEQLCDVFVAQCQ
                     LAVAMTNPMSVLYPAIRQKATNSHGDISNQLTSCVEGLSNLKTWELGYLMPLKDRQVN
                     VHATVKLFAHLTSLYYQSTRVALCHHMALLLFVREEARWHQSRVMSIRQIKEELVDAI
                     GAVTATVRDFFTVCNVSSGHLPLSVLMNIILPAFLLRLDIQLSPSVPSLGNAHSSQSP
                     KLSRDSNHSLNFYLQIIQICNTRYDTSYIADWFEQLIRMATAVKMRMLSAHTRSPKQF
                     PSFPKSFLDFLEYQPITYLRLAATIDNLFATANVSLATTQRLSALQRGMVPHSGLRCA
                     SSTNHSRHDLVTSLNKQCNDNSDYPTTLEGCDDFTSSQQTDYMYLINDLPLLGG"
     gene            <941098..>943039
                     /locus_tag="TRUGW13939_00303"
                     /db_xref="GeneID:55987818"
     mRNA            join(<941098..941740,941797..942425,942476..942593,
                     942652..942702,942755..942780,942833..942906,
                     942973..>943039)
                     /locus_tag="TRUGW13939_00303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483513.1"
                     /db_xref="GeneID:55987818"
     CDS             join(941098..941740,941797..942425,942476..942593,
                     942652..942702,942755..942780,942833..942906,
                     942973..943039)
                     /locus_tag="TRUGW13939_00303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339406.1"
                     /db_xref="GeneID:55987818"
                     /translation="MASKLLSALLNYQGQDSAHPYTLLIGIGVIFAIALIVRLRNPLN
                     SIPGPFWARWTPFWLTYYASNGNMHRKMIETHKRYGSLVRTGPNEISVSNPQALKVIY
                     GQQIPPVVVIPVPTLNWDCAKFFEARIGAGNNFRKSDWYSVWQGVRKWDLFGERNEEI
                     HRAQRKLVSQIYSLSNMKKLEPYVNSAVSVFVEKLATQSHAPIHMNKWTQLFAFDVIG
                     EITFSKRFGFMESGNDDGAFSMIENSLRSAAWVGYVPWVYWTNLRLSPIIGSHLAVTA
                     RQGRLLAFAAKAIAERKERGSEHEDILSQFFSVQQEKPEFNDMSITSMVASNIFAGSD
                     STGASISSLLFYVCKNPDSKKQLVDEIDAVAKAQNIQRGEVFSLETANGMPYLQACMW
                     EALRCFPAVGMNLGRVVPPSGVEIDGQYIPGGTVVGANAWVVHQDKKTFGEDADKFRP
                     ERWMEDSERVGDMKRGFFSFGGGSRLCIGRNIGWLEMSKVVPTLLHTFDMELPDPDLE
                     LIEHAWSFVKIENFRVTLKPRGKLAAN"
     gene            complement(<943565..>945236)
                     /locus_tag="TRUGW13939_00304"
                     /db_xref="GeneID:55987819"
     mRNA            complement(join(<943565..943710,943779..944018,
                     944071..944439,944497..944870,944962..>945236))
                     /locus_tag="TRUGW13939_00304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483514.1"
                     /db_xref="GeneID:55987819"
     CDS             complement(join(943565..943710,943779..944018,
                     944071..944439,944497..944870,944962..945236))
                     /locus_tag="TRUGW13939_00304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339407.1"
                     /db_xref="GeneID:55987819"
                     /translation="MASATISTPTGETTGSPAPDDSSSNTMTRAENDNEKHAEPVGAL
                     QASDDETQDKGDPSPLKASVNNVSSIPNGGTKAWLQVLGAHFLFFNSWGIVNAFGTYQ
                     TYYEESFLSSSSPSSIAWIGSIQAFLLLFVGALTGPVYDAGYSRALIIGGSFFLVFGQ
                     MMLSLCTEYWQVLLAQGICVGIGSGLLCVPSTAILSQYFTTRLATAVGITASGSSLGG
                     IIYPVVFHRLQPTIGFPWATRVIGFIMLFTQIISIMVMRVRVLPDKKRAIIDIGAFKE
                     MPYLFFVISVFVGFMGLYLPFFYVQSFAIEKNITDSNLGFYILAIMNATSAFGRIIPG
                     FLSDKIGPMNVMTPCALISAVLCFCFIPVKSVASLIVLAVLYGFFSGTFVSSPTATVV
                     RLSSHSRGNIGTRLGQCFGAVSFGLLIGTPVGGVVLDKHGFSGLWIFAGALTAASGCL
                     VIVSRLFYVGSDLMKKA"
     gene            complement(<946514..>947454)
                     /locus_tag="TRUGW13939_00305"
                     /db_xref="GeneID:55987820"
     mRNA            complement(join(<946514..947151,947214..>947454))
                     /locus_tag="TRUGW13939_00305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483515.1"
                     /db_xref="GeneID:55987820"
     CDS             complement(join(946514..947151,947214..947454))
                     /locus_tag="TRUGW13939_00305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339408.1"
                     /db_xref="GeneID:55987820"
                     /translation="MSTQLDAAAIARVSLHDPTHFSIQHSQTLHRLVLLQHWNIPTDS
                     KVLELGCGQGDCTTVLAHAVGEQGRVVAVDPADLDYGAPYTLGQAQGHISQGPLGRQI
                     TWVQKSPLDYLSSLPPASETKAFDATVLAHCLWYFPSPSLILSTFHALKQHSKRLLLA
                     EWSLVATHPSAQPHVLAALTQAALECRKPKNSVSNVRTVLGPKRLTELALAAGWQLES
                     ETRVQGGEGLLDGQWEVSACLSSSFEREVEEKVNDERERAVVFASRDACEASLEGIKG
                     GRKGVRAMDIWVASFV"
     gene            <947688..>948052
                     /locus_tag="TRUGW13939_00306"
                     /db_xref="GeneID:55987821"
     mRNA            join(<947688..947705,947759..>948052)
                     /locus_tag="TRUGW13939_00306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483516.1"
                     /db_xref="GeneID:55987821"
     CDS             join(947688..947705,947759..948052)
                     /locus_tag="TRUGW13939_00306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339409.1"
                     /db_xref="GeneID:55987821"
                     /translation="MPATFTNLYDRDAELDVDYYLNTHMPLVQKLLGPSVLISWKLWK
                     LPDDSPFSYEGEVIWASIEAREAALKTKEGSQCKEDLKNFVKKPAMVFLRELVGSGPN
                     S"
     gene            complement(<948925..>950575)
                     /locus_tag="TRUGW13939_00307"
                     /db_xref="GeneID:55987822"
     mRNA            complement(join(<948925..949018,949070..949311,
                     949367..949400,949451..949540,949588..949744,
                     949806..950009,950068..950086,950147..950273,
                     950355..>950575))
                     /locus_tag="TRUGW13939_00307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483517.1"
                     /db_xref="GeneID:55987822"
     CDS             complement(join(948925..949018,949070..949311,
                     949367..949400,949451..949540,949588..949744,
                     949806..950009,950068..950086,950147..950273,
                     950355..950575))
                     /locus_tag="TRUGW13939_00307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339410.1"
                     /db_xref="GeneID:55987822"
                     /translation="MAQINVLSHLSHVSFHDQNESDYHQNRPAIAPQPSGNKVNIRLP
                     DMFVLFLAEPPRVNSHYDRIKAESEAWFAEKCQLNDRLRKIISKTDFSYFCAITAAEA
                     GPQELRTLCDWGNWVFPFDDMFDNGNLKENPEEAQKVIDVLLSDMVIDPDQSNTNNGE
                     SSHGQLSEQQGWLIDVHKLVWTRITESSPVGVQKRFAKHIHSYCKGSMEQVHWRSKGQ
                     LPSVQETLDVRRKSAGVLPLFALAEYALKLNIPDEVFDCESIKEIERIAVDFVVIQND
                     ILSYCKEEDEGIPHNLVAITRYQLQSTNILGASHPQVAFDSVGALLVELYQRWFLALA
                     VLPSWGEKIDIDVQRYIASVKAVVMANLNWSFRSERYFGKRVAEVRRTRVVQVLERLE
                     IAI"
     gene            <951897..>953295
                     /locus_tag="TRUGW13939_00308"
                     /db_xref="GeneID:55987823"
     mRNA            join(<951897..953000,953059..>953295)
                     /locus_tag="TRUGW13939_00308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483518.1"
                     /db_xref="GeneID:55987823"
     CDS             join(951897..953000,953059..953295)
                     /locus_tag="TRUGW13939_00308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339411.1"
                     /db_xref="GeneID:55987823"
                     /translation="MTTTSEQSQSGDEKQKWSYKFTWTDDHPDPQVLKPLRHEYDELG
                     ALALEKLLDIKKRHEKKGDLYNILENHHAEDETLTEFWNNVHAVPEWVDWEQLARGQK
                     VFYRYGLANIVGFALQGFVCENSASTGVVEILVRTGGFSTRVLWGRLLETFQWLLQVT
                     KSLDEVQPGGEGFRSTVRVRLLHSSVRRRILQLVDRRPEYYDVNKFGIPVNTMDSIHS
                     ITTFCLNPMFLQLPRMGLKPLQQEKEDYLALFRYIAHVIGTPIEYFMTVEKAKALMES
                     CYLHELEMTETSQIVAHNFVRAVESLPPPLVISRGFIEAGSRWLNGHKLCNELGLGQP
                     GVLSYIAFAGHCALVNALIWAQRLVPPFDKFMIELLRSKLYWAVIESEGGLNGGTGFE
                     MKYKPQIGRVTRREEAATFASGFPMLECFFFLCAILAVLVIVGTGYLFGKLMQA"
     gene            complement(<954949..>956332)
                     /locus_tag="TRUGW13939_00309"
                     /db_xref="GeneID:55987824"
     mRNA            complement(join(<954949..954968,955040..955440,
                     955497..>956332))
                     /locus_tag="TRUGW13939_00309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483519.1"
                     /db_xref="GeneID:55987824"
     CDS             complement(join(954949..954968,955040..955440,
                     955497..956332))
                     /locus_tag="TRUGW13939_00309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339412.1"
                     /db_xref="GeneID:55987824"
                     /translation="MATSMLHYFGFGNNALSAKEEAKDEPVRALPASWYTSPGMYELE
                     RRAIFSKRWLFMTHSSRVKETGDWLRYEIAGFDFIIARDRQGNINAFHNVCRHRAYPV
                     IEKQGSGNAKILACRYHGWSYGLNGKLAKAPGYQELNGYDKEQNGLFPIHVKVDINGF
                     IWVNLDANEVPEVSWEEHFLDVDKQERYKAYNFDDYDLDHSYELDGHYNWKILADNFN
                     ECYHCPTTHADIPEFLNLDSFDSDLKDGHIQHHCISTPEQIAKGLYTASTYYFPVSAM
                     VVSPHFIMIQKFLPTSPNDSKMAYEIYRNKNSSDTDFKLISEMYARVMREDKVLCNNA
                     QKNLDRNVFINGQLHPKYEKAPLFFQSTVRDAITKHFDLEKSEGKEIWPAKRKLPCSA
                     QVSEKDEEICAALSCGAHDDAPDFVW"
     gene            <957280..>961162
                     /locus_tag="TRUGW13939_00310"
                     /db_xref="GeneID:55987825"
     mRNA            join(<957280..957353,957404..957550,957611..957879,
                     957943..958490,958543..958612,958870..959045,
                     959105..959285,959349..959774,960420..960564,
                     960748..960781,960844..960915,960974..>961162)
                     /locus_tag="TRUGW13939_00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483520.1"
                     /db_xref="GeneID:55987825"
     CDS             join(957280..957353,957404..957550,957611..957879,
                     957943..958490,958543..958612,958870..959045,
                     959105..959285,959349..959774,960420..960564,
                     960748..960781,960844..960915,960974..961162)
                     /locus_tag="TRUGW13939_00310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339413.1"
                     /db_xref="GeneID:55987825"
                     /translation="MFVMERAQRSDMHVGNRKQRRAAIARLTWNASRCTACRQSKIKC
                     SGDEPCVNCRRRSLTCQFSEGSSKILVSEGYLRDLQKQVQDWQRAASVKRPREDLSRF
                     DDYLDAGNTVDDFGAPAGLLGPRPEESPTSPVTELSCNIWTSPFTLPTPVINNTHQEQ
                     RKWIWLAPSSAWSLTARLIVMLTEKPDLDSDKDPPQFYLDGDVYPFAWPRATTPGLPD
                     TSGLPSLNYALYLFQTVRFHLGRAYRFFDEELFINNIHDFYNSGSDEKAVEPRFWFVQ
                     FLMVLALGNAFLSRPRNQKEPPGSKYFARAMSAMPNYTSTGKDSLLAIEALALVGLYL
                     YAIDHRESAHVHVGHAIRIAQMEGMHTQLPEDVLGTIYKTEKTQLGTFLEITRSILET
                     MARYAEEIEKMIHVNFHGSMNNVPEETRHTILLYHQCVIVATRPLLLSVLKERLEKLG
                     RAEEDWQKFLALPMSLISIGIKSAEKTLQIIGDGNGLLETFLPFDLELTYAAALHLTM
                     ANALFPSSTDDRSYSQAAHSILDEMVLCGNRVAEARKGELTRIEGLFQDLAKRVEQEG
                     LRILTLSDPGLAEVMPVDIADEIHSEEEIPVTEPGMTLRSSARDTRPFSAYSSPPANI
                     DSLDSVAERIRDGMLKYIFITKESIGDGIHWVAFASQVFKLHKRRAGTSIIPWIGFNI
                     QTNILKMKYFTVLAFSAMLPAVFAAVAAPASSLEKKSCSASSCLCNGIQGQFCGDESV
                     NAKCLNTHVYECQSGTGYACDYGRRDSCAKCGSLSC"
     gene            complement(<961844..>962635)
                     /locus_tag="TRUGW13939_00311"
                     /db_xref="GeneID:55987826"
     mRNA            complement(<961844..>962635)
                     /locus_tag="TRUGW13939_00311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483521.1"
                     /db_xref="GeneID:55987826"
     CDS             complement(961844..962635)
                     /locus_tag="TRUGW13939_00311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339414.1"
                     /db_xref="GeneID:55987826"
                     /translation="MPSFRKALPFLLAGTALAGSVRRRISSERPGIYTNSTRPGIAAT
                     IDYTDTNWAGAVTEETDVTYVSGAFEVPAVSMPAGGDSATAYCGTAWVGIDGWGNDCS
                     GGLIQAGVNWCIQNGAVTYTPWSEWWPAEAQVNFDNFAVSQGDLITVSITATSTTSGT
                     AVLSNQATGASITRTWTGESPALCLRTAEWIVEDFTLLESTGNVLAPFANFGQVYWTN
                     TNCKVNGQSWGAANSNIADMVQGSDVLATAYLSGNDVIINYGTGQ"
     gene            complement(<964086..>964781)
                     /locus_tag="TRUGW13939_00312"
                     /db_xref="GeneID:55987827"
     mRNA            complement(<964086..>964781)
                     /locus_tag="TRUGW13939_00312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483522.1"
                     /db_xref="GeneID:55987827"
     CDS             complement(964086..964781)
                     /locus_tag="TRUGW13939_00312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339415.1"
                     /db_xref="GeneID:55987827"
                     /translation="MAPRPRTYTLSLLFSVAAFSSLATANCNGGSLNTSSWYYSVEKY
                     PATVFDVAQETRRGVCDIGRHNLMADVTIIPNISQQIWIPPQVCDPDNKTCLIPENNA
                     TSHCIYGGPRLYYTVNGDTYDRIAQRLNITVESLMEKSSGNMTATTALQPGQFVKVPL
                     CEPSQCILQPYTFSSGGYKDLADKYGTTVGQIMMLSPTYNYSTSVVNSESGPTIDLPI
                     SCTALSSNITVVD"
     gene            complement(<965376..>967045)
                     /locus_tag="TRUGW13939_00313"
                     /db_xref="GeneID:55987828"
     mRNA            complement(join(<965376..966112,966169..966474,
                     966541..966672,966728..966776,966827..>967045))
                     /locus_tag="TRUGW13939_00313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483523.1"
                     /db_xref="GeneID:55987828"
     CDS             complement(join(965376..966112,966169..966474,
                     966541..966672,966728..966776,966827..967045))
                     /locus_tag="TRUGW13939_00313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339416.1"
                     /db_xref="GeneID:55987828"
                     /translation="MADSILLYNGTVLFHEGNKVKFLHNYDVLIQGSKISKIGQGLQL
                     EFNGRMLDCSGKIISPGFIDTHHHLWQTQLKGRHGDEVLVDYMVSGMLQSFNYEPEDM
                     FWGQLAGCIESIDSGVTTVVDHANLTYSPAHATEALRATASSGLRTIFCYGVMPRLKK
                     WTSEFEMDTEIFPEWWHSTLETLAKSQPFGNGRVTLGFSFDMFKLPRDIITDIWTKCR
                     NLGLKILTTHYSSPAMPNSIKMLSDYGLLDKDIIVSHANNISEEDARTLAKNDVYISS
                     TPETELQFGPGDVVAFRDDIRSHASVGLDCHSTNSSDLLTQIRICLQHSRATVAGKVF
                     QQEGKQPRELTIKLEEAFNLGTIQGARAVNMENQIGSIAEGKLADIIVFDTQSPAMVC
                     AAEENPLAAVLLHSSVRDIETVIIDGIIRKENKQLCHVEILTEPNGNEKEKWSWSEVS
                     RNLLDSRLRIKKRGEGQDYAVAKKTLFGTS"
     gene            <972195..>973455
                     /locus_tag="TRUGW13939_00314"
                     /db_xref="GeneID:55987829"
     mRNA            join(<972195..972751,972813..>973455)
                     /locus_tag="TRUGW13939_00314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483524.1"
                     /db_xref="GeneID:55987829"
     CDS             join(972195..972751,972813..973455)
                     /locus_tag="TRUGW13939_00314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339417.1"
                     /db_xref="GeneID:55987829"
                     /translation="MILSIPEEYRDKLEVIEPTDPRSDEQVLASLSEYKAVISEKNVW
                     AYWHSGLSNMPKWNQRNVIDWVRILGPEWTVRVLDNVSGSVNHVLRFIPESLMPPAFV
                     NQTMEGPFVGQHGADLTRTACLYEHGGVWMDVGSFLVRHVDRVCWNELEDPNSPFTVA
                     MFMLWGIVPGNFFLAARKNDPLIYQWHRLFSHLWSDRKDIKGIMSHPLVAPIIPVTFE
                     NMTDKFDLDWIDYDVALDYGIQITCLTRIFCLEENAEGFSGVERWRNNVLALDAGEEI
                     ARAEWQRSFVGFGQLALDIVSLPCSGPDADSTSEKYKEAEKMIWDLLANSTVWKVSHA
                     KGLTHTPQLGVLLDMPENEDKDAAPNTFGELLRYGTRHFRQKREHVTRWHKREPSMTW
                     KKDILEP"
     gene            complement(<973702..>975882)
                     /locus_tag="TRUGW13939_00315"
                     /db_xref="GeneID:55987830"
     mRNA            complement(join(<973702..973793,973843..973948,
                     974006..974216,974291..974413,974464..974594,
                     974661..975169,975232..975329,975399..975407,
                     975455..975528,975584..975720,975786..>975882))
                     /locus_tag="TRUGW13939_00315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483525.1"
                     /db_xref="GeneID:55987830"
     CDS             complement(join(973702..973793,973843..973948,
                     974006..974216,974291..974413,974464..974594,
                     974661..975169,975232..975329,975399..975407,
                     975455..975528,975584..975720,975786..975882))
                     /locus_tag="TRUGW13939_00315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339418.1"
                     /db_xref="GeneID:55987830"
                     /translation="MADEQSPLLGHDVEVDAPQRRPVSVIIGVLVIGVFIANAEGSFV
                     LATNSQIASDLGSPKDASWLVTSYILAMSAAQPLYGKLSDIFGRSSLLITAYSFFSLG
                     CLICGLAPSLPTAILGRAISGIGGAGMGSLVSILITDLVPRRDIAPWRSYVNVIATVA
                     RMLGGPVGGYLADSVGWRWSFLGQCPPTLIAIILTARLIPSNFIDKDTGTLATPSSST
                     NSARFARIDWAGSLFMVVAIVSLLLPLEMAGLRLEWLLGCLIVSSVATSLFVVIELRW
                     AKEPIFPIRLLSSRTVVFSYLITFFQTSAQLGMMYSVPLFFRLVDNASASVAGAHLFP
                     AIAGVTVAGLAGGFAIKRFGRYKWLLIIATVLSSACYLLLAFRWTGRINMWESLYIIP
                     GGLGNGLVQAAGFIALTSGVVKADMAVASSGYYLSSNIGTVLGIAATNAIFQTSLRHG
                     LERQLEGCESRREIIDAILSNIDYIRELKGPLRDTVVGVCVQGLEYGHVAQSVCAVAA
                     LMSVVLLPELGLESEEGEGT"
     gene            <976572..>978801
                     /locus_tag="TRUGW13939_00316"
                     /db_xref="GeneID:55987831"
     mRNA            join(<976572..976787,976861..977107,977164..977555,
                     977610..977716,977764..977883,977942..978078,
                     978140..978319,978373..978501,978587..>978801)
                     /locus_tag="TRUGW13939_00316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483526.1"
                     /db_xref="GeneID:55987831"
     CDS             join(976572..976787,976861..977107,977164..977555,
                     977610..977716,977764..977883,977942..978078,
                     978140..978319,978373..978501,978587..978801)
                     /locus_tag="TRUGW13939_00316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339419.1"
                     /db_xref="GeneID:55987831"
                     /translation="MSVRLAVPKAPSHGSTVEGGGDVEITATEKHDDIITLTVIHGLA
                     LPDTEEGKRKRFWWQRAPKRDPNAIATQISVFDDPATAAQYQPRADWENIHRFNPDAR
                     WTWGEERKIVRKMDLYITVFACVMFMALQLDRANLSQANSDNFLGDLNMNTNDYNLGN
                     TVQKVCFLLAEIPSQLIGKRIGPDRWIPTQLLLWSIVSAAQFWLKDRASFLACRAILG
                     LLQGGFIPETVLFLSYFYTHRELSLRLSFFYNAISLAEIIAAFLAVGLLSMDGVHGAD
                     GWRWLFLIEGLITFVVALLAFILLPPGPTQTSGGLRGKDGWFTEREETIIVNRLIRED
                     PGKGTMHNRQPISLKLLWQSLTDYDLWPMFLISLLFQTPASPPGTYLTLSLKDLGFNT
                     IQTNLLTIPYITGTMITMWSLTYVSEVLGELCLSALFAQIWVFPFLIYINVVDMTTIN
                     KWKSWVITSLLLSYPSAQALQVGWVSRNSNVVRSRAISAPMYNMFNQVGAIIASNIYQ
                     DSDAPRYATGNKVLLALLVVNIFVYLFTKVYYVLRNRHREEKWNAMTKEQKVHYLDTT
                     TDEGNKRLDFRFAH"
     gene            complement(<978928..>980969)
                     /locus_tag="TRUGW13939_00317"
                     /db_xref="GeneID:55987832"
     mRNA            complement(join(<978928..979499,979571..980390,
                     980461..980618,980669..>980969))
                     /locus_tag="TRUGW13939_00317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483527.1"
                     /db_xref="GeneID:55987832"
     CDS             complement(join(978928..979499,979571..980390,
                     980461..980618,980669..980969))
                     /locus_tag="TRUGW13939_00317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339420.1"
                     /db_xref="GeneID:55987832"
                     /translation="MLQLACLLALVGIAASNSLAQQQPLSAPAKPNVIFILTDDQDAH
                     LDSIAYMPFVQKHLLNRGTHYRSHYCTTSVCCPSRVSLWTGKLAHNTNVTDVNPPYGG
                     YPKFISQGLNDNYLPVWLQEAQYNTYYTGKLFNVHTVENYNAPFAAGFTDNEFLLDPF
                     TYDYLNSTFQQGRESPQSYEGEYTTDILTKKAYSLLDKAVVAQKPFFLTIAPIAPHCN
                     VFMNGTGLDENPVFSFTEPIPAKRHEHLFENIQVPRTPSFNPEQPSGASWVKTLKRQN
                     ETNVEYNDHFYRSRLRALQAVDELVDGIFARLQDYDLLDNTYIVYSSDNGYHIGQHRL
                     QPGKTCGYEEDINIPLIIRGPGIAENKTTDIVTTHTDLAPTFLQLLGIPLRPDFDGEP
                     IPLTQADIEVADSKRQEHVNVEYWGFANGEGKYDFDLSAYNHTYKALRVKGREYNIYY
                     SVWCNNEHELYDMTVRLFIFMVLRHLLSIDASKEKADCEQADPHQLHNLLSTDDKENQ
                     TSHAILGISLPKVVARLDSLLLVLKSCKGQVCVKPWKALHPQGEVTSLKDALDTRYDY
                     FYKEKQTSRVYFDECARGYLLDVEGPQYNFESNDEGNSFIRDGLPWYEWV"
     gene            complement(<981973..>983320)
                     /locus_tag="TRUGW13939_00318"
                     /db_xref="GeneID:55987833"
     mRNA            complement(join(<981973..982727,982804..>983320))
                     /locus_tag="TRUGW13939_00318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483528.1"
                     /db_xref="GeneID:55987833"
     CDS             complement(join(981973..982727,982804..983320))
                     /locus_tag="TRUGW13939_00318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339421.1"
                     /db_xref="GeneID:55987833"
                     /translation="MDSIDKTYAPVEYMPLEDIERPERYRPGGYHPIAIGDRLSDRYD
                     VVHKLGFGTYSTTWLARDSNTKKYVAIKIAIAEANILESKILNSLALSEPSDEGYPGK
                     ALIPRVLDIFSLDGPNGRHTCLVTEPGMMALAEARDASYTRLFKLPVAKAIAAQVIQA
                     VAFLHHRGVVHADLHSGNLMLRLPNSIDELFPGELYEKYGQPNVEQFVRLYGKPLSGG
                     VPTHGVVPISLGKESELVPLSEAKIFVTDFGESFLPSITQRHHSNTPGILAPPETYFM
                     PHEPLSFPSDIWTLACTLWEIIGQRPLFEGFNPSSDWMIKEHVDALGKLPCDWWQKWD
                     ARQRWFTEEAKRTYEGAGRQLANRFVDSIQEPRRESTMEDIGEAEKSALLAMLRGMLA
                     FKPNERLPVTEIIESQWMLRWALPVLEKVAA"
     gene            complement(<984178..>985399)
                     /locus_tag="TRUGW13939_00319"
                     /db_xref="GeneID:55987834"
     mRNA            complement(join(<984178..984257,984306..984354,
                     984411..984511,984562..984703,984752..985280,
                     985338..>985399))
                     /locus_tag="TRUGW13939_00319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483529.1"
                     /db_xref="GeneID:55987834"
     CDS             complement(join(984178..984257,984306..984354,
                     984411..984511,984562..984703,984752..985280,
                     985338..985399))
                     /locus_tag="TRUGW13939_00319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339422.1"
                     /db_xref="GeneID:55987834"
                     /translation="MLLLDYQNVLIQSLLTERFSGVPPVSIDQVVSDFDGVTFHVSTP
                     ESKSRIVISIALKCFRELLQYGAQAVLEREYGPYIIDTEPGYDFSVQIDLENLPADEE
                     GKEELVTRLSLLKRNVMAAPFERAFDEFAKLSEEASKYTTESAPQGIKEGGEVMAIHY
                     REEEAIYIKSSHDRVTVIFSTIFREETDRIFGKVFLQEFVDARRRVQTLQNAPQVLFR
                     NDLPLELEGVPGLKNSGDGQYSYITFVLFPRHLTPQRRYDSISHIQTFRDYFHYHIKA
                     SKAYIHTRMRKRTADFLQVLNRARPENEERERKTASGRTFRVQG"
     gene            <985680..>988665
                     /locus_tag="TRUGW13939_00320"
                     /db_xref="GeneID:55987835"
     mRNA            join(<985680..985696,985751..986005,986079..>988665)
                     /locus_tag="TRUGW13939_00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483530.1"
                     /db_xref="GeneID:55987835"
     CDS             join(985680..985696,985751..986005,986079..988665)
                     /locus_tag="TRUGW13939_00320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339423.1"
                     /db_xref="GeneID:55987835"
                     /translation="MVKSYLKFDHSKTFGLVTSASSNAIWTRDEDVASTERHTGAGRA
                     IVGANEEVLCWDVKKGELLSQWRDASCKAQVTAITQSKADEDVFAVGYDDGSIRLWDS
                     RIATVIISFNGHKSAITQLAFDQSGVRLASGSRDTDIIVWDLISEVGLYKLRGHTDLI
                     TSLNFLSPAEEVGSDQSDVGGFLLSTGKDALIKIWDLSSKHCIETHVAQSNGECWSLG
                     LSPDHSGCITGGNDGELKVWSIDERAMREVAREKEGYENKKILTEQGTLYRQGKDRTI
                     GITFHPRADYVGIHGSEKAVEIWRIRSSTEVQKSLARKRRRRKEKEAAEEGNPDDKND
                     ENSSPPISEVFVPHVIVRTGGKLKSFSWMTTKSTGKLQILTAATNNELETYSIVASGK
                     QRAKDSEETEYSRVLSVDIPGHRTDIRSLALSSDDRMLASASNGSLKVWNVRTSTCLR
                     TLDCGYSLCSSFLPGDKIVVVGNKNGELEVFDIASSTLLDTIKAHDGPVWTLQVHPDG
                     KSMVTGSADKTAKFWDFQVVQEEIPGTKRTTPKLKLVHTRTLKVSDDILSVRFSPDSR
                     LLAVALLDNTVKVFFVDSLKLFLNLYGHKLPVLSMDISYDSKLIVTCSADKNIRLWGL
                     DFGDSHKAFFAHQDSIMSVAFVPTNNEGNGHNFFSASKDRGIKYWDGDKFQQIQRLDG
                     HFGEIWALAMSRSGEFLISASHDKSIRIWQQTDEPVFLEEEREKELEELYENTLTTSL
                     EDDENGEEKAEAVDAGKQTVVTLMAGERIIEALDLGMEDLETVRQWKAVKAKNPNAAP
                     PQRNPLYMALGNVSAERHLLNVVQKIPAASMQDALLVLPFSKLDSLFTFLEIWASRQW
                     EVPLTCRVLFFMLKTHHRQIVSSKMMRPMLDRIRSTLREVLAKQKDEMGFNIAALQFI
                     GTQVREQGNKSYVDVDTWEEQQVSKTSSGIKRSFVNIA"
     gene            complement(<989749..>990378)
                     /locus_tag="TRUGW13939_00321"
                     /db_xref="GeneID:55987836"
     mRNA            complement(join(<989749..989934,990049..>990378))
                     /locus_tag="TRUGW13939_00321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483531.1"
                     /db_xref="GeneID:55987836"
     CDS             complement(join(989749..989934,990049..990378))
                     /locus_tag="TRUGW13939_00321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339424.1"
                     /db_xref="GeneID:55987836"
                     /translation="MSGKLLTIVLLGLGLVNASPIVKRSVATDITTITSDVQKLDSDV
                     TGWDGSLLTALPLLSDVTTIKDDINTAITDTNSSSAFSSSDSTTVTNEIVALQPIIAT
                     TLNDLVAKASDVSAIGFTSTVQSNLEDLKTLADQLTAALDSKVTSSDASSIETAATAI
                     DSSFASAISAY"
     gene            <992401..>993469
                     /locus_tag="TRUGW13939_00322"
                     /db_xref="GeneID:55987837"
     mRNA            join(<992401..992408,992470..>993469)
                     /locus_tag="TRUGW13939_00322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483532.1"
                     /db_xref="GeneID:55987837"
     CDS             join(992401..992408,992470..993469)
                     /locus_tag="TRUGW13939_00322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339425.1"
                     /db_xref="GeneID:55987837"
                     /translation="MYCPASPPIEYSISKLGDNVYQMGSKFICEKTVGEIPGDAIASW
                     KDCDDTTYYLRKATSKELSSAEKQEFKDVIYQAGTSSSVWSIGTSVICKVKTCCDEME
                     LESITLAFVAGNLPHMPIPKVVFSWRDTEWNRTFLLLKRIKGQTLHSAWPSLSLEHRD
                     KIAATISRYCRDMATLQAPALQSATGLGVLEPFLNVNAENSHPSWKPRLLGPFHRGVF
                     EKYIQRISEQPAPLLGDVFHFYHADLGPTNIIVSGDGEVTGVLDWESAGFYPKYWISL
                     KPYMSAGFSLGSKESRREWVDLFETKLSEVGFELNREDVRWCEQLHMDFFDVNKALLE
                     D"
     gene            complement(<994522..>995181)
                     /locus_tag="TRUGW13939_00323"
                     /db_xref="GeneID:55987838"
     mRNA            complement(<994522..>995181)
                     /locus_tag="TRUGW13939_00323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483533.1"
                     /db_xref="GeneID:55987838"
     CDS             complement(994522..995181)
                     /locus_tag="TRUGW13939_00323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339426.1"
                     /db_xref="GeneID:55987838"
                     /translation="MSASRKNYWLSSFNETADFPPNVRKAMDTLINVMSSEVTAEGKM
                     ISLPNAELDMVEWVIQACQYVEYMRALGSYGRRVYTIFADDYNQPTALVEKPPIAQWL
                     QEAGKELTLMKLLTYLGQVLLECENEIYLREHYYIGQLPKEPIERIRDKVSHVLGMDI
                     LEDFEEQKHRPLKLSKDVLSIVKAFEDAGQKIEDGIPEHQTLEEAEEYANQVIAQYRP
                     E"
     gene            <996326..>996985
                     /locus_tag="TRUGW13939_00324"
                     /db_xref="GeneID:55987839"
     mRNA            <996326..>996985
                     /locus_tag="TRUGW13939_00324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483534.1"
                     /db_xref="GeneID:55987839"
     CDS             996326..996985
                     /locus_tag="TRUGW13939_00324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339427.1"
                     /db_xref="GeneID:55987839"
                     /translation="MNALEIPTAFLPRAIRTLMKNLKRIEASIRQNGERSADDLIEAG
                     KLYEEFLQFVIKHGETTEAYRRSSRPSRIRNKDIEVDENEPPSTTEWLASFASRSEPD
                     NLPSPDEMQDYIRQMIYILDVEVRLREKYNVERLKARPVQHLRDVLDMFISQLNIPSR
                     IKLIGGGPVRMTEAIAGITQIINSLGSNIDELLPLYPDEDAAAADADRMIAEMMAENG
                     E"
     gene            complement(<997571..>998909)
                     /locus_tag="TRUGW13939_00325"
                     /db_xref="GeneID:55987840"
     mRNA            complement(join(<997571..998570,998626..>998909))
                     /locus_tag="TRUGW13939_00325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483535.1"
                     /db_xref="GeneID:55987840"
     CDS             complement(join(997571..998570,998626..998909))
                     /locus_tag="TRUGW13939_00325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339428.1"
                     /db_xref="GeneID:55987840"
                     /translation="MHELDPLVIEYQHDKHRPREAEALLVLRKVASLVKPIMRQRGWK
                     VGTLSEFYPRQRNLLGLNVNAGQKICLRLRYPSDERQFLPLEQVVDTMLHELCHIVHG
                     PHNKDFHALWNQLRDEHEELVIKGYTGEGFLSEGKRLGGRRMPVDEARRVARAAAERR
                     RTLGAGSGQKLGGAPLLKGSDVRRVIADAAQRRIDVTNGCASGSSEGEKLAEEASRNG
                     FRTKAEEDDANERAIMEAYIEMIQEDERSKWGSLYVPPSQRNPAGPRGSVYPNAPPIP
                     EHSKPRRQLISTTRTLSDSEPNNTAKNNDDELDKTQWSCPTCTLNNPSTYLCCDACGS
                     ERPAALLTTQSRLVQNSAPNTAKRRLSKSQHSVSSDSSSSRVLSFKKDTSEKMAAWEN
                     SKSKRPLGWLCHVCGAFMETEWWTCSACGTMKANS"
     gene            complement(<999501..>1001719)
                     /locus_tag="TRUGW13939_00326"
                     /db_xref="GeneID:55987841"
     mRNA            complement(join(<999501..1000509,1000567..1000657,
                     1000714..1001121,1001176..1001405,1001484..1001573,
                     1001655..>1001719))
                     /locus_tag="TRUGW13939_00326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483536.1"
                     /db_xref="GeneID:55987841"
     CDS             complement(join(999501..1000509,1000567..1000657,
                     1000714..1001121,1001176..1001405,1001484..1001573,
                     1001655..1001719))
                     /locus_tag="TRUGW13939_00326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339429.1"
                     /db_xref="GeneID:55987841"
                     /translation="MRETESEKPRHRVQSVSAGNKNAVVNGRVITANQETYLIFVNLS
                     LLEGNPTGKLSGTPKPHAPVITDDVLVRSDEPTLPDDEGFRALGYMPFEENFILSPAS
                     KSDADCDFFTSDTANFLSFIPPKPYADSLVQHFLKEVNYQYYILFPLKFSQDYAAWWT
                     KRTNGQKLDAAFTSLLLRVCACATQSVGGELRKKLEIELGEKTQSLSQRYHEAAQQLS
                     SKIPSGKGSLTLVQQLFLTASWFKIEALFAESWQVLGSAIHKAQELGMHRDAFNKRYS
                     DFECEMRRRVWCILYIWDWQMSASLSRPLIISSGKFELPTGRLENTFGDSQNPPSPIT
                     HMIFQCQLIQDLTKITNIDQDIVPSSQVLIIKQVIDSWFESFPPLYRLSNPDTQWDEE
                     YPYVFSQRLQLHTIGRMIMFQQLKPYLIGKPYESNANSDPTLANSGVDCALALVHISH
                     QFYDLAYPIHSKFHLVIFVMFDTIATLCSAMMYDIDFKLSRREEVIESISSVLDMVKQ
                     TQYSAKTAVVCYRTLSKLVTKLPLPVQEKIPHLSRPLSSFDGDTVTHEISPANTSAGH
                     LSGTTENSLETELKTPPLFDLPELPISDRYFPGFGDLSVMDLGGMDEAFDWGTIGLDF
                     ASGPVS"
     gene            <1001947..>1003513
                     /locus_tag="TRUGW13939_00327"
                     /db_xref="GeneID:55987842"
     mRNA            join(<1001947..1001979,1002047..1002389,1002452..1002615,
                     1002671..>1003513)
                     /locus_tag="TRUGW13939_00327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483537.1"
                     /db_xref="GeneID:55987842"
     CDS             join(1001947..1001979,1002047..1002389,1002452..1002615,
                     1002671..1003513)
                     /locus_tag="TRUGW13939_00327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339430.1"
                     /db_xref="GeneID:55987842"
                     /translation="MTSDDQFFFDFLASIPHDVKRYSADVADAIDRHVDYAATAVKDT
                     LTVYLPSIIKPGTRDVSLLHPPKPLSVPERVYNWVLRNRAWTAALIAFFGTGSVLLLG
                     SRVFDQRKRRARRAGNGARKEIVVIAGSPHEPMTRAIAEDLERRGFIVYVVVQSAEEE
                     HIIQTQNRSDIRALHLDITTTPSTPSEIHPALHGIFSLISHAQSPAPGIQPHTCQLSG
                     LIILPSLNYPTGPLPTIPASSWADTVNTRLLSPILITQMFMPLLTHRNHSSSILFLYP
                     SISSSLSAPYAGPEVAITRALSGFATSLRQELRLLQFANGASCNIDVVEMRLGNLDLG
                     SQYRVSQVTGTEILAWSPQQRALYGQSYMSSIEQRPMAAHGPGAIRGSSARVLYNAVF
                     DSLAPPQKSLFGNKKRRKPVVFVGRGSRSYGIIGQWVPSGIIGFMLGYGNSPSTVSSG
                     ASSETGWERV"
     gene            complement(<1003768..>1004684)
                     /locus_tag="TRUGW13939_00328"
                     /db_xref="GeneID:55987843"
     mRNA            complement(join(<1003768..1004154,1004241..>1004684))
                     /locus_tag="TRUGW13939_00328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483538.1"
                     /db_xref="GeneID:55987843"
     CDS             complement(join(1003768..1004154,1004241..1004684))
                     /locus_tag="TRUGW13939_00328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339431.1"
                     /db_xref="GeneID:55987843"
                     /translation="MRPFLSLFGADPGLDHLHPYETSWILPPYFLGGLRAIIGFYIFV
                     CIVLIFAWDATHDASTAIARSFSYFTWLNFWGMGFYFIVASIHTFVYAATGRSAIFDR
                     LPRVFRGLHALFYTCITTFPFLVVIIFWAILYSGPWYPTWFGAWSNISQHGIIGLYAL
                     LEIFLTTTPLHPLIHAPFLILILLLYLSLAYLTHKTQGFYSYSFLDPGPHGKNSGKVT
                     GYCFAILAIVLVAFALTWLFIWLRRRWTGGRIKRSKRDRELVYTTERGAFRASRGVEK
                     "
     gene            <1005279..>1006095
                     /locus_tag="TRUGW13939_00329"
                     /db_xref="GeneID:55987844"
     mRNA            join(<1005279..1005512,1005577..>1006095)
                     /locus_tag="TRUGW13939_00329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483539.1"
                     /db_xref="GeneID:55987844"
     CDS             join(1005279..1005512,1005577..1006095)
                     /locus_tag="TRUGW13939_00329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339432.1"
                     /db_xref="GeneID:55987844"
                     /translation="MKGSPFKRLRIFERTLLQSNISHEHRDQQQQDRDSCTSTNSSCR
                     DMAIDDVTKASMRHHNTFRTANIVGNNERHEIRKVSLDDLSSFYNEAFALKRVSRLPL
                     LRDHAPKVIKADPLSGILVLGYPRLHWAPLLQRVEASAFGLETLLELKLKLCSYIGVL
                     YRNGVVYRVKQDCVYPVKRASGKWTLYLGGWQDVGFYPQSQWKSAALKELKTEQLDRI
                     ESFFALLCTRATAIAESGAMNGAKDQGKGWSG"
     gene            <1007749..>1010066
                     /locus_tag="TRUGW13939_00330"
                     /db_xref="GeneID:55987845"
     mRNA            join(<1007749..1009853,1009916..>1010066)
                     /locus_tag="TRUGW13939_00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483540.1"
                     /db_xref="GeneID:55987845"
     CDS             join(1007749..1009853,1009916..1010066)
                     /locus_tag="TRUGW13939_00330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339433.1"
                     /db_xref="GeneID:55987845"
                     /translation="MNSRPDYLDFHGDGTRSARASPSPRIEHFDGEIPPALSPLDAFA
                     AQGRLLARQLDESMRRDRRMSRLPPQSVARSLSQPRPGYFRSPGSDSSQRVHRPTESP
                     DLVVNHIFEDPKYRPQSQHPRISGLSILHSETGFDDDFSQPPMPQDDESERVLPATCY
                     EAPRVESPEPVVALQRDYSDSSSNLPTPQSNSHNSPSVSAGSSMDSNHPQISTTLAPP
                     VSPMPQSFYNPKYMQPENSDDDYTSSNTGSTFSKARQFSAGSGISMPYSPMSPHVRSH
                     PRSPSVSSEASNYLPRPSFNFSRPLSRSSTSLSAPSPVMPQEAPTSNQTPSTAHPTSG
                     RQSSTGIHRENKPAPIVLEEGIMASFDEEPPSSAVSSYVYAKYSLPRGRSVMRNSIVF
                     AGLQTPHFEWQEPLFESPPSKTAGDRTPSPGAAPKETPVQAPEAKSKQLKPPSGEAIP
                     TIVDPLDTVPSTPTRQSYEIPRETRPSFELPPNHLQRSRSEHHLDDSKSSSADSASTI
                     RPLTARTTATQATDSEQSTEQSVEEHVDKGIECHEKGALQESTYHLRIAAKQNHPIGM
                     LLYALACRHGWGMRPNQREGVQWLRKAVDSAGLEVGEDDEAVGGKDAAARKARRAQFA
                     LGIYELGVSHLNGWGIEQDKALALRCFEIAARWGDADALAEAGFCYAQGVGCKKDLKK
                     AARYYRQAEAKGMSMVGNSWIYKDKYMADDDDSRQSRQSRSRQGGASEKKPRSKSRTR
                     SIFGRKKSLAA"
     gene            <1012650..>1013891
                     /locus_tag="TRUGW13939_00331"
                     /db_xref="GeneID:55987846"
     mRNA            join(<1012650..1012810,1012890..1013308,1013371..1013495,
                     1013568..>1013891)
                     /locus_tag="TRUGW13939_00331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483541.1"
                     /db_xref="GeneID:55987846"
     CDS             join(1012650..1012810,1012890..1013308,1013371..1013495,
                     1013568..1013891)
                     /locus_tag="TRUGW13939_00331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339434.1"
                     /db_xref="GeneID:55987846"
                     /translation="MADVKAESVYPEVVSQDAPAKRGFVAGTIAHFKKWWWVHLIVLI
                     CVVLIIIFPIIYVAYPKIAQTDVNNATLNVTSLVFSDPTPDTIHVNQTQVLGNKAIYH
                     PKIYSFNASLGLAGSPVPVSYATVPETASNDGQVIIVDATLQLHNIEATTNFTKAVLA
                     SETWELGVYGRPQLKEMVLPKSTVTFNKTVEMKGLNGLEGFALSNVTISAAPGADGTN
                     MNGTVSIPNPSVVTVPMGNITMDISVNGTAVGQTFLNNLNLIPGANIYPVKSLINNTL
                     MLSFIGKSGPYPSGVVPLDISGNKSVYNGQEISYFSDALRSTSLRATLNVTQVLIDSG
                     LGLLLGAL"
     gene            complement(<1014621..>1015975)
                     /locus_tag="TRUGW13939_00332"
                     /db_xref="GeneID:55987847"
     mRNA            complement(join(<1014621..1015294,1015347..1015581,
                     1015648..1015672,1015737..>1015975))
                     /locus_tag="TRUGW13939_00332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483542.1"
                     /db_xref="GeneID:55987847"
     CDS             complement(join(1014621..1015294,1015347..1015581,
                     1015648..1015672,1015737..1015975))
                     /locus_tag="TRUGW13939_00332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339435.1"
                     /db_xref="GeneID:55987847"
                     /translation="MYSFMTPSFAGPDVWPSLPHPAPPVAGASSLTASAFAPTPLEIP
                     IFANAAYYPNWRIYKKQPPSTLRLGFVSHVFYAFAWVKEDGQVYLSDEWADSQMPVDG
                     TEGCLRAFTQLKRQYPQMKVILSVGGGGKGSENFAKVARSPPAVEKFASSARALVDQF
                     DLDGIDVDWEHPSTTQQGVDYIYLLAQLRTVLPAPRYVLTSALPAGEWALKHINLAVA
                     QQYVDLFMVMCYDFSGPWVDRSGHQAQLYTPAQPHSDAASISCQSAVTYFLAQGVHAK
                     KILMGIPAYGRSFVGAQDLNQPYLESGGEDGAFDYSELPRPGAREIVDKTVGATYCVG
                     GDDGGFVSYDNTRTVEQKAKFVTNLGLGGLFYWHIAADKRGGDSLLETGYNTLHEL"
     gene            <1017425..>1018189
                     /locus_tag="TRUGW13939_00333"
                     /db_xref="GeneID:55987848"
     mRNA            <1017425..>1018189
                     /locus_tag="TRUGW13939_00333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483543.1"
                     /db_xref="GeneID:55987848"
     CDS             1017425..1018189
                     /locus_tag="TRUGW13939_00333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339436.1"
                     /db_xref="GeneID:55987848"
                     /translation="MAAEVQSVADRLITGDRTHPPDYDFSFTPFLRRNFGFGLATDIP
                     VCKAFKEGHCPLGPTCPDRHPTPSRVTTSTTNASGLAPSVTHGSLVCKHFLKGLCKKG
                     FKCEYLHEYNLRRMPECQSFSRSGYCPNGEDCLYHHVRETARLPRCEHYDRGFCPLGP
                     ICAKRHVRQRLCPYYVVGFCPDGRACEHGAHPRWSDNLPRPQIRVEKTEEDLERERLL
                     IREEQEKEEERQREWRNERGRGGFMRYRGRGRGRGM"
     gene            <1018765..>1019562
                     /locus_tag="TRUGW13939_00334"
                     /db_xref="GeneID:55987849"
     mRNA            join(<1018765..1018788,1018849..1018934,1019005..1019398,
                     1019458..>1019562)
                     /locus_tag="TRUGW13939_00334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483544.1"
                     /db_xref="GeneID:55987849"
     CDS             join(1018765..1018788,1018849..1018934,1019005..1019398,
                     1019458..1019562)
                     /locus_tag="TRUGW13939_00334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339437.1"
                     /db_xref="GeneID:55987849"
                     /translation="MAKIAIVFYSMYGHIVKLAEAEKKGIEAAGGKVDVYQIAETLPQ
                     EALSKMHAPPKTDYPIADPSTLLEYDAVLFGIPTRYGNFPAQWKAFWDHTGGIWASGG
                     YWGKYAGVFISTASPGGGQESTALSSMSTLAHHGFNYVPLGYKHTFAQLTNLDEVHGG
                     SPWGAGTFAAADGSRQPSALELEIAEIQGKTFYERVSKVSFA"
     gene            <1020129..>1022321
                     /locus_tag="TRUGW13939_00335"
                     /db_xref="GeneID:55987850"
     mRNA            join(<1020129..1020230,1020304..1020434,1020509..1021991,
                     1022055..>1022321)
                     /locus_tag="TRUGW13939_00335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483545.1"
                     /db_xref="GeneID:55987850"
     CDS             join(1020129..1020230,1020304..1020434,1020509..1021991,
                     1022055..1022321)
                     /locus_tag="TRUGW13939_00335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339438.1"
                     /db_xref="GeneID:55987850"
                     /translation="MASPRPIVLRFESRNGQFRVTVPPSMLFPDLRDKILEHLPPSTD
                     PTSIILSNKPIGVGGQERPLASLDGVAIERVGLSHGDKLFLGYQEKASLSNGDSHPQQ
                     AAPSQKPVTESRRLNGAAVPQQTTVALPPHPTSPSAILKNPWEVVEQSPLDDFLDKKD
                     GKIPRPRDTKMCRHGPKGMCDYCMPLEPYAPEYLADKKIKHLSFHSYLRKINSSKNKP
                     ELKSSYMPPLSEPYYRVRRDCPSGHPPWPEGICTKCQPSAITLKPQEFRMVDHVEFSS
                     PSLINGLLDFWRKSGSQRLGYLYGTYEEYTEVPLGIKAVVQAIYEPPQVDEVDGISLN
                     EWETEKEVDEVARLCGLQKVGVIVTDLLDAGKGDGSVVCKRHADSYWLSSLEIAFASR
                     YQARYPKATKWSETGSFGSNFVTCVLSGDENGAIAVSAYQASNSAVEMVRADIVEPSA
                     DPTVMLVQSEDDNDSGSELRYIPEVFYRKINEYGANVQENAKPSFPVEYLLVTLTHGF
                     PTDEAPLFIDSTFPIENREVIGESQELRVVARKLVTHDDTKKAIRAVSDFHLLAFLHS
                     LGTFSKDEEELLARVATTHDPSDGLQLVNTSGWATLVAILQESGERPPKRPLPMARDT
                     PVASFAQRHGHLQSRSVSPKSDSERLAKRFKGTSLE"
     gene            complement(<1022832..>1025739)
                     /locus_tag="TRUGW13939_00336"
                     /db_xref="GeneID:55987851"
     mRNA            complement(join(<1022832..1024259,1024329..1024509,
                     1024827..1024917,1024974..1025411,1025493..>1025739))
                     /locus_tag="TRUGW13939_00336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483546.1"
                     /db_xref="GeneID:55987851"
     CDS             complement(join(1022832..1024259,1024329..1024509,
                     1024827..1024917,1024974..1025411,1025493..1025739))
                     /locus_tag="TRUGW13939_00336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339439.1"
                     /db_xref="GeneID:55987851"
                     /translation="MRSAGLFLLFGTVMAIPDSHSGPKALIYRGPAACDGCPESVAAL
                     LQSSASKFAIEYAGPNEKIDINADSLSKVDLFVQPGGGDLEPGWKHTKKYKKAIREYV
                     AQGGRYAGFCLGAYLAGPHLGYDLLPPGSSIADEMDQPGAQVKNTTDTVIQVDWNFQT
                     GTKKGQKQDGRWLYFQDGAVVKLSESAKADALVLGRFSSNGDIAASVTSFEKGWVGLV
                     GPHPEADESWYQLVNVTNPDGVNFDIGHDFVESIMAQRKDHMVSVWGSRAPNNQSRAE
                     EGDRRSDEQEDSSVARESREADEHTRLLPRSNGDGYLSPDDPAVSPYNLWNVRALRFF
                     STLFLAISFVWWVLLFVSIFVSPPGMHNRGSGFTDFSYTTLTVGNLIIGLLFFALPSQ
                     PMLIWNGVLAVLLVSDMILVLAVPRLRLEEGWVGIASVVWAAFIALYNMAQVYSVEKG
                     KEQEEERLTGRVETRRTLLQWLAVLAETVVLGIIALVAILLTATLILRARDASLQAPG
                     RKYLVNNEKYEVHLACIGNETTTTSINEKKPPTILVEAGERPSEHSLQPFIHNAYANG
                     TIPRYCYWDRPGIAWSDNAPSPHSAGMSADVLSEVLALAGEEGPWIIVTAGIGSIYSR
                     IFASRHMHDVTGLLLIDPTHEDRLHGDIGNPGHGFALWGRGIISPLGLDRLAGVIFKG
                     RTREDRTYGQVAYQGGRFIKAKLQENLVAASITASEIASAKNIQTPETPLVVVSSGVE
                     VGRSESWAKQQQSLTGITDHLVSWDIVKGAPHEVWQTFEGRTVLEKRLKKLVKQ"
     gene            complement(<1026525..>1026989)
                     /locus_tag="TRUGW13939_00337"
                     /db_xref="GeneID:55987852"
     mRNA            complement(<1026525..>1026989)
                     /locus_tag="TRUGW13939_00337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483547.1"
                     /db_xref="GeneID:55987852"
     CDS             complement(1026525..1026989)
                     /locus_tag="TRUGW13939_00337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339440.1"
                     /db_xref="GeneID:55987852"
                     /translation="MKFTSAVAVSAIALASQVAASPMQKRDIPSSFYSNMPITGSIFS
                     FSDDASCNEIFYQSGSCGFSTYFTSQFPSSAGQEFIALSAADMDQFGAAQNDELCGKT
                     IDITGPNGVTKQAVVADRAGADIIDMCAGLWEAFGSVNGDGTNIQVQWKVSQ"
     gene            complement(<1028589..>1029281)
                     /locus_tag="TRUGW13939_00338"
                     /db_xref="GeneID:55987853"
     mRNA            complement(join(<1028589..1029113,1029177..>1029281))
                     /locus_tag="TRUGW13939_00338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483548.1"
                     /db_xref="GeneID:55987853"
     CDS             complement(join(1028589..1029113,1029177..1029281))
                     /locus_tag="TRUGW13939_00338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339441.1"
                     /db_xref="GeneID:55987853"
                     /translation="MKSPSTNMNSEKSVNVEDHDAVLSSAKMHLQILLAQLGYLKATD
                     TAINDPELQRLLPLLSENSSKNVPQGQSVQAPKKSNTPKIEVLHTPQTFIANREYVGK
                     NHDFLLAEPGDRVVVHAWVDGKDAVGFNERNFSAGRISSNFLGDKVPNSKDKFESFIA
                     DEPNCPIRWSGGRLDIKSGDRIRICMWNSKKNGVGVNLATGKIGDFTLV"
     gene            complement(<1031337..>1033370)
                     /locus_tag="TRUGW13939_00339"
                     /db_xref="GeneID:55987854"
     mRNA            complement(join(<1031337..1031438,1031497..1032063,
                     1032113..1032381,1032439..1032921,1032981..1033208,
                     1033277..>1033370))
                     /locus_tag="TRUGW13939_00339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483549.1"
                     /db_xref="GeneID:55987854"
     CDS             complement(join(1031337..1031438,1031497..1032063,
                     1032113..1032381,1032439..1032921,1032981..1033208,
                     1033277..1033370))
                     /locus_tag="TRUGW13939_00339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339442.1"
                     /db_xref="GeneID:55987854"
                     /translation="MAESIAAGKYIFERVAQLGIRHVFGVPGDFNLFLLDELLKVPQL
                     TWQGTCNELNAAYAADGFARVRDLPGCLVTTYGVGELSAMNGVAGAYAEHTGMIHIVG
                     MTSRPQQNAKIMIHHTFKANQDHLIYTQMGQPINKTQAILLDDATMAEEIDRVIIEAV
                     KTRLPVTIYVPMDSVSVLLDAKRLQVPLDLEIKNSPQVEDKVVARVLEEIEKASNPAI
                     LADVLAIRHNAQAETRRLAELTRFPSYSTPLSKGIIHEDSEYYNGLYNGQVSFPETQA
                     AIEASDLVLNIGPLLSDSNTGGFTRNLLDENLVMLGHDHCAVKQERFEGVHFLPVLKR
                     IVQELETKASQYKLPRPQKGPRIEAPLLNDSKSGPITQSYIWQRIGRFTRPGDVVLAE
                     AGTAQYGVPDAVFSKDVSFITQIYWSSIGFTVGACLGALTAAREIEGAQKKRVLLLVG
                     EGSLQMTVQEIGTYIRYGYTPLIFVINNNGYSIERAIHGPNQLYNDVSMLWDHQKMLE
                     FFGAREETGKKSRSFTCKTVEDMEKVLSDQEFIEANHIQLCEVFMDQFDYPWRLSGQL
                     DVARKRAAAAAQAK"
     gene            complement(<1034382..>1037227)
                     /locus_tag="TRUGW13939_00340"
                     /db_xref="GeneID:55987855"
     mRNA            complement(join(<1034382..1035444,1035531..1035701,
                     1035758..1036374,1036433..1036506,1036562..1036743,
                     1036890..1037024,1037082..>1037227))
                     /locus_tag="TRUGW13939_00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483550.1"
                     /db_xref="GeneID:55987855"
     CDS             complement(join(1034382..1035444,1035531..1035701,
                     1035758..1036374,1036433..1036506,1036562..1036743,
                     1036890..1037024,1037082..1037227))
                     /locus_tag="TRUGW13939_00340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339443.1"
                     /db_xref="GeneID:55987855"
                     /translation="MNSDPPINPENCSPESAPLNNNGATLLERPRKNKPRRVLAEERK
                     RAARACDRCRKLKEKCEGGVPCRRCLYYSNTCEFNRAGPQEQDDSPRAIRCPDLSLDT
                     ESLQQTYEVLRKNEATLVDPREPELEEDDDDDDLISLNEEVCTIDPVQENVTHYSGEF
                     SYWNFSMRLKRYIDERMFQPSQGSEEISGYWRAEKVQSGLSNLSAIISCFPPRHIADF
                     LTDIFFKYAQTNYFLVNQSWSRGKLNIFYLEPEKLSTKDAPAISIVLTIFAIGTQYVY
                     LDSTRRNHRPKGSLTFSEDEVGKAFYQQAIKLLPEIIELSSLESVQACLLFGVYTLPL
                     DASGLGYVYLNLAIRLAMQNGMHRRYTGNVLSATMIETRNRVWWSAYTLDRKINIFHG
                     RPLSLSRSDVETNLPTVSENHGENLSFSNTVHMVTSIRLVHYLEELLQHMTLLRTSTK
                     QKIPSTLSHLIDTKRALATWWQSLPKAIIRPDISHGFSSWRAAMYVRLEYCLVRLFVG
                     RPFLLHGSCSQPHSEASPESEEMNCTDGPLEPRKKPTSRRLELVNDCVSAAQEALDIC
                     RSLRENTPGLARASYIEYSSCRASLLVLIACSIQDETCQFYDLLQDGLDMICEMSAAG
                     DSARSEVSLIESLERALSHLQPVDLQTSNHNTAAASHRRYDSFKTWESMWQMNNNSNN
                     NTTTSCESHYNMVDSGPAAFRPPGQSLTPAHFPSHLDQSLPTSSIYADNENNLPDSQV
                     PIPNHSEIETVDPFSSMYSGIDLDLFSERHINPATSGSLHPESQLLEDLLRDSGF"
     gene            complement(<1037678..>1039146)
                     /locus_tag="TRUGW13939_00341"
                     /db_xref="GeneID:55987856"
     mRNA            complement(join(<1037678..1038529,1038592..>1039146))
                     /locus_tag="TRUGW13939_00341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483551.1"
                     /db_xref="GeneID:55987856"
     CDS             complement(join(1037678..1038529,1038592..1039146))
                     /locus_tag="TRUGW13939_00341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339444.1"
                     /db_xref="GeneID:55987856"
                     /translation="MTATNGVSKAPGCIPAPNPGQTFWQQDGNIEFSDYRSTETLPEQ
                     TDILIIGAGYAGTSTAYHLLAEGTKNSITILEARGVCSGATGRNGGHLRPDLYGHIPT
                     YIERAGLEAAVEIAEFEIAHVPAMKKFIREQGIDCDFNLCRSIDVWCNEQSAQNAKTV
                     YGQMVAHGLSYMEDVVFYTGKEAEGISGVKGAKACASYTAASMSPYKFIIHLTKLILA
                     SEQVNLQTHTPAVSILPDPSGGYTVDTSRGKIHADTIIHANNAYVSGLLPEYEKNIIP
                     CKGIACHIAVPDGTKAPLLNNSYINRTEDNTLSYLIGRNDGGIVVGGAAAKFKPFKYQ
                     WYNNVDDSILIDAAKDYYNDYMQRTYHGWDNSGAAVRQIWSGVMGYSYDSHPHIGSVP
                     NKPGQYINAGFNGHGMPVIWLSAKGLAKMIAHGAPFEKCGIPRLFQTSQLRIDRAQNG
                     TEGKGDILGTASFGATKQ"
     gene            <1039664..>1041331
                     /locus_tag="TRUGW13939_00342"
                     /db_xref="GeneID:55987857"
     mRNA            <1039664..>1041331
                     /locus_tag="TRUGW13939_00342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483552.1"
                     /db_xref="GeneID:55987857"
     CDS             1039664..1041331
                     /locus_tag="TRUGW13939_00342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339445.1"
                     /db_xref="GeneID:55987857"
                     /translation="MNALSSHDSHHPTEMVSQDRKDEEKAMSTEVPGGSDAIANGYYE
                     ERQAFKQGLRERHIQMIALAGTIGTGLFLSSGRAVAHSGPLGAFLGYTIIGLSVSSIM
                     FVVGELGALVPLNGGIVRYSEYFFDPALSFANGWNLVYSYLVSIPAEITAAAVLIEFW
                     VTINNAVWITIFGILMVATAIFLVRVYGELEFAFSMLKIMLVIGINIMALVITCGGGP
                     DHRTIGFQYWRNPGPFVQYLGISGSLGRFLGLWSTMNNAIYSYSGIEVITTAAAETRN
                     PRRAIPQAARRIFIRVLLFYILTIFMIGLVVPSNDPDLVHSTGTASQSPFVIAATRAG
                     IKVVPSIINAVILTSAWSSGNSNMLSGSRILYGMAVHGHAPAVFRRLNRFGVPYAAVA
                     LFGLFICLGYMTVSSTASTVFTWLQDLVSISTLINWMSICIVYLRFYYGCKKQSIDRH
                     RDLPFAAPWQPYTTWATLILFTVLLITGGYSTFIHGEWSDETFVSSYINIPIILLLYF
                     GYKLWNKSKIIPLDELPIKAFIEIYQRNPEPAPKPKRGLHKLNILWA"
     gene            <1041658..>1042377
                     /locus_tag="TRUGW13939_00343"
                     /db_xref="GeneID:55987858"
     mRNA            <1041658..>1042377
                     /locus_tag="TRUGW13939_00343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483553.1"
                     /db_xref="GeneID:55987858"
     CDS             1041658..1042377
                     /locus_tag="TRUGW13939_00343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339446.1"
                     /db_xref="GeneID:55987858"
                     /translation="MPKHVVFDVVGTCVSFDAYFARIENVIGTKLHQHAITARHFGYT
                     WMEAAELEFTFLSISERYKPYKEVMKAVFYRTLWMAGIDDPRSFATDSERDQCIAGYS
                     ELKLRDGAKECLEKLRAAGFTVWCFTTGDIARVRGYFEKAGLDMPLANFVSCDDQKIA
                     KPALAAYRSVLNKFSADDEKWFAAAHMWDVSAAKSVGFKGAYCTVYEKEPCLEIFDTE
                     IDVMADGLVTMAEGICQASIA"
     gene            complement(<1046431..>1047234)
                     /locus_tag="TRUGW13939_00345"
                     /db_xref="GeneID:55987859"
     mRNA            complement(<1046431..>1047234)
                     /locus_tag="TRUGW13939_00345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483554.1"
                     /db_xref="GeneID:55987859"
     CDS             complement(1046431..1047234)
                     /locus_tag="TRUGW13939_00345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339447.1"
                     /db_xref="GeneID:55987859"
                     /translation="MATDRADVILPRVSGSSNSRPINILLVNPNSSEYMTKDCLTALG
                     PSLPPDVIVHGFTAPYPAPTAIESQTDAVLSTEACIRAIKPIADNYDAFLVACFRAHP
                     LIGVLKEEFTQPVLGIMEAGMYAARMLGGNMGIICTSERSAAAHGRTVSEYGFSDYFA
                     GCEAAKLGVLELDSEPRAEVQAIITQKINRLVHEKGADCVLLGCAGMAEMRAICAAST
                     EGSGARVLDGVGLGVQFLVGLVREGLKTSKNGIFRDSSVDRVKRLQDWL"
     gene            <1047601..>1049495
                     /locus_tag="TRUGW13939_00346"
                     /db_xref="GeneID:55987860"
     mRNA            join(<1047601..1048617,1049200..1049352,1049421..>1049495)
                     /locus_tag="TRUGW13939_00346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483555.1"
                     /db_xref="GeneID:55987860"
     CDS             join(1047601..1048617,1049200..1049352,1049421..1049495)
                     /locus_tag="TRUGW13939_00346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339448.1"
                     /db_xref="GeneID:55987860"
                     /translation="MGEKADILFIESPVQAVDTARREALAKRFNLLYYDCDSTTDFIE
                     RLKPGGQYSGVVAIVRNGWHKVGKLASQHLFAPEVVPHFPGCLRIICCSGHGYDASDV
                     KGISARGIWFCNTPGACTEAVANTAWFLVLDTFRYLSYSHWCARYDWNASRELGLIAS
                     DPCGQSLGIVGLGDIGLAIAQKCESAWGMKIHYQGPRQNICAERVLQNGAIYHCRISD
                     MIPELDCIVLAAPYSDETHHLLSTKEFALAKKTGLRVVNIARGKMIDEEALIEALDQG
                     KVVGAGLDVHEIEPGVNSKLKDNWKVTLLPHIGVCSSTSWQNFEKINLDNLEAFLTTG
                     RPINYKQALKNLIAVIEAAGSSIQHVIKVNVYLTSMDDFGQMNAAYEEIFNTDPRPAR
                     TCVAVNAFPAKTDVEIDLIAAL"
     gene            <1049982..>1051203
                     /locus_tag="TRUGW13939_00347"
                     /db_xref="GeneID:55987861"
     mRNA            join(<1049982..1049985,1050047..1050497,1050549..1050717,
                     1050767..1051040,1051100..>1051203)
                     /locus_tag="TRUGW13939_00347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483556.1"
                     /db_xref="GeneID:55987861"
     CDS             join(1049982..1049985,1050047..1050497,1050549..1050717,
                     1050767..1051040,1051100..1051203)
                     /locus_tag="TRUGW13939_00347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339449.1"
                     /db_xref="GeneID:55987861"
                     /translation="MSSYVVVGAGVVGLTTALELKDRYPSANVTIAAKYLPGDSFSDY
                     TSNWGGANWFPASADNGRQEKWDSITYKKFKQLSRVRPDSGVKTMNIRFHYDRPIDEV
                     GIITPATGKIWFEDLVGGLKPIEKDELPDGAAFGFEMASFVLDVQRYLPWLQMEAHSR
                     GVEIHRKIFTDIREVFNLYPEASAVFNCTGLGSLTLGGVEDKMLYPARGQILLVEGPK
                     EPIPTMYFRSPHRDADATHIFPRGKDGMGGVILGGCREKNNWNGEVDLEFAEVIKRKC
                     CALVPQLGKPENLKVIKHGVGLRPSRKGGARVEREYIDGKLVIHNYGAGGTGFQSSW"
     gene            complement(<1051875..>1053505)
                     /locus_tag="TRUGW13939_00348"
                     /db_xref="GeneID:55987862"
     mRNA            complement(join(<1051875..1053365,1053470..>1053505))
                     /locus_tag="TRUGW13939_00348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483557.1"
                     /db_xref="GeneID:55987862"
     CDS             complement(join(1051875..1053365,1053470..1053505))
                     /locus_tag="TRUGW13939_00348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339450.1"
                     /db_xref="GeneID:55987862"
                     /translation="MGLDTIVRNGLIVTESGVLPAGQEIGISNGKISLIGFGLPEGPE
                     TKIIDAQGAYITPGGVDSHVHLAQRNAPTGDTWETGTRSAVAGGTTTVLAFASQTKEM
                     TSLFPVLEEYHEKSRGQSYCDYGFHFILTNPSETILWQELPRIAKEEGITSVKLYMTY
                     ELYKLSDRQLLDTMLACRSLGLTTMIHAENSDMINFLIQGLERNENTAPFFHAISAPK
                     IAEDEASYRAIRLAELVDAPVLLVHVSSDGAMKHIREAQTRLLPIHAETCPHYLFLLS
                     DKLANHEHDAFHGAKGVCSPPLRHNPEDLEALWRGISNDTFTIFSSDHAPTKYDHPQG
                     KKAGIIDGIPKFSKIPKGIPGIETRLSLLFSETEGCLPKERARLSLARFVQLTSGNPA
                     RLYGLTRKGSIMPGFDADLVVWHPHNQGEKTIAQEKLHHGVDYTPFEGMRVRNWPRLT
                     MLRGEIVWDADKDSVTGVKGFGNFLKRENGRLLVGKLGQLPAGMIEGERDLWRPRPVA
                     "
     gene            complement(<1054294..>1055376)
                     /locus_tag="TRUGW13939_00349"
                     /db_xref="GeneID:55987863"
     mRNA            complement(<1054294..>1055376)
                     /locus_tag="TRUGW13939_00349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483558.1"
                     /db_xref="GeneID:55987863"
     CDS             complement(1054294..1055376)
                     /locus_tag="TRUGW13939_00349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339451.1"
                     /db_xref="GeneID:55987863"
                     /translation="MSSTTSASRLVTVAACQLGPVHLADSRRDVLKRMLSLLEQAAQQ
                     GAKLAVFPELAFTTFFPRYLFEGIDLDQYFDVEDPSKGGIEQSPNVKPLFDRASALGI
                     DVYVGYAERSIQKDGTHIDYNSSVYYSADANKIVGKYRKVHLPGTVEPRTEPGAVQQL
                     EKRYFRPGDLGFPAFRAPGLVEGALKKSTDLDNVTQSTGKGDPIIGMLICNDRRWAEA
                     WRVYGLQGMEILCCGYNTTAFPTTAAGHQLDLTPEAAEEMVMLHHKLSCQGNSYMNAC
                     FSINVAKTGAEDGNPLVGGTIIVHPLGHIIKEAQTKEDELVLATIDLADCHRPKSTVF
                     AFEKHRRPEHYHPILDRTGVIEPDLL"
     gene            <1055833..>1058129
                     /locus_tag="TRUGW13939_00350"
                     /db_xref="GeneID:55987864"
     mRNA            join(<1055833..1055998,1056052..1056151,1056228..1056313,
                     1056375..1056662,1056721..1056840,1056902..1057256,
                     1057337..1057777,1058006..>1058129)
                     /locus_tag="TRUGW13939_00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483559.1"
                     /db_xref="GeneID:55987864"
     CDS             join(1055833..1055998,1056052..1056151,1056228..1056313,
                     1056375..1056662,1056721..1056840,1056902..1057256,
                     1057337..1057777,1058006..1058129)
                     /locus_tag="TRUGW13939_00350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339452.1"
                     /db_xref="GeneID:55987864"
                     /translation="MGLRNRLQVNQGDSSLAHSNKDLEPIPRDSPKRTWTWPSLLGFW
                     IAEAFSISMYQVTSTAVTKGLSPPMALGAMVVGHVLVCIPAMLNAYVGAIHGINFPIF
                     TRVSFGMRGSYFAVFVRGIVAVIWFGTQSYQAGQCISVMIQAIWPSFKNLPNHLPQNS
                     PVTSSELLCFFLAIIAQLPLLYLNVSTLRYFFLVKTMVMPVFGVVLFSWAVASAHGFG
                     PVFSKPSHIKDGTPVAVVFLQCLTSAIGPKATLALNMPDLTRYARKPREVFWTQAVGL
                     IILVSLCGLLGATVSSASEVIYGEVTWNPLQVALLWNNRAAQFFAAFCWAFAAIGTNI
                     SANSISFSNDIALWFPKYIDTRRGAFICAFLSILSMPCAASFSSFLGGYSLFLGAIAG
                     VIIVDFWICRRRSLRIGSLYEMHGTHYFTAGFNLRAFLAFICGIVPNMPGLAAVCGQA
                     GIPKGATYLYSLSWLVSILVSGSVYWVLFQIKPFKVDEEEEKFAIDGVEAETVMNEES
                     SHVILKDESKMVHEISGAGIASHAYDPEKDTGGSPLERLLKDGGIGGRSAW"
     gene            complement(<1060570..>1063716)
                     /locus_tag="TRUGW13939_00352"
                     /db_xref="GeneID:55987865"
     mRNA            complement(join(<1060570..1061632,1061688..1062502,
                     1062556..1062599,1062653..1062791,1063528..>1063716))
                     /locus_tag="TRUGW13939_00352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483560.1"
                     /db_xref="GeneID:55987865"
     CDS             complement(join(1060570..1061632,1061688..1062502,
                     1062556..1062599,1062653..1062791,1063528..1063716))
                     /locus_tag="TRUGW13939_00352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339453.1"
                     /db_xref="GeneID:55987865"
                     /translation="MSAPGGGAPSPAQRSGSIGPNASMPPMSQQPMNANAPVVHTPTT
                     PGPSGPPPAPVSQQNLNQIVIDYLAKKGYTRTEAMLRMESASQEIDGRSLPQSNENQR
                     PKYQAGFDLLKVWIEDNLDLYKPELRRVLWPLFVYSFLDLATALYPQEAQQYFEANKN
                     LFLPEHAEDIRSLQKITLPEHVQDNSTAKLYRGNKYRLILSNPAFSNLMQFLENKQKE
                     GGSVMSAIMSSYCNVITKDRAADDRFSFAAMLGRSSESHTFPAEDEGIPGHHPGSAYT
                     GDNPAMTGTLPRLRLGKFPPEAELESDVRAELEDHDSKNPPAPGQNSLIQEYDDMIKK
                     EEDEEAPTHADVPFPPSTARDVAMEVQRVKENRDRFRIEGRSGGVGVACSVCMFTFHN
                     THDRMICLDFSDDNMLVAAGFEDSYIRVWSLDGQAIRPSHEGIEEFTSPPSNSKRLFG
                     HSGPIYSVKFAPSAPRSEGEIAPTNARWLLSSSADKTIRLWSLDLWQCMVIYKGHDQP
                     VWDLSWGPFGYYFVSGGHDKTARLWATDRIRQQRIFAGHDQDVDCVCFHPNSAYVFTG
                     SSDRTVRMWAVTTGNAVRMFTGHTGNITALACSRSGKYLASADDQGSIFLWELASGRF
                     VKRMRGHGKGGIWSLDWSVESTVLVSSGADNTVRVWDIAPPASEPTSNQTRLAADTGS
                     GTKIDANAGGSSTQASTSVGPGSSKKKGKENVVTPDQISAFPTKKSPVYKVKFTNMNL
                     IVAGGAYLP"
     gene            <1064101..>1064727
                     /locus_tag="TRUGW13939_00353"
                     /db_xref="GeneID:55987866"
     mRNA            join(<1064101..1064178,1064257..>1064727)
                     /locus_tag="TRUGW13939_00353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483561.1"
                     /db_xref="GeneID:55987866"
     CDS             join(1064101..1064178,1064257..1064727)
                     /locus_tag="TRUGW13939_00353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339454.1"
                     /db_xref="GeneID:55987866"
                     /translation="MDEPSDTTSQTFSSADRIRQLNDIDKDIATLVNSAGLAIKVLAN
                     DKSENNSVEERKAAFKSATSQYFALLSSIDVRLRRQVYALEEAGILDAEAVSANTGSF
                     RGDAAGGAGAGPNAAGAAAAAAGGGAGAGQFSPLEISWLNSRKDTVGKDKEAESWAAA
                     RELVKRLQTESGQANVDKMDTD"
     gene            complement(<1065041..>1066180)
                     /locus_tag="TRUGW13939_00354"
                     /db_xref="GeneID:55987867"
     mRNA            complement(join(<1065041..1065117,1065175..1065222,
                     1065277..1065546,1065610..1065989,1066152..>1066180))
                     /locus_tag="TRUGW13939_00354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483562.1"
                     /db_xref="GeneID:55987867"
     CDS             complement(join(1065041..1065117,1065175..1065222,
                     1065277..1065546,1065610..1065989,1066152..1066180))
                     /locus_tag="TRUGW13939_00354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339455.1"
                     /db_xref="GeneID:55987867"
                     /translation="MADTQFDSALDLLRRLSPRDTGRSLQSITTLVPDLTEDLLSSID
                     QPLEVRRCSKSNRDYLLCDYNRDGDSYRSPWSNEFDPPLEDGTVPSERVRKLEVAANE
                     AFDVYRDLYYEGGIGSVYFWDLDDGFAGVVLLKKGVTPGGKSSGAWDSIHVFEATDRA
                     RMSHYRLTSTVILHLANQTDALGEMDLSGNMTRQIETDLPVESDASHIANVGRLVEDM
                     ELKMRNLLQEVYFGKAKDVVGDLRSLASLSETNQDRAAHREMINSMGKR"
     gene            complement(<1066427..>1069750)
                     /locus_tag="TRUGW13939_00355"
                     /db_xref="GeneID:55987868"
     mRNA            complement(<1066427..>1069750)
                     /locus_tag="TRUGW13939_00355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483563.1"
                     /db_xref="GeneID:55987868"
     CDS             complement(1066427..1069750)
                     /locus_tag="TRUGW13939_00355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339456.1"
                     /db_xref="GeneID:55987868"
                     /translation="MSDTYSDFDDDDFVVASTQSEVVDSQASVADSPRPSKRRRLRNG
                     SAASTAHGKAAAGLGGDEFEDPDDDMDSDGSPSLPSPQRYSEDDESDDGYQSKYKIFV
                     PKKPSLQEDTFVTQLTQPHSSPSRIRGPRWKKPEPQIQQTMAPETSGGPVRHEPGNDE
                     NDVDLLAALAASLESFEEERPRKFNTSTVSANATTTTRPVVSQPDDIGFDIGDIPDDA
                     FDSSPCLSPQKVSMAPPPTTTNRPLQTQRTNLRQTTLFQAATRDPSQAVRSWSPPDRD
                     EPPTHHKLDTEAMQTWVYPTNLGRIRDYQFNITQKGLFHNLLVALPTGLGKTFIAATI
                     MLNWFRWTKTAQIVFVAPTKPLVTQQVSACLGIAGIPRSETTLLTGNVPPGIRAEEWQ
                     TKRIFFMTPQTLTNDLKTGIADPKRIVLLVVDEAHRATGGYAYVEVVKFLRRFNSSFR
                     VLALTATPGSTVEAVQTVVDGLEIARVEIRTEQSLDIREYVHARNVDVQTFTNTEEML
                     LCMDLLSKALQSSVDQLRSLNAYWGRDPMTLTAFGLTKARQQWMASDVGRNAHFGLKG
                     KVNSLFTVLASVAHAIDLLKYHGIVPFYRHLVSFRSNTEGKKGGKYQRAIVEEDHFKK
                     LMNHIDPWSKNPEFIGHPKLEYLREIVLNHFMDAGEGTDQISNTRIMIFAHFRDSAEE
                     ITRVLKRHEPIIRPHVFVGQASAKGSEGMDQKKQLSVIEKFKSGTYNTIVATSIGEEG
                     LDIGEVDLIVCYDSSASPIRMLQRMGRTGRKRAGNIVLLLMQGKEEESYIKAKDNYEK
                     MQELIASGTRFDFHEEKSARILPKDVKPDVDKREVDIPPENSQQELPEPKKKKGRAPK
                     RPPKKFHMPDDVETGFTKASRIGEGSGNADIRTMVKKKPKKRAPTPPPPKPAEIPRAE
                     EVLLTPQQESELEFRYRNVGGTTPQFIRGPRKDAFPQLQRTLRPTKLIAHGSLTRRMV
                     NAFQKMDATQPSCELHYDSVLDEIRKRASKLPARQVYKPAKKALLPTSSNSTRIPPSP
                     DRKTDRSSPLMCSPYAAPDANDRPFYVSQISDVEDMDYDLPDIETLASRLNEPNSPKK
                     ARKRPRRVIEDDDDDDEFF"
     gene            <1070757..>1071454
                     /locus_tag="TRUGW13939_00356"
                     /db_xref="GeneID:55987869"
     mRNA            join(<1070757..1070877,1070944..1071210,1071276..>1071454)
                     /locus_tag="TRUGW13939_00356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483564.1"
                     /db_xref="GeneID:55987869"
     CDS             join(1070757..1070877,1070944..1071210,1071276..1071454)
                     /locus_tag="TRUGW13939_00356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339457.1"
                     /db_xref="GeneID:55987869"
                     /translation="MKFSIVALSGLAAIAASQTTTGTAATAVVSLTPEASCATKCADT
                     DVCCRAQCYHVPCPDASMANDTTSCVAACPQGDGSAKDTDAYASCQQSCYNSHFFPAT
                     AYTGGATGTVASASASETGSNSASATGSSDSESGSATTTGASGTQSGSATASGSGASA
                     TNTGAASQLGLQIGSAGIVGAIVAAMVL"
     gene            <1072175..>1075807
                     /locus_tag="TRUGW13939_00357"
                     /db_xref="GeneID:55987870"
     mRNA            join(<1072175..1072812,1072868..1073302,1073348..1073744,
                     1073794..1073932,1073987..1074488,1074654..1074887,
                     1074949..>1075807)
                     /locus_tag="TRUGW13939_00357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483565.1"
                     /db_xref="GeneID:55987870"
     CDS             join(1072175..1072812,1072868..1073302,1073348..1073744,
                     1073794..1073932,1073987..1074488,1074654..1074887,
                     1074949..1075807)
                     /locus_tag="TRUGW13939_00357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339458.1"
                     /db_xref="GeneID:55987870"
                     /translation="MPDTNDTPLRPYRSHKIPACDFCRRRKSRCTQDLVDQPCLLCRM
                     HGAACSTAKRGVDASPRAQTPTASNSTKRRRVNDKGSQNTDGRQRRSSRTAAARHSPV
                     VEEQQSRPARRLSAVAANDTNNQSSHIIGPAMARDAQVLQRYMSPAYDTAVSYARPNP
                     YSVYSHDPRDPVVYMKVPRHRNIVPSGNGTAGFKQFESMEKIIEPLGPELFHVYFENI
                     HPPFPILDENTVLEAYRQDGLPHSLVCEIYAVSLILWKTSRKIASSGRPTPDIRYMWN
                     LAVSAMNDDFSAPDFSTVLACILDLLGRPITSITYNAVNIGRVVALAQSLGLNRNPLK
                     WDLDFRQKSLRIRTWWGILIHDQWASLSHGTPPHIHRSQWDVPLPDSDSLLINGASTG
                     GFIANDRAQGGRCFIALCQLTVVLGGILSLLYTVEDQTREQAFRALRRHETALDQWEE
                     GLPHWLCPGSLSYNRKTAGALNLQLCYLVVRMCLWRIGLLELHRSDDADIKKDKLYYQ
                     ARCRKAARAVIDFITLLKRSEIDVFWLPYTAYHFTSAATLILRCALEAEDTDTAQECV
                     ASAKRLMDFLRKMKNEVNWDLADICLGHCEAVVEKLSDSHCLETWRRIPHGGGQQQQQ
                     QQQQFEEEWNRNIPAQASHEGPPEPLDDGIFVPLNQDVNESGAESAQTLFQDLMAYNS
                     TPGTMIDNPMFPDLWQLPYLDDFISDFLSITVLKFNKFNNMQLPQPFADIPRESFLFG
                     PSPIQHLPNITKALGGQVHIYAKREDCNSGLAFGGNKTRKLEYLASDALAQGCDTLVS
                     IGGFQSNHTRQVAAIGTKLGMEVALVQEKWVQWEDPVYDKAGNIQLSRLMGADARLDP
                     SPFGIEHKQTLQKLQQEMVDRGRKPYYIPAGASDHPLGGLGFARWAFEVEQQEKEIGV
                     FFDTVIVCAVTGSTMAGMVAGFKLAQKKNGSRPRKVIGIDASATVKQTFDQILRIART
                     TGTKIGLSEDDNVTADDIILDDRYHAGVYGIPDQQTIDAIKFGASTEAFITDPVYEGK
                     SLAGMMDLVRKGEITAGSNVLYAHLGGQLALNAYTGM"
     gene            complement(<1076141..>1077305)
                     /locus_tag="TRUGW13939_00358"
                     /db_xref="GeneID:55987871"
     mRNA            complement(join(<1076141..1076386,1076444..1077160,
                     1077222..>1077305))
                     /locus_tag="TRUGW13939_00358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483566.1"
                     /db_xref="GeneID:55987871"
     CDS             complement(join(1076141..1076386,1076444..1077160,
                     1077222..1077305))
                     /locus_tag="TRUGW13939_00358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339459.1"
                     /db_xref="GeneID:55987871"
                     /translation="MTNTNQPSSRSRGRPAIPHDHPAIQIDHGDGDGDSDSAYEGSVT
                     STSMSLRSSILDYEYENGRRYHAYKAGEYVLPNDEAEQNRLDLQHHVYRLCLSGRIYR
                     APIRNPQRVLDIGTGTGIWAVEFADECPEAVVIGTDLSPIQPHFVPPNLKFYIDDFEQ
                     PWEFGEDEKFDMIHWRSLCGSTGDWPKLYKQAYENLKPGGYLEVQEYDAWIFSDDDKP
                     LAKAPWTLDWVTTLSELSDQFQKPLNVGRLQKQWMVEAGFEGVDELIMKVPIGTWAKD
                     AKLKEIGTFERVHMTESVEAHSMALFTRVLGYTLDQANVLFSMVRKDLNDRSLHLYTV
                     YRFLYGRRPESDQL"
     gene            complement(<1077849..>1079615)
                     /locus_tag="TRUGW13939_00359"
                     /db_xref="GeneID:55987872"
     mRNA            complement(join(<1077849..1078038,1078103..1079264,
                     1079339..>1079615))
                     /locus_tag="TRUGW13939_00359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483567.1"
                     /db_xref="GeneID:55987872"
     CDS             complement(join(1077849..1078038,1078103..1079264,
                     1079339..1079615))
                     /locus_tag="TRUGW13939_00359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339460.1"
                     /db_xref="GeneID:55987872"
                     /translation="MTYDFIIIGGGTAGSVLASRLHQATTTTSILLIEAGPDVSTRAD
                     VLDGTQWPRLLRTELDWCDVTVPQRHLNGRELPNFAGRALGGSSATNAGGWTRGENKN
                     YDTWSRLLSDPRWSYDNLLPYFRKIETHFDPHSDPAVHGFDGPIKTEPAARRQYPLRD
                     QVKTAWTSLGVAHKTDMNDGDPIGLGDLVENRVDGRRSISSSAYGLEGVKVLTDTLVK
                     RVVVSEIDGVKVATAVELADGTIIEASREIIISAGAYRSPQILLLSGLGPRDELAQHG
                     IETVVDLPDVGRHFQDHCAVSQWWKLKEPEKGLSVGSPAFNNPIYFKGNAVDFVVTQP
                     VSPEGLLKALAADAEANPELHPLVLQRGHLELYILYAARNQQNPAIVPDGTHITTSAV
                     VMLPTSRGSIRLRDANPASQPLIDPNYAATEADRYVLREGLRLIHKVVRETAAGQEFV
                     ASETVEDGFSPISAESTDDELNDLIRRRLGTMFHPAGSVAMGKVVDSELRVHGVERLR
                     VVDASVMPSPVVGHIQNAVYMIAERAADFILGSV"
     gene            <1080120..>1080657
                     /locus_tag="TRUGW13939_00360"
                     /db_xref="GeneID:55987873"
     mRNA            join(<1080120..1080249,1080440..>1080657)
                     /locus_tag="TRUGW13939_00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483568.1"
                     /db_xref="GeneID:55987873"
     CDS             join(1080120..1080249,1080440..1080657)
                     /locus_tag="TRUGW13939_00360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339461.1"
                     /db_xref="GeneID:55987873"
                     /translation="MIPPPPLASPTPSEPHHPSDLPRLELVAFPLKPPALPSTSNSQY
                     AGEQGLDGQCRTGRRNQRVLKQINMGRMGVAKIGNFAGEAHAGIGGVIVVDAESEQVG
                     KDGQEEGDCIVDS"
     gene            complement(<1080433..>1082142)
                     /locus_tag="TRUGW13939_00361"
                     /db_xref="GeneID:55987874"
     mRNA            complement(join(<1080433..1080761,1081563..>1082142))
                     /locus_tag="TRUGW13939_00361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483569.1"
                     /db_xref="GeneID:55987874"
     CDS             complement(join(1080433..1080761,1081563..1082142))
                     /locus_tag="TRUGW13939_00361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339462.1"
                     /db_xref="GeneID:55987874"
                     /translation="MATRGEMSYIPLEALAQDNNNDAEEEQLHRKRRNLWHRIDTASV
                     WASFLGFPLLLLAVTLLALFWYESLKAIDGAEPQIYWVCVVNAGWVTRLVTVCTTSIR
                     MVMAFQAGLATAMVAGIVLETKSVSLLQSPFYSILWAVKIAFSNLWTSTNFRPHLSRF
                     IYVLVLTEVLVITASQFLSTIFLSDFVNGSFTQCVLSPGNTSSTNNNWGILTLDPRSQ
                     WETFHPPADTLGVDDTITFFLAVLPNLLTLCVNYNYTADSGVSLSRKIANFGNAHTTH
                     IDLFQDTLITTASPALAVQALLTRIY"
     gene            complement(<1083008..>1084439)
                     /locus_tag="TRUGW13939_00362"
                     /db_xref="GeneID:55987875"
     mRNA            complement(join(<1083008..1084088,1084152..1084192,
                     1084263..>1084439))
                     /locus_tag="TRUGW13939_00362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483570.1"
                     /db_xref="GeneID:55987875"
     CDS             complement(join(1083008..1084088,1084152..1084192,
                     1084263..1084439))
                     /locus_tag="TRUGW13939_00362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339463.1"
                     /db_xref="GeneID:55987875"
                     /translation="MKTVASFIGFLSLAPHVAPYPGSIKLGSRAVQRTQPSRSNNGQA
                     VEVSLTDWIANTDLQWYSTIEVGTPPQTFTIMYDTGSTGLVLPDKGCTSCGNGNLFDP
                     ARSTSFSSLPNAGVYTLLDYSTAATSVPVIAGNNSANCTYVTDVVTLHGLKSPEQTFA
                     LCNLYPSSFENVPMDGILGLGISPQASSDNSTTPSFWSWYNSGLLPEPIFSFDLIPGS
                     EMGAELTLGRIDHSKYTGEIAYINLDQKATSESQLYIVDLTTLFVDDKKVLVTGNYSS
                     NNSSGGGCQAPAPFKPGIAALDTGTAFLQAPDKQIAAEIYAQIAPEITEIDPNGAWGA
                     PCAVLDAVAPELLTFSINNGTGSYFNLTLTRNFFNLGEYPGQPGICQAVFNHPIIPIA
                     DPLGEGRPVWILGSPLLKEYYTVWDGLNLNVGFAKLVHRW"
     gene            <1087228..>1087683
                     /locus_tag="TRUGW13939_00363"
                     /db_xref="GeneID:55987876"
     mRNA            <1087228..>1087683
                     /locus_tag="TRUGW13939_00363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483571.1"
                     /db_xref="GeneID:55987876"
     CDS             1087228..1087683
                     /locus_tag="TRUGW13939_00363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339464.1"
                     /db_xref="GeneID:55987876"
                     /translation="MTDISSIREMVFKENAKRIVMKMKTRCLNPDDYANSAKTILNDI
                     FPNWESDNRILFLAVEVFEERAFMAFDINHHDYDFRTAHQDKSPLPVYVLKRVHKGRN
                     WDLIRLPRDDTIICTRLAELHRAHGYDVELPIVEDHTSVIVHANPRSPV"
     gene            <1088049..>1088729
                     /locus_tag="TRUGW13939_00364"
                     /db_xref="GeneID:55987877"
     mRNA            <1088049..>1088729
                     /locus_tag="TRUGW13939_00364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483572.1"
                     /db_xref="GeneID:55987877"
     CDS             1088049..1088729
                     /locus_tag="TRUGW13939_00364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339465.1"
                     /db_xref="GeneID:55987877"
                     /translation="MAVDMQALIKAMTVYMTTCMSGHDPSHNPTHVLRVVHLAHTILE
                     GELSRHSTTTQYDRDIITLAATLHDIGDHKYLPEPTDTKIDPKQMVFNTLVAHGADAS
                     LAERVQTIVSNVSYSNEIKNPAAVRALIADERYRELAVVQDADRLDAIGAVGIARTFT
                     YLGSRQQKGAPGQRWELDESIEHFGEKLEKLEGMMKTDTGREMARERTRRLREFKTWW
                     MEETGNDN"
     gene            complement(<1089089..>1092439)
                     /locus_tag="TRUGW13939_00365"
                     /db_xref="GeneID:55987878"
     mRNA            complement(join(<1089089..1092179,1092249..>1092439))
                     /locus_tag="TRUGW13939_00365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483573.1"
                     /db_xref="GeneID:55987878"
     CDS             complement(join(1089089..1092179,1092249..1092439))
                     /locus_tag="TRUGW13939_00365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339466.1"
                     /db_xref="GeneID:55987878"
                     /translation="MPPAASEDIFQNFNQLSLDNTPLSQSPSSAPDITGKKKKKGKNK
                     NGTKGKDTLPQQADQMASDEIQPSPPSQSDPSSFPGNAFNIPAVSRPVGTSPSPVLGA
                     LGQINNNPESETVLRTDAWAKSIPFGKSPPNDVLDPAFASGSPRSVPTTLERAAFASS
                     TSPPPAAARPISYGQIGFTSSPSPRHTSIDRQKRHSMGTHFQNQPPLPHLPQAHFYGA
                     PEIDIPSPHRPSADSHYSFCGWDYVPGLPLKTSKIGGKVLVVGMDGELNILAIENHKT
                     RTIGTLTGLNGRVLDAKILTYTARSDPYASSRPHVAVTLHGPTASKDEPGDASSVASD
                     HNEILPGLPGKSTTSEKPQTRDETVYQTRVEIYSIKTGEHITTLFQSKPAPCFENYPN
                     LSLIAPAPVGNLRLYTSMNYIVVVSGTSGEVFIYGVVSASYQCLGKTWTSVQSREVRR
                     YSTSSSSTDQDGSQADIHYGSVSSEVPMISLNGRWLAVVPPASSSRAPPLGTVPTHLV
                     QRKIPGLDTHIPPSKPAVNCATDLGDGESFFDKVARGVTQEFFRGARWMGDQGLQAWN
                     SYWNKDQSSPGGNARRSSPYSETQGPHGLFPPTHGQDTSGALSSEPDLVSIIDMKKLE
                     QGQDPKGAALVPFATFQAPNGCGFLSFSPNGHMLLTASKKGDVQYVWDLMQAKNYRSA
                     VFMSEDVVGNSPLTPHVRLIARHSRLTTSSIVDIVWAYPTGEKFAVITRKGTVHVFDI
                     PRAAFQWPPLRRVQAKSQGPSAEDQTPLSPESEEAGTASPFATAMKLVGGTTQPILAA
                     VRGRAPSVGSNFSGTPTFGISSAAGISGKAVAVGLSKSVGAATGTVNTLRHVGENRLH
                     LTGFTKDPTPSRVTWITIHNECLLGVIDHGLFRLYRVQRSADRNKARRHQSVIGNRVA
                     EIKLPAYLQDLSGPLQIGLPADEKVAGSWALSSSAPHSSSTTKLDSQPLSQAEIETNT
                     PYQPFHTDRRVNIQVLVDPASASGPTLGPWVFGNDIPTQTLHVRPLQHSDDEETHGQV
                     AGAPEMENLISLGNGRDQVEEVVITTRRKKRQSSAHSPTSRRDDDDGFFEDDCDVLDF
                     AQDRV"
     gene            complement(<1093570..>1093882)
                     /locus_tag="TRUGW13939_00366"
                     /db_xref="GeneID:55987879"
     mRNA            complement(join(<1093570..1093758,1093826..>1093882))
                     /locus_tag="TRUGW13939_00366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483574.1"
                     /db_xref="GeneID:55987879"
     CDS             complement(join(1093570..1093758,1093826..1093882))
                     /locus_tag="TRUGW13939_00366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339467.1"
                     /db_xref="GeneID:55987879"
                     /translation="MLLAATAIFLYYTAWTILMPFVDKGHPLHDFFPPRVWAIRIPVI
                     LTLLGSAVVGSFLGIVMIRSSRKKAAKAKAAAAKKKT"
     gene            <1094252..>1096639
                     /locus_tag="TRUGW13939_00367"
                     /db_xref="GeneID:55987880"
     mRNA            <1094252..>1096639
                     /locus_tag="TRUGW13939_00367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483575.1"
                     /db_xref="GeneID:55987880"
     CDS             1094252..1096639
                     /locus_tag="TRUGW13939_00367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339468.1"
                     /db_xref="GeneID:55987880"
                     /translation="MSDPVMLQSAVRVPTPPPGASYSPQPSSTRKRSPPSRSPSPNRR
                     RSPPGDSSRDIGDVPRLDSDRALERERQLAERLRQTTDAPRKPLTEEEKQASAKAEYE
                     KLLNMRSGGTYIPPARLRALQAQITDKSSKEYQRMAWEALKKSINGLINKVNVSNIKY
                     IVPELFGENLIRGRGLFCRSIMKAQAASLPFTPIYAAMVAIVNTKLPQVGELLLGRLV
                     VQFRKAFKRNDKAVCISSTTFIAHLCNQQVVHEMLAAQILLLLLHKPTDDSVEIAVGL
                     TREVGQHLEEMSGPIALAVFDQFRNILHEADIDKRVQYMIEVLFQVRKDKYKDNPSMR
                     EELDLVEEEDQITHRLGLDDEMDTQDGLNIFKFDAEWQEHEDAYKKLKAEILGEGSDY
                     DSDDESGDSSDEEEAEEERQMEIKDQSNTDLVNLRRTIYLTIMSSIDFEECCHKLMKV
                     SLPPGKEAELPSMIIECCSQERTYSKFYGLIGERFAKLNRMWSDLFEESFAKYYETIH
                     RYETNRLRNIARFFGHILSNDAVGWHVLSMIHMNEEETTSSSRIFIKILFQDLAEHLG
                     MAKLRERLIDPVLRPSFDGLFPLDNPRNTRFSINYFTSIGMGALTEEMREHLKNLPKP
                     TLPALPAARDESDRESVSSYSSYSSYTGSSRSYSRSRSPRRDRDATRGRSYTRSASRS
                     GSYSRSRSRSRTPAGAARRGRSYTRSPSRSRSRSRSVSGSRSPVRARNRARSYSRSPS
                     RSRSRSRPRSYSRSPVRRGAAAAAAAPRGRSYTRSPSRSRSRSRSVTPPPRASRR"
     gene            complement(<1097557..>1098730)
                     /locus_tag="TRUGW13939_00368"
                     /db_xref="GeneID:55987881"
     mRNA            complement(join(<1097557..1098139,1098196..1098364,
                     1098420..1098576,1098653..>1098730))
                     /locus_tag="TRUGW13939_00368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483576.1"
                     /db_xref="GeneID:55987881"
     CDS             complement(join(<1097557..1098139,1098196..1098364,
                     1098420..1098576,1098653..1098730))
                     /locus_tag="TRUGW13939_00368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339469.1"
                     /db_xref="GeneID:55987881"
                     /translation="MAPSHEKGRRGTTRASDDEFVLYLQGVPAHCRWQELKDFVRQTA
                     MHIRQAVVYDDPNGYPTGIGQIIVKNEDEAWRTFRKLATTGWDGQVLTVTLAKASAPT
                     KPISGPKQSPSASRPRFSFGMGNGSSNRTVPSDSVATRGYMPAPPPLMNYIHAYPAST
                     PSWAANPEAHPFSPSPAVFPFNHMEYQYYPTSSMNPPQHMYGAAIMDATTMFIHTVPY
                     YHQGGVIATGGGYPDPTTSTAFALAAAVPSCCSVIIDNLHRNIDVQTLKDHFHTTARA
                     VVEHCEIVKTPPSPHAKDKEASSYAMATFPSTEEATKAVSLCNGTMLSGNRIV"
     gene            complement(<1102093..>1102320)
                     /locus_tag="TRUGW13939_00369"
                     /db_xref="GeneID:55987882"
     mRNA            complement(<1102093..>1102320)
                     /locus_tag="TRUGW13939_00369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483577.1"
                     /db_xref="GeneID:55987882"
     CDS             complement(1102093..1102320)
                     /locus_tag="TRUGW13939_00369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339470.1"
                     /db_xref="GeneID:55987882"
                     /translation="MSAPSIPLQAPSTPAPAPEPTDLPSSHSFLDIVRCSRCQRSLSI
                     QHTSPPAAGVVQFGMNSYYCSRCASMVGFNR"
     gene            <1103702..>1104496
                     /locus_tag="TRUGW13939_00370"
                     /db_xref="GeneID:55987883"
     mRNA            <1103702..>1104496
                     /locus_tag="TRUGW13939_00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483578.1"
                     /db_xref="GeneID:55987883"
     CDS             1103702..1104496
                     /locus_tag="TRUGW13939_00370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339471.1"
                     /db_xref="GeneID:55987883"
                     /translation="MSGPSLYSFADVDSLAQQLRQYVLNSQNAAVSRHGNFRMAVSGG
                     SLPNTLAKALLTKGDGSSEDTPLFSKWEIFFADERAVPLDHPDSNYRLIKDELLDKIP
                     SALGSPTVHTIDAERVKTGSADELADLYQEDLKRSFAAKDSIKVPTFDLILLGVGPDG
                     HTCSLFPGHPQLREKDAWVVGITDSPKPPPKRITLTLPVVAQAVNIAFVATGGGKQDI
                     LRKIFDTEEGSSLPSGLVNVEAGEKVSWFADNAATEGVSFPKRSSL"
     gene            <1104795..>1106390
                     /locus_tag="TRUGW13939_00371"
                     /db_xref="GeneID:55987884"
     mRNA            <1104795..>1106390
                     /locus_tag="TRUGW13939_00371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483579.1"
                     /db_xref="GeneID:55987884"
     CDS             1104795..1106390
                     /locus_tag="TRUGW13939_00371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339472.1"
                     /db_xref="GeneID:55987884"
                     /translation="MPTPRDDPSNNPAKRSDETRRIPVRQPSKTSSIPTPSFASNNNT
                     DDVVNKRKSLLPQRSISMRPARPLQQPQPQPQPQQQQQQQQQQQQQQQQNHADRKQVS
                     PDHPTSTHKPAPAQRPRSGLEETSQTQVRKKPVAPSRTKTDRGVVRSRSPLKVQPQNI
                     DNKTIPPATTTVAAAAAATPTSPTKKKTQMPPPSRPTRSASLRQLSAPKIASGQGKGH
                     TRHKSQVLPGNTTPLPAAASKLQRPTFNTFQQHFSPKKAGREAASAETNTTSKPEGDV
                     LTAASRPEVAALQTEFLQLYLLYSLSVQQDADWRSTAELQLRKKYNHVANAYQGQLAE
                     ERVVQQQWNLKALHDWSVDCTSSGNALEDFSTQIQNLSQVIQEVTDVTAANSGRYTLV
                     VKAFEDWLTIVENVKESRRGRKHAFETGFEELQFIYPMDRVWKDEVEALTSKAELCLR
                     RLQNLAMLDDTQHNGGSALLQIVRGHRDLLVLMVSELKEMRDIEFEVVALEKSWVSRA
                     ADQLCTVEDGQHISSTRKGIWTA"
     gene            <1106841..>1108606
                     /locus_tag="TRUGW13939_00372"
                     /db_xref="GeneID:55987885"
     mRNA            join(<1106841..1106879,1107597..1107822,1107897..>1108606)
                     /locus_tag="TRUGW13939_00372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483580.1"
                     /db_xref="GeneID:55987885"
     CDS             join(1106841..1106879,1107597..1107822,1107897..1108606)
                     /locus_tag="TRUGW13939_00372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339473.1"
                     /db_xref="GeneID:55987885"
                     /translation="MKGPIHVILTGTFDITGTAPPRDLREFGLQGQLEWGLVALERGL
                     HSFGRLLMSPGQQVMQVRLEGQPGASTIPRTDWRQGDRASLGDSGVHRVLPPLPSLNS
                     PFAPREQAHSSSPLFQTTPDTPQSSSNVQIQYLRHEITSKTLALQDLQRDYDKLLTTV
                     IPQQPAHNSSDLRPLLPNKPNLEKQVSELQTQVNELLQAQEETQRESTASRNQYMQIM
                     AMSSRLQAQSTTDARRWQAEKEEWDNQKKALLDKIHHLERQVYYDEEENNSSNNSTKN
                     NMEALEQKCRALERHIRGLNEETMQLDEALQTTLRLSASIRAKVKQAG"
     gene            complement(<1108874..>1112392)
                     /locus_tag="TRUGW13939_00373"
                     /db_xref="GeneID:55987886"
     mRNA            complement(join(<1108874..1109731,1109788..1110111,
                     1110173..>1112392))
                     /locus_tag="TRUGW13939_00373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483581.1"
                     /db_xref="GeneID:55987886"
     CDS             complement(join(1108874..1109731,1109788..1110111,
                     1110173..1112392))
                     /locus_tag="TRUGW13939_00373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339474.1"
                     /db_xref="GeneID:55987886"
                     /translation="MERADEEARRTCWSLDWKPDPSLLSSKELIDLCASNDKATAAAS
                     FVELFAHQNPIMQILEAGDVLLDTSQKIRDRLTTYGLDIDGEPGLPLFRTYTITNSGA
                     SDNNDNDNDDTNTESSRLIRRKLDTANSLDEQGFTDCHYDFLICNDRKYLLTATPQGL
                     SNINSLLEENAKILLLEEFVVLSKADLNNLEDSTSANRDLSSLSTSETYNIVESAGSG
                     STIIITPNSGIQRIIAQVLQKRLSSELGSPDIVTLEDINPAQYEGRNYISLLDLDASV
                     FHDISNDRWAAFQQILSTAKSVLWVTKGQGADQGLVSGLGRVIQSEYLDLRFVEVALE
                     ASTSKDKVISHILTVLQRTLLAEDLDLETEYREQDGKLCVGRVIETTTVNSMIRSSTG
                     PSRSSVQQFGADSQRALNLSIASPGLLDTLQFEDDPDYALPLGPTDVEIKVSSTGLNF
                     KDIIIAMGQISGNRLGFECSGIVSRAGPQAGFAPGERVSCCTLSGAYKTFVRTDASWV
                     IRLPDNVPYADAASIPLVFATSYYSLVTVARLSENETVLIHSGAGGVGQAAIQIAQRI
                     KAQIFTTVGSPEKKKLIQDLYGIPESHIFNSRDTSFAEEIQKHCPAGVDVVLNSLQGE
                     LQEASWKCIAPLGRFVDVGKADFETSRKGLNMKPFLTNVSFSSVDLSVVMRRAKPVMA
                     EIMSAIRDYMTDSTNPISPPQPLQVYQIGDLKNAFRRMASGKSSGKIVLDLNPASEVP
                     IVPSRSTRYDFDPNATYVIGGGLGGLGQTLVDWMVERKARHFILLSRSGAAKNEAAQE
                     MISRHAANGVEINAPSCDVADENAVRSVFERLSQTMPPIKGCIQGSMVLRDGLLSSMS
                     AADWNAVLRPKTQGTLNLAAHLPRNMDFFVLLSSISAISGSRCQANYSAANSYMDALA
                     QELVAQGRRCLSLNLGVIKDVGIAAQLGTNAALRRDGFEGLTTPELLALLDYACDPKC
                     PRATNPQRAQLIAGLGAAMTLAPEHFESVYWTRRCMFRQLQEVNRITAQNTDSGSNTS
                     SKGAEKNFGRLLAEAPDENAAADAALKGLVNKLANLLNLPETDVETRTPLHSFGIDSL
                     VALEIRYWVSKELKTELSIFDIMQAGGLAGLAGVIAQKSEARTKQ"
     gene            complement(<1112431..>1116591)
                     /locus_tag="TRUGW13939_00374"
                     /db_xref="GeneID:55987887"
     mRNA            complement(join(<1112431..1113219,1113501..1114432,
                     1114491..1115187,1115254..1115841,1115892..1116160,
                     1116217..1116361,1116421..>1116591))
                     /locus_tag="TRUGW13939_00374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483582.1"
                     /db_xref="GeneID:55987887"
     CDS             complement(join(1112431..1113219,1113501..1114432,
                     1114491..1115187,1115254..1115841,1115892..1116160,
                     1116217..1116361,1116421..1116591))
                     /locus_tag="TRUGW13939_00374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339475.1"
                     /db_xref="GeneID:55987887"
                     /translation="MDPIVVIGFDARLPQDACSSREFWDMLLQGRNAVTSVPKERVNM
                     DAFYHPNPDRTDTANVRTGNFITGDIAAFDAPFFSIQQIEAESMDPQQRLLLETSYKA
                     LENSGTRLDQIQGSKTSVYVAASTRDYEVILYRDPELTPKYMGTGIGTSLLANRLSWF
                     FDLRGPSVALDTACSSGLAAVHMACQSLISGESNMAIVGGVSLILAPEVNMNQLSTLG
                     FLSPDGRSYSFDSRANGYAKGEGVCVVVLKRLSDAIRDNDTIRGVIRATTVNQDGRTP
                     GITQPSKRAQTENIQRAYKEANLDMNDTHYFEAHGTGTAVGDPLEAEAIHNAFQRSPE
                     RPLWIGALKANIGHLEAAAGVASLIKAVLVLEKGILPPNADFRVPNPNIPIDKYNFKF
                     LKSPMPFPTDGFRRISINSFGYGGTNAHAIVDDAFNFLRIHGLQGKHLSVVKPPQTLT
                     QSSDFDPVNAGDFKITNGHHSDSSPVKTNGKPNGHFILNRPIVLPFSSADESGIERTL
                     KTYQEYFSRLGKEKSVDEEQEYLQNLSYTLTTRRSNLPWKSFSVISSMDQLRSGDLIW
                     SKPQRSSAAPSLSFVFTGQGAQWYAMGRELSLYPVYVESMQRSDRYMKDLDCPWSLID
                     ELHKGESLSLVNKPEFSQPLCTALQIALVDLLDSWDIKPVAVIGHSSGEIAAAYCAGG
                     LSHESAIRAAFYRGQLASKLLEQQPNSGTMLSVALSETKVQEYIRDAIQRTGETVSVG
                     CVNSPQNVTLTGGTRAIEELSQLLQNEGIFARTLSTGIAYHSQFMEAISAEYLAKLGD
                     LEPGSKSGNPPLFFSSVDGVKIPANNTCNPEYWVRNLVGQVAFLSALQHMTLYLLEER
                     KKDGSSGKDLLLEIGPHPSLQRPIKETVKDAKDIDYIQTLARNVHALVSISNLTGRLR
                     CSGIPVDVLQVNFPNAQVEELDKSNLYPASGMLVMVIEAARSLAGSQSVSGYHLSNIN
                     FPAGLLIPQNVDSVEAQINFNPVKPGMPDQHRIHDFQIFAYFGEGWHELCHGTIETEI
                     KISQEGTQTEAERQRPQGLLNGESNQRWDEVNSKEFYQAINEYGMSFGPAFQGLQKVR
                     VANDQATAEIELDKWNHENTKFAPTPHIIHPTDLDIIFQSSIAAFSQGGRLPIPVLIP
                     QKIRSIWVSQDLLGRSSKEVLRVSNKIETRGYREADFSIAAVNEQRRKFS"
     gene            <1117387..>1118564
                     /locus_tag="TRUGW13939_00375"
                     /db_xref="GeneID:55987888"
     mRNA            join(<1117387..1117576,1117640..1118099,1118157..1118218,
                     1118272..>1118564)
                     /locus_tag="TRUGW13939_00375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483583.1"
                     /db_xref="GeneID:55987888"
     CDS             join(1117387..1117576,1117640..1118099,1118157..1118218,
                     1118272..1118564)
                     /locus_tag="TRUGW13939_00375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339476.1"
                     /db_xref="GeneID:55987888"
                     /translation="MVVLQKTGRLTLRLTIAMIVIAVLSVVIRFAARIKTRTKFKIND
                     AFLVAGLLSFLGVEISLLAGIYTSGGTLDESQIKDLQDLINLFKYVFALESFVTTAIT
                     LIKLSILALYRDLFPIQQFRAYTVVIGTLCLIWYIICFLINIFQCTPVKAAWQLDLLT
                     KGEAKCLVYGHYIIGYEVSNMLLDITILALPIHVLHTLHLSRPRKIIVGGLFALGGFI
                     IIVCIIRTVYLSDATLENPVALYNGLNWTSVELAVGILCACIPVYGPLLPTQRAVKAI
                     TKWSSQKTRGNYFSWMFKSSSRYEQHQGDSNELAGLSHQQLTEESSIRQKRSSNISAV
                     "
     gene            <1119093..>1120253
                     /locus_tag="TRUGW13939_00376"
                     /db_xref="GeneID:55987889"
     mRNA            join(<1119093..1119639,1119703..>1120253)
                     /locus_tag="TRUGW13939_00376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483584.1"
                     /db_xref="GeneID:55987889"
     CDS             join(1119093..1119639,1119703..1120253)
                     /locus_tag="TRUGW13939_00376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339477.1"
                     /db_xref="GeneID:55987889"
                     /translation="MPEYWDPEQPLVARQPWKLLYSFCFIVSVVARLPIWALSYTIPW
                     LRPVPSWSYKTALTVSLWRQGFRFLSNIRFRTAQPLEPGSEKDLFVELKPTADLKAYT
                     GLLENPSVQPTSVGGFWLPSLECLSTISANNNDNNTNNASKNWVILHFHGGGYVLISP
                     RVPTTQQGPKQLCEELPADGALLTAYNYLIHEKGISASRILVSGDSAGGHLAILLLRH
                     LIAHPETGLPLPRVLLLHSPWLDLTAKGTSVDYKPGSTQDYVCDPFLKWGATTFTPGG
                     VSPEAEFISPALHPFKSPVPIWASAGTVEKLYPVIAEWVGKMRDAGSTIELHDLKDMP
                     HDTFAVSTEWGLESPAREAIRAAKGFLERVL"
     gene            complement(<1120402..>1121558)
                     /locus_tag="TRUGW13939_00377"
                     /db_xref="GeneID:55987890"
     mRNA            complement(join(<1120402..1120598,1120669..1120770,
                     1120829..1120971,1121023..>1121558))
                     /locus_tag="TRUGW13939_00377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483585.1"
                     /db_xref="GeneID:55987890"
     CDS             complement(join(1120402..1120598,1120669..1120770,
                     1120829..1120971,1121023..1121558))
                     /locus_tag="TRUGW13939_00377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339478.1"
                     /db_xref="GeneID:55987890"
                     /translation="MAATRLEGLTAVVTGSSSGIGRGIALALAAAGARLVVCADLKEG
                     HVALSTSAATVKTSLSHGAEMVSRALVTSKDNNDESVDTPTHELIHARYGKERAIFVR
                     CDISREKSDAADGIFSIENAIQEAVSRTGRLDVSVSVSVLFRATSANQIQRLVNNAGA
                     GILDIPLHEMTAAQWNQCFGVDSAGTFIATKFAVTQFLQQDEDEYGFRGNIINVSSIA
                     GSAGLPGCSAYCAAKSAIIGFTRSVAIEYAERRIRCNAIKPGYIMTPLLHKIIETTDD
                     VTWLEKASPFNRLGQPKDIGQAAVWLASGRESGYVTGIDLSVDGGFLAR"
     gene            complement(<1121799..>1122668)
                     /locus_tag="TRUGW13939_00378"
                     /db_xref="GeneID:55987891"
     mRNA            complement(join(<1121799..1122164,1122240..>1122668))
                     /locus_tag="TRUGW13939_00378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483586.1"
                     /db_xref="GeneID:55987891"
     CDS             complement(join(1121799..1122164,1122240..1122668))
                     /locus_tag="TRUGW13939_00378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339479.1"
                     /db_xref="GeneID:55987891"
                     /translation="MYVAMSSPLSSIVLVPGAWHTPDCFDQFRSVLSELNLSSSAVAN
                     PSVGDATVSKTLTDDVDNLRSVITQLIEQEDKFITVLAHSYGGMVASGAVKDLGYAER
                     KRIGKRGGVVMVVYLAACAIPEGMTVVQSCGGSPAPWWEYKGNQIFANDRNISNPAHT
                     LYNDLPPTMQEQAISKLQPINAACFDMPNSYEPWRDMPCTYIFAERDNCVPLPGQHYF
                     VGLMGDGVATASLSTSHSPFLSQPRELAALVQRAVHEGLKKAGAFD"
     gene            complement(<1123893..>1125043)
                     /locus_tag="TRUGW13939_00379"
                     /db_xref="GeneID:55987892"
     mRNA            complement(join(<1123893..1123932,1123996..1124538,
                     1124604..>1125043))
                     /locus_tag="TRUGW13939_00379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483587.1"
                     /db_xref="GeneID:55987892"
     CDS             complement(join(1123893..1123932,1123996..1124538,
                     1124604..1125043))
                     /locus_tag="TRUGW13939_00379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339480.1"
                     /db_xref="GeneID:55987892"
                     /translation="MSYPTRSLGRHGPQVPAVGLGLMSLGDIYGPAGSLDEKVAFLEH
                     AHATGQRFWDTADMYFDSEDAVGEWFKRSGKRNDIFLATKFGIQIDPKAGTGSIRSDP
                     EYAKIACEKSLKRLGVDSIDLYYCHRVDKVTPIEKTVEAMVELKNQGKIRYLGLSEVS
                     AETLRRAYAVHPISALQMEYSPFALDIEKPSIDLLNTCRELGVAIVAYSPIGRGLLTG
                     QIQSFDDIPAKDFRRVLPKYQPEHFPKILQLVQGLKDVSQAHHECTPTQAAIAWLLAQ
                     GSEIIPIPGTKSTKRMDENAGSALVKLTEKEVQHIRDLAERSEVPGPRYSDAMNMNSI
                     ADTPPL"
     gene            <1125484..>1127201
                     /locus_tag="TRUGW13939_00380"
                     /db_xref="GeneID:55987893"
     mRNA            join(<1125484..1125560,1125617..>1127201)
                     /locus_tag="TRUGW13939_00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483588.1"
                     /db_xref="GeneID:55987893"
     CDS             join(1125484..1125560,1125617..1127201)
                     /locus_tag="TRUGW13939_00380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339481.1"
                     /db_xref="GeneID:55987893"
                     /translation="MYQSIGKSKQQTRGREKVKTGCKTCKARRVKCDEGWPACRRCIS
                     TGRVCKGYGIWGGGGSPHDQQQPQSSRALSIYCTPVPVGNLSREEQTHFDWFVNKTRE
                     KFAGLFTSEFWGTLVFQASAREPAVRHAVVALSAAHRFEIGCDPWIIPAIYGVGVEKF
                     TLQQYNKAISYLRVATGKSGQSGLYVALITCMIFVALEYLRGQYQMASAHLRYGIQLL
                     SNISVPLPRSSMSPRMFSPVEDFVHNTLAESYARLSLQAALFGSVPSDMCVMTRKHSL
                     PYSFCSLLEARQTLDDLLNRVYCLERHCHSLRVSQLSIEDPEIIETQSKIMSDLSLWR
                     KIYKALLIQIEANGALKEKFGSRLLNIYYELAVIMASVCLSEDEMIFDSFTKNFLGIL
                     TGFVDLWNYWASQDPDVEEMQDIFVYKIENHGFTVESGFIPPVYYTALKCRIPGIRRQ
                     AIRILRSAPHREGVWNGQLLAEVLEEVVRIEESELGPAQLGSTKEFPLSEITASSRIS
                     GVSVILPNRAKDDTFVRYKKRIDNGQWVVMFELKIMYSAKQNSLK"
     gene            <1129235..>1132656
                     /locus_tag="TRUGW13939_00381"
                     /db_xref="GeneID:55987894"
     mRNA            join(<1129235..1129392,1129448..1132101,1132156..1132430,
                     1132483..1132596,1132648..>1132656)
                     /locus_tag="TRUGW13939_00381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483589.1"
                     /db_xref="GeneID:55987894"
     CDS             join(1129235..1129392,1129448..1132101,1132156..1132430,
                     1132483..1132596,1132648..1132656)
                     /locus_tag="TRUGW13939_00381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339482.1"
                     /db_xref="GeneID:55987894"
                     /translation="MKSSLYDRILHRELGHGPRSAGINGIYSAAEWMDSLDIVNELGG
                     HTGCVNALSWSRSGRLLASGSDDTCLNIYSYQPESSTAPFALSTSVSTGHRANIFSVK
                     FMPHSDDRTLVTCAGDSEVRVFDVEHSFQKNASATSVAAARSKRMTDFFTGVRYLDHS
                     NTNTRVYSSHSDRVKRIVTESSPHLFLTCSEDGEVRQWDLRQPTSAYPAPESGHGLAS
                     YNQPSYASNVPPPLISYKRHNLDLNTISCSASQPHYIALGGAHLHCFLHDRRMMGRDL
                     LAEKGQMDGSSPLESTRDDEAMNRATRCVRRFAPKGQKRMKPKDNGHITACKISDARP
                     NELLVSWSGDHIYTFDLVRSPDAREKDDSVISYDTSRKRKRGKVSSSTSLNSAIRHHS
                     RMRSEDVGQSDPEMSFHIRYRNRDSEDIPITSLADESFPPNAPEEAVDDSVLTDAQKM
                     SYEIAKSLVKLRKYLFSLESSMRETTLSQWHYDLTPYEPTFTAALDYAFACLIPMDDI
                     HRSWRYPINPSPDEVIRHQTFRRHRESARRFVQASATLAHFLGSCVEDYAEREDVRED
                     LFETIVPAPSEDGKIDPESQFGYDFLKAILLWLNGGRETLKDGFKLKRNSPRNRRRFP
                     IPDDGDDRAIEDYLIPYLRELAGSSPIVDVDASRFEHDESRILFPTQHAAVTAFEKAI
                     KLSLEESDNAVIHEEEDEISEHVVRALNRQAANKYWALRVGRGLLMSVGDGIDFAFVN
                     RAFGGSPAITGQDDDDDDERMQQDIDPEDESEEIEDFRLVSNRRRTHRRRPHNVTHLH
                     ARSNMSEDEDDHLELDNGNASDGDEEVLDFDDDDDDDENDGSNEDSDDDDSDEFFLRR
                     GRLANSRHGDKVEIQAPCGTPENVYKGHCNVKTVKDVNYYGLDDEYVVSGSDSGHIFI
                     WDRKTTKLVNILEGDGEVVNVVQGHPYEPTLACSGIDNTIKIFSPDRRLQYDARHGIN
                     ILNPDHPANMFSSRPQNSAGSSQVFGLRSCKRMKDSYQIMSQNDAERQGGMSEAYITR
                     SMLSRLAATLRQRHTMPHTNPGMDSDGATIVLDENCTVM"
     gene            <1133008..>1134609
                     /locus_tag="TRUGW13939_00382"
                     /db_xref="GeneID:55987895"
     mRNA            <1133008..>1134609
                     /locus_tag="TRUGW13939_00382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483590.1"
                     /db_xref="GeneID:55987895"
     CDS             1133008..1134609
                     /locus_tag="TRUGW13939_00382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339483.1"
                     /db_xref="GeneID:55987895"
                     /translation="MDPSTDLVQQITSISQSIYTSDPHNPHLYLARGKLHAQLGFHDL
                     AAADAYRALTLLEGVVEEEPDCVEYVARRRASTLTGEKKEEKEEDDDDDDDDGGFVRI
                     SRDEYDANIAPVYVLLVQSLTQCGCLRDAFEFGSRAARHLRLLGDQQYADSIDILEKN
                     GLGQNPNTLPAQGYARRVLYPWNTHEPDRKAQETLSLLNKRLETVAPACEVRAVSLPA
                     LHGEKLQEDEEKEEGEVSVQLGLFAKRDLQPGEIILRESSLLTATNRLHDDLCDACNG
                     PLPGLSEAVACQECDDTIFCSQTCHDHAQAVYHAAVCGHEGLESLGKDVADPQDKADY
                     LYFLLLGRAVAMAATQDCHPLDLPEVKYIWGDFHEYDSTEKDLPFSFQLSILQPMRLL
                     EEMGLDPFTTLARYDTWVLNTLYAKFRGTASGRLSTWDGGPEVCAVHPLWCLANHSCD
                     PNVRWEWGGEITFMVRREEEKAVWKRGDEKKEVSAALLRKDEEILNHYCDIGLGVRQR
                     REWAQGALGGLCQCTRCKWEEKPSS"
     gene            complement(<1134826..>1136335)
                     /locus_tag="TRUGW13939_00383"
                     /db_xref="GeneID:55987896"
     mRNA            complement(join(<1134826..1134949,1135002..1135756,
                     1135832..>1136335))
                     /locus_tag="TRUGW13939_00383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483591.1"
                     /db_xref="GeneID:55987896"
     CDS             complement(join(1134826..1134949,1135002..1135756,
                     1135832..1136335))
                     /locus_tag="TRUGW13939_00383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339484.1"
                     /db_xref="GeneID:55987896"
                     /translation="MASKPSPLTNIPSFAAPTAAAGPASPQSPRKLRKYQSHQSLTST
                     SFSTFGQPLPSIAHGSGVRQRDTPPNATGTGTGSQQNAEPQHNNRQRARSNSESGSSI
                     ATPLITAPPKAKRPARKTGSSGYFMKRTGLETLLRDGPADGKLLDTLQELRLMVLSNK
                     VEADTDGMSSHRIYLWLALFAIPPVPTDEYLGLVHRGRSPVYTKIRNDTFRTLATDPL
                     FKRRVTEASLIRLLNAVAWKLHDTQNPKPQSRPSSRRKEMLEMAIDSPPTITEETAEG
                     EPPAKSDTKAQGAIYVQGMNVLCAPFLYAARSEVEAFALFHYFVTKECPGYVRGAMDG
                     VHKGLRLVDRCLEIVDPKLAAYLFSKGMQAELYAFPSVLTLCACTPPLPEVLHLWDFL
                     FAYGPHLNILCIVAQLNRMRDAIMQSESPNKLLRSFPPLEADKIISLTVSFVRKIPDD
                     VYGDLVDHAK"
     gene            complement(<1136749..>1137717)
                     /locus_tag="TRUGW13939_00384"
                     /db_xref="GeneID:55987897"
     mRNA            complement(join(<1136749..1137182,1137234..>1137717))
                     /locus_tag="TRUGW13939_00384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483592.1"
                     /db_xref="GeneID:55987897"
     CDS             complement(join(1136749..1137182,1137234..1137717))
                     /locus_tag="TRUGW13939_00384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339485.1"
                     /db_xref="GeneID:55987897"
                     /translation="MNSNTSYKPSPLSFNSPRASPFRRPSSPGSPTTAIRASTPTSSP
                     GRGPTPVQSPSKLNQSYTIGDTEGTVVEDDNQPIPSPRSPRFREPPASPTKNTNNGRG
                     SFSSLTASRLSRSNLGNTDTLSKLPSAQLRDMREAFQVLDRDNDGNVDRADVADILSN
                     LGQDSSSSATAQFFPAGAAQTMNLPTFLNTISSLLAPLSSRTELLNAFAAFDDDDSGQ
                     VDIAELRDALLHTSPEAGESPLTEREVDDVLGGFTGRRAFGGKGKSAGLNGVKRGEVF
                     QYPEFVSSVMGGADNGSGAGNRADTPTKA"
     gene            <1139627..>1142184
                     /locus_tag="TRUGW13939_00385"
                     /db_xref="GeneID:55987898"
     mRNA            join(<1139627..1140327,1140381..1140441,1140496..>1142184)
                     /locus_tag="TRUGW13939_00385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483593.1"
                     /db_xref="GeneID:55987898"
     CDS             join(1139627..1140327,1140381..1140441,1140496..1142184)
                     /locus_tag="TRUGW13939_00385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339486.1"
                     /db_xref="GeneID:55987898"
                     /translation="MANPLPIRTPTGESQTEKPPHLASFPSSSQLSASGKTRISPAAS
                     FLKRSPSSAQKLRRRASVEHPDLLQTGKPRRFKSQYPLDSSERHVEYILVASFHIDRG
                     PIMEHQYPAAISGDESMLAELMLPDQTHVRSQDWTIFFLHKDTGEDDEDADQEGKKKR
                     KKGRKNKDTDGQENQYNDHERNAEESSDDDYDDDDDDDDNEGDDDDEEEEGGEGPPLM
                     YVLNLVNTKQDNTVRRGAVVKAMAICTRHSFLHIYKPLLLLALEEYFKAPYPETLASL
                     YDAVNAMDLSLLPRFSLLERSILQASDSKDMFIEKFERMIEQRVADDESERGSGSSSL
                     GSPTKARYTLPRDTHEYESKVVYNEIPIPVKIPTVIWPETVGDFSLIKLIQIFAAPHS
                     TAPQPFALHPHLTTNGAYTHPIIVLVNAMLTQKRVVFLGHNRPSGEVAEAVLAACALA
                     SGGILRGFTRYAFPYTDLTKIDDLLKVPGFVAGVTNPTFANHPEWWDLLCDLPTGRMK
                     ISSRVEPAPVTEGSKFFQQNNTPSGQAAASLDPTGDMTFMNDILQSINQRYGEGVIRA
                     KWRAYILKFTRVAAAFEETVYGASALYIMGPGEESASSGGGLKVDPSDPASLRGHGYV
                     WPDESAKNRELAACVSRIEGWRNTRSYYGFIQDVAASYHATGPVKSTDLQHHHDRLRS
                     LKLPSEVAGTIYLAFAHSIRDYAGICQLLTVTPESQAGLFYVSLGLFHTDPVVREATA
                     DLIDRISSHEAGRHFWNRVGRFTKLAYSRARRDRDALVNSPALSAGSHGDVFGAPLQQ
                     QQSLVGVALGETTSNRRS"
     gene            <1143210..>1144298
                     /locus_tag="TRUGW13939_00386"
                     /db_xref="GeneID:55987899"
     mRNA            join(<1143210..1143649,1143710..1144040,1144092..>1144298)
                     /locus_tag="TRUGW13939_00386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483594.1"
                     /db_xref="GeneID:55987899"
     CDS             join(1143210..1143649,1143710..1144040,1144092..1144298)
                     /locus_tag="TRUGW13939_00386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339487.1"
                     /db_xref="GeneID:55987899"
                     /translation="MASTTSRIRNKLNALWDALLHKDMSQNLGQNQVIEPLFLKSKQI
                     YLIDHDFSSTKVEDRYPPVLFEPCPQSLLDRNPVDIAGYDDPQFGNRVTEFQDYVAGA
                     ELSSIRHCTNRVSSQLGAWAYTFTRRDTTSAFVNLQIMRGIYPIEEPHGILLSKGFTM
                     STRDMKWSANMYEHNLVVWEKELPHVIVLSKQSQIGTDDSIMYGELAQLVTIMRNRAC
                     QPEEVLIDEDQNFEDEKEEQDARWPVRSKYVFGLEQRFPVLMVSIVGPQHGRIFFACM
                     DGHDDLIIRKSSLFSFERLATAPWDLFSRFLLSGPLLEDKHGNLISPRR"
     gene            <1150775..>1154877
                     /locus_tag="TRUGW13939_00387"
                     /db_xref="GeneID:55987900"
     mRNA            join(<1150775..1151683,1152403..1152515,1152579..1153102,
                     1153156..1153439,1153490..1154166,1154226..>1154877)
                     /locus_tag="TRUGW13939_00387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483595.1"
                     /db_xref="GeneID:55987900"
     CDS             join(1150775..1151683,1152403..1152515,1152579..1153102,
                     1153156..1153439,1153490..1154166,1154226..1154877)
                     /locus_tag="TRUGW13939_00387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339488.1"
                     /db_xref="GeneID:55987900"
                     /translation="MPPSPIGIRRGLAGVALHLTLILFLITSGRSSPTEISEELSDSP
                     EVNEHITPSTADVDAEGQPLVKRSSSFPTAFDTLGNNFTETSCPDFFHTFLNDTTYQS
                     CHAIAPLLENSNSFFKAMGSPSTLDPLLDTSCSANITECSTFMTNMASNLTDNKNCGS
                     DYQLGNPAVVQAYDSMVSYGPIAKAACLKDPSTEKYCFTEAATNSSNVANFYLYLLPL
                     GNSLPGGSRPTCNQCTQATMQVFQQSAIVKGNPLVNTYLSAAEIINVNCGPGFVNATV
                     NVGTQDATKNGSSAGSRLGMSPSLSSAIKCDKRSPCSNCRASSIVCRTASRPKEQRQR
                     ILISDQYEKKIEAIEGRLAHIETLLENLTSLSAAIPARMLATPSMSLQSSSSPSKAQL
                     IPPPSTHPSISSAAASSTSLSRARRDTKPNAAFEGDSSLRAHSVHASRVIENAMNSDT
                     GFGPNPEMQDALVALRNLIEKQHSGSVNQDYRFAAPQHGDASTVDISSVKMPAMESVV
                     GMLRICKETQNFLDLPFIDFEQFNELCKKVYFATEDYSVATFALVNGGLYHLFKGLAF
                     LQGKEFPEASENVSICRTNLEYALSRFNIFTAATSENLQALLIGASYAIDISQPSLCW
                     ALTSTAARLCQTLGYHRTVGTAGDNPLDLKLRNRMFWFTYILDKCLSLRLGHSSILQD
                     FDITLPLPEPSADSKMSMWDSMYHHWVKIGYFQGRIYEELYSPRALSGPAADRTQRAK
                     QLVADMQLWYQDVAQIDPSRAYNPVYYEAAASSSEIMYYGLSTLAYRAVPPGPLDSSI
                     IFSNGCIETARAALRAHQRNSERYKNSNSHIWHGYISWVLINCPFTPFMVLFCHAIAT
                     ANLEDLKCLGDFVSSLQSPGGTVEAAEKLWRLCQVFHRVAELYIKTKINHQEMYQQQQ
                     QHTHLDPGHQSQDAFQQQQPSVKHANDETLSDFSTPKFAPLQQQQQQQPPPFATDDFE
                     PYLSALGFPNAAGFLNIGDQNMATETTAEDYSSSNAPNGASDNIGSWLGGDSFSLENW
                     FTGNVNIMSLVETDLSNFGGTG"
     gene            complement(<1157283..>1158098)
                     /locus_tag="TRUGW13939_00388"
                     /db_xref="GeneID:55987901"
     mRNA            complement(join(<1157283..1157591,1157641..1157939,
                     1158002..>1158098))
                     /locus_tag="TRUGW13939_00388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483596.1"
                     /db_xref="GeneID:55987901"
     CDS             complement(join(1157283..1157591,1157641..1157939,
                     1158002..1158098))
                     /locus_tag="TRUGW13939_00388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339489.1"
                     /db_xref="GeneID:55987901"
                     /translation="MKIVASDKPIVNETITDLDKSNPTGVADEGNPSLNGDADLSGDS
                     DLSREARMAISIRNILEDVGEDPSREGLLKTPQRYAKAMLFFTKGYGENIYDVAKKAI
                     FEADHNEIVLVRDIEIFSICEHHLLPFWGKVHIAYIPNGRILGLSKLARIAEIYARRL
                     QVQERLTQQISQAIEEILHPQGVIVVMELVHMCVMTRGVQKTNSVTITSCKTGVFKTD
                     KAAEEQFEFLLKMKHT"
     gene            <1159132..>1162569
                     /locus_tag="TRUGW13939_00389"
                     /db_xref="GeneID:55987902"
     mRNA            <1159132..>1162569
                     /locus_tag="TRUGW13939_00389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483597.1"
                     /db_xref="GeneID:55987902"
     CDS             1159132..1162569
                     /locus_tag="TRUGW13939_00389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339490.1"
                     /db_xref="GeneID:55987902"
                     /translation="MNSLDSLKRALRQEVQETGFSAKRTLSNTQYSAGFNILLQDSGW
                     MTYQNFVIPQLCQLLTSFFKLRASISVLEIGPGPKSVIGYLPKHLRRIVRKYTAFEPN
                     ILFATKLDEWLRSETDSPLPCLTNLPDIHKIPFSGGDDIESGRNDERYDIILFCHSMY
                     GLKPEHRFIQRALNMLVEQPRHGIVVVFHRDRPIQLGSMVCHRVASFPNGEVRVANRD
                     GELDSFASFLAGFVMQDAIMDKDIQAKWRAVCRKLGYKKEFDPDHLFFGSPNIMVAFT
                     QKADRLGEIMAHVPLTRDDRIVKNWEARLHCAASVLRPTEIAQVQKCVRWARGHNVSL
                     TVLGGGHSGHCLWPHVVSVDMGSFDRVHVLAREEGQEQSSHLVVAEAGCKTGDIVRET
                     MAAGVTVPLGSRPSVGAGLWLQGGLGHLSRLYGLTCDAIVGAVIVSTSSKVLCVGLVP
                     DQLQPADAIRPENESDILWAIKGAGTNFGIVISVTFEGFAAPTYLCQSYVVSLSDHVD
                     AQLKLGDFDKLLASQLPRNCSADAYLYWDAGKLRLSVTTLESHQSKCDFAPTTAITTP
                     ALAYLEQAGDPRFVNGVELFDTEMYMSTMHGGGHGGGKTSSFKRCIFLKHVGKAEVAD
                     ILVTAIETRPTQLCYLHLLQGGGAIGDVAPKDTAFGCREWDFACVITSVWPREQTDIA
                     PCAVQWVYNVAENLMSVSSGAYGADLGPDPRDIVLSTKAFGPNWQRLATLKQNLDPQN
                     VLAYACPIPRLKLIVLVTGESGAGKDYCAEIWASEFIGYTQKTITACVISISDAIKRE
                     YAVATGADIKSLLWNRTYKEQHRPALTKFFQEKVRQQPRLPEQQFLNVVNNNTDVDVL
                     LITGMRDEAPVAVFSHLYPDRRLVDVYVQTSEQTRRSRHAGNNNEDNDSGNTETRPNK
                     TRLNYHPSFIFENEETGTRAAELFASNCLLPFFHEDLQKLDSMVRRVPNFPRVDIEFR
                     HVLGISQQPDGLRLTTSLLRDQFSGDWGNIDTVACCEAGGFVFASPVALQAEVPLTLM
                     RDAGKLPPPTISIVRRSSYISSYTIPNESIAKEKRIEMQPGMLSSGSRVVIVDDVLST
                     GETLCAMLQLLTKTGINIENIHIMVVAEFPIHKGRERLRQRGFGKVHIQSLLVFDGA"
     gene            complement(<1163118..>1164666)
                     /locus_tag="TRUGW13939_00390"
                     /db_xref="GeneID:55987903"
     mRNA            complement(join(<1163118..1163575,1163638..1164015,
                     1164080..1164272,1164326..1164349,1164403..>1164666))
                     /locus_tag="TRUGW13939_00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483598.1"
                     /db_xref="GeneID:55987903"
     CDS             complement(join(1163118..1163575,1163638..1164015,
                     1164080..1164272,1164326..1164349,1164403..1164666))
                     /locus_tag="TRUGW13939_00390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339491.1"
                     /db_xref="GeneID:55987903"
                     /translation="MASNVYQLKFESLLEEFKKTLKRRERETFRITTFKELENTIGDI
                     QARQHSERRPQNLNRLKPFLEAVRQFENVVKVFFSNDEIVPFIWGPIRFLLQVVSADT
                     EAFSELLGIYESIGENLPLLLQYKNYFSANPQMGRIIFPIYEKILEFHHIVLDYFQQP
                     QWKQLFKVTWNTLKFRFYSIVSEIGRYRSLVESEASPSQIEDFHESRRTEDRRFETEM
                     KDEDLRRSEAVYEWLRATNIDTDHYRFSEIRKDNPGTGQWLLENPTFKKWFDPQFPAI
                     PPLLWLSGLPGKNVLASLVIEEAQKLTPTPLVLFFYFKRNDSDRNNFPALARSLLAQF
                     LKQDRGLLLYFYKKCYSSTETELTSPSLIEELLNFAFKKCKSAYIVLDGLDECAREER
                     SRITQWFRKLVEDLPTSEPEKLRCLLVSQDDGVARKDFSGITSIKC"
     gene            complement(<1167242..>1169550)
                     /locus_tag="TRUGW13939_00391"
                     /db_xref="GeneID:55987904"
     mRNA            complement(join(<1167242..1168915,1168969..1169336,
                     1169406..>1169550))
                     /locus_tag="TRUGW13939_00391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483599.1"
                     /db_xref="GeneID:55987904"
     CDS             complement(join(1167242..1168915,1168969..1169336,
                     1169406..1169550))
                     /locus_tag="TRUGW13939_00391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339492.1"
                     /db_xref="GeneID:55987904"
                     /translation="MSDTLSPPGSSVYASDTMYVGDGTWDSTRNTFLLPNLMGVNFDT
                     MRYNGMGNRFRDMPGYHSMILAHGIIATIVFLGFVPAAILIVRYYSIWNRYWAYKYHA
                     WLQVLTLLLSTVVFILGWFAVGPRRSLTNPHHGIGLAIYVLIIFQALWGWFSHKVELG
                     KRRHRSPLKLVIHRWIGRATAILGIVQIPLGLTLYGSPKSLFILFAVAGFFWLALFFI
                     LSYRYDEGGIDYGSDYDSRGSYMSGPSSPEEKRHSGLGKTAAAVVAGAGLMKLFKSRR
                     SHDHAEEDIQSSYMDEKYSDEGHKTGWGKRLVEVGAVAGAAALAKSFWDRRRKRESDN
                     EAGRYRPAPHAHSDSMSEDTISRVEEGRPVAGTPGPYLHPGRRQSYSSMDYSYYTHPE
                     QDQGHGARNAILGAGAFAAVKNLFKRRKDDDEQRRIEDIKRRDREEEKVARANSQRKQ
                     SGDGFVPRRQKPSQSVLSSEMTSDITPRPARPDNRTQEAMVSGGVRDDTSTIPPAPPQ
                     HGQPPESVFDSDLESAVTGAAAGAAAGSASRRRSSSRRRHDGVSSPPVSVKVKMHNDG
                     RHVTLRRLTEEEAAANRQAKRHSRERHSSRRRGSASSLSGNEGGSDRWRRVEEMERRQ
                     AEQTQREQAAALAAESAATASVAPISPPPAPLAPPPMSHAATSQMSVPPAPSNMQYPP
                     TASLTSPGTWTGTEASADYANNRRRRRAERAQARARQQAQHSVEFT"
     gene            <1170637..>1171715
                     /locus_tag="TRUGW13939_00392"
                     /db_xref="GeneID:55987905"
     mRNA            join(<1170637..1170680,1170747..1170764,1170826..1171264,
                     1171332..>1171715)
                     /locus_tag="TRUGW13939_00392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483600.1"
                     /db_xref="GeneID:55987905"
     CDS             join(1170637..1170680,1170747..1170764,1170826..1171264,
                     1171332..1171715)
                     /locus_tag="TRUGW13939_00392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339493.1"
                     /db_xref="GeneID:55987905"
                     /translation="MPSESLQVFVKAVSRLLGWIYMLCWSLSFYPQPINNFRRRSTYG
                     LAIDFPTINVLGFVCYAIYAGAFLYSPLIREQYAARNPVSPEPSVRFNDFVFAAHAVV
                     LSAIVYSQFFPAVWGFKVARYQRVSKPVAGLFWGSLVAVAGLVLIVLRASPDGGSDAS
                     SWAWIDVLYGISYVKVVVTVVKYIPQAWLNYKRKSTVGWDIRQILLDLSGGVLSIGQL
                     VLDSSFEADWSGVTGNPIKFLLGNVSIIFDAVFVVQHYILYRHRSGETTGEEEEDDDN
                     KGPDLRTPLLSEDGGLPR"
     gene            <1173580..>1174494
                     /locus_tag="TRUGW13939_00393"
                     /db_xref="GeneID:55987906"
     mRNA            <1173580..>1174494
                     /locus_tag="TRUGW13939_00393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483601.1"
                     /db_xref="GeneID:55987906"
     CDS             1173580..1174494
                     /locus_tag="TRUGW13939_00393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339494.1"
                     /db_xref="GeneID:55987906"
                     /translation="MFVTTQFQQCPEVYSAGKLPYTALFDMSGFFSEQARRALEGDNE
                     MASHLFAADSCHQQQQQQPQPLVMSTSPSPTTTAYPYPQPAFYESQYYQVPFMAGSFD
                     SSASVSPVSPVSPVWNSHPQQQQQQQFEFAMQRYAEDAAARQQQINPVPSYHAVPRLS
                     HPRRHHIHNHYHQKQQHQQRHLPSSSSSSSPSITSDSLDNLSDCGVRSANGTWRCAHP
                     GCSSKTVFTRACDLRKHYNRHRKYLFCRFDGCPQSREGGFSSKKDRARHEAKHNPQIT
                     CEWQGCGRVFSRADNMKDHVRRIHCRGR"
     gene            complement(<1176916..>1178404)
                     /locus_tag="TRUGW13939_00394"
                     /db_xref="GeneID:55987907"
     mRNA            complement(join(<1176916..1177030,1177085..1177282,
                     1177329..>1178404))
                     /locus_tag="TRUGW13939_00394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483602.1"
                     /db_xref="GeneID:55987907"
     CDS             complement(join(1176916..1177030,1177085..1177282,
                     1177329..1178404))
                     /locus_tag="TRUGW13939_00394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339495.1"
                     /db_xref="GeneID:55987907"
                     /translation="MADVYDSDDACNRSPALQPAVIKYGPDEPSPPFPHKRPASRDRD
                     SPGSDGGRSRKHHRTHKALRSTQGDAVLIGILGPNRPDIAQQAGARPLRSESDSDDDY
                     RERAVKLSPRPSIVPSSDVAKQVASDALGLVHNEHVRNNHNNHHHNNNNNNILPPISE
                     LVFPPLPYHRRGSEQVIHDGLATSVVARYTISPSNMPAQELLPALHSPPHSTAGSPEN
                     TQSLPPVQSLLRDISSVSVSSPHYGAASAPSPAGVHSRRVSTSLPPPPLPPQSQMPTP
                     YSPAAPSPYPWRPSGFKSEGSTVSTVYETPSQGPLTGKSPANSYPTPTEPRPPGEENA
                     EAGSLYKCQFPDCNAAPFQTQYLLNSHANVHSQERPHYCPVQDCPRGVGGKGFKRKNE
                     MIRHGLVHDSPGYVCPFCTDQQHKYPRPDNLQRHVKAHHIDRSKDDPELRDVLSQRPK
                     GSGRGRRRRGHT"
     gene            complement(<1180131..>1181334)
                     /locus_tag="TRUGW13939_00395"
                     /db_xref="GeneID:55987908"
     mRNA            complement(join(<1180131..1180827,1180885..1181180,
                     1181236..>1181334))
                     /locus_tag="TRUGW13939_00395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483603.1"
                     /db_xref="GeneID:55987908"
     CDS             complement(join(1180131..1180827,1180885..1181180,
                     1181236..1181334))
                     /locus_tag="TRUGW13939_00395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339496.1"
                     /db_xref="GeneID:55987908"
                     /translation="MAGPLRQPIDIASLERYIGQNLPVVKTPLDVKQFGFGQSNPTYQ
                     LTASDGQKFVLRKKPPGKLLSKTAHMVEREYQIIHALEQTDVPVPKAYILCEDSSVIG
                     TPFYIMEFLAGRMFTDPAFPGVSATERNELWHDALRTLGKLHRVDPKSVGMEKFGKPT
                     GFYDRQIATLTRISQTQAGAVDVDTKQAVGELPHIGENVRFFSDRASQPRDRSTFVHG
                     DYKIDNLVFHATEPRVIGILDWEMATIGHPLSDICNLTSPWHMDTNEGKAAAFQPGHT
                     PGIPTRAQSLEWYGQAAGWDPRADVTWGDAFFFFRSSVIMQGIAARYALRQASSAHAR
                     EYALKMKPFAEETYQRVRVAEAERARGKL"
     gene            <1181715..>1182579
                     /locus_tag="TRUGW13939_00396"
                     /db_xref="GeneID:55987909"
     mRNA            join(<1181715..1182168,1182228..1182359,1182409..1182449,
                     1182496..>1182579)
                     /locus_tag="TRUGW13939_00396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483604.1"
                     /db_xref="GeneID:55987909"
     CDS             join(1181715..1182168,1182228..1182359,1182409..1182449,
                     1182496..1182579)
                     /locus_tag="TRUGW13939_00396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339497.1"
                     /db_xref="GeneID:55987909"
                     /translation="MLRPASKGWRLVYRPMIRTCNSFPHTVLRFSTSSTMTKETTPPP
                     DTSAAAVHEPPSLPASPLPKRTKTTEPDSSIASVMASSTSNGTAVTSISQPQPPLMVK
                     KLVESATAPTRGSAFAAGYDIYSAKEAVIPAKGKGLVDTGLAIAVPEGTYGRIAPRSG
                     LASKNFIDTGAGVIDADYRGEVKVLLFNFSDVDFTIKQGDRIAQLVLERIYTPDVLVV
                     EQLEESVRGVGGFGSTGK"
     gene            <1182861..>1184228
                     /locus_tag="TRUGW13939_00397"
                     /db_xref="GeneID:55987910"
     mRNA            join(<1182861..1182917,1182972..1182982,1183033..1183112,
                     1183164..1183376,1183432..1183549,1183613..>1184228)
                     /locus_tag="TRUGW13939_00397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483605.1"
                     /db_xref="GeneID:55987910"
     CDS             join(1182861..1182917,1182972..1182982,1183033..1183112,
                     1183164..1183376,1183432..1183549,1183613..1184228)
                     /locus_tag="TRUGW13939_00397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339498.1"
                     /db_xref="GeneID:55987910"
                     /translation="MSGEQDMVPETKVLAIASHVSYGFVGNTMATYVMQSLGCEVAGI
                     NTVHFSNHTGYRQVKGTKTSAQEIRELYQGLAQSYLTDFDVLLSGYAPSAAAVEAVGD
                     IAEDLKRRAESRPGSFFWILDPVMGDLGRLYVNEDVVPAYKKAIRHADLILPNQFEAE
                     VLSGVKISTVADITAAISAIHATYSIPHVIVTSIQLSRLGSSTPTSTLTVIGSTIRSD
                     GSPRLFSVDVPALDCNFNGTGDMFAALMVARLREAVFTASTTPQLKSTRSWVSPDDVA
                     STDLPLATATEKVLSSMHYVLERTMEARTAELAAAADEQDDTDGSTDEQRQFRKHLRE
                     TKAGEVRLIRNVHALRSPKVIFRAREWQSS"
     gene            <1185730..>1186601
                     /locus_tag="TRUGW13939_00398"
                     /db_xref="GeneID:55987911"
     mRNA            join(<1185730..1185861,1185952..1185974,1186064..1186194,
                     1186277..1186365,1186423..1186512,1186569..>1186601)
                     /locus_tag="TRUGW13939_00398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483606.1"
                     /db_xref="GeneID:55987911"
     CDS             join(1185730..1185861,1185952..1185974,1186064..1186194,
                     1186277..1186365,1186423..1186512,1186569..1186601)
                     /locus_tag="TRUGW13939_00398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339499.1"
                     /db_xref="GeneID:55987911"
                     /translation="MSSLRFARAALRARPAAIRLPLGRRTYADAVADKIKLSLAMPHQ
                     NLYKSTDVVQVNVPAESGEMGILANHVPSIEQLKPGLVEIIEESGGSKQFFLSGGFAV
                     VQPDSRLSVNAVEAYPLEDFSAEAIRNQIAEAQKIAGGSGSEQDIAEAKIELEVLETL
                     QAHVK"
     gene            complement(<1186823..>1188355)
                     /locus_tag="TRUGW13939_00399"
                     /db_xref="GeneID:55987912"
     mRNA            complement(join(<1186823..1188024,1188076..>1188355))
                     /locus_tag="TRUGW13939_00399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483607.1"
                     /db_xref="GeneID:55987912"
     CDS             complement(join(1186823..1188024,1188076..1188355))
                     /locus_tag="TRUGW13939_00399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339500.1"
                     /db_xref="GeneID:55987912"
                     /translation="MAPPTQSAPLASLLVARFLRSNNYTETLDAFIREAGLPSDAGET
                     TEKEPASEPAGVGRWTLEDIIQEKKTFDQSLTFERHDESVSAKDQWTSLAPSQPTVVG
                     TPSSTNLLHVSVKPWKRDDKESSTSYVVATGADKRLSLFNLDADQTVAASMTQLSDSP
                     ILSQTSVCDGKYQFLTGMSGKLLLVQNDQVIDSRKDHSKYTVQVAAYEDRDDGNVWIA
                     TAGWDAQVLVYHMKVPSPPDAPKIGEPVGAIKLPTNPESVLITRNPDTQELTLLVSRR
                     DSTHIYFYNLEALRSTNDDTDNAATVQCEEIGKQNLAPHSNAWIAFSPSCLALSPHDP
                     GLLAVALSTMPHMKVMIIRLLFPSSSSSSTQDSTPQTREERNESASVSQATQAMAALA
                     LQNREDAAIVIQTNTFAPQTPYSTPQVVWRPDGSGVWVNGDDGVIRGIEAKTGKIVTM
                     LKNGHEVGSKVRSIWAGWVGEKEDSREEWVVSGGFDKRLIVWR"
     gene            <1188875..>1190309
                     /locus_tag="TRUGW13939_00400"
                     /db_xref="GeneID:55987913"
     mRNA            join(<1188875..1189000,1189071..>1190309)
                     /locus_tag="TRUGW13939_00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483608.1"
                     /db_xref="GeneID:55987913"
     CDS             join(1188875..1189000,1189071..1190309)
                     /locus_tag="TRUGW13939_00400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339501.1"
                     /db_xref="GeneID:55987913"
                     /translation="MEAVTLQQSPATEPVANTVEPSMDIDMDIDLGPLPEPDAIETDD
                     VQQPPPVLQEGAVDPHTAEAQHEKVHVRGVDDLATADIKRFATDHFSAEEPSRIEWID
                     DTSANIVYSSEEVGLQALAALTQLGEEDASALPSLRLRTAKSLSSHLESVLQVRAAVK
                     TDRKKPRAHESSRFYLMHPEHDPRERLRRELSEKRSGHDDDGDYHRLRFDEREHRRRR
                     NRHADSDFNVNMYDDGPARRGSSAGSQDRPRSRRNRRPAARELFPGEGAGSGRLRDRS
                     ASPGRDNLDEMRRSDDERQQTRRRFRERSPRSSSANQKKELFPSNSDGNSRELFPNKT
                     AASYLRKELFPAKANSNHRRTDAIDAADETADLFARRMSVPLVDGAAEADTGELYIKG
                     AANDQGMALRGHGNGVSIKGNAQAVKELFPNKYNSNNAGKELFSDKLDGRGGRRRRAE
                     DMFA"
     gene            complement(<1194927..>1195754)
                     /locus_tag="TRUGW13939_00401"
                     /db_xref="GeneID:55987914"
     mRNA            complement(<1194927..>1195754)
                     /locus_tag="TRUGW13939_00401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483609.1"
                     /db_xref="GeneID:55987914"
     CDS             complement(1194927..1195754)
                     /locus_tag="TRUGW13939_00401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339502.1"
                     /db_xref="GeneID:55987914"
                     /translation="MQYRSPKQCRERFHQNLKPSLNHTPISAEEGLMIERMVTEMGKR
                     WAEIARRLGNRSDNAVKNWWNGSMNRKRRGLVVQTSSRTCNGRIEAPYPRASDHQRRS
                     SWSMVKTQAERSPVPVSHLIHNRPSSSHDHHTRHLAPVLTYSTRHVEPSMTSPAFSEV
                     STLEPPSLVSDHNSVSSASPRTLPSPQMLSLPVDMRHGYVERRCSVPTSFLQQGVSSR
                     EEAYAPSDREVSTHRKWETDYQSYKPSGHHYSNSVPEAVEPQIERRDSRMGLQSLLN"
     gene            complement(<1202945..>1207998)
                     /locus_tag="TRUGW13939_00402"
                     /db_xref="GeneID:55987915"
     mRNA            complement(join(<1202945..1203574,1203631..1206217,
                     1206305..>1207998))
                     /locus_tag="TRUGW13939_00402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483610.1"
                     /db_xref="GeneID:55987915"
     CDS             complement(join(1202945..1203574,1203631..1206217,
                     1206305..1207998))
                     /locus_tag="TRUGW13939_00402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339503.1"
                     /db_xref="GeneID:55987915"
                     /translation="MLPSVALPSPHFQPHHHIDRRLNYDLFARPYDMDQSGFLDPSFQ
                     QNAHANHINNSSSSSNTFAASVPRSRIQFAHPVQHPLSHATDLNGLPTKTAEHTLRRK
                     TPNGTLAAGYDGTPTDQANQPPAAKHILVNRQLTPSQLPLTADNWQPEHSVPLQYQNF
                     PPSFKQDVSRNNGALPTDNFQPGTGASWVRSVNMQLGMDSALHQTLPIPHSQHYFLQN
                     GPSIPTVLPATLQPCLGPTAPVGTGPYGPYWPDGAYIPYRPAALRDSRFDGSSPQLAD
                     RNNAVFDMQPPFVNHTSFATGAFSNTGLSWNQLAAGPVNQDSLLQNNFPPRHSHQNSF
                     GVAKDLLQHHLPYHVRAASRQTADPVGWNHSLSVPPSLSKAQSRVQTVEFKEKVLSWA
                     HGVYVDLLATIHHARKQSMSRSTATGQPQRPLKPTIYPKPPRQPGLDFSSSHPNLPRH
                     NSYPSSRFDFLPPEASLFNDKNRQSERSASGHMFGQNSTDTPRRASGTPLSKLVHNDT
                     NIVATAASALEMLSHLCNESSWEWIEGMLLGGCLAYGLGDYQKAVRWYMRIIAKDAGH
                     VEAISNLAASLLALDQKEEALQHWLRAVKLRPSFFEAVEHLINLLCTSHRGKEAVNII
                     EYVETNLRVPRNGDCFRSDEHASETESDADSTASYDRAAFDYDNDLDSALAMKINLND
                     SASAGFASSGFAIPGSDNGRMLALVHAKGNMLYALGNNASAAAAFEEAILIAAGPRRH
                     GMKSLIKQTLDAFTTSRNAYNPAIETDDSREPILLQPDKALQTASLVFPPYGNPPGLQ
                     YVAEGLAKKAAISTTSNCLLSLAKIYQDGMSTVSTAGAAKTATPGVRDILALYYLSLS
                     LQPSPSTANNVGILLASIQHNAPVKSRPRSTTSMTLDIPGVTPGSGIWLALTYYNYGL
                     KLDPKHAHLYTNLGSLLKDTGQLQAAIKMYEKAVQYDGNFDIALANLANAVKDAGRIN
                     DAINFYHRAVKVNPDFAEAVCGLANALNSVCNWTGRGGVLNGYGFTDRVHVDDNGLPR
                     DANTIQVGFGWMKRVVDIVDKQLKDGEAWGRGILTPSVIDQLCAQVSSVAPYGLKAKD
                     LNLLLRSWAGKKWEGSRIVRLVERIMRAITWQWYQDRHVYGKEYPLSRYRRPQLPSGL
                     ASPNAPTVLPFHTFTCPLSAKQIRHISQRNGLRISSATLRSPWLPSTVYPPPQPPNPY
                     LKVGYVSSDFNNHPLAHLMQSVFGFHNPNRVKAYCYATTPSDNSAHRLQIEREAPVFR
                     DASSWPVDRLVEQIVRDGIHILVNLNGYTRGARNEVFAARPAPVHMSFMGFAGTLGAE
                     WCDYILADELSIPRDTLSPGRRDYRINDRPFEDDHAEEVENWVYGERLVYTRDTFFCC
                     DHRQSAPDNHDPSIRWDQELERRWKMRKDLFPNLADNAVILGNFNQLYKIEPTTFRTW
                     LRILSDIPQAVLWLLRFPDIGEQNLKQCAVTWANKEVASRIIFTDVAPKQAHIARAQV
                     VDLFLDTPECNAHTTAADILWSGTPMLTYPRYKYKMCSRMASSILSSALPGSEAGRQA
                     KKELIAISDDDYREKARRLCHDLRYEPSFYGKGTGRLLELRKMLFTSRWQSKLFDTRR
                     WVSDLEDAYDKVWNAWVKGEENDIWL"
     gene            complement(<1212903..>1213593)
                     /locus_tag="TRUGW13939_00403"
                     /db_xref="GeneID:55987916"
     mRNA            complement(join(<1212903..1212916,1212970..1213326,
                     1213395..1213517,1213590..>1213593))
                     /locus_tag="TRUGW13939_00403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483611.1"
                     /db_xref="GeneID:55987916"
     CDS             complement(join(1212903..1212916,1212970..1213326,
                     1213395..1213517,1213590..1213593))
                     /locus_tag="TRUGW13939_00403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339504.1"
                     /db_xref="GeneID:55987916"
                     /translation="MPPKFDPNEVKVIHLRATGGEVGAQSALAPKVGPLGLSPKKIGE
                     DIAKATGDWKGLRVTVKLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSK
                     SVPLEEIIDIARIMRNRSLAKELRGTVLEILGTAFSVGCQVDGRSPKDVSDDVKAGEI
                     DIPEE"
     gene            complement(<1214126..>1216786)
                     /locus_tag="TRUGW13939_00404"
                     /db_xref="GeneID:55987917"
     mRNA            complement(join(<1214126..1214150,1214202..1214395,
                     1214457..1215554,1215610..1216089,1216148..1216442,
                     1216501..1216631,1216694..>1216786))
                     /locus_tag="TRUGW13939_00404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483612.1"
                     /db_xref="GeneID:55987917"
     CDS             complement(join(1214126..1214150,1214202..1214395,
                     1214457..1215554,1215610..1216089,1216148..1216442,
                     1216501..1216631,1216694..1216786))
                     /locus_tag="TRUGW13939_00404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339505.1"
                     /db_xref="GeneID:55987917"
                     /translation="MDYEALKDQWSDVEDRDGVRLSWNTFPSSRMEASRLVVPIGAVY
                     TPLKEKSDTPLLQYEPVTCKAPCKAVLNPYANVDVRARIWICPFCLMRNPLPPHYKDI
                     TENAIPPELHPQSTTIEYRLARPAPAPPIFVYVVDTCQEEDSMQALKDSLVMSLSLLP
                     PNALVGLITFGTMAQVHELGYGECAKSYVFRGSKDYASKQVQEMLGLLAPGLRPGAPQ
                     VPGRPPPPMGPAARFLLPVQQAEFQITNVLEQLQRDPWPVANDKRALRCTGIAVSVAV
                     GLLETSFQNAGGRIMLFTSGPATEGPGAVVSPELKEPIRSHHDIDRDNIKYYKKAVKF
                     YDNLAKRAAHNGHIVDIFAGCLDQVGMLEMKNLSNYTGGHMLLTDSFTSSQFKQSFVR
                     VFDKDENDNLLMGFNASLEVLTTKELKVTGLIGHAISLNKKSSSVGETECGIGNTCAW
                     KMCAIDPAASYGIYFEIANQGGPAPMQQGPQRGMMQFLTYYQHSSGQFHLRVTTIARN
                     LSGPAGDPALAQSFDQEAAAVLMSRIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYR
                     KDDPTSFRLEKNFTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDTGNSLIMI
                     QPTLDSYSLEQEGSQPVLLDSASIQPTHILLLDTFFHLLIFHGETMAEWRKAGYHEQE
                     GYENFRSILEQPKEDARELIADRFPLPRFIICDAGGSQARFLLSKLNPSTTHSTGGYG
                     GGVTAQTIFTDDVSLQTFMEHLMKLAVSGTN"
     gene            complement(<1217538..>1219159)
                     /locus_tag="TRUGW13939_00405"
                     /db_xref="GeneID:55987918"
     mRNA            complement(join(<1217538..1218296,1218354..1218904,
                     1218970..>1219159))
                     /locus_tag="TRUGW13939_00405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483613.1"
                     /db_xref="GeneID:55987918"
     CDS             complement(join(1217538..1218296,1218354..1218904,
                     1218970..1219159))
                     /locus_tag="TRUGW13939_00405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339506.1"
                     /db_xref="GeneID:55987918"
                     /translation="MIRQDSHRIDPKRRAVLDPKKKQFAAPSFKQQDYPHRLNFYDVP
                     PTAEITLEEFEQWAIDRLKVLAEIEACSYRNKSPQETEAHVEPLLKKFLPLAPNLSAS
                     AGVVNEQLRNERQKDHYSHFILRLAFSTTEDLRRRFVRAETMLFRFRFQKDDSKERHF
                     FIESLNLDWEPVSKDEKQELADQLANSTPGLRRFDDETWYKVDWERIPELVERRAVFV
                     RKGKAYVPQREQLSMVIADFTMRLEKAMELTSRALPRLDEDDRLTPILNHLSKNFGSA
                     ESVYSEGEGVVDGAPITAASVDPLSAHFPLCMRSLHMTLRKNNHLKHFGRLQYSLFLK
                     GIGLSLDECIVFWRQSFRGYTDDEFNSKYKYNIRHVYGDVGGDVNRRGRGYPPYSCQR
                     ILTESAPSTGQTHGCPYRHFSVDNLTALLQTTGVHDKDILRGVKEDVEKQRYHIACNR
                     VFEWAHKAEIKKVKEDGSWNQTDLDTIVHPNTYFKRSYLLKTAGKPSKE"
     gene            <1219838..>1220664
                     /locus_tag="TRUGW13939_00406"
                     /db_xref="GeneID:55987919"
     mRNA            join(<1219838..1220012,1220075..>1220664)
                     /locus_tag="TRUGW13939_00406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483614.1"
                     /db_xref="GeneID:55987919"
     CDS             join(<1219838..1220012,1220075..1220664)
                     /locus_tag="TRUGW13939_00406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339507.1"
                     /db_xref="GeneID:55987919"
                     /translation="YNMTTTKRLKKAARIILIGAPGVGKGTQTERLLARFPQLAAISS
                     GDLLRDNVRRKTALGIQAETIMQAGNLVPDSVMLDLISSELSSKGWITSPQKPAQPTA
                     VPSSSSSSSSTKSTSPSLTSSFILDGFPRTATQATSLDHILPINFAVHLSTPPAVIIS
                     RITKRWIHAPSGRVYNTDFNPPKVLGKDDVTGEPLTQRQDDSVDTWKERLNKFEESSR
                     NLLDHYDNKGCLWHVEGDSSDEISPKLFAELERRFA"
     gene            complement(<1220961..>1223614)
                     /locus_tag="TRUGW13939_00407"
                     /db_xref="GeneID:55987920"
     mRNA            complement(join(<1220961..1221506,1221582..1222130,
                     1222430..1222538,1222593..1222830,1222889..1223436,
                     1223511..>1223614))
                     /locus_tag="TRUGW13939_00407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483615.1"
                     /db_xref="GeneID:55987920"
     CDS             complement(join(1220961..1221506,1221582..1222130,
                     1222430..1222538,1222593..1222830,1222889..1223436,
                     1223511..1223614))
                     /locus_tag="TRUGW13939_00407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339508.1"
                     /db_xref="GeneID:55987920"
                     /translation="MTGQSKPVPLSPWQSAVAGATGAVLANAMVYPLDIVKTKLQVQV
                     KSRKADVQDAESTPHYESTLDAINKIFQDEGLPGLYNGLNGALLGVASTNFAYFYWYS
                     VVRAFYVASAKTSKPPGTAVELSLGAVAGAVAQVFTIPVSVVTTRQQTQSKSEKKGLL
                     ETGQEVINSEDGWTGLWRGLKASLVLVVNPAITYGAYQRLKDVFFPGKANLRPWEAFA
                     LGAMSKALATIATQPLIVAKVGLQSKPPPGRQGKPFKGFIEVMQYIIDHEGPLSLFKG
                     IGPQILKGLLVQGLLMMTKERMELLFILFFAYLRKIKEDRLKKIAERAAATAKTSLPC
                     AEFAETLPDSSTLPSRNWEKSGMGWWSPWSSGSQSDPEGHSDDSRRSKDESARSLWHS
                     PTPSSTTTTTSTSTSSQYTEWNSILNSFNWSQLKEPGNLVPTILLTGGLLFVFDIHRR
                     FLRRIPEATNISPSILRRRSLLGRITSVGDGDNFRMYHTPGGRLAGWGWLPWKKVPNS
                     RKELKDRTIHIRLAGVDAPELPHFGRPAQPFSHEAHTWLTSFLLNRRVRAHVLRPDQY
                     RRVIATVYVRNWLDFPPLRKRDVSEEMLKRGFGTVYEAKTGVEFGSKEREVRYREAET
                     IAKNRKQGLWKDFGRKKGKNNFESPREYKTRMGIEHPLGGTTPVKPEAAEESRGLLAS
                     LRGRLFSSRKKDNGS"
     gene            <1224225..>1228559
                     /locus_tag="TRUGW13939_00408"
                     /db_xref="GeneID:55987921"
     mRNA            join(<1224225..1224278,1224330..1224700,1224759..1224972,
                     1225029..1226889,1227044..1227264,1227328..1227438,
                     1227500..1227627,1227689..>1228559)
                     /locus_tag="TRUGW13939_00408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483616.1"
                     /db_xref="GeneID:55987921"
     CDS             join(1224225..1224278,1224330..1224700,1224759..1224972,
                     1225029..1226889,1227044..1227264,1227328..1227438,
                     1227500..1227627,1227689..1228559)
                     /locus_tag="TRUGW13939_00408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339509.1"
                     /db_xref="GeneID:55987921"
                     /translation="MSNPTIRSTTDAYLDRAQKYENEVFTAGSQTQALEAAIAAAESY
                     MRALNLAESSQDKKKLDLKCKEWLSRAEDIKTSGKWKTPGPGKKAPVLKEPVSSKKLS
                     TREEIILLESAKLNKFVFPPWKETPDFKEFELEQDGQKFEDKILGLSTSQKKVFNGWK
                     RPEELYPHYSHFASNDPMVGSEIMDLVQDVTTDCSVVASLCAAISRTERGHHALFRSV
                     IFPYDDAEDAPRLSSSGKYVFRFHFNGCYRKVTIDDRLPSSKSSRSLFVIDRNNPHVL
                     WPALLEKAYLKIRGGYDFPGSNSGTDLWVLTGWIPEQIFLHHEDVTPNQLWKRIADSF
                     RFGDSILTIGTGELNQREERLQGLISRHDYAILDLEEVDGRRQMLIKNPWADPASKVP
                     GTYGRTFEEQQPDVNKSQKPLLPGSFWMDYDQVFQNFENLYLNWNPGLFRCRQDIHFV
                     WDLSKPRLNQGCFAGNPQFSVSTEAGGPVWLLLNKHFRTTETPSAGDEPGFISLYVYK
                     GGGQRVFLSAGAFYGGPFVDSPNTLARIDMDAHSTYTIVVAEQSLPLLPQNFTLSAFS
                     RNEVALKNAETKYSHVTQTQGEWSPATGGGNTESPRYPSNPQFALQVVEEADISILLE
                     MSNLELAVHVKLFWSDGKRVSTVRKRDIITDSGDYRPGCVVAETKNLQPGSYTLVCST
                     FTPDQLANFGLWVSSTKQFHVKALPAETAGRLLVLSDIGVLPPGTDRIIAPLCVPRLT
                     RIKLVARSRESTIGNRHVASSPMLMTVERGQGPYKEILASSENGEFSDAISGIRVPDV
                     DIRPEYQQQGGIWIAIERIGGPGGQVTDHVDVEALVGSLAPLSRLRSTTSSMINPNPT
                     QLPTHSQRHLSTNKHGDQYPEQLESRRCRALHHSGGASRACQTRGRLLVLVSATGNYW
                     AVNQIISKGLHNSDEESIHFTTSLMDKLEQFKTENPDNDAITDNVAGQAYVEQFGLEI
                     FGKADNAIRANKASKQTADTFLAAATFLELCQIWGALDPDVLSKVKFAKYHAVRIAKA
                     LKNGEDPNLSNPAAEPAAENTEGEALDPNDPEVQAIQGTSTQPPARERQASVEEVPDE
                     SDRIQRQLAQQSILNESLHPSRSSSIPPPPLPQVPLDSAASNTEEAPPPELPSAPSDL
                     QLPQVPPTLPDTPKTIGGSAAFQSFPPPASSSAPDVPDLPQPPATFSAPSNPVIQTQP
                     PPVIPTATPTIGNRAPAAPVPGPAATSTPPVDDNSISQAQKHARWAVSALSFDDVNTA
                     IRELKIALQHLGAE"
     gene            complement(<1228913..>1231310)
                     /locus_tag="TRUGW13939_00409"
                     /db_xref="GeneID:55987922"
     mRNA            complement(join(<1228913..1229256,1229319..1229611,
                     1229666..1229772,1229832..>1231310))
                     /locus_tag="TRUGW13939_00409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483617.1"
                     /db_xref="GeneID:55987922"
     CDS             complement(join(1228913..1229256,1229319..1229611,
                     1229666..1229772,1229832..1231310))
                     /locus_tag="TRUGW13939_00409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339510.1"
                     /db_xref="GeneID:55987922"
                     /translation="MNSTPQPSSCVFCKASFSRPDALKRHWTTCKVRLAESWELPQIS
                     SKARGRKRKACDRCARQKRACVLKNNRQTCQPCAVQNKECSYRRIADAATEHQDQPND
                     LNCSNWAATGRESTTDEFPSGVSMGAVPQSAVQQSQCRETVAKSNPSFDLAHQRISWT
                     FFQEFNLGRSQNCRPTELNIALVAKFPFLGRVAKAHGFVGTFECGSVEHRSTVSKRLW
                     KPYAYRGVSEVWKRGLPSGPMLSSNYTPSIQADGLNLPTATNLHDFSNDSKFGDPPRK
                     LYSTSMMQAPETYSVGSTTNQHMSVLNVNSHLNACPGQGSDDNALLSIKTYEIVNAIR
                     NAIIDKPKNSTVTVTWSYQLETMCYQFFCPTNIEKFLALYWSCWYPNWPTIHQPTFDS
                     VTVDFTLVTAMVILGACLSPNQRDHDTANIWFNVIEEITFNHEVFSGNTTCEDQDENT
                     VASLSSRINILQAAYCVCLYQTWEGSKQSKRRVRRHRFNSIIWLARDIGFNHATLKSV
                     STADITEFEWNDFIIRESTIRLFTYIYNLDSAYAMFCGQPPRLLFQELRFDLTAPEAC
                     FQAGSAEECFVTLKSWRQTQIGYGDVTILSAVKALCHESLGNFDHFFATLSVLNMFTI
                     ISALYAIVFQLKSSPLPIPDTTWIRVGLQRWGRLWPSPVRDEELSARFTESEPDGWKG
                     VGFMRYAPEYWLLTNLVLNQILPGTGLSTAKGLEDTTRDDDTGMSQLNALVAEFRIKP
                     "
     gene            complement(<1232163..>1233709)
                     /locus_tag="TRUGW13939_00410"
                     /db_xref="GeneID:55987923"
     mRNA            complement(join(<1232163..1233247,1233310..1233364,
                     1233437..>1233709))
                     /locus_tag="TRUGW13939_00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483618.1"
                     /db_xref="GeneID:55987923"
     CDS             complement(join(1232163..1233247,1233310..1233364,
                     1233437..1233709))
                     /locus_tag="TRUGW13939_00410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339511.1"
                     /db_xref="GeneID:55987923"
                     /translation="MFSNIINSERRDGGSAAARAIDPRTKKELWDVPVANEKDLNDAV
                     FAAREAFKSWKLTSADDRQKCLFRVADELEARRGEMCPVLAKETGKSDLLANMEIDDT
                     LKFIRFNASQYLPDEVTYEDDELKIVSTHPPLGVVGAISPWNFPLVLAVAKIAAALVM
                     GNSIVVKPSPLTPYATLKFAELAIPILPSGVLQVLNGDNDLGRLMTLHPGIDKISFTG
                     STATGKKVAESASRSLKRVTLELGGNDASIVCPDVDVESVTRKVAAGAFFHSGQMCVA
                     SKRVYVHRDIFAKFREIFVDAVKDTVIDASGQQPTLFSPMQNEMQYRIVKGLIDDSKE
                     KGYNVICGGDTTEEQPGLFIRPTVVDRPPDDSKIVTMEQFGPIIPLCEWSSEDELVTR
                     VNDTDSGLGSCVWSGDGGTAERIARKLEVGTVWINSFGIPHPHGYFSGWKQSGLGGEW
                     GRQGLLSYCHTQTLQIYKQT"
     gene            complement(<1234194..>1236226)
                     /locus_tag="TRUGW13939_00411"
                     /db_xref="GeneID:55987924"
     mRNA            complement(join(<1234194..1234483,1234543..1234864,
                     1234926..1235425,1235482..1235622,1235696..1235877,
                     1235940..>1236226))
                     /locus_tag="TRUGW13939_00411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483619.1"
                     /db_xref="GeneID:55987924"
     CDS             complement(join(1234194..1234483,1234543..1234864,
                     1234926..1235425,1235482..1235622,1235696..1235877,
                     1235940..1236226))
                     /locus_tag="TRUGW13939_00411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339512.1"
                     /db_xref="GeneID:55987924"
                     /translation="MSFEQPLPLQFKGSRPHGSTPLALPPKVTIEDFNSFIQSITEFL
                     GADNVEVISTKEQIDDGTYMKPTYTHDPHHVMEQDYFLASAIAAPRNVADVQAIVKLA
                     NDLSFPLWPISIGRNSGYGGAAPRVRGSLVLNMGKNMNKILEVNVEGAYCLVEPGVTY
                     KDMYDYLVEHNLQDKLWLDVPDLGGGSILGNTLERGVGYTPYGDHWMMHSGMEVILPT
                     GELLRTGMGALPDPRRPETMGLKPEDQPWNKTAQLFPYGFGPYIDGIFTQSNLGIVTK
                     LGMWLMPNPGGYQSYLVTIPREEDLKQAVDIIRPLRLTMALQNVPTIRHILLDAAVMA
                     PKTAYSSKTEPLSGEELDEIAKKLNLGRWNFYGALYGPEPVRNALCGVIKDAFSAIPG
                     ARFFFPEDTPKDSVLRIRHKTMQGIPTYDELKWIDWLPNGAHLFFSPIAKVAGEDAML
                     QYAVTKKRCNEAGLDFIGTFTIGMREMHHIVCIVFNKKDPEQKKKAHWLIKTLIDDCA
                     ANGWGEYRTHLAVMDQIMGTYNWNKSIFLKFNEVIKNAVDPNGIIAPGKSGIWPRQYN
                     KDEWVLR"
     gene            complement(<1236779..>1237877)
                     /locus_tag="TRUGW13939_00412"
                     /db_xref="GeneID:55987925"
     mRNA            complement(join(<1236779..1237792,1237857..>1237877))
                     /locus_tag="TRUGW13939_00412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483620.1"
                     /db_xref="GeneID:55987925"
     CDS             complement(join(1236779..1237792,1237857..1237877))
                     /locus_tag="TRUGW13939_00412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339513.1"
                     /db_xref="GeneID:55987925"
                     /translation="MAAVLQDQGPNFTFRIQEVEIPTLKPREVLVKLEATGFCGTDLS
                     LAYGYLGSCNSILGHEGIGRIVATGSDCASKAAVEGQRVGIGWIRDACGSCRVCISAA
                     GGETRCITQVFSGRDIPGTLASFAVVPERYITPLPDDVPSELLAPVMCAGVTAYKALK
                     VANSTPGSWIALSGAAGGVGLLGLQYAKAMGYRTIAIDGGERRGGICLDAGAEIYLDY
                     EKEKDLRSAILRETGGTLCSAVIVCAGAASAYESALHCLDYFGTLVAVGIPPPTSKVS
                     FHPLTLIDYGVKVIGSITGDRVDILEAAEFVRRGLVKPKVIGIGLNELSQYSRRVNEL
                     DGKLVVRLEN"
     gene            <1239468..>1240714
                     /locus_tag="TRUGW13939_00413"
                     /db_xref="GeneID:55987926"
     mRNA            join(<1239468..1239510,1239586..1239747,1239804..>1240714)
                     /locus_tag="TRUGW13939_00413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483621.1"
                     /db_xref="GeneID:55987926"
     CDS             join(1239468..1239510,1239586..1239747,1239804..1240714)
                     /locus_tag="TRUGW13939_00413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339514.1"
                     /db_xref="GeneID:55987926"
                     /translation="MGSEKPAVLIIGGLGFIGRHTALYIHENNLASELRIVDKVLPQL
                     AWLAPEFEKACSKEHFVQADAGQEQAFPRIFDRANGKQFDYVINCAGDPRHSQPEEVY
                     QFRNHDMSLALAKEIVKRSIPVFVESATAMVYKSGSKPNKEDDKTAPWHNLAKWNLKV
                     DEDLAKIPELNWVGLRFPHVYGEYDRRYFSIGLCLARTHKFLERELEMLYSKDLKVNT
                     VYVKDAARALWTAAEWRASKGNDSTVPNVFNVVDHNDTSQAQIGQALSEIFDIKVSFL
                     GTLVSQLAKLSLDDVIEELNEESLQVWAELLEEKKITRAGPISPFLEKDLIKDQDLYI
                     DGSLFETTTGFKPEWPNFTVDSLRNMIASYERMGWWP"
     gene            complement(<1241746..>1244799)
                     /locus_tag="TRUGW13939_00414"
                     /db_xref="GeneID:55987927"
     mRNA            complement(join(<1241746..1241880,1241932..1242381,
                     1242444..1242683,1242747..1244324,1244389..1244636,
                     1244748..>1244799))
                     /locus_tag="TRUGW13939_00414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483622.1"
                     /db_xref="GeneID:55987927"
     CDS             complement(join(1241746..1241880,1241932..1242381,
                     1242444..1242683,1242747..1244324,1244389..1244636,
                     1244748..1244799))
                     /locus_tag="TRUGW13939_00414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339515.1"
                     /db_xref="GeneID:55987927"
                     /translation="MSSSDDDTPLVAASRSSGPGLSAPVISKRTDATIGGSGNANGSA
                     APGISIRYGPVEDEDSEMADAADGVNGRAASKRKSRLSAGNKSYMDPESSEDDKPLSK
                     RRRTANRKIVSDSEDDDAPLALKANGAKLPSASKTAIGDESDSDPPIKRKLSKEKSKI
                     EQKAAKEAKEIRKSEATSKKTAVKKEKAPSAKKKQANGVKRELSDDETLLKSVPKKTT
                     RPTKSESATPAKKGKDKATAVKEETEEVEGAEEEEEYRWWEDPTKGDGTIKWKTLEHN
                     GVIFPPPYEPLPKNVKMKYGGVPVTLEPEAEEVAGFFGSMLNSTHNVENPTFQNNFFE
                     DFRAILKKTGGAKDSQGKPVQIKEFAKCDFKPIFEYYEMKRIEKRNLSSAEKKKLKAE
                     KDEIEAPFMYCVWDGRKQKVGNFRVEPPGLFRGRGEHPKTGKVKTRVQPEQITLNIGK
                     SAKVPPPPEGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANSDVKGQSDHKKFEK
                     ARELKKHIDHIRKDYTKGLKAELMADRQRATAVYLIDKFALRAGNEKGEDEADTVGCC
                     SLKFENVSLRPPNTVIFDFLGKDSIRFYDEVEVDLQVFKNLKIFKKAPKKDGDEIFDR
                     LTTSALNKHLSNYMTGLTAKVFRTYNASYTFATLLREMNAEGSVAEKVKQYNDANRKV
                     AILCNHKRTVTAGHANQMEKLGDRIKGLRYQKWRIKMMMLDLDTSVKKKKGPKYFERD
                     EDLDQDWVREHQAFLIEEQKQKITKKFEKDNEKLIAEGEKEMKPKELEERLLTLKDME
                     KKFQKENKTGKVEADGRGQTIEKLENNITKLEQRIENMSLQAEDKENNKEVALGTSKI
                     NYIDPRLTVVFTKKFDVPIEKFFSKTLREKFDWAIKSVEEDWEF"
     gene            <1245398..>1248384
                     /locus_tag="TRUGW13939_00415"
                     /db_xref="GeneID:55987928"
     mRNA            join(<1245398..1245453,1245571..1246145,1246209..1246321,
                     1246376..1246431,1246486..1246575,1247075..1247141,
                     1247188..1247337,1247395..>1248384)
                     /locus_tag="TRUGW13939_00415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483623.1"
                     /db_xref="GeneID:55987928"
     CDS             join(1245398..1245453,1245571..1246145,1246209..1246321,
                     1246376..1246431,1246486..1246575,1247075..1247141,
                     1247188..1247337,1247395..1248384)
                     /locus_tag="TRUGW13939_00415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339516.1"
                     /db_xref="GeneID:55987928"
                     /translation="MLSRAARPALKAGSAAAIRAAPSNAAGFATLREIEGRLKSIRNI
                     EKITNTMKIVASTRLTRAQKAMQESRVYGETSNTVFESAETKPLDDKKTLFVVASSDK
                     GLCGGIHSSLSKATRRLLVGNENADIVILGEKAKAQLSRSNAEKIVLSFSQVCKDIPT
                     FADAQAIADQIALLPADYASVKIIYNKFVNAQSYEASIVEAYSEEAITESPNISAFEV
                     EEEALANLRQYALANSLFWALAEGHACEISARRNAMENASKNAGDMIQKFQILYNRQR
                     QATITGELVEIITGATASEDILMLTIHLAFPLSKSSSHEGCILSLGMVDYYKILGVAR
                     DASARDISTSYKKLALKYHPDKSDNTDKSLAYFQQIQEAIEVLRDPVKKEKYDKTEPR
                     FEWEKVVDDIYNDYSDAWATWDPEDPDYQEFAAWEEARYKQTWHEEGEAEDTTQSQQQ
                     QQQQQEEEEEEEEQHWRKSQKEWRQKRAEAMRARIIRDEENLNTDEDKSEIFSKIPIY
                     ECHVNGSTTTEEDADLLQNSKYDSHLDSYPLIDLSDPPEDDHPGGQYASGIQELLGDN
                     GWVDNEYIEAVVSNQQTTSQGPYERLSRFLEYKLCSGRYHQENMQAEIAGLYLESMQQ
                     CFMDLQMHHMDDNVTCNPEGFRQCHHLGPWEKHLGAEECDVCGIWRPLYTMSCPACKV
                     KACVGCKYEKNNEELI"
     gene            complement(<1248662..>1250188)
                     /locus_tag="TRUGW13939_00416"
                     /db_xref="GeneID:55987929"
     mRNA            complement(<1248662..>1250188)
                     /locus_tag="TRUGW13939_00416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483624.1"
                     /db_xref="GeneID:55987929"
     CDS             complement(1248662..1250188)
                     /locus_tag="TRUGW13939_00416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339517.1"
                     /db_xref="GeneID:55987929"
                     /translation="MASPQPGDIAYLPQELFQMLVGYLEPVDIVRCRRVSQTWYEAFG
                     NPSSLIPIAKERFPLAKEVRELYQTAASACGEEYSEKRLHQWRAVFDKVSERYYRLAR
                     GRPRSIQKFNLQGNNNHGKGGYRTFRVSPWETHSSHFGDNIDMFFDQALWTYEEGLAV
                     FPNEDEDCLTLLDLETQHTFMVPFVTAEKIIRRLRLHDRLLVIEWAENEPFHWLNERD
                     SVHRHYATSFDITQDGRGWDITLRNEWKIMFLGHPLGERDRFFSTHSRSHYAIYVWQP
                     NRSLYTAEEDAPIESLSVWDISRRSEYRASQDPTGRLRDTSADSGPPIVNRLTFRELG
                     FHSVRQGGLPGIIRLDIPNGSDSISITEVKNPGLSDEYNPLEYSPRVFVTTIPFIGQG
                     PSWRRRVDTLFPPYRGNCAMEIPPWTKTAPFPCYWGICEATDNKAGVSFCLSYLFPQS
                     YVEGTETHTLTVTIHTPGAITRLSHDLSRQLSVKGKICGNERFVIGEDGENQLTVLRF
                     "
     gene            <1250610..>1252104
                     /locus_tag="TRUGW13939_00417"
                     /db_xref="GeneID:55987930"
     mRNA            join(<1250610..1250753,1250819..1250826,1250883..>1252104)
                     /locus_tag="TRUGW13939_00417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483625.1"
                     /db_xref="GeneID:55987930"
     CDS             join(1250610..1250753,1250819..1250826,1250883..1252104)
                     /locus_tag="TRUGW13939_00417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339518.1"
                     /db_xref="GeneID:55987930"
                     /translation="MPAHLHLALLASLLGGASAAGLYTKSSPVLQVETNNYDSLIAKS
                     NHTSIVEFYAPWCGHCQNLKPAYEKAAKSLEGLAKVAAVNCDEDENKPLCGQMGVQGF
                     PTLKIVVPGKKPGKPRVEDYQGQRSAKAIVDAVVDKIPNHVKKLTDKDFDSWTTADES
                     PKAILFTEKGTTSALLRSLAIDFLGGLQLGQIRSKESEAVEKLGITSFPTLVLLPGGE
                     ADPIIYEGEMKKKPMLEFLSQAAQPNPDPAPSSLKKKKAKGSSKLTEKDSSQQTESPK
                     PNVEVTEEEKPVAVPVKAPEVSELSTPEDLESACLTPKSGTCILALLPETQSPDSELP
                     DDAKEALATVSELSHKLAAHRLPFYSVPSINSYSKVLRSQLGLLEESGTELIAVNGRR
                     GWWRHYTQTEKDGFSLHAVENWVDSIRLGEGAKSKLPEGVIVEDKQQDPEDETPAEEK
                     EATHDEL"
     gene            complement(<1254043..>1257306)
                     /locus_tag="TRUGW13939_00418"
                     /db_xref="GeneID:55987931"
     mRNA            complement(join(<1254043..1254244,1254320..>1257306))
                     /locus_tag="TRUGW13939_00418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483626.1"
                     /db_xref="GeneID:55987931"
     CDS             complement(join(1254043..1254244,1254320..1257306))
                     /locus_tag="TRUGW13939_00418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339519.1"
                     /db_xref="GeneID:55987931"
                     /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDRAKDVIVNLYHIM
                     STADVKQNKSVLWAYKKDLIGFTSHRKKREAKIKKEIKRGIREPNSEDPFELFLSLNQ
                     IRYVYYKETEKILGNTYGICILQDFEAVTPNLLARTIETVEGGGMVILLLKGMSSLKQ
                     LYTLSMDIHSRYRTEAHDDVVARFNERFILSLGSCDSCLVVDDELNVLPISGGKNVKP
                     LPPPDPSEEGNSASKKELQEIKDSLIDTQPVGSLVTLAKTVDQAKALLTFVDAIAEKT
                     LRNTVTLTAGRGRGKSAALGVSIAAAVAHGYSNIFITSPSPENLKTLFEFVFKGFDAL
                     GYLDHVDYTILQSTNPAFNKAIVRVNIHRNHRQTIQYIQPQDAYALGQAELLVIDEAA
                     AIPLPLVRKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGASLKDADTDIAD
                     RATGKSTRNSEKAIGGRSLREITLSEPIRYAAGDPVEKWLNKVLCLDATLPKSKLNTQ
                     GCPHPSQCQLLHVNRDTLFSFHPVSEKFLQQMMALYVASHYKNSPNDLQLMSDAPAHQ
                     LFVLVPPIDEDAAKLPEPLCVIQVALEGRISRESVMNSLSRGQRAGGDLIPWLVSQQF
                     QDEDFAGLSGARVVRIATNPEYLNMGYGSRALELLVDFYDGKFTNLSEDASYPSDEMV
                     RITDAELENANLLQDNVQVRDIRSMPPLFGKLSERRPDSLDYVGVSYGLTPSLHKFWK
                     RSSFAPVYLRQTANELTGEHSCVMLRALAAGSNDISWLSAYARDFHKRFLSLLSYQFK
                     EFPSVLSLSICESATAGSKSDPSFSPLPLTKATLDGAFSPFDLKRLDSYANNMLDYHV
                     ILDMVPIVAQFYFFGGLQGKVSLSGVQQSILLGVGLQRKDMDSLEKELNLPASQLLAM
                     FIKIIRKISTHFRSLLEGAVEAALPERSAVADVSTAHDDVTDDKFQPLEVDLDEELRE
                     GGEEIDQEMKEKQRALIDSLPLDRYEINNGPTSWDNAEKQIRQGGASTVSIKSTKQHK
                     RKAGDTAREIYDQEVESKIRKKVKKGTEGKKK"
     gene            <1258634..>1261424
                     /locus_tag="TRUGW13939_00419"
                     /db_xref="GeneID:55987932"
     mRNA            join(<1258634..1258655,1259036..1259115,1259173..1259319,
                     1259371..1259801,1259867..>1261424)
                     /locus_tag="TRUGW13939_00419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483627.1"
                     /db_xref="GeneID:55987932"
     CDS             join(1258634..1258655,1259036..1259115,1259173..1259319,
                     1259371..1259801,1259867..1261424)
                     /locus_tag="TRUGW13939_00419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339520.1"
                     /db_xref="GeneID:55987932"
                     /translation="MHVVGTRISIVELFQRRGNDWGKSTLQLFGIILLGVVGVWLPVG
                     FVVYLIRPGYFLFTALNYYHAVFTLATLLTITCITSLWLISRFGLLNISLLTSFLIIC
                     ATLTRLLFSGAPLYAQPSVGKLTFSLLVLPIGGAMLLNVNKMSETESRFTLSTKTWVF
                     RLLLVFCAGSLILTLMPRNQPQTLPIDILIQTGREQHEMYVNQAKVSNNLEEAVSEYK
                     RRYNQYPPPGFDQWYDFATSRHSPVIDDFDQIYSDLAPFRAYPPHYWRRLTHELATDS
                     FSDIGAIRIRNGSSRAQEGVKPTHAWMVHATMEMLDAFVKYLPDMDILLNLNDEPRVA
                     IPQHAMSEMRSAAKPADFGNGEPPIKVWSADRESKWDPIEPVNMAPFSLFTDYAKSNI
                     WDVANQICAPLSKARSERAWNRRDLCLDCLQPHSLEQFVSDWTLAADICHQPDLKNLH
                     GFFTSPASWKTSQHLVPLFSQSSLPGFGDILFPSPWNYVDKVKYEPSTAHPDVPYLEK
                     KNTLFWIGATSEGISINGEWKGMTRQRLMHLMNNNSATAVTVLMRSGADKGFKYHVVD
                     GAAPREKLGLQADVYLSDVVRCDDCETQEQELGNPAKRISFQEHWKYRYLFDMDGAGF
                     SGRFHAFLQSHSLPFKTGLFRQWYDPRLTPWHHFVPQDVRLHDVWSTLGYFSGITVQG
                     GSKESTSVLMEAHEEEGAYIAEEGRDWAQKSLRKEDMEIYFFRLLLEWGRLTDDQRDQ
                     LGFDP"
     gene            complement(<1261765..>1262919)
                     /locus_tag="TRUGW13939_00420"
                     /db_xref="GeneID:55987933"
     mRNA            complement(join(<1261765..1261926,1261988..1262411,
                     1262462..1262697,1262755..>1262919))
                     /locus_tag="TRUGW13939_00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483628.1"
                     /db_xref="GeneID:55987933"
     CDS             complement(join(1261765..1261926,1261988..1262411,
                     1262462..1262697,1262755..1262919))
                     /locus_tag="TRUGW13939_00420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339521.1"
                     /db_xref="GeneID:55987933"
                     /translation="MRASTIVQLAALAQLGSGHRHGGLHHRQTSGNGTYTLSDNYPTG
                     LDFFSKFSFSTDSDPTHGYVTYVDQDTASSAGLIAAKDNGTYIGVDSTNTASGSGRQS
                     VRLTSTATYNKGLFILDLAHMPGSVCGSWPAFWTVGGDWPTYGEIDIIEGVNQQSGNA
                     MTLHTSDGCTINDSGFSGQVSTSNCFVDAAGQSNNAGCGIDSSDTTSYGDGFNGNNGG
                     IYAMEWTDEFIQIFFFSHDNVPADLTSANPNPAAWGQPAALFSGDCDIDSHFQNHNIV
                     FDITFCGDWAGSVWSSGSCATQAASCNDFVQNNPSAFESTYWQVNSLKVYSR"
     gene            complement(<1266683..>1271535)
                     /locus_tag="TRUGW13939_00421"
                     /db_xref="GeneID:55987934"
     mRNA            complement(join(<1266683..1270665,1270720..1271155,
                     1271206..>1271535))
                     /locus_tag="TRUGW13939_00421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483629.1"
                     /db_xref="GeneID:55987934"
     CDS             complement(join(1266683..1270665,1270720..1271155,
                     1271206..1271535))
                     /locus_tag="TRUGW13939_00421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339522.1"
                     /db_xref="GeneID:55987934"
                     /translation="MSSMNEGKNDGAREDELDLDQEDQDQDLPAHTNGHVTTNGAGPT
                     SHLDTDDLDETGSNQSDDVPAIVTDPGDVGPQEDITEEDGASQSLPRAVPGAEDTSSL
                     PDDTPSLHGSLRSSPGSSAFALRESSASSPSPAHRPFDLRFQSRLSSSSFSSPRASSP
                     FIFHNHSRNSSFASQPFSATADLEHEPQQAPWEVVRWTKLRKIGGQSFSELGRRNFGQ
                     PTCISVSTMIVLGTSKGIVLVFDYQQNLKTIVGSGTKAAEAGAVTSIAMSADYTTVAA
                     GHMSGDIFTWEISRAARPFLHIPPIQTRQHEELSVDGHITGVSILHLGFLGTRRTALV
                     SADDRGMAFSHLATRGMGAVGRTVKTTRILGRYPEFSLQNARPRKPSSVLAFSALPLG
                     NVDQPTDGLGLVAMLTPYLLVIVSTTPVAQTQYKSPRPKEVGSHNVMSAALAWFPAIK
                     LKGKDEVSQTKLVYCWSNVLTVLEVFESDSDSGSTKDRPPVLEFHPRSRWRADEAIVA
                     VQWLSRSVMAVLTITQQLLILEDKTLRVTDSFDLLHKHIYHVDLFSSQLHSLVEQYDE
                     NDASMHGVVADAFHQSFKAYKGRLFLLGYNDLSVGSLSNWADRLLAYMEVGDFVAAIR
                     LATTYYQGDAEKLTVGLPEEDDIRHSVVGEKLLEMISASLRFAFGRNQEAGAERVQKS
                     QLKDLADASITSCTCIEDYDFLWEEVYEWYEEHESEGIFLDVLEKFIREGQVRSIPPT
                     AFKALITYYSTNHTSAWLEEVICLLDPTTMDLEQVTMLCKQHNLYDAYVYVWNRVLGD
                     YIGPLETLLEFVIQIMKSTTDGNDSADIGAKDYENAMKIFPYLSFVLTGRIYPTGEEL
                     EEDDATNSKTSLYTYLFSGGRSASSGQKNPASSLQTILKFDSSSFMSMLNEAFEDSFL
                     NDSADLADGSPAPGLRMNRQYVISILLDAMRSPEFGPLETIYLDMFIARNLPKYPQYI
                     LLSGTTLHQVLERLCQCPNKEMADDCELSVEYLLSVYHPPDIQSLIPLLKEAQFFRVL
                     KSTYRAEKRYPDLILIYLEDTSEREQVFKCIFDCLRSGTGLNNKQQRDVIQVIKSHPR
                     ELALIDVSEAARTIQKVIPSLHPSFLESLSQDDYKQFHYLATLLEPEIYNAGTKTVPA
                     ELESPIVERYVQLLCRYNRSHVADFVDALRAHELRLEEVLPAMESSGVVDAAVVLLAR
                     QGELRRAMDRLLAYLGTLESGLVGIFRNADDSPDSAGTAEAIRDLLESLEKYSGVGIW
                     LCQGRTRTSKSKQNGTTRGNKRVSVALQQPLTFEEELWLDLIDAIVRIVRNTSSLLPK
                     DSKSKWALPSGDEKHRAEGTGGEISFVFRQLVQRVFTALLSCTTTTGDPSESAQVSFL
                     RVLRAFLARAASSSPSLSELRSVLASIFSTYTYEESLLSLANGMLDKDLFVHVDEVTK
                     LRQRGWRPRGQVCEVCRHRIWGPGAGASIWTAWERRRAEGERERADKSLDHDNSLAKG
                     KGPSKIEEEVKLTVTTPDGEELSNDAMSKDKTQPNSGPVVVFACRHICHRDCLLNRNP
                     EDEGGLEESSHLRTSLRPDAGWELVCPICT"
     gene            <1273067..>1274020
                     /locus_tag="TRUGW13939_00422"
                     /db_xref="GeneID:55987935"
     mRNA            join(<1273067..1273589,1273659..>1274020)
                     /locus_tag="TRUGW13939_00422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483630.1"
                     /db_xref="GeneID:55987935"
     CDS             join(1273067..1273589,1273659..1274020)
                     /locus_tag="TRUGW13939_00422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339523.1"
                     /db_xref="GeneID:55987935"
                     /translation="MLMQRLAFLSAALAPLAAAQCNGHSEFCDRSWSNITLVGAHDSP
                     FVGDGLSDNQNINITAQLDLGIRFLQGQTHKSGDTIELCHTSCILEDAGSLDDFLGSI
                     KTWLDANPNEVVTLLVTNGDNLDISEFASVFNSSGILPYVYTPPTSPDVLPIDQWPTL
                     QELIDNGTRVVAFLDYGADTTSVPYILEEFNYYFETQYDVTDSTFSNCSIDRPAGASP
                     DGLMYIVNHFLDKDVLGIKVPDRDAAPTTNAATGDGSIGANADLCDDLYGRPPNVLLV
                     DFTDQGAVIDAQNALNGV"
     gene            complement(<1274197..>1277502)
                     /locus_tag="TRUGW13939_00423"
                     /db_xref="GeneID:55987936"
     mRNA            complement(join(<1274197..1274228,1274284..1274386,
                     1274446..1274866,1274927..1275373,1275436..1275603,
                     1275662..1275833,1275895..1276372,1276429..1276611,
                     1276672..>1277502))
                     /locus_tag="TRUGW13939_00423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483631.1"
                     /db_xref="GeneID:55987936"
     CDS             complement(join(1274197..1274228,1274284..1274386,
                     1274446..1274866,1274927..1275373,1275436..1275603,
                     1275662..1275833,1275895..1276372,1276429..1276611,
                     1276672..1277502))
                     /locus_tag="TRUGW13939_00423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339524.1"
                     /db_xref="GeneID:55987936"
                     /translation="MAPGQPFQSHGFQTSIDTARQQTTPKTTTTTTTTIAPVAGVKRP
                     LQTIGDRRPRVTTTTAASLHRYTHRQAQDSTPDNNNYQKIVPAAEATHTSRIVASAIS
                     GPTSALAPPTATHARPQSAASPLLSLQHPKYGLPPTLVSNFKAVGIDSIYPWQASCLL
                     GRGHLSGERNLLYSAPTGGGKSLVSDVLMLKRVIEQPARKAILVLPYVAVVQEKLKWL
                     RRIVQDVEKNIVVDDSDNDAAAKPRTRPPKEIRITGFFGGSKSRTTWADTDIAVCTIE
                     KANSLVNAAIEECTIGDLAAIVVDEIHMLDDDSRGYLLELMVTKLLLLQQDIQIIGMS
                     ATISNTDLLAKWLRASYHGSDHRPVPIEEYLVYENIIYQAAQSKEFFQTATKLDPASL
                     LQASLGSYRVIDASAFKQLAKPTVNAMVALAVETATAGFGALVFCGSRLACQANAMLI
                     GGAVQPPSASDAEILEKRLDLLAELQSLPCGLDPVLQVTVPNGVAFHHAGLTTEERDL
                     IADAYDQGIIKIIVATCSLAAGVNLPARRVIMQGARMGRDLVGPALLRQMRGRAGRKG
                     KDTVGETFLICEKPDLEDVAEIWDAEIPAIESCLAQDQDNKGVKRALLEAIATRLVSG
                     REAIEEYMRNTLLYRTREAAEIQKLTEASLQELVDAKLLHLREDESYEATKLGGAIVA
                     SSFSPDDGLFIHEELKRALEAFVMDGEMHIFYMFTPLSVAMNNVIDWIVFRDQLDALD
                     ESGIRALQFVGVQPGFVNNMAQCGRTLKEDNPAQLNLARVYHRAFTAFQLRDLSNEVP
                     LSTISSRYRTPRGVVQTLAQTCHGFAAGMVRFCQRMGWGMLAVVLDHMRDRLQAGARD
                     DLLEMAQVTFVKSRTARLLWENGFRSVRALAEADPKDIVPVLMMSRPRKMQEQQEIER
                     YSAKIQRKAEVIVGSANRIYELQMHVEIDE"
     gene            <1280666..>1285873
                     /locus_tag="TRUGW13939_00424"
                     /db_xref="GeneID:55987937"
     mRNA            join(<1280666..1281419,1281476..1281959,1282021..>1285873)
                     /locus_tag="TRUGW13939_00424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483632.1"
                     /db_xref="GeneID:55987937"
     CDS             join(1280666..1281419,1281476..1281959,1282021..1285873)
                     /locus_tag="TRUGW13939_00424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339525.1"
                     /db_xref="GeneID:55987937"
                     /translation="MSEDRQSTESLPPPAEASDAASNGSPPARPKPRQPALSTKPPSI
                     DKPDEGIPSEAVQSAPMTASNSSSSEAGQVSDPLAAGPYSTRSRGRNGASRPNYAEDI
                     EMDFELTSPAPSAIKMATAAASAKRYAASSLSSSPATTETEKGPAASTRKGHATTNGV
                     HPSPAAKDMIPGTSSFSANAAANGAVSAVSRKRKQPHGGASVNGSAKRLSTAAENQSN
                     FRLSNMMTFENCGARLMKNGKLKADDGTTLEVNDHVYLICEPPGEPYYLGRIMEFLPA
                     KGNPSGPVEMIRVNWYYRPKDIQRSVSDPRFVFASMHSDPCPLSSLRGKCSISHVSEI
                     SNLDDYRRLKDTFWYDKMFDRYMLRYYDVVPTKDVINVPENVKRVLDERWKFILCEPA
                     RKKELTGAVKTCIKCGLYAASAESVDCAVCHKTYHMNCVRPKLTKKPARGFAWACALC
                     SRAQERRLEARNTSNVTADSHHDMEEDLPEEDDDEPMVDATATGRSSPATDDKTKKPE
                     PATAAQIAQAKMWPYRYFGIHCQVEDALDYDDRIYPRASSRIGTRHQAITAPWYGQPV
                     QYTKPLDARKKAKGTGKGAVHKMSKETQAAIEAEKQDRLARPWVMDEPTGFIRRGEDE
                     PVTVNGKQVRTAELLFKMSEANQIPSGRGEDDAPGSEMTPEDREKFIDEYMTRAKEVA
                     SERGLPKYHTNFLDKALEYLYSESFNVDAALKKLKKADLYKDLKEPKLNKEQKALFEE
                     GVSKYGSEWLNIRRHIGNIEPRHVVRYYYMWKKTPEGRRIWGSYEGRRGKKEAIRANS
                     SSKLLDDIADEQDDSAFDNDKATDKKRGFQCKFCTTRSSPQWRRAPLTTPGATVPADP
                     ATKKADKGPQLAVALCHRCAIMWRKYAIEWKDADELAKKLQAGGNKAWRRKMDEEMLA
                     QMLVSDEGPLNINSNTRATAQQIGVNVNGSVANDSQSEPAKKKPRTLIDKDSATNSAR
                     NSVEPLPRKKATEKPAEPIPIIPDHPRQKTLPCAVCRRIDSGAQNSVTCKDCQLTVHR
                     RCYGVNSRIDSTMKWFCDTCSNDRNPTASTRYECTLCPVTVTEHELMEAPPKSSNKKK
                     TDRDKEKEKMDREVIAKVIKNYQEKQEAAGKPIGPREPLKRTAGYNWVHVNCAVWHPE
                     IKFGNAEEFEPADGFTLIPRQRYKEICKVCRTINGACVSCDYPGCNAKFHVGCAFQAE
                     YGFGFSVSPVKGSRKEATATVRIGEETGLASPTVWCSSHTPQTIVHDLGEPTDQDGLS
                     ALGLYVKTYKQADFTIARKTTSSQHISVPSTHTSVNANRRASAANAGVIEARNTAHEN
                     GEGLDTSPPMETSHTSAGPQGSKACFHCKTTFSPRWWSIENPFRGAMAANGMSHLTNG
                     AGLHARTISQNSIPYINGDHHHPESEPAFECHKCHLKKPMVVPPSESRPPPYATNMGH
                     VLPGSRAADYTPPYVSHAHPPQPGPLARPPHPSGPLPPPPPPPAAHSSEWYNGYEKMP
                     GHGVNALPPQTNGFGPPPVSYSSGHLPHLNGYNGPPGAPAPVPPPAHSHHGPPPPPPP
                     PQAPHHPHPAPGHYGTVPPPPPPTAHPYPGPPYAPSTLPSPHAPQNRPFGTSMSPPDI
                     HASIARRSPPNALGTAPRGYPVERVGHSPLLSRGSVDPPLPSTPNRSEEQAIASTRPT
                     SSGRYVGPSGTNSNTGASASPSLKNLLS"
     gene            <1291283..>1294426
                     /locus_tag="TRUGW13939_00425"
                     /db_xref="GeneID:55987938"
     mRNA            join(<1291283..1291454,1291514..1292153,1292214..1292276,
                     1292331..1292497,1292554..1293146,1293209..>1294426)
                     /locus_tag="TRUGW13939_00425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483633.1"
                     /db_xref="GeneID:55987938"
     CDS             join(1291283..1291454,1291514..1292153,1292214..1292276,
                     1292331..1292497,1292554..1293146,1293209..1294426)
                     /locus_tag="TRUGW13939_00425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339526.1"
                     /db_xref="GeneID:55987938"
                     /translation="MACNFSSGAVYIDERVQTERWIYRDTINASQSISDLMPEEPTTL
                     QVNVQSLLDVCSQIYLCHSGKSFSTTLADLHELSLSSSGPVFAFIDIDSNTEAVALRR
                     RGGQDPTSNLSVGNGNPSFKGFSFLSESANSYGVQLLALLSSDLQLQEGPKLILPVAL
                     LRSSEESSDGGAEFDPDAEAYCTDQSMDHNCPILSSSQQISLPRCLDAGAVDVICQPL
                     QPLRVRGLMVHAIRARRAAQREMSRFMAVKKSRKQSWVGLHNEKPYAYLREVMVSKLM
                     KSICNPEEAIEEFHDSDLDITPERKAFVERIVGEWGFCAHSLTEDELVHAACTMLTHA
                     MTMPGLEAWKLTEDELRTFCLASRAAYNSFVLYHNFRHAIDVLQSVFWILLRIGALPP
                     VNASHESPSPIPKSPVADLITPHDALTLLISAIGHDVGHPGVNNVFLIKLNAPLAQLY
                     NDSSVLEAFHCAAFSQILRRHWPAAFRDTNLRKLSISTILATDMGVHFKFMGSLAELQ
                     SKYHANEDLQTWSPQDRDTYKTLMCGLIIKCADISNVARPWKIAEQWTNILQEEFAHQ
                     GEMEKEVGIETALFGGPPELGNVLKLATGQINFMSIFALPLFEGVADLCPRLGAAVEQ
                     IKSNRSTWQQIIDREEQRNLVVPDADSDEQRSPRSLSPAKPETTALSTVQENDIIVAE
                     GPNAEITLDQPPDESVSAPSLTAQQKVAESTIDLSQTTISGFQTPANNDKTIISFESP
                     SSHDESTEDSSEATLATYTGAHYRGVSNTSNPVSRPSSSYGIGRDTRTQSESTCANTV
                     ATPVSPATNATSFVTLDSGDEKDNISGSGLSSRSDVYPLDDDHRPSRPSSSLGLYAVS
                     DRQLPESKGLYFPQKPRSSDRLRELSKSHHVMSTFLENALGRNPLSAECVPHTHTNGD
                     ESSSPHHRTIPRKKSRLRLAFWRRKIQSQQQADNEY"
     gene            complement(<1295067..>1295780)
                     /locus_tag="TRUGW13939_00426"
                     /db_xref="GeneID:55987939"
     mRNA            complement(join(<1295067..1295287,1295359..1295542,
                     1295625..>1295780))
                     /locus_tag="TRUGW13939_00426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483634.1"
                     /db_xref="GeneID:55987939"
     CDS             complement(join(1295067..1295287,1295359..1295542,
                     1295625..1295780))
                     /locus_tag="TRUGW13939_00426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339527.1"
                     /db_xref="GeneID:55987939"
                     /translation="MTEQTPTINQQPPPTDKVNPPETSMTGSSQVHLPRITIKFCTQC
                     KWMLRAAYFGQELLSTFGTGLGEVALIPVTGGVFTVTMYHASPSSATNDDTLTVSETL
                     LWDRKTHGGFPEVKQLKSLVRNIIDPSRDLGHVDRALKASKTATSADAPKGNGDTLQT
                     DQRGKDQGKEDDTNQESQKDACQDCQ"
     gene            complement(<1296253..>1298325)
                     /locus_tag="TRUGW13939_00427"
                     /db_xref="GeneID:55987940"
     mRNA            complement(join(<1296253..1296358,1296423..1296587,
                     1296648..1296749,1296816..1297038,1297106..1297381,
                     1297434..1297793,1297846..1297950,1298004..1298161,
                     1298225..>1298325))
                     /locus_tag="TRUGW13939_00427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483635.1"
                     /db_xref="GeneID:55987940"
     CDS             complement(join(1296253..1296358,1296423..1296587,
                     1296648..1296749,1296816..1297038,1297106..1297381,
                     1297434..1297793,1297846..1297950,1298004..1298161,
                     1298225..1298325))
                     /locus_tag="TRUGW13939_00427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339528.1"
                     /db_xref="GeneID:55987940"
                     /translation="MGGLRAVEDRPTPKEVYNFRLYYEAIIIATGSLLFGYDSAFVGT
                     TIARESFMNDFNITSATADSISSNITSAFQAGAFFGSLFSFFITERVGRKWALQISVS
                     VFIIGAVLMTATTGQLGMIYAGRVLTGLGCGGITAGVPSYIAELSIPSIRGILTGFFE
                     VAYQIGSVIGFWINYGISQHMDQSKAATWRIPMGWQLIPAGLLLMGGFFLHESPLWLM
                     RKDREEEALAVLRELRHLPVDHQYIQEEVAMMRNRLEEEEAISTRYGSGRWAFIRGAI
                     NELSQKGMRNRVFLVFCAFTLANMSGASAINYYSPTLFKSLGITDVSLYTGIYGLVKA
                     IASIIFYTFLIDFLGRRSPVIVSSIICSLCLWFVGAYVKVGHPATVIDAGEALSPSTA
                     AGGKAAVGMIMIYAIFWSFGLNGVPWIVSAEIFPGALRNVSGTYASLVQWATQFAMTK
                     ALPYIFNSFGYGTWFFFASWMFLATVWSFFLLPETKGLTIEQMDKIFGYEHAPGHGAL
                     VGPKVLLDLEDRKDSPGQHFEDV"
     gene            <1298849..>1302485
                     /locus_tag="TRUGW13939_00428"
                     /db_xref="GeneID:55987941"
     mRNA            join(<1298849..1298998,1299068..1300262,1300319..1300440,
                     1300692..1300831,1300913..1301690,1301751..>1302485)
                     /locus_tag="TRUGW13939_00428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483636.1"
                     /db_xref="GeneID:55987941"
     CDS             join(1298849..1298998,1299068..1300262,1300319..1300440,
                     1300692..1300831,1300913..1301690,1301751..1302485)
                     /locus_tag="TRUGW13939_00428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339529.1"
                     /db_xref="GeneID:55987941"
                     /translation="MKMELSWAEIAQHDSRKSCWIVIDSKVYDITSFIAQHPGGAAVL
                     LKQAGSDATEEFNAVHSPAYLEDLPAKCSIGFLKPETRNLLKKGKKEASTSTTPGKEP
                     AVPHISTCVAVSDFEAHAKAVLSNKSWIYASSSANSGLSMKGNIDDWSLVTFRPRVLR
                     RVGQFDTQTSILGHKTQFPFYASPMGTMGTVNTGAEPQFVRGAVRKGVHAVISTGSTK
                     TNEQIMQSLVDEQQLLDNRSPSRLFFQLYINVDRQKVIDLLRRVKKAGYKGLWITVDT
                     PILGKRLADRRLQAEEVLEAGLEEEKNREGPENSFAPASGGRPVPGALSPNTTWDDLV
                     WIREEWDGPIVLKGIQCAEDAKLAVEHGCQGILLSNHGGRQLHSAPSALTTLLEIRTY
                     YPEVLGKIEIFVDGGVRDGSDVLKALCLGATGVGIGRPLLYALAAYGSDGVERCIDRI
                     VLSDELSIAMGLLGITSLDQVRPEMVNASRILNTIWRPTSGFKIWKNLVSAVCILDAT
                     PVIAAKSILSVTQPGIPKLGPLHVLIADDTLRRHTKIHLKPDEAVAHRVTRACDRCRA
                     QKSKCDGVSPCGICVRKGLKCSFKKGDELKNNERAQKSPPVENYTINRRDSSEPARKR
                     TRHHAWVQADQVLSDQSLVPQVVPLHSASSCSGLHTTSESEIRAVLQQREFQLQEDAV
                     KSAEQDHLSQPTSQLGDLFVPSAEDEYLFPSDEVLIDSWARTLDVDHYVCLYFVHFHP
                     FWPFILKSAFVPRKEPRILVLAIVMFGLWVTGEDHLRKLAWTIHGHLHVMLKRQMSRW
                     SIWPRRRDAFSNTQGLEDSSTNNTRWPLATYQSILLFTIFAMTAHDPEEAYEYVSNDS
                     IEENTNNVDILERIRPIFAHLVRTCRTQGAFYFPAMIAQGSPEDPYLFAWTNLEELKY
                     FALSLYKASSLFTSLTDNRGDDNNNNDDEEHDERTSTRILVSDLEFPVPDNGYLWSAP
                     GAREFFRRRELQLRDPATVERSQYIRDSGPWISDIVGGKAKVSLAHRRKAWMSLGPFL
                     GYIAGVDIA"
     gene            complement(<1303374..>1303839)
                     /locus_tag="TRUGW13939_00429"
                     /db_xref="GeneID:55987942"
     mRNA            complement(join(<1303374..1303436,1303490..1303547,
                     1303688..>1303839))
                     /locus_tag="TRUGW13939_00429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483637.1"
                     /db_xref="GeneID:55987942"
     CDS             complement(join(1303374..1303436,1303490..1303547,
                     1303688..1303839))
                     /locus_tag="TRUGW13939_00429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339530.1"
                     /db_xref="GeneID:55987942"
                     /translation="MAAYEIRSGGDVKQKKQSMADLKLRRLTELNSRLKEDLDRPRVK
                     VSEAALSLINYCNNTRDFMVPSVWGQVDKREDPYAPQQSGGCCTVM"
     gene            <1305062..>1308431
                     /locus_tag="TRUGW13939_00430"
                     /db_xref="GeneID:55987943"
     mRNA            join(<1305062..1305103,1305194..1305418,1305483..1307857,
                     1307915..>1308431)
                     /locus_tag="TRUGW13939_00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483638.1"
                     /db_xref="GeneID:55987943"
     CDS             join(1305062..1305103,1305194..1305418,1305483..1307857,
                     1307915..1308431)
                     /locus_tag="TRUGW13939_00430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339531.1"
                     /db_xref="GeneID:55987943"
                     /translation="MPPPPHIKPENVLKRARELIAVGQSPAALTVLHEHVTSKRTRSS
                     PVASLEPVMILFVELSVDLRKGKAAKDGLYQYKNIAQNTNVGTIEVVLKRFIELAEQK
                     VTEAQTKADEIQSSLESTAPSTNVDDLEAIETPETILLATVSGEQSKDRTDRAIVTPW
                     LKFLWETYRTVLEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQN
                     AAKYSAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSVEDIHTLLSLSKR
                     PAKNVMMANYYEKLARIFLVSENYLFHAAAWNRFYNLLRQSSVTIAAGQGSKKDNPSV
                     TETDMTKAASFVVLSALSIPVISTSRSRGALVDVDEARKNKNTRLTNLLGMGQAPTRA
                     ALFKDALNKGLLKRARPEIRELYNILEVDFHPLSICKKITPILEQIGADAEMEKYVVP
                     LQQVILTRLFQQLSQVYESVSLKFVYELAQFPDPFQVTQSMIEKFIMNGCKKGDLAIR
                     VDHVSGVLSFDSDIFSSAKALHPGSAAGSAESEVGSVQRLQSTPAEIARSQLSRLAKT
                     LHVTCVYVDPSYTASRVQAKQLSLARAREGAAKEHEDILARRVVIEKKKEAATESLQR
                     KQREEETRKRIRTQQLQEAEKQRLLDEQREREKKRMKDEQDRIRQQEIKKQLEELKTG
                     VKGIDLSEIDPEELDSNRLRAMKLAQLEKEKHELNDRIRITAKRIDHLERAFRREEVK
                     HVSEDYEKQKEHDMEVYQRQKEETLVEAQKKHKADVALKHRLSRLVPQFTEFRDSLNE
                     KRHEEFERRHKAAEREFEAKKKQRVKEVQERRRREKAEREEEERIRKEEEERAEREEQ
                     ERIAKEEEQRRAMAERKAQREEERKKLDEVAARQKQREEEAEARRAARRTGPAPEPAR
                     PERVERAERAEPTEPTERIAPRLNIAPRTTTGPSWRERLAAKGTTDEAEAEPSDEAPP
                     PARKGGYVPPHQRQGSAAPAPREATPPANGGGADRYIPRHLREGGAPPASRPTAPPSE
                     APEESKPSTGGRWVPSWKRQQQ"
     gene            complement(<1309382..>1310739)
                     /locus_tag="TRUGW13939_00431"
                     /db_xref="GeneID:55987944"
     mRNA            complement(join(<1309382..1309988,1310060..>1310739))
                     /locus_tag="TRUGW13939_00431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483639.1"
                     /db_xref="GeneID:55987944"
     CDS             complement(join(1309382..1309988,1310060..1310739))
                     /locus_tag="TRUGW13939_00431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339532.1"
                     /db_xref="GeneID:55987944"
                     /translation="MSGPPSPMSPRHRRNRSSLDMSPSINRMSENGYFYPQTPQSPRP
                     LSPETPRQRNSQILSGDRRMSEDYMGTVDSGGGLGNLADELADAWGDGEGYEDASGFE
                     ANGQAENMEDFHKDEDTSGQGTPREPMSPDQGNGLQPPRARARQTQSRHRRNESQYDG
                     SDYGNDSDFDELGELSPNLERRMADIESLARRGIEENGSSTDQIINRFIESLRDLGAQ
                     SAIENGAARLITAHTSITSHLTHQTRALQTLIHPLLFSPFPLLSTESIDELIPLIDDG
                     LIPNLPVPFQPPTHGSLRPDSPSSTKSTQSQLAAVDPLLSLQALLSQTSDLTLTLRTL
                     SDTLHESRQLTSTASRRLRSAREIVAEIRREEEDREEGHRWIESGQWDRKLKEREAGR
                     VCGDVVSGFEAVCGEWRMKLFGAAGTTAAATTGAAA"
     gene            <1311310..>1312023
                     /locus_tag="TRUGW13939_00432"
                     /db_xref="GeneID:55987945"
     mRNA            join(<1311310..1311478,1311529..1311760,1311852..>1312023)
                     /locus_tag="TRUGW13939_00432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483640.1"
                     /db_xref="GeneID:55987945"
     CDS             join(1311310..1311478,1311529..1311760,1311852..1312023)
                     /locus_tag="TRUGW13939_00432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339533.1"
                     /db_xref="GeneID:55987945"
                     /translation="MSYVRRMTPTDLLSLNLTNLDPLTENYDLGFYLNYLMRWPSLFS
                     VVQGHDAGIVGYIMGKLEEQPAALRQSEHYTPWHGHITVLTVAPSSRRLGHARRLTES
                     LEHVSDNNDAWFVDLYVRATNKVAVDMYKGMGYSVFRRVVSYYQDDPSGMSEEGEDAF
                     DMRKPCSRDKDLIHVRENGEGFPVSPEDVY"
     gene            complement(<1312470..>1313852)
                     /locus_tag="TRUGW13939_00433"
                     /db_xref="GeneID:55987946"
     mRNA            complement(join(<1312470..1313598,1313650..>1313852))
                     /locus_tag="TRUGW13939_00433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483641.1"
                     /db_xref="GeneID:55987946"
     CDS             complement(join(1312470..1313598,1313650..1313852))
                     /locus_tag="TRUGW13939_00433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339534.1"
                     /db_xref="GeneID:55987946"
                     /translation="MDQDAHSKTAIEASNNLVGQGDSPSDNTPSPPQEEKTSGYGNAV
                     HDFDTGLQAWLQVLGAFFLFFNSWGVINTWGIFQTYYEEHILSDQSADTIAWIGSVES
                     ALLMFFGVITGPLFDAGYFYALVPFGAFMVVFGYMMTSLASKYYQIMLAQGICVGIGA
                     GCMFIPAVSLLPQYFNKRRALANGIAASGSSIGGVIYPIMFNKLQEEIGFSWATRTLA
                     FVALGTCSISIAVMRVRFKPKEKRALVQFSAFTELQFNLYSFALFFGFLGFYNFLIYV
                     QPWAIQKGVVSDTLGFYLVPILNAASTFGRIMPNLVADYSGPLNMLVPASAISALLAF
                     CWIAVNSSAGIVIVSLLYGFFSGGFVSLPPIVMMVITKDLRNFGTRLGMSFSICSIAL
                     LIGTPIGGAILGGTGSYVGVQAFCGACLATCAALMFWIRILRSGPKILYRT"
     gene            complement(<1314776..>1315464)
                     /locus_tag="TRUGW13939_00434"
                     /db_xref="GeneID:55987947"
     mRNA            complement(join(<1314776..1314809,1314869..1314988,
                     1315046..1315336,1315427..>1315464))
                     /locus_tag="TRUGW13939_00434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483642.1"
                     /db_xref="GeneID:55987947"
     CDS             complement(join(1314776..1314809,1314869..1314988,
                     1315046..1315336,1315427..1315464))
                     /locus_tag="TRUGW13939_00434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339535.1"
                     /db_xref="GeneID:55987947"
                     /translation="MSDFGDHDGDEAGFDYEAGEADYDDHEPEDFLEPEEGADGYDDT
                     GAEDAFSHAVNGERTIISGDPNAGGGRGVIEQPREKKIPNDKRTTTPYMTKYERARVL
                     GTRALQISMNAPVLVDLEGETDPLQIAIKELNQKKIPLIIRRYLPDGYYEDWTCEELL
                     "
     gene            <1315776..>1317536
                     /locus_tag="TRUGW13939_00435"
                     /db_xref="GeneID:55987948"
     mRNA            join(<1315776..1315884,1315939..>1317536)
                     /locus_tag="TRUGW13939_00435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483643.1"
                     /db_xref="GeneID:55987948"
     CDS             join(1315776..1315884,1315939..1317536)
                     /locus_tag="TRUGW13939_00435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339536.1"
                     /db_xref="GeneID:55987948"
                     /translation="MILCDAPSFDMGFKRKATSDAARQRSKIAKHAEPSDDLTSEESD
                     VSFEADSIGDIHHDATPGTPFSVTSSKYPSELKTHLCPFDGCTKAFNRPARLQEHIRS
                     HNNERVFKCTHDDCDKTFLRASHLNHHIKSAHTAVRDYVCDRPGCGKTFVTGTRLRRH
                     LAAHDGSDKFRCTEYPPCNETFRKHSTLNRHILLTHLNQKPFPCQHVDSVTGQACQQA
                     FESAAHLRSHENRVHPKNRFTCTECASASNASLETAGDSMSAGSCFPSYAELQAHIKS
                     AHPPQCTRCSFVCSSSRELRRHLEMSHGDVSLEERRQFPCTMPGCGRSFTKKGNLTVH
                     IRTVHDGEKRFICGGTDLSSSKKVEGWTMSDGCGKRYGSKLALEEHVRTAHLGLLNTK
                     AERREKQGVVKKPQSRSKSSNMSTMALLTGEGYADESGRHIVCFVDECEHRFYREYDL
                     WVHMQSKHGCVEDEIENMFIQRALLQGGQGTVCGIYGLDLDAGGVYHSDPGAGIPSFP
                     DLHITGNEFDEKINEMAPFEAGDDSFMHGFGNPTGLIDEPMESKNDFGEVDPSLFNMM
                     DS"
     gene            <1319511..>1323419
                     /locus_tag="TRUGW13939_00436"
                     /db_xref="GeneID:55987949"
     mRNA            join(<1319511..1319526,1319647..1319997,1320059..1320216,
                     1320282..>1323419)
                     /locus_tag="TRUGW13939_00436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483644.1"
                     /db_xref="GeneID:55987949"
     CDS             join(1319511..1319526,1319647..1319997,1320059..1320216,
                     1320282..1323419)
                     /locus_tag="TRUGW13939_00436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339537.1"
                     /db_xref="GeneID:55987949"
                     /translation="MVRSRVLSFISAFAPKNNNQTSASSDSNVSSLTASGSTTAKLDN
                     HEPAPLRSSPIPSGTTLPNSDRSSIMRPASMAFTYQAPQTDIAHDTLPELLPVFSFLN
                     GQSNKLYQEGYFLKLNDLDTHGRPCGDRKWVECFAQLVGTVLSFWDASALDAAGHDGE
                     VAPTFINLADASLKMIETLPTRDKSSKPLQNILSISTAGKNRYLFHFNSFHSLTQWTA
                     AIRLSLFENTSLLEAYTGSIIAGKGKELNNIRMIMERCRFKHEDWARVRFGAGTPWRR
                     CWCVVTPPDEKEYQKVQKTMKKRSAYDRTTPVLTGTIKFYETKKTKKVQPIATISDAY
                     AAYAIYPQSKPLIDQSTLLKIEGSITIHGPNQSKTEGFIFIMPELHPAVSGFEIMLRF
                     LFPVFDTFGLYGRPTRLIADTNNVKSLMLAFPKQRRYGYLDVLDVANLINTAGSQNWT
                     EKDWRRKLREVTGQRMSTVNSPASSISGGRPRQRSSLPGKRGSTRFQEPVKPWLSEFN
                     QSADAIVETSNVPSAAAGPGQAYGHTRAVSDTSAFLMSNSPIEPPASAPQPIQESPPP
                     EPPIHGTSFGAERPGSNGSSSDPDPLAREAEDIVSPDLSPNGPPAPVAVPPAFAHQPG
                     EVPASRPKTSLEIRNANSRMSISTLTQLAEVRGMHGASPDSSESRQGSYPANYHSQDS
                     TPLTEVSDHIPDTDPIKQPLPAAPVQNHAVSPVPSRPASQLFNLQLDTSKATKRKPLP
                     PHPGSYRAPDPSSTYEPVSAASDQSLRDLRHTVDEAALERVLPRQMFSPPQRTHTEII
                     SSVRLDDESNYGDESPSPSYASTRKSTDTKRSEASIPRPRMGVLKTVGDAPPEKHEVT
                     IGDARFFANQEQPKENPNIPTVDFGPTMVHSLHTRTPSMSDVLGQFGHGRSDSELTAR
                     NENAMPSHARKLSRSPAGDDKRRSVIWQPGMAAAPPDSPGKRTMTPEQYVHQRSGSSP
                     RITPAYLAAARPRSGDWASPTHQHPTNRELPPRPHSRSSTMMLNQNDMPHRPHSRSPT
                     MMLYQNDMPPRPHSRGSTMMLNPTEVSQRPTSRGSTMLLNQNDLSSHLSAREQEHVAR
                     MTGQSFFNFSNSNGRSNGRQNVGSGGLVGAIDARQREKQSMKEGLSNQMVQHAIAQRQ
                     HHQMYEAQQEHARVRSIYNMPGANYTWDTSSNMNYGNHPPSHAGQQGWSSNPQMAHTP
                     PAAQAPPPYFQQYQSY"
     gene            <1324914..>1325957
                     /locus_tag="TRUGW13939_00437"
                     /db_xref="GeneID:55987950"
     mRNA            join(<1324914..1325412,1325485..>1325957)
                     /locus_tag="TRUGW13939_00437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483645.1"
                     /db_xref="GeneID:55987950"
     CDS             join(1324914..1325412,1325485..1325957)
                     /locus_tag="TRUGW13939_00437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339538.1"
                     /db_xref="GeneID:55987950"
                     /translation="MIGQIYVEKLSPHPAPANPPLPIIFIAGAAQTGTNFLDTPDGRP
                     GWASYFLSKGHTVYLSDQPSRGRSFWFPGQGIMGDIGSPDDVSDIFTDVQNNGNQWPQ
                     AKLHTQWPGTGRIGDSTFDAFYRSQMQFQNDRFISEEQNAQAYSALVDLVGDCYIISH
                     SQAGAYGWRVGDMRPDLVKGIVQLEPSGPPFTLRPPFGTDPAFAFGLTDLEIGYKPSA
                     GKNAEYIETTIEPAIDADHDECIMQKSPAKQLTNLGKIPELVVTGEASFHAPYDYCTV
                     KYLKQVGVDVEFADLGKEGIHGNGHMFFMEKNNLEIADLVYQWLKRH"
     gene            <1326497..>1327879
                     /locus_tag="TRUGW13939_00438"
                     /db_xref="GeneID:55987951"
     mRNA            join(<1326497..1326716,1326913..1327369,1327435..>1327879)
                     /locus_tag="TRUGW13939_00438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483646.1"
                     /db_xref="GeneID:55987951"
     CDS             join(1326497..1326716,1326913..1327369,1327435..1327879)
                     /locus_tag="TRUGW13939_00438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339539.1"
                     /db_xref="GeneID:55987951"
                     /translation="MAGSGAGSPAYRAETNDPNLDQRVSISFILIDTFFLLVFFASRY
                     FNPKAVGVPMVVCNTLCYVLCMGSAATGILMVKIGGAGHHADTVPVSTVENWLKLSKV
                     LEFTYTPAIMFAKLAALFLYHQLFEVSSYRRVIIGLGVIIILQGVISLILAFSICRPF
                     RYFWTQAVDIHDGSCGDVMLFYKTYSIPSLVTDVVMVILPWPILLKLQMPTTEKIGLF
                     FTFLAASMGIITCALRFSVFFTTPLFSDPTWYASGGPMIYALIEPSIYMIASILPTTR
                     HLYRRVYRNVQRAAQLRSAQSNSDANNISQLAELGRIGNSDTGSHRTTRPVDVWEVDA
                     NSSQEELTLREWHQSRPAGTSSPGTPEARSFVSSKITKY"
     gene            complement(<1328314..>1329783)
                     /locus_tag="TRUGW13939_00439"
                     /db_xref="GeneID:55987952"
     mRNA            complement(join(<1328314..1329259,1329343..1329523,
                     1329591..>1329783))
                     /locus_tag="TRUGW13939_00439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483647.1"
                     /db_xref="GeneID:55987952"
     CDS             complement(join(1328314..1329259,1329343..1329523,
                     1329591..1329783))
                     /locus_tag="TRUGW13939_00439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339540.1"
                     /db_xref="GeneID:55987952"
                     /translation="MAGKSRFTRLDAFAKTVEDARVRTTSGGVVTLASLLIIFWLVWG
                     EWADYRRVVVLPELIVDKSRGERMEIHLNMTFPRLPCELLTLDVMDVSGEQQVGVAHG
                     VNKVRLSSAAEGGRVIDVEKLELHAKNEVAVHLDPEYCGECGGAPAPENAKKPGCCNS
                     CDEVREAYAAKQWAFGKGDNIEQCLREGYADKIDAQRREGCRIEGDIRVNKVVGNFHI
                     APGRSFTSGNVHAHDLETYLDRSLEGSDKHTMSHIIHQLRFGPQLSDEVSQRWQWTDH
                     HHTNPLDGTQQMSDEPAYNFMYFVKVVSTSYLPLGWDSQRSSEVHQDHESTPLGLHGA
                     AHGSSGSVETHQYSVTSHKRSVTGGDDAAEGHKERIHAQGGIPGVFFNYDISPMKVIN
                     REDRPKTFTNFLTGVCAVIGGTLTVAAAVDRFLYEGAMRVKKKSHSN"
     gene            <1330535..>1332699
                     /locus_tag="TRUGW13939_00440"
                     /db_xref="GeneID:55987953"
     mRNA            join(<1330535..1330942,1331137..1332603,1332658..>1332699)
                     /locus_tag="TRUGW13939_00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483648.1"
                     /db_xref="GeneID:55987953"
     CDS             join(1330535..1330942,1331137..1332603,1332658..1332699)
                     /locus_tag="TRUGW13939_00440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339541.1"
                     /db_xref="GeneID:55987953"
                     /translation="MARTKVSQTRSSTSRGGIRKRTATRADRDGDLDMAGPDRGRGGK
                     RGRGRGGQPQPRDGLRSNLNQDRIKKAMEGGGASTQATFRQSGNKPPLEEISITGWKL
                     SKAATNADGGVRSTVDWLEKKLTSNKPGRKNIIKHRVEGDAIIVSVRPEVLDRMLHFN
                     NFTFAGALLTVEKYENGSSVSTEDMKGRLKAFLANRFIASGKILNLQGLSADPILREI
                     GLFHSPTTESKFYQALMKVWSLEFPTQLASQEAVVNLSLANNALSSIQPITVLSQNFP
                     NLKALDLSNNNFQDDKGLGGWRWKFRQLEFLDLSNNPISFTPNFKETMMKWYPKLKTL
                     NHVQVRTDEEVAAQSRAPIPVQAPFFQDEGSIAENFIRKFFLGFDGDRNATINAYYDN
                     SSAFSYNVNPAAPRAAQDSTATSGWENWIKNSRNLKKINHLGPRMSRMFVGSESIREI
                     WNIMPKTQHPGIDQATQWLFECHLIPCLPDVTGQSTSGVGGLLVMIHGQFDELAGTKV
                     ETRSFDRTFILGPSTGPENVRVISDMLTLRTYGGSSAWDAGVQMAPSPAAAAQPVHPE
                     APQGYGAPAPGKSDIQVQQEQLILQLSFNTKLKLEFAQQALLQHNWNIEGALKAFEES
                     KANNQIPAEAWVVV"
     gene            <1333293..>1336013
                     /locus_tag="TRUGW13939_00441"
                     /db_xref="GeneID:55987954"
     mRNA            join(<1333293..1333353,1333416..1335217,1335273..>1336013)
                     /locus_tag="TRUGW13939_00441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483649.1"
                     /db_xref="GeneID:55987954"
     CDS             join(1333293..1333353,1333416..1335217,1335273..1336013)
                     /locus_tag="TRUGW13939_00441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339542.1"
                     /db_xref="GeneID:55987954"
                     /translation="MSTAIHMNANEASNLDHLDAVDYDPITHLNAIFSHPSTLSSVSQ
                     TSEILRVYQNDLDNDIAQLVEEQVTSNADSVQRIQAAKADLAELFKKINDVRERASRT
                     EQAIMDMTADIKQLDSAKKNLTLSMTALKRLQMLTTAYEQLRALAKTRQYRDCAQLLQ
                     AVIQLMAHFKSYRSIDQIATLSRNVADIQRELLEQICEDFEITFAKGEVVQRRGVLSE
                     ACLVMDALGENARSRLTTWYCNTQLREYRQVFRGNEEAGSLDNISRRYSWFRRMMKTY
                     DDEHAAIFPTSWRVNEVLANAFCEGTRDDFKGILSRSVRSGQTFDVNLLLSCLQETLD
                     FEHSLDKRFSTTSRPSTDTIASSTAESAVFTQVISEAFEPYLGVWVDAQDKQLASLLP
                     KYRQQPLKRDDDEFHAQLVIPSSTELFTFYRHSLAQCAKLSTSSSLAELSKVFARYLD
                     QYAQQVLLTYISERPTGQTPSKVPSIEDLILVLNTADYCYTTCNQLEEKIKGRIDESL
                     KNTVDFESQADTFMGIASAAVRGLVRKVEVELEPCWREMRNSPWSKLENAGDQSSYVA
                     ELLSKTKSKAEDILQLLHKQQYARAFGDNIVEFISNSFTSTVYQCRPVSETGAEQMLL
                     DLYTLKSGLTSLLPSAPAGFVKRVNNSFAKVDTLLKTIQVRPSPPEALVQAYLIQIAD
                     RNEVNFRRVLEIKGIRSKQEQGPLVELFNLHRASDRHAPSLQQSNPVFSLFHISPTAS
                     GPATGSAVSHGLSNLGSTATASMGGPSRFDPSILGSAIISAARDGVDRLPLGSGGAVG
                     AGGSHAGSGSASPAPTLSGQRLTGDNFDGGPPSSSNNLNDNLRNLGKFFRRDLGGFGG
                     RFGRAAEDSNR"
     gene            complement(<1336670..>1337732)
                     /locus_tag="TRUGW13939_00442"
                     /db_xref="GeneID:55987955"
     mRNA            complement(join(<1336670..1336692,1336752..1337426,
                     1337489..>1337732))
                     /locus_tag="TRUGW13939_00442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483650.1"
                     /db_xref="GeneID:55987955"
     CDS             complement(join(1336670..1336692,1336752..1337426,
                     1337489..1337732))
                     /locus_tag="TRUGW13939_00442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339543.1"
                     /db_xref="GeneID:55987955"
                     /translation="MGGKSATKSAYFDKLKGLLDEYKTIFIVSVDNVSSQQMHEIRVS
                     LRGEGVVLMGKNTMVRRALKGFVNDNPEYERLLPFVRGNVGFIFTNADLKAIREKILA
                     NRVAAPARAGAVAPLDVFIPAGNTGMEPGKTSFFQALGVPTKIARGTIEITSDLKLVE
                     AGAKVGASEATLLNMLNISPFTYGMSITQIYDDGQTFGADVLDIEDEQLLKALSIAAN
                     TIASISLAANFPTVPSVLHSVVNTYKKVLAIAIETEISWPEIEELKDRIANPDAYAAA
                     APAAAAAATDGGAAPAAKEEEEEEEESDEGGFGGLFD"
     gene            <1338067..>1341227
                     /locus_tag="TRUGW13939_00443"
                     /db_xref="GeneID:55987956"
     mRNA            join(<1338067..1338542,1338605..1339285,1339345..1339701,
                     1339959..1340029,1340078..1340119,1340176..1341099,
                     1341157..>1341227)
                     /locus_tag="TRUGW13939_00443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483651.1"
                     /db_xref="GeneID:55987956"
     CDS             join(<1338067..1338542,1338605..1339285,1339345..1339701,
                     1339959..1340029,1340078..1340119,1340176..1341099,
                     1341157..1341227)
                     /locus_tag="TRUGW13939_00443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339544.1"
                     /db_xref="GeneID:55987956"
                     /translation="IWLRKLPLNREILAITIMALKPQHPFQCLRYVDRQDSGLIIASA
                     GAKLYSFSVNDGRKLYTWPPSGGTSSPTSQVDSAERGDEPPEKKRKLLPGSTAENEKE
                     EAQAKSESAISVPTWSTIPILVISHSGRYVIAVTAEDKNVRVLEIDSDGVLTQLSARP
                     VPKRPCAISLSFDDNTIFSADKGGDVYGLSFHPSEDGELRIVSRPKKAYQPAANAQVV
                     HTKRNLYSLQQQLRQQQEHEKQGIEHTVSRPVKPNALLGHISILTDIALGAVPSTSST
                     DKPHVYLITADRDEQIRVSRGPPQTHIIEAYCLGHELFVTRLCTLTSAPHLLISGGGD
                     DYLLVWDWRIGQPLHKVQIATEGKQGKPVVRGIWEIHFNGSSSVAILVAFNGSPELQS
                     FLLQEDGQLTPQKSIQASGNVLDVTWAESQATLFLSIDACHEAGSTKTWRKNFSATQT
                     LVESYIAKVQDGSLEFESTTAQVVEQVNSQGTEDVVAVLDDEPAQQKAQKALSGTALE
                     RKMYSKFEPLKNDLLLRAARGETVERPPIWVMRQAGRYLPEYHEAKGNRDFFDCCRSP
                     EIASTLTLQPIERFEGLIDAAIIFSDILVIPQAMGMTVEMIDKKGPSFPEPLQSPDDG
                     QYEKILQKQVDVEKELDYVYKAITLTRTKLNGRVPLIGFCGAPWTLLCYMVEGGGTKL
                     FVQSKKWIYKYPKESKALLQKISEICVEYLALQVSAGAQLVQIFDSWAGELSPATFKE
                     FSLPYLRYISQNLPKRLQELGIDAVPMTVFAKGAWFALDELCDSGYNVVGLDWLHDPA
                     EAYKIARGRVTLQGNADPGVLYGEHSAITATVENMVKGFGGGKKGWIANLGHGITPFV
                     NPDDLRFFFEEIHRLTK"
     gene            complement(<1341368..>1341879)
                     /locus_tag="TRUGW13939_00444"
                     /db_xref="GeneID:55987957"
     mRNA            complement(join(<1341368..1341646,1341703..>1341879))
                     /locus_tag="TRUGW13939_00444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483652.1"
                     /db_xref="GeneID:55987957"
     CDS             complement(join(1341368..1341646,1341703..1341879))
                     /locus_tag="TRUGW13939_00444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339545.1"
                     /db_xref="GeneID:55987957"
                     /translation="MGANSDLITDPGFVAALEEARQGGAEGGVPIGACLVSKDGEILG
                     RGHNMRVQKGSATLHGEISALENSGRRPASAYEGSTMYTTLSPCDMCTGACILYKVKR
                     VVVGENKNFLGGEQHLRSRGIEVVVLQNEECIQLMETFIQEKPQLWYDL"
     gene            <1342305..>1346849
                     /locus_tag="TRUGW13939_00445"
                     /db_xref="GeneID:55987958"
     mRNA            join(<1342305..1343295,1343439..1344808,1344879..1345036,
                     1345091..>1346849)
                     /locus_tag="TRUGW13939_00445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483653.1"
                     /db_xref="GeneID:55987958"
     CDS             join(1342305..1343295,1343439..1344808,1344879..1345036,
                     1345091..1346849)
                     /locus_tag="TRUGW13939_00445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339546.1"
                     /db_xref="GeneID:55987958"
                     /translation="MATHREYTVGLVCALELELIAVAAMLDERYKDLSKPSDNNSYIL
                     GRVGVYNVVVACPKYGFDINKVAGRMISTFPSIKIGLTVGIGSGVPESVRLGDVVVSE
                     PTNELSGMVQLDFEEVTLRGNIRFTESLNCPPIELLTALKALKREHAICGSKNPEYLK
                     YLEFLRPNFVPKHARLECLRDRLFKADCQHICNPPFDDANAGAQDKGNIETEEEEDHC
                     IHCDQTKIIHREPRGMRVHHGLIVSSNPVIKDALTRDNINTRFGGNVLCFEMGAAGLM
                     DDFPCLVIRGICDYADSHKNRGWRDRAALVAATFSRELILLLPAQEVEQMPTIQERGG
                     SLLRDEICSHQQNQEYQTKDTFEWLLNSSEFQHNAKDQILWLQGTPGAGKMIISYELA
                     MQQVQEQVYEHQKLANQVLSFISSANRPLTPAELQHAISIEENSDELGKNNVADIELI
                     LSVCGGLVTVDNERNTIDLVHSSAQEYLELNRERWFPNFHTDIANSKDGVSEISAEVS
                     LWSAFETDDSESSFGGLHVSREACEKLAEVLCKDIDLRTLYLEALTLLGKGRFSKNHD
                     QILKRFFKSLRSEVDDTLHLQTIRLLRYASSREQITEWILRLCVPSPDLETLRSRQKF
                     LDQKEFRDEILNRFLEDQAVGLHDKGDRKNQLDHEISSENSEDDDEASSEDAEDGNGP
                     IRFEQLQAIISFLTRGPSYEDLKSDLYLLVHPPTGIPEAIQLGGVRSLRKLLEKRFSE
                     IVTGEYAWIKELSEAGYSYYEISELLYQDETDTPWIYFELEAPSPLEMSFKRSLSVSK
                     DQQGPKNFKSCAVWGVIPASRDPSKWNGAVTFKEKNTVAVVSITTALDWSCAAAGTMQ
                     TSGLCCDCFTVIVHRTHEPEFDEELTPVSLYRINFDSVLEVLAELKGISSSDHIAQSK
                     LTNILRLLHDILDPIFQDFQGTFQSNDLEASLHSLSLAVQFISLGLLSYNQGHVGPIQ
                     PFFLDTPQRKILLAGSKLCEHHSDGIIAELMNLTCIGDMVGGPVLSFKIAQLSMDGPY
                     LQEERKFDLMATAEDLLDTWGPGGFIVHRDTGASPCAIKLCGGIIYATRENTPKYHWS
                     PSTQVGQFYPVHMNPQSKICIGSLVTINSYCNINERECWERSSCAFENLDVHDDFWTY
                     DENQTGFQAGNYVLLQANITRHRLSGKTLKKVILEWETEMLIPALNCLWGLQVSFCTG
                     VTKRVPLRELIADVLPTFTNTFIRERARWVELEEQYHILDAFRKDDFQGWLANLPPKL
                     YSYVIRVVRRIIRTLQSTGIDPEGRYLSVAWPYDSPPFRCFRISCHDRENSWARVLAD
                     SEDCATFAYISTKCLVTNRVQCQGPSPLWRSTTPLLQTAIIRHNGNYPGSLESKRTHF
                     FKKPDSLLKVMVERQGDSGAITLLVAPSTVPARVQQRLYRLDMMRSQ"
     gene            <1347176..>1348919
                     /locus_tag="TRUGW13939_00446"
                     /db_xref="GeneID:55987959"
     mRNA            join(<1347176..1347712,1347768..1348481,1348539..>1348919)
                     /locus_tag="TRUGW13939_00446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483654.1"
                     /db_xref="GeneID:55987959"
     CDS             join(1347176..1347712,1347768..1348481,1348539..1348919)
                     /locus_tag="TRUGW13939_00446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339547.1"
                     /db_xref="GeneID:55987959"
                     /translation="MSILSLVEDRPTPACVYNWRIYLLAGVASLTSCMIGYDSAFIGT
                     TLSLPSFRSEFNFDSMSSSKQDLVSANIVSCYQAGAFFGALFAYGISPFWGRRIGLLI
                     ASLVFTLGAGLMLGANGERGLGLIYAGRVLAGLGVGAGSNFTPIYIAELSPPAIRGRL
                     IGVYELGWQIGGLVGFWINYGVQTTLPENHKQWIIPFAIQLIPSGLLIIGALLIRESP
                     RYLMIHGKREQGIKNLCWIRQLPADHIYMIEEIGAIDQATEELASTVGIGFWKPIKAA
                     FTTRKYQIRLFIGAMLFVWQNGSGINAINYYSPTVFKSIGVTGTNSALLTTGLFGCVK
                     TAVTIVWILYLIDHVGRRNLLIYGALGGSVCMWIIGAYIKIAQPTKNPTSHLNGGGIA
                     AIFFFYLWTTFYTPTWNGTPWVLNSEMFDQNMRSFAQACAAASNWLWNFLISRFTPQM
                     FDTMDYGVYFFFASLMLLSIVFVFFLVPETKGIPLENMDMLFELKPFKAHSTVLKRLR
                     EDEEQFREAAKGVQVEKSSPSVHVEDAEVGQAVYL"
     gene            complement(<1349098..>1350180)
                     /locus_tag="TRUGW13939_00447"
                     /db_xref="GeneID:55987960"
     mRNA            complement(<1349098..>1350180)
                     /locus_tag="TRUGW13939_00447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483655.1"
                     /db_xref="GeneID:55987960"
     CDS             complement(1349098..1350180)
                     /locus_tag="TRUGW13939_00447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339548.1"
                     /db_xref="GeneID:55987960"
                     /translation="MTAIVKIAIVGGGLIAPRHAAAVHLHPAAELVALVEPSPKGPET
                     AAQFNTRLYTSVADLLASKDVKPDAAIVCTPNHTHVSISRDLLAAGVHVLVEKPLSHS
                     TDTARDLVQYTKENANVKLAVGHHRRFNPYMLKVKEIVSSGSLGSIMAVNGMWMLFKP
                     DDYFEPPTDWRRRKDAGGVVLINLVHDVDLLQFLFGAIERVHVEKIARQRGDHHKADE
                     GAALTLRFSSGVVGSFLVCDATPSPYNFEAGTGENANIAAAPSKENFYHIFGSNASLS
                     VPEMARWSYDGRPAKSWYQPLTVDKFDVDSSAVPYEGQLAAFLDYIAGKENSSCSAVE
                     GLRALLVCDAVRKALDGNRTIDVELA"
     gene            <1351655..>1353094
                     /locus_tag="TRUGW13939_00448"
                     /db_xref="GeneID:55987961"
     mRNA            join(<1351655..1351690,1351762..1351831,1351915..1352733,
                     1352787..>1353094)
                     /locus_tag="TRUGW13939_00448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483656.1"
                     /db_xref="GeneID:55987961"
     CDS             join(1351655..1351690,1351762..1351831,1351915..1352733,
                     1352787..1353094)
                     /locus_tag="TRUGW13939_00448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339549.1"
                     /db_xref="GeneID:55987961"
                     /translation="MVKDTKFYDVLGVDPSASEAQLKTAYKKGALKYHPDKNASNPEA
                     AETFKELSHAYEILSDPQKRQVYDQYGEEGLEGGAGGAGMNAEDLFAQFFGGGGAFGG
                     MFGGGMREQGPKKARTIHHVHKVSLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVR
                     QCTGCNGSGMKTMMRQMGPMIQRFQTVCPDCQGEGEIMREKDRCKKCSGKKTIVERKV
                     LHVHVDKGVKNGHKIEFRGEGDQMPNVLPGDVVFEIEQKPHPRFQRKEDDLFYHAEID
                     LLTALGGGTINIEHLDDRWLSVKIAPGEPITPGAIKMIRGQGMPSLRHHDFGNLYIQF
                     DVKFPQSSDLQNLELLEKVLPPRPQQPQPPQDSMVEDFDVEEVDPSQSARAQGAAYDD
                     EDEDGVPPGAERVQCASQ"
     gene            <1355673..>1358352
                     /locus_tag="TRUGW13939_00449"
                     /db_xref="GeneID:55987962"
     mRNA            join(<1355673..1355964,1356027..1356172,1356226..1356769,
                     1356833..>1358352)
                     /locus_tag="TRUGW13939_00449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483657.1"
                     /db_xref="GeneID:55987962"
     CDS             join(1355673..1355964,1356027..1356172,1356226..1356769,
                     1356833..1358352)
                     /locus_tag="TRUGW13939_00449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339550.1"
                     /db_xref="GeneID:55987962"
                     /translation="MPGEIATKVGHTLAKVLGIKLQYRDPLGTSDHLSRGESIFSSGT
                     ADTYVEPEPTSAEWLYEHVPSRHDVVDYLISLFPFLSWIGRYNLQWFIGDLVAGITVG
                     AVVVPQGMAYAKLADLPVEYGLYASFMGVLIYWFFATSKDITIGPVAVMSTLTGNIII
                     EVQGSHPEFSKPEIAQALSIIAGAIVTFIGLIRWGFIVDFIPLTAISAFMTGSAINIA
                     SGQVKSLLGESADFSTRGATYEIIINTLKHLPSAKVDAAMGLTALFMLYGIRSACNYG
                     ARRNPQKAKLFFFLSTLRTVFVILFYTMISAAVNLHRRDDPAFKVLGHVPRGFQHAGV
                     PTLTKPLIASFATNLPSAVIVLLIEHIAISKSFGRVNNYVINPSQEMVAIGVTNLLGP
                     FVGGYPATGSFSRTAIKSKAGVRTPLAGLITAIVVLLAIYALPAVFFYIPSSSLSGVI
                     IHAVGDLITPPNTVYQFWLVSPFDVIIFFAGVLVTVFSSIENGVYTTICVSAALLLWR
                     IVKARGDFLGKVRVHSVLGDHLLDSNGKYGPVGQLPAQASLGSNDPDNTFRNVYLPVR
                     RQDGSNPQISVEHPYPGVFIYRFSEGFVYPNANHETDYLVSSIFKETRRTNLESYPTL
                     GDRPWNNPGPRRGHVEEDRSQLPCLRAVVLDFSSVNNVDVTSVQNLIDIRNQLDHYAS
                     PDPVQWHFAYVNNRWTKRALASAGFGYPSVGSEESSVKRWKPIFSVAELGGIDSAAAV
                     AERERLEKLKTIDPEHGEPTQTEQEQNHPENSSNDSINYQSQLKTSTAYENGRKIALV
                     SGINLPLFHVDITSALQSAIANAKQYETHQKLVDA"
     gene            <1358893..>1361278
                     /locus_tag="TRUGW13939_00450"
                     /db_xref="GeneID:55987963"
     mRNA            join(<1358893..1359214,1359294..1359633,1359701..1359713,
                     1359767..1359802,1359863..1360259,1360311..1360418,
                     1360483..1361120,1361177..>1361278)
                     /locus_tag="TRUGW13939_00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483658.1"
                     /db_xref="GeneID:55987963"
     CDS             join(1358893..1359214,1359294..1359633,1359701..1359713,
                     1359767..1359802,1359863..1360259,1360311..1360418,
                     1360483..1361120,1361177..1361278)
                     /locus_tag="TRUGW13939_00450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339551.1"
                     /db_xref="GeneID:55987963"
                     /translation="MLISGYKFLKKKYDLKYKRISVQETAETSCPHRQQASATSPETA
                     DSAAKETVVVANANEICPICKQEEHDATVYRWKLIGGLLLPYTLASLDLTIVASSLPF
                     IASYFDKFDQLNWIVTAYTLTSTAFIPTFGQIADIFGRHAALQLSMGFMLVGSTLAAA
                     AQSWGMLLLGRALQGTSAAGIMSIIMIVLADKVSLKENAKNSTIFTMVSSIGYSVGPV
                     IGGYLTNANWRYVFVVSIPIAFLSHFTIYFLLYKELLPGTHFRKGSRWSSILPGLATL
                     DIGGTLLFIFGVGLIILGTAWGGSTYPWASAQVLAPIVVGSICFASFFAYEYLLEPGQ
                     LLARAFPRQVPMIPYSLFSRLDTLLIAILDFASGAAMYAVFYYIGVYFTLVEAYPSSK
                     AGVQLLYYIPGLGVGVYMAILMCNVWPAQTFLPLTLGTIEETIGLAMLAWAISTRNTS
                     LVNGMMVLAGAGTGSRFMPSSLHIAGVWPEKIAPAMSLMRFAQPFGGTLALTIMGAVF
                     NNKWSGSSALSNSSSSAASSFDPHSTDSLDSVSALPQNVQDIVRNVGKDAIMWAFIAI
                     LPILGISLVTGLFLGNVWIKPSKESKKDAENGEREAGTSEVIYVPYLYALFKGNVNSF
                     KRLSKPLSEQEKMQQAGEQRDVELRGL"
     gene            complement(<1361612..>1362122)
                     /locus_tag="TRUGW13939_00451"
                     /db_xref="GeneID:55987964"
     mRNA            complement(join(<1361612..1361983,1362048..>1362122))
                     /locus_tag="TRUGW13939_00451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483659.1"
                     /db_xref="GeneID:55987964"
     CDS             complement(join(1361612..1361983,1362048..1362122))
                     /locus_tag="TRUGW13939_00451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339552.1"
                     /db_xref="GeneID:55987964"
                     /translation="MPPTQQELSLLIHPLVPESVQHNARVLSQLRSLTSFLLGISAGI
                     LGLQSAYGFAFYFLGTLLVSALVQVLVIKPSGSTAGAFFPGSSGGEVEGIDATGKIGG
                     KGNGKGKGKSIERKGAWRDVLLGGGVMSEALSGFVLGWAGVGGVLR"
     gene            complement(<1362781..>1364738)
                     /locus_tag="TRUGW13939_00452"
                     /db_xref="GeneID:55987965"
     mRNA            complement(join(<1362781..1362834,1362887..1364178,
                     1364234..>1364738))
                     /locus_tag="TRUGW13939_00452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483660.1"
                     /db_xref="GeneID:55987965"
     CDS             complement(join(1362781..1362834,1362887..1364178,
                     1364234..1364738))
                     /locus_tag="TRUGW13939_00452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339553.1"
                     /db_xref="GeneID:55987965"
                     /translation="MASHIIGNRNSTPEASKSTLRPPSSARNLGGSHQLRASADMSGF
                     PSPLSSRNIRPSSEVFFNQQPQGQGNMDDALDQAAQQWIADIDQYETTLEEMAAATLD
                     QDFKDELSAIEQWFRVLSEAERTAALYALLQQTTQVQIRFFIQVLQQMAKSHPMSGVL
                     SPANFGEKELDPMSNRLSDAMSKLTMEGSRNSIGRPPPSPGAKRNSALDPSTINAMFP
                     DAAAAIAKKKAEFTQQTGNAPTSNRNSAVFGGDRSSLVAPTISAPDSKNSLNQPPSSP
                     WAQRAPEPQPPIARPKSSSGQPQQAPMGQFSQPLRSPRPGNVQNTTITAPETSHHEPP
                     LLSPYNLGNSSWASMTNTPMAPTFNTQQSGGAQADMVANATAMKLAALSTVNNRIALD
                     DARKYRRARSNDGHGKNSNAGHLSPGLGPSIPGANLVMVNDAGQVLNAQQIAALQAQQ
                     QAALSAGRSRPNSPGITLQGPLGQVGFTAPQNNGFLAAYDPTSGLLGNGLGNLGMSQF
                     GVGSHEGYLSDHSEVQRGRSPRGRRGSSKPPEDPTDPTLLKDIPAWLRSLRLHKYTDN
                     LKDLKWSDLVELDDKGLEDRGVNALGARNKMLKVFEQVKEARAEGKLEIS"
     gene            <1365816..>1369176
                     /locus_tag="TRUGW13939_00453"
                     /db_xref="GeneID:55987966"
     mRNA            join(<1365816..1366108,1366164..1367229,1367294..1368302,
                     1368356..>1369176)
                     /locus_tag="TRUGW13939_00453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483661.1"
                     /db_xref="GeneID:55987966"
     CDS             join(1365816..1366108,1366164..1367229,1367294..1368302,
                     1368356..1369176)
                     /locus_tag="TRUGW13939_00453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339554.1"
                     /db_xref="GeneID:55987966"
                     /translation="MEHHEYSDDVPMENVQYQWSGEPSLAGQPQDIDMAIDPRLYGDA
                     FMPWGPESSQHAPGNGSVPSLLANHQPPFQEQFDLSEPSTTSENEGIWSEEEANYAQE
                     DDKDDSDAAYTESEAAQDENDDTAAEPPRRKRRRGGHGAFRGRFGARGGKGIKRGPRR
                     PLEPSPEFKLLHSQATDAFIDGDYEKATDLVQHAILINPEMFAAHSLLSEIFLARGQQ
                     DKAVNALFSGAHTRPRDPDVWFNVAELIRDRAGEDPHKALTDRIYCYSRVIEIDPKNY
                     PARFHRAAAYRELGYNGRAATEYERILKELPHNIRALRHLAETYIDMQDVQRAIDYYM
                     DSIKYYMSLDTEDSLKFSWSDLNIFVELLAYERQYELGLRLLTSASRWLLGRNEDKIW
                     DDLDDDREWDVSHSPRRIKTDGFIPGMFPENSYGIGLPMELRMKLGIFRLKLGDRHLN
                     EALGHFEWLAPDDQSDDSKVHDYGDLFREAADALKDAGLFDQALRFYEPLQFTEEYAD
                     IGFFLAIGDCAFACGKNQEAASYYMTVVENDSTHLQARVNLAKLYEELGDKERALYFV
                     NQAVLLGREEAGGRRRTRRRDPRIANLAREFQGTNDLHVPNVAPRLSNVLAQSDVSAP
                     DTDRPGHVQYLYSKMNELRPAMRGGDENATEDWLDIADALLRDFRSNRSFYPLQKNTA
                     FLGYAREAQKKGGKKKEDLVMDEMQEMAGRLQESLSNIPEERIQATVPTDYYGISFAD
                     WLEIFLEYAFVVSGQGDSEEAYNVLAAAADASIWYHSKDKTRHIHICWITCALRLQDE
                     ETLVSEARWFSREYQFTTDTYRLFSLLSRVSGNPQKSLFHASPNMKFMLRQVKAMDYS
                     IPGSVMRKTKSREAAYQEKASLTTRNEHGELIKAESMDVALLVLYGHILYSGNSFLPA
                     LNYYFRAHALDKNNPSILLSIGLCYIHHAVKRQSENRHYMIFQGLSFMTLYRESREKE
                     GSLLVELQEVEVNFGRLYHSLGLLHQATIAYERALEMGEQIQAEAAGRKAAGESFVED
                     FSTEAAVALQNIYALSGDTLGAREVTEKYLVV"
     gene            complement(<1369269..>1371515)
                     /locus_tag="TRUGW13939_00454"
                     /db_xref="GeneID:55987967"
     mRNA            complement(<1369269..>1371515)
                     /locus_tag="TRUGW13939_00454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483662.1"
                     /db_xref="GeneID:55987967"
     CDS             complement(1369269..1371515)
                     /locus_tag="TRUGW13939_00454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339555.1"
                     /db_xref="GeneID:55987967"
                     /translation="MSSPDRSLKKQPPDPNPNPNDPACLPDYETEFLTTEELHQFEKA
                     LNTPDAESLVALNDWRPIRQRVRRPFRRRQKTRPQRTTDETREGVLYTVLKYPFLVIV
                     FGWLFVLSLTYVVTRLYIHLYEHFVTWTGRREKLRRALHVTTNYEEWTKAARSLDYHL
                     GNEKWKEKDEYAYYDYPTVRNVVSQLRQLREKAQGEAESAVTNGPSSIEDLCALLEAC
                     VKNNFVGVENPRLYSEAYSGTKHLVQEYVDEVHNSLEFVLNTRQLAKEDKYRHFRHLD
                     TNFGRTALCLSGGATFAYYHFGVVRALLDNGVLPEIITGTSGGALVAGLVATRTDEEL
                     RQLLVPALAHRIRACHEEFPGWVKRWWRTGARFDTLDWARQCSWFTRGSMTFREAFER
                     TGRILNVSCVPSDPYSPTILANYLTSPDCVIWSAVIASAAVPGILNPVVLMKKNRDGT
                     ISPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQVNPHVNLFFFSSRGSVGRPVT
                     HRKGRGWRGGFLGSAVEQYIKLDLNKWLRVLRHLELLPRPLGQDWSQIWLQHFSGTIT
                     IWPKSVTSDFWNILSDPSPERLARMLHTGQQSTFPKLQFIQNRMKIENLIMQGLLRHS
                     PTGTRDYSPLLSRRHDDGDTKHKPDSAHTLLLRESLGHNINNNINYISELPIDNFSDT
                     DDGGFSSSSYLDLPNSSRKQNGDEDYRRNSVMEEMRRQSAVFFDDPDVYGEESDEGSN
                     SSRKQEKL"
     gene            <1375044..>1377396
                     /locus_tag="TRUGW13939_00455"
                     /db_xref="GeneID:55987968"
     mRNA            join(<1375044..1375085,1375153..>1377396)
                     /locus_tag="TRUGW13939_00455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483663.1"
                     /db_xref="GeneID:55987968"
     CDS             join(1375044..1375085,1375153..1377396)
                     /locus_tag="TRUGW13939_00455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339556.1"
                     /db_xref="GeneID:55987968"
                     /translation="MEKLNSEDGQLFIKNLASFVRTHEKALANALQLRRQSAPSAGYA
                     STSSTLAAALSFGALKFTSHNVKPAKLTLTPHHLFYLLSQFEELSIPVGSMNVRLQNI
                     HNDSSSAYVSFLNQPRRSRGDRDSIHSVSSVRSVMSGMGSLWSSFGIGSKDASKSEKA
                     KAALDTDLKYLYSAFTKIPCLRLAPDHRARLIRGYEEFPLDTAVPLHAFKNLSALEII
                     DIDYRSFYGWDRLSEQLRTLTLKRAHLEDPADLLTKVVLDDIDKRRRRPSRSQASPVL
                     GGSGPQPVCKHEPRVPSSAPGSPAPDSSLGSSTSPKAVPMIRGASDGERGHRRAGSYS
                     PTRPPTARQTRHSRAYSVNKLGRSGSGSSQNSSEVSLPANRSSSNLLTGVLPATKWRF
                     LRHLGLADNSLTSISANSFTPVANTLHSLDLSSNLFTQVPESLASLVALRALNLSNCM
                     IDSLRSIAKNPLPAITALNLRGNRLSSLAGIERLLSLERLDLRDNDLTDPTELARLTG
                     LPEIREIWISGNPFTKTHSGHRVTIFNLFRSTPGYAEDIIIDASGPGYSERKQLVERA
                     AERESAPVIRSVEPELERTVSRAPAPTPSIKQVDRVEGSERRKKNSRRRIVDASGEPS
                     ITGNGVDPFQSNIITGTPFTDPFTEASDKASKKPNAIASVEPVKKAAVPLPHKDKPLP
                     VIPDLDWHATGDAYRQKLEALRQDVGSSSAWLGVLSDETWRQPTVSVPRTGTGFDTPM
                     MRPTAMNRPGSQMIMSGQTLS"
     gene            <1379613..>1380827
                     /locus_tag="TRUGW13939_00456"
                     /db_xref="GeneID:55987969"
     mRNA            join(<1379613..1379792,1379852..1380253,1380372..1380671,
                     1380735..>1380827)
                     /locus_tag="TRUGW13939_00456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483664.1"
                     /db_xref="GeneID:55987969"
     CDS             join(1379613..1379792,1379852..1380253,1380372..1380671,
                     1380735..1380827)
                     /locus_tag="TRUGW13939_00456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339557.1"
                     /db_xref="GeneID:55987969"
                     /translation="MADQSDVDLDSIIDRLLEVRGSRPGKQVQLLESEIRHLCTKARE
                     IFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
                     TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
                     IAAIIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSE
                     NDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEF
                     DNAGAMMSVDESLLCSFQILKPAEKKQKYVHGGIGSGRPITPPRKQKK"
     gene            complement(<1382149..>1383154)
                     /locus_tag="TRUGW13939_00457"
                     /db_xref="GeneID:55987970"
     mRNA            complement(join(<1382149..1382189,1382259..1382558,
                     1382615..1382680,1382752..1382791,1382905..1383008,
                     1383136..>1383154))
                     /locus_tag="TRUGW13939_00457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483665.1"
                     /db_xref="GeneID:55987970"
     CDS             complement(join(1382149..1382189,1382259..1382558,
                     1382615..1382680,1382752..1382791,1382905..1383008,
                     1383136..1383154))
                     /locus_tag="TRUGW13939_00457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339558.1"
                     /db_xref="GeneID:55987970"
                     /translation="MWIVNWFYDVLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDR
                     VAILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHER
                     FPESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHHMGLWQTTGKGKVPLE
                     GIRPIEVFMCSVVMRQGYGEGIRWLSQYV"
     gene            complement(<1383873..>1386071)
                     /locus_tag="TRUGW13939_00458"
                     /db_xref="GeneID:55987971"
     mRNA            complement(<1383873..>1386071)
                     /locus_tag="TRUGW13939_00458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483666.1"
                     /db_xref="GeneID:55987971"
     CDS             complement(1383873..1386071)
                     /locus_tag="TRUGW13939_00458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339559.1"
                     /db_xref="GeneID:55987971"
                     /translation="MAHHQQHHHHQTDHRKTPALYNLLKMVFSSDQPTLSADQEVEVV
                     DDGDEPPDHYSSPHQSSRHSAAAGQFYLKSSRTMLEKKESLLTRALRSPDLAPADRER
                     KASYPLSNASGHSTAELTSDGDLTSPAYSNTSSPPHPHTVSLVPALEPKIVSPPSDPS
                     ESKLEADLGRKRCISFACARRVEQPKEAEKKPATDNKNTNTDVADPPKRKSALTFACP
                     SRHTESNKTSNSHRKASPAPRTRGSPAPSSRHRLPSQDTTPSKKEAPAQQPVSQKPGS
                     IHPSGLGKFQPSEETRFHEFAGELDEMDSWMAGPAEHKEKITLNDCLKKENAIRKLGE
                     EAEAEAIEEEQEEDLADGDDDADTVHDFSSDDGNESDNEAGFADSDDESDDDSQYEFW
                     GPSTTTAATSADNLEFVRLNTAERRNSNISLDSLKQDSSTSRRPSTSAQTKTSRRPIN
                     IPRPNTPDLPDSTDFVCGTLDEDRPLEAAYISCMEERRRKKHVVIPQDIDPSFPTTDP
                     EDNEDDDLEEDNFDDEEIDTAAQIEEELLRGRRKGAPRTSPRISPRRVHSPAPRNHGQ
                     VSPKRMKSPAPKLRPSATRNIPALNIPAPVTGVNITGPAVTQPYYSRTSRTKSLPRTP
                     NPFFMRLEKSKQLLRPDSRPTSPERAPSRGRELHTRGPVDIIQGLERKRQKRKEKFWR
                     QHCRKAAKEQTERRAKSGKGAERMKELGLEVAERFRAYGVTKDTQLVLSV"
     gene            <1393978..>1395276
                     /locus_tag="TRUGW13939_00459"
                     /db_xref="GeneID:55987972"
     mRNA            <1393978..>1395276
                     /locus_tag="TRUGW13939_00459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483667.1"
                     /db_xref="GeneID:55987972"
     CDS             1393978..1395276
                     /locus_tag="TRUGW13939_00459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339560.1"
                     /db_xref="GeneID:55987972"
                     /translation="MSEVLRFATSLLRLKGIRSYSLETNSIISTICYWRRQEKLGEPD
                     ITMENIDSYIKFWLKRKGITSEALKAIQQHAGSLSRGLLMTLHSLRDYSGCKSFPKHV
                     LDLEDCEERIRKIYRRTQSPDVYDEDDYLAVKNIVDHAARSNQKSYDEQLASFSPLET
                     ASKVSGSVLLTSTNSIPPQILENIPSPIPQQPADNLDAYMSDAEPLYSDTFETDFLKE
                     YIKDFSGLKKDQKKAGKPDAHMSDAEPLCSDATEKDFLEEHTKDYSRISRKGQIWKKE
                     ADSYKNKDYIYYVNPDTSACRHIVVSCCRIAISGKGQDIGDGTIRVRIQVEPHGKRHP
                     NCYATKALDEDPASRLAFLIKYKPYSGPEIQRFAKSQGDMGLYAANTFVNIIADRMSL
                     EEIATFPRRYIYLHKESTYGPELERFVGGNYTEGCKNRDR"
     gene            complement(<1396679..>1398195)
                     /locus_tag="TRUGW13939_00460"
                     /db_xref="GeneID:55987973"
     mRNA            complement(join(<1396679..1396783,1396835..1398031,
                     1398097..>1398195))
                     /locus_tag="TRUGW13939_00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483668.1"
                     /db_xref="GeneID:55987973"
     CDS             complement(join(1396679..1396783,1396835..1398031,
                     1398097..1398195))
                     /locus_tag="TRUGW13939_00460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339561.1"
                     /db_xref="GeneID:55987973"
                     /translation="MATKALEAHFRHLSVHDENNDRHDMTDSHRISKVVTTNNSTRPS
                     ERDQLPERSTLRKPLSDISAHIPNTAHRVGEHHIASIRQQQNTALNHVASQVAQTKDG
                     KAPSKARHPLSVVISQAPDVTFETGESNAVRDVKRQDTVANHVASKVAQAKGGQALSL
                     VQARLSVALLEKSNSVVKAGIHSVQLIVQPAPKPLHLGMFEIGRALGKGKFGRVYLAR
                     ERQSGFICALKVLHKNEIQKEHMQKQVAREIEIQSNLRHPNILRLYGHFHDRKRIMLV
                     LEYAGKGELYKHLRKADRFQEKKAAQYIAQMAGALQYLHRKHVIHRDIKPENILVGLY
                     GELKMSDFGWSVHSPSSRRLTQCGTLDYLPPEMADPKRYGKPYDEKVDLWSLGVLMYE
                     FLVGRAPFEDTPAMTYRRIAKGDMKVPSFVSPEAKDLIKKLLVLDSDQRISLEKVRQH
                     PWIIKHCESVAKQDKS"
     gene            complement(<1398633..>1400727)
                     /locus_tag="TRUGW13939_00461"
                     /db_xref="GeneID:55987974"
     mRNA            complement(join(<1398633..1399318,1399373..1399824,
                     1399877..1400361,1400414..1400610,1400679..>1400727))
                     /locus_tag="TRUGW13939_00461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483669.1"
                     /db_xref="GeneID:55987974"
     CDS             complement(join(1398633..1399318,1399373..1399824,
                     1399877..1400361,1400414..1400610,1400679..1400727))
                     /locus_tag="TRUGW13939_00461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339562.1"
                     /db_xref="GeneID:55987974"
                     /translation="MESLIYEDSPLADYLEDEGERDQDWTPQKVDTSAPLSDAVPDFA
                     PRRTSSIQNRIRKRLPAPLVINSLRETSTLGKIHRTCSSAVSSHIGKRDNERFLEQFG
                     YVIVASRLLDEYNTSSHVSATNHALPYAPGFEPLSFTTTVGLTGAVVTAATSFSIVGM
                     IHWSRSRSGVGMNPRRIAVLLFVLPLVGIVFYAFARRQWLKFVRHQAVQETSLFVNHA
                     QNFDSVMSSSILFIQEVELVSRGYRISTPLPPISRLEETTQARRCMRLRRTISECLFT
                     VLNRYIQAQHSIGLLTDPSNLEKYYDIYEISTEELREARSAPSETPVDDQYSLRFLRT
                     LIGRLYTVRKSILCCLLALKAEGSSADIVTWTSAVEEVRDLATITGDATRRITDILNE
                     QDREAPPASPLPAASSTGRDTLRAQARRLNSLSQGIRALHAKMHVMREESDGNISQEG
                     ATDYEIGVSMMAQYESIGSDIRGLLQEWEAGKAALLSSFEHPNGSERFSRASSDVKLP
                     LSPLSPTSSLGGITAVDGSPTAALRALNGETTSSTSHAENVNEMEEIFEAIVMPTSRK
                     RQSLTREERIARVKEDRARQAAARERTDASTNMLKELETVIKHRPQLNKSHRVTSI"
     gene            complement(<1401810..>1403886)
                     /locus_tag="TRUGW13939_00462"
                     /db_xref="GeneID:55987975"
     mRNA            complement(join(<1401810..1402447,1402579..1402799,
                     1402856..1403701,1403771..>1403886))
                     /locus_tag="TRUGW13939_00462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483670.1"
                     /db_xref="GeneID:55987975"
     CDS             complement(join(1401810..1402447,1402579..1402799,
                     1402856..1403701,1403771..1403886))
                     /locus_tag="TRUGW13939_00462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339563.1"
                     /db_xref="GeneID:55987975"
                     /translation="MERRGGSPSRGSNYGLACMQCVKAKCRCVPRATGDSCERCFRLR
                     KDCQPSDSARRRNAQKGKESDTRIAHLEGKIETLMSVMQTVAGSSGSPIDLHRLLNGE
                     SIPLPITGSSGISMDSTSTYPNPSQGPTPPTESFPTAPQSSNPSPPALSDITPFEAEA
                     SFNFFRSRMLPCFPFISLAPDVTVWQVRQNRPFLFQAIITVTTLSTQKKFARAEELKH
                     LIFTSALLDVQSSFDLLVGILTYLAWSTDAFLGRADLLSRLMMLAISLVYDLRLFKPS
                     PPDVQMIVTLTQGFSEDNRLANEETLQSFMDQQRAVLACFVLSSNISSHFGRIDALRW
                     TPQMEEALRVIEKNKPYPTDEWFVFEVRLHLIMQRASHIREQHETDRARTAASTTATP
                     VPEILTAYTRYVELYIDQAGRLIGPDASLLNVSGSGIESAFLPGYERIGSLWRSVESV
                     KAWLDAFYKLPAAQCLGLPFHFWSQLIRCTTILKYLTTLDDPAWDCQAVRQKVDIMEV
                     LEWMSKKLNLISEEAGLQSNDDLFKLLSKLLSGSRDWVEAKVKTSSSQMPANEVLPDI
                     HTTSLEAEIPDLDYIPWLQSMDLENDKWFEEVLGWSPTAF"
     gene            <1404169..>1405077
                     /locus_tag="TRUGW13939_00463"
                     /db_xref="GeneID:55987976"
     mRNA            join(<1404169..1404604,1404665..>1405077)
                     /locus_tag="TRUGW13939_00463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483671.1"
                     /db_xref="GeneID:55987976"
     CDS             join(1404169..1404604,1404665..1405077)
                     /locus_tag="TRUGW13939_00463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339564.1"
                     /db_xref="GeneID:55987976"
                     /translation="MPEKTVLITGCSQGGIGASLAKVFRAKGFYVFATVRNVAKAGSL
                     VDREGIEILELEVTSLESIQQCARAVEKRTGGSLDVLVNNAGASHVLPLLDTTIDEAK
                     KLYDTNVWSVLAMTQAFTPMLVKAKGVLCNISSVAAFVPFAMSGTYNSSKAATTMLSE
                     TLRLELEPLGVRVITVMVGIVDTPINAKSDALVLPDNSYYGVIRDRIALFRDGSAYPN
                     KQDPDVTAKNIVHDVVNGSSSYIWRGQSASLAWFCFTFIPNRFLVNMMNGDKGLDEVA
                     RAHKSG"
     gene            1405951..1406030
                     /locus_tag="TRUGW13939_00464"
                     /db_xref="GeneID:55987977"
     tRNA            1405951..1406030
                     /locus_tag="TRUGW13939_00464"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:55987977"
     gene            <1406559..>1409679
                     /locus_tag="TRUGW13939_00465"
                     /db_xref="GeneID:55987978"
     mRNA            join(<1406559..1409238,1409294..>1409679)
                     /locus_tag="TRUGW13939_00465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483672.1"
                     /db_xref="GeneID:55987978"
     CDS             join(1406559..1409238,1409294..1409679)
                     /locus_tag="TRUGW13939_00465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339565.1"
                     /db_xref="GeneID:55987978"
                     /translation="MNALLDSPCPSENKPGLGRRQQYQLNDPWKDGTLDDFENTAAID
                     FTTEIHIPSLAREKPRRAHSKTSFAIHDDSKQNTTFTSSSVARNNTLKRKTQDGRSSL
                     LAQPAQRFQRPRVSTAGRSPTENPNAGRNAASGQQTGNVERRQSYPKAAESTSVSTTL
                     ENEALKKDVRRETVYIPTEDTTMPAVFMKLFSPLKSNQINANGSNPVDNTASISSLEA
                     RIAAKRKPRTSTSTAPKRAPLQEATRVPQQSAIHENVFGKNGGKENIPPGYIVGDGTK
                     FNAKDEGFPVFEMPTKKPLKTVRKTETRFSNQAEKVKKPVLKATKEKSPIVSIKTADQ
                     QKTKKVTPKFHEKASIIGLKNSGPENSKSSGSIVRNKLSIPQIHPMTIDQRYPLLDND
                     ITNPMMYEENWLLHQEIVITQLVNGLFDSANGKLDAGNSDVLRHELFQIYQSDVFLLL
                     YKRLHASILYGALAPPKEALRRGSRLSDDIGMKRTFLNFWTKTYDLHALRAAAEVVIG
                     RRISPSAQINGRLSDSLTKKHKGLKRTLETFLETFLIRNEDKEQPAANQDEVPGSLYR
                     HTVLRSILIIILLDSGRLTPWTSLPKRLFATSSPHKSSTAALQALANQLLPSTGDIIR
                     PLNHLDCQLYYKQHDLQDYEFHINNLAVDLRDGVILTRLADLFLYPSTLPPSSGFELD
                     TTTSMTEVLASRGMKAENEWPLSQCLKLPCTSRATKIFNTQIALKALSETKEVKHATK
                     DICAEDIVDGHREKTISLLWGLVGKWGLTQLIDWDDVRNEITRLQKKISPHPDSASQE
                     GETLPNVDSVSHKEMLVKWASILAQLKGLQLDNLSTSFADGRIFESIIDEYEGYLTGE
                     QKANHNLSPKSIADKKSSLQDTGLEARLRSLGCSSQFASLLAPPSTGSRILDSDFVLG
                     ALTFLCSRLLTSTKRIRATIVIQAAWRQVLACRALHRRALAKRTAEQCAAVVNARDRI
                     LWAKSVIVMWWRKQNQTKRKATLKSTKFPNHKSKGHISGQNQRATNRVN"
     gene            <1410061..>1411737
                     /locus_tag="TRUGW13939_00466"
                     /db_xref="GeneID:55987979"
     mRNA            join(<1410061..1410369,1410433..1410447,1410498..1410899,
                     1410971..1411342,1411396..>1411737)
                     /locus_tag="TRUGW13939_00466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483673.1"
                     /db_xref="GeneID:55987979"
     CDS             join(1410061..1410369,1410433..1410447,1410498..1410899,
                     1410971..1411342,1411396..1411737)
                     /locus_tag="TRUGW13939_00466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339566.1"
                     /db_xref="GeneID:55987979"
                     /translation="MSTVRENGGSSTCVIELRPTSAFSTKEDGQRPPGITLNTERENN
                     DNSNDHHTPGWEQDTESLGPGRAVAHAREKWNEPSVNAPRTFATFWCFVIMGANDAAY
                     GALIPYLETYYNLTYTIVSLVFLSPLVGYAVAALFNHAIHMRLGQRGVAILSSSFHLI
                     AYVINSVHPPFPVLVVSFIFAGLGNGLGDSAWNAWVGNLANANEVLGFLHGFYGLGAV
                     LSPLVATSFITKANLQWYTFYYLMIGGAVIELAFGTVAFWKANQHEFRKHIAQSSEQS
                     SQHKGGNGLKEALLTKPAARVTWLCAAFLLGYVGAEVALGGWIVTFMMRVRHGGAFAS
                     GMTATGFWIGITVGRVVLGFVTARIGEKFAISIYLLLAMAFELIFWLVPQFYVSAVAI
                     AIQGFFLGPLFPAAIVAATKLLPKHLHVSSIGFAAALGGAGAAVFPFAVGAIAQAKGV
                     QVLQPFALALLIAVLGAWMLLPRMPKNEE"
     gene            <1412525..>1413305
                     /locus_tag="TRUGW13939_00467"
                     /db_xref="GeneID:55987980"
     mRNA            join(<1412525..1412879,1412939..1413225,1413288..>1413305)
                     /locus_tag="TRUGW13939_00467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483674.1"
                     /db_xref="GeneID:55987980"
     CDS             join(1412525..1412879,1412939..1413225,1413288..1413305)
                     /locus_tag="TRUGW13939_00467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339567.1"
                     /db_xref="GeneID:55987980"
                     /translation="MDNSHVALVSMLMRAEGFSPYRCDRNIALGINLVSLTKVLRAAQ
                     NEDILTLKAEDSPDVVNLMFESAETDRLSEYDIKLMDIDQEHLAIPETEYAATVSMPA
                     AEFQRICRDLNALSESVVIEATKEGIKFSCQGDIGNGSVTVRQNTNVDKPEQNVSIQL
                     SEPVALTFSLKYLVNFCKATALSSQVNLCLSQEVPLRVEYSLGSGHLRFFLAPKIGEE
                     D"
     gene            <1416140..>1417313
                     /locus_tag="TRUGW13939_00468"
                     /db_xref="GeneID:55987981"
     mRNA            join(<1416140..1416222,1416279..1416723,1416775..1416969,
                     1417020..>1417313)
                     /locus_tag="TRUGW13939_00468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483675.1"
                     /db_xref="GeneID:55987981"
     CDS             join(1416140..1416222,1416279..1416723,1416775..1416969,
                     1417020..1417313)
                     /locus_tag="TRUGW13939_00468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339568.1"
                     /db_xref="GeneID:55987981"
                     /translation="MYIPNSKWTWLFVVIVVIQAAVILGLESYVFADFQIHLQTVKAV
                     DSKSSTKTIPTFLSLYIFGFVYELVLAYDALRLKNTIQIIGLCICNVGLLIYGAVQIE
                     QIQEAVDLLDGIGALDNDLWDQTKPILIAIPCILGLTSVLMIGVAWKLYDEFAWTIYK
                     HISADLRMKRRYLTYQIYIALLKFDFFFFLGFTVQFVVVVTGRTNTEFALTIAAIPVT
                     IIILVFAAYFTRRESTAGMCAVIVLYIGGLAYFLFKLVRMYQPSREAEYTSARRSLTF
                     FAVITLLLIVSTIVNAIICTINFHKGLKPHIWKPRKSNDEEKSTEMGPQTPGDDNPSR
                     MMID"
     gene            <1417978..>1418531
                     /locus_tag="TRUGW13939_00469"
                     /db_xref="GeneID:55987982"
     mRNA            join(<1417978..1417980,1418066..1418411,1418497..>1418531)
                     /locus_tag="TRUGW13939_00469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483676.1"
                     /db_xref="GeneID:55987982"
     CDS             join(1417978..1417980,1418066..1418411,1418497..1418531)
                     /locus_tag="TRUGW13939_00469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339569.1"
                     /db_xref="GeneID:55987982"
                     /translation="MSSPRASSPLASGTESGPDTKSPGSGAAAASGSAGNRPSSPTPP
                     GGPRTALRRRAAADHKESLRNARPTSTRSAGAGGSSGTMLKLYTDESPGLRVDPVVVL
                     VLSLGFIFSVVGLHVIAKVTRKFSA"
     gene            <1419749..>1421837
                     /locus_tag="TRUGW13939_00470"
                     /db_xref="GeneID:55987983"
     mRNA            join(<1419749..1419867,1419926..>1421837)
                     /locus_tag="TRUGW13939_00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483677.1"
                     /db_xref="GeneID:55987983"
     CDS             join(1419749..1419867,1419926..1421837)
                     /locus_tag="TRUGW13939_00470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339570.1"
                     /db_xref="GeneID:55987983"
                     /translation="MAGVAHFTVPLHQSFGYGIVVGLGFAFALLMIFITWALKRYQYE
                     VQTSEMFSTAGRTVKSGLVASAVVSSWTWAATLLQSSTVAYEYGVSGPFYYASGATVQ
                     ILLFATLAIELKRRAPNAHTFLEVIRARYGTVVHCVFIVFCLMTNILVTAMLLTGGSA
                     VLTALTGMHTAAACFLLPIGVVLYTVFGGIKATFITDYLHTIFIVVIIFVFAFNAYAS
                     SPVLGSPGKVYDILTAAAKANPVDGNSQGSYLTMHSREGGIFFVINLIGNFGTVFLDN
                     GYYNKAIAASPVHAFPGYVIGGLCWFAIPWLCATTMGLTAIALQGDSILSSTDVTAGL
                     VLPYAAVQLMGYGGAVATTLMVFMAVTSAFSAQLIAVSSVFTYDIYQAYIKPSAKGQN
                     LVWMSHMACVVYALIMAGFATGLYYAGIGMGYLYLLMGVIISAAVIPGSLTLLWKGQN
                     WVAAALSPPLGLAVALIAWLVTAKSLYGELTVATTGQNYPMLAGNVAALLSPLIFIPI
                     LTLIFGQQNYDYESMRNIRKVDDSDVAAAAHVDLEMIPGETSHPEDMTATEKQKLDKA
                     AFWARTLTVIMTLCLLILWPMPMYGSGYVFSKKFFTGWVVVGILWLFCTAFGVVLFPL
                     YEGRASIVRVVRMMALDAMVKGRKKHLAQEPDTSVTASPAQAASVEKLPVAE"
     gene            complement(<1421911..>1423129)
                     /locus_tag="TRUGW13939_00471"
                     /db_xref="GeneID:55987984"
     mRNA            complement(join(<1421911..1421981,1422062..1422342,
                     1422399..1422574,1422629..>1423129))
                     /locus_tag="TRUGW13939_00471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483678.1"
                     /db_xref="GeneID:55987984"
     CDS             complement(join(1421911..1421981,1422062..1422342,
                     1422399..1422574,1422629..1423129))
                     /locus_tag="TRUGW13939_00471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339571.1"
                     /db_xref="GeneID:55987984"
                     /translation="MVEPHISPRDVIVHPSRTPSSPYHIFFLPGNPGLVEYYAGFLES
                     LHQSLNKALPGFHVTGCSFAGFETTASINNSAQGRGKEQLYNITEQTDFALEKLRQCI
                     TTDNISESKPKVILIGHSFGTFVATEVMKRIQTEQLREAFDVVGGVLLFPPIPDLEMS
                     PRGSKLAAFLRWKYLPGICSSLAGLVHILPVSWTHAVIRHATAFPADALATTHAFLGS
                     KTGVAQALYLGRLECDEIKAARWESAFQSIAQLTPKPPVIRIFFGSDDHWVLNELRDA
                     FVSQYCDPNGPKGFGEKLDITARVDPSDDGDETSVVIPHDFSIRHSEHVVPYVVEDIN
                     EIVHAIAQ"
     gene            complement(<1423502..>1425511)
                     /locus_tag="TRUGW13939_00472"
                     /db_xref="GeneID:55987985"
     mRNA            complement(join(<1423502..1423682,1423745..1423785,
                     1423839..1423868,1423935..1423959,1424024..1424057,
                     1424117..1424170,1425024..1425093,1425148..1425174,
                     1425231..1425265,1425320..1425353,1425406..1425428,
                     1425481..>1425511))
                     /locus_tag="TRUGW13939_00472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483679.1"
                     /db_xref="GeneID:55987985"
     CDS             complement(join(1423502..1423682,1423745..1423785,
                     1423839..1423868,1423935..1423959,1424024..1424057,
                     1424117..1424170,1425024..1425093,1425148..1425174,
                     1425231..1425265,1425320..1425353,1425406..1425428,
                     1425481..1425511))
                     /locus_tag="TRUGW13939_00472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339572.1"
                     /db_xref="GeneID:55987985"
                     /translation="MSIEKREKLEAQIKSVDMTEDMQQEAIEVATEAMDKLHIEKDIA
                     QYIKKEFDSRKGATWHCIVGRNFGSFVTHEFSSKLEGYEQTRAFCQNCGNWDVQCETR
                     WPWFTVCFVPCIPLGSKCKEAHCYRCGFTQDMSMRPDITPNTQPPPGVSWGPAYGPPP
                     VLMKYPGPMQPPPAATQAPPVSSGANPDAGNVYK"
     gene            <1425824..>1428596
                     /locus_tag="TRUGW13939_00473"
                     /db_xref="GeneID:55987986"
     mRNA            join(<1425824..1426051,1426103..1426837,1427057..1427329,
                     1427382..>1428596)
                     /locus_tag="TRUGW13939_00473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483680.1"
                     /db_xref="GeneID:55987986"
     CDS             join(1425824..1426051,1426103..1426837,1427057..1427329,
                     1427382..1428596)
                     /locus_tag="TRUGW13939_00473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339573.1"
                     /db_xref="GeneID:55987986"
                     /translation="MESSRVFVSGLPPTISNHDLGKHFSGRFQVTDAHVIPSRRIGFV
                     GFKEAAHAKQAVDYFHKTYLRMSKISVEMARSTAEMESTKNQNTPDRQESSSTNNLKR
                     KRGAEDPNKDAKLNEFLSVMQHSSKTRTWANDDDGLVQPLAANEAANNTDKIEETAEK
                     VPENPVKKPKVKTAPVAHSAAQEQTPQVSEDAENDNMDTQDDSAPTDGQEDQPKSDAD
                     WLRSKTSRLLGLLDEEEQTEVKAPSSESEDDSDKPAKSKIQQPEEIFESQASPEEEEI
                     EEERDYDADVELIRTSGRLFLRNLAYGATETDLEPIFAPFGKIDEIHVAFDTRTTSSK
                     GFAYIQYIDPSSAVNAYKSLDGKDFQGRLLHILPASAKKSYKIDDYELSKLPLKKQKQ
                     IKRKMEASSSTFNWNSLYMNTDAVMSSVADRLGVSKAELLDPTSSDAAVKQAHAETHV
                     IQETKSYFTSNGVNLDSFQQRERGNTAILVKNFSYGVKSTELKKLFEPFGQLTRFLMP
                     PSGTIAIVEFARPDEAQKAFKGLAYRKLGDSILFLERAPKNLFDAPATAAIQSASSEI
                     KAKSQGFSATDTFAAEDNEIQPPTTTLFVRNLNFTTTNKRLTEVFEPLDGFLSAKVKT
                     KQDPKRPGETLSMGFGFVEFRTKEQAQTALAAMDGYSLDQHELVVKTSHKGMDAAESR
                     RREDTAKKVAARRTKIIIKNLPFQATKKDVRSLFSVYGQLRSVRVPQKFDRSTRGFAF
                     ADFVSAREAENAMDALENTHLLGRKLVLQYASEEAIDAEEEIRKIEKKTGQQVDREKL
                     QSLTGTGRKKFVVGAEED"
     gene            complement(<1429111..>1429452)
                     /locus_tag="TRUGW13939_00474"
                     /db_xref="GeneID:55987987"
     mRNA            complement(join(<1429111..1429353,1429417..>1429452))
                     /locus_tag="TRUGW13939_00474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483681.1"
                     /db_xref="GeneID:55987987"
     CDS             complement(join(1429111..1429353,1429417..1429452))
                     /locus_tag="TRUGW13939_00474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339574.1"
                     /db_xref="GeneID:55987987"
                     /translation="MLQENVGNQKENGTSDLASTSNRIATRFPFTVFLLSDRAAIGTV
                     SSGLAIRGRADEEHVKKAVILTAVIRAQKKGTMSDVGTSKGFAAARPS"
     gene            <1429586..>1432132
                     /locus_tag="TRUGW13939_00475"
                     /db_xref="GeneID:55987988"
     mRNA            join(<1429586..1430039,1430094..1430270,1430325..>1432132)
                     /locus_tag="TRUGW13939_00475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483682.1"
                     /db_xref="GeneID:55987988"
     CDS             join(1429586..1430039,1430094..1430270,1430325..1432132)
                     /locus_tag="TRUGW13939_00475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339575.1"
                     /db_xref="GeneID:55987988"
                     /translation="MAGWQTDSFVSQTQPSLDSVGGGAAAAHRALQHTSGNAQSYADG
                     AAMNGDGSSRDGHFQPLALKYPPAPVSYHHPVSSSTSVHESHILAARLQARKLRRLQS
                     ASHPVSGMRTKRSYLKSQKYLEYRARPRRDTGKDGEPVWSDALEDAFQQALEANPPMG
                     RRKWSERGKSYGRNELIAEYIYNLTGKRRTRKQVSSHLQVLDSFLKGDPEWERLVREK
                     PDAPNTQPPTTTPQYRSSIQHQMSRGMSSQQFPSCPDYSASSHSYNGDLPTPVTLGSN
                     TYEPTSHLIHAFNFDMWVSAPQQANRIDKALHVYTRLQGDQHRPVALPMPLDNLAGWR
                     TSFPHLSSLVEDINNPLDCDVILLEVNLQLMGDFPPSGSRLGIQLDLDFGHPTMGDVS
                     LASQMEDWTCSTFIYEEGQKMVETYNDLQKASSTKIKPLFESSWWAKLFTQLTQEKQM
                     AEGSGQSEAVQAADNHTRQFFHSLSAVQELRATPSSHRRMSTYSTSNQGDESKRMAIL
                     LWKFRQTRPGEVGTTTWRRLIPPPERTTANSPRAAAGIDLPPLALDSMVSSKPQEHVY
                     QQSHPSMMQHQLPAVNIQQQWPVYADHADGVAHMFNTQGSYDFLNNISKPEDNLVDKT
                     SVTSVLDSFTGLTQETTQPGSVSVPSASQGLFNVHDLPLASHSHLSGFGLGGDSNHYI
                     TSQHIHDNNNNVLNSIFGSAGPSIHDISQTQAPLWEPQGSSLHSDLGGSGYSHMHFPS
                     NGHHHHHNHNHHHQHQQQVPVSREHQGSGLEGILPSDDFIDKLVSGVSAGGHLNGAAP
                     TNTRYTDNNAVESV"
     gene            <1432975..>1433721
                     /locus_tag="TRUGW13939_00476"
                     /db_xref="GeneID:55987989"
     mRNA            <1432975..>1433721
                     /locus_tag="TRUGW13939_00476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483683.1"
                     /db_xref="GeneID:55987989"
     CDS             1432975..1433721
                     /locus_tag="TRUGW13939_00476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339576.1"
                     /db_xref="GeneID:55987989"
                     /translation="MSKTIALISGANQGIGLAAATRLAREFGYQVIIGSRNAENGAKE
                     ATKLQTEGLAVDSVQLDLTSDESIERAADYISSKYGKLDVLVNNAGILIDVGVANANP
                     ELPTRELFEKTFSTNVTGTACLTEAMIPLLRKSDQRPRLVFVSSIMGSITESLDQTSA
                     WYEGEYRAYDASKAAANMLAVNYNRILRDVRARVNVACPGLVATNLTKYTAYGGTPED
                     GARRIVQLATLAEDDETTGTFSNVHGGIAW"
     gene            <1436934..>1438154
                     /locus_tag="TRUGW13939_00477"
                     /db_xref="GeneID:55987990"
     mRNA            join(<1436934..1437078,1437135..1437922,1438140..>1438154)
                     /locus_tag="TRUGW13939_00477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483684.1"
                     /db_xref="GeneID:55987990"
     CDS             join(1436934..1437078,1437135..1437922,1438140..1438154)
                     /locus_tag="TRUGW13939_00477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339577.1"
                     /db_xref="GeneID:55987990"
                     /translation="MSSPTIKLTSGYDMPRVGFGLWKVNNDTCADQVYSAIKAGYRLL
                     DGAADYGNEKEVGQGIARAIKDGLVKREDLFVVSKLWNTFHDGDKVEPIVRKQLEDLG
                     VEYFDLFLIHFPVALKYVDPAERYPPGWTNADGKVEFSKATIQETWQAVESLVDKKLA
                     RSIGVSNFSAQLIMDLLRHARIRPAALQIEHHPYLQQKELVKYVQGEGIAITAYSSFG
                     PLSFIELDMSRAQSTPTLFEHDIVKSAAAKHDKTPAQVLLRWATQRDIAVIPKSNNPA
                     RLAQNLDVTGWSLEQAEIDAINNLDLNLRFNDPVNSLKR"
     gene            complement(<1438163..>1439950)
                     /locus_tag="TRUGW13939_00478"
                     /db_xref="GeneID:55987991"
     mRNA            complement(join(<1438163..1438957,1439049..1439249,
                     1439318..>1439950))
                     /locus_tag="TRUGW13939_00478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483685.1"
                     /db_xref="GeneID:55987991"
     CDS             complement(join(1438163..1438957,1439049..1439249,
                     1439318..1439950))
                     /locus_tag="TRUGW13939_00478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339578.1"
                     /db_xref="GeneID:55987991"
                     /translation="MNVGKLRNLSLSRQYARGITSRGCRPGALSPLTRKSISTCLPRR
                     PVTNPCSRQPTSSVVFSRQYAIEKGTVKPVSSVHDVEEVDAALQQMISEGSNLAETIT
                     RQNEDIQIGSELMIHAVYDSLIDLSLQLVVKLYPDGVTGLINAEDAYTSFPPGMEEYV
                     KQVRNGLRLNGPENVHKTSFEDAVERTTRMFNLVEKAHAELGHLFGEHHETLNEKVQN
                     MWSLLKRAEKADKFIETETENEEKDAASDKSTMTSEKKEFDTLKSKISKLVDETQRMR
                     NDRSNLEHPQNVGEGIAWGLFGIGAAVAAGTRSRLSGSINVNESKLEHERDLQKTHKI
                     RYDNAFARLEKVNVTLGALKSQKNSVDEHVKSLEKVVASSKKALGFVVDRKNILSRIH
                     NDLINMTKFATRYKAHQYDERASLGFLAKGIVDVLDATPDWPGTVVPVVLTAMFLRWP
                     PSIVLSDSDDVLGESEGGDNEAQVKLDRVVEKASLNYIKFAKAANPQPHLNDYLHDVE
                     FDWEHTFARWRKIIEDGEFTGFRPAPAIPLRPYD"
     gene            <1440863..>1443682
                     /locus_tag="TRUGW13939_00479"
                     /db_xref="GeneID:55987992"
     mRNA            join(<1440863..1440944,1441002..1441164,1441225..1441342,
                     1441414..1441763,1441832..1442297,1442369..1442773,
                     1442835..1443239,1443297..1443518,1443575..>1443682)
                     /locus_tag="TRUGW13939_00479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483686.1"
                     /db_xref="GeneID:55987992"
     CDS             join(1440863..1440944,1441002..1441164,1441225..1441342,
                     1441414..1441763,1441832..1442297,1442369..1442773,
                     1442835..1443239,1443297..1443518,1443575..1443682)
                     /locus_tag="TRUGW13939_00479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339579.1"
                     /db_xref="GeneID:55987992"
                     /translation="MAISTPGPDTLGVLITKNTATIASYKTDLQAKAHASKHGWLAYL
                     GMAPVCLELLALCTLTAARDDARNIILVSNKKYEYLKGHLHLSTCLIEVVNRGSTAFT
                     NCNKHMEEIRATSESVKDTVTMIVKALLRGNLQLTVQLDTLVEAAETCKDAAAKMDDE
                     LEAWYKYVMELHEACDATDQDTKGKYQIALSDEKARKVEQELLTTSITSAEKWVKDRE
                     EQVQEMKDLVKEELKNYPTGNQLMVMDLVQTLGNAAASATNILAGAAASRIGGGSAFN
                     NKTKSKSSSGKKKETSDDDDDDDDEAADDVANDPASVYLPFALMAINQLHGIVSDKAG
                     VQWDLITNVESTSGKGGQLDLTGVSGSLTRHRATLEKKKTAKSSKVGKALLKSIGEVE
                     LVVSELQVERTKSRNMGDNWKKPANDSKQVSGWQSTVKKSQKAVQKLDTKDKALTSGT
                     KNPPLPGANLQAAASSGSKTASQMAVEAASFKVTTAREMYKSTLSSADTARSQLLAFQ
                     SQMNNIKADLDSLKEDKLTLEAVKVCLRNCLTLLVELKDCILQLRLFFTQLAVQIKTL
                     VKGNVLPFKSTVQHAISSPEALIDRVILQQYTVAIWAGFDQFKEVAEFYKSVHDPHIL
                     NGLNLVNKMTLQNNVTAGYQQIEQYSKTSQTAVIDLINAETTKFKTRIEKTYGQIIEL
                     EKNSALPPTEAQQDLLGSAVKSAENVIKDQLDAKSAPINYMTQPREQRDAQADQLSKA
                     LDPETLQNQADALKGELGFHEQDSDEYLGMDD"
     gene            <1444026..>1444901
                     /locus_tag="TRUGW13939_00480"
                     /db_xref="GeneID:55987993"
     mRNA            join(<1444026..1444202,1444269..>1444901)
                     /locus_tag="TRUGW13939_00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483687.1"
                     /db_xref="GeneID:55987993"
     CDS             join(1444026..1444202,1444269..1444901)
                     /locus_tag="TRUGW13939_00480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339580.1"
                     /db_xref="GeneID:55987993"
                     /translation="MFSATAARFSAILGDGLRTLASRQIAIETSRPLRKIADRRVVLG
                     ALQKYGEVVTFKHVKPAQQDAAHGRILAIFDTPEAATKAIDASPLEITLHDESSNNAN
                     DRTVMCEISTSAVDHYNHIIRKNPYHGPWEMDYSDKRVRDVIKTKAPRHELADCFPVS
                     KEGAPAAGQEEKPDKDIEGVDREMDREMDREIDREMDREMDREMDREMDREMDREMDR
                     EMDREMDREMDREMDREMDREMDREVDGDLEEVSARSLDEILKQRVDKEGQ"
     gene            complement(<1445098..>1446608)
                     /locus_tag="TRUGW13939_00481"
                     /db_xref="GeneID:55987994"
     mRNA            complement(join(<1445098..1445117,1445183..1445585,
                     1445644..1445718,1445840..1446136,1446203..1446274,
                     1446355..1446386,1446461..>1446608))
                     /locus_tag="TRUGW13939_00481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483688.1"
                     /db_xref="GeneID:55987994"
     CDS             complement(join(1445098..1445117,1445183..1445585,
                     1445644..1445718,1445840..1446136,1446203..1446274,
                     1446355..1446386,1446461..1446608))
                     /locus_tag="TRUGW13939_00481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339581.1"
                     /db_xref="GeneID:55987994"
                     /translation="MKDRTGWDGKLRIDDPTERRAVITNPEALEDPDYSDDEALPVDT
                     ISADEDILEDEDPDVEDIDLVHYRIGSIPALKLERFTKLEKICLRQNHISRIEFPSNF
                     GATLKELDLYDNLIGHIKGLDELTNLTGLDLSFNRIKHIKNISHLTQLTDIYFVQNKI
                     STIEGLDELVHLRNLELGANRIREIQNLDNLKALEELWLGKNKITEMKNLSALSNLKI
                     LSIQSNRITSITGLSELHGLEELYISHNGLTDLSGLESNTALRVLDFSNNQVSKLENI
                     VHLTHLEELWGSNNALSNFEEVERELKDKENLETVYFEGNPLQTNSPALYRNKVRLAL
                     PQVKQIDATYVRLV"
     gene            complement(<1448073..>1449875)
                     /locus_tag="TRUGW13939_00482"
                     /db_xref="GeneID:55987995"
     mRNA            complement(join(<1448073..1448444,1448494..1448643,
                     1448701..1449767,1449845..>1449875))
                     /locus_tag="TRUGW13939_00482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483689.1"
                     /db_xref="GeneID:55987995"
     CDS             complement(join(1448073..1448444,1448494..1448643,
                     1448701..1449767,1449845..1449875))
                     /locus_tag="TRUGW13939_00482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339582.1"
                     /db_xref="GeneID:55987995"
                     /translation="MATIAGPPDHGPDNAPADELIQAQPHPSDDGIAVVQSSSLPENT
                     QSRPPLDKPKKKRSLLLVPSRTSSRGSKQQSSDMTTETAQDESNTLANSRTNLTKRRR
                     DRSKASSRRSQRNDQEENMHAKPATPDEDRYLRPERKPKSTSRFLSILNCCSTSEPDN
                     EDPDLPAKRAETRLPPPARQPPSEKVDISAAESSTAESKDHQLLNEKTGESAANPPHA
                     EETQEQPNILPVAEGRSDLAGEHATAPRSEPSNKQPVNVPSDLSLSKKDGSGDEIQPE
                     STPGQSQDDRDVPIPDAPIPSSEEEEDPVPTQDVAPPPPQPPPPDVYLPGPPTTPGKQ
                     NIWLLPPPLPHLDGRKCLILDLDETLVHSSFKVLERADFTIPVEIEGQWHNIYVIKRP
                     GVDQFMKRVGELYEVVVFTASVSKYGDPLLDQLDIHNVVHHRLFRDSCYNHQGNYVKV
                     SFLTSDEIESRTGELTAIKDLSQVGRDLRETIIIDNSPTSYIFHPQHAIPISSWFSDA
                     HDNELLDLIPVLEDLAGTQVRDVSLVLDVSL"
     gene            <1451614..>1454166
                     /locus_tag="TRUGW13939_00483"
                     /db_xref="GeneID:55987996"
     mRNA            <1451614..>1454166
                     /locus_tag="TRUGW13939_00483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483690.1"
                     /db_xref="GeneID:55987996"
     CDS             1451614..1454166
                     /locus_tag="TRUGW13939_00483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339583.1"
                     /db_xref="GeneID:55987996"
                     /translation="MAAQSTLQRPNDPLVGLFRRYAQLLRARVQRSSKTGKLIATIAL
                     LISIIASSYGGYSWFRRQSTEHVQGRRMLRRNSGLRGKDGSRIIYVPYKDNLTSKVTI
                     HPTKPTTFDAHRRLFLNPPRAARRGDEDAVSQIPPLTTKPGLNLAFLHQFLSLMSIMI
                     PRWHSKETGLLMSHGVFLLLRTYLSLLVARLDGEIVRDLVAGKGRAFSWGLLKWCSIG
                     TLASYTNAMIHFFQSKISIAFRTRLTRYIHDLYLNENMNYYKLANLDGAVGQGADQFI
                     TQDLTLFCASAAGLTSSLGKPTVDLIFFTYQLYRGLGPLALTGILSGYFTTATVLRRL
                     SPPFGKLKAVEGKREGDFRGLHSRLLANAEEIAFYGGADIEKVFLAKSFKDLQRWMKG
                     IYSLKIRYNMMEDMILKYVWSAFGYLMTSIPIFLPAWGGVVDTKERGDLSDNGGRERG
                     RMKDFITNKRLMLSLADAGGRMMYSIKDISELAGYTSRVYTLVSTLHRVHANAYYQPR
                     GSHPELYSLSDVQGTIHSGFDGVRLEHVPVVAPSLYPQGGDELIESLAFIVHSGDHLL
                     VSGPNGVGKSSISRIVAGLWPVYRGLVSRPRGFGMDGIMFLPQRPYLSIGTLRDQVIY
                     PHSAMEMHENGRTDAELGRILEEVHLGYLPDREGGWDCRKEWKDVLSGGEKQRMAFAR
                     LLYHEPRYAFIDEGTSAVSSDVEGLLYERSKEKGITLITISTRASLKKYHTFQLTLGL
                     GMSGEEWEFDRIGTEKEKMGVEKELQELRKRLDNVENWKLRREEIESELAKVFVAGGE
                     LAPPPYEEASEETSAEAPAEAAETPEETSVEASEDAPEDASVEVPTEAASEL"
     gene            <1454692..>1457068
                     /locus_tag="TRUGW13939_00484"
                     /db_xref="GeneID:55987997"
     mRNA            join(<1454692..1454854,1455007..1455083,1455143..1455260,
                     1455375..>1457068)
                     /locus_tag="TRUGW13939_00484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483691.1"
                     /db_xref="GeneID:55987997"
     CDS             join(1454692..1454854,1455007..1455083,1455143..1455260,
                     1455375..1457068)
                     /locus_tag="TRUGW13939_00484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339584.1"
                     /db_xref="GeneID:55987997"
                     /translation="MEESFEVVPLPPSHFGDGSRNAWPKEQYWQQTDDRLYRQKLATM
                     WMQKSGKLVRGEQYILDRLPDGYALLKRPRFSSPDIWDKFVYGHPSGACFNSPNQFFP
                     HFSWLMKGQQSSCPCECFPMQSSRGRPLKNPKALPQRGPTDPEGVPDVFREAIAKLKR
                     LGEIDEPIYEHQSMDWRAGNKPIRENIVRLGLQSSYVPRVGEVVLWMPQLDGELRYDD
                     RTGIYRKFSSRTSRFTDIPKWRAGTIGQAPDKDPVLLEDLIEPTSKEWAVNYSGFRVE
                     TFPDPNSDEKSSSLQYSYIHIHLLRPFYSWPVWLANIPEKDWHPSIKHAMTVMSSLSL
                     VDKYRFSGEWPDASIDCRGIFLGPEMIIVGDAVRLKPAGASLETIDNLPAVTDVMVID
                     QIQFRLISCIDDTQQSPLLAEKHQVRVRGKVYTLSPMRAYREPGEYAPPPLGRHEVIN
                     AFQQTSMTEYGPWYRAHKIGTSVEVSQDMIIGRCYEPSAMELVFGKTALNFDLAGMLA
                     SRDWARRADNRLPDGQHWFWADYRTQALGIDTLNGEDVGRYSDARNCKMWKAILNILD
                     GTASKSDYDAAKLPRRAGRPSTTTKDKSQFSEIGKMSSLVTSGLHMDTSANVSSIEDS
                     DSSSNDEDGTMAIEYGPKYSGIRNDNTNNESDTQWDFSIALPIRGGSESPQKGKRPRL
                     S"
     gene            complement(<1457247..>1460810)
                     /locus_tag="TRUGW13939_00485"
                     /db_xref="GeneID:55987998"
     mRNA            complement(join(<1457247..1458133,1458184..1458336,
                     1458405..1458470,1458731..1459492,1459549..1459974,
                     1460042..1460206,1460267..1460541,1460752..>1460810))
                     /locus_tag="TRUGW13939_00485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483692.1"
                     /db_xref="GeneID:55987998"
     CDS             complement(join(1457247..1458133,1458184..1458336,
                     1458405..1458470,1458731..1459492,1459549..1459974,
                     1460042..1460206,1460267..1460541,1460752..1460810))
                     /locus_tag="TRUGW13939_00485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339585.1"
                     /db_xref="GeneID:55987998"
                     /translation="MLSIAPNRASRSLLARLSVECRLPGYSPASRIPKSGLPVYNFVA
                     GSAPRCSSTKSTPQSAFASRLQGVQAAVPDPYPRLENHPGRINIADFRSRYDYLESDQ
                     VVEDTVVVQGRIRSYRLAGSKLIFFDIIQNGSKLQAMCNLRQLADITPAKFKQFYRLL
                     RRGDSFSVIGQPHRTGRGELTVQVTELPKMLSPTLHDVPVDTKEHGTSAFPRHVQYLA
                     DKRTWDVLRLRSAIIQHVRQFFIDRAFMEVNTPIIAGEAGGATARPFVTTANEFPDKQ
                     LSLRIAPELWLKRLVVGGFDKVFEIGSSFRNEGIDKSHNPEFMTCEFYQAYANLEDIM
                     SLTEDFLSGLALNVQQHKERIESDISNPDVDFSSPFRRIDFLPDIEAAIGRSLPDLSA
                     STAEEDIKTLFNELSIPLPDLPTLPRLMDKLCATYLEPQCQNPTFITNPPECLSPLSK
                     SFVHPSCSQKVAARCELFIKGSEYVNAYEEENSPWEQRRKFQDQVAYNVHTHEWGEVD
                     ESYLQALEWGLPPTGGWGCGIERLVMLFTDSKRIEDVLPFGTLRTVSRRFDAPPIMTE
                     TRVVQADPVVVSLQDLITGAVSFETLTGAFGPSSLGIIIVKDLPAKFKDLRARVLSNS
                     SHLAALSEHELKNLESPESKYLVGWSCGKETLRSGHFDTLKGSYYINCAFYQNSELQN
                     APADDFPDFPQYTAPNIWPPPEKFDSFRTNVQDLCSLIIDTAGLVARACDRYALANID
                     GYQEGYLEHVVKTSLTTKARLLHYFPADDSSSATITTTDQGDETKNEQQEDDWCATHV
                     DHGCLTGLTSAMFVDEAANPPKNSDSTSPLPELPSSPDPQAGLYIRSRTGEIVKVNIP
                     KDCLAFQTGEALELITQGKFRAVPHFVRGAKTTTATGKIARNTLAVFTQPNLNEEVQA
                     GKTFADFAREVVERTY"
     gene            <1461155..>1461518
                     /locus_tag="TRUGW13939_00486"
                     /db_xref="GeneID:55987999"
     mRNA            join(<1461155..1461252,1461329..>1461518)
                     /locus_tag="TRUGW13939_00486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483693.1"
                     /db_xref="GeneID:55987999"
     CDS             join(1461155..1461252,1461329..1461518)
                     /locus_tag="TRUGW13939_00486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339586.1"
                     /db_xref="GeneID:55987999"
                     /translation="MSFLFGGRPQLSSEQKISAAETEVEMVSDMFNRLTQSCNAKCIP
                     ADYREAELNKGESVCLDRCVSKFFEVNIKVSEKMQGEAANRQGGGMGGFGM"
     gene            complement(<1461939..>1464523)
                     /locus_tag="TRUGW13939_00487"
                     /db_xref="GeneID:55988000"
     mRNA            complement(join(<1461939..1463909,1464032..>1464523))
                     /locus_tag="TRUGW13939_00487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483694.1"
                     /db_xref="GeneID:55988000"
     CDS             complement(join(1461939..1463909,1464032..1464523))
                     /locus_tag="TRUGW13939_00487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339587.1"
                     /db_xref="GeneID:55988000"
                     /translation="MSTASTEHTDTPFGQPASGSKRGSHSRQAPSMDEHMDGKKHQRI
                     VLADPVALLYLEEDPSTTVLHRRTRLQGYEIYIVEQWACSRTHPTLIICTYTGDPSHR
                     ITVGVLSVPTDRDSWSPRLKLYFSAVQQYHAASRETPLGTLMVTNLSAFPSALTVIAI
                     PDGDLYRASERVPLYAAVIELVKQCQIALTIFDKLAPEYVDGLLCDVTEKAIGDWWAD
                     IGTDLYNIEPSDGILGATTVAAILGALMGARHRLNAVGAPVPKDVFDVSGLKRGISHF
                     QKSQKLERTRRLDRNTLDRLHRASQKSTNSERWTGAVKSTVAELSGKGGEMVMGMVGR
                     DRGTISDIETLDLERFAQLATGERARWLWQGKPYKSGFSYDLETASRTDDLVFTKDDH
                     GGYVWKRHNDSDLAVDRVTQDQDSDRRVHDSTLGIEDKDQNLGRIVSRSLTEKVSDAR
                     AGFGRFKDAVGLPGLRSHHQQGHNRYKPSKEENSIDADAYNSGGESEPDQGVARLSLE
                     ARPMASGSVDSSLDNPDLPMYKIETSSPASQSQKLTPDPPEIHIQTESLPEEALEPPG
                     RPQNGRPETVHEESENDLELAKTRSTDAGSNNDIPDGLAFKSLRRSQSFPDEILGAPI
                     SSRGSRWPRHLSFSTVEEVVLVWEGFKIMKSASDDKTTSNLEQALLRENVLLSDAQIF
                     NSRVLELTSKTVPWVEEQVASVERMHQTGTTLQGELSYLYPEHLEEARVLRERINQLL
                     DDESSRMTEEVKKVELLGAKLDYELNVLESKVEDVEDGLQDFERNVSEIEGRIKDLVK
                     GERMNDTSWSSWFGRKFGHMYI"
     gene            <1465265..>1466711
                     /locus_tag="TRUGW13939_00488"
                     /db_xref="GeneID:55988001"
     mRNA            join(<1465265..1465388,1465456..1465583,1465644..1466414,
                     1466493..>1466711)
                     /locus_tag="TRUGW13939_00488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483695.1"
                     /db_xref="GeneID:55988001"
     CDS             join(1465265..1465388,1465456..1465583,1465644..1466414,
                     1466493..1466711)
                     /locus_tag="TRUGW13939_00488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339588.1"
                     /db_xref="GeneID:55988001"
                     /translation="MMDLLQKEHERVWKRLKTGKTISDVQSTIDLLQEARNTIAADPA
                     KASITLAKLQNPVKSSFDTTNDSLKEAHSSLNKYTKALDKLFKDRPLPSTEYDALSSS
                     PGLVNRAIAMHLMREGQFSVASTFLNETAQDKTPAQPGYEASSSASDESNLALSFDRI
                     KSGEIQEQFTTMYHILQELNENANLLPAIHWARDNRTMLEARGSNLEFDLCRLRFVWL
                     FHGGNEPQTPMPVRRQAALEYARQEFSNFMPRHLREIQQLMGAMAFTPNLEASPYRHL
                     FNSRTSWSDVAQSFTKEFCSLLGLSADSPLYIAATAGAIALPTLLKLQTIMKAKRTEW
                     TTQDELPVEIPLPSSYLFHSIFVCPVSKEQTTDQNPPMMMPCGHVIAQESLQRISKGN
                     KFKCPYCPNESHPRDAQKVFL"
     gene            <1467683..>1468704
                     /locus_tag="TRUGW13939_00489"
                     /db_xref="GeneID:55988002"
     mRNA            join(<1467683..1467846,1467911..1468264,1468325..1468598,
                     1468663..>1468704)
                     /locus_tag="TRUGW13939_00489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483696.1"
                     /db_xref="GeneID:55988002"
     CDS             join(1467683..1467846,1467911..1468264,1468325..1468598,
                     1468663..1468704)
                     /locus_tag="TRUGW13939_00489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339589.1"
                     /db_xref="GeneID:55988002"
                     /translation="MFARKTPYGRSESFSDKQQAKKSMSRSMKRSFKEHSISSRGIRR
                     EKKHERSSTECDHPSSAIITISVGKEQRLFAAHEHVLRTSPFFAARCRGQFLEPHNKL
                     ISLPDEQPEILSCILEYLYKGDYYPRLAHNKRHDTWEIEDNGMDIDGEAKQASLLVYD
                     ADGSVILKDTAVYCAAERYNLPDLKRLALRKQGLQSGIHCSTILSSARYAYANTPDSE
                     SKLRAHYLALIIRSRSTFKRSGTMQMEMEKGGKLFFDLFVAMCNHMDDLNASPTSKGW
                     W"
     gene            complement(<1469734..>1471377)
                     /locus_tag="TRUGW13939_00490"
                     /db_xref="GeneID:55988003"
     mRNA            complement(join(<1469734..1469817,1469874..1470294,
                     1470348..1470409,1470462..1470614,1470689..1470749,
                     1470803..>1471377))
                     /locus_tag="TRUGW13939_00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483697.1"
                     /db_xref="GeneID:55988003"
     CDS             complement(join(1469734..1469817,1469874..1470294,
                     1470348..1470409,1470462..1470614,1470689..1470749,
                     1470803..1471377))
                     /locus_tag="TRUGW13939_00490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339590.1"
                     /db_xref="GeneID:55988003"
                     /translation="MASVFADFKAGHAQRSGPRLAAALTPVATANDRNRLMDFYQMTN
                     SAHSEEDIRHHLLHDKRTGTKLNKQQGNAWVQVFNAYWITISELVQVQQGQGSWLKVF
                     EAWKELTNQLIRGYSSNHFAAWTIHCLYVAGKYLRAFAIKADSVSESSPNAGAFGNGF
                     QDDVVSNVEKNANLEDAARTINRMFTLCLGDRSHGRVTEMGHIRDYQSIVQNLNQVGL
                     SKNVLRALYASSADLPEFDQFPKSHIVTFNYYVGLIHFLEENYKEAEESLTQAWLMCK
                     ADAWKNKELILTYLIPCHLVTTHRLPSRELLAPFPRLEQLLRPLCDCIKQGNLVGFDN
                     AMSAAADQFVKRRIYLPLERGRDLALRNLFRKVFVVGGFEPSKDGQPQIRRTRVPLAE
                     FAAALRIGTKADEKSRIDMDEVECLLANMIYKNMMKGYISRERATVVLSKSGAFPGTG
                     V"
     gene            <1471743..>1472750
                     /locus_tag="TRUGW13939_00491"
                     /db_xref="GeneID:55988004"
     mRNA            join(<1471743..1471746,1472113..1472297,1472360..1472536,
                     1472592..>1472750)
                     /locus_tag="TRUGW13939_00491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483698.1"
                     /db_xref="GeneID:55988004"
     CDS             join(1471743..1471746,1472113..1472297,1472360..1472536,
                     1472592..1472750)
                     /locus_tag="TRUGW13939_00491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339591.1"
                     /db_xref="GeneID:55988004"
                     /translation="MGRLNEYQVIGRHLPSEANPTPKLYRMRIFAPNTVVAKSRFWYF
                     LTKLKKVKKANGEIVSLNVISEKRPTKVKNFGIWIRYDSRSGTHNMYKEFRELSRTDA
                     VESLYQDMAARHRSRFGSIHILRVVEIQDSESIRRPYIKQLLAKDLKFPLPHRAPPQS
                     TKKIFAYQRPSTFA"
     gene            <1473309..>1474472
                     /locus_tag="TRUGW13939_00492"
                     /db_xref="GeneID:55988005"
     mRNA            join(<1473309..1473353,1473425..1473707,1473770..1473847,
                     1473904..>1474472)
                     /locus_tag="TRUGW13939_00492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483699.1"
                     /db_xref="GeneID:55988005"
     CDS             join(1473309..1473353,1473425..1473707,1473770..1473847,
                     1473904..1474472)
                     /locus_tag="TRUGW13939_00492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339592.1"
                     /db_xref="GeneID:55988005"
                     /translation="MFSRSAFRLSQPARQSFRKYSTETPAKSNNVATIAFVVGAIGIG
                     AGIYRYTQQKGASAEVAKQRDNAFTGGDQGFIGLKLGAIEVLSPNTKKFRFEFEDKEA
                     VSGLHVASALITKFKPEGAEKAVIRPYTPVSDEEQPGYLDLIVKSYPEGAMSQHIHSM
                     NVGQRLDFKGPIPKYPWDANRHNHIALIAGGTGIAPMYQLIRTIFKNPEDKTKVTLVY
                     GNVSEDDILLKKELQDLENTYPQRFKAFYLLDKPPKEWTGGKGFVTKELLKTVLPEPK
                     EENIKVFVCGPPGLYNAISGNKKSPQDQGELTGYLKDLGYGQDQVFKF"
     gene            <1475788..>1480866
                     /locus_tag="TRUGW13939_00493"
                     /db_xref="GeneID:55988006"
     mRNA            join(<1475788..1475868,1476277..1476690,1476744..1477184,
                     1478003..1478089,1478151..1478177,1478254..1478631,
                     1478696..1480375,1480438..1480497,1480550..1480729,
                     1480786..>1480866)
                     /locus_tag="TRUGW13939_00493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483700.1"
                     /db_xref="GeneID:55988006"
     CDS             join(1475788..1475868,1476277..1476690,1476744..1477184,
                     1478003..1478089,1478151..1478177,1478254..1478631,
                     1478696..1480375,1480438..1480497,1480550..1480729,
                     1480786..1480866)
                     /locus_tag="TRUGW13939_00493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339593.1"
                     /db_xref="GeneID:55988006"
                     /translation="MSRKDDSKAKDAIVTVNIDDFTRTRDNVIVSLATLQSAVSDLSR
                     AYINHANTVLNRGPITVESSLSSGLAGGLATTLLENGLLGAGLPRHSSPPEATKPEVG
                     DKKKRKRAPPDPNAPKRALTPYFLYMQHNRSQIASELGPQAKPKEVSDEGTKRWAEMP
                     EEDKAVWKKLYADNLAVYKAKMTAYKAGLPLPDDDNAKADNQLQQSVAAAEAEAAEDD
                     DSSSSSNEDESSEEPAKEPTPPPSGKRRRVGAKAANNVSTPVSAKKASPEKKKTPAPK
                     KTETKEVKEAKEPASTRKSLGTSADGKPSKKKRKSDIDKLVISQLGFLAQRRLARGVR
                     LNHAEATALISSNLQELIRDGNHTVADLMSIGKTMLGRRHVLPSVVSSLVEMQVEGTF
                     PTGTYLVTIHHPISSEDGDLEKALYGSFLPIPPQTAFPDPDPQDYKAENQPGAVIVVK
                     NTRIALNGGRKRIRLKVMSKGDRPVQVGSHYHFIETNPQLHFDRVKAYGYRLDIAAGT
                     SVRFEPGDTKTVTLVEIGGNKIINGGNSLASGKVDTSRVDEILLRLQQAGFAHTPEPA
                     GGDLGPINPGSMDREAYARMFGPTTGDIVRLGATNLWIKVEKDWTTYGDECTFGGGKV
                     LREGMGQASGRSSKDCLDTVITNALIVDWSGIYKADIGIKDGIIAGIGKAGNPDVMDG
                     VHPDLLVGSSTDVIAAENKIVTAGGFDTHIHFICPQQVNEAISSGITTMLGGGTGPST
                     GSNATTCTPGPNHMRQMMQACDALPVNIGITGKGNDSGKQSLREQCLAGAAGLKLHED
                     WGSTPAAIDSCLEVCDEFDVQCLIHTDTLNESGFVEQTIGAFKNRTIHTYHTEGAGGG
                     HAPDIISVVEHSNVLPSSTNPTRPFTLNTLDEHLDMLMVCHHLSKNIPEDVAFAESRI
                     RAETIAAEDVLHDLGAISMMSSDSQAMGRCGEVILRTWNTAHKNKLQRGTLSEDEGTG
                     ADNFRVKRYISKYTINPAIAQGMSHLIGSVETGKIADLVLWTPDNFGTKPKMVLKSGM
                     IAVAQMGDPNASIPTVEPIIMRPQFGVLVPSTSIMFVSEASISQGIVQTYNLRKRIEP
                     IKNCRNIGKGDMKYNDIMPRMKVDPERYTVEADGQLCTAEPATSLPLTQQYFVY"
     gene            complement(<1481140..>1483082)
                     /locus_tag="TRUGW13939_00494"
                     /db_xref="GeneID:55988007"
     mRNA            complement(join(<1481140..1481172,1481390..1482306,
                     1482360..1482900,1482950..1483026,1483079..>1483082))
                     /locus_tag="TRUGW13939_00494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483701.1"
                     /db_xref="GeneID:55988007"
     CDS             complement(join(1481140..1481172,1481390..1482306,
                     1482360..1482900,1482950..1483026,1483079..1483082))
                     /locus_tag="TRUGW13939_00494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339594.1"
                     /db_xref="GeneID:55988007"
                     /translation="MAAQTITTAVTLFAAPSTLNCGTSYSNESLAFQYAIDGKIRTLS
                     DNNAPAEDSYRGLLFVPTLEAMDTCNNITAPYIPQNVTRRIDLPEYDHDIIGLAPWVN
                     RDCTQAYLAASRRENARAVIFYQPNSRDTSKPPSSNSGVWNLGDSDYWKKDNDFPVYA
                     IPGPSGSRLMHQLSEYSRQSTDNSSLESSPETAYSVRCARLYTLFNFEADALSSVPGI
                     WVFILAILGALVFVMLLAYVITQHVQKKRRVNLQQRLVAGEIDLEHLGIKRLVVPPHL
                     LSQLPVYVYPDNTAESPIDPDSKTPASEEKESPQEPNSKSEENEELKTQAPQQLHKND
                     NHHQQQVQQQQQENYDESISAILEEVTPPPRIRNRYRLTFSQLTCAICLDDFVPGSSL
                     VRELPCTHIFHPECVDAFLMRDGSTCPVCKHNVLPSSFISEQVTNFMVRREQRMRRLH
                     SHHDREMELQGLYLSFFERVQARVRGLVDRARGRSSPSSSSSDEQQQQQQQQQSDNSE
                     EDHDPFSSSCFGEAN"
     gene            <1484233..>1489263
                     /locus_tag="TRUGW13939_00495"
                     /db_xref="GeneID:55988008"
     mRNA            join(<1484233..1485188,1485244..1488032,1488083..1488428,
                     1488478..1488606,1488661..1488790,1488868..1489106,
                     1489164..>1489263)
                     /locus_tag="TRUGW13939_00495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483702.1"
                     /db_xref="GeneID:55988008"
     CDS             join(1484233..1485188,1485244..1488032,1488083..1488428,
                     1488478..1488606,1488661..1488790,1488868..1489106,
                     1489164..1489263)
                     /locus_tag="TRUGW13939_00495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339595.1"
                     /db_xref="GeneID:55988008"
                     /translation="MPKKLAHDDYTVGWICPLEVEQIAALEMLDEEHGRLPQSPGDHN
                     VYNLGSIAGHNIVIAGLHQAGNSSAAVVVTQMRMTFQNLRFGLLVGIGGGVPTKTDSG
                     IICLGDVVVSKPVGGHSGAVQYDRGKAKHGNFERIGSLAPPPVVLLNAAQDLAVKRAR
                     AHEDPIGRNVKRIDTSIQGLRRYKYPGPGEDNLYRPEYLHLRPGVSCDECGCDPSQRI
                     QRTTHGDEDDRSHVVVHRGIIASGELVLKNAILRDQLAHDGLLCFEMEAAGAMADFPC
                     MVVRGISDYCDSHKNDHWHGYAAAVAAAYARELFFHVPMDPKSSLPWELLQQARQQDF
                     GETALREKRIEILKLLNTTPYRDRKDRNPDRIQGTCEWFTEHELFLDWQQAKNSRLLW
                     VSADPGCGKSVLAKYLVDSVLLTTASRATCYFFFKDDFEDQRGVIGALCCILHQLFIQ
                     KRSLLSERILERFEISGEKFDRSFSELWDILLSIAEDPNAGEIVCILDAIDECEDKGR
                     SQLVQALCKLYGTQTNFNLKFLLTSRPYGGIRRGFQPLEIPGMPIIHLSGENDTEMEK
                     ISKEIDIFIKARVRGIGAKLKLTAEEEGLLFEGLMRVPNRTYLWVHLTLDLIESDPNI
                     DKYGIVKTTHNLPKTIDEAYDRILCKSRNFAEAKKLLHIVVAAERPLTLKEMNLALAL
                     RKYHKSYTDVDLLPEDRFRENVRDLCGLFVTVNDSRIYLLHQTSKEFLVQIAFTVPPQ
                     HIKHDGLEWKESLRLQVSHGILAEICIQRLLFAEYESHPVKKDGMSSQYTDSHVFLDY
                     SAKYWAAHLQDSDGENDITTDLILKLCDAKSNRCLTWLRIYWTSTNTEFPENFNDLMI
                     ASYFGLTALVKQKLHRGGIDLNSRDSTYGRSVLSWAAENGSYAIVKLLLKAGRSSLKR
                     IMSFRKGAEVDSTDRYGRTPLSYAAWNGHVAAVKLLLKSGARVDTMDEIGGTPLSYAL
                     VNGHDTVVNLLLNKETKIDSEDNISKTLMFEAAKKKHDAVVKLLLEKGADFEEKDDSD
                     RTPLSYAAGNGHETVVKLLLQEGADIESKDISDRTPLLWAAGNGHATVVKLLLENGAQ
                     FEYKDITTQNPLLRAARDGHKAVVGLLLEKGAALEVKDQLDRTPLIWAAMNGYDLVVK
                     LLLEKGAEIEFQDSSGQSPLLWAAKNGHDAVVELLLSKNANFEFKDNTGKTPLSWAIE
                     SGNGQVVMLLLGKEAGNPDSPELKRVRQIKQENANFAECKMLLLGTSESGKSTIVKQM
                     KVLHQNSYTEEELTLYRFTVFKNLIDSIQALIEAMYSFDLKPTTQENQEYSSFLLEYR
                     LEPSPKTLLDTKVGDAISSLWKDEVIPKVMERQKEFYLMDPATYFFDQVKRISAGNYI
                     PTVDDVLRARIVTTGIYESRIRIGNLGIHMFDVGGMRSERKKWIHCFENVTAIAFCVA
                     LSEYDQFLLEENEQNRMMESLLLFDSVVNSRWFMRTCIILFLNKVDLFRKKIPYSPLG
                     DYFGDFSGGTNVNAATEYFLWRFNIVNRAQLNLYAHVTQATDSTNIRLVFDDVKQKVI
                     QNSLKDSKVL"
     gene            <1490280..>1492398
                     /locus_tag="TRUGW13939_00496"
                     /db_xref="GeneID:55988009"
     mRNA            join(<1490280..1490814,1490871..1491352,1491406..>1492398)
                     /locus_tag="TRUGW13939_00496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483703.1"
                     /db_xref="GeneID:55988009"
     CDS             join(1490280..1490814,1490871..1491352,1491406..1492398)
                     /locus_tag="TRUGW13939_00496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339596.1"
                     /db_xref="GeneID:55988009"
                     /translation="MPLANKSKTKGRDARQSRSRNTTPSSGHSASTTTGASAVSGYLE
                     NDLGKLFSQTSVQYVDILDQVGGSGSIPDVRSLEQLSDQLKTLSQLADARGDICNAAM
                     RELSQRKKDVVEDSREQEMERDTEDRKMKREADDEDEPSRALKGGKLKKRKERPSKED
                     RPLAVGSHEVTRQDGGELGVRKRSLEATSPSSKKSRNAATGSSSSLSPPSLASPPLKA
                     EAEAADSPSSEDSDDSRQPEPAQLVPQFQVFGPNPLKFDDPTVYHIRDVTSETTDDEK
                     REIFSVAHFPPSDLSHMMAGVAPDKDFSNAKPTSQVNANTFLTWVEPFVRPLTEEDIA
                     FLKEKGDRTTPFVMPRRAKKHYSEVWAEEDGAMSIDNSNDRDRLPLNQGRGSIEQLTD
                     ENAETDKVSVGPLVSRLYSLLRYEHRTETEENSNNNGTTNGDTSMNSLLGDSFMDLDH
                     QPLNGESENKPLPAATSFPDASPNNFKVPAAKLEHAQLDERLKAELRYVGFFGPEDNP
                     DFDAHYDDDIAQRLRLLQGELKKQMLINGARKTRLMEIAKERMAYQEYSTIHDDLDSQ
                     VQQAYLKRTRTLGKSKKGSQAKHRPGGAGGGSHVVSAAGVGRPGIGDMARTLMDRRKR
                     WRDCIGPVFKDSKTTVPSRDESIFDTVTMAEYEKAELEGWDEEQE"
     gene            complement(<1492634..>1494449)
                     /locus_tag="TRUGW13939_00497"
                     /db_xref="GeneID:55988010"
     mRNA            complement(join(<1492634..1493677,1493733..1493869,
                     1493917..1494354,1494407..>1494449))
                     /locus_tag="TRUGW13939_00497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483704.1"
                     /db_xref="GeneID:55988010"
     CDS             complement(join(1492634..1493677,1493733..1493869,
                     1493917..1494354,1494407..1494449))
                     /locus_tag="TRUGW13939_00497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339597.1"
                     /db_xref="GeneID:55988010"
                     /translation="MIKAIFYSKFDTQEGPKVVHQVPDGAIVPSSTAAAAAQQTLLFT
                     FSDISFFVIPRQELCGNLLQVCIGGYRILGYPICMKSPCYDRNEFIFNFCLVVAEDED
                     FSKYTSIVQKLADLMHGLEEQSGFLSRDHSKSGQGKLYSLCETLMEDLNNYSECMIPI
                     DELNTLNFKLFPVYPAPSHVKAYDVPLFTVRFETFMDENWDLTLQKIIPYINGVNSVR
                     IISILADVELSLAYKAIRHLLYYGCVFLLDIFSFSAIYAPTAQFSSTIACDEGMQQEC
                     ARYTNMRFAPTQSKLAPAPPGTSSSRADLSSSHGGGLWALDTEDIWPLVGDPEPQTSS
                     SNDGEDTEPARRKCLDGVGIVELYASLKQGQSVKQWYAANARQLVNVDVRRFITFGII
                     KGFLYRVHKYAYGPRPEAFKSLHFKTPTTSLKGGIAPSTIPDSPDGGLLSNENSIQLA
                     DSLGPSESELSAVSTSFRSTNNNNISMSNNSNNNNNSTPIRPESTAATSYEEDEESEA
                     IDKSLEKYLDGQHCFDEICTELEIGERDLSARLKKVPWPVHIINR"
     gene            complement(<1495213..>1496169)
                     /locus_tag="TRUGW13939_00498"
                     /db_xref="GeneID:55988011"
     mRNA            complement(<1495213..>1496169)
                     /locus_tag="TRUGW13939_00498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483705.1"
                     /db_xref="GeneID:55988011"
     CDS             complement(1495213..1496169)
                     /locus_tag="TRUGW13939_00498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339598.1"
                     /db_xref="GeneID:55988011"
                     /translation="MHKPSIAEAVHNATFPRPKSNDPTSFEAHIKRNLVPEVRMETSM
                     FYGSLDCIEAQYPGLDYSYGPHRMRLGRFPWHRKLFRVFDDLGLTKAEIAFLCRWEGT
                     KSARERYEKEEGTKVRDTTADGVRPATPSPGPIARFASDEVAQPSSTRASTVKEEAIV
                     KVNPIITDHLEEEKKDDDEEEEDEEEEEARKEKEEEEDEEEEESSDEEMESYGLQLNQ
                     RLLYATAARERGANVPMDEDWEQWLKEAVERGNYSDMLDAIRTGQPVGNASLNPSSPI
                     PANNTALLSQLAISARQSVSMAVAQSNRSLQHASSSASSTAR"
     gene            <1496854..>1500359
                     /locus_tag="TRUGW13939_00499"
                     /db_xref="GeneID:55988012"
     mRNA            join(<1496854..1497058,1498188..1498321,1498376..1498474,
                     1498526..1498679,1498742..1499010,1499065..1499619,
                     1499670..>1500359)
                     /locus_tag="TRUGW13939_00499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483706.1"
                     /db_xref="GeneID:55988012"
     CDS             join(<1496854..1497058,1498188..1498321,1498376..1498474,
                     1498526..1498679,1498742..1499010,1499065..1499619,
                     1499670..1500359)
                     /locus_tag="TRUGW13939_00499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339599.1"
                     /db_xref="GeneID:55988012"
                     /translation="PGTPANAVRRLQKVDLFLEGRRSPGVIIQRLRRLRPSSSPGRCR
                     KGTKKTRQQKANSTPELGAQAAFELDYFRKVPDQPAPLACFLSHVHSDHLQGLESLQS
                     PFIYCSAVTKELLLRIEKYPHRMNFSKGILESRKQHYGHLAKLLRPIPLHTPTEIQLT
                     PLQRIRVTLFDANHCAGAVMFLIEGQGKAILYTGDIRAETWWVNSLTRNPVLIPYACG
                     LKTLDTIYLDTTFAVKSQIYRTFPPKSAGIQELLEKVKNYPQDTMFYLRAWTFGYEEV
                     WQALSIALNSKIHVDRYQYSLYKSLAARSQNVPGLDTASFLCGFQLGNEFIPGCLTLD
                     ENVKIHSCEPGAFCSSIKSGKSVFITPVVTRDMAGTDVPEIGAGGGKGDLYQNHELEL
                     PDETALQKLEELLMKHVDDANTVSHATETLRTAFKAGKNKLSLDEFGLAKDADVSLQD
                     LVSVISKVREQPSDISGTADTITFSYSRHSSYAELCELVSAFKPKDVFPCTVDRETWD
                     ESVSMESLFGYLCSAKQFAHDKHMLDTESDRLERENKRARYTLMRDARHHLQAMGGRV
                     HFAIGPLPADFDEVLNEESQNSYQTTDSHHASQEPFLDSEAPATASDHGAGRSSIEET
                     NVISRNVDSQQSIPKSVFQSQDTENEVRVDGLPSAGAQSYSNRRRAYRAARTGTFDAW
                     NEIAIVSAGNNHTEEEVEL"
     gene            complement(<1500943..>1501860)
                     /locus_tag="TRUGW13939_00500"
                     /db_xref="GeneID:55988013"
     mRNA            complement(<1500943..>1501860)
                     /locus_tag="TRUGW13939_00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483707.1"
                     /db_xref="GeneID:55988013"
     CDS             complement(1500943..1501860)
                     /locus_tag="TRUGW13939_00500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339600.1"
                     /db_xref="GeneID:55988013"
                     /translation="MVKPLSFKGDKKSKKRKHRDEDSESRRPNPFSDNAVVPAAAAQD
                     EQATDEQSWVSADVATDLNGPVVFVLPSTPPTCIACDANGKVFASELENVIEGDPSTA
                     EPHDVRQVWVATKVAGAEGFSFKGHHGRYIFILWTPKYGGETVTAWYANAGTRYLSCD
                     KYGIISANASAISPAESFIPIQAHDTPGMLAFQTRGGESETDTFVTIQEDSGKGSGAV
                     EIRGDASSITFESTIRVRMQARFKPKLKASRETKAREKISRRELEAAVGRRLEDDEVK
                     RLKKARKEGNYHEEILDVRVSGKHDKFAS"
     gene            complement(<1502399..>1503870)
                     /locus_tag="TRUGW13939_00501"
                     /db_xref="GeneID:55988014"
     mRNA            complement(join(<1502399..1502592,1502650..1503108,
                     1503162..1503362,1503426..1503441,1503500..1503568,
                     1503671..1503764,1503836..>1503870))
                     /locus_tag="TRUGW13939_00501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483708.1"
                     /db_xref="GeneID:55988014"
     CDS             complement(join(1502399..1502592,1502650..1503108,
                     1503162..1503362,1503426..1503441,1503500..1503568,
                     1503671..1503764,1503836..1503870))
                     /locus_tag="TRUGW13939_00501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339601.1"
                     /db_xref="GeneID:55988014"
                     /translation="MASIPATMKALHLLTARSDRYEKPEVYGIVEIPVPTLRENDVLV
                     KVKACGVCGTDLHIHEGEFLAKFPLVPGHETVGQVAAIGPKVKGFEIGDRVVADNSEL
                     CGQCFYCRRGEELLCEHFEAHGVTMNGGFAEYCAYPAGRVFKIKNLNDVDATLLEPAS
                     CAAHGLDKIAPKMGSSVLMFGAGPTGLVLSQMLRQNGGCHVVVAAPEGLKMDLAKKLG
                     AGDEYIALSRSNPEVQFQKLQVDNPYGFDIVVEATGNAKILEDSINYVRRGGKLVVYG
                     VYANKDRVSWPPSKIFGDEITILGSFSETYKFPAAIDYLDRGKVKVEGIVNKTFKLEQ
                     WGECLEAMRNKSAIKAAITFD"
     gene            complement(<1505520..>1509134)
                     /locus_tag="TRUGW13939_00502"
                     /db_xref="GeneID:55988015"
     mRNA            complement(join(<1505520..1506442,1506496..1508529,
                     1508585..>1509134))
                     /locus_tag="TRUGW13939_00502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483709.1"
                     /db_xref="GeneID:55988015"
     CDS             complement(join(1505520..1506442,1506496..1508529,
                     1508585..1509134))
                     /locus_tag="TRUGW13939_00502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339602.1"
                     /db_xref="GeneID:55988015"
                     /translation="MPTWSSRILPRPPSPSSHNPSHTRPSNRTVDLDRGAALAINYNV
                     PILPSSAPSRPHRRSLSQPFPSLMPTSPRRGGRKVTKEDFLDSDSDGNDDAYDPIRYV
                     PEPRSHSPRKGWTPAEEVVNGKCMTCHSTMRWPKNTKIFRCSICLMVNDLEPYLNGDD
                     HVGDESQPPTPPPKDGSFEPRLPATPLSIEKTKELIDGCLRDFLQRRLAGHQRQEPEP
                     QYVHDVHLQQNHLGNPKEQHTSSRHVQKQYNTDLLSPSSGSGRNDQITRLRSSSDTPL
                     IRRNDPSPRDQDRSPRRTNTNTDTTEPKHGSGTRSWMFRPLEDYIIKSFAGCDCLNNS
                     FLTPGPPRRTVSESIYPRPRPEISAPIVSPDGQVFELDPKMLLLGDIAENSSWWMGGR
                     PQRHEAKDAGAVPAKSLPRSSRSRVNSKSPRIDWEAVAEWYKVVVNVGDSWRDIWSAL
                     VENNEMNPDIPVDMRGLDREIAEARVHAQRTLLKATENLLKRPRRPLRRLESARFLLI
                     VLANPQLTSSKEPATQSLTPASNSDPNGSIPNFSRLPGTGDRRGVSSSHKSRPRNLVD
                     HSGIVKRTLGLLANLPDSCHHYLVSWFARYSESQYERLVTLVGRFLTHRLTRQHGRQR
                     SGPMPSVNGLVPSLSGNIENSHVQLHAALSGLSSDQTGEANNKRKIYTDDWQVRAAAR
                     VMALLFAANNVHVTRRRHDTARNNEGTPFVRHKDKSTLPLHYFYNSLLDYSDLVSDFE
                     AWEARTTTFSFCQYPFLLSISAKSRILEHDARRQMSIKAREAFLDSILRQKDVSQYLN
                     LKVRRDCLVEDSLRGVSEVVGGGQEEIKKSLRIEFVGEEGVDAGGLRKEWFLLLVREV
                     FDPNHGLFVYDEDSQFCYFNPFCFESSEQFFLVGVLLGLAMYNSTILDVALPPFAFKK
                     LLAAAPPTNMAASSAPKHPHTCTLEDLAEYRPTLAKGLQALLDYDGDVQETFCYDFVA
                     RVDRYGQHVETPLYPGGEKRPVTNSNRQQFVNLYVHYLLDTAVQRQFEPFKRGFFTVC
                     GGNALSLFRPEEIELMVRGSDEPLDVPTLRAVATYENWPLKEDPESEPVVSWFWDFFT
                     QANPSDQRKLLSFVTGSDRIPATGAASLSIRLACLGDDSARYPIAHTCFNKMGLFRYS
                     SKRKFEAKLWGAIFNSEGFGLK"
     gene            complement(<1510249..>1511262)
                     /locus_tag="TRUGW13939_00503"
                     /db_xref="GeneID:55988016"
     mRNA            complement(join(<1510249..1510389,1510445..1510671,
                     1510743..1510899,1511176..>1511262))
                     /locus_tag="TRUGW13939_00503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483710.1"
                     /db_xref="GeneID:55988016"
     CDS             complement(join(1510249..1510389,1510445..1510671,
                     1510743..1510899,1511176..1511262))
                     /locus_tag="TRUGW13939_00503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339603.1"
                     /db_xref="GeneID:55988016"
                     /translation="MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSR
                     PDKARRLGYKAKQGYVIYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLRSTA
                     EERVGRRCANLRVLNSYWVNQDSTYKYFEIILVDPQHKAIRRDPRINWIVNPVHKHRE
                     SRGLTAIGKQSRGIKKGHGYTKTNAGRRKTWKRHNTQSYWRYR"
     gene            complement(<1512158..>1514891)
                     /locus_tag="TRUGW13939_00504"
                     /db_xref="GeneID:55988017"
     mRNA            complement(join(<1512158..1512725,1512808..1513384,
                     1513472..>1514891))
                     /locus_tag="TRUGW13939_00504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483711.1"
                     /db_xref="GeneID:55988017"
     CDS             complement(join(1512158..1512725,1512808..1513384,
                     1513472..1514891))
                     /locus_tag="TRUGW13939_00504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339604.1"
                     /db_xref="GeneID:55988017"
                     /translation="MATTAGKPIMAPKPGSSAPGNNASIRLEKGNQGIRRSTPDSEAL
                     TSSDDELDHRQGPTSTNAPLSKPVRRTSWLNEVPQNLPRRTSITASGSLAPVGINTQS
                     PETEQTSWGANASPGVNSSVSWGHGGSFPWATGIWTADNRKEPPPRLTELSQSPTMPN
                     MPNTNFNEEILSPTTARSMAGDSSIPFNIPLHPTPKTYRSQSYSVGQLDPETVKLMAS
                     KVPSNPNASRGRAGNQYPGLQHRPSRPSLLEDLGHDPALLGRVREDEDDEEEAEENNI
                     DSNGSHSYAASQARAIDQLARENALLRQTAHLEGARMRDRTMSSASANSNYSLSGGMH
                     NLHRIRGGVPEEVDLAVEDQDELGNIPPGYGNVRNSGRRRMSEHSVNIEKHTPPFGSV
                     ENRPLESLRRAHWQTSLGFGSIGELPQSRRHSFADIPTRHGSISDGQAHMGALNGRAS
                     LVDREDGYSNVIDGGLHAAAPDNLSSSLHQSYNVPAAYGRPQPGLTPSHQSQRLYIVT
                     FKCHRADVFYIQEDTGLQVNPGNLVIVEADRGTDLGTIQHANVTWQEARELKEKYAEE
                     HYKCLMMFSRQAQNGATNVVSPSIGHRSAVGGMNPTGAHGAHEPQSTEIKPKLIKRLA
                     QNHEILTLRDKEGNEAKAKRVCQQKVVDHRLNMEILDAEFQMDWKKLTFYYFADSYIN
                     FNSLVTDLFKIYKTRIWMSAINPASFVTPSPGLSAPEPAGLNYNQNSVADRRHAHENR
                     AYNVSQMPPGSGNLRDAVERADLGNTHAGMIRNAYMDHYNQAFGSAAARHHEPGFGHN
                     MASNDPFASYPSSTYGLLETSTPEFLGGAPHHHGHQQMHPARGDWVETFQGLSLGS"
     gene            complement(<1517841..>1518953)
                     /locus_tag="TRUGW13939_00505"
                     /db_xref="GeneID:55988018"
     mRNA            complement(join(<1517841..1517987,1518060..1518599,
                     1518669..>1518953))
                     /locus_tag="TRUGW13939_00505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483712.1"
                     /db_xref="GeneID:55988018"
     CDS             complement(join(1517841..1517987,1518060..1518599,
                     1518669..1518953))
                     /locus_tag="TRUGW13939_00505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339605.1"
                     /db_xref="GeneID:55988018"
                     /translation="MYTMSTHQASRTLLRRAFQTSQRAIREREATGFINNNRRSIHYI
                     RTVSAITPSESRRRPTLRPSSQPLGIPKINEPSAGNRRSIFIQTESTPNPDALKFLPN
                     QPVLPENFPTPFLEYLSPRSTLAPPHPSPLAANLLNVDGVSSVFYGPDFITVTKSSDA
                     NWAHIKPEVFSLITEVVSSGEQIVNTVERTAGDGSQEGGHEDTLGYNEDDDEVVGMIK
                     ELLETRIRPAIQEDGGDIEFRGFEDGIVNLKLRGACRTCDSSTVTLKNGIESMLMHYI
                     EEVQGVQQILDQEEEISMHEFAKFEEKLRQQKGPDATAPSALDSAGA"
     gene            <1519759..>1524356
                     /locus_tag="TRUGW13939_00506"
                     /db_xref="GeneID:55988019"
     mRNA            join(<1519759..1519829,1519888..1520354,1522214..1523739,
                     1523798..1524223,1524273..>1524356)
                     /locus_tag="TRUGW13939_00506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483713.1"
                     /db_xref="GeneID:55988019"
     CDS             join(1519759..1519829,1519888..1520354,1522214..1523739,
                     1523798..1524223,1524273..1524356)
                     /locus_tag="TRUGW13939_00506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339606.1"
                     /db_xref="GeneID:55988019"
                     /translation="MPTLCEVCSKEPAKYKCPTCSLMSCSLGCTKSHKIYCAPKPSPA
                     VTGKESAAEKQQQQDLPSDTLSNGHSNKPINIHDLGSSPELQKLFEEYPGLRGKLREI
                     YRSSLEEEWNPEPQMGGRSHRGGGRGGGHKRAPWTAERGFKRGVGHVTRWREKCEDGE
                     STGSDAEGFMKFIALVADSLANARRNRDSSAAHPTVALALSRAELLLGSISLHRAQPS
                     PLSYRLVREGKKKKKKKVDGTGKHRVPRDDRKKGSTVALNASNSRYGRSNSHPIPPRI
                     SPSGTRLNTSRRPPSPGAIAATADSAAAPSHYPSSNKSALRTTWRHSAGSDAFNSFLD
                     MEDDNDDARSSRPPSSSGHSKDTATSGGDSGVTFYELVNRLVALPMSKQDTKFVSIFL
                     CLYRKFAAPSTLLNSLISRFDKTERSDLPQLTRASEQLRLLQVVAQWVAEYPGDFSYP
                     KTRRKLVEFVDIIERNHVYMFAAKEISLHLENQVEDDDVGWPYRDGLEGESDEPESTL
                     HLSNNSSPTTLINTSFADNILHNISSLDLSDDTPTGSSRDSGTLSNTSSTGRSGSTMT
                     QSSFALQALEKAQQEAVTLELAPRYFLNKVQWRQFMEIPEDDFARELTRIDWIMFTSF
                     RPRDLVRHVSLSGPEKAKAKTLQNVNRMIQEFNHLAFFVASMVLLRDKAKHRARAMEK
                     FMNIALKLRRQNNYNSLGAVIAGINGTPVQRLGSTRELIPPSVQKEFMRLVILMGTQK
                     SHFAYRLAWENSFGERIPFLPLHRRDLVSAEEGNKTFFGPNKDRINWKKFEVMGDVVL
                     GIQSSQRTSYSYLQKNEEVQRLVLDAKMCDEEDLFARSTYVEPSAGTVDKSKMWGWLR
                     T"
     gene            <1525352..>1525708
                     /locus_tag="TRUGW13939_00507"
                     /db_xref="GeneID:55988020"
     mRNA            <1525352..>1525708
                     /locus_tag="TRUGW13939_00507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483714.1"
                     /db_xref="GeneID:55988020"
     CDS             1525352..1525708
                     /locus_tag="TRUGW13939_00507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339607.1"
                     /db_xref="GeneID:55988020"
                     /translation="MADLSLKSRHLYRALLRELPRRPLSSPSPLKLRFRERFQSPPKE
                     ISSSPSQRQQELEKADQFVRYARAQRMYATLVERYNPGMDMDQEERVRLSARRVGMNL
                     PIDVESNNNNEGGEGR"
     gene            complement(<1529047..>1530300)
                     /locus_tag="TRUGW13939_00508"
                     /db_xref="GeneID:55988021"
     mRNA            complement(<1529047..>1530300)
                     /locus_tag="TRUGW13939_00508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483715.1"
                     /db_xref="GeneID:55988021"
     CDS             complement(1529047..1530300)
                     /locus_tag="TRUGW13939_00508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339608.1"
                     /db_xref="GeneID:55988021"
                     /translation="MAPTLCFNCQASRAVIIRPKNRHKLCRSCFLEIFEAETHETITS
                     TSLFRRGERIAIGASGGKDSTVLASVLKTLNERYDYGLDLVLLSIDEGIKGYRDDSLE
                     TVKRNAVQYDMPLEIVGYDELYGWTMDQVVAQVGKKGNCTYCGVFRRQALDRGAARLG
                     IRHVVTGHNADDVAETVMMNLLRGDLPRLSRGTNIVTGSIDTEVKRSKPLKYAYEKEI
                     VLYAHHKKLDYFSTECIYSPEAFRGSARTLIKDLEKIRPSSILDIVRSGEDMASLVPP
                     EIRNSGNPIVSADDRGGCGSQNGRSSGGEMAAMEKKLAANDEAQEREIEVTLPSRRSS
                     VATVQSQRFPRLQPKGKPVKAQTAGKCERCGYISSQKICKACTLLDGLNKSRPKTSIE
                     VGIEDEESSSTLMRQMETVQLSSMT"
     gene            complement(<1531729..>1532531)
                     /locus_tag="TRUGW13939_00509"
                     /db_xref="GeneID:55988022"
     mRNA            complement(join(<1531729..1532066,1532128..1532154,
                     1532213..>1532531))
                     /locus_tag="TRUGW13939_00509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483716.1"
                     /db_xref="GeneID:55988022"
     CDS             complement(join(1531729..1532066,1532128..1532154,
                     1532213..1532531))
                     /locus_tag="TRUGW13939_00509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339609.1"
                     /db_xref="GeneID:55988022"
                     /translation="MASSKNTSAARGTSTLTILALVFAALVALFVYLDQHLDWFYVFT
                     PEHLHDVSQRAIAAHGNDTRAVVGYIVGELDQKLGGKHLNFDEEWVFNNAGGAMGAMY
                     IIHASITEYLIVFGTAIGTEGHTGRHTADDYFHILQGTQLAYVPGSYEPEVYPQGSVH
                     HLHRGDVKQYKMDDSCFALEYARGWIPPMLGFGYADTFTSTLDFPTLWATTRITGREM
                     ISNLLQGKL"
     gene            <1535643..>1536947
                     /locus_tag="TRUGW13939_00510"
                     /db_xref="GeneID:55988023"
     mRNA            <1535643..>1536947
                     /locus_tag="TRUGW13939_00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483717.1"
                     /db_xref="GeneID:55988023"
     CDS             1535643..1536947
                     /locus_tag="TRUGW13939_00510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339610.1"
                     /db_xref="GeneID:55988023"
                     /translation="MDTDAKMQSYNQAALNEFVMLPVSRDMISHLALQASKVIRCETH
                     VTASSVSQHGQPTPPSTPPMDPADNNSSLPPLETFITSLVHRSQVQVPTLMTSLVFLG
                     RLRARLPPVAKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTVVRGYEGFGFSL
                     AEVNLMERQLLFLLDWETRVTEQDLFQHLEPFLAPIRQQYEVAEQQQQQQQQMAESRH
                     QHDWWRLNASADSLAARLRRQKQEMRGEVRHTSQKRPQHVAATAAVQTHSASRSSPLS
                     VLEDGDRYSPYHRRRPSPYRSANNRSISPPSVKDIPGLSRTETRNSMAPSSSRSSSVA
                     PSARSTPGSMSTCSSSLDDVMVADGNASPASSALSYSYVNIQPYSKEQMMSAGNNHSQ
                     PNKKIKTAGSIGGSGGGLMARFLASAAGVYMGGRMSRPIAQN"
     gene            <1537979..>1539615
                     /locus_tag="TRUGW13939_00511"
                     /db_xref="GeneID:55988024"
     mRNA            join(<1537979..1539435,1539498..>1539615)
                     /locus_tag="TRUGW13939_00511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483718.1"
                     /db_xref="GeneID:55988024"
     CDS             join(1537979..1539435,1539498..1539615)
                     /locus_tag="TRUGW13939_00511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339611.1"
                     /db_xref="GeneID:55988024"
                     /translation="MPSPTCHLPNGNTFSVTPVFGGVNFKSNDLNLHHTAFPPGWTVV
                     IHTEKPVVVVGDDAEGKQQDGQQATKMRMSSFKQPTRQNDCIFISSISNPSSMDYKPP
                     ISPSRQIAMMLWATLWWYFHEPEPDLYLATAESANTPISGRPKGEWRVNIKREGIFKG
                     RNIMQKMERMGLIANVDSSVGTESIESRAPASWERMFTSRRSFWQLDPRIFIFTLTPA
                     AASTANLGIAPSPLISPYGSRPASPSVDFFRPGDGGSLSTDHHQPSPIQVQNVTSGPY
                     TSSSHLPTYYPPPPTQYIFTNGVRHPLRPRPPHQGETFYSRYIPSVGQYLSFRVPVLS
                     PGKHLPLSSFSSLTVSRIHNPSPPGPSDLDFLHKWMNDPRVNNSWSEAGPRERQENLL
                     IDGLSSRHSFPVIGCWDGKPFGYFEIYWVKEDRLGRNLGRVGNYDRGLHLLVGEQEFR
                     GPHRVPIWLNALVHYCWLADARTDAVLLEPRVDNQRIITYLTNVGFYKEGEVAFPHKQ
                     SAVMRINRDSWECPAL"
     gene            <1540051..>1541568
                     /locus_tag="TRUGW13939_00512"
                     /db_xref="GeneID:55988025"
     mRNA            <1540051..>1541568
                     /locus_tag="TRUGW13939_00512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483719.1"
                     /db_xref="GeneID:55988025"
     CDS             1540051..1541568
                     /locus_tag="TRUGW13939_00512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339612.1"
                     /db_xref="GeneID:55988025"
                     /translation="MPLTILSEAQVRSLLLSLTRDDVLALQQNIAEALREYSTGSQDQ
                     GCAASYQPQRTAITRKDGTTTVFMPASTGKTTGIKIISARLDPRAVANPADAFKPGCS
                     IGQDLTASRQSAKVSLSADDYSSRRSSSSLSTDMGSMSLTSTTTTTTSSSQDGSNEKD
                     DDDDDDFSSSSFSSDAPSINHQSLNPNNPKQSSMGYGQRIDTKGWIPAGARDSSPRGA
                     LTLLGEDGLPFGLVSAQELTAFRTALTSLCVFNKRKHVKNLTVFGAGRQAYWHIRLAL
                     LLRGPDIKRVYIINRSFERAAELLQDIYSASNASWRAHVKFSAFSSDFVEYDRLLREA
                     VRKADAIFCCTPSLTPLFPAECLTSTEGKRKGRLVSAIGSYKPHMTELHPDIFRNEVK
                     PHNHSHHHHKHAQRGGVVLVDSLELCLQEAGEIVQAELKPNQLVEIGELMIMKQAARL
                     EVEAGGEVEKGLQKWLESGNVVYKSVGLGLMDLVTGGDLVALARERGVGTVVPDF"
     gene            complement(<1541814..>1543160)
                     /locus_tag="TRUGW13939_00513"
                     /db_xref="GeneID:55988026"
     mRNA            complement(<1541814..>1543160)
                     /locus_tag="TRUGW13939_00513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483720.1"
                     /db_xref="GeneID:55988026"
     CDS             complement(1541814..1543160)
                     /locus_tag="TRUGW13939_00513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339613.1"
                     /db_xref="GeneID:55988026"
                     /translation="MVVPPWSPLVSLGIVSIFSLLHLVSSHPIEDDQSIVVHLRRAFS
                     PDESNQLPVQVAGIVASYIIFDALVVFLLLFVGRRLRRAVQTSNCSLDVVMLQPINKF
                     GESTDPSPISGVTGDTSFPSPDKPRGWNMSWSSVSKSHGHKGHTSMNSSSSIATVDES
                     VVSADRRRAQEEMEILYAAVMEHDAKKASAKSSPVIGEKEAMSPMSPVEPPPIQSPQL
                     FPPPQYQYQAPLSPRQGSTATNKSRTSQRLSRISNLSIFNPSRLSSASANKLKSPRSV
                     RELPISPPVKSPEAVRTATFQDSQPLSPRIYNPGPPPTAPLPGSNNNNTPRGFALQPI
                     SPPSSRTHHPHAPAPLTINPNSASALPFRQQFNPPLSAPPTKTTILERPAYVPGGPRT
                     GMPTPYSPYMPFTPVTPLTPSRLVTKREKRRQQKSNGLRVLHEDDMVKNDDDIWGT"
     gene            complement(<1544138..>1545810)
                     /locus_tag="TRUGW13939_00514"
                     /db_xref="GeneID:55988027"
     mRNA            complement(join(<1544138..1545382,1545436..>1545810))
                     /locus_tag="TRUGW13939_00514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483721.1"
                     /db_xref="GeneID:55988027"
     CDS             complement(join(1544138..1545382,1545436..1545810))
                     /locus_tag="TRUGW13939_00514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339614.1"
                     /db_xref="GeneID:55988027"
                     /translation="MMSFARSFALSNSIHASGIPGRRCLLLGDGAPPHQRSFSSHPPP
                     RENGAPNDNESATGEVKEEGALSRRLSEMTEEALLEGGRSARKNIEAAGFSDDLKAQL
                     EEKIKTSTFRSEHAGAFSVANMPASAGKGTQDIAGATPWRETESIHDTALRMLDDSKK
                     PMRVPYQIPKPTLPVVNLKPAPKTRESTGRRLASARDRTNTYTLSQSAGLSDEEREAM
                     RSEFRSRFEPGARSLPMSIQGLTSLANERIEDAIARGQFKNLPRGKGKHTQTDHNANS
                     PFIDTTEYFMNKIIQKQEIVPPWIEKQQELAREIDRFRQRLRTGWRRHAARVIASKGG
                     SLQQQQTRARAYALAETRLAEKSRLEASFASPETGNAREPSFSQISHDGQLAATSLPV
                     GQDQQNPISSAEQAEPSGEDTSLPQLAPLRDPDYMAIERGWHELQIKTLNDLTRSYNL
                     QAPRLAQKPYLNLERELRTCYADVAPSLADEIVSRTSSKVRSSSTQRKESGGIMGDIV
                     QANQRVRVYDEDSSKGYGLKEFWKDLWGRGA"
     gene            <1546054..>1546514
                     /locus_tag="TRUGW13939_00515"
                     /db_xref="GeneID:55988028"
     mRNA            join(<1546054..1546180,1546261..1546340,1546416..>1546514)
                     /locus_tag="TRUGW13939_00515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483722.1"
                     /db_xref="GeneID:55988028"
     CDS             join(1546054..1546180,1546261..1546340,1546416..1546514)
                     /locus_tag="TRUGW13939_00515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339615.1"
                     /db_xref="GeneID:55988028"
                     /translation="MPAKGASTRLNPVRLQTIQHLRVRRPNQQQQNTCATIMSSMLNC
                     WASAGHSNEGCTGLEEALKSCMDERKGNAAQSNSVNYHLMRMFPKVSGPRKREGRLK"
     gene            complement(<1546814..>1549661)
                     /locus_tag="TRUGW13939_00516"
                     /db_xref="GeneID:55988029"
     mRNA            complement(join(<1546814..1546871,1546925..1547137,
                     1547205..1547568,1547633..1547742,1548191..1549276,
                     1549330..>1549661))
                     /locus_tag="TRUGW13939_00516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483723.1"
                     /db_xref="GeneID:55988029"
     CDS             complement(join(1546814..1546871,1546925..1547137,
                     1547205..1547568,1547633..1547742,1548191..1549276,
                     1549330..1549661))
                     /locus_tag="TRUGW13939_00516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339616.1"
                     /db_xref="GeneID:55988029"
                     /translation="MAVTWFTGIGIGIALSCLVYQYIIYPAFLSPLAKIPNAHFTAPI
                     SPAWIIWKRYREQNNRTIHAAHTKLGPIVRLGPSEISVNCVEGGIKTVYSGGFEKHDW
                     YPRVFGALNTFSMFTMTGSKEHATRKRMLSNIYSKSYLQSSPNLKRISKTVIHDRFLP
                     ILAEAASSKQSIDVHELNSSLTMDFVSAYLYGLRNASNLLQDVPFRKHILHNYQCRKP
                     FEFYYQEVPSLIPLSQAIGIPVIPKWCQDAGNVMDEWNLDLCDKANKSVASTDPEIEP
                     TAYKQLKNSMMKHLHLQKEDPEANSQAYEQQRIDIACEMYDQLTAGHETSAVGLTYLY
                     WELSKHPEIQNDLRKELQTLSPPITSPPASESELVLPSAKDIDALPLLQGIIMETLRL
                     HAPIPGIQPRVTPSPPTSLANYDNIPPNVRVNAQAYSLHRNPDVFPDPESWEPRRWLK
                     DGHSPEMEEMRRWFWAFGSGGRIAIARSSAASQLTTLAKSFSKMSDKDAGTPRVYIAR
                     HGETEWTKSGQYTGITELDLTAQGVTQVQGTGNILVGAGKAIDPSNIAQVFISPRKRA
                     QTTFELLFSSQLDSSRVSTTERLAEWDYGQYEGMVTSQIRALRKEHGLDGERPWDIWR
                     DGCEDGESAQQVTDRLDDLVKEIKSIQQNHMHGEPGPADVVLVAHGHLLRAFVKRWLG
                     YPMEFPLSLMLPPGGIGVLSYQHHSINEPALYAGMAFP"
     gene            <1550193..>1552011
                     /locus_tag="TRUGW13939_00517"
                     /db_xref="GeneID:55988030"
     mRNA            join(<1550193..1551274,1551333..>1552011)
                     /locus_tag="TRUGW13939_00517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483724.1"
                     /db_xref="GeneID:55988030"
     CDS             join(1550193..1551274,1551333..1552011)
                     /locus_tag="TRUGW13939_00517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339617.1"
                     /db_xref="GeneID:55988030"
                     /translation="MLADLPSEIIYHIALYLPVASSLTHLAQTCRRLHDIVSADAIFR
                     AFVQSRFSPSVEGIPPFWKDVSQALTSRSRALDKCAIIARFMLPSPDVKVVGIDQPTR
                     HDRPTIGYRPCLDSYEVWTGGRWEDREEVLAWGAAEKIFLRIRSTGNSADEKWLRFND
                     LEDVSSHDDIRSVHLLRPNHPGKTAGNEHIIYGRARGDVAHVAINPDDATYTVQQTFV
                     TNRTEVHSLDLSPGPAPILAIHNASDSISLYRTVTEDSQVSSFASLKGETEEGTPRHY
                     SKFLSPTRLAVGYGKKIDTIAVSDIVEDHISTCREFFFSDDPFESRLWPQRKARVGAI
                     TPLSVDMNGENAHGEVFLAGWGNSRVRLHDLRSPRMYEREYIDVMDSNPIYCIQPVNN
                     RFLVGAGAEAIINIFDLRMQNAYSHFDAKLSEHNNQAKPKGGEYSCFLSHQPPGESRK
                     RYALYRGPIYTMSSPSPTSSTIYTGILKGVMRLNLGSTDDLLGSSSNWYQNHLDLTVD
                     DINQNPSSAPSPIGDVKIMGLSGYERPSPEAKSVSAKLRSQVPFCSISETDRLRESET
                     GWDRRWRRVDENQSWRSRGD"
     gene            complement(<1552294..>1553567)
                     /locus_tag="TRUGW13939_00518"
                     /db_xref="GeneID:55988031"
     mRNA            complement(join(<1552294..1553430,1553493..>1553567))
                     /locus_tag="TRUGW13939_00518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483725.1"
                     /db_xref="GeneID:55988031"
     CDS             complement(join(1552294..1553430,1553493..1553567))
                     /locus_tag="TRUGW13939_00518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339618.1"
                     /db_xref="GeneID:55988031"
                     /translation="MAAKKIQKNTTSSKVVKTVKDSSSKAKPENPPGSLVAAVATFLS
                     DFGYSSASRALLKEEKQRNGKDLSSDNKPAAPSLVTLFSDWQASNDKDGDEKAQSSDS
                     SSASSSDSDSSSDSDDSSDSEAEAKSDVEMDDAPADLKKESSSESSSSDSSSSSESSS
                     DEESEEDAPPVKSAGVKRKAEDEDDAKPSSKKNKTAKVSKKASTKSSSSETSSSSESS
                     SSSSDTGSDSDSDSDSDSDSDSDSSEVLEEATKKPLPDSDDSSSDSSSDSDDSSSDSE
                     DESEKKAKTGSDSSSTLASSASESDSKSQKKEAKSESFNSVPLPPDPQVKKKHTGARP
                     TRLAAAGALPHDHPSNTYVAYAYAERAYNDLSITRGKGFTKEKNKKKRGSYRGGPIDT
                     GPSQYSFKFED"
     gene            <1554213..>1558862
                     /locus_tag="TRUGW13939_00519"
                     /db_xref="GeneID:55988032"
     mRNA            join(<1554213..1554399,1554519..1556713,1556767..1557875,
                     1557932..>1558862)
                     /locus_tag="TRUGW13939_00519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483726.1"
                     /db_xref="GeneID:55988032"
     CDS             join(1554213..1554399,1554519..1556713,1556767..1557875,
                     1557932..1558862)
                     /locus_tag="TRUGW13939_00519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339619.1"
                     /db_xref="GeneID:55988032"
                     /translation="MNAPPSRGYDSPGPRARRPMGEPRNDGGPGAGEGQMSRAQMFQD
                     EKRRIMSSCFSKEDSDGTLAESYITHIRITEDAAYPSGPAPPNSPPENKKPRLIIVSL
                     RKSGRVRMHKARENNDGTFSIGKTWMLDDLSAIQSYSDLPATTPAEQQQKEWASNVGF
                     VVTVGKPYYWQAGNFKERDFFIASLVKIYKKYTGGRTPKLIGFDEKQRQALVGDSSQG
                     PLRPEASTKPAGPPPQEPRLNPPYPTQPPSREGRPQRPDEKLLRAQQSRDQIREARST
                     PSPGRPVHARDGPPLKANGRIEGDRNAAMEQMADLAGRQTLESSSETSRATSRNRDHS
                     RPGRAPPSRDGRYGHEIKPNPALDATRDLQRPTTAGSGGTGSLGQSLVQESSERLSRP
                     SSRGDVGSVPPSRDGNLSNRSSRILDVDLPPALRPGSRPGSSSSISRANLEPPKTAHE
                     PKVAAPELLPAASKSAESLVLPIQSSVDTPVVPPATKAAEQPETPAPTAKLPDIPVTA
                     TETETKDEGHRPGLGPMFKKKSGKEIANALSKAATAYSAFKPRPGGGRERLMASQKPQ
                     ADDGPDGITSVVPAPLLRGQSSESTKTPNPVTETAPTTITDSTTEAVPAPEAPPPLTV
                     VTDTAPGPASIEAEPPKVEITRAATDEMTTPVDQVKQLPAVDFVVPVEEKPRSRPTSP
                     AQEKRRRRREDNIVKYCQALGIEPNVLEGIGGNFDEILTDLGWTGRLSDDKKIDDLEA
                     DIRREIGRVQAISWLGNIEQQEGKIDQLAKLIDKTIDECEELDGLLTLYSHELSTLHD
                     DVAYIETQSQGLQVQTANQKLLQNELQNLLNTLSISSNDLRPLKEATLNSSDSVRVAE
                     NTLSLLYKAMLTIDSDIGQNKKRMADAAGDSSSMGTYTDSDVRQMRAIKDKKDSYRAE
                     AGAFLKRLRQFMTLAFKAAEQKRVEISSASSTATKLDNTARNAARQDLWMYNALMLFA
                     REVGTTEWAMIINLYEQDAKTPYQNEFRNHCATWKRAVKKNSGDEQDLLFTHHEKEKD
                     GDGITNAARKLTVRRGKTVRLNHGAKSLEKQSGKLEPFEVFAGALQEMLKMISQEQNF
                     AVHFFHLSSLASGEFPDVVAASDPDNRHIPDFTVKQLHDPDRDLAKRVEQIMDSIYSF
                     WATDMQNLVDWALRTERLQGVGVLAALEGAISEYDDTNQDFIVHTLQKLVSRLNGLFN
                     RFVDEQIRGIEETKVKINKRKGVISFMRTFPHFAVVIENMLASQPSSNFSDVRVAVNE
                     AYNKINRAMWESLKFIAKEAPGQAPGATTGTGDPEDKEALNYHVLLIENMNHYIEEVD
                     VRDLSVLEGWRDRAYQDYYEHMNLYIDAVIRRPLGKLLDFIESTESLLTHTSNPADIS
                     ARTSHSKHVAKKLVSSHDSKELRRGADLLRKRVEKHFGDADDPGLSRSLVQKVLKECE
                     SRYSDAYERINKIIDSVYEGQVELDWNREEISSLFRR"
     gene            complement(<1560173..>1561281)
                     /locus_tag="TRUGW13939_00520"
                     /db_xref="GeneID:55988033"
     mRNA            complement(join(<1560173..1560713,1560766..1561083,
                     1561145..>1561281))
                     /locus_tag="TRUGW13939_00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483727.1"
                     /db_xref="GeneID:55988033"
     CDS             complement(join(1560173..1560713,1560766..1561083,
                     1561145..1561281))
                     /locus_tag="TRUGW13939_00520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339620.1"
                     /db_xref="GeneID:55988033"
                     /translation="MRRATTLSLFLAAQALGTVFDYDPDENYRPRNVTGLDYYYYPWI
                     GSYYNGSAVFTISDVEPRDDRTDSEIEEEGELELCGQLQNITYTWSYPAILAITETEP
                     EDERPENTNPIDVALFTSYSNFTKYFSDYMDSGNMQIRDMPFVFESIEMARYSVLTGR
                     DKPDFNLTVAEDTGNGLPFRVTGSSELEQNPLATLQMNMSTCSRTEGWWAADPISLGD
                     DLDDISGLANPTVQLTFDDSSTSFSIQSWVRANTLAEKGEETPRISARLTIEFLGRID
                     AARSDVLNEGTPVTWTRSMGFGNNSLSLDYESGALAAAGVSIWSILAAVLAYIFI"
     gene            <1563144..>1563623
                     /locus_tag="TRUGW13939_00521"
                     /db_xref="GeneID:55988034"
     mRNA            <1563144..>1563623
                     /locus_tag="TRUGW13939_00521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483728.1"
                     /db_xref="GeneID:55988034"
     CDS             1563144..1563623
                     /locus_tag="TRUGW13939_00521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339621.1"
                     /db_xref="GeneID:55988034"
                     /translation="MVLTKIENPIVMEHAHIYPFSLGIAGQRQSFWDGLRLFWLEEVV
                     DIWHEILGTAQGTERLVNTMMLDCTSHRAWGAALFAFKFEKISEDKRQMNLKFYWLPR
                     RTMEPQMTLSKEEFLKSPEIPSERSLGPGFLQFFTVRTGQTIKSGDIITLYTLGSNH"
     gene            <1565224..>1571607
                     /locus_tag="TRUGW13939_00522"
                     /db_xref="GeneID:55988035"
     mRNA            <1565224..>1571607
                     /locus_tag="TRUGW13939_00522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483729.1"
                     /db_xref="GeneID:55988035"
     CDS             1565224..1571607
                     /locus_tag="TRUGW13939_00522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339622.1"
                     /db_xref="GeneID:55988035"
                     /translation="MPWRPLPRIAFAVAIYPFQPSSPADLPLELGDELYIIEQGGSNG
                     SWYRGYLVAPPSLLAGLTSVKGQTLEARVFSGIFPRNCVEIREYLGDADGRKALDKGD
                     AAAQASGQQSPTSDDGHNILDIPEELLLGPRSVSVTTPIRSPSVPLTPPARNPNSPKP
                     AAPVPMLKIGDETPTSYEEPLVDEIASCLREWHSTNLHELLLTRQYVSLEQVSNIILE
                     LDLARRQLLHDVLTAKEKDTIRQDTVWSLVRGNKMLTGEVIVRDPKQNGRLLTGEDSA
                     IELTKLQSEMSMLDSDPAQNVDFVSLHHMLLEVKAVSGSNSGLVTLNMYLASKSEDGS
                     LKPLSETYTLDVPSPESFSALAHSSKLKTLFTELCAADVGEGSGANTQLFLVVKVQAV
                     ELPRPSLPPAVRSPSSRDGTLARSASTMNSGRGVKARRSMVWNTKSPRTGQPETIKEN
                     PPQSAGSTDAPRQSESSSKENTVIRTIGVGIIDVAHIIRQDKDAEQVITIWSPVDEDA
                     EEEENDNQGFDELIRTVLPSSSGRYVKSHRSSRLHIHFHPFVGSDPDALIRNNPTLMH
                     NVTQTRRIGFAAAPSTPRSDIYLTISRAKLPFQALLSHPQVGQVPLIANTGYRNLQLT
                     LEIRNASGARLERCIFASSNSSGHTAWRTTVTDKDSSWDQTIRLKIPTEEVPGAHIIM
                     SIADAPEFPFALSWLPLWDEGAFVHNGPHSLLLHAYDKVTSSVDESGRGAYLNLPWSS
                     ASKGNSAKDESVTGSMSALLIETNLCSTEHSQDQIILGLINWKRQENGDILKLLRRIL
                     FVPQIEIVKQLRDVLDALFGILVDNAGIEEFEDLVFNALVTVLGIVHDRRFNLGPLVD
                     RYTETQFNFPFATPCLVRSYLRLLQGSDSPEQSRNLRAAFKVGRHLLKFIINAREQQK
                     LKEEGIGVTKSTFNRDLHSIFKCLETLMRNPSPAMIGNKTLVVQHIHSWFPELTSVLG
                     KDEIIMIALSFMDACKDVKGMLILYKLILIQNYTRLEVFTSGPERDTLISSCLGWLDP
                     YWGSIGSISDQYRDQVRLCSSIITELLQQPDRKLYGFMGKITSSYCAIILEGVEDTDY
                     LSMLYSKSFPFQVKASKRSQKFDEALVELAGLMASISNIQNPKLPVLKQDDMAVFLSN
                     ALEAHKSIINCEAYPGDWLSVHIYNHRAAVKDLENISSLLTEFFLPPPDDADSFDTRL
                     WELFFTTLLKVVSSEALALETFPEQKRRAVWKIGGDVREQGAALLRQSWEAIGWDTTE
                     EEKAKYGLKRLGGFQVQYVPNLVPAIIELCLSVHEGLRHVAVEVLQTMIISEWDLNQD
                     LSIIEMEIVTSLDVLFQTKHMNESIAQKLFITELLGLFDKDPESEDALTTDVKGLIST
                     IDELLDLLVSSNGGGITESLHTLRLMEFMKDMGREDIFIRYVHGLAQSQISESNFAEA
                     GLALQFHADLYAWDPTRYLPALSNPAYPEQNAFERKEALYFEIIQHFEDAKAWTHALA
                     CYKELAEQYEFIAMDFAKLSRAQSSMAKIYEAISKEDRSFPRFFRVFYKGLGFPTTLR
                     DKQFIFEAMPNERMSAFTDRMQKLHPSAQIMSSGEIDDIEGQFLQIASVSPYRDTLHP
                     VYQRSKVPYRVREHLLISVPNQFAFTSKRHTGSLDIKEHWAEKTVFTTAEPFPNILRR
                     SEIVATEIVDLSSIQTAIERTWRKTQELHLLEKLAASGDDTSLSSLTDALIQLLDLGI
                     GQTSCVAIYRSFLSQDEKHGIENEDEDAEEEEEEEEQKPIDPLENALAVALIDHALSI
                     KHSLSLYSRPSHKATQSEFLSRFEEVFAPEIASLSAHSQLLSPPPSASHSGSRSTPLA
                     NGNNSAELGARSFSPEQELIRSTRVNGNNVKHAPKSSLSHRISIVNPFKRSNHGASAS
                     VATTGTAHQTDGKSHRQSTDLQGYDDDAATINSRATSRGGRSDKRRSWFGGESKSKYK
                     ITPSVTGAGDDGDESRSRRNNSRTRSATEKSVKSAKSQDDPHHHHHRRHSRLESKKST
                     PVITANEWDTAATALPRTSYSERPRTSGEESLKQSTANGTSSIAVSPVPTYSQDYSST
                     NGNGNQNPSGVRDSVKKRFSLLKGINRKSSRLNVRDDGGAMRNGSFAQPLREE"
     gene            complement(<1572054..>1573016)
                     /locus_tag="TRUGW13939_00523"
                     /db_xref="GeneID:55988036"
     mRNA            complement(<1572054..>1573016)
                     /locus_tag="TRUGW13939_00523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483730.1"
                     /db_xref="GeneID:55988036"
     CDS             complement(1572054..1573016)
                     /locus_tag="TRUGW13939_00523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339623.1"
                     /db_xref="GeneID:55988036"
                     /translation="MDPTTQKSIKTRICMISDTHTKTPHPSPCTDKAYRHPLPKADVL
                     LHAGDLTQIGRLPEHELMVGMLKQADAELKLVIAGNHDISLDKKYYARRGAARHGSAR
                     VEDPDEIKSLYTNDEARQAGIVYMEEEVKTFELKNGARFTVYASPYTPEFCGWAFAYE
                     RNEDRFNLPDSSSPPQQVEGGKKFQASNPVPSFPEVDIMLTHGPPLGILDQVVYGKRV
                     GCEHLLKACTRARPRLHVFGHIHEGFGAVRHNWVTSTTETIPQDSETVREQRSCYYNI
                     GNDGENQPLVFGEETLFVNASVVTVRYHADNAPWVVDLDLPAVS"
     gene            complement(<1573601..>1574271)
                     /locus_tag="TRUGW13939_00524"
                     /db_xref="GeneID:55988037"
     mRNA            complement(join(<1573601..1574129,1574198..>1574271))
                     /locus_tag="TRUGW13939_00524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483731.1"
                     /db_xref="GeneID:55988037"
     CDS             complement(join(1573601..1574129,1574198..1574271))
                     /locus_tag="TRUGW13939_00524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339624.1"
                     /db_xref="GeneID:55988037"
                     /translation="MGISRDSRHKRSATGAKRAYYRKKRAFEKGRQPANTRIGNKRIH
                     LVRTRGGNTKYRALRLESGNFSWGSEGISRKVRVIVVAYHPSNNELVRTNTLTRSAVV
                     QVDAAPFRQWYEAHYGQAIGRRRQQKSEVPEEKKSKSVERKQAARALASGKVDNALER
                     QFEAGRLYAVVSSRPGQSGRVDGYILEGEELAFYQRAIRK"
     gene            complement(<1574909..>1575685)
                     /locus_tag="TRUGW13939_00525"
                     /db_xref="GeneID:55988038"
     mRNA            complement(<1574909..>1575685)
                     /locus_tag="TRUGW13939_00525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483732.1"
                     /db_xref="GeneID:55988038"
     CDS             complement(1574909..1575685)
                     /locus_tag="TRUGW13939_00525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339625.1"
                     /db_xref="GeneID:55988038"
                     /translation="MANTSVDSPQPQNPLGAGNAQNAEQHRLRQQQICAHMNADHQET
                     LGFFLKVYCRVSAKEAKSAELEEIRLSGMTITTTTSTCPPATAQKTHYFVPFEPELSS
                     ISEVRQQVVKMHHHCLKTLGRSDITITEYRPPTGFPAVLFTTCLLTFAAFSRRANFQE
                     GSSLYSLVLRHVPSFAVFCYTIQPLLITLMVAIHLSEALYMWVYRLKPHNIAFGSRLW
                     LCWFVNDFIEGYTAMQRFDAVVAEEMAKKAQHAPKKKPSN"
     gene            complement(<1576479..>1577028)
                     /locus_tag="TRUGW13939_00526"
                     /db_xref="GeneID:55988039"
     mRNA            complement(join(<1576479..1576485,1576541..>1577028))
                     /locus_tag="TRUGW13939_00526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483733.1"
                     /db_xref="GeneID:55988039"
     CDS             complement(join(1576479..1576485,1576541..1577028))
                     /locus_tag="TRUGW13939_00526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339626.1"
                     /db_xref="GeneID:55988039"
                     /translation="MAAVAEKQQKEAPVKHEEEEEDYYNSEDGSDYDSYSDDDLDEPQ
                     TELEDDLNSQNRRNQRRKNKQLQQRQFDDDDDEYDDEYDDEDDYGSEDDAQALAPLDK
                     NSYGPIRESNQGVGGKKIETAKEATGSIDDEEGLKLKLDINLEIEIELKARIHGDLTL
                     ALLA"
     gene            <1578429..>1579248
                     /locus_tag="TRUGW13939_00527"
                     /db_xref="GeneID:55988040"
     mRNA            join(<1578429..1579165,1579242..>1579248)
                     /locus_tag="TRUGW13939_00527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483734.1"
                     /db_xref="GeneID:55988040"
     CDS             join(1578429..1579165,1579242..1579248)
                     /locus_tag="TRUGW13939_00527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339627.1"
                     /db_xref="GeneID:55988040"
                     /translation="MSEQASNPEVSQENPAPSTPQQKKPPKLNRKKPATEEQQQQQPD
                     VKAEEDPSQQDEQEDNNATKDEPSDEVPKQEEEEQDEKQEQEPQPEPEPEPRRRNRRS
                     RPNRRVQRYNDPEDTEEINRSEMEAQQQPQGGRRNRTRAGPSKGGRRFQQEQQDQDGG
                     PLGGIGEVGNTVSGATDMVQNTAGKAVNGVTDSAGKAVGGVLGGGQKQEDDDGGKDEQ
                     LRLRLDINLDIEIQLKAKIHGDLTIGLFS"
     gene            complement(<1579760..>1584485)
                     /locus_tag="TRUGW13939_00528"
                     /db_xref="GeneID:55988041"
     mRNA            complement(join(<1579760..1579905,1579960..1582319,
                     1582410..1582838,1583326..1583669,1583736..>1584485))
                     /locus_tag="TRUGW13939_00528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483735.1"
                     /db_xref="GeneID:55988041"
     CDS             complement(join(1579760..1579905,1579960..1582319,
                     1582410..1582838,1583326..1583669,1583736..1584485))
                     /locus_tag="TRUGW13939_00528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339628.1"
                     /db_xref="GeneID:55988041"
                     /translation="MAPRLNLFATRNVLRHITTQQSTSTAANRWNTTRVAALESSTKQ
                     CLGAPQIRRQAYSSKKTEQPEEAEQPKGPTQDTLPDVSHEAAAVDKILSGKKCDGNAP
                     GSPELEQGTPIDEVREYSAALLALEYANSAMLKKILKRDEDAFKYAPKVLRDQANKKG
                     TRSYSTSARLFQQNLQQQPSAGRPDDASAAMVESMIMTATDQAIERDPGLKFDMPDRL
                     PKSEHFKNRYDPLVEQFTKLMMEDGKLSKAQRDMEIILNHLRTSSPPKLDPRRRLLTA
                     LPAPQLPLNPVVYLNILVDSIAPLIKIRQQKGLTGGGASVPMPVPLSIRQRRRTAITW
                     ILSTADKRKDSQWAMRVANELTSIAEGRSGVSIELVAFTPSTTAHPSAAGASTSTSTP
                     TSREPAGVTATPLADGVTRRLPVTQEDPSTGNTDRARPPSLEETQFLPEKQSLGIGQR
                     QHLLWASALKYWPRTTKEAQHVDSSDGLANMKFSHSIQFNAVPDWNDYYIAYDNLKKL
                     IYSLERQANCPDNNAAPDAESAPLLDASVDTDTIFRHALDTELEKISSFYQVKELSIF
                     GDVEEAVKEQAQYKANTDGLNMDPVSETVIKSRTLSIGSRPRTGSIFQSLGLRQNRRE
                     STMSGGSAGEGAFEDDDDDDDGDSDDDSRTEDTRRRSHTRHRDVGDRSDGHPSEMGDS
                     RVWTLGGSRHEDDNIDQRFLDLYNLGVALKKRIISLYVSLCELKSYIQLNKTGFSKAL
                     KKYDKILNRNLRRAYINDTVSSAYPFTDSTARHVDENIRNVEQMYVDIVTKGDLSLAR
                     RELRLHVREHVVWERNTVWREMIGIERKAQAANMGIRRTLLGGDHDPFAAQRQGDAET
                     IKTQVDTPLGRIYLPEWLFSLSFLFLLMIVTIFVILLWVPIMETPEQQNCLAMVVFVS
                     LLWATEAIPLFVTSLLVPFLVVVLRVMRSDTKPHTRLDPEAATKAVFASMWTPVIMLL
                     LGGFTIAAALSKYDVARRMATFVLSKAGTSPRVVLVTNMFVSMFLSMWISNVAAPVLC
                     YSIIQPLLRNLPPESNFSKALILGIALAANIGGAASPIASPQNIIALENMYPAISWGT
                     WFFISLPVCILSIFLIWSVLLVTFKPGRGTTIVPIRPVRENFTGIQWFVTITTLVTIV
                     LWCFSHQLDTVFGDMGVIAIIPMVLFFGSGILTKEDFNNFLWTIIILAAGGLSLGKAV
                     TSSGLLHTIANAITEQVADFSLYGVLIVFAALILVMATFISHTVAALIVLPLVQQVGV
                     GMENPHPNLLVMASALMCSVAMGLPTSGFPNMTAIMMEIPGTGQRYLRVSHFLTRGIP
                     SSLISFVIIVTIGYGLMSIAGL"
     gene            complement(<1585026..>1590486)
                     /locus_tag="TRUGW13939_00529"
                     /db_xref="GeneID:55988042"
     mRNA            complement(join(<1585026..1585077,1585132..1586006,
                     1586072..1586510,1587482..1587497,1587556..1587818,
                     1587872..1587933,1587988..1589718,1589772..1590185,
                     1590239..1590325,1590379..>1590486))
                     /locus_tag="TRUGW13939_00529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483736.1"
                     /db_xref="GeneID:55988042"
     CDS             complement(join(1585026..1585077,1585132..1586006,
                     1586072..1586510,1587482..1587497,1587556..1587818,
                     1587872..1587933,1587988..1589718,1589772..1590185,
                     1590239..1590325,1590379..1590486))
                     /locus_tag="TRUGW13939_00529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339629.1"
                     /db_xref="GeneID:55988042"
                     /translation="MQRHITWLSVVILIWSQAIHLVSCYQEASHVSGGTSVGTATQST
                     SFTTLYPPHNAYRVLVAQTQGVYNAQLEREGHPALLPFPLPLPLPSVALNLGGNADVV
                     TSIPSTSSSSSWTTTVVETVKTTVPFNPTGSATTTSTSVGQDTKTTVTSLPSQTATQK
                     PATRAASSAASMNQQDVFNTVSLDAVPTNIATKDDHPVPKIGIVNTTSPIETNKFYAN
                     FFLGDQTTSSFSQPYSLSWAKGSGGARSWGLVASHTELDQLVYGNTSAELPKNPVEYY
                     LNPIGLQPLILSAAEFGNSTVLNTDRLTGFSANVILQPSNGSSQSITFPIVQGMGFVT
                     GVYSGLQPFIQSSILFRNVVQAGSPRPGTYKFQITLEDNKSWLMYVTPDDGLQPTFNF
                     TTSATTLAGPAGFSGAIQIAKNPAGSGGEAVYDQSAGVYATTANISGSVTDTTGTYKL
                     SWEKAGRNASSAPLLMFALPHHIQSFDDTTKQGLQAVQLRATTKGNTTAVLGDSWTMV
                     EQNLPMDMDFAPWSPALGSVSTLSAENIQTIMDAAKTELTVDVDGQSNVNSMYYGGKV
                     LSKFATLVYTVNTLANDPQAAAETLDGLKTAFARFVNNEQQFPLVYDNVWKGVVSSAA
                     WATNDLNQDFGNSGYNDHHFHYGYFIHAAAIIGALDPSWIEPNKAWVNMLVRDAGNPA
                     TDDPFFPFSRAFDWFHGHSWAKGLFVSGDGKDEESTSEDAMFAYAVKMWGKTSGDKSM
                     EARGNLMLAVLRRTLSNYFLMEDDNLNQPNNFVNNRVTGILFENKAHHTTYFGANLEY
                     IQGIHMLPLLPSSAYTRNQTFVQQEWDSMFAENACSPASKVSSGGWKGVLYANRAITN
                     PDESYEFFKQPNFDQGWIDGGATRTWYLAYAAGLKGGKFSASFKTQVHRQGSLSRSMT
                     GVSSNGSLEPDERSNLLPHRDSVRSQSGSPYLRDERFWVRIPTQFGHLTWATLLSNYV
                     NVLLVFVPLGIVSGALEWGAATVFTLNFLAIMPLASLLSFATEELAATMGQTLGGLMN
                     ATFGNAVELIVSIIALKDGQIRVVQASMLGSILSNILLVLGCCFLVGGLRFPEQRFNS
                     TVASTMSSLMAVASASLIIPASLFAAMSDSRDTDPSETRDNILLLSRGTAIILLLLYV
                     MYLVFQLKTHAKMFEEGFQEEGLANGQQTGETEEAAPVEHHEEEHILNPFAAGVALVI
                     VTILVAICAEYLVGSIEGIVEKTGMTKTFIGLVLIPIVGNAAEHVTAVVVAYKDKMDL
                     AIGVAIGSSLQIALFVTPFLVILGWIMGAEMTLHFQVFETVSFFISALVVILLIQDGK
                     SNYLEGGLCLGMYAILAIAFYVYPDSAQ"
     gene            complement(<1591710..>1594634)
                     /locus_tag="TRUGW13939_00530"
                     /db_xref="GeneID:55988043"
     mRNA            complement(join(<1591710..1591892,1591968..>1594634))
                     /locus_tag="TRUGW13939_00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483737.1"
                     /db_xref="GeneID:55988043"
     CDS             complement(join(1591710..1591892,1591968..1594634))
                     /locus_tag="TRUGW13939_00530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339630.1"
                     /db_xref="GeneID:55988043"
                     /translation="MAGRKSNVLKSREETKPKPAKRQRQSAGLNALAAAEDQFPTKAK
                     FRPHRFGEVEDFSKRKRDYDDDDSENKRRRTEEDEDEDLSGRGSDSEGHEWKVGQVDS
                     DDDSDIDSDDALGSSDEERFEGFTFRGSSKPHAKSKPKAAKRKEINLSEDDASDHEED
                     DDDDSLGEDAVDLATAWDMNAQEDSDEDDANNTSKGKPSTKDASSESDLGDSEDEESD
                     INSDTDLSMSDDDKVGTKDGLSKLRDFVSSMETTKPRERSTKSSRGQENVAPTEYGLT
                     PSRKLTVSDLMASGMDSRLKSSLKHLDSAVPSKDPKVGTNGKLTAPLPKRQQDRIDRA
                     AAYDKSKETLNRWIDTVKSNREAEHISFPLPDPYEQQVSRLGPVAPKTDLESTIQSIL
                     VESGLATSEKATETQLQAAEDLQTRKMSLEEVQARTAELRKRRDLLFREEIRAKRIKK
                     IKSKSYRRVHRKERQKMEELEQQALIDAGVEPEEKEREQYDRLRAEARMSTKHRDSKW
                     AKSLKQTGRTAWDEDARTSMTDLARRDEELQRRMEGRSVRTNEDDYLGSSSSESDDEN
                     DAWDEEDSDFESRKLNGDLDMVGGTGSGESTGPHSKLLSMAFMQRAEASRKQQNDDEI
                     KNIRKELNGDVSGSDSDQEGGRKKFGTSKPETGKGPVASRKKNEFEETVGSEDEDLRN
                     EATKEPDNTTLSKKNKKSKSGTSVKATKSTGLKAATRSAPETEEAVENPWLVQNTRNN
                     RKRDVGEADQALDISVAAPIDESTSRKPESQSAKSRTNRAAPQHDDESSDSADNTPVL
                     LKNHDLVKRAFAGDDVIAEFKKEKEEVIEEEGDKIIDNTLPGWGSWTGAGVSKKQQKR
                     QKRFLTKVEGVRPEQRKDARLGHVIINEKRVKKNARYMATQLPHPFENRQQYERSLRL
                     PIGPEWSTSDTFHDATKPRVLVKQGIIKPMERPQA"
     gene            <1594901..>1595381
                     /locus_tag="TRUGW13939_00531"
                     /db_xref="GeneID:55988044"
     mRNA            join(<1594901..1595080,1595142..>1595381)
                     /locus_tag="TRUGW13939_00531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483738.1"
                     /db_xref="GeneID:55988044"
     CDS             join(1594901..1595080,1595142..1595381)
                     /locus_tag="TRUGW13939_00531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339631.1"
                     /db_xref="GeneID:55988044"
                     /translation="MKPSQPLMARLRLTTKQVNGGYYKGNRTGSMGAFDKKGKYVLDY
                     RKVRTYVVPESLNEFMLTPFVTNSFQPTPTKYKYKKYGGRPRAFNGNHYIDLWKSTNA
                     QEVQALRDNGGKFPEGDAEEVEAEELEAEERKTEGSS"
     gene            <1595842..>1599688
                     /locus_tag="TRUGW13939_00532"
                     /db_xref="GeneID:55988045"
     mRNA            join(<1595842..1597865,1597954..1598965,1599017..>1599688)
                     /locus_tag="TRUGW13939_00532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483739.1"
                     /db_xref="GeneID:55988045"
     CDS             join(1595842..1597865,1597954..1598965,1599017..1599688)
                     /locus_tag="TRUGW13939_00532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339632.1"
                     /db_xref="GeneID:55988045"
                     /translation="MTGRLEILALPLTDNAFPIANKAMFQSFTGSSRRPRQVNLSGRN
                     INPFAASNSGRQTPHGNGPQNALAIAQQERLLRQQERARLSAARVLQKTWRGHLCRRA
                     TRETWRQEWDMAEQGRTGVTLQFGDGQLSQASTVIPYSDLNQCQAQLRLLLRFFETSS
                     DYDAFRLLYFSRTLRRTLEEVPAMPAEGGWTALLARLGSITLRLLRKLASRNDHPRLA
                     GDHFLGLLCFLIDLIPRQMAQLAGEYYTVMATLTANIELLGPKLNYSSGDIVKSTLAL
                     LQPITADTLGAYEWFARTYLTIPDLQSHIGQLDALASNINYKLLAKGLDSFMQNLTDK
                     QSAGDEIESRLWLLAYFIFLRRSTLSGSSDQEAPEPEFVKVVSSLLNSVALYVSRRLE
                     PDDSFESEEEQYSPLPPFVESQITSLVNQKSITGLLSRVKPGLFGNETSAADLDASED
                     AKALASYALTLLRVFPRRGDDIRMWLYLGSATSTDSSALRVPAIKFFWTISKSTELFA
                     KISHDSNAVLSLLQPITGEDPKRSLQREQNWTIILLFLELYTFLLKVMDDEEFFSGDS
                     RPTVIDMKVSWTRESALLLKDVRDLTVFLKNLAFTLYWNAADLNESQDVQTPSGIKSY
                     FTPHSRQEPVPTVRDVEQRNKEKGLPGVTGIPLEYFKGLVTGLLRMIHERDSRRKFLP
                     DGHWLMTTRFDMEGFIPAVVAEEENRHQLQEEEEDQQEDSYMDDITDQSLGLIGTGRA
                     QQARRIEAFRRHQHQAARRKQMEAVAPRLEILRNMPFFIPFATRVQVFREFIYRDQMR
                     RRQGYIDPDSWRMSVSAASMGRLMNGGAPTQDVLSRHHANIRRESVFDDAFDQFYDLG
                     EGLKEPIQISFIDTFGAVEAGIDGGGVTKEFLTSVTNEAFTSSNGLDLFVENDQNLLY
                     PNPTSVEQRKEVLRGMGVQERTPQFSDGVRDLLKRYEFLGRVLGKCLYEGILVDVHFA
                     GFFLLKWALTGGSTAAGKESAYRANLNDLRDLDEKLYEGLLLLKNHPGDVEDFSLNFT
                     VTDTIPVPGAKDRIITKELKLDGANIAVTNQNRLVYISYIARHRLQNQPALQTAAFLK
                     GLGEIIQPSWLSMFNQAELQTLVGGDAGEIDVADLRRNTLYGGIYVIGDDNEEHPTIK
                     LFWQVMESVSNEDRQKVLKFVTSTPRAPLLGFSHLNPRFSIRDSSDDQERLPSTSTCV
                     NLLKLPRYSSAEVLRDKLLYAVHSGAGFDLS"
     gene            <1600705..>1603194
                     /locus_tag="TRUGW13939_00533"
                     /db_xref="GeneID:55988046"
     mRNA            join(<1600705..1602138,1602192..1602266,1602330..1602979,
                     1603038..>1603194)
                     /locus_tag="TRUGW13939_00533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483740.1"
                     /db_xref="GeneID:55988046"
     CDS             join(1600705..1602138,1602192..1602266,1602330..1602979,
                     1603038..1603194)
                     /locus_tag="TRUGW13939_00533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339633.1"
                     /db_xref="GeneID:55988046"
                     /translation="MSAEVAATPTTENANGAPDANGTTVDTNVAPESATSDTASTPNN
                     NQPHSASLYVGELDPSVTEAMLFELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTA
                     DGERALEDLNYTLIKGRPCRIMWSQRDPALRKTGQGNVFIKNLDTAIDNKALHDTFAA
                     FGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKD
                     RQSKFEEMKANFTNIYVKNIDLDVTDEEFRDLFNTFGEITSATISRDPDSGKSRGFGF
                     VNYISHESAQVAVADLNDKDFHGQKLYVGRAQKKHEREEELRRQYEAARLEKASKYQG
                     VNLYVKNLTDDVDDEKLRELFSAFGTITSAKVMRDTVAEGSEDSDKEDSGKENVEKEN
                     EEPAEKAEKAEKAEDKEDEEEDEDKENKDEKKSDKKLFGKSKGFGFVCFSSPDEASKA
                     VTEMNQRMVNGKPLYVALAQRKDVRKSQLEASIQARNNIRQQQAAAAAGMPHPYMQPA
                     VFYGPGQQGFIPGNAGQRGLAFAPQPGMVMAGIPGGRPGQYPGGFPQQGGRGMGNPNQ
                     QIPQNFGQGIPIGAMQAGPGGIPNGMAYPQMAQVQFGRGGGGRGQVPQGIPPNVPGGR
                     GGPGFGQGRGGVPPQQGHARPGQGGRGQNAGAGAPAASDAPSGSAAMQALSAAPPAQQ
                     KQMLGEALYPKIQAQQPELAGKITGMLLEMDNAELIGLVDDDAALRNKVQEALDVYDE
                     YMKSKGPGADESGDAPKPKEGAKEGAEETKS"
     gene            complement(<1604639..>1605937)
                     /locus_tag="TRUGW13939_00534"
                     /db_xref="GeneID:55988047"
     mRNA            complement(<1604639..>1605937)
                     /locus_tag="TRUGW13939_00534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483741.1"
                     /db_xref="GeneID:55988047"
     CDS             complement(1604639..1605937)
                     /locus_tag="TRUGW13939_00534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339634.1"
                     /db_xref="GeneID:55988047"
                     /translation="MIAVSALVLASAAAAQYILPTHDVPFIGGNVFKSNDTAVASYPF
                     SYKPPFDPKEYGGYYYWSVNNETVSGTNFTGYDTKDGYTIPDGSTGKYPYFQISEGHP
                     KAINKSTLFESCGEPKFKKILHIIFENEVYEWTMGQVFWKLLAKRGKLLTRSYAIAHP
                     SLPNYAAIVAGDFFGMAHEDFYNVNATSVYDLLDANHVSYGTYVEWYNPIATHRGPND
                     CNNYITNGPIDSTNPEWASQIYRRLDVPALLFSTYTGNYERCSKIYDANNTFADHVMS
                     HTLPEYSYYVPDMLHNAHDPESNSNYFNQPNTGAQWMNAFLDLYLPELEAQGTLVVAT
                     FDEATWWNDDDTSPNNDSHIATILFGSGIAPDTTDDTYITLYGMLRGAIQNFGLGSLG
                     RNDTNATNGNLFDLVDFPLANLDGDGHGDHPGNQEKPSGR"
     gene            complement(<1606659..>1608949)
                     /locus_tag="TRUGW13939_00535"
                     /db_xref="GeneID:55988048"
     mRNA            complement(join(<1606659..1607319,1607394..>1608949))
                     /locus_tag="TRUGW13939_00535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483742.1"
                     /db_xref="GeneID:55988048"
     CDS             complement(join(1606659..1607319,1607394..1608949))
                     /locus_tag="TRUGW13939_00535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339635.1"
                     /db_xref="GeneID:55988048"
                     /translation="MQSSDILPGTTELGSLIANSNDESQFVGSSSGVYFINTVRQAFA
                     KSLGPLGNDPLSSPGFPAAEETLVGPESLSSGNASRDKTANSAAENDIRPQKNWGYDS
                     EVSSALGEAPALENARQLMMMYFKVWHPIFPFLHGPSFLQEMEALYSANNTLDGESQP
                     RGSHHQSTCWTTIFQCVFNLAALLQPDLQLRQESKIQSVAEFPKLVGILLYRHDMLSL
                     QAVLVMQLYLVATMSLHNASLIGGSILRSILHAGLHRCPYRYKQLTSHDRHLRKRIFW
                     CAYAIDRYLSQALGLPLGIQDSDIDVCLPGNLEYHAPADPGHFSVSSSLQDGYDESSI
                     SRTSAEESSSYIQEELLNREITLASYVIYGKLTGRALELFHKSIQNRQIRRSAVLYLV
                     SDVHKWWNNLPSSLQQKGESHNNNPEDFEESAADSFDLSPFFSVLYEHLILCINRPYL
                     SLDPSSPDFCSSLQTCIGAARNILSSLRAQPYKGQALFWPGLLSAAYMSGLIIAFACQ
                     LKQYVLSKGCQEIRGCLEILQVMSKQWETAKHCHSALSFLLLNIQRMNLQHQNAPPVS
                     LNFEERGVPAGMSRSKRQKITHAAFDDQTSSSRSTTTTTHYNNHHDDNNLAHSLSLAP
                     SQTPETRVSTNNKPMQSQNTRTPFQSRNFATYNENPESSSTNNNNPSPYSPLLMMMGG
                     TTNSQVEQSLLQWPPGGPTMTTNFDLNMTDLFQGSTWDPSLFDAFTQGQLPSQDDL"
     gene            <1609108..>1610215
                     /locus_tag="TRUGW13939_00536"
                     /db_xref="GeneID:55988049"
     mRNA            join(<1609108..1609277,1609421..1609483,1609537..>1610215)
                     /locus_tag="TRUGW13939_00536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483743.1"
                     /db_xref="GeneID:55988049"
     CDS             join(1609108..1609277,1609421..1609483,1609537..1610215)
                     /locus_tag="TRUGW13939_00536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339636.1"
                     /db_xref="GeneID:55988049"
                     /translation="MRVKDLPNNDIYIHRCFALQIQLTEPQKTWQAQLAEKKSECLAS
                     QLLAIPAGHENKRPTCGQCLEYHRQCAWPEQLKRGPAKGYIEALEGRLYETENVLLKL
                     LSRLSQAQLSSMLSENELETGERNQNQPDTHDSGSLSRQREVEYWKVNPLNSVDNIRR
                     WEQECLDIRNKPDADNNNDAENNTTSTRRPRRTKSTTITSHDGAVGLATNTKSPIGQD
                     YLRDRFQEQQQTGPSRRHSEVGGDSQNNTETPPQLITTASPFDASIAENFGPVHHTKE
                     YTSTARTPQLSAWEEAPSISFQKQFLW"
     gene            complement(<1610369..>1612180)
                     /locus_tag="TRUGW13939_00537"
                     /db_xref="GeneID:55988050"
     mRNA            complement(join(<1610369..1610497,1610564..1610682,
                     1610740..1611094,1611151..1611800,1611874..>1612180))
                     /locus_tag="TRUGW13939_00537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483744.1"
                     /db_xref="GeneID:55988050"
     CDS             complement(join(<1610369..1610497,1610564..1610682,
                     1610740..1611094,1611151..1611800,1611874..1612180))
                     /locus_tag="TRUGW13939_00537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339637.1"
                     /db_xref="GeneID:55988050"
                     /translation="MGSTLPPVKERKPIKDLQKVFHYTDTQTRKPTRDNDPYEYQAGW
                     GNRFQSEVIPGTLPAGQNNPQEVRFGLYTEGITYSAFAAPRHANFSTYMYRVRPAAVH
                     ITNSDGYHNNIGTEAHIENCFLSINPKVESLVEQAEWAPFPLPPASKRIDFVDGLHTL
                     GGSGDPNLREGIALYVFMINADMNNRAFCNLDGDFLLVAQHGSLDIQTELGKLFLQPG
                     EICVVQRGLRFAIRLAPGHTEARGYIAEVWGSIWELPDLGPLGGHGLANPRDFLHPVA
                     YIDDELHGDWTIVNKSNGKYNAIEQDHTPFDLLAWHGNVVPYKYDLTKFASQNATSID
                     HTDPSVNCVLTAKSRDPNTPLADFLWFGPRWDVASNSFRLPYFHRNSATEFLASLYGN
                     GLGRSDDFLPGGGSVEVSHTPHGGFNEGYQYEMRIQENEPRRILENQMTIMLESSRSF
                     LFTEYARGGCGTFRRQGTEPKVWDALPDRFSSYPAIKEILAQAKADKAARKARLDIYY
                     DDEKLAELATFE"
     gene            complement(<1612698..>1618082)
                     /locus_tag="TRUGW13939_00538"
                     /db_xref="GeneID:55988051"
     mRNA            complement(join(<1612698..1613987,1614045..1614352,
                     1614552..1614583,1614642..1615043,1615107..1615744,
                     1615799..1615948,1616292..1616449,1616510..1616647,
                     1616710..1617054,1617117..1617503,1617565..1617759,
                     1617815..>1618082))
                     /locus_tag="TRUGW13939_00538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483745.1"
                     /db_xref="GeneID:55988051"
     CDS             complement(join(1612698..1613987,1614045..1614352,
                     1614552..1614583,1614642..1615043,1615107..1615744,
                     1615799..1615948,1616292..1616449,1616510..1616647,
                     1616710..1617054,1617117..1617503,1617565..1617759,
                     1617815..1618082))
                     /locus_tag="TRUGW13939_00538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339638.1"
                     /db_xref="GeneID:55988051"
                     /translation="MKARTPGPSLFRPLWRRNFSSSASRGAINKIVANAQEAISGLKG
                     SSMILVGGFGFSGVPSTLINAVRDRPELKDFTIVSNNAGMPGVGLGQLLETRQISKMI
                     ASFIGENKVFEKMYLEGDLALELTPQGTIAEKCAAGAAGVPAFYTPAAYGTIVQSGEL
                     PLRYNKDGSVAEKSQPKETREFNGKHFVLEESYFADYAFVRVAKADKLGNCQFRKAQN
                     NFNEAMAKNAKITFVEADEIVEVGQLAPEEIHLQGVYVSKVIKSTEEKKIEKVTFAKD
                     PNDLLKAGSGDATARRERIVKRAAKEFEDGMYVNLGIGMPLVAPAFLPEGIEVVLQSE
                     NGILGLGGYPRPGEEDPDLINPGKETVTLAEGASVFGSHESFGMIRSGRIDLTMLGAL
                     QVSQYGDLANFMLPGKVKGIGGAMDLVANPSKTKVVVTMEHVDKKGNPKILPACTFPL
                     TGPLCVWKIITDLAVFNVHPTEGLTLKEVAEGVTVDEVKSKTAAPFKRTETMLTKVGR
                     EVLRRTPHDVVVLSAVRSPITRAFKGGFKDLWPEEILMPVMQAAVQRATIQPSDVNDV
                     LIGNVLAELGFAKTGRMAMNAAGFPNSTTFHTTNRQCSSSLQAVTHIAHAIMVGQIDV
                     GLGGGVESMTRCYSTRGIPVDVSPTLKNSPVKDARDCILPMGFTSENVAERYGVSRQD
                     QDEYAVESQRRASEAQRAGRFDKEIVPINARYIDEETKQEGTKLVTLDEGIRPGVTVE
                     KMAKLKPAFKENGGSTAGNSSQLSDGASSVILARRTWVEERGLKPIGRFVGTQVAGNA
                     PDEMGISPVFAIPQLFKYTGIEQKDVDIFEINEAFASQTLYILRKLGLDPAQVNPNGG
                     AIALGHPVGATGGRQTATLFAELERQDKELGVVTMCASTGLGVASLFILPKYHLARQV
                     VTSSPSVVSLPSTPYVSLASNVEMASPSLHRLVRGRNFVKPHLSSIRQPLYLQLNSIT
                     LQRYSMKGQTRSMGSVSAIDSAIFRTLFGTDEIRQVFKDESYIRRCVDAETALARAQS
                     KCNVIPSGVGAEVTKRAVASKLDLERLRHETEIVGYPILPLVRQLSDLCGEDAGKYVH
                     WGATTQDIMDLASVLQMKEGLVIVERLLRDVIKTLRDLSGKYRDTPMAGRTHLQHALP
                     VTFGYKCAVWLSGFQRHLERLQQLRDRALLVQFGGAAGSLASLGSGDDGIRVRKALAE
                     ELGLVDPSITWHVARDGIAETINFLALLGGSMGKVALDIIIMSSNELGEVSEPFVPHR
                     GASSTMPQKRNPISSEVILAASKILRSNAGLVLDGMVSDFERASGPWHLEWVAVPESF
                     VLVVGALSQTHFALSGLAVNDKQMLDNLHSTRGLIVAEAVMMGMAPYVGRQTAHDIVY
                     EACRNSIEQGKSLLECLLLKDEVTSKMSREKLESLCDPVNYLGAAPRMVDDVLAVKDL
                     "
     gene            <1618819..>1622878
                     /locus_tag="TRUGW13939_00539"
                     /db_xref="GeneID:55988052"
     mRNA            join(<1618819..1619296,1619354..1619611,1619674..1619800,
                     1619855..1619939,1619992..1620030,1620079..1620844,
                     1621126..1621213,1621277..1621388,1621485..1621516,
                     1621569..1621689,1621752..1622256,1622310..1622603,
                     1622667..>1622878)
                     /locus_tag="TRUGW13939_00539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483746.1"
                     /db_xref="GeneID:55988052"
     CDS             join(1618819..1619296,1619354..1619611,1619674..1619800,
                     1619855..1619939,1619992..1620030,1620079..1620844,
                     1621126..1621213,1621277..1621388,1621485..1621516,
                     1621569..1621689,1621752..1622256,1622310..1622603,
                     1622667..1622878)
                     /locus_tag="TRUGW13939_00539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339639.1"
                     /db_xref="GeneID:55988052"
                     /translation="MASKDIPPTPTLSEKHSGVPERLADKAQHAKSLIFDIATKKQKA
                     RKRPLAIPQGIERPTFLKAIDELSQQLGQENVELADQPLKDGWYMERSFVLGNRCIKE
                     ILIEIDPNTHDAMHVLDEEEFVASAVVYPGSTEEVQTIVAWANKYKIPIFPISIGRNL
                     GYGGAAPRVRGSVVIDLGRRMNTILDINPDDHTCLVEPGVTFYALYEAIQARGYDHLW
                     VDVPDLGGGSVLGNTLDRGVGYTVYGDHWACHSGLEVVLPTGEVIRTGMGAMANSSSW
                     QIFPYGFGPMADGLFSQSNMGIVTKLGMTLMPNPGGYESYLYTFTEEADLAPLVDIIR
                     PLRIGNILENVAQLRHVVQAIALNGKPRSTHFQGQGQITDELARKIARRDLNYGDFTW
                     LYYGMSYGPKHIRQYKLDIIHKEFMKIPGARRIDPASLPKDDYFWSRDRIAAGIPDLE
                     ELRWVNWYPNGGHIAFSPVSPVRGSDATNLWQIARGRAAEFGLDIFPAFCVGLREMHL
                     IVECVFDRDDKSMREKALACMRGMIDDAAAKGYGEYRTHIALMDQIASTYDWNDNALM
                     KFNQRLKDALDPNGILAPVSKASLSFEMSGSIPVLRPLVQCTQKQHASKCTQQKSMSS
                     SSTTSNEKGKLPLAGIRVLDMSRVLAGPYCTQLLGDLGAEVIKVEHPVRGDDTRAWGP
                     PFAEYKDGRDGPGESAYYLSVNRNKKSLGLSFAHPEGVEVLHTLAKDCDVLVENYLPG
                     SLEKYNMDYETIRKINPRLVYASITGYGQTGPYSNRPGFDVMVEAEFGLMHLTGSRNG
                     APVKVGVAVTDLTTGLYACNSIMAALFARINSGEGQHLDVCLSDVQTATLANMAESVL
                     VSGKRDSGRWGTAHPSVVPYQGFKTADGDIFVGGANDRLFGILCSKLGKPEWSTNPKY
                     ITNNERVRNREELEGLIEAETTKRTTQEWLEVFEGSGLPYAAVNDVLDTLNHEHTKAR
                     GMVQDIDHPICGLIKVLSPPVKYSNADPSIRLPPPLLGEHTEEILVEVAGLERKRVQE
                     LRSKGVVA"
     gene            <1623608..>1626555
                     /locus_tag="TRUGW13939_00540"
                     /db_xref="GeneID:55988053"
     mRNA            join(<1623608..1623683,1623739..1623793,1623852..1625166,
                     1625214..1625264,1625319..1625443,1625493..>1626555)
                     /locus_tag="TRUGW13939_00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483747.1"
                     /db_xref="GeneID:55988053"
     CDS             join(1623608..1623683,1623739..1623793,1623852..1625166,
                     1625214..1625264,1625319..1625443,1625493..1626555)
                     /locus_tag="TRUGW13939_00540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339640.1"
                     /db_xref="GeneID:55988053"
                     /translation="MVLKKCTICDRKFKKTEHYKRHERSHTKERPYECSVCHKRFSRS
                     DVLSRHAKGHVQNQNNEVSQATNGTNAAQNATADANLSQPSTLNPDPAPIVMDDQNQL
                     SERRASMATPVQPGDPNDGPMTHLIPNGTDALEDSQLPHIPTPRDMQLAPPGGLSSNL
                     DFLADISVHHNRTEPEMNPMMMGDQQPYFGWGNVSALNPTDQDASQRPMAFDAVPNEM
                     LQLWLEPRADSTSHHSSNDYIRDPAMSFMGDNFLSPGRRNSHSIDPVKYGDNIPNERF
                     ARVERCWFAPSPLVGRLINSLWRDISCFECDNLFAVPTYHSLNSLTDNYPGTRFGLDD
                     ECRLRLQAIFGLTQMPAMLGFGASTADAVSPTASSTSGSIPTFPPAEILDMALDLYFR
                     HFHPLVPFVHMPTFCARTTRTSLLFVMCQIGMSILGTKGSTSFVMKTFPFILEKISGE
                     LSKCAVGSATPASLMSTFAAAFLMLNLAAMTGEKQHLQQSQMVYINLMSVAQRHGLFV
                     AAEGHILDMALFEAVPDLDMRWKAWSRVESAKRLIVGLLSLDSWYSSFLSTSPIIMPD
                     AVQLILPCHDSLFKANSSSRWMQLIRSGKRILMPMIKSPSETVDLPAMDSPVVDDICM
                     HAVLAMIQLRLSESYHRLICNRTTYPFVPCHTYAMDGRARCLTTLQVQVMNAYSSNDY
                     SLERLNPNCLVMWHHMCMTLTADMQIFNLAAGRDGAEAARRALDDIAAWSQTPSARRA
                     CLHAAEIFKILSNRKASDDIMFFSAYALFSAGLVLGLYTFMVVVPQSTTTEVQVGAAS
                     IEVLDDTIDWQQVDCEGFNITGNQPFATAPTDIPAIKFIRNGGTIYIRGVPQQGGYQS
                     ARRIMLDYGGLLKDTGKWSVRKFAYVLHIMSDVLMDVD"
     gene            complement(<1626958..>1628305)
                     /locus_tag="TRUGW13939_00541"
                     /db_xref="GeneID:55988054"
     mRNA            complement(join(<1626958..1627962,1628021..1628146,
                     1628204..>1628305))
                     /locus_tag="TRUGW13939_00541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483748.1"
                     /db_xref="GeneID:55988054"
     CDS             complement(join(1626958..1627962,1628021..1628146,
                     1628204..1628305))
                     /locus_tag="TRUGW13939_00541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339641.1"
                     /db_xref="GeneID:55988054"
                     /translation="MSPRTIKTSLVNHILRSRRTFSTSRVSNADFTHAVIGAGVVGLA
                     IARQLAARQGTSTLLLERHGAAGTETSSRNSEVIHAGIYYPADSLKTRLCIEGKNLLY
                     NLCATQNIPHRRTKKWIVAQTDAEWEVCLKLRQHAQDIGVPTCLVSHEEAARTEPDVQ
                     ALAGVVESPTTGIVDAHSLMTCLQGQFEDRGGDIAFQTAVTRVEPINGGKEGYRIFTS
                     SSPEAVDQEETSITVDTLINSAGLYACHINNMILPPERHKQPFYAKGSYFSYSASKPT
                     SSTLIYPAPVPGHGGLGTHLTLDMGGRIRFGPDVEWVDSPDDYRPSPARLQQALPEIR
                     RYLPSIEADAIASDYCGIRPKLGHASSNTAGKGFQDFVIREEEGYAGFVNLLGIESPG
                     LTSSLAIGEMVEGLLYRN"
     gene            complement(<1628718..>1630970)
                     /locus_tag="TRUGW13939_00542"
                     /db_xref="GeneID:55988055"
     mRNA            complement(join(<1628718..1628759,1628814..1628849,
                     1628901..1629971,1630023..1630367,1630421..1630467,
                     1630523..>1630970))
                     /locus_tag="TRUGW13939_00542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483749.1"
                     /db_xref="GeneID:55988055"
     CDS             complement(join(1628718..1628759,1628814..1628849,
                     1628901..1629971,1630023..1630367,1630421..1630467,
                     1630523..1630970))
                     /locus_tag="TRUGW13939_00542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339642.1"
                     /db_xref="GeneID:55988055"
                     /translation="MWLDRLSGHSTPSGTPPPLNNRQRSPRPPPSQAFRPSLHPRSSS
                     TSLLLTPNDSSTSLPTTARIPSNGPPHKSALARTPPPGTAGPVDVLYGIIGRKTADSL
                     GEPPMEKPTQLVDAIDFGELSLEEFVTRGKDSGGILSSEAGVATIQQFEGDRDKFQEL
                     HNAIVDCDDVLKSVESYLSDFQSELGTVSAEIETLQTRSVQLNAKLENRRNVERLLGP
                     AVEEISISPKTVRVISEGPIDENWVKALNEVEARSASIEKSAGSSVKAVEDVNPLLVA
                     LKHKATVRIRDYLVAQIKAIRSPNMNAQVIQQQHLVKYKDLYSFLSRAHPALSDEITQ
                     AYVNTMRWYYLSNFTRYIQALEKLKIHASDQNNVLGGDPSAQRSSSGGPGGRGVAHDP
                     FSLGRRIEVLRTTSHMAISSYIAEEEKATHGFEVPFRNFNLALVDNVSSEYSFLTKMF
                     SVKSFHHISRTASEIFEPLFTLGSAMTKQLTDNTTDCLGVLLCVRLNQRSAFELQRRK
                     VPVAETYINGINMHLWPRFQKIMDLHCESLKRLSSGAARSSVSALSLTMDEAKQSSAP
                     HFLTQRFGQLLHGILCLSSEAGDDEPVSNSLSRLGTEFDALLAKLGRGSGDTKRRERF
                     LYNNYSLILTIISDTDGKLANEQKAHFNEMLKNVSKRG"
     gene            <1631670..>1632365
                     /locus_tag="TRUGW13939_00543"
                     /db_xref="GeneID:55988056"
     mRNA            join(<1631670..1631687,1631838..1632104,1632174..>1632365)
                     /locus_tag="TRUGW13939_00543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483750.1"
                     /db_xref="GeneID:55988056"
     CDS             join(1631670..1631687,1631838..1632104,1632174..1632365)
                     /locus_tag="TRUGW13939_00543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339643.1"
                     /db_xref="GeneID:55988056"
                     /translation="MADDAQHEHTFDSADAGASATFPMQCSALRKNGHVVIKGRPCKI
                     VDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMDVPNVSRKEFQLLDITDDG
                     FLSLMDDGGNTKDDVKVPDGEVGDRINKLFTDEGKDVSVTVMSAMGEEVAVECKGA"
     gene            <1632974..>1635138
                     /locus_tag="TRUGW13939_00544"
                     /db_xref="GeneID:55988057"
     mRNA            join(<1632974..1633078,1633173..1633263,1633317..1633426,
                     1633483..1633745,1633841..1633946,1634000..1634138,
                     1634201..1634587,1634642..>1635138)
                     /locus_tag="TRUGW13939_00544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483751.1"
                     /db_xref="GeneID:55988057"
     CDS             join(1632974..1633078,1633173..1633263,1633317..1633426,
                     1633483..1633745,1633841..1633946,1634000..1634138,
                     1634201..1634587,1634642..1635138)
                     /locus_tag="TRUGW13939_00544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339644.1"
                     /db_xref="GeneID:55988057"
                     /translation="MEYVKRGPCGQDGCRERRYYLQDGVWFCRRGHQQEGRQVEEDPD
                     DFGRRGTIHRVKRVAEEKIQKTYSGRRGYRLFIQAYQLILWKQCHVLVHEKGFPADLE
                     KVVKDLWALRLQSLVDKFDESLDAADSNGSAEIFSSQASAIDAVEDKSPSSSTARKVT
                     DNPLLEESLGLCYLGTLLLRLPVSIGDIYRFAMREELPFVQAIRLVPLEIRDRLTQVY
                     TRALSVQTALSGERLHETVYQLGMMYSREYNITFPPLNVPLMLFQFVRQLALPLEVYS
                     SVRKLQQILDFSFQFPLDKKTSTRALSFPEAQLLALIVVATKLIFPFSKTKGFPISAT
                     EPAAQVLDWNVWNAAQKHFEKKSKEKGRLAKGQEVTVNDGHVFHLTGQQMDDYLDWYE
                     NTWIDKNRAANPLAPMFPISRMESSSHPAETKPSTKEKEDIEEKIRTVTGGITPAETV
                     PPKHSEGSEGKQNGNSDDEEEEENDDTTPRPGYSYRVYKQESDMPKTARKFYETAANL
                     SGLSLKTLMAAVNRSELKLEKWQEDTRRAEYHGERNVEYTAFRDIEEGDEWGTDSEE"
     gene            complement(1636751..>1639640)
                     /locus_tag="TRUGW13939_00545"
                     /db_xref="GeneID:55988058"
     mRNA            complement(join(1636751..1637667,1637724..1637775,
                     1637836..1637900,1638399..1639205,1639259..1639387,
                     1639439..>1639640))
                     /locus_tag="TRUGW13939_00545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483752.1"
                     /db_xref="GeneID:55988058"
     CDS             complement(join(1636793..1637667,1637724..1637775,
                     1637836..1637900,1638399..1639205,1639259..1639387,
                     1639439..1639640))
                     /locus_tag="TRUGW13939_00545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339645.1"
                     /db_xref="GeneID:55988058"
                     /translation="MDETVEDLSTDRDAKQAFDAETREKSRAVDEKREAIERACQQKD
                     VKALVGYATSPGGLLDDTLRQAAWPLLLGEDQSKEVSQIDWTDLPRHGDEDQVKLDVN
                     RSFVYYPQGEEEDLAKRKQQLSNLITETLRRHPMLCYFQGYHDIAQVLLLVLGPHTAR
                     NTFARVSLLRIRDYMLPSLTPALKHLNLIPVILESVDVRVRRHLSGTQPFFALAAALT
                     LYAHDIEEYDDIVRLYDFLLSHEPVVAIYLFAAIVLKRKKELLDIPIDEPEMIHFTLS
                     KLPAPLDLEGLIVSTLDLYEQHPPESLPFRTWRQIPYNSVLKTSRTVGEAVSFDEATQ
                     LFELQAKQLQREESRKKIYAALWRYRRPAGSLGLALLVGLVSIYIHVDAEVRLSLLLL
                     SNTSAIHYRGDLGHTDLQEDLEFHPSNFENDARTAKIQADSQPFLGGNGGGGGGSSRD
                     AGGRSGDGKHRLWTIQYYSQFFDVDTNEVLRRCVAAVYPRSNFLDILDGNPDLYGPFW
                     IATTVIIILFLTGTISQYLSREHDKHFEYDFRLLSGAAGLVYGYTGVIPIALWAALRW
                     FGSSTADLVECWALYGYANLMWIAVALVSWSPLTALNWALVGVGFASTVFFLLRNLYP
                     VLTATDAKTSKMLLIAVVVLHAGLAIAIKVLFFAYDFFIISLLLSSFANTFSSHGSPV
                     SKKNHDDDDDKHDDDDDKDDDKRRLLF"
     gene            <1640518..>1644655
                     /locus_tag="TRUGW13939_00546"
                     /db_xref="GeneID:55988059"
     mRNA            join(<1640518..1641086,1641142..1641256,1641319..1642894,
                     1642947..1643119,1643171..>1644655)
                     /locus_tag="TRUGW13939_00546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483753.1"
                     /db_xref="GeneID:55988059"
     CDS             join(1640518..1641086,1641142..1641256,1641319..1642894,
                     1642947..1643119,1643171..1644655)
                     /locus_tag="TRUGW13939_00546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339646.1"
                     /db_xref="GeneID:55988059"
                     /translation="MESGFWPTQHTEIADALFRNVQSTQEPTTTGPKKPKIALLTQTI
                     VPSPTIQFVLPARLRSRLQNDVVFVGERSLVLREIVMGSYLEDVSVKSDFDADIMAVK
                     AVSLYGDMPLDVQMRLGIQEDSSGPAYTNEDLPDHILVLTLDSKELVFLYYRDDFEKQ
                     NGRFTHFRRPLPSDVSIVERFGRHLAVDPKSRAIAVAAPANFFGVFLLKSPGDLLSQI
                     KEQTLDPIFEERFFRLDGDILFMEFLYPEADNENKIILLFVISKGSDTFAVCYDWDSA
                     DTLRQARPKVILKKLPEVCRLPSLIIPLTKSTSFLIVTTSLLIVANHFTSSDMKFKKW
                     PTPETDSSLPMTWAKWARPYRHQKYNNSHDDIYLCREDGAIFYVNIEDYGLTILVYAL
                     GSLGCDVDGAFDTIDFSDPSHGGDLLIAAGNTGNGGLFITEPRQNPTRVQKFENWAPI
                     LDTALVPPSQQPAQHEHSMKTHVNGNGRLYACSSCANGRGAVNEFRYGYEAQIGWIVS
                     LEDLSSARSIWCIPDFSDEGTYLLISDPITSTLLHLPRSNGGEIYAIDDLNSALDTSA
                     QTLAAGYTPDGVLVQVTSNSVCLAVPENPSLKHVSGFQIDQAMLISSVNGKLALFAVV
                     LGSDHGIALKIGKITLLDGCLSSNYLGDILDLNEVPTSLLVEEINNDIFIFIGSGEGH
                     IDCYQLLNSETHFIGRYALELNDNDLLKVIDSMVLLTWPGTHHATLFCGLRSGILVPI
                     DVQFTVDSPEKTMDTTQHPYIRLGHTVVKLSRKDKGVLATCGSGFWCISDIEKTDASN
                     FDLNEVWITDQDNSAYVQKSIEVFTVVDAPLNSSSTALDGSLVCISEGQLLICTLDRR
                     AKPIPRKIDVPGCANRIAYSQYLQSLIVAYTATETVKIPGTGNSNRYTRPYLDFIDLE
                     THRSGLSSSREGSQDNSAPQPWRPSGSSGEKITCMLDWTPEHDGHKYHFVVIGTARRS
                     QEDKGRIIFLHARRSTVNPGQIECSVKYIHPFDGPVRAVAAYGECTLMVAAGNDIIPI
                     EPDIPKRKKQWVPSARYKLTSPGVSITVHDTFLYVSTARESLVVLQVVENKLELYAHD
                     GARYESLSHQRIGGESKLVLASTRGGKLSLFSETGITNTDKLLTPAVAEANMPLSVIR
                     LSPCTTAHPLLPTTTVTHGVTVDGTIYQIMTINEKEWQLLRFVQNLCSRDSLVSPFLS
                     ARKKRWTWTDIMPQSNKPSQMHVDGDILSRLVKHGADRLREMLDGDETRSLQADASAA
                     LPLRTCMEVFEDMFREVFGDIPSHHNTISHFMSWLQKLLRRRI"
     gene            complement(<1645018..>1648055)
                     /locus_tag="TRUGW13939_00547"
                     /db_xref="GeneID:55988060"
     mRNA            complement(join(<1645018..1645054,1645108..1647158,
                     1647206..1647469,1647517..1647622,1647673..1647719,
                     1647784..1647835,1647902..1647920,1647983..>1648055))
                     /locus_tag="TRUGW13939_00547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483754.1"
                     /db_xref="GeneID:55988060"
     CDS             complement(join(1645018..1645054,1645108..1647158,
                     1647206..1647469,1647517..1647622,1647673..1647719,
                     1647784..1647835,1647902..1647920,1647983..1648055))
                     /locus_tag="TRUGW13939_00547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339647.1"
                     /db_xref="GeneID:55988060"
                     /translation="MEDIRLPEETAEDRVRAATEFLDPTDARARSYRADIVLMLNRGL
                     RRLIVSIDEIRAHNRELADGLLTLPFEYSEAFNKALKAVVKTLPHRPAKETGEDVAYY
                     CAYVGAFGENACNPRTLGSSHLNHMVSLEGIVTKCSLVRPKVIQSVHFSEKQNKFFSR
                     KYRDQTMTASGATSSNVYPQEDDEKNPLTTEYGYCTYMDHQTISIQEMPERAPAGQLP
                     RGVDVILDDDLVDRAKPGDRIQLVGIFRSLGNRGAGSGSSTFRTVILANNIIQLSSKS
                     GGGIAQTTLTDTDIRNINKWAKSRKTKIFDMLAQSLAPSIYGHEYIKRAILLMLLGGM
                     EKNLDNGTHLRGDINILMVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGLTAAVT
                     SDKETGERRLEAGAMVLGDRGVVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTS
                     LNARCSVIAAANPIYGQYDPHKDPHKNIALPDSLLSRFDLLFIVTDDPEEKSDRLVSE
                     HVLRRHRYRQPGTEEGVPVREQANQTLGVGLEESQDDNRPTEPLEKYNIMLHAGINPT
                     SKDGNVEIFSLAFIKKYIQYAKSRIKPILTKGAADHIVATYSALRNDDLSGNQRKTSP
                     LTARTLETLIRLSTAHAKARLSSRVEEKDAKEAEIILRFALFKEVVEDGRRKRRKTTF
                     DDSDEEDNSDEDSDDDSDETPSRAQSGATPRAAARAGLRSTGTANNRSSDSRAISQGS
                     EGLYDASPRGQRLQSSRSTRNQTQTESQMSVASSQPASQLVESQTDESQNQSSQASSG
                     APIQPNRLNTFRQTLGPLMSRVFVNDDSADVEALIGTVNTAIRANQALGERHVFQRPE
                     AIQALKVMNERNELMYLEDDETVYRI"
     gene            complement(<1648561..>1652304)
                     /locus_tag="TRUGW13939_00548"
                     /db_xref="GeneID:55988061"
     mRNA            complement(<1648561..>1652304)
                     /locus_tag="TRUGW13939_00548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483755.1"
                     /db_xref="GeneID:55988061"
     CDS             complement(1648561..1652304)
                     /locus_tag="TRUGW13939_00548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339648.1"
                     /db_xref="GeneID:55988061"
                     /translation="MLERAAGCLETAGQGLLRTCNGILRSQKSLDSTFWKQRTYDSSW
                     QSLSRQIDKVQHGQSTRECTSSHHHAHEPFLDFLYPDKCLLPMETQHSTERKKTADYG
                     HRRVTSTVSRPRSSRTLHLFSPRRDAVIGIDVPQFSRGAHTAIPPAQGHSRRQNVLDT
                     LLDETQQQDNDGVWEMWRNSNKEPELRSRLMDHLARSQRFIDVERAISLLEEVDPDKR
                     TADDYSSVIVSLFSAGHTSTVYQLCETALTQQTKVDAFAIVFKISITEKRWQDTLGFW
                     RKGHDKFDYKSFGSLASLQDFPQCVLSLLEYMKTINDLDAKLLDVLLTTVFQSKDAMG
                     DIKLETLLSLTREFSDLGIITQQHYELGIKTLIKVKTRSSFVTAMVLYRNFRWHLSTC
                     VPPTSILHGLLETLVELGNHRGVQYLLNDFTHFHRKPSVEAYKIALTVFSRRGDSDKA
                     KELFGDLLRDHGAPSLHDPDYPRLPRHIKWVVPIIHSYALVGDYPRAIEEFNKIIPIY
                     RLNPNTVAWNALISAPANANYLKKAFRIFRRMQVKGVKPNQYTYAILMNLCARLGNVK
                     AVLALSEMAQENNIELTTYLLYPVVDAYCRSQFLDEAEQMAESSMSLELSGSRTILWD
                     RLLWAHAFRADMDSVSRIHKRMKEARLQFTENTYAAMMLSFCIVGRPDSARRLLRGLQ
                     RSRKIHASEFLYTIVLYGFVKQGNRDMVYIIYKEMLARFENPGMSTRLLMLRHTIGRD
                     TLKDVATGDPSNSRLAMSEDYLFRAVFDFEKTDFAKKSPRPGTSSLPMSQAFPSLYYE
                     PVLKAYSMEGLHGRNERLLAEYRLDVEAAKASGKPTVTPSLRFLSVLMQVYLLAGKLE
                     TVGEFWKMAKQRALDVSRGVNIESLAINKRQPALATDSTAGPDKQQQSSLPDSAMVLD
                     STTAPVEYATPRGPFYLDREVVPAQAYILSRHLSLYMRTLGENGQTDQLPELVKTHIR
                     RGYSLTSANWLTYVRTLAASPLASEQIDAFVTFERIFMPAFPGWRRLRRGAQLRPPDV
                     PRTIDMLDSRRTNDPETLEKAGARLWTKVDPTWTRPTYNVMIYLGAALRDFKRRSLYV
                     GTEEMDTLYNAAPQTLEALAYMPHWREKYQGVLLRDQPERIDPAKKAGNPYVWTGGIL
                     GVDGHVRPKLRGGAEHARYELSELEATLPSPQSDQADAQEPPQSEDVSEAKDYDPAEI
                     DDRERVQAPEDEHDMELETTIELQRRNLGVDSVRNEMLRDQKK"
     gene            <1652720..>1654658
                     /locus_tag="TRUGW13939_00549"
                     /db_xref="GeneID:55988062"
     mRNA            join(<1652720..1652910,1652971..1654089,1654151..>1654658)
                     /locus_tag="TRUGW13939_00549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483756.1"
                     /db_xref="GeneID:55988062"
     CDS             join(1652720..1652910,1652971..1654089,1654151..1654658)
                     /locus_tag="TRUGW13939_00549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339649.1"
                     /db_xref="GeneID:55988062"
                     /translation="MDITTLFFSRREESLLSGDYNSYRVQTTRRLHTVRKKLGRTTPK
                     GRKYTAHAPISPEDVASNPEFAHLLILSAERGWAQAMHMKATHSADPSAKGVVGPTRR
                     HIITRLNKASKHAERLVSLLHEQSLSQASDIDLLEAHAYLALLLGTLFTEKQRWEECL
                     RHFSVARIIYTALGQNAKKEAFRDLVSVTIDPSLRYAAYQLRLPRSKPLPSLAIEHFP
                     HDAEIRAELEKVDPNCLTEDVAGTTKLATGEVQQLPESISWRSRSVPIEDASIAQALA
                     AATAAETKLSSFLSERPSASNKEKSAAYDAVILASQEAVDATKTAIDDLSNEGVEQGD
                     RRMQALQVIRTVVNHSLVGWRVGRNRVLTGDSDGLSLEAEDGKRQSSKRSNNGKFVSQ
                     LRERVALYDSTLQSLEFVRDLPGVAGDSEFVEELETKRSYFRSLRCLAIGRSHSLQGN
                     VENGLALFSRATELAKALLAKQKGAATPPEGPTKLEISAGQIQALLVTSEGLVAQHRG
                     LASLNKLAEKKSDSAGFQAPLIHRMDEYAAHDLDLTNLVSFPPKMQPIPTKPLFLDVA
                     WNYIQYPQEGKQQGQEQAAEGQGAKEEAGGRRGWFGFGR"
     gene            <1655324..>1657116
                     /locus_tag="TRUGW13939_00550"
                     /db_xref="GeneID:55988063"
     mRNA            join(<1655324..1655483,1655569..1655719,1655774..1657022,
                     1657081..>1657116)
                     /locus_tag="TRUGW13939_00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483757.1"
                     /db_xref="GeneID:55988063"
     CDS             join(1655324..1655483,1655569..1655719,1655774..1657022,
                     1657081..1657116)
                     /locus_tag="TRUGW13939_00550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339650.1"
                     /db_xref="GeneID:55988063"
                     /translation="MVDFNGSFASPLADASVVAQLANPTELVSSFLNGLTVWTAILYL
                     AIAAVFYDQVKYIYLKGSIVGPSMKIPFMGPFLQSVNPKFHEYKAKWNSGDLSCVSVF
                     HKFVVIASSRDLSRKIFNSPSYVKPCVVDAAHKLLGPTNWVFLDGKAHVEFRKGLNGL
                     FTRHALSLYLPGQDEVYDKYFKHWLEVSTKNENKPVPFMGEFREFMCAISCKTFVGEY
                     MSDAAVKKIADDYYLITAALELVNFPIIIPFTKTWYGKKAADMVLEEFSKCTAKSKAR
                     MAAGGEINCIMDGWVKAQLDSAAYREKIAKGISVDDSEKPAQLLREFTDYEVAQTVFT
                     FLFASQDATSAACTWLFQLMADRPDILDKVRDENFKLRNGDRDAPLSMDMLENMHYTR
                     AVVKETLRYRPPVIMVPYIAKKDFPITESYTVPKGSMIIPSVYPSTHDPEAYEDPETF
                     NPDRWISGDAEKQSKNWLVFGTGPHYCLGQTYATHNLMGLVGKASMHLNWEHFPTPES
                     EEIKVFATIFPKDDCHLAFTARD"
     gene            <1657717..>1658459
                     /locus_tag="TRUGW13939_00551"
                     /db_xref="GeneID:55988064"
     mRNA            join(<1657717..1657995,1658073..>1658459)
                     /locus_tag="TRUGW13939_00551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483758.1"
                     /db_xref="GeneID:55988064"
     CDS             join(1657717..1657995,1658073..1658459)
                     /locus_tag="TRUGW13939_00551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339651.1"
                     /db_xref="GeneID:55988064"
                     /translation="MSAIQSSVASLARRGASSSLRTASRHSIVSSSSSSSRSRLLCTA
                     VSPAAGLNAANSITKSLNNNNYKLWNSPLRQYRNYSSQDDQLKQIGFEDINTRVTADP
                     SSSASNLILIDVREPAELSSTGIIPGAVSVPLASQPDAYFLSPDEFETRFGFPKPGSE
                     QGIISKKKEIVFYCKAGVRARAAAQLAVQSGYDAASVRVYDGSWLDWMDKGGKVDKWE
                     GNE"
     gene            complement(<1658728..>1662034)
                     /locus_tag="TRUGW13939_00552"
                     /db_xref="GeneID:55988065"
     mRNA            complement(join(<1658728..1658971,1659037..1661501,
                     1661567..>1662034))
                     /locus_tag="TRUGW13939_00552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483759.1"
                     /db_xref="GeneID:55988065"
     CDS             complement(join(1658728..1658971,1659037..1661501,
                     1661567..1662034))
                     /locus_tag="TRUGW13939_00552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339652.1"
                     /db_xref="GeneID:55988065"
                     /translation="MAPKKKGSKKQQEEDWEAELGEAAPAGEETQDPANGDAEANGDG
                     EEVGGGGLLAALKKNRSKKAKKGKNVDNDWVEGEDPTQADANGDAAVDLASKAPQEGS
                     FEDEDDVFSGKPKKPASKAQPKKEEEEEDGGKLKSKKEKEKEKKEREKQRKKEQAAKK
                     KSTTPAAPAKPEPAKPIPEVETAPTPEPAQKAEPAGKKKKLPPHLAALQKQQEALRLE
                     RENEEKRLAEEQAAEAERLRELEEEEKKKEEARQRKKEKEKEKKEQLRKEGKLLTKAQ
                     KELKERNELSMKRMLEAGVGHVAGLDGKAEPSEKKKTVAVNRKKKGIKKDEVDLEAAA
                     ARAQARREAEDDKRRKEEEAKAKEEAKATAAAKGEESELEDWEAAAAADDDVKDSWDA
                     DSDKETKDTKTEAAEAAEESESESDSEDESSSEDEEATATQRAIAQRKAEAAERRKKQ
                     HEEALAARSKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFP
                     VDALKQKTSVVNKDGSFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHG
                     LEPQTLESMRLLRDRKTPFIVALNKIDRLYGWKKIDNNGFRESLEMQSKGVINEFRTR
                     LEQTKLAFAEQGFNSELYYENKSLARNVSLVPTSAHTGEGIPDMLKLLTSLTQERMTN
                     ALMYLSEIECTVLEVKVIEGLGTTIDVVLSNGILREGDRVVLCGLNGPISTNIRALLT
                     PAPLKELRLKSQYVHNKEVKAALGVKIAANDLEHAIAGSRLLVVGPDDDEEDLEEEVM
                     SDLENLLSKVAKDQRGVTVQASTLGSLEALLEFLRASKIPVSNISIGPVFKRDVMLAG
                     TMLEKNLKEYAVMLCFDVKVDKEAQAYADEVGVKIFTADIIYHLFDDFTKHMAELTEQ
                     RKEESKLHAVFPAVLKTVAVFNKKDPIVIGVDVIEGSLKLLTPIAAVKQNPTTGQKEI
                     IQLGRVSSIERDHKALQVCKRGQPSVAVKIEGANQPLYGRQLEESDTLYSEISRRSID
                     TLKEFYRPDVTMEEWGLIKKLKPLFDIP"
     gene            complement(<1663011..>1664327)
                     /locus_tag="TRUGW13939_00553"
                     /db_xref="GeneID:55988066"
     mRNA            complement(<1663011..>1664327)
                     /locus_tag="TRUGW13939_00553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483760.1"
                     /db_xref="GeneID:55988066"
     CDS             complement(1663011..1664327)
                     /locus_tag="TRUGW13939_00553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339653.1"
                     /db_xref="GeneID:55988066"
                     /translation="MASAPLDQLVKGAPGTNAPPSFSDSPAPLPKSYLQGNASDSRPS
                     TPDPLSTLPSSPPQIYLNLLILESSLRAQYLALRERRRQNTFFLMLLAFWVAYFFYAL
                     FMRPREDGSGVGGSVYWMVETAEKVAFMGGIVTGILVWGTGQWERGMRWPRRWFAVAN
                     RGLRGMNTKIVLIRGPWWKEGLAFFSFIFPYSSLFQSPGNFQYVELHPSEKKTTRHTQ
                     FVHDEESESGIVEEDLAPGGDFVRLLLLPKAFSPEFRENWDEYRTEYWERENERRAQL
                     RRKVRDRERHRARQEGDWLWWLPIRRSRSRRIKLVDSHSHSHSHTHQHHQHHHQPSSG
                     GGKPQEGRTRRNTRSNSLSQHSRGLSRSSTPEGGTTNATESPQSHRRKKGSKSSTSRS
                     LSPLTATPVSKRDSMISVSSTASDDSFSSGLRERRVTPEMPTAAEA"
     gene            <1665022..>1666683
                     /locus_tag="TRUGW13939_00554"
                     /db_xref="GeneID:55988067"
     mRNA            join(<1665022..1665138,1665193..>1666683)
                     /locus_tag="TRUGW13939_00554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483761.1"
                     /db_xref="GeneID:55988067"
     CDS             join(1665022..1665138,1665193..1666683)
                     /locus_tag="TRUGW13939_00554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339654.1"
                     /db_xref="GeneID:55988067"
                     /translation="MSSADTVSPSGSEAAQAQVSAPGSSAWFPLGMKDGFSQWWCKVP
                     AAAAEHKVLSFIPYLQQAPTQRQTGNTASLPDASTGAVDSLQAPDLSQQGEETVNSDN
                     DPYGPRRWRSRMVELSGRGRALNEFSVERVGEQADQNLVILHGYGAGLGFFYKNFEPL
                     SRAKGWHLYALDLLGMGRSTRPSFKIKAKDRQEAISEAEDWFIDALEEWRVKQKIDRL
                     TLMGHSMGGYMAVAYALKYPGRLNKLILVSPVGIPEDPYAVNESMPEPSDSTLANEFT
                     QDQEEITNPGRNVNGSKPVVNAGAVKTQPDPAPRRTLPKIVSYLWDSNVSPFSIIRWA
                     GPMGPRLVSGWTSRRFSHLPAPEAAALHDYSYSIFRLRGSGEYALTYILAPGAFARSP
                     LIRRIQGVGRQVIRPNSAEALQPTPELSPSILGPAAAASSAASTSATSLPRRENGIPV
                     VLMYGDHDWMDVAGGFAAKEKIEEQKRQALADASPEQRKADNGSAKVVVVKNAGHHLY
                     LDGYEEFNQIILKEMADVQQREARKEV"
     gene            complement(<1667287..>1669628)
                     /locus_tag="TRUGW13939_00555"
                     /db_xref="GeneID:55988068"
     mRNA            complement(join(<1667287..1667961,1668028..1668404,
                     1668647..1669481,1669584..>1669628))
                     /locus_tag="TRUGW13939_00555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483762.1"
                     /db_xref="GeneID:55988068"
     CDS             complement(join(1667287..1667961,1668028..1668404,
                     1668647..1669481,1669584..1669628))
                     /locus_tag="TRUGW13939_00555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339655.1"
                     /db_xref="GeneID:55988068"
                     /translation="MDQITITTTTTLQNEPWTSVIGGLLLPNDPDQVSAKAILKQKID
                     DTIQLHIQPEGKMIYDDQGLSFSKRLDNLERTTGNQQGQIASLQDRDTKRQDQIASLQ
                     DRDTKQQDQIATLQNELTPLQNQMGIIRFSEFLKYLPSEKRVDSYERNKLVHGGDVSF
                     DLRFLESVDEMFLQRHGLRHGDLETAFSKRYSRSHQYFRSRDLSEAMEQVVNLRCSRE
                     HLKFWKNLGDLPKEYDDKRNRLQGACDRTMRLWFKPNDQSYSIDDANASWDHLYDQYE
                     TLRKAIVAEREEMMNSIRMMLLSTAIHTLFVLPALLLVSIPLALSASITMLLAFAALY
                     LRAFIIYIELAGALLINFFLFPAHSPTTGSFLAFSEVNTPAGSPSKSRSHHPHHHHHF
                     NPTHDAKSWGEKYSASKEVDYFHSHHSYHGPPLTPSREPFFNFISGDAERDFEGVGGW
                     RTPLQSRKRDPNSSSPPGSYSASEEGLLDDEQAWLSLNKRLELPSRQLSFVPPSALPP
                     LQQQQQQKTATDTSGPKRPRYHKRSITTSPVTVQGSSSLSGLPPFSEEEQSKNNNTRL
                     QTSKSSAGLESLLLQPPSSKRPHSPLLSSFDYQPFLMTTSGSGDEWKMAHYPSFVRRR
                     SSASSSSQTNRSLTGLGLS"
     gene            complement(<1669920..>1671050)
                     /locus_tag="TRUGW13939_00556"
                     /db_xref="GeneID:55988069"
     mRNA            complement(<1669920..>1671050)
                     /locus_tag="TRUGW13939_00556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483763.1"
                     /db_xref="GeneID:55988069"
     CDS             complement(1669920..1671050)
                     /locus_tag="TRUGW13939_00556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339656.1"
                     /db_xref="GeneID:55988069"
                     /translation="MAGHQPRFPWELGVFDAHCHPTDTMASIAHISLMRATALTVMAT
                     RGEDQDLVEEIAARFAEREKVIPCFGWHPWFAHQIAQDGMKTTTKAEHYRQVLTGTSE
                     EDQQFFQTLPDPKPLRALLAETRTRLLAHPHALVGEIGLDKAFRLPMPWQQHEVESRD
                     VGLTPGSREGRKLSPYRVSMDHQRAVLKAQLQLAGELRRAVSVHSVQAHGAVFDVLQS
                     LWQGHERKQESQRERKQRKLEETYQDSSDNSSSQLRDKPSSSQEDNEPLPYPPRVCMH
                     SYSGPPDQLKQYLRPSVPTQVYFSFSAVINFANPSVEKVAAVLKALPDDRILVESDLH
                     CAGPEIDQLLEDVIRTICRLRGWSLEDGVKRLAENWRRFVFG"
     gene            <1671628..>1672158
                     /locus_tag="TRUGW13939_00557"
                     /db_xref="GeneID:55988070"
     mRNA            <1671628..>1672158
                     /locus_tag="TRUGW13939_00557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483764.1"
                     /db_xref="GeneID:55988070"
     CDS             1671628..1672158
                     /locus_tag="TRUGW13939_00557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339657.1"
                     /db_xref="GeneID:55988070"
                     /translation="MAIISGTPSPRQPILNQDSAKTILQQHLKDTTRSDIVKIANNGQ
                     GLIFVDIMNKQCDGLENRLAAEENRLTAEKNRLAAEENRLAAEKSMLQNDDTNLQDQI
                     VNLQDQIADLKNKLDDQTTNLRNKATCLRNEITTLWNETNLQNEMSNKATSLQNEIRN
                     EITSLQNETTYLRIEQ"
     gene            <1673320..>1674015
                     /locus_tag="TRUGW13939_00558"
                     /db_xref="GeneID:55988071"
     mRNA            <1673320..>1674015
                     /locus_tag="TRUGW13939_00558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483765.1"
                     /db_xref="GeneID:55988071"
     CDS             1673320..1674015
                     /locus_tag="TRUGW13939_00558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339658.1"
                     /db_xref="GeneID:55988071"
                     /translation="MSIRIAIQRELDSPIPLEIRPETRMAGNQEGLGLIDAKDLQLRS
                     IQQHMDNVHAPELLKYLPSGIKRPDTYKRNELVHAGNVIFDLDFLRRVDSVFLVENKV
                     QRHDLLAAFRNRYGDDPEAFQGYLPAEVERIINLKSSLTHLWTWKDLKRPGDNEHISK
                     RDALINMCDTAIRRWFQRTTHPYSMDEVASTFADIRNRYDIERECIEKESKSLGKFQR
                     LRNKVRGLKRFKK"
     gene            <1675284..>1675898
                     /locus_tag="TRUGW13939_00559"
                     /db_xref="GeneID:55988072"
     mRNA            <1675284..>1675898
                     /locus_tag="TRUGW13939_00559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483766.1"
                     /db_xref="GeneID:55988072"
     CDS             1675284..1675898
                     /locus_tag="TRUGW13939_00559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339659.1"
                     /db_xref="GeneID:55988072"
                     /translation="MAEKYQGQPPLETVHKLLDELANLDKLCITWGHAIEEIEDQYGQ
                     KIRVAGVNLDLLFLNIVLVKYQGHAVALGGVYDDLPAFCAQYGVDPGSLQGDALKVIE
                     GLTNMKSYLVNFYDACDRMDKQSDTTEQRDILRDQCSNVISRWLDQKPPCSIEEVQAT
                     LIDLLKQHARDVPLIDVQEVQEVPATKKRWTWKQIMDRTRFSKK"
     gene            complement(<1676105..>1679158)
                     /locus_tag="TRUGW13939_00560"
                     /db_xref="GeneID:55988073"
     mRNA            complement(join(<1676105..1676335,1676388..1677510,
                     1677576..1677659,1677719..1677849,1677903..1677978,
                     1678037..1678099,1678149..1678168,1678294..1678777,
                     1678875..>1679158))
                     /locus_tag="TRUGW13939_00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483767.1"
                     /db_xref="GeneID:55988073"
     CDS             complement(join(1676105..1676335,1676388..1677510,
                     1677576..1677659,1677719..1677849,1677903..1677978,
                     1678037..1678099,1678149..1678168,1678294..1678777,
                     1678875..1679158))
                     /locus_tag="TRUGW13939_00560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339660.1"
                     /db_xref="GeneID:55988073"
                     /translation="MDTVSSPESLRYLYQIVVAEIADISKRDDINILHSRLDGILLKL
                     KLSAIDINDDNDQVLDNNARFSNKTAEATRRYLLDIRGVLRTIDEAALPTNAEELGLL
                     FDQLEKAVDSLQVHAEQQLRSLHPQPINKREYEDVDANLDPTITKFEPPVGYYSSSSA
                     AKNSSASPPQHHVNTNHFIDGVDRTGNYSTGTSMPDHGSEWAHVYEASYSADLAFNQP
                     PAGGGEHSAGTSASPRSKKRKRNKPTLSCKECVDKKIKCDRGRPHCLSCIRRGTDCIY
                     RLKAEMSEENVRQSTTRRIYPPKSKGHQSATDQGASPASSSGAKPALFTHQEGTDLLL
                     SHAPYTSINSSNIFGIGAEYPFSNYWTQNGGVAEVLRMFPKKQQSDILLSVFFEAVDP
                     VYPLLNRENFYVDYEAFWELDEKRKTEVDIDFLALVFIMLAMGTQFLYNPGSQQPLQG
                     AAEFYSSACHQSLRLFSYLNRASLRVIQSMVLMTYFLLNSGRASDGWAFSGTMIRQAY
                     ATGLNREPTLISSTFTLFERAERRRLWHAVVCQDSFMSMSLRLPPATTHSDIDSAAPL
                     LENDDSIYSVETTPESGGEDLFNGPRVSDPGYVQSMYSLALLAQETIATPRSLSLPLV
                     TNPRQRNALLARFRACYRTFPDEFRAWDEDSIKRLAEQGNKRLVRQITFLTGLYWHCM
                     TLVQSEALDEMSNLQQQQEDSKPANVSSSLDSSIRGTLDCAYESMRAFFATHDVLGEE
                     GSVWWAFGHRAFSVSAKKIILADVLKKYGPPAGSSPPPKSKTTNSRRTTALDPLWERA
                     RGDVQRMLQLLQGPAGAGDEAARTRIEVLSSYL"
     gene            complement(<1679798..>1682370)
                     /locus_tag="TRUGW13939_00561"
                     /db_xref="GeneID:55988074"
     mRNA            complement(join(<1679798..1680977,1681028..1682219,
                     1682307..>1682370))
                     /locus_tag="TRUGW13939_00561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483768.1"
                     /db_xref="GeneID:55988074"
     CDS             complement(join(1679798..1680977,1681028..1682219,
                     1682307..1682370))
                     /locus_tag="TRUGW13939_00561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339661.1"
                     /db_xref="GeneID:55988074"
                     /translation="MASAATESRSPSGSGVTKKKLSAACVHCHRRKVRCDARAVGFPC
                     SNCRSAGKTDCRIHEKKKRPIVRSALNPVPIRCAPSLLADPPASSPSQQHQHQQQTPR
                     HNHKQQQQTPAADAISQPLPPRSSYPPQQQPLNNGVEFKPTPKDRLQSEESSHRNQTP
                     QPTSQSVTGREDRREMENRLVTLIDEQDSDRREIQRGVRAIYVGHDVSNMSFLLRQQR
                     GDEASYHFAGNEIPRRRIEIGHDQLMQDALTLPEQSLADELVDAYFTHVNPLYPIVDE
                     EQFMAQYRNRDPADPPPILILQAILLVGAHVSRQKQEREELKNVFFRRCKWLFDSRIE
                     RNRDILVQTALLLTWHSDAIDDDVSANAHYWVGVAARIATGLGMHRNPVSNKFAASDR
                     RMWRRVWWILVQYDVLISLSYGRPQAINLEDCDVQSLTPADFIGCGSRVQVDFVMHFA
                     ELCSMISYILRERFGLRVDAERRKAILPKADEALANWSLGLPDSLRLRSSDIDASSAM
                     LHLTYNNFLILLHRPHPKASAYSEDYGPHDAEICSAAAGVITSIIEELRQQNGIRYLW
                     CSGVFTVFTAMIQVRVELRFSNPVLAINALRRFDSTLHSLRELADYWSSAETILRLFE
                     NSKRLQQDLRVVHNEVTEKFEEPRKQTEPRQQTTSTTTAATNNVSRAEIPPPPPPPPP
                     PPPPSMNSQSIISAAGHQQPLNSMSATASSANLARPGSNDVWPSEPPPASRLDSDTFA
                     RANDISNVQQVVAGMEPPREYLDWRQLFPFTDPANPGPMSIEAFPDMEDEWRQLYWEP
                     QMTDLFQEGIWLQ"
     gene            complement(<1683354..>1684311)
                     /locus_tag="TRUGW13939_00562"
                     /db_xref="GeneID:55988075"
     mRNA            complement(join(<1683354..1683602,1683662..1683789,
                     1683839..1683949,1684152..>1684311))
                     /locus_tag="TRUGW13939_00562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483769.1"
                     /db_xref="GeneID:55988075"
     CDS             complement(join(1683354..1683602,1683662..1683789,
                     1683839..1683949,1684152..1684311))
                     /locus_tag="TRUGW13939_00562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339662.1"
                     /db_xref="GeneID:55988075"
                     /translation="MSSASPPKEPEVEHENQSGDDPESMDRDNQDPSGQGQGEFEVKE
                     QDRWLPIANVARIMKTALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKT
                     VNGEDILYAMTSLGFENYAEALKIYLAKYRETQSARGENQNRPSSSGYGSASAVGGGA
                     AGAPAARGANAPAGFPGAPENVLSANLDPSEQEGQNYGYGSIVGQAHNGAGGEFH"
     gene            complement(<1686265..>1686793)
                     /locus_tag="TRUGW13939_00563"
                     /db_xref="GeneID:55988076"
     mRNA            complement(join(<1686265..1686297,1686355..1686547,
                     1686606..1686696,1686754..>1686793))
                     /locus_tag="TRUGW13939_00563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483770.1"
                     /db_xref="GeneID:55988076"
     CDS             complement(join(1686265..1686297,1686355..1686547,
                     1686606..1686696,1686754..1686793))
                     /locus_tag="TRUGW13939_00563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339663.1"
                     /db_xref="GeneID:55988076"
                     /translation="MASQPQVSVRKQQELQLQYSNYKNALQTMAQKIGDIEQETEEHK
                     LVIETLEPLPKERKCFRMINGVLVERTIDDILPSLKTNADGLKQVLDELLKQYKTKQT
                     EMDTWKKKNNVQVVQQ"
     gene            <1687224..>1690102
                     /locus_tag="TRUGW13939_00564"
                     /db_xref="GeneID:55988077"
     mRNA            join(<1687224..1688061,1688108..1689648,1689728..>1690102)
                     /locus_tag="TRUGW13939_00564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483771.1"
                     /db_xref="GeneID:55988077"
     CDS             join(1687224..1688061,1688108..1689648,1689728..1690102)
                     /locus_tag="TRUGW13939_00564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339664.1"
                     /db_xref="GeneID:55988077"
                     /translation="MARDDAPPPAKRQKPGPMRDAKRQDIDNWETNRMLTSGVAQRRE
                     YAGDFNPDEDEATRVHLLVHDLRPPFLDGRTIFTKQLEPISAVRDPQSDMAVFSRKGS
                     RVVRERRQQRERQKQAQEATNMAGTALGNLIGIREDEGDSAVAAPIEDTYKSGNKFAQ
                     HLKKDRGGASSFSKSKTLREQREYLPAFAVREDLLRVIRDNQVIVVVGETGSGKTTQL
                     TQFLYEDGYAKYGMIGCTQPRRVAAMSVAKRVSEEMDVDLGDLVGYAIRFEDCTTDKT
                     VIKYMTDGVLLRESLVQPDLDKYSCIIMDEAHERALNTDVLMGLIKKVLIRRRDLKLI
                     VTSATMNSERFSRFFGGAPEFIIPGRTFPVDIQFSRSPCEDYVDSAVKQVLAIHVSQG
                     PGDILVFMTGQEDIEATCELVEDRLRLLNDPPKLSILPIYSQMPAEQQAKIFERAEPG
                     VRKVIVATNIAETSLTVDGIMYVVDSGFSKLKVYNPRMGMDTLQITPISQANSGQRAG
                     RAGRTGPGKAFRLYTEQAYKNEFYIQTIPEIQRTSLANTVLLLKSLGVKDLLDFDFMD
                     PPPQETITTSLFELWSLGALDNLGELTSLGRRMTPFPMDPSLAKLLITASEEYACSEE
                     MLTIVSMLSVPNVFFRPKERQEESDAAREKFFVPESDHLTLLHVYTQWKSNGYSDGWC
                     VKHFLHSKSLRRAREIREQLHDIMVVQKMNLVSCGTDWDVIRKCICSGYYHQAARVKG
                     IGEFINLRTSVTVQLHPTSALYGLGYVPDYVVYHELILTSKEYMSTVTAVDPNWLAEL
                     GGVFYSVKQKTYSHREKRITEHEFNRRMEIETQMAADRERAAAEREREKERSDPARQR
                     REIEVGVGIGKPAPAARSVVKKPLVGGNRRGGGGGGGGGGLTSSSVVKKPVIGRKPGG
                     RAF"
     gene            complement(<1690447..>1691020)
                     /locus_tag="TRUGW13939_00565"
                     /db_xref="GeneID:55988078"
     mRNA            complement(join(<1690447..1690513,1690579..1690745,
                     1690814..>1691020))
                     /locus_tag="TRUGW13939_00565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483772.1"
                     /db_xref="GeneID:55988078"
     CDS             complement(join(1690447..1690513,1690579..1690745,
                     1690814..1691020))
                     /locus_tag="TRUGW13939_00565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339665.1"
                     /db_xref="GeneID:55988078"
                     /translation="MAPKTAPSSASTAATALSPKASVAEITQHIWQRYLAQTSQRTFL
                     LDAFMAYLVLVGGIQFVYCVIAGNYPFNAFLAGFSAAVGQFVLTASLRMQTSSSSPSK
                     GAGSKGGKTVEGDEGTPEISHERAFADFIFGSFILHFFCINFIN"
     gene            complement(<1691441..>1695907)
                     /locus_tag="TRUGW13939_00566"
                     /db_xref="GeneID:55988079"
     mRNA            complement(join(<1691441..1694145,1694726..1694856,
                     1694922..1695361,1695426..1695570,1695630..1695653,
                     1695723..1695732,1695796..>1695907))
                     /locus_tag="TRUGW13939_00566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483773.1"
                     /db_xref="GeneID:55988079"
     CDS             complement(join(1691441..1694145,1694726..1694856,
                     1694922..1695361,1695426..1695570,1695630..1695653,
                     1695723..1695732,1695796..1695907))
                     /locus_tag="TRUGW13939_00566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339666.1"
                     /db_xref="GeneID:55988079"
                     /translation="MASVAGSVAADANFMSVRTQLAKDWSGKGGDPGDKYFHESTFHP
                     HYDGRFASQALPEEESLPHLISLVQTYLATMNDLGVETWIMHGSLLGWWWNQKILPWD
                     SDLDVQISESGMHFLGDYYNMTEHHYDIPNVPEGRTYMLEINPNYVIRTTDDRSNLID
                     ARWIDTSSGLFIDITAVRADDENRKNGNPGALMCKDSHRYDESDIFPLRESVYEGINV
                     KIPYQYAKLLSGEYGGRSLTNAKFAGHTFVEEAQLWIKDEYVSRCFSNNCNANLDNSQ
                     VETFKQNAQEADRELTTSVAGRAREQAKAMSSSNDSPNAPMYMTPSTTSASPPSNNGA
                     SASAPAPISAGTGNSSNNSATVASPSLTSKPATTTTTANADSRLNPRSCVTCRRRKVR
                     CNKREPCSNCVKAGIDCIFPGPGRAPRKQRRPPDAELLSRLRRLEGVVESLGGPASID
                     QLISNQQQQQQQKTTTTNATTPGRSTSLQDGVAETGNLDEDDPKNAHMRRDGIEELGR
                     LVIDDTKSRYVSNRFWASLGDQIEELQDILDHSSDEEEDYPSPGESVKSGSRNHDAFI
                     FGYSSVASSLRNYHPTPTQAFVLWKTYEQNVAPLLTVVHKPTIRNIIIEAATNLESLD
                     KNTEALAFSVYLSAVISMTPEQCMTELGEDREGAISRFRFATEQGMARANLLNSQNIT
                     LLQAAVMFLSCIRRQDDSRFVWTLSAVILRLASGLGLHRDGTHFGLSPFETEMRRRLW
                     WNICILDVRAAEDHGTDPMINDMIYDTHLPLNINDDDICPDSKTTPVEKTGCTDMTFA
                     LIRCEVTLAYRRLTYIPPGAVSLPANLQDREALIERLHNRLNDRYIRHCDMQIPLQWV
                     CATVARLIVAKLWLIVHQPLNKHESSRLSNEGRNKLLLTSIEVIEFSRLLETNENTTR
                     WSWLFVSYNQWHAVAFVLAELCVRPLCPGVDRAWLAVNSTFRDWERQGLSKKAPLWRP
                     LSQLMKKATNFRKKQLEELRSKYGSNPLVSQSEASSAIPTTTTIPTNIPSVVEFGRLP
                     HPVAASQLGTPSLVSTSSPPVNDTPAHEQPFGLSNSSTAGFSLDLNKGMPELLEDMLP
                     AHSMTQGWQDLSMNNDASASFNPYNNNNMTTVNNGFAPPSAFSFPAQQQQQQQQVDAT
                     NMFETPVNWDQFDDVMRDFQLELTQGVGEGENVMGNMHMDFF"
     gene            complement(<1697176..>1698707)
                     /locus_tag="TRUGW13939_00567"
                     /db_xref="GeneID:55988080"
     mRNA            complement(join(<1697176..1697567,1697626..1697655,
                     1697711..1697763,1697811..1697878,1697947..1698270,
                     1698332..1698405,1698459..1698495,1698546..>1698707))
                     /locus_tag="TRUGW13939_00567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483774.1"
                     /db_xref="GeneID:55988080"
     CDS             complement(join(1697176..1697567,1697626..1697655,
                     1697711..1697763,1697811..1697878,1697947..1698270,
                     1698332..1698405,1698459..1698495,1698546..1698707))
                     /locus_tag="TRUGW13939_00567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339667.1"
                     /db_xref="GeneID:55988080"
                     /translation="MTAIQDLRVHAPVIIAEAVCLIVFCSFMVGLRFYARWLKGSRLG
                     MDDLAIALALLFVIAMAITILIETGMKGFGYSAAVGDTGPNHPDANVAGWPTELLQVP
                     ALGCIKLSFLFFYRRVFIKFVAREFSFVNLFMIAAVSAWTICFFFLLLFLCNTDFAAY
                     WTSGTTEAERCLPTGMVHMGYAISDVVTDIIIILMPVGEIWKLHLPVRRKFAVMGVFG
                     MGAITIAMSIVRMVIYQRALSVQFDPDADEEYLTTLTTYFSMLEAGLGVMAACLPVQY
                     GLFRSEKVQSMIRSIHSLTSLGSRGSGGSGNNSRTRSFYTAQSRGQSQSQNLNTAGEV
                     SDAGGEPIPASVRNGSDAGTNSHLETQGIVVPKSFGTEEHAAQNV"
     gene            complement(<1700048..>1700837)
                     /locus_tag="TRUGW13939_00568"
                     /db_xref="GeneID:55988081"
     mRNA            complement(join(<1700048..1700443,1700498..1700687,
                     1700770..>1700837))
                     /locus_tag="TRUGW13939_00568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483775.1"
                     /db_xref="GeneID:55988081"
     CDS             complement(join(1700048..1700443,1700498..1700687,
                     1700770..1700837))
                     /locus_tag="TRUGW13939_00568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339668.1"
                     /db_xref="GeneID:55988081"
                     /translation="MVDALLAIPRLVRLLGPVAMVNRVTSNVFSFMCKDNQYGCHATA
                     TAGVVWTGVMTNIGLPTPTEEPATRTPSTAEGIEAWGIKLLSVAPETSTTTSLPLTTR
                     PATTTQAPTSSFPSSSIVTSSGLPTSSGTPEQSSSKSGLGTGAEVGIAIGSALGAALV
                     ALGAFLFYRNRKKNKQVALPPAYTAAPLPKHEHELDGHDAPQLLDSQHPQRVWELGA"
     gene            <1701933..>1703193
                     /locus_tag="TRUGW13939_00569"
                     /db_xref="GeneID:55988082"
     mRNA            join(<1701933..1702333,1702485..>1703193)
                     /locus_tag="TRUGW13939_00569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483776.1"
                     /db_xref="GeneID:55988082"
     CDS             join(1701933..1702333,1702485..1703193)
                     /locus_tag="TRUGW13939_00569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339669.1"
                     /db_xref="GeneID:55988082"
                     /translation="MYGQESADSWGAQILHHATRRRYRGIAIPLVVLTLLFTIWICSD
                     LVTGAIKQRPLSGFSFADSNGSHQTHTEEQEINGPQWATHNPKTNTGSLIPPKIWQIL
                     LPKKQTADDVIIDPDTLRDTPSWLVMNPDYTYTLVGHDGGSEFVKQHFPDDPSLIEMY
                     NNLPNVGMQSDFLRYLILDVEGGVYTDIDTVALKAIDKWVPTDLRDKVRLIVGVEFDR
                     RDGGGWADIPHWLQFCQWTIAAAPGHPIFRKMVTRIFQSLDDISVSHGVPVNKLTPTS
                     FEVMNSTGPAAWTDVVFEALQEHDSSLKTTKDLSFMTKPRLYGDILVLTIDGFGMGQP
                     HSHSTNDGSTPDAALMRHLFRGSWRGDSIEPDNGS"
     gene            complement(<1703973..>1707955)
                     /locus_tag="TRUGW13939_00570"
                     /db_xref="GeneID:55988083"
     mRNA            complement(join(<1703973..1704238,1704305..1704389,
                     1704451..1704569,1704626..1704748,1704814..1705017,
                     1706062..1706819,1706868..1707687,1707749..1707853,
                     1707925..>1707955))
                     /locus_tag="TRUGW13939_00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483777.1"
                     /db_xref="GeneID:55988083"
     CDS             complement(join(1703973..1704238,1704305..1704389,
                     1704451..1704569,1704626..1704748,1704814..1705017,
                     1706062..1706819,1706868..1707687,1707749..1707853,
                     1707925..1707955))
                     /locus_tag="TRUGW13939_00570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339670.1"
                     /db_xref="GeneID:55988083"
                     /translation="MEVDVAVIGAGLSGIAFARFYLETHADARLAIFEKDSSIGGVWS
                     AERVFEAFWVQSPLRMSSFADVALEIPDDAPRLHDTFEARYVTRYLEEYVDSHVYNGA
                     SLRSRIWVNADVRSVEKRGSDDDEDGGWLLHVDGAQPRSVCCKKLAVASGLTSIPNMP
                     TFPRSPEWKIPILHHRDLGLHERTILATDESSAAYKNITVLGGGKSAADMVYGALKKG
                     KNVNWIIRTSGEGPGIFMDPAAGGRYKHAAEGGATQKATALSPSHFYTLPTASLALHQ
                     NEAERASLEEKIYAADKRFKALANYHGREGALPGFRGLEPKASFFWSSGPIGVIQHSD
                     FWDLVSKNVNVYRSDLCGTTSNAIVLTDGTNVPTDAVLCGTGWISSYPFFTPEQAAQL
                     GLPHQPDDTISAEEKTWEELSKKADAEILQTFPILGHPPVDAKPVGGDTNLTPARLYQ
                     GMAPLNDSSILFLGRARMSNNFRAADAQAIWATAYWDGHVSLPPSDEVKRQVAYMNAL
                     SRRRYPTRGVDGINFHADLVHYTDKLACEAGIFSHRKGWWGDPEEPCLASDFRDCAEE
                     YRGRYDGHDVEQTLGLKYHVHLSRKRSPRRWTAWLISALTHLLMVLLVLIAINFVPHA
                     RTILILGETPRPKLYSPLTPAIEYTIDMPPWDYWSNNPFFGTPSDDSERAWNRLIHPH
                     GLQVLPDEAEHLDANRTVVTKNSNSLFMLGVYHNLHCLRRIRQTLQAEHYYPNMTAKQ
                     KESDLEHTSHCLEALRTSMMCHPDLTTNRFYWSHRPWHDLSVRPDVARECVNWDRLEG
                     FMRERRYDPGDILKGHGDDLADDYKEDYKEDKKLKYEG"
     gene            <1708510..>1710183
                     /locus_tag="TRUGW13939_00571"
                     /db_xref="GeneID:55988084"
     mRNA            join(<1708510..1708694,1708789..1709039,1709118..1709162,
                     1709269..1709339,1709394..1709835,1709924..>1710183)
                     /locus_tag="TRUGW13939_00571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483778.1"
                     /db_xref="GeneID:55988084"
     CDS             join(1708510..1708694,1708789..1709039,1709118..1709162,
                     1709269..1709339,1709394..1709835,1709924..1710183)
                     /locus_tag="TRUGW13939_00571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339671.1"
                     /db_xref="GeneID:55988084"
                     /translation="MGNPTDSSMAKPAAMLPSTESCRDSELQLSPEWANDPRNPVNWS
                     LARQWSIIFLLWGANTVASICSTAFEPALPFVMDDFGSHSSSLSAFTISIYLVGYCFG
                     PLLVAPVCELYGRVVALYPGFVVYLAALAICGSSHSIAVFIVFPAWSGRDVYDQWCYF
                     WPIVGGYIAETIGWRWIFWISIAFLRIFMIGCLLILQETYPPILLARHQSGSNTEKPA
                     SSQLFLRACTRPLRFIFRSRLILLFTLYTSILNSYLYILLSTLGTTFQTVYNFSTGSS
                     GLAYLGMMTGFLLSQITLGVFSDLYANQQARRRADTKLKPEDRLPPLILGAVLLPAMY
                     SYIPVQIYVVDVYPLHTASATGAMSIIRSAISAVVPLGADPLYARLGYGWGYTLLAGL
                     ALPFIAFGVILVRWGERISDEGGCY"
     gene            complement(<1708724..>1709065)
                     /locus_tag="TRUGW13939_00572"
                     /db_xref="GeneID:55988085"
     mRNA            complement(<1708724..>1709065)
                     /locus_tag="TRUGW13939_00572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483779.1"
                     /db_xref="GeneID:55988085"
     CDS             complement(1708724..1709065)
                     /locus_tag="TRUGW13939_00572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339672.1"
                     /db_xref="GeneID:55988085"
                     /translation="MPAKPHQGTEDDKHGNTMTTTTDGQRRKVDDKPRIQGHNTAIQL
                     TNRSNQQRAEAVSHEINGNSECGERAAMRTKIVHDERQRRFKRGGTDGADLNVSFNLT
                     CTSMPEGKIKF"
     gene            <1710856..>1713512
                     /locus_tag="TRUGW13939_00573"
                     /db_xref="GeneID:55988086"
     mRNA            join(<1710856..1711940,1711993..1712270,1712323..>1713512)
                     /locus_tag="TRUGW13939_00573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483780.1"
                     /db_xref="GeneID:55988086"
     CDS             join(1710856..1711940,1711993..1712270,1712323..1713512)
                     /locus_tag="TRUGW13939_00573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339673.1"
                     /db_xref="GeneID:55988086"
                     /translation="MSTHHNQGGGPADHQSLSTPQLNRSCESCRALKVRCLPDTNMPN
                     QCQRCTKANRPCIFVAPQRRRPRKRTDSRVAQLEKEMAAMRSMLKDRRAAAAAAAAGG
                     GTATKEEIINEESESGSEEEEQDEVDFGVMPMEKPHPLNYQEIKLVNVNPSQSPGVRS
                     TYDLSGDGHSMQSTPSLIPHSSSPDFGDGGDIVDRGLISPAAAEDFLSLFMTDLLDYF
                     PFIVLPLDTTAAQLRQSKPVLFLAIIAAAAIAVDAGLANVMNHEIISLYSQRFFFRGE
                     KSLEMVQALILMNIYYLPPDSPSQIQAYQYSHIAATMAIEVGIAYKKRMPRKPNRNRR
                     QATPAEKFDEQMAEQARTILTCYHLSSTVAMRTRRPNMLQYNDWIKECVRMLSKSPIE
                     SDRRLAIWFELQIITDEALSSFGLDDTASTAPLTETRVNAVLRLFDKKMDDWKENLDA
                     EDLTVPMVLEYQHALLSIYELGIGEGYREPDAIKRQYYTLPAPESGEQQYEPLSALRV
                     DLNIKWLNAAHGLLDSFLNCDVHTMRKMPNLTYSRVVLGVMVLLKIFFSIKSGALRDV
                     ISLGTVNMEQYLESMTERLTEASAGSKYPIPSRWLRVVGGKARDWLTRFENHRTEKEE
                     ARLQAQRDAEKAKAKAAAAVTVVGPSTSSFTAAWHGGIVPTPTKVVPVGMQPAYPDEY
                     HQQQYHQQRQHEQTHEFNPNLAYQQTTNTSPVASMSATSATSVHNYNHNAWPTPTQND
                     PGMHHQHHHQQQQQQQHHHPHINNPPAVAHPYTLPSQPAAAVWSFQHDMANLQQQQQQ
                     TQTQPFPLDLGGQQDATSNHTNNPMYSMENAIPMDMEFDWVPDRGMFQLPTF"
     gene            complement(<1713913..>1715815)
                     /locus_tag="TRUGW13939_00574"
                     /db_xref="GeneID:55988087"
     mRNA            complement(join(<1713913..1715242,1715299..1715743,
                     1715803..>1715815))
                     /locus_tag="TRUGW13939_00574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483781.1"
                     /db_xref="GeneID:55988087"
     CDS             complement(join(1713913..1715242,1715299..1715743,
                     1715803..1715815))
                     /locus_tag="TRUGW13939_00574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339674.1"
                     /db_xref="GeneID:55988087"
                     /translation="MADTGSVASVAGAGLRLALLLNAVACQVANLGVDIHSISKGITL
                     FSTSLKQARQSLQSEHSVHTQDCLDTANQISEQARTVFEEVEDMLDEVQKPNSQATEG
                     GGGPQSVQQRFKTCFKKQRVTYLLAQLESLKFSLMVIVQVLQLGRLVEVKNVLNTLTE
                     ELIAQERADAQNMLIVRYWSTKKLDRLWDLARQEAKEDRAPTVKFESSTSSTQDLSSP
                     TSPGMSKLPIIPLGVESSLNAVEELPKDMLRLTGTILDALLNRWIREEVGQRLVTYDA
                     NAAAAAGFPHAYVSSGSEDGYSDDGYGRPDMQGYYLEGTTTDWRKPHSQDARTQAAQL
                     RKLYSTKQAHVHSDSEDSDSSTSSSMRRKTKRKNRQPAATGDGDGRQYTTTAAARSSS
                     GEPASRPYSYSVSNKVPGSDTESNWRHKDTVNTHSQTRPIPVPQPNNVHANGLYPARA
                     PTSSPSSSNARNGVHQQHHHHHHQTYYSSTAPNGFLSTTPTGGSQSYQQPRYTPAPPP
                     PTRAFSRSMSDNISQPQQYLAPQQQQQQHQQQQQLPQRHRSSRSRKGYHSPQPYDRHR
                     DLKRTAMRGILGASAIGGFMDALEAFSVI"
     gene            <1717275..>1720600
                     /locus_tag="TRUGW13939_00575"
                     /db_xref="GeneID:55988088"
     mRNA            join(<1717275..1719278,1719332..>1720600)
                     /locus_tag="TRUGW13939_00575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483782.1"
                     /db_xref="GeneID:55988088"
     CDS             join(1717275..1719278,1719332..1720600)
                     /locus_tag="TRUGW13939_00575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339675.1"
                     /db_xref="GeneID:55988088"
                     /translation="MASEAPATAPSAESKPPPPQPQADLDDFGLPIRTSKERTPPPQD
                     SASTSPSFHDAQEFSPKNEEPPPVAEQKEEERGEKEEQKAAPSGAITPTGDQERGHAG
                     LSNEAQQSTSVTGLGVTIEEVTKPELADAADSSANHTTEHTQTGQDSSDARASHEKHA
                     AVGASEWSHQKLTEEHGDEESDSEDDWKAMPALGELDHYDDYGRLVAKGSRIEDEDYA
                     DIGSAARGYTRVQLDEDAQSATSMDEDTSYLFKESHGTSLGIDDETRDPLSQLQATKV
                     ILSEGQRIAYVGVVRLAVYQMTKDLENVVATKSSKKAFQDALDSTKKWSQAVMMRLFA
                     HMDIDSAEQVMIEQLAEHGVQSADLVPTLMKSARVENPMAEEQSPSLNSPSISSPSLG
                     SGHRDSLSPSETNNKTPENEKEASLSPGTDGVPEVQTPSQMPTSAKIEIDLRWTVLCD
                     LFLVLIADANYDSRSRYLLEQVGKAMNISWMQICRFEKKVIDALEMEQAAAKETWDES
                     EHMEERRKKSMKKKYMLMGLATVGGGLVIGLSAGLLAPVIGAGLAAGFTTIGISGTGA
                     FLGGAGGTALIASGATLTGSYTGLKASHRRTAAVQTFEYRPLHNNQKVNLIVTVSGWM
                     TGKVDDVRLPFSTVDPIMGDIYSVFWEPEMLQSMGSTINILATEALTQGLQQVLGSTI
                     LTALMGALQLPLVLTKLSYLIDNPWNVSLVRANAAGLILADSLMSRSLGKRPITLLGF
                     SLGSRVIFSCLKELARKGAHGIIQNVYMFGSPIVANKDDYMKARSVVVGRFVNGYSSN
                     DWILGYLFRATSGGIMRVSGLAPVLDVPGLENLDVTNLVSGHMSYRTAMPRLLREVGW
                     EVLSDEFAEIEDPDPENHAERQRELIREIDEARREAEEKPDKKKFGLFKRSRLAKKKG
                     WETYDPDQVDSSSPHSNNSPGSTFVQDSILFDIDAIKAELASEQIEVKQLESTLPPIK
                     VELNSPQHPAEPSPRPDLKQSKSADDAATLVDKQSTTTDPKTSPPPPPLPVSEAKPDE
                     DAQLTFDTSYHVPSHDARPPLHSAATMPADFGHNAWADDDGHGHGHGHHGEEEEIQMT
                     FE"
     gene            <1721562..>1725982
                     /locus_tag="TRUGW13939_00576"
                     /db_xref="GeneID:55988089"
     mRNA            join(<1721562..1722880,1722936..1723168,1723564..1724433,
                     1724493..1725868,1725926..>1725982)
                     /locus_tag="TRUGW13939_00576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483783.1"
                     /db_xref="GeneID:55988089"
     CDS             join(<1721562..1722880,1722936..1723168,1723564..1724433,
                     1724493..1725868,1725926..1725982)
                     /locus_tag="TRUGW13939_00576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339676.1"
                     /db_xref="GeneID:55988089"
                     /translation="VTMTGYYEREASYASVRLTAKNYRGGPPLSIVNGKSIRQRSDSG
                     GSTSRSIDETAEEETMSGQKNDNTGIFDDPISSSDESDQPAARGSEDEDEEEKEETRQ
                     KEGIKPTQFQSRARSQSQPYSQSQPSRTPRSTDPDLEDTFGAFSQQRKRRNNYTKSGN
                     IHGSSSNPFPSQKRARDSQQETDYNTNGSKRRKLDDAKADSSKGFRLPKDREILSPVK
                     APRKDDVVDANPAPGFRMPAIFDDDSVLDRMPSDPTKIFKEPRSQPSGSTISSSLASK
                     DAIFDEVHPVSSPLSDISLSAFPGEISLLKTKEEPEVEELAESLCPNCSAPVDADLLD
                     EFLALPNRRLRDERRFCERHQQHKAEKEWTEKGYPVIDWEAFELRIQQYFPTLDKQLV
                     PQNTSFFRGRLESALKSGQAKNFRLTLEGDNLENMSCGYYGPKGASRMLTAVTSKFSR
                     RLRQLASMDNILKTAGPAAYAQAVLVPELAVLLIKQDMNVDSQEARQILRDSTEIGNR
                     LNAAENDTIDTLNMPLSETTPLLVVQTAPARHRYPHHALRRSCTLLLGLVLFVAVCLF
                     LFPTGLESPWPYTPWARPYPESWPHGSGLGYSDLQALLQETPKAEKIEEWSKYYTSGP
                     HLAGRNFSQVLWTQQQWKEFGVEDTTIASYDVYINYPQDHRLALLKQRGDDYDVTFEA
                     TLEEDILEEDGTSGLADRVPTFHGYSASGNVTAPYVYANFGTYKDYEDLLAAGISIKG
                     KIVLVKYGGIFRGLKVKRAQELGAVGVVIYTDPQEDGEITELNGYKAYPDGPARNPSA
                     VQRGSVQFLSIAPGDPTTPGYASKPGVERQDPENAIPSIPSLPISYTEALPLLKALNG
                     HGPNATHFNKYWQGGGLAHKGVEYNVGPTPDDVVINLYNQQEYVTTPLWNVIGVIKGS
                     IPDEVVILGNHRDAWIAGGAGDPNSGSAALNEVIRSFGEALKAGWKPLRTIVFASWDG
                     EEYGLVGSTEWVEEKLPWLSKTNVVYLNVDVAASGPNFDVSASPLLNKAIYEVTGLVQ
                     SPNQTIKGQTIRDTWDGYISTMGSGSDFTAFQDFAGVASLSLGFSPGPSDPVYHYHSN
                     YDSFDWMKRFGDPDWKYHIATARLFSLLAAYFSEQPVLGLNVTDYAVGLQTYLDRIKP
                     HAESLPKDTHFKFAPLENSISDLHNVATSFDAHAADLKSHLGDDIPWYHWWKKAKLFF
                     QIRAVNQKYKFIERKFLYQPGLDGRNWFKHVVFAPGLWTGYSGATYPGLVESFDAGNV
                     TNAVRWSEIIQEQIGLAVESLQ"
     gene            complement(<1726330..>1728176)
                     /locus_tag="TRUGW13939_00577"
                     /db_xref="GeneID:55988090"
     mRNA            complement(join(<1726330..1726871,1726929..1727313,
                     1727372..1727890,1727956..1727984,1728047..1728070,
                     1728128..>1728176))
                     /locus_tag="TRUGW13939_00577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483784.1"
                     /db_xref="GeneID:55988090"
     CDS             complement(join(1726330..1726871,1726929..1727313,
                     1727372..1727890,1727956..1727984,1728047..1728070,
                     1728128..1728176))
                     /locus_tag="TRUGW13939_00577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339677.1"
                     /db_xref="GeneID:55988090"
                     /translation="MLQEKQKLPVKQLFILSICRFAEPIVFTSVLPYLPEMVESVGVR
                     KNEIAKWVGISSAVLAICQCVMAVPWGALSDRVGRKYTILMGLTFTMLFSLMFGFSKS
                     LVTLLIARAFLGLMNGNVGIIRTMVAEMISDKALQPRAFSIMPLVWTIGSIFGPAFGG
                     ALANPAVRHPEIFGDWEIFRKYPYALPNILASLFFIVGITTGVLFLDETLASRKDNVD
                     YGRVLGQYLTGFCTGRRRQPRRDLDEAVDETTRLLPDRDDLENPVKKTQKPKPPKKVS
                     FKQVLTPQSILILAAYTMMALHSMAFDSLFPVFLHHPTQEIVNNPDVHLPFKFAGGFG
                     YDAQTTGFLYTLIGIIGMFVQFLIFPVAARRYGVLYCYKVVASLFPIIYAITPFTVLV
                     PERIRMATVFVLMVSKLILVIFCFPCCTILLTNSAASLEVLGTLNGVGVSVSAVGRAA
                     GPALVGQAFTVGVKHGYGIVPWWILMVLTVLGAVPVFHIIETDGFAGNQPVDDDDDDD
                     EQSEEEH"
     gene            complement(<1729611..>1731531)
                     /locus_tag="TRUGW13939_00578"
                     /db_xref="GeneID:55988091"
     mRNA            complement(join(<1729611..1730250,1730311..1730497,
                     1730562..1730701,1730759..1730867,1730929..1731077,
                     1731145..1731325,1731381..>1731531))
                     /locus_tag="TRUGW13939_00578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483785.1"
                     /db_xref="GeneID:55988091"
     CDS             complement(join(1729611..1730250,1730311..1730497,
                     1730562..1730701,1730759..1730867,1730929..1731077,
                     1731145..1731325,1731381..1731531))
                     /locus_tag="TRUGW13939_00578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339678.1"
                     /db_xref="GeneID:55988091"
                     /translation="MPADYERRDATEDEINELPHVADSIPSNVWIALVVSGAERFLFY
                     AATTPWQNYAQYDHENTSIPGALGLGEAMASNISSAFYAFTFLTSVAFAVLSDAWLGR
                     YITLCLSFCLDFCGCLILFVTSLPAVTDGSVKLVGFILAIVLTGLGTGGVKATIAPFI
                     GDQYPNVAPQLIITKKGERVVTDRTLTMQYIYNVFYWFTSIATLSLIASTYLEKKIGY
                     WAAYLMPLCAFAVVIPLLVLWYKPLVKLPPQGSVIPHFAKVIWFSARDRFRLDAAKPS
                     YQAEKYHREVDWDDLFVFEIKRGLSACKVMACFIPYHLCNNQSVNNLITQAGEMRLNG
                     VPNDAIKAINPVFCVILGPVLQRFLYPGLRKAGIPFGPIARMTWAFITMSGSMAFAAG
                     AQKLIYSRAPCYDEPLVCGASDGGRIGNGISVWVQIPSFFFLGLAEILGFTTLAEYSY
                     SEAPTNMRTLVQSLVQVSSGIDSALGIAVSPLSKDPMVLYLYTGLAVTMIVVAPVFWV
                     VFHRHDRNRQ"
     gene            complement(<1732212..>1734244)
                     /locus_tag="TRUGW13939_00579"
                     /db_xref="GeneID:55988092"
     mRNA            complement(join(<1732212..1732359,1732409..1732978,
                     1733055..1733138,1733200..1733410,1733576..1733925,
                     1734078..1734104,1734168..>1734244))
                     /locus_tag="TRUGW13939_00579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483786.1"
                     /db_xref="GeneID:55988092"
     CDS             complement(join(1732212..1732359,1732409..1732978,
                     1733055..1733138,1733200..1733410,1733576..1733925,
                     1734078..1734104,1734168..1734244))
                     /locus_tag="TRUGW13939_00579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339679.1"
                     /db_xref="GeneID:55988092"
                     /translation="MSRIASYGITRSFQPIHAAHHPRHPQHAKHVVERKTELHLASIT
                     EKLVTLEKTVHQLSSIVKHRQHAITDRDESVFDQTANPRQLRESTAVVQSRFYSNRKP
                     PLHFDISREEHDPDSQHQPVTPQSTRNKPTPHASTSKEVPTGLDQSTFPGKESNDCNE
                     DHGLTDFHAAISILHRLQFDFTLEFAQAEMLAGIYLYRKSRILDAWRHMNAGCTALYV
                     MTKRDLRGQTQRDRTEWNTILRLYWVSLNLENDILVYHPDLPRSPLYKLEESVALPLG
                     CEESATTHMPASVRKTYTFFLAETGLKAILKRMPSVGRDNGPVTDISPDQGQTTLTTA
                     AVPSAVNKELESQLSTWLAGVPSFLGWSPEPCLGEQTKVGTRLKLLYWFARFSLYSDS
                     TENALHNSSVCFTMQAWTAVQDTLLAAQNLVQIFVSEKSDPDPILQHRVRLVMSTLES
                     AMVKNFIQSRYTQEVGRLLQMASEMVGNNYTITASPRG"
     gene            <1734900..>1739639
                     /locus_tag="TRUGW13939_00580"
                     /db_xref="GeneID:55988093"
     mRNA            join(<1734900..1735162,1735222..1735265,1735317..1735522,
                     1735608..1735880,1735935..1736067,1736131..1736148,
                     1736218..1736354,1736424..1736555,1736620..1736702,
                     1737461..1737505,1737573..1737636,1737785..1737941,
                     1738021..1738054,1738109..1738206,1738259..1738390,
                     1738447..1738649,1738707..1738794,1738872..1738988,
                     1739052..1739250,1739342..>1739639)
                     /locus_tag="TRUGW13939_00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035483787.1"
                     /db_xref="GeneID:55988093"
     CDS             join(1734900..1735162,1735222..1735265,1735317..1735522,
                     1735608..1735880,1735935..1736067,1736131..1736148,
                     1736218..1736354,1736424..1736555,1736620..1736702,
                     1737461..1737505,1737573..1737636,1737785..1737941,
                     1738021..1738054,1738109..1738206,1738259..1738390,
                     1738447..1738649,1738707..1738794,1738872..1738988,
                     1739052..1739250,1739342..1739639)
                     /locus_tag="TRUGW13939_00580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035339680.1"
                     /db_xref="GeneID:55988093"
                     /translation="MASQNAPKKLRVAIIGAGPAGLGAAIEFQKLPFVDVRIYDQATV
                     LREVGTGISLQPNTWRLLDLLDASRNISPDDIFRPEDHHSVQHRNGRTGELLVSHGPR
                     ATAPNHLHARCFRSVLQNALLS