GenomeNet

Database: RefSeq
Entry: NC_049562
LinkDB: NC_049562
Original site: NC_049562 
LOCUS       NC_049562            6905517 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome II, complete sequence.
ACCESSION   NC_049562
VERSION     NC_049562.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 6905517)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6905517)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 6905517)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055899.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..6905517
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="II"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            complement(<2143..>7128)
                     /locus_tag="TRUGW13939_02469"
                     /db_xref="GeneID:55989978"
     mRNA            complement(<2143..>7128)
                     /locus_tag="TRUGW13939_02469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485663.1"
                     /db_xref="GeneID:55989978"
     CDS             complement(2143..7128)
                     /locus_tag="TRUGW13939_02469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341556.1"
                     /db_xref="GeneID:55989978"
                     /translation="MYNTFFEQLEEFPIVVCRECRHAVWPSQIETHLRRAHRYVSTTM
                     RVTLADDVRTWPNIAHDPIELNIPATRTTAIQQLVAPVDGYRCQLSSHSCQYICTTMP
                     TMRQHWIKHHQWSRTRKIGQPTHMEQKQIQHEQDQACRPVQCQRLFPVKANSQYFAII
                     PETDEAVAPDGDACETLIQNMQAHWRSVQEAADRKIQAGQVDEANPWLRRTEWVKYLG
                     EFDIPDLIQSVSPPPADIDGQPSIEPEAHAIWTAMARLATISQLSVIHQIGVFVRLEA
                     IRTEQHQTRYTPLEAYQDEESIVKQVRPWQEMLMFFWRTQQPHEWTSPPYRFTRRQRM
                     AWERLVDAVRIPPTRQVSKGKVITRSGATRAPWVEEEEEEEGEEEEEEEEERDTMSID
                     SLSVDSNEPDFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPL
                     SPVERACLDFCIELLNQRITRREYDSALVCAAAVLGVREGGFRTPEDYPPILSRVIKV
                     ARFMVVKKAVELSDEPEEEDAAELPSSMDHTDWDSAYGGSPPPSSPGRKGCLQWVTQM
                     MDRFMVRGSQGPTQWMLDLRTYGLKIHYNTTSAGHVQWQNGDELCYKDRQFTMNEFRG
                     MVHAVVQDARRILIDDILGCPSDAVPAIPWDRLYDDPSNNQARWSFLQDTRTQWPVDG
                     EHWMWHRIRQDPAVRRRFIQADGQGFHPARWMAYQNRITAFLEKLLVAIQFTWGQPAR
                     APELLSIRHENSPMGGIRNMFIEDGMVVLVAQYHKGYQLSGDVKIIHRYLPREVGELL
                     VWYLWLVQPFERVVSGNIYQRDQVSSHIWTAHPHQAKWNSERLRHILQRESAMGLRGQ
                     SLHIASYREVAIAISRRYLRNKYRFAADDGDDPEAMDEVQLLADAADRQAGHDPHTAG
                     GIYARESRELFGAMASMRERYRGSSQDWHTWLGFASCQPPSDPDADPFSAPPASSTSW
                     FTDEAQRSREERWQRMQRMDVDQALRDMMGPDAAFRGPQKQIVQAVIQGQSPVIGVMP
                     TGGGKSLLFMLPAWMARGGTTVVIIPLVSLRDDLQRRCAELDIQCVAWNNRQPADGAS
                     IVLITPESAVRDETFSTFLNRKQFTGQLDRIVIDECHIALHDQYDFRKSMTQLGQLVR
                     YRAPMLLLTATMPREDEERLCQRMYFPPSTVHWIRARTSRHNIAYRVVRIARPQEHGR
                     RGDVGAAIMAWIEQEIPRYSPGKVVVYANSRHQTEQVAEALGCGAYHSHTIDRAGMLS
                     TFRQTPSGVIVATSALGMGIDIPDIRCVIHVGRPRSLLDYAQESGRAGRDGQGSTAVM
                     VLDGSGGGWGDPVTDRDAGSLRALEQVQRYIDQPCRRGVFDPYLDGEVDGYQRQQCEE
                     GEAACDGCCAAAIPVETQATSPTTQSETPAISPARRVQVQARSPVPAPARSPKRKLSE
                     AFTMVTMPHARRRGYNEPWEQLRSHIEREARTVDSIREHFDRWVGRCRICAMHEAPSE
                     HFTYQCPRAEGQQAAAWIEETIRKVTGNQREDGRNGYEDYAVCFQCHSPQWICPRWVR
                     VDHGGYQRTKEACRYLETAAHTMAQLLHGPMREVIQPAWERRLAQMPGGGVPHENQAA
                     LIRHFQRKFGKRGEERSGLVEEMTWMCSWVDDTMQVDVESSEDSNSIISHM"
     gene            <17967..>19316
                     /locus_tag="TRUGW13939_02470"
                     /db_xref="GeneID:55989979"
     mRNA            join(<17967..18259,18314..>19316)
                     /locus_tag="TRUGW13939_02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485664.1"
                     /db_xref="GeneID:55989979"
     CDS             join(17967..18259,18314..19316)
                     /locus_tag="TRUGW13939_02470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341557.1"
                     /db_xref="GeneID:55989979"
                     /translation="MRSLHLLAFGFGPLLCAAAGTFSIPNVNATFSNSPQPFLIQVDP
                     NFIEDTRQRVAHARAPVFLNMTGDGPSAENFTSVRDFWVNEYDWDATQAFINDKFQQF
                     TTVVDPVINNATYPVPLHFVHHRSNRSDAIPLLFIHGWPGSFIEVGHIIGNLTNPPNA
                     SVPAFHVVAPSIPGFGFSPAPQSPGFGPADAAHAFNELMQQLGYSKYVIQGGDFGGVT
                     LRYQAHLFPQQVISALSNFWIIQPGDNDMQVFAEGKATPDEVAYINIIEIYINQWSGY
                     RLIQSTEPLTIAYGMTDAPLGNALWIYSVMAKVVDPALTSWTPEEIITWSMMYYIQGP
                     YGGMRFYKEVQNDGGFATLNFGVLPQVEVPVAISQFPYDLTYRMPLEWAQRGGNVLKR
                     TVHNHGGHFAAYEVPELLLNDIWSWFGDKELSGTKAFIH"
     gene            <21042..>23178
                     /locus_tag="TRUGW13939_02471"
                     /db_xref="GeneID:55989980"
     mRNA            join(<21042..21524,21653..22741,22794..23058,
                     23105..>23178)
                     /locus_tag="TRUGW13939_02471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485665.1"
                     /db_xref="GeneID:55989980"
     CDS             join(21042..21524,21653..22741,22794..23058,23105..23178)
                     /locus_tag="TRUGW13939_02471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341558.1"
                     /db_xref="GeneID:55989980"
                     /translation="MSDTKTLTGDPFIRGLFESLLKRRLFYTEAFEIYRTSGSLHSDS
                     RGLFDYGPPGCALQSNIFEVWRRHFVLEEDMLEVDCTILTPEEVFKTSGHVDKFEDWM
                     CKDSKSGDFLRANHLIENVLEARLKGDKTARGVAVDDTEKGDAKVDAKKEKRKIKDIK
                     AIDNYDGTELGELIERLDIRNLDGNNKVSPPVPFNLIFKTTLGPNSASPAYLRPETAQ
                     GQFLNFKKLLDYNQNTMPFASASIGKSFRNEISPRSGLLRVREFLMAEIEHFVDPEGG
                     KKHQRFNEVNNIQLNLLDRATQLSGKTDLRNMTLEQAVEKKIVDNETLGYFLGRIYLF
                     LLYIGVDKSKLRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTVHSK
                     KTGGSLIVREPRLEPLKIEEWQVDINKAKFGPTFRKDEKSVEAALQALGQTQREELSE
                     VLKENGHITIQVPGTLPDDKIDVSKELVSFEKRTIVQNTRDYTPNVIEPSGIGRILYS
                     LLEHVYWHRPDDVARGVLSLPLFVAPTKVLIVPLSNHQTFILVIRRVSQRLRQFGISC
                     RVDDSGASIGKRYARNDELGIPLGITIDFDTIKDDSITLRERQHETIDNQEVWDDIFK
                     RLPEFISQEGDD"
     gene            <24986..>26140
                     /locus_tag="TRUGW13939_02472"
                     /db_xref="GeneID:55989981"
     mRNA            <24986..>26140
                     /locus_tag="TRUGW13939_02472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485666.1"
                     /db_xref="GeneID:55989981"
     CDS             24986..26140
                     /locus_tag="TRUGW13939_02472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341559.1"
                     /db_xref="GeneID:55989981"
                     /translation="MARLLDLPNELILLVVDYVQADTTQKLLPFFQWGDVYRRLIEQN
                     PPQRIKDLHSLCLVSARLNNLLKPILYRNICVRDDGFRIYPQTQLKRSLENDSKLEGH
                     IMSAIVPCNHLIYDIYQFFWFPNIQALSILRFNDWEPMEFEDDSHVGTSPVTELNLIG
                     CGAHEEALAAVLSWPTALEVLHYDAEQGEWDGHYGDEPAKSWTCAAFVRAIQPQKATL
                     RELTLTRPWLEHEGLGNGPRIDLSDFTALTMLRIYQVFLCGDEDPLEAWSSLPRSLER
                     LDVFYDDWDLTRFDEDDFLRGLLAHKKEYLAHLRTVSIHSPEQTWDSDIEEFMPTGQW
                     TPPSPLARAFETAGVNIDIWLGPAEPPKFEELGIPQLLKPPRKRRFLDID"
     gene            complement(<28467..>29702)
                     /locus_tag="TRUGW13939_02473"
                     /db_xref="GeneID:55989982"
     mRNA            complement(join(<28467..29246,29343..>29702))
                     /locus_tag="TRUGW13939_02473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485667.1"
                     /db_xref="GeneID:55989982"
     CDS             complement(join(28467..29246,29343..29702))
                     /locus_tag="TRUGW13939_02473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341560.1"
                     /db_xref="GeneID:55989982"
                     /translation="MIVSSGILAMGSQSRGYRMRSACNACHSAKLRCSGSSPCSHCQI
                     SGESCVYSLSDRLGRPKGVKNKRTDSSSHDTTRKQSTKSIPTEAASAQREAIASYNHL
                     DGGSMCDLVLEDDLDFFTNILTDPSHYLLSHHVSPADEGYMMPPNGTTDATSPHASLQ
                     CRCFQRYTDLLAHLRILRQQSASFSIDTLLVANQRTLATWKHFSQCLACSTPLNEEVI
                     FLAAISLRSMLRVVQVFCSNPPAARSVDTSLLSHSLGDPKDDSNNEIRMIIGSYQVEG
                     DERQMIGNMLVLHTLNRIEFAVSCLSEHIAQCTPSDPSYADSMTSNWVVPDESAVRSD
                     WDIGLKPVQVILRGLDTAIKNMSQTLQWKSRVATNNMGEGIIEQM"
     gene            complement(<31585..>34428)
                     /locus_tag="TRUGW13939_02474"
                     /db_xref="GeneID:55989983"
     mRNA            complement(<31585..>34428)
                     /locus_tag="TRUGW13939_02474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485668.1"
                     /db_xref="GeneID:55989983"
     CDS             complement(31585..34428)
                     /locus_tag="TRUGW13939_02474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341561.1"
                     /db_xref="GeneID:55989983"
                     /translation="MAPLPKNLFEALTKAARSAPEKGLSIYPPGQTEGKPTRITYSEL
                     LRDALIRGNSIKTIPGLTPDKIVLIHLDNHEDNVRWLWAVLAAGQVPAISVPFTNNLD
                     QRRKHIEHLQEVLHDPVVLTRKHLVAEFLDLPGLAIHPVEELDIHNTPFQVDYVLQNG
                     FTKSPDDLAALMLTSGSTGNAKAVALRHGQMLNAVAGKSACHATHSDEAFLNWIGMDH
                     VANLTEVHLHAMTVGADQVHVHAGDLLANPLLFLQLIDRHAVGYTFAPNFFLASVRKA
                     LEKVLLPHLPVEKAASLGLPNISTLRCLISGGEANSTALCAALTKLLQPLGGSYDFIR
                     PGFGMTETCAGSIYNIDCPRSDLALDREFTSLGYCIPGMEMRVRNAEGGNCGANDFGH
                     LEVRGVNVFNEYYNNPTATQESFTPDGWFVTGDLAFLDEKRRLHMIGRGKESININGL
                     KYYPHEIEGAIEDAHIPGVTPSYTAIFPYRVPGAASETLCAVYLPTYAVDEISTRLNT
                     RDKLRTVIMQQCMVRPYRIIPLDREFLPKTALGKLSRAKIRKAFEAGMYNASIKQDEI
                     YLAQATGAAHLQPTTPAEVAVQAIFAEVFGASRSELGIHTSMLDMGCSSIEIFQIKWL
                     LQNDPALVDNVPITTIIGHPTIQGLAAALDPAATGVSKPYDPVVKLRQGGSKTPLWLV
                     HPGVGEVLVFLTLANQFTDRPVYALRARGFDGEPFFGSVDEMVDTYREAIQRVQPTGP
                     YAIAGYSYGGTVSFEIAKKLNRDGFETPFLAVFDQPPHIKDRMRHGGWADVLLTLARF
                     FDLLPNPEDEETVAAELRAVGGGLEDDTNKDKLVDILLSSASNQRLQEFGLDKNRLAT
                     WTSLALNSHTIARHYEPQGNVPLLEVFYGQPIEAVARTKAEWLEHKLSRWNQYVTDVQ
                     FHEVAGHHYTLLAPENVQGFYRTLQTRLEARGV"
     gene            <35210..>36846
                     /locus_tag="TRUGW13939_02475"
                     /db_xref="GeneID:55989984"
     mRNA            join(<35210..35269,35318..36105,36219..>36846)
                     /locus_tag="TRUGW13939_02475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485669.1"
                     /db_xref="GeneID:55989984"
     CDS             join(35210..35269,35318..36105,36219..36846)
                     /locus_tag="TRUGW13939_02475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341562.1"
                     /db_xref="GeneID:55989984"
                     /translation="MVPSTVLVSHKSEAETTYEVSWDGPDDVANPLNWSSARKWQNVV
                     LVSIQATLSPMASVMLAVTSTAVTADFHQTDLYTPSLPTALFVLGFGLGPLFLAPLSE
                     LYGRRIIYLSCFTAFTVSNILCAVAPNMAALVVFRLVCGMAGSAGPSIGGGTIRDMFT
                     PETRGRAQSVYSFGPTGGSALGGIIGSFILAGTGNWRWVLWVMAIASGITSVVSFFFL
                     YETYPPYLLRKKARHLRASTGNDAHHSSYDSPLGHRQLLARTLTRAMHMLITAPACTA
                     MSVYMALIYGILYLHMVTLPLLYSSKPVYGLPSYEWPAALTGLSYLGVGVGSFGGVLV
                     CALCLNRTYMMMKERAVRKGLPTETKYPQFRIPLMQVGACIVPLGLFIFAFTARTYVH
                     WIAPLIGAAVFSAGMLITYVCVTTYLVDSFDQYAASALAAMTLVRSIMGCIFSLIGFR
                     LYESLGYRWGTLMLALLCVLAMPLPALFYFIGPRFLRLGGY"
     gene            <38121..>39426
                     /locus_tag="TRUGW13939_02476"
                     /db_xref="GeneID:55989985"
     mRNA            join(<38121..38177,38244..39111,39194..>39426)
                     /locus_tag="TRUGW13939_02476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485670.1"
                     /db_xref="GeneID:55989985"
     CDS             join(38121..38177,38244..39111,39194..39426)
                     /locus_tag="TRUGW13939_02476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341563.1"
                     /db_xref="GeneID:55989985"
                     /translation="MASQAKRLSPRGLKDSLPVTDEVARSVQEGRDAFQRALKTPIPL
                     IQNSSHPGLLVMVGPCSIHDTAAGMEYAQRLAAAAKKYRGELLIAMRVYIEKPRTTVG
                     WKGLVHDPDLVQGEESDLTRGLSVSREIMLRVAELGLPIVTEVLSPFVLPFIQDLLSC
                     GIIGARTTESQTHREIASDAPMPVGFKNGTNGTVSVALDAIQAAAQPHSFLSVDDDGH
                     LIDHFSAGNPDTFVVLRGGSDGPNYSAQHIRQAELAMANARQPVRLVVDCSHGNSMKD
                     YRRQPEVAANVANQISAGAAIAGVMLESNINPGRQNISPDGLCGLQYGVSVTDGCISW
                     EETERVLEGLAASVRARQTVPLTPAISVPLSSMQKTLEKLQPSVSVVELSG"
     gene            <42753..>43630
                     /locus_tag="TRUGW13939_02478"
                     /db_xref="GeneID:55989986"
     mRNA            join(<42753..42840,42898..43338,43419..>43630)
                     /locus_tag="TRUGW13939_02478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485671.1"
                     /db_xref="GeneID:55989986"
     CDS             join(42753..42840,42898..43338,43419..43630)
                     /locus_tag="TRUGW13939_02478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341564.1"
                     /db_xref="GeneID:55989986"
                     /translation="MTSNNLARCCTLGSLHEGVAKGEIKDIGNISTYFSYPPDKSTEN
                     AILILSDVIGHRFINTQLIADQFAAAGYFVVLPDLFYGDTVPLNRPEGFNVMDWVKNH
                     FPEQTDPIIESVLTEMRENLGCKRIGGVGYCFGGKYVCRFLKPGKLDAGYTAHPTMVD
                     ADELSGIEGPLSISAAVRDHVFSTAKRHESEEILDKKEVPWQINLFPDVEHGFSVRCD
                     VTKPRQKYAKEQAFAQAVAWFDEYVKKH"
     gene            <44122..>45210
                     /locus_tag="TRUGW13939_02479"
                     /db_xref="GeneID:55989987"
     mRNA            join(<44122..44398,44476..44612,44674..45043,
                     45101..>45210)
                     /locus_tag="TRUGW13939_02479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485672.1"
                     /db_xref="GeneID:55989987"
     CDS             join(44122..44398,44476..44612,44674..45043,45101..45210)
                     /locus_tag="TRUGW13939_02479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341565.1"
                     /db_xref="GeneID:55989987"
                     /translation="MKTAWQRLIRFVATDGRLLYGEPVLPHPNFDLGETVEETKLQAY
                     VIVGEDLYDTSGATTVTDEVVTVKELLGPLTPKSVPILRCIGLNYLTHIKETGGGIPS
                     YPTLFIKPPNAVHDHGQNVVIPKIAQDEQADYEGELCVVLGKEAKDVAEQDALDYVAG
                     YTVGNDVSARKIQLDPKLAGPKPQACFAKGFDTFAPLGPALIGTSIISDPSTLTLQTR
                     IDGELRQQGDLNDLAFSIPYLIHYLSSGTTLEKGSVIMTGTPGGVGWFFKPPKPLVCG
                     TKMEISVPNIGTLRNGIQHAE"
     gene            <45674..>47477
                     /locus_tag="TRUGW13939_02480"
                     /db_xref="GeneID:55989988"
     mRNA            join(<45674..45940,45995..46094,46172..46368,46430..46488,
                     46548..46760,46835..>47477)
                     /locus_tag="TRUGW13939_02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485673.1"
                     /db_xref="GeneID:55989988"
     CDS             join(45674..45940,45995..46094,46172..46368,46430..46488,
                     46548..46760,46835..47477)
                     /locus_tag="TRUGW13939_02480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341566.1"
                     /db_xref="GeneID:55989988"
                     /translation="MVENKKGLDSHVDEKALAVRAVDSGSTTAEAQLAEKKLMWKIDC
                     LILPILFIFYFLAYLDRINIGNARIEGMNEELHLDVDNRYNVALFLFYVLYIPLEIPS
                     NVWLKHARPSLYLPGLMFCWGVITMCTGFVHTYQAFYGLRVLLGLFEAGLVPGVIYVS
                     SMYYRRFEYQKRLSVMFVATSMGGAIGGLLAYGIANLSGDYGFLGWRWIFIIEGAITA
                     FIATLAPFIMVDWPEQCRFFNAAERDLIRARLVDDGGECRMDTLNRDSLRRILLDGNI
                     YLGSLTYMGLTTSGLAMSFFLPTVLKEYGWTSTEAQVHTIPIYAFTLGLTLVMSWASD
                     WLQHRYGFLMLCSLMATVGYGMLLNVQSLGRGARYAACFLIAGGGICSGPLAIGFLSN
                     NLAGHWKRAVGSALQVSAAGFAGIIGSVMFLEDEAPIYHTGFSTGMGMVWVSGVAATL
                     MAINVWRENRIRDRGGRDSRLSLPEEVLNNLGDDHPHFRFTL"
     gene            complement(<50211..>54857)
                     /locus_tag="TRUGW13939_02481"
                     /db_xref="GeneID:55989989"
     mRNA            complement(<50211..>54857)
                     /locus_tag="TRUGW13939_02481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485674.1"
                     /db_xref="GeneID:55989989"
     CDS             complement(50211..54857)
                     /locus_tag="TRUGW13939_02481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341567.1"
                     /db_xref="GeneID:55989989"
                     /translation="MVSLHPCRPADIDDLIRRIQDPKRDENEKKALKTLVARMVQRFC
                     DHPQPSYYIEASRLSELGVVDKEQYKDLMTVFLNKIINKSSEGNILHRDLLPVYNYGL
                     RRHQGRAPGGFLVAPLVALSNRLKRAVQQPDLHAQYHYVFILGALLEIAGDLKVSGLD
                     HDSVHQPLCEQLRDLRKHDEPRLAQVASFAYQALRGVPDNLGPWDVFWRTSGAVLSTT
                     AKILSAVPNMDPDKFVQAAPDFFEMVKLFSNVLESIIDIQDSAKKLRIAFLEDMEKSN
                     KTRVWYDVLHFTGPFLVAGEQSPDAAAKAFVILEDILAQSSRFGDKWQFWCGLYCQLE
                     QSWINGNEDMKNHVVRFVEATFLQKSLQNNRANDIRVQGWIDLISNTFNHPEWTIQDS
                     KHRQRSPLRFRKKEKIILKLRHPFQQLKQDHPPEKLFEDTWKTCYEAHEFYADARVLA
                     YYMEEDRLMIQRLSGSTLDMGSCYINLSVIESVVLPKKSPEGFSISHRQRLGVSATDN
                     VKDIQLHELFQERSLRDNRTGRPKRILIRGYPGVGKTTLCKKIIHDFVHGQLPWDFDR
                     IIWIPLRELQHQSSLEDFLEQKFFAFQPEQKLLHGALKKILFAQSDSRTLYLLDGFDE
                     IARDVSTEKEKKLRKMFGFLRGCENMIITSRPFAVNPSTFGNLDLELETVGFHADQVQ
                     QYLSQSGNQGEISASQMDQINGFIDDHWLIQGLYRIPILLDALCYTWGNGLSSESVNT
                     MTALYQAIELKLWRRDMVQLGKLSQLDADNCHSRMQIKKHMKTSMELIEEIAFNGLYN
                     SIIFFSTAQLQCLYDNLPGRDEESNSTIMRHSFFRTAGDVGPHQTQTFYFMHSTFQEF
                     FAANYFVRCWINNKKLACVSLESAELDERSSEEFLQRWKYSGRYKILWRFVSGLLCMS
                     KNSQKLVDFMSVLDGEPRDLLGPAHIRILMQCFSEIAVPDSELALEKIKARMESMLPR
                     LVSSSLAYEMEFPENILQDALVNGTPKQKMGVLQALLHRAQVSSSLLQWVMNCYLEGS
                     LSQLRTEESIASVFARHYDKWPTKTDELLDSKDLNVEMRISILKKLPRKIKLSDSILL
                     SMIGEFANWGRAGTLNNPAEVISRQSSLSEEILSKIFALLEIGSASEKRCAIWSLLGQ
                     LSNENDVLSKLLALQAEDDSVVRCEVAKALGLTTDQPEALESLLKLLRDKDDSVRISA
                     ASSLEMQHNLPVHVLDALDDAIEDENMIVRGIVISIWSRQDFSTTRLRKTLFYCLSSS
                     IEHQLVRCFSRLSPLGEDIISSLIMEVKGKNRSRQMGALAVLSTQKDLSGEILKELLP
                     FLQVETDHSVHARACEVFKRQTVLPDFAIQVLIPQLESKDKYIRSAAIKTLANCRTLP
                     ETALRESLYELGLWSFSGPLNPTGILLHNQDNLPIEILQKIIYFLRDWGYKDEVLGPH
                     TERILRNRTEFYAMLPNQDKKVWESLFRVWFHYSLHEEDWSCYRCQDSIYLATPQGLH
                     EIPLSTKSSQQKLEIGVKAVKDEMYGINPVDTDTLSDRVRSGFTGLVGLVVDSL"
     gene            complement(<57052..>61574)
                     /locus_tag="TRUGW13939_02482"
                     /db_xref="GeneID:55989990"
     mRNA            complement(join(<57052..57078,57132..58107,58164..58693,
                     58747..58919,58968..59541,59648..60254,60312..60913,
                     61006..61060,61113..61228,61284..61364,61419..>61574))
                     /locus_tag="TRUGW13939_02482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485675.1"
                     /db_xref="GeneID:55989990"
     CDS             complement(join(57052..57078,57132..58107,58164..58693,
                     58747..58919,58968..59541,59648..60254,60312..60913,
                     61006..61060,61113..61228,61284..61364,61419..61574))
                     /locus_tag="TRUGW13939_02482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341568.1"
                     /db_xref="GeneID:55989990"
                     /translation="MNSSPSSSFLSEREQIPTSEEREVLSHAEKSSLPHYRDNKENIK
                     SPSIANYLRILLYGAKNGRAFTIILGLVCAMGSGIALPLMNIVFGKLVGDFNRYFVPG
                     SEQNEQTFKSSVNRSTLYIVYLFIGKFVLTYVSMVCFRIISLHASAALRLEYTKALFA
                     QSISQLDEITVGAITNSITALSNTIQQSVSDRLAILFQSLALLISAYAIAFRYSWTLT
                     LVVSAAILFVLIGFAITVPYLVKAQQDVDRLDNKHASIASDVFSSIRTVFSLNAEAPL
                     SKKYSLLVDDAQKKGMKISPVHGIHLALLFFAMYVSFALAFWFGLKLYREGHIANIST
                     VITVFFSVLIVVTVLGGIASPLIIISKAISASAAFFNIIDSERISTTGLREPVVSSRT
                     DIVFQNVVFAYPTRPNIYVLKGFNARFEKGKTTALVGPSGTGKSTVIALIERWYQLQA
                     PSDSAEESSSGDILIDGQCINNLDLKWLRSQIGLVEQEPFLFNDSVYNNISFGLIGSK
                     WENESEDKKKELVIEACKEAFADEFIERLPLGYSTVIGEGGITLSGGQRQRLAIARSI
                     VRQPPILLLDEATSSIDVRGEKVVQAALTRISKDRTTIVIAHRLSTVRRADHIIVMKD
                     GINIEQGTHEELTLKSGMYHSMVYAQQLQPLSDLAEDGTEDIVFSPIENIGSRGYSSY
                     HSDDGEDQESGQKSKEVGFFRAFWVFAYEHRRHWILYVFIIIGAVGAGSGYALQSWLF
                     AKLVEVFQFTGQRLVDAANFWALMFFILALAMAAFYGMLGFASNSISMFIVSTYRKDY
                     FFNLIRESVSYFDREENASGSLVSKLSMDPRQLQELFGPTGVFPLISVFNVIGCVAIS
                     FAFGWKLAAVSIFAAMPFLFLAAFMRIRYEIMFDSLNAAVYKDSSKFASEAVRGFRTV
                     TAFTMEDTIIRRYSALLTDQRKKAIRKAWYATLVFSFSDSVELCAMALTFWYGGQLLA
                     SREYEPTVFFIVYIAIIQGGQSAGQFFSFGPNIAQAKASASRILGARSSVKQQLQNSS
                     PEPLLSYGQNCAADIELRDVCFKYASRNIPALVNVNISIDSGQFVAFVGPSGSGKSTI
                     ISLLERFYDPTHGSILFNGRDICSLELFSYRKCLSLVAQEPKLFDGSIKDNLLLGLEI
                     TDDKLIENQMVQACKDAEIHDFIMSLPDGYFTDLGTNAQTAFSGGQKQRLCIARALIR
                     KPLVLLLDEATSSLDSQSEKLIQEAMERLAVKRNMTIIAVAHRLATIQKADVIFVLGE
                     GVTSRGSEILEKGNHNELLRNKGPYWQMCQAQALEL"
     gene            <62371..>78506
                     /locus_tag="TRUGW13939_02483"
                     /db_xref="GeneID:55989991"
     mRNA            join(<62371..68280,68346..74843,74955..>78506)
                     /locus_tag="TRUGW13939_02483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485676.1"
                     /db_xref="GeneID:55989991"
     CDS             join(62371..68280,68346..74843,74955..78506)
                     /locus_tag="TRUGW13939_02483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341569.1"
                     /db_xref="GeneID:55989991"
                     /translation="MEHRTAIHSPTQVETETWLGITSTKPGVKTNFDGEPHVSVTEGQ
                     LTPPVEEVEVWQEVAAQCQCRLEDLEDVYPCTAAQEGMMALTAKDPNAYTLEYVFYLP
                     PGTDPTRLEQAWRSTALANPILRTRIVPTSQSGCIQAVVCGSIPWQVHADDDGIPCMT
                     SGTVAWRPGAPLAYFVLNWPRRVLTMIIHHSICDDWSISVLLREVDAAYNGQKLEARP
                     FRPLAEYIEANRARSENFWKTEFHDSHKASMTPFPPLPTAGYTPRPTERLEKTFDTHP
                     GPTAGFTVNTKLRLAWAIVQSLYTGSEDTFFGTVNAGRGVPVPGVQEMSGPALATVPV
                     RVQINPNHTVMEALDAVQGQWAATMQFEHVGLQSLMHLGPGPQAACRFQTLMSVEPRD
                     GHQIHGVLSQHRSEQQTYDSYAVILLVRPSSRTVWLETRFDPAVIDVQQMERVLSQMA
                     HIYQQIEKKPNILLAEIDTVSPEDRTELTRRNTSNISCSAPPLSVHQLIHQRASQQPQ
                     EIAINSWDGDISYQKLDDMSSVLAVHLSRQSVGPGAFVPLCLGKTKWMAVAMLAVMKT
                     GAAFTLLDPSYPSSRLLKMCQKIKATLIVTLEPQLPVASRLGVHTVVKVDSLNLETKD
                     SDFAPNPTSSPMDPIYAAFTSGSTGNPKCAIVNHAGFTASALAHSEPCHFTPQSRVLQ
                     FASPAFDLCILEHLSTLIMGGCLCIPSAAECHSNLTEAMNKFAVNVALLTPTVTRIVS
                     PGSISTLKVLVFCGETVRASDVSRWEQHVEVRNAYGPAECSVVFSVQPHLRSEDPVNI
                     GFPTGCVGWVVHPEDHCRLMPLGCPGELVIEGPVVGDGYFSDSEETARVFIEAPPWRR
                     EFVAIPTRRLYRTGDLVQCTGDGSFRFIGRKDTQAKLHGQRLELADIEHHLHRSFPEA
                     RQAIADILRSSHEEGHGDGRPKTLLVAFVCLPLSSSAGKENHEESLFLSPSDEFRAAC
                     AIAESRLSETLPAFMVPAVFLPLSHVPQTKSGKADRRYLLGQAALLPWERMQEFRVTR
                     EQPQMPSGEREEKLQQIWARTLNRAAHEIGINESFFRLGGDSVSAMQVAASCKTSGFN
                     VTVADIFRHPTISKLAQKVQESKRNPQSIPQTVKEDPTDKLFHLSPIQQLFFEHVPDG
                     HNKFTQEFLLRVTKPASSPKIRKAIQQIVAQHSMLRARFDQDSDGNWGQIVRRDVVTS
                     FQLHEHRLSSIGDHDNLQRIFSDSQSRLDIQHGPMFVVDLIETDGHEQYLGLMAHHLV
                     IDMVSWRVLFQDLEDILSMDRPSQSVSMPFQQWCGLQQEYAAESLDPQTALSTNIPAA
                     PLGYWGPPAIWASNTMGDTLEQSISVSQEITQWILGAANDAFQTRPVEIIQTAVLYSF
                     LLAFDNRPAPTIFSEGHGREPWDQHIDISQTVGWFTTIAPIFVRAKKGQNFAELLQLT
                     KDSRRANPRNGWDYFASRYLHPEGMYYCQGHSQMEILFNYLSLFQQLERPGALLQLQS
                     IPDQDIIQPPSDLPRFALIDVTAKVVNGSLSLVFLYNKRLRHQDRLQKWTQLCLQTLE
                     ELPKALQQDQQLTISDFPLLSLTTDGQLQDLLHQIPCQLKVPVSDIEDIYPCSPVQLG
                     MWLSQVKNPRMYWSHIKWSAYPRSRVSVDIEKIKAAWRRVVDRHAILRTVFTDGTGRL
                     SHPLQIVLKSTQVDVQVISQSESFADNEMPSLSDQSLMTQSLMNKKGQPPHQLKLTIQ
                     TDGAVACDLTIHHMLVDGVTVQILLDDVHRAYDGQLEHSPAAGYNKYLQYLQGNHQTS
                     SETYWKQYLEGVHPCIFPSLGIKVQGKEQLTLKLVPFSFDIGRRLQSFCQHHGITISN
                     ILQVAWGLVLRTYTGSESVCFGYLNSCRDIPVQNVREISGPMINLLICRLSLPGNAQI
                     LSTLLENQDAYARSIEHQHFSLAEVMDSLNLSNQPLFNTAMSLQKESANLDPSYTSDI
                     NLGAAQGIDSTEYALTANIITGEKRVSGDLTYWSHVVTDQQAELITDTFFHILSQLID
                     PANSHLGNIDPLSEKNYNHLLQRNQGLPETVRTCIHTDIQKHSLEDPTASAVCAWDGD
                     FTYGELDQVSTLLAEHLIKNGVGPEVFVPICCEKSRWVVAAVLGILKAGGAFILLDPS
                     HPAQRLRDMLADFSCPVLLTSTRDMELAAKIVPKVIAVEGLELRWDSGTAKRELISTS
                     PESAAYAAFSSGSTGRPKASVMEHQSFSSAAEAQRRSLCLHQGSRVLQFASYAFDASI
                     VEILTTLLVGGCVCIPSDTDRNMRLADSIRELGVNWTLLTPSVARILDPYKVPTLDIL
                     VLGGEGMSDDDVCRWSPHVHLMNAYGPSECSVIATAQSSSHFLSNDPADIGLPVGGLV
                     WVVNPQEPHKPVPVGAVGELVIEGPIVGRGYVNRPDHMEAAFIPYPAWLCRMRRKEEQ
                     GRLYRTGDLARCLPNGSIRYIGRKDRQVKLHGQRIELAEIEHHIMQCWPGDGPQVFVD
                     VVTPSNRNNKFLVASIEYPSEDANERAFEAAVEESKLRLQERVPKFLTPSVFLPVAAV
                     PRLLNGKVDRRQLQREASRALRLQMDRSSEGSQNARRTAQLTKEERTLQNLWAQILHL
                     PVDSIGPNDNFFSLGGDSILVMKLASTAGEQGVQISVPDVFLHPRLRNLARIYSSPQQ
                     KELQSPMEELKQDGTVPPFSLIPPDRRANAQTEAMVQCGVSMEQIEDIYPCTALQAGL
                     AALTAERPGSYIKRHRFRLAQNIHLDRLKEAWEKVSACNGILRTRIIQSSLGCLQVEI
                     RDCKLHWTVREHEVDETPAWEVIFGQALIQFEVYPVRNDGSHNYTGRLEMLITAHHAV
                     YDSWSLPLLTQWAQLAYNDLDSPRLLDSTPFQKFIQYSMSQEKEALEHWRADLHDFDA
                     DPFPSLPSPSYRPQASKMIQISMQPGRLSADMVSRTTAVRLAWALVQSQYQSSEKVVF
                     GVVSSGRSAAVPGIEAMAGPTIATIPLSVVVDGNVTVSRALMDLQERVLQLTPYEQVG
                     LSQIAALGPEATRACSFQTLLIEARGEAKDDEDALILARPVIDSRDKTSDTYAIQLTI
                     ALGSNEVTVEALFDDVVVPEWQMQHMLDQLNHILQQVHREPQSIVRDILTLNTNDIQQ
                     LKTWNREITNIDHSTVVEAIHKHCIARSSSLAVCAWDGDFSYGELDARSEDLASLLVS
                     QGIGPEAFVPIYLERSCWTAVAVLGVLKAGAAFVLLDTFHPQGRLRTICEEIRATVII
                     TSSDNQAAAQSLVNNTVLVTGDINKPSMLVPDFSSHPDSHRAALYAVFTSGSTGKPKA
                     AVIENGSFVTMATPYARTMGINIHSRVLHFASYAFDISILEILGTLFAGACICILSEA
                     DRRDHLSQAVKKLQPSHAIFTPSLLRAITLADVESVHTIMLIGEPVRTSDIQQWEGSV
                     HLLNTYGPAECTVVFTMKSCADPSGDARNIGSCIAGAGWVTDPRDPHRLVPIGAVGEL
                     LLQGPLVGRGYLNNSEQTAAAFIPCPPWMGKLGLVDDRRCSRFYRTGDLVRYEKDGTF
                     SFVGRADCQVKLRGQRFELGEVEAQIQQHFPSEIEDVAAEIITPAGAVHSPYLAVFIA
                     LRGSEAPGVPSSPILSLDIVVLEGFGEQVTTVKERLADILPGYMMPSAFVPLRHLPQT
                     IGGKVDRRRLRESAATVTRQQMESLFSPTVAPKRVIATDAERTLQDIWARALCIPTEE
                     VGVEDSFFRLGGNSISALQATTQARAVGIDHSVADLFQWRTILQVTKRFAKSPQRTQA
                     NDPNVDDVFPCAPAQRGILLSQMQDDSSYAAHFLWQLHGRPAVGVARLISAWQQVVSR
                     HSALRVSFRPHPSADGEFEQVLLRHIEAPVEVIEGENDGDSHSPVPSVLTRPSITTVT
                     QHDGQTVPHKLTICATSTGRVFCRLDINHVIVDTASLDILEYELCQAYDGLLPTKLQP
                     DPYREYMNFAQGEPQDEARSYWHSYLKGMKPLSFPSPRVTTTSQFADSVRLSEISLSH
                     RGSEIEAFCHSTDWTASNLLYFAWAMALRAFTGSDDVCFGISTSGRLVPVPHIDQAVG
                     QFSNMSICRVRLAHHLPLNHVALQMQEEYSEILSYQSFPLVEIARAAGATLHDLASTA
                     VNVQYTRASTPSAPVEKHSLTLNRLHGQDPAIQDIALYAEFQPDGQIRALITYQPSRV
                     SAPLASQLGEYFDLAISRILQRPHAVVGDFELLSDQDHQRLRSWNGKLPDRSPYCIHE
                     IIQQHAIQQPDHIAISGWDGSFTYEDLDKKASLLSLYLTTCGISAAQPIPVCFEKSRW
                     TIVAILAVMKAGGTFVPLDPTQPIARLQEFCNRINATTILSSVAQAALSRVLCKKVIE
                     VGDGMIPSHCNGRPDSARVKQAVDPEQGAYILFTSGTTGTPKAVVVSHASYLSSAVSQ
                     IRAFSLDRSSRFLQASSYAFDASVMEILTTLIAGATVCVISEPERNQMMLTGVCPLSV
                     SHAFLTPSLARGLDANKASEWVQTLLIGGEPLSDSHIIQWGNVCRLMHCYGSSESAVI
                     NTVSSDLLPGHDPRSIGRPVGVHCWIADQHDHNRLVPVGAIGELILSGPPVGLGYLND
                     SEMTNDAFIQPPEWLSTVYPEQLPEWRLYKTGDLVRYDISDGSLLFEGRKDRQIKVRG
                     QRVELEDIEYHVRRCFPGAEEAMIEQVMILEEPYPSSPDTSSTRAAPRLVACIWDGLD
                     DQSATVNGFAVNDVPLGESLLRAPSQEFHSAAAAALRRLRDDIPSYMVPDFYVSITQV
                     PRKISGKSDRQRLRKAIQAIQPMEWRAYSAAQRNKRPLESETAIKLHAILTELLNIDP
                     ETVGADDSFFHLGGDSILAMRVAANARAQGMEISSHHILRHATISDWANIVDSHSANA
                     SSSQRYVPYSAVSKHERERILSLHLVKDHPFTVDNVVDILPTVGFQSFYITHSSPVST
                     AKVFPTTLDIDRLRSACRRVMLHHSVLRTFFVSLEDSLYQVILRDVEPVFHVVETEDP
                     EAYITQESQRYISPSTAQGSLSLEFTVVTSSSRSNCVFILSISHAQYDGPSLSHLWQA
                     IASAYEGGVLPKTVQFSDVVYNRLSDTNEEAFSFWRKYLHGAPATALDPLKITDIPTS
                     PEHDAKITSARREITQSYLIPEITVSTLVKAALSWTLSHYTLQEDIIFGQVVHGRGCP
                     IPDVDKVLGPCTNLLPTRISINPEWTVLDLLRHAQAQQLETLSYDYVSFEDIVQKCTN
                     WPNNTSLGFLVHHEGVGLGGSFEMGGIRASSSSSWANSKIATQGQVGIVSMEHEVGLD
                     LMITAAVDTLEESKVELLVDELASAIQLFSRFPSHPLSALARQRTIQSGTTALPN"
     gene            complement(<80662..>81354)
                     /locus_tag="TRUGW13939_02484"
                     /db_xref="GeneID:55989992"
     mRNA            complement(join(<80662..80704,80785..81001,81064..81226,
                     81289..>81354))
                     /locus_tag="TRUGW13939_02484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485677.1"
                     /db_xref="GeneID:55989992"
     CDS             complement(join(80662..80704,80785..81001,81064..81226,
                     81289..81354))
                     /locus_tag="TRUGW13939_02484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341570.1"
                     /db_xref="GeneID:55989992"
                     /translation="MSKTIPRSAAIALRVVQVASATIVAGIVGYFLNALQGGGDAWPI
                     GRWIYVQVVAGLSIVLGCVLIIPNLHGCFVWPVDIIISLAWFAGFGNLINDLDGILCG
                     QINSIGSVSGTNAICSQWKAGESFAFISAMVWLVTGFWGLFYVWRADQQRLGYWTGRY
                     DV"
     gene            <82637..>84163
                     /locus_tag="TRUGW13939_02485"
                     /db_xref="GeneID:55989993"
     mRNA            join(<82637..82751,82810..82945,83002..83432,83493..83617,
                     83672..>84163)
                     /locus_tag="TRUGW13939_02485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485678.1"
                     /db_xref="GeneID:55989993"
     CDS             join(82637..82751,82810..82945,83002..83432,83493..83617,
                     83672..84163)
                     /locus_tag="TRUGW13939_02485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341571.1"
                     /db_xref="GeneID:55989993"
                     /translation="MSDIIKPVPLAEGAKSNSFLDKIAQFTIGNSRGELPSKEAGAAE
                     QTSPAEPLTKWQRLKLHYGRFWICYLILLIVGLAILLPILLIFIIPAIAQDLLNSGSI
                     VIDAASILQPTSASVLLNISSHVYVPGPFTVKTDPLQLQIFVPQTGSDYLMATLNMPA
                     NSIHKNTSMNMDGSQFTPFENYTSWQAFVHNTIFLDDGGLGLKGHVGTQLGQIKKFNL
                     DINKVAPSKALNQFKGFSIDSARLLLPAESDGTNLLANATLPNQSVLTLEIGNTTVDI
                     LSGNLIIATGLIENLYLTPGNNSFSIRGKANLTNLIANIGEVLTYQGPYIRDGKLSLT
                     TKVTNIKYNSSTVPYYTEEMGKLHLTAQTPLIGLLLNTITGLLQGSGLNSTLVQEVKD
                     KLHGDHGNLQSQLGDLVDNSTELESLTRRHLEDLVILSGQ"
     gene            complement(<85301..>87436)
                     /locus_tag="TRUGW13939_02486"
                     /db_xref="GeneID:55989994"
     mRNA            complement(join(<85301..85419,85481..87141,87200..87329,
                     87400..>87436))
                     /locus_tag="TRUGW13939_02486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485679.1"
                     /db_xref="GeneID:55989994"
     CDS             complement(join(<85301..85419,85481..87141,87200..87329,
                     87400..87436))
                     /locus_tag="TRUGW13939_02486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341572.1"
                     /db_xref="GeneID:55989994"
                     /translation="MALLPQSAGYATILVGGAFFAALMNGFTWVQRRYTKFDPGKIEE
                     FSSASRSVKTGMLSVGITSAWVWAAVFLQTGTLTYLYGVSVPWWFGIGGFVEIAAFSF
                     ISSKVKVNAGGASTFLQVAKVRFGVLGHWAYMFAAVVANFVVGSEILIGGAGVITGMT
                     GVSQYAAIWLLPLVIVAYVLTGGLRATFIADYLHCCILFSCLVVLILATYTRGDDIGS
                     PGKLYDLLLAASEAVPAAGNKHESYLSFRSEGGMYYALTATTSFFGLSFCDQSYWQRS
                     IAARPAGTSKAFLFAGCFFLSVGLGIGSSMGLAARALVSNPAFPGYPAGLSLAELNAG
                     LAGPYASIVILGKAGPAMYTIIAFMATTSALSAQLVAVATIFSYDIYREYINPTATNS
                     QLMRVNHASVICWAIFLAAINTAFAYIGLNLNFLFYLMAVCTSGSVFPIGLLMCWTRL
                     NKAGAVLGVIGGLVMGMVAWLVTAVTTQGAISTTTLTDSKVILSGSLSALGTGAIISV
                     GLSLIKPASFDFALTRAIGRGSIGPLDAASASGEKSSQSNQNATNNGSVNDAHAYYEP
                     ALNSVKDGGLTPDFEDQYAEEVVKLEQSQTKFRIITGILLLIILVLIPAPLAGTAIVF
                     PKGLFILQCVAAATFAFVSLVLIAF"
     gene            <88409..>91241
                     /locus_tag="TRUGW13939_02487"
                     /db_xref="GeneID:55989995"
     mRNA            join(<88409..88518,88586..88715,88777..89071,89132..89172,
                     89223..89445,89497..89535,89587..89687,89733..89823,
                     89873..90009,90062..90148,90249..>91241)
                     /locus_tag="TRUGW13939_02487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485680.1"
                     /db_xref="GeneID:55989995"
     CDS             join(88409..88518,88586..88715,88777..89071,89132..89172,
                     89223..89445,89497..89535,89587..89687,89733..89823,
                     89873..90009,90062..90148,90249..91241)
                     /locus_tag="TRUGW13939_02487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341573.1"
                     /db_xref="GeneID:55989995"
                     /translation="MYLRDAVSISKSIHYTPDTSSKSPDRRRVATLPEDFITRSQSPI
                     HPSRKRSASKSSSLGPVTVSAASTGPNVDDSDSSGNQTKILSESGKAHLLLIDQDDQI
                     VYSGPSTGIPLFARLGLLHTVEVSESDKNGLYFSSHSGGALGIIGASRSSYDCFDLCL
                     QRCPQELMFNLIRYHLTSPLFFPVLHAPSLLSEFVAVTKRRLICTPQYGAFLMSILAV
                     TVRLVENAKFLLPPSERDQASESYFELAQDLLRSSKNNLDIRHILALYHLALFTEGRN
                     NSTGPVSTFVAEAIGLAFTTGLHRNTRDFKMDPVTLQIRTRLFWALYSLDISLAYSQG
                     RPPLIRLSECSVDLPVIVDNEYVTKTTILPQPESSPPVAMAAAVEVTKLYMVLEQVLS
                     AINAPSETVAAAFSLDDRPLARNRIFIERDLPPYLSQVDATVNPASKTFHASRVRATV
                     QFVRTLIARQALIDGFEANPSPTEVEFDSATFKACHLSIDIIKTYSRLRHTGHLRFCG
                     FQAVSHVTAAAHTLIACMLRNSDSAFEYRPDLLTAIDLLLAFSAPFPSAKTIAQLLVQ
                     ISRTLDYRHGSTSETEAAAIRVLARKFAPPLPKCSSRANASERQQAVSKTPALSSLRP
                     PLWQYGANTAIQQLDSEALPIKHFVNAGIFADDGPRSNYSSLTMDTLAAPQSAHPGEV
                     TPNFAVTTEDLVSSWGLSSSFTSLANEPHQWAMNNPLSVGSTAMKVDSAWEDGVFSFL
                     NDGLFNNL"
     gene            complement(<91350..>93290)
                     /locus_tag="TRUGW13939_02488"
                     /db_xref="GeneID:55989996"
     mRNA            complement(join(<91350..91473,91551..91764,91845..92007,
                     92086..92318,92383..92413,92469..92849,92907..93051,
                     93107..93190,93241..>93290))
                     /locus_tag="TRUGW13939_02488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485681.1"
                     /db_xref="GeneID:55989996"
     CDS             complement(join(91350..91473,91551..91764,91845..92007,
                     92086..92318,92383..92413,92469..92849,92907..93051,
                     93107..93190,93241..93290))
                     /locus_tag="TRUGW13939_02488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341574.1"
                     /db_xref="GeneID:55989996"
                     /translation="MTITIKPSVLIIGCGPAGLGAIEQFKRKDFDVVAYEARDSVGGL
                     WNFEATPPPCRITFAEDGHAIALTDLERSGWPAPSPTPMYAGVTANTPRDIMPYRSHP
                     YPKGTSEYPTYEVIYQYQQLHAAHYADYIRLNRVVTRVRHTPEDSISIKKRWSVEWTP
                     SVTSSSPDTGTTFEEGFDHVVIANGTDSRPFIPYTDGLWNWKGEILHSRWYRAAKVFA
                     GKIVMVVGSGPSSADIVRELGMLCVEQSPLAPAKIYRSFKSKLRYDTEQEKGWTEHIS
                     NIARMRVVEPPSSHSATGRIITVADEVLDDIDVIIFATGFVARFEFCHSSDAPFDNAP
                     LVHRPQVPPGSRRPSKDLVDQADLEGGHRVHNLDAYQLFYLPDPTLVLLLLHAEAIPW
                     PFSEMQARVVAAYWTNTPLKLTPHPEEGVESHDLLVLGHPGEFEYAENLLKLIGEGGP
                     EEVDDQGRWGAWPDWKKRIREIID"
     gene            <93751..>94762
                     /locus_tag="TRUGW13939_02489"
                     /db_xref="GeneID:55989997"
     mRNA            join(<93751..94083,94162..94260,94333..94378,
                     94443..>94762)
                     /locus_tag="TRUGW13939_02489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485682.1"
                     /db_xref="GeneID:55989997"
     CDS             join(93751..94083,94162..94260,94333..94378,94443..94762)
                     /locus_tag="TRUGW13939_02489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341575.1"
                     /db_xref="GeneID:55989997"
                     /translation="MSPVPLIIDPTSSLLFGPEVVILDASWLYDPSPPTRNAYEEFIA
                     GPRFPNARFWDLDAVSEPHPDGYVLMLSSPERFAAFAGKHGIAKSSHVVVYDSEGIFS
                     APRTAWTFKIYGHEKVSVINGGLPRAKKEGIKLETGPPSNFEETQYPIPTVERDAVVQ
                     FDEVLRLAQRSSPSTDNTFLIDARPAPSYEDGHIPSSLLLDFPSSLLNDSANFTYLRE
                     PEELKKHISQQLGQDKLNQIVSGTVTVVNSELSPLLKPLSALVKPKN"
     gene            complement(<95020..>95491)
                     /locus_tag="TRUGW13939_02490"
                     /db_xref="GeneID:55989998"
     mRNA            complement(join(<95020..95302,95367..>95491))
                     /locus_tag="TRUGW13939_02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485683.1"
                     /db_xref="GeneID:55989998"
     CDS             complement(join(95020..95302,95367..95491))
                     /locus_tag="TRUGW13939_02490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341576.1"
                     /db_xref="GeneID:55989998"
                     /translation="MSRAPVADFVDSFFTRTLFQADDDSLAVSVLDEELAPNIEIVIN
                     GTSFTKAAFTTLITTQFRTAFVSSIIEIKDLNIATTNSFGSTGVVAQWTEYLTIGKED
                     RKELKQSATTIVRVEELHGKRVITGLWEAQTSD"
     gene            complement(<96290..>97981)
                     /locus_tag="TRUGW13939_02491"
                     /db_xref="GeneID:55989999"
     mRNA            complement(join(<96290..96452,96559..96702,96767..96926,
                     96983..97070,97132..97362,97424..97507,97568..>97981))
                     /locus_tag="TRUGW13939_02491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485684.1"
                     /db_xref="GeneID:55989999"
     CDS             complement(join(96290..96452,96559..96702,96767..96926,
                     96983..97070,97132..97362,97424..97507,97568..97981))
                     /locus_tag="TRUGW13939_02491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341577.1"
                     /db_xref="GeneID:55989999"
                     /translation="MVDFTLSDSENATRTAARGFAKAHLAGAKAIYSNFSSPAERFQS
                     IKPIYAEAVKAGLLNGQVPAPVGGTSANLVEAAILVEEFYAVDASASLTIFATGLGLT
                     PLALAYQPQFKEFMDPFLSGEGAPLASLVFSEPAGVANWLEPGAPGLQTTAYLDGDEW
                     VLNGEKLWATNSAGWDFRGADLGCVVCRCVNEDVVSKSSHPQDLTMVLLVTKADIERS
                     GEGSFEVLKHVETLGHTAVSGPHIKYTNVRVPAKNLLCPPGTGAAVVNHSFEISAMLV
                     GAMGVGLQRAAFDAALAFSRDTRGGTVPIGNRQSVADLLINIKMRTDTSRLLTWKAAH
                     CLLAGPGEHEQRRELSLQAKIFCSDAAVQSCTDAINAVGISAYNLDYPFGDLLNTAMV
                     LPIFDGGNIGIRRRALQSIFMSEGYQPWLTSFGSD"
     gene            <100688..>101973
                     /locus_tag="TRUGW13939_02492"
                     /db_xref="GeneID:55990000"
     mRNA            join(<100688..100902,100958..101213,101288..101740,
                     101797..>101973)
                     /locus_tag="TRUGW13939_02492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485685.1"
                     /db_xref="GeneID:55990000"
     CDS             join(100688..100902,100958..101213,101288..101740,
                     101797..101973)
                     /locus_tag="TRUGW13939_02492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341578.1"
                     /db_xref="GeneID:55990000"
                     /translation="MELSPFLATETMAWEEAEAGLTRMKAYRSHARKLLSEKVNMEEA
                     QKCLNSDLSPEIYNGLFACVAISRHAYRWATIPIIKVAQEETVVEFPPELDMAWSFLQ
                     QRYGVTSPGGNVTSNFYCNYDSDDNLVYTFNVGMPDAIRAAEYHFGHIFPAMERQGLP
                     IYYHMVMAILSSKRDDLKQTVQHLKSISEHLKPTLKIFFDSLVDSKVSKKYWMRYVQG
                     IQGWAAGNMVDSKYIEYDGLSGNQLLLLHCVDAFLGLEPYLPIENTLRYIPHLQRELS
                     TAFSKHSFRRKAEKANNSRVVAEMDSIAKQLRLFRASHRSRATPYLSVPAPERLIMTA
                     GKSVLESDAIQNVKSAIGFLDVLLLKRFQQTR"
     gene            <103273..>104524
                     /locus_tag="TRUGW13939_02493"
                     /db_xref="GeneID:55990001"
     mRNA            join(<103273..103443,103496..103532,103590..103660,
                     103712..104162,104235..>104524)
                     /locus_tag="TRUGW13939_02493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485686.1"
                     /db_xref="GeneID:55990001"
     CDS             join(103273..103443,103496..103532,103590..103660,
                     103712..104162,104235..104524)
                     /locus_tag="TRUGW13939_02493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341579.1"
                     /db_xref="GeneID:55990001"
                     /translation="MVSPVGGKDVPSQVPEIYGVNIAFTAVTVTTVLLRVWTRFWFVQ
                     GLKVDDYIMIFSALLTLFYGIDVCLQTHYGFGYHWKDLVDPTAFSNSLKLFYGGELVY
                     YINVGLTKITLLILYLRLFVTTSYSKLRLLTWVMIGLTTAVTITWTFLIMLQCNPVAK
                     AWETTLPGKCVNMTAVFYSHAGINILLDFIVYIMPIPMLWGVNRPLRDRLALIIIFAI
                     GGFVCIMGIVRLQSLRKATVSTDPSWDNVPSGLWSCMEADVGIICACLPSLKPLFVRF
                     FGPTIGSKSLSKSGTQNFHVLSDSQNALHQPHAGVELYNRRTSFNVVRTDDFSVEEGY
                     AKGKS"
     gene            complement(<105247..>106266)
                     /locus_tag="TRUGW13939_02494"
                     /db_xref="GeneID:55990002"
     mRNA            complement(<105247..>106266)
                     /locus_tag="TRUGW13939_02494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485687.1"
                     /db_xref="GeneID:55990002"
     CDS             complement(105247..106266)
                     /locus_tag="TRUGW13939_02494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341580.1"
                     /db_xref="GeneID:55990002"
                     /translation="MPENRAAFITSARQRPLEIRSLPYTSPEANQIVIRNRAIGINHI
                     DWKIQEHEFAPFRYPGVLGHESAGDVVEVGSNVSRFQVGDRVLAEGTCMATQKDADGS
                     FQLYTAVPEHVASPIPDTLSYENATVLPLGVSTSIMGLYAPDTLELDYPSLDPKPQGQ
                     SILVWGGSSSVGSNVIQLAVHAGYEVIATASKHNFDHVRKLGATAVLDYHEPTIVDDL
                     VTALNGKTLKGAFDAVGLPETTVPLAKVLLQTTEGTKKLVSVLGPPADLPEGISFKMA
                     WAIVSPPELGLAIYQNFLPDALAKGVYVSFPKPDVVGKGLEHIQNGMDVLSKGISAKK
                     IVVSL"
     gene            complement(<107423..>108791)
                     /locus_tag="TRUGW13939_02495"
                     /db_xref="GeneID:55990003"
     mRNA            complement(join(<107423..107528,107657..107839,
                     107889..107974,108031..108059,108120..108665,
                     108734..>108791))
                     /locus_tag="TRUGW13939_02495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485688.1"
                     /db_xref="GeneID:55990003"
     CDS             complement(join(107423..107528,107657..107839,
                     107889..107974,108031..108059,108120..108665,
                     108734..108791))
                     /locus_tag="TRUGW13939_02495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341581.1"
                     /db_xref="GeneID:55990003"
                     /translation="MYGTATATLAATVTKSGGFGFIGGGFDFTSSSSQLSTLEKELLK
                     ARELLGLKALPEQDSNEREFDSLPIGVGFLTFHNDDPSGLIPLIRRHRPVAVWLFAPA
                     GDQHTRLIKEIKSAGCEWNLKIFVQIGSVHTAVEAINDGADVIVVQGSDAGGHQFANN
                     SSIITLLPEVVDAIQNSQKEIFILAAGGIMDGRGIAAALALGASGVVMGTRFAATVES
                     EASRATKSVLVSTKDGGVSTAKSVVHDALQGRGDLWPLKYDGRAVICDPYKDVLAGAM
                     PVEQASARQKKATSESDTSGMVVWAGAGIGLIQDIRNAGEVVEQSRLEAIRVLNLLSK
                     F"
     gene            <109547..>110386
                     /locus_tag="TRUGW13939_02496"
                     /db_xref="GeneID:55990004"
     mRNA            <109547..>110386
                     /locus_tag="TRUGW13939_02496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485689.1"
                     /db_xref="GeneID:55990004"
     CDS             109547..110386
                     /locus_tag="TRUGW13939_02496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341582.1"
                     /db_xref="GeneID:55990004"
                     /translation="MASMDTQLNRGPDQNSAERSSPSRQFDSQSLEESVETQKKELGE
                     RNSNTIDTMLELVLSYRFDGRLEEAETLTRNIIQIRREDLGETHRDTLVSITKLAEIY
                     AELGREIEAEKLQLNVLEARRKVLGELDEDTIDSMEQLAIWYQNRGEYHNQKRDLDKS
                     EELYQMVLKSNTTIHGQGHEITFESSTNLAGIYRLQGRLDEAKKLQTGIVEKSKTVLG
                     LEHTSTAVSIEELARINHAQNRIESAKLLQKQAIDIYKATVGDKHPLTEEAEGEFIRI
                     CQS"
     gene            complement(<110665..>111777)
                     /locus_tag="TRUGW13939_02497"
                     /db_xref="GeneID:55990005"
     mRNA            complement(join(<110665..110772,110825..111703,
                     111766..>111777))
                     /locus_tag="TRUGW13939_02497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485690.1"
                     /db_xref="GeneID:55990005"
     CDS             complement(join(110665..110772,110825..111703,
                     111766..111777))
                     /locus_tag="TRUGW13939_02497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341583.1"
                     /db_xref="GeneID:55990005"
                     /translation="MVESNSDMKKLADKDGHFRRKDSVFRSFISRSPSAEFPAEANRY
                     VLYINLGCPWAHRTNIVRSLKGLEDIIQLVKVGHGLGPILWEFNGTDGSDEKEPLYGF
                     NYLKDLYLKVDPEYEGRYTVPLLWDKKTEKIVSNESSEIIRMFYTEFDDLLPAELRED
                     GPRGLYPEHLRGEIDAMNEWVYHQINNGVYKSGFATSQEAYDANVYTLFEGLDRVEKH
                     LGEPGHQPYLFGDHITEADIRLYTTTIRFDVAYYSIFKCNIKMIRHDYPRIHRWLRLL
                     YWDESERTRGGAFKKTSTLDLYKRGYAASVGKVHGFPLEKLVLPAGPLPAILPFDA"
     gene            complement(<112772..>115282)
                     /locus_tag="TRUGW13939_02498"
                     /db_xref="GeneID:55990006"
     mRNA            complement(join(<112772..114597,114682..114812,
                     114887..115212,115259..>115282))
                     /locus_tag="TRUGW13939_02498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485691.1"
                     /db_xref="GeneID:55990006"
     CDS             complement(join(112772..114597,114682..114812,
                     114887..115212,115259..115282))
                     /locus_tag="TRUGW13939_02498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341584.1"
                     /db_xref="GeneID:55990006"
                     /translation="MAKGSFQHEANATGTGGWEDAFKKASSLTAQLNLDEKAFVVTGV
                     NGPCVGNIPAIPRVGFKGLCLQDGPLSLRQSSYSSVFPAGLSTAATWDRDLMYQRGAR
                     IAAQFKAKGANIILGPVAGPLGRSARGGRNWEGFSPDPYLTGVAFSQTIEGTQSQGVQ
                     ACGKHLIGNEQETQRSPSWDSSGQMQDAVSSNIDDRTMHEMYLWPFAEGVRSGVSSIM
                     CSYNRVNETYACNNDAVMDKLLKTELGFQGYVMTDWWALHGDALPGIQPGLDMLMPGP
                     LSGNTSQFGYNLTSLVQNGELPEWRLDDMVNRVLTPYFYLNQENYPTVDLDTAQIGGQ
                     TWGADIPTYDYTFNTGNLSDINRDVRGNSSAFIREIGAAGTVLLKNDDNLLPLKNPGR
                     IIVIGNDAVGATGGPYWPDNTNVVLAVGGGSGTGRMTNLISPLEAIKQRSPDAFVQAV
                     TNNEGIYQNTMNTLYPAADVCLIFLKAFSGEGADRQTLLPDYNSEWVVSNVTSNPAIC
                     PKTVVISHSAVPNVHPWADKVTAIIAAHLPGDQAGNSLVDILYGDVNPSGKLPYTIAF
                     EESDYNAPIADFTNNNNGDQNLWQSDFTEGLMLDYRHFDSSNIQPRYEFGFGLSYTNF
                     SLSNIQIATTSSDISPYPASLNGDLPPPGGNADLYTVVASINVTIENTGQVAGRAVPQ
                     LYLGFPSNPVSGDTTPIPVKVLRGFERTRSLDPSESVTVKFDLRRKDVSSWDVVNQEW
                     AIPSGTFKVFVGQSSRDLPLVENLGFVN"
     gene            complement(<116484..>117203)
                     /locus_tag="TRUGW13939_02499"
                     /db_xref="GeneID:55990007"
     mRNA            complement(<116484..>117203)
                     /locus_tag="TRUGW13939_02499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485692.1"
                     /db_xref="GeneID:55990007"
     CDS             complement(116484..117203)
                     /locus_tag="TRUGW13939_02499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341585.1"
                     /db_xref="GeneID:55990007"
                     /translation="MAPIQFGILAVAYQVVDAAGPTDLLASASKSALLTIRDYVPIGD
                     DLISRAPEFEFHHIGVTKDPVDLGTSQMTIVPTTTVDECPELDILLVGGPYLGTFDLH
                     PKHADLIRRHVAAGKLLFTTCTGASLVASTGALDGRMATVNNIEYEWVRKRWPKVNWT
                     REKKWIIDGNIWTGSGAIAATDMVAHWLKENYGLDVLIQAAATLDYEPRDSDGLFNVF
                     PQRFDSKGEKLSTHIFRYHEE"
     gene            complement(<117914..>120045)
                     /locus_tag="TRUGW13939_02500"
                     /db_xref="GeneID:55990008"
     mRNA            complement(join(<117914..118575,118632..118906,
                     118962..119150,119202..119741,119799..119870,
                     119933..>120045))
                     /locus_tag="TRUGW13939_02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485693.1"
                     /db_xref="GeneID:55990008"
     CDS             complement(join(117914..118575,118632..118906,
                     118962..119150,119202..119741,119799..119870,
                     119933..120045))
                     /locus_tag="TRUGW13939_02500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341586.1"
                     /db_xref="GeneID:55990008"
                     /translation="MNPQTRTRNSKRNSTACEHCRVAKVRCQASEQPGVCERCLALKR
                     ECISRTRPRPRRWERTWGTGDTGPSPQSPGHRGTFSINYTVQVQAHLNNSFDTLREMH
                     DQALDAVLSEEDHINKSQRASPSANLPSPSSSSNQSHPISDIGRQPLFDIASAESLLD
                     TFKSMVNYLPFIVFPDDSPISYFATTKPFTLLSILTVASGSKMVHKHALYDDEFRKAL
                     GLKYVSGGEKSLELLQGLLIYCAWYPFHLRPKNGQLVRFLRIAADLIHDLHLDEDFLA
                     MPNPLSREVTDDELEKIRTYLAYMYLVSTYIVVWRGERDLPTNCPPWARNAIDILQHN
                     AQVDGDNTLVALVRLSSVFFDASKAINERDVLTVQNSQLILIGLEQQYQELQHSINHL
                     IMGMGVTRMQAMFVDVFLDCGSLLVFPVAESYLSAKTSSFPPPLSKICSATKKIRALL
                     DYVGELEDSTLLSFTINDWTRLIMVLTLSFRLSFPLSLYPDFDSARARSELQLDQFLS
                     KMSHGADDTASNDLLSASRALLGLAKLKYDRRLGSLGGPPSVTPRSRVFGCPVMDGSL
                     RTSVGQWDQNFTNLSDASEPKALPLFHDVWATMTIGWGNASDIPWEWPQF"
     gene            <120581..>122409
                     /locus_tag="TRUGW13939_02501"
                     /db_xref="GeneID:55990009"
     mRNA            join(<120581..121391,121442..121783,121829..>122409)
                     /locus_tag="TRUGW13939_02501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485694.1"
                     /db_xref="GeneID:55990009"
     CDS             join(120581..121391,121442..121783,121829..122409)
                     /locus_tag="TRUGW13939_02501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341587.1"
                     /db_xref="GeneID:55990009"
                     /translation="MAFGESLHDVVRDAPLGQLVRLFTNNRLFQYPEERPDFKLPEPW
                     IRMLSDADIDRTARPELAMPSTISNLNVVEVVEDSNAAELDIESKEFPEGKSTRLTPK
                     ITKDGSILVDWYYEQDIANPHNWSNLRRALLALIICLYTFVVYLSSAIYSSSTQGVME
                     KFGVSNLKATLGLAMYVLGYGVGPLLFSPLSEIPRIGRNPIYIITFAIFVILSIPTAL
                     VNNFPGLIVLRFLQGFFGSPCLAAGGASMSDMYSMINLPFAMIAWVGAMSCGPSFGPL
                     LSGFAVPAENWRWSLYESIWASAPVLIALFIFMPETSGPNILLRRAQRLRKLTGSQKL
                     MSQSEIDQSHMNVSSIAIDALIKPLEITIKDPAVLFVQVYSGIVYGIYYSYFEVFPLV
                     FPVYYGMNLGEVGLVFICIAVGCIFAIIGYGSLLYFVITPRIKKVGMGPQENVLLPGL
                     PISFGPPLGLFMFAWTARASIHWIVPTIGVTIYAGSIFTLLQCMFLYIPLSYPKYAAS
                     LFAANDFFRSALASGSILFAHPLYHNLGFAKGTSVLGGLSIIGIIGMFLLYFYGAKLR
                     ALSRFATYTKD"
     gene            <123644..>125150
                     /locus_tag="TRUGW13939_02502"
                     /db_xref="GeneID:55990010"
     mRNA            join(<123644..124252,124311..>125150)
                     /locus_tag="TRUGW13939_02502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485695.1"
                     /db_xref="GeneID:55990010"
     CDS             join(123644..124252,124311..125150)
                     /locus_tag="TRUGW13939_02502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341588.1"
                     /db_xref="GeneID:55990010"
                     /translation="MFGGKLYVLPALVFALQTFATTVDYKTLKTDKGDGIPDFSFCGY
                     HASDDPLPPSDRQPATIINASSGDQTQRIQNELNKISAAGGGVLALGAGKYHLSAGLV
                     IPNGTVLRGAGSDKTTLLPKDGSMHVITMGSDDINDPKSGNSVSITDDYVPVGATNVT
                     VDSASGLKVGQDVWVQRQVTQEWIDAMGMGDLVRDGKHQTWLSTSSFVQQPRKIQSIS
                     GKVITVDIPLTDTLDSEYMSPELAPYDVPEGPSEMGVEALSMTVEPTCSGVVIDDDSC
                     SGAAVSFLSWTVDSYLRDVSLTGFNNVIGISKNARRLTIQNVSITRDHATDNGAGYAA
                     DIGISGTQILVIDSSTNGPQDGKSFPVVTQSLTPGPNAVVRYHAEQVQKGIQPHARWA
                     HGFLVDNSTVTTSFINRGTDGSGHGWAINSGVMWNVDGDYEVQSPPLGTNWGIGCNGD
                     KQSDSNGTFVAQGHTIQPASLFEQQLSDRGLA"
     gene            <126128..>126676
                     /locus_tag="TRUGW13939_02503"
                     /db_xref="GeneID:55990011"
     mRNA            join(<126128..126370,126434..>126676)
                     /locus_tag="TRUGW13939_02503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485696.1"
                     /db_xref="GeneID:55990011"
     CDS             join(126128..126370,126434..126676)
                     /locus_tag="TRUGW13939_02503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341589.1"
                     /db_xref="GeneID:55990011"
                     /translation="MNPFIRSFQSGEAWHRIGLASEFPDIAQDKNGCQITPSCKAFRI
                     PHTKDQDPVETSIDLPGDLKDQVLVFKYKGNFHAVDHQCPHSSFPLSQGRIFDIEDFG
                     ITLSTGITCPKHEWSFDIVSGQADRGNYKLKVWEVQLRDHPVSNAIDKEVWVRRKPRI
                     G"
     gene            complement(<127196..>128758)
                     /locus_tag="TRUGW13939_02504"
                     /db_xref="GeneID:55990012"
     mRNA            complement(join(<127196..127644,127876..>128758))
                     /locus_tag="TRUGW13939_02504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485697.1"
                     /db_xref="GeneID:55990012"
     CDS             complement(join(127196..127644,127876..128758))
                     /locus_tag="TRUGW13939_02504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341590.1"
                     /db_xref="GeneID:55990012"
                     /translation="MSANIVIWSVLGLVFLRVLYERIRDRSLPPGPPRLPLIGNLHQA
                     PTDAPWLTYQKWIKQYGPIVSAQFGGNTVIFIGDATIARELLEKRGHIYSDRPRLVMA
                     GENLTKGMHLLLRRYDERYKLHQRLDAPVLSPRASKTYYPMQDLESKQLLFDFLSTNN
                     FQKVYERYAGSLVYSLAYGIRLHTGNEPMLHHAHQVQENFGYAGRVGTWIVDALPFLN
                     HLPPSLAPWKKTAEKFYQIEKALHLGNMQTGLASKGWNWTKEFSKSKQSDPMSEIELA
                     YNLGILADAGFDTTSVQMQATVLGIFWAMALDENKFDRPLEFLPERWLEKSDDGKDQF
                     VNFFGHGRRICTGRHIAKNSLFLLIARILWGFNIRHAVDQDGKIKEVDDLAMTSGFVS
                     SPLPFEAVFEPRSAHSKEVIGNSWHSTEKDVDVLMDSIKAQQISAGLNVLA"
     gene            <130509..>131919
                     /locus_tag="TRUGW13939_02505"
                     /db_xref="GeneID:55990013"
     mRNA            join(<130509..130561,130619..130655,130751..131132,
                     131185..131302,131386..131453,131521..131558,
                     131653..>131919)
                     /locus_tag="TRUGW13939_02505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485698.1"
                     /db_xref="GeneID:55990013"
     CDS             join(130509..130561,130619..130655,130751..131132,
                     131185..131302,131386..131453,131521..131558,
                     131653..131919)
                     /locus_tag="TRUGW13939_02505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341591.1"
                     /db_xref="GeneID:55990013"
                     /translation="MTNDYRSTLIAVGWSLAGKGWEDGLMMFAWAGAIVTTALVTLST
                     TYGFGLHFDAIDSAANKSLATKYTLIPPAISLLSAGAAKISIVIFLMRILGSSAKLPY
                     KLILYIPTIIMIGANIFAMVVLLGYCTPPQKAWNPSIPGHCMSAETLDIGGRAVTVYN
                     AAMDFLCAFFPIYMVWRLNMKTRTKWGLAVVMGGGILGAAASLVKVVMMSNIKNTSDI
                     TYSWAPIALWYMTEMFAIIIAGSIPTLRPLWKVIRGLQSTSQSNLSSGYRSNSQPIKK
                     NSSKSKDGSTPAAPGLYTIALRDLDKDGSDLESNGPRSSRERIL"
     gene            complement(<132511..>134097)
                     /locus_tag="TRUGW13939_02506"
                     /db_xref="GeneID:55990014"
     mRNA            complement(<132511..>134097)
                     /locus_tag="TRUGW13939_02506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485699.1"
                     /db_xref="GeneID:55990014"
     CDS             complement(132511..134097)
                     /locus_tag="TRUGW13939_02506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341592.1"
                     /db_xref="GeneID:55990014"
                     /translation="MKFTLLSIIVLAADAVLGRHVHHTKDRLAVITNTGTYTGLIDSK
                     FPKTRQFRSIAFAQPPIQSRRWLPPQKLPLSTEHYDSYNFPPSCPQFVSKIPTLNNQY
                     FAKGTLVNNGNQNDTSGLSGANTSEDCLYLAVWTPANATIHSKLPVLFFMSGGGFSTG
                     GIDISYQLPTDWIERSQSHLVVTINYRVNIFGFPNARGLAEQNLGTLDQRAALEWVRD
                     NIVQFGGDPDKITLWGQSAGSMSADAHAHAFYDEPIASAYFLQSGTVFTSPAVTDTTY
                     SNFSFVAKKSGCQFDDDSGGIAELECMRQVPFDKIENLIGQYADSGQHPALNFIPVVD
                     ESIIFSDYEARARAGKVAHRPTILSNTANEMSSMVPLPSNLTRGPDQALVLAYDVAMW
                     ICPTYNSTIERSRLGIPVFRYQHAGTYPNLNPFKWLGAYHGSDVPMNFGTYGLLTTLA
                     NTSEFEAEVSRTMQDHILAFAKDPYHGPQKIGWKPIVASNRFSGEIIRFGANGRVIQY
                     VNETEVDGTCQGVGTYNAFP"
     gene            complement(<135787..>138525)
                     /locus_tag="TRUGW13939_02507"
                     /db_xref="GeneID:55990015"
     mRNA            complement(join(<135787..137097,137154..137639,
                     137692..138269,138324..>138525))
                     /locus_tag="TRUGW13939_02507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485700.1"
                     /db_xref="GeneID:55990015"
     CDS             complement(join(135787..137097,137154..137639,
                     137692..138269,138324..138525))
                     /locus_tag="TRUGW13939_02507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341593.1"
                     /db_xref="GeneID:55990015"
                     /translation="MFRRVVHSLLFLSTAVAVSIDACPGYNASNVVSTSSRLTADLNL
                     AGDACNLYSRDAHYLKLLVEMQTDSRLHVKIYDEVLEVYQIPSSFLEVPSGGNSTQDS
                     SDLSFSYTSYPFSFSVQRKSTGDTIFNSSGSNLVFESQYVRLRTQLPDDPYIYGLGED
                     SDRFRRETKNYTRTLWNMGNPGLPNHENLYGSHPFYLEMRNGQAHGVFLWNSNGMDIK
                     IDQDTNGQYLEYNINGGVLDFYFVSGPQPADVSRQYANIIGTPTAQSYWTYGFHQCRY
                     GYQDVMEVAEVVYNYSIAGIPLETMWTDIDYMDLRRTWTLDPDRFPLEKMQELVTYLH
                     DHQQQYILMVDPPVSLNDSASWENAVQLDVLMKNSSGETFVGGMWPGPVGYVDWFHPN
                     AQSFWSGQIASFFDDDNGVGVDGVWIDMNEPANFCAPCSNPYSETAPTPPDVRTSWEP
                     LPGFPADFQPPSSSFTEKRDAQGNSTGLPGRDLDNPPYKIQAKYGTLWGWTVWPSAPN
                     YGGYEQYDIHNLYASGMISHTRKGLLDRRPDERPFIISRSTFSGDGAQSGHWTGDNDS
                     KWSHYLLSIVQHQEFASIFQMPMVGSDVCGFNQDTHVNLCARWAMLGAWYPFYRNHNA
                     NNAVAQEFYLWPLVTEAAKKAISTRFALLDYFYTAFYQQTVDGSPSTIIPLFFQYPND
                     TNTLDISYQFFYGPSILVSPVTIEDATNVTIYLPEDTFYDYWSGQRIIGNGTNITLTD
                     IGHTDIPVHIRGGSILPLRTDADTVNTTAALRNKNFTLLIAPDNSGRAAGYLHLDDGK
                     SLNSTSSDINFSYENGSLALGGTFGYSTDLQVISAKVLGDGSGATFNLTKSLNKPWVV
                     NI"
     gene            complement(<139300..>143651)
                     /locus_tag="TRUGW13939_02508"
                     /db_xref="GeneID:55990016"
     mRNA            complement(join(<139300..139986,140049..140239,
                     140295..140410,140463..140992,141070..141239,
                     141322..142087,142148..142294,142353..142632,
                     142729..143188,143513..>143651))
                     /locus_tag="TRUGW13939_02508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485701.1"
                     /db_xref="GeneID:55990016"
     CDS             complement(join(139300..139986,140049..140239,
                     140295..140410,140463..140992,141070..141239,
                     141322..142087,142148..142294,142353..142632,
                     142729..143188,143513..143651))
                     /locus_tag="TRUGW13939_02508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341594.1"
                     /db_xref="GeneID:55990016"
                     /translation="MAVYLDPREAEDTAVAANDGYIPIESEKENKEPAEEKKNGTNGL
                     LVSIVRLVATYIYASCFTYVAYYLTRNVRQSYLRAALSQEIAYYDRSTSGSISQQATT
                     NGKLIQSGIGEKLGIVIQAISTFVAAFVIAFVTQWKLTLILIFMVPTLIIALGMAGGI
                     DAMIEAKILQVYAQAGSYAENVLGGVRHRHARPRRDFRPSVLFSVIMAANTIMQIAPH
                     MVTFSRAATAASELFTLIDRKSEIDPFDESGEKPEGTAGVINMHGIDFSYPTRPDATV
                     LEGFSLRIPAGKVTALVGPSGSGKSTIVGLLERWYNPCAGSISLDGNDISQLNLKWLR
                     TNIRLVQQEPVLFNGSVFENISNGLVGTQWEEASQDDQMQRVQEAAKIAFAHDFIQEL
                     PQGYQTRIGERGGLLSGGQKQRIAIARSIISEPKILLLDEATSALDPHAEGLVQKALD
                     SASKNRTTIVIAHKLATIRNADNIVVMSNGKIMEQGHHEELVSRDGIYATFVKAQDLA
                     PNHVKENHDSEGTITLDEASERRGDHVIRDQSLARIRTTEAQQLATLKDRENHDFNEK
                     TGIIHSIWKLLRGSPEIWLWFAITTVTCIAGAAVNPGQAFLLGNIMSVFTSPDIVARG
                     NFIALMFFVMSLGILVVYFVMGWSTNSIAQCLSRKMRREIFESFLRQDIQFFDRPENT
                     VGALISRLDSYPQAILELMGFNVAIILMSVLNIVASSILAIAVSWKLGLVGVFVGLPT
                     MMLGGYARVRLETNMDDEMGHRLSASASVASETVMAIRTVSSLAIETTVLKKYVDELD
                     LGISHTIGPMFHMMAWFSLTQSVEYFVLALGFWWGSKLINDGEISLYQFIVSFMGVYF
                     SGQATALAFSFASSFTKANQAANYYFWLDGLSGTICETNDNLKERPVYGCCSYDFQDV
                     QFSYPLAPHNRVINSVSLSIRRGDFVAFVGASGCGKSTMVSLLERFYDPASGSITIDS
                     SSPLSSINPLLYRKQVALVQQEPTLFPGTIRENISQGVPDLIVTEEASEEVLEEACRA
                     ANAWDFVSSLPEGLDTPCGTSGNHLSGGQRQRIAIARALVRKPNVILPDEATSALDTE
                     SEKLVQGALSGAASSRDRITIAVAHRLSTVRDASCIFVFYAGKIVEAGTHGELVAKGG
                     MYARMCEAQRLHGAA"
     gene            <144658..>146888
                     /locus_tag="TRUGW13939_02509"
                     /db_xref="GeneID:55990017"
     mRNA            join(<144658..145452,145523..145960,146020..146276,
                     146339..>146888)
                     /locus_tag="TRUGW13939_02509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485702.1"
                     /db_xref="GeneID:55990017"
     CDS             join(144658..145452,145523..145960,146020..146276,
                     146339..146888)
                     /locus_tag="TRUGW13939_02509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341595.1"
                     /db_xref="GeneID:55990017"
                     /translation="MLNERMSRLSHEPTNSRTSNSLDFAGPIKSIQEEHCLLEPTPSA
                     SSIGSIRNQETLSYRPTSEGIREFHYDSSKEEHEGESSLFAHAVFASRFLQNAIDNTT
                     NSEVAHEMEAALDGLRSAVNSGKPQSDTLDKLYPHARAIPLGSTTRGLPLPTMDKVFM
                     CFRMARESSQVAMLWLGNLMRPAQFNDYFFKIASPSPTTEADLVIVHCGLYWLFCECS
                     KVATNEETKQDYDAQAFICEVNLETVLANLRFHQPTNIDFVYAMGMASLYCLQKSKPS
                     TAWNFINSASHMIQALGLQHNVPACIEGPEEQAQKRDLFWTIYTTEKMLSLRLGRPST
                     FRDQDITLTRIGMGRPNGSFLAELAPGWVNMATIQGRIYDDIYSPGALTQPPHIRNSR
                     ARDLAAELKTTMRRTQDTHDHYEASKGHVMGVDYHEIARRYDRVVGLCMLTLIYRSIA
                     PEIPSTSAFCQECIDAARDTLKEHNRCVAVITKARGKTVLLETYINWTIIQSPFIPFI
                     ILFCHVIETSKTSDLEHMRGVVETLESTSNTPVHNTCAKQRRLFKALYDVAEKYVEVK
                     SRDDSGQVGMPWSMQYVGVFARKASNELALSPLDSAGIVGDSGTTNTVDAPGPLPLHS
                     EANGESMGLVGGLGGPMVFRNTAFGDVDVEMDLSGAQLWDWFNKNQSMMRMLEDT"
     gene            <147153..>148338
                     /locus_tag="TRUGW13939_02510"
                     /db_xref="GeneID:55990018"
     mRNA            join(<147153..147373,147441..147781,147851..>148338)
                     /locus_tag="TRUGW13939_02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485703.1"
                     /db_xref="GeneID:55990018"
     CDS             join(147153..147373,147441..147781,147851..148338)
                     /locus_tag="TRUGW13939_02510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341596.1"
                     /db_xref="GeneID:55990018"
                     /translation="MATSEYSNCQTPLSPSIYAKRSPGDIEEGRHVYRPGGFHPVYVG
                     DIYHDRYEVLSKLGYGAYSTVWLARDTQRQKRDSSEFIALKVLSAECYGAEKDLFERE
                     ILTHLKNGNPKQVGYDQICHLVDDFEHKGPNGTHVCLVFELIGESLRSFGGWFPESMI
                     PESVMRRFTIQLLLALDYAHDHNVIHTDIQPSNIFVKMRDYTLIESGYLVKELMPHQE
                     KNEERYTVVPSRSFRRYYFNITDNFSHFDIVLGDWGVSSWADKHLTEKIQPVALRAPE
                     VLIEAPWDATTDFWNLGAVLLELFCAVRMFSGEVPPDGHYELKQHLTEIVDLFGPVPK
                     AFTGERLSRYRPIGF"
     gene            complement(<148875..>150494)
                     /locus_tag="TRUGW13939_02511"
                     /db_xref="GeneID:55990019"
     mRNA            complement(join(<148875..149325,149390..150200,
                     150263..>150494))
                     /locus_tag="TRUGW13939_02511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485704.1"
                     /db_xref="GeneID:55990019"
     CDS             complement(join(148875..149325,149390..150200,
                     150263..150494))
                     /locus_tag="TRUGW13939_02511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341597.1"
                     /db_xref="GeneID:55990019"
                     /translation="MFFEKILVPCLISSAIGLASPTIGHGIKKRADIDSFITTEGAIA
                     YKGTLANIGPNGTGAPGASAGIVVASPSKTDPDYFYTWTRDSALTFTALIERFIAGDS
                     SLKTLIEQYITAQEHLQTVDNPSGGLSDGTGLAEPKFYVNMTAFTGAWGRPQRDGPAL
                     RASALIAYGNYLISQGSESLVLSNIWPVVENDLSYVAQYWNQTGFDLWEEVEGSSFFT
                     IASQHKALVEGNTFATSLNKSCDGCVSQAPLVLCFLQSFWNGSAVISNLGSSGRSGLD
                     ANSVLGSIHTFDPSAACDDATFQPCSSRALSNHKVYVDSFRAVYSINSGIEAGSAASV
                     GRYPEDSYQGGNPWYLCTLAAAEQLYDAIYQWSKQGSLTITTTSLPFFQDLVSDAAVG
                     NYSSSSTTYKSLTSAVKTYADGFVSLVEKYTPTDGALAEQYGRDDGSPLSAADLTWSY
                     ASFLTAAARRNGTVPASWGESSGNDVPSACSSGSASGTYVTPTATSW"
     gene            complement(<151748..>152383)
                     /locus_tag="TRUGW13939_02512"
                     /db_xref="GeneID:55990020"
     mRNA            complement(<151748..>152383)
                     /locus_tag="TRUGW13939_02512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485705.1"
                     /db_xref="GeneID:55990020"
     CDS             complement(151748..152383)
                     /locus_tag="TRUGW13939_02512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341598.1"
                     /db_xref="GeneID:55990020"
                     /translation="MSDQGYPDIHVDLDAGEKNVELGGISKEVWKTLEEKWGNLAKAL
                     HRLNIFLNFHDHYKHDDDAPDSVDWAMTKGAPSVNNTKIELAEIRYGRIESIAPKDSL
                     WFIIKHHQDPQGPIHKMSTFYSSVQIYNGDKTVKHKILPDVPVRVIEATQHGLDTYVL
                     LAMHAEPNEWGPVLNICKGRLEVKESVTVRVMDSKPQGKHRSATWKGEEKN"
     gene            <154213..>154899
                     /locus_tag="TRUGW13939_02513"
                     /db_xref="GeneID:55990021"
     mRNA            <154213..>154899
                     /locus_tag="TRUGW13939_02513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485706.1"
                     /db_xref="GeneID:55990021"
     CDS             154213..154899
                     /locus_tag="TRUGW13939_02513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341599.1"
                     /db_xref="GeneID:55990021"
                     /translation="MGSPSSFCGVTLVDSPVVRLAFEFAKENLDEVSFRHVYRSWIFG
                     AILASKIPAFAKINFEVHAISTLLHDLAWDHLSSFSTPDKRFEVDGANAARKFLEREA
                     PQFDNRQLQLVWDSIALHATPSIAQHKEPEVALCTMGITVDFLGSRFPGGLITDDEYN
                     AVVKELPSVDFKESVKRKMCGLCANKPETTYDNFVRDFGERFVVGYSARVINSVDILL
                     GADWRRGPVE"
     gene            <155468..>156558
                     /locus_tag="TRUGW13939_02514"
                     /db_xref="GeneID:55990022"
     mRNA            join(<155468..155912,156071..>156558)
                     /locus_tag="TRUGW13939_02514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485707.1"
                     /db_xref="GeneID:55990022"
     CDS             join(155468..155912,156071..156558)
                     /locus_tag="TRUGW13939_02514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341600.1"
                     /db_xref="GeneID:55990022"
                     /translation="MSTPSETHKRKTPTGKLYAIADIHVAFAYNQEAWAGLSPHPGDG
                     LILCGDIGETVEHLRLAFSTATRCFDTVWWCPGNHELYTLPTGSSADFRGEEKYQQCV
                     EVARSYDVLTPEDDFVVWGGQGGPTVIAPIFTLYDYTFKPDDVAVENAVAWAKEQNIE
                     ATDEFLLHPDPYSSRQEWCSELVKKFEAKLEAAQAQFPSLPFVIANHWPLRKDLATLK
                     FIPRFVIWCGTALTEDWHRRFNARAVISGHLHIRRTDWKDGCRFEEVSLGYPRQWKHC
                     AEMGLEVNDLLREVLPGPEPPENGEAPVQWRRYG"
     gene            <157305..>159481
                     /locus_tag="TRUGW13939_02515"
                     /db_xref="GeneID:55990023"
     mRNA            join(<157305..158192,158252..158682,158734..>159481)
                     /locus_tag="TRUGW13939_02515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485708.1"
                     /db_xref="GeneID:55990023"
     CDS             join(157305..158192,158252..158682,158734..159481)
                     /locus_tag="TRUGW13939_02515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341601.1"
                     /db_xref="GeneID:55990023"
                     /translation="MLFFKPVIAVLYHFILVSQALASKCWQNTACTGPKEPSFLGPWE
                     ANVLSPASRTVSPVSVLDNNHQFLSTYPAKVYLGGNGSLFVFDFGQEVGGIVNVNYTA
                     SGEGSLGLAFSESKNFTGYTSDESNGGSGPDGALYVNITSESLENGSYTMPLNKLRGG
                     FRYLSLYTLTDNSTISVEIDTVELEISFQPTWEDLRAYGGYFDSNDQLLNRIWYASAY
                     TVQTNIVPPSTGRVWPAPTEGWSNDAIIGNGTGILVDGAKRDRAVWAGDLGISIPSVL
                     VSIGDADSAKSALDVQYAHQQPYSQKENTGELPEVGPPISFYGSDTYHMTTMIATYDY
                     VLYSNDLKWLRSIWAGYQNAMVYITSKIDDTTGLLNVTGASGWGRSATDEGYSTIGNM
                     LLYRALISGSELANWLDQPSLATSWQELASILKVAVNSPDNNWDPTAGAFKNTATDDS
                     IFPEDGNSMALYFDGANSSYAARISKQLTTNWGPIGAVTPELPGNIVPFVESYEIKGH
                     LAIRETQRALDLMRLSWGWYVSNPYGTESTMIEGYYEDGSFRYANDGYDNAGSYPSHS
                     HAWSSGPVDSLISYVVGMRPTAPGGAQWALAPQFGDLSRAEGGFTTPLGKYSARWILN
                     RSGYTLEYDVPTNSNGILMLPSRSKLPKIEWDGIPQSQGTFNSSTGLTEIYGPGGKHR
                     LSVVFS"
     gene            <160525..>161409
                     /locus_tag="TRUGW13939_02516"
                     /db_xref="GeneID:55990024"
     mRNA            <160525..>161409
                     /locus_tag="TRUGW13939_02516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485709.1"
                     /db_xref="GeneID:55990024"
     CDS             160525..161409
                     /locus_tag="TRUGW13939_02516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341602.1"
                     /db_xref="GeneID:55990024"
                     /translation="MRSIAQITALSMATGATALDILGISIPDGLFTGPWYGAPDNDFD
                     CVDAQGRNPVVLIHALAASREVDLNLLHKNMTSEGWCVFSQTYGSPINPPLIGGLTEM
                     TESAADVGAFILEVAQKTGGKVDVVGHSEGGVQTLYVPMVQPDVAAVIDHAIALGPAV
                     HGAHYFGFTDFYQSLPTPFPTLLKAAIEPLCDACIDMENNDGDIYIAFKNSPKIVPNN
                     INATIIMSKDDTLVPINTSRIDEPNVSNLVVQDFCPDDHLGHADLAWSESVWGIVKNQ
                     LQETNDPFNCDTGASFRK"
     gene            complement(<163545..>165361)
                     /locus_tag="TRUGW13939_02517"
                     /db_xref="GeneID:55990025"
     mRNA            complement(join(<163545..163594,163665..163978,
                     164029..164264,164326..164422,164493..165188,
                     165246..>165361))
                     /locus_tag="TRUGW13939_02517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485710.1"
                     /db_xref="GeneID:55990025"
     CDS             complement(join(163545..163594,163665..163978,
                     164029..164264,164326..164422,164493..165188,
                     165246..165361))
                     /locus_tag="TRUGW13939_02517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341603.1"
                     /db_xref="GeneID:55990025"
                     /translation="MQAISNEPGANEAQLVCTSCKTRKRKCDKALPKCSPCSKKRLKC
                     EYLQPVPNGDSTQTDQPWHSISIVNESQHNSRAIDFPTMLFLDPTILQQSQVELYQTT
                     FHIPGQILGYLGDMDDIRNIASKFFTHVHVWMPFISKKRFYEVYLPSYSKYRPDVTLL
                     FLSLKLLTSSPPRDPQNPQTRLYRAVKHFLVEVEDSTVFSILVLQAGVLLALYELGHG
                     IYPAAFLTIGACARYAYALGIKTKTAASTRRVLTLVEVEERKRVWWALVILDRFVSIG
                     CPGRPFVTEDPTLDDLFPIDDEAWDKGIVRLEDSFTLSAPKASHMSKFALLCQAARLL
                     GQVLHHLSSNSVDSHDAWIQLERTIQSMLAASLDSENPDNDQIAFVYSTLVALHTPWL
                     SPGPGMAIMDAERSNHAREVIQQILHKVKTNLVEQKCFLARDPDDISPWGLFFAYRLC
                     VDHIRSGERASGPDFSEVIKSLKETFVTIDARWNVAGVYLKLLEAQEATSYF"
     gene            <165847..>166848
                     /locus_tag="TRUGW13939_02518"
                     /db_xref="GeneID:55990026"
     mRNA            <165847..>166848
                     /locus_tag="TRUGW13939_02518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485711.1"
                     /db_xref="GeneID:55990026"
     CDS             165847..166848
                     /locus_tag="TRUGW13939_02518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341604.1"
                     /db_xref="GeneID:55990026"
                     /translation="MSRYAASHIKPEGAGDSRPTALQIIRDEGLENKLAGKVVVITGA
                     TSGIGLETARALSATGATLFLTARDLPKAKTCLHGILESDLVSLVEMDNTSIASVRNA
                     AATILEKSNGLVNILINNAGIMGITNLTLTEDQHEIHFAVNYLSHFLLFQLLRPALLA
                     SATSDFSSRVVNVSSSAHRAGNLDHLVNDNFEEGKYDHEVAYANSKLANVYMANEIDR
                     RYGHKGLHATSLHPGGINTNISRHIGPEFVAQIMTNPEVLKILKSAEQGAATTVIAAI
                     GKDWEGKGGKYLENCEEAKRGPDDNNVFGVGWVRQTYNSETEGRLWRDSLKVLGMST"
     gene            complement(<168321..>169626)
                     /locus_tag="TRUGW13939_02519"
                     /db_xref="GeneID:55990027"
     mRNA            complement(join(<168321..168712,168765..168930,
                     168977..169119,169173..169322,169389..>169626))
                     /locus_tag="TRUGW13939_02519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485712.1"
                     /db_xref="GeneID:55990027"
     CDS             complement(join(168321..168712,168765..168930,
                     168977..169119,169173..169322,169389..169626))
                     /locus_tag="TRUGW13939_02519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341605.1"
                     /db_xref="GeneID:55990027"
                     /translation="MVNLKTFLWCLAIGQAALVQAHPGHDVKTEAIERAAALKNRRGL
                     SQCADTLSARGFESKNAMRRDLAVQQLRRQKAIRRSTPNLVDRDLGSLNTSHHSTLDV
                     DFQTDPDVLFSSNATCILTPDVTQGPYYVSGELIREDVVEDQPGVPLFLDVQLVDSTT
                     CEPVPSSFVEIWHCNSTGVYSGVVANGNGNYDDATNINKTFLRGIQQTDEDGVIKFET
                     IFPGHYTGRATHIHVLAHAINETVRLANDTVSGLYTAHASSVGQIFFDQDLITNVEET
                     TPYADNTQELTENSSDDILLQEADDIDPFVEYVYLNDDDVSDGIFAWISLAIDSSEDS
                     SITPAAYLTSSGGIANEDSGSGGGSPPS"
     gene            complement(<175321..>176159)
                     /locus_tag="TRUGW13939_02520"
                     /db_xref="GeneID:55990028"
     mRNA            complement(join(<175321..175661,175727..>176159))
                     /locus_tag="TRUGW13939_02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485713.1"
                     /db_xref="GeneID:55990028"
     CDS             complement(join(175321..175661,175727..176159))
                     /locus_tag="TRUGW13939_02520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341606.1"
                     /db_xref="GeneID:55990028"
                     /translation="MGPIDVRPATLEDAVSIAEVHYKAIEKYHVFYAGFLCTHPRDII
                     PKSTESALRNHKNIFLVAVDTTTGQIMGFIRYQIVPKVAEPKQPEPEQPLAQLNQAHL
                     SQSVVSLYAPKDHLKDLWKKFNEREDEMEACYQGTARGEEHFYVKHIMVDPVHQRKGI
                     GAKLLSTVLERSDAEGRPTFLVASAEAHYLYSKLGFVDLEVFKIDNEAWSREVLDLER
                     KLGIDVDQRFEDECKGLHEVESYMVRRTSRDHRNKGASA"
     gene            complement(<177285..>179175)
                     /locus_tag="TRUGW13939_02521"
                     /db_xref="GeneID:55990029"
     mRNA            complement(join(<177285..178274,178333..178512,
                     178576..>179175))
                     /locus_tag="TRUGW13939_02521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485714.1"
                     /db_xref="GeneID:55990029"
     CDS             complement(join(177285..178274,178333..178512,
                     178576..179175))
                     /locus_tag="TRUGW13939_02521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341607.1"
                     /db_xref="GeneID:55990029"
                     /translation="MSSLTNYIAFLASNAVSTGVSRIGHYDEASDTIHPLSFVSGTPI
                     STLYQVIEAGEHNIVASRGEEPLPLSKVKILPPIDGRDILAVGKNYSEHAKEFNQSGY
                     DSSDKVDQPSCPVIFTKRATSIIATGEDIYPHAEFTQTADYEGEIGVIIGKPGYRITE
                     ADALDHVWGYTIVNDMTARERQRDHKQFFIGKSPDTYCPIGPLAVPASYLPKKLQVKT
                     HVNGELRQDATTDDLIFSIPTLIKTISEGQTLQPGDVIATGTPAGVGIGKTPPVFLKP
                     GDEVAVSVSGLGTLRNRIASQSAVNTTVNRIQKQSHIHLTNWSKSINGTGLVDIGGKL
                     LNYKHLGRNDGPPIVFVHGLGGTVDYWTPLVSANKLAETYSLHLFDLEGHGLSPTSPL
                     SVLSISSFAEDIKDVVQHANLSSGITLVAHSMGCLVALAFVLANPGKVSKLILVGPPP
                     SPLPVAASQGSYARAATVRSQGMSAVVDAVTTAGTSDNTKKNNAVALTAVRLSLLGQD
                     PEGYAKACTALAGATNTLDINQVDAETLIITGDEDKVSPPALCEKYKSTIPRCTVEVL
                     PQTGHWHLFENLGGVSRAVQGFL"
     gene            <179714..>180633
                     /locus_tag="TRUGW13939_02522"
                     /db_xref="GeneID:55990030"
     mRNA            join(<179714..179900,179971..180107,180160..180493,
                     180551..>180633)
                     /locus_tag="TRUGW13939_02522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485715.1"
                     /db_xref="GeneID:55990030"
     CDS             join(<179714..179900,179971..180107,180160..180493,
                     180551..180633)
                     /locus_tag="TRUGW13939_02522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341608.1"
                     /db_xref="GeneID:55990030"
                     /translation="ERPDMPDQIAKMASNGDSSKIEDLEKLRTAGGHIDSRGQPSLPI
                     VHRRLANPSPLGLLSFATGIFLISIFGVQARGLTTPNLLISVLIFFGGVCQFIAGIAE
                     IVAGNTFGATVFPSYGAFNLSYAMIYLPGSGIMAAYTDSTTGAISPEFNQALAMYVWA
                     WFILTVIFTIAAMRSSWILFLDLFFLDIMLILLAAGFMVNSQTVLTAAYSFGFIVAFL
                     SYWAGCAGLWADGITPIDLPTFAMYKED"
     gene            <181398..>185324
                     /locus_tag="TRUGW13939_02523"
                     /db_xref="GeneID:55990031"
     mRNA            join(<181398..182087,182151..183355,183418..183579,
                     183650..184023,184196..184236,184333..184446,
                     184503..>185324)
                     /locus_tag="TRUGW13939_02523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485716.1"
                     /db_xref="GeneID:55990031"
     CDS             join(181398..182087,182151..183355,183418..183579,
                     183650..184023,184196..184236,184333..184446,
                     184503..185324)
                     /locus_tag="TRUGW13939_02523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341609.1"
                     /db_xref="GeneID:55990031"
                     /translation="MPTPKRRMPISCEPCRGRKIRCLRAKDSAGCCETCIRRGIPPSQ
                     CVFLGYHHHYLQPAGERSSDDPSNGELLARIRDLEHLVRGQAANSPSPPIPSVHNGLT
                     PSTQASSSLGPGSNGYKSETEESAMPAQLTPPMYESSRPQHASYGTLSMSDRGHVQFN
                     PHGSQWSSVLKDDSTTVASVANFEYDDDESAADFPFNLAACTKPEDLLAALPPVRQCD
                     ALKNAYFDVFAPLFHILHNPTFHKEYISFQKEPESAPLSWLALLYVILSISVTALDDN
                     DPILHDLGRKKTSGQNASVLMLRYRNAAMQCLSADRYLFRHNMYTIQALVLLIYGINH
                     THGKTWALLGVAYNIATALGCHIDPAHFTTLSAIQCEERRRCWAGLMMLYTIQNISMG
                     NFEQRHIKADVQLPANINDEDLTDLEVSDNSHSIASISVDAPTQMSYVLFKFRLYHLC
                     SKVCNQIFGPTHPTYSAVLQCDAEIAAEQDSWTDRYLTESQTGNILTYHHVHLNILYG
                     YSHQMSLLLHRPVLLNRSSAGYTDDEVKRSRVQCLKSARGLLGLQQMFHESAQFQPYR
                     WYSLGLGSFYAFHAAIILVTLLPEVKDEVEYVENRRLLEVSLSIFEQTRNRSRMCAKA
                     APILRHLLFPTPPLSFGSSSTESIQPNAPPMPVPDYPTQMEVLMTQLQPQQWLSQPSM
                     SWDGFYTSFAKNIFEVIVVKAAIIPRMRGNHKTPVYAKDDLSLPRAHFIFSEIGSRKS
                     APSSQYWYSAFAGLSRSSIKMTEDRKTCPLHSRRICSNHTAIGWNSRRFGILRVGQKS
                     DAATITSPQLRLGDLVTTLNQPIPRLHIHVKELHPTFGAEISGVDFSVPVADEIFRDI
                     LAAVTLYGVVVFRKTSLNDDSHVAFARQFGRLDDVKPYVKAGRPNRLKHDELFDVSNV
                     EMDGSLLDPESPRGQAGKGNGLFHVDSSFNPRRAGYSLLLAHELPPPGAGTGGQTAFA
                     DTRTAFADLSSNIKESLLKNDYVAAHSIHHSRKLAAPDFFADMNPLDHPMGRHKLVQR
                     HEASGRMNLYIAAHIHHIEGLSETESADLLRNLFTHASQDKYVMEVQWHNPGDLVIWD
                     NTCTMHRAVGGSFLRKYKRDMRRATVHDKSSYAWGLNEHTDERQGLP"
     gene            <188234..>189074
                     /locus_tag="TRUGW13939_02524"
                     /db_xref="GeneID:55990032"
     mRNA            join(<188234..188646,188710..188930,188995..>189074)
                     /locus_tag="TRUGW13939_02524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485717.1"
                     /db_xref="GeneID:55990032"
     CDS             join(188234..188646,188710..188930,188995..189074)
                     /locus_tag="TRUGW13939_02524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341610.1"
                     /db_xref="GeneID:55990032"
                     /translation="MLKSILLGLAAMAYAQETTLCSQYATYTSGSYTVNNNLWGEDSG
                     SGSQCTYVKSISDSDVSWSTTWNWSGGSSEVKSYANSQLSGFTKKYLSQLSSIATSVN
                     WSYDNTDINADVSYDLFTAADINHVTYSGDYELMVWLGKYGSIQPLGSQIATANVAGI
                     TWQLWYGTNGSQKTYSFVASSAQTTWSGDLMDFFNYLAENENFPASSQYLINLQFGTE
                     PFTGGNSTLTVESWSASVS"
     gene            <190135..>191351
                     /locus_tag="TRUGW13939_02525"
                     /db_xref="GeneID:55990033"
     mRNA            join(<190135..190506,190583..190968,191030..191166,
                     191230..>191351)
                     /locus_tag="TRUGW13939_02525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485718.1"
                     /db_xref="GeneID:55990033"
     CDS             join(<190135..190506,190583..190968,191030..191166,
                     191230..191351)
                     /locus_tag="TRUGW13939_02525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341611.1"
                     /db_xref="GeneID:55990033"
                     /translation="IAQAIDAAIACFKSAVGLAASGLIELLESEVFSRRATARMLSKF
                     VLAAWLLVAPALADLQTITSSNRSRSYWVHAPDDFQDGKTYPAVIVFHASSKLGFNID
                     GFAMEADVRLSLPLVPTAYSPDRYFIYPNGVGGVWAGPSYGNVSVAEDLQFVSDLISD
                     IKSKYGIDTKRIYATGLSNGAGFVGTIACSDVGGQFAALAPVAGSFYTDANDTDCTPA
                     RSPLPILEIHGGSDKTVFYDGGQGEGGLLPAIPTWLGYWQQRNGCTSNSTVDSDSGDV
                     HHTTWVCGGKNGTLQHWKVDENGHDWPSKTINFDMMAAGMGPQPIEANDIVTDFFDQF
                     SLSD"
     gene            <192262..>194072
                     /locus_tag="TRUGW13939_02526"
                     /db_xref="GeneID:55990034"
     mRNA            join(<192262..192276,192336..192505,192574..192636,
                     192689..>194072)
                     /locus_tag="TRUGW13939_02526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485719.1"
                     /db_xref="GeneID:55990034"
     CDS             join(192262..192276,192336..192505,192574..192636,
                     192689..194072)
                     /locus_tag="TRUGW13939_02526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341612.1"
                     /db_xref="GeneID:55990034"
                     /translation="MSQLQEKEENVESVVDRPSPDDSRESSLPSGKDDLVGEKYPLTA
                     LDDAIVGWDSQYDPANPRNFAPAKKWTLLAFISAITFLSPLASSMNAPGISIMDAEFH
                     NSSTVLSSFAVSVFVLGFSVLIPKYYHFRLLGFSFLLQNWCANTVIVCQVGPLLLSPL
                     SEIYGRQPILNIANIFFSLWQIGCALAPNINALIAFRFFAGVGGSACLTIGGGIIADL
                     FVVEQRGLATAMFSIGPLFGPVVGPLIGGFIAQRAGWRWVYWVLLCATGTVTIGNIIL
                     NSETNHVVLMQRKTANLRKEIDRPELRSVYDIDSKVKKTRDVLIQGIFRPLRILFRSP
                     ILLFLALYFAFVFGCMYLLFTTLSTLYIEVYHWEVELCGLAYIGLGMSFCVGVIVVAR
                     TSDATVVRLTKANNNVYEPEMRLASSVIFALFIPISFFWYGWTSDKHVHWVVPIIALI
                     PFGFGMMGIFLPVQTYFIDAGGRYAASAIAGLTAFRCLFGAFLPLAGPSMYASLGLGW
                     GNSLLGFVALALVPVPAVIFKYGSRFRQRHPINLD"
     gene            complement(<194249..>195342)
                     /locus_tag="TRUGW13939_02527"
                     /db_xref="GeneID:55990035"
     mRNA            complement(join(<194249..195192,195291..>195342))
                     /locus_tag="TRUGW13939_02527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485720.1"
                     /db_xref="GeneID:55990035"
     CDS             complement(join(194249..195192,195291..195342))
                     /locus_tag="TRUGW13939_02527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341613.1"
                     /db_xref="GeneID:55990035"
                     /translation="MPIVLGREVGPIGFGLMGLTIRPDPIPYDEAVKVMKRSLELGAN
                     LWNAGEIYGPPHANSLHLLEYYFRKYPEDSEKVVLSIKGCFSFATGPDGSPEGVRKSV
                     ENCLEILQGRVFISIFEPARVDPNVPIEKTVEALVEYVKAGKIGGIGLSECSASSIRR
                     AQAVHPISAVEVELSLFSREVLENGVSVACAELDIPLIAYSPLSRGFLTGQVKSLDDI
                     PANDSRRNLPRFQPETFELNMRLVNQVQNISAAKSIPMTQTAIAWVCSQGRPTTPRAP
                     QVIPIPGCTTVARVEENLKKATLEQNYLSDIDELLKHTSVHGDRYGGKVAAYMNG"
     gene            complement(<196200..>197705)
                     /locus_tag="TRUGW13939_02528"
                     /db_xref="GeneID:55990036"
     mRNA            complement(<196200..>197705)
                     /locus_tag="TRUGW13939_02528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485721.1"
                     /db_xref="GeneID:55990036"
     CDS             complement(196200..197705)
                     /locus_tag="TRUGW13939_02528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341614.1"
                     /db_xref="GeneID:55990036"
                     /translation="MSTEIKSSEMGHDTTSYTIDAESGKVPETKNIETDSYLVTFNTP
                     ADPDNPLQWPVAKKWVVTGVLSATGLNRIMVSTIMAPALIDIGSSLHMNQEESVMGMS
                     VYLLATAFGPLVIGPLSEVYGRQPVLHVTNIWFLVWNIICGFANGKGLLIASRLLAGL
                     GASAIYALAGGVLGDIWPSEQRGRSMALYILIPMLGAAVGPIVGGFITEATTWRWIFW
                     STSILQAVMVAGSFLAFKETYAPIILQRKANLVRRSTGNSQYYTEMEKLASGRSSLWV
                     IQRSLTRPLRLLAFHPIIQAQSLLSAFDYGILYLMLSSFSDLWTTQYGESVAISGLHY
                     IAICLGEIVGVLITGHTMDASFRWLKSRAHGADQPEYRMPLVIPSVILMPVGLLMYGW
                     AAQANTFWLVIDVGAAILAFGMTFAGQAFQAYVIDTYADHTSSASAASQFIRSLTAFG
                     FPLFAPAMYNALGYGWGNTLLAFLTLIIMIPAPLLIWFYGPGLRQRARSSY"
     gene            <198250..>199542
                     /locus_tag="TRUGW13939_02529"
                     /db_xref="GeneID:55990037"
     mRNA            <198250..>199542
                     /locus_tag="TRUGW13939_02529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485722.1"
                     /db_xref="GeneID:55990037"
     CDS             198250..199542
                     /locus_tag="TRUGW13939_02529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341615.1"
                     /db_xref="GeneID:55990037"
                     /translation="MSAHAFEPPSSQFPSPCSSVLGHQELLDRFRLTTIPQFSSYYNS
                     SLWQIVLAQTSVSTTNLSDAAIALSAAHHEREHRGFDTQRAAPVAFDMYINAISESRQ
                     TLARLSEEHAVWTGFIISFMLAGVEALRGKPENASMHLTNGLKVAFSLECNTISQRPI
                     LRLDCNVIEESTHFIMRLDIKLSDILGGPENVDQDPANPTKQSIKVAFYNLKNYVDHI
                     MNLVDEPNDLSCNIQGMLAQLETWDAHLTQLVPAAFETVLYEFQMVKLFRETICLLLL
                     AKQCLCMRYTEGNPNCLRELKAYLSKLLFLEGQMRCDKKYVSHLTPAQLKFLAARHGL
                     VSLKTSSDASEPLSAPTSHRAVEELVMQEEGAIRNSGLAPPQAMCMDITSALENGSVS
                     IRYCLVDQNGSFVWVEKRALIWKAAVFRQATVKPSDFA"
     gene            complement(<199814..>201487)
                     /locus_tag="TRUGW13939_02530"
                     /db_xref="GeneID:55990038"
     mRNA            complement(<199814..>201487)
                     /locus_tag="TRUGW13939_02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485723.1"
                     /db_xref="GeneID:55990038"
     CDS             complement(199814..201487)
                     /locus_tag="TRUGW13939_02530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341616.1"
                     /db_xref="GeneID:55990038"
                     /translation="MAVDSSSPTPLDGDDEIKDTLATEGLKHGHNSSSSPPVDRQLEN
                     PASNESESEPNGSKREDNKRELTEDDCYDKLGYSFPVWKKWMILTVIFTVQMSMNFNT
                     SVYPNAIVPLSEHFNISEQAARVGQMIFLVFYAFGCELWAPWSEEFGRWPVMQLSLFM
                     VNIWQIPCALAPNFGTIVVCRALGGLSSAGGSVTLGMTADMWEANDQGFAVAYVVLSS
                     VGGTTIGPIFGGLIQEHLSWRWNFWIQLIFGCVTQLMHLFVTETRSTILVDREAKRLR
                     KSGEDPNVYGPNELKENRLDLKEVLRIWRRPFEMFVREPIVLFLSLLSGFSDALIFTC
                     IESFTLVFKQWNFDTVQIGLTFIAIVVGYILAYLAFLPDLARQRHIRGKLGDAARLPE
                     RRLLLLLFIAPLETIGLFGFAWTSMGPDYTPWIVPLIFVCMIAIANYAIYMATIDYMV
                     AAYGVYSASATGGNGFARDFLAGIAAMYSTPMYTNIGGKFHLQWASTILACLAFFVAI
                     PIYVFYWKGPEIRRSSKFAQTLAADREIRQERRASQRRLSELPPEEQPY"
     gene            <203205..>204146
                     /locus_tag="TRUGW13939_02531"
                     /db_xref="GeneID:55990039"
     mRNA            <203205..>204146
                     /locus_tag="TRUGW13939_02531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485724.1"
                     /db_xref="GeneID:55990039"
     CDS             203205..204146
                     /locus_tag="TRUGW13939_02531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341617.1"
                     /db_xref="GeneID:55990039"
                     /translation="MAECKTFHLFPKLPAELRLEIWRLCLPQRVCEKDQAFPGIVFDL
                     PDDEIPVPCLLYQTTEVNGRPPAISRICRESREIALKTGLFYQFFRSTNSLLKPRPSE
                     AEWWSYTAIHSAWFDSTRDSMHLNWEPTYRGEFDDRGSALQSLAWDASQAGGRGSINI
                     GYFQSNYILIKDLRDALKKLPTWTVVMRVVVIHTNFSTGASTGLFGLLDDSRVQLIDI
                     FDEARMNALFDLAEQCEPYGLVTARQQISRDSPQSIQQKLRDAVRHKLRSEETEKLLP
                     RLRPVIMFRLCTEMCNRVGSTASIRGVRWARKARKGL"
     gene            complement(<204385..>205171)
                     /locus_tag="TRUGW13939_02532"
                     /db_xref="GeneID:55990040"
     mRNA            complement(join(<204385..204624,204698..>205171))
                     /locus_tag="TRUGW13939_02532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485725.1"
                     /db_xref="GeneID:55990040"
     CDS             complement(join(204385..204624,204698..205171))
                     /locus_tag="TRUGW13939_02532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341618.1"
                     /db_xref="GeneID:55990040"
                     /translation="MLLCYAYRLDIAAGGTFIAPDCPGTGKDKRCYFDEFLRYIEEVE
                     ERSPWSGSTSVGKNLAPNVLSTAEELVTTGYSNAVDPGVLYETPSGFDNFRGVFEPAI
                     DNIQECRQALGDKGIDWELNGIRTSIANTLDARIVDQAAFIIIGVNEKLHETGFSWTA
                     ETKPVTGLDGNTWHEVDVEATIKAHPDDAFEGLDDAINDYILHFDQQPSEGNKNKRHA
                     RAIWASQSFASRVFGDPSC"
     gene            <207347..>210388
                     /locus_tag="TRUGW13939_02533"
                     /db_xref="GeneID:55990041"
     mRNA            join(<207347..207462,207515..207886,207969..208047,
                     208107..208280,208343..208407,208465..208679,
                     208770..209136,209168..209373,209443..209990,
                     210062..>210388)
                     /locus_tag="TRUGW13939_02533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485726.1"
                     /db_xref="GeneID:55990041"
     CDS             join(207347..207462,207515..207886,207969..208047,
                     208107..208280,208343..208407,208465..208679,
                     208770..209136,209168..209373,209443..209990,
                     210062..210388)
                     /locus_tag="TRUGW13939_02533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341619.1"
                     /db_xref="GeneID:55990041"
                     /translation="MAVSNWTNLNLCPLNVCCDIWGQCGITSEFCTASPVDIGAPGTA
                     KNGFNGCISNCGIFITNNKDKSAEIRRIGYFENWNIERICLNMDVSKFQGNTYYTHVH
                     WAFANVTDAWAVDISGAKDQFYSFLNLIDIKCILSFGGWGFSTSDYTFNIFYDGVKDG
                     NRQIWANNVVEFITANNLDGVDFDWEYPGAQDIPRIPPDSTDSGKNYLEFLKLVRSKL
                     PSDKTMSIAAPASYWYLKYFPIKEIADVVDYIVYMTYDLHGQWDYDNTFADPGCPNGG
                     CLRSQVNKTETEYALSMITKAGVNANQVVAGVALYGRSFEMENTSCTGPECHFTGPLS
                     GATKGRSGYISNYEIFEILAQAQNPDLYGNISISQYSSDEVGDVLIYNKTNWISWLSP
                     SSYASRRSWTDGLNFGGTSDWAVDLNETYSNNGTGSAIDSGYDCDDDYTACNYTITFD
                     SLDNLSASAGNLRCLLICLIRLMPTTLDVNNGYDELFGYYVTYIDKLVPEILQDPFMF
                     NITSDDENWKNVGALPEVGYGMDYFICKFDDTTFPCNQAQSEKYERFMVYTTTSLDLT
                     DSDGYSAGLAKAGLSPDWVVFGDYQIESDIVSPHGGQKRYYKFTNFPIKNDSMVVPNP
                     KDIVTKALPSIPSLKTSMQATLLDMKLSQWRNGSLTDPAQAYSTAVFMLMQAVDSMAQ
                     AKELGEKEEKEEEEEEKRKKNFILMIVSVVLMFVFGVGEEVAAATGFASLARAIALAG
                     ELGNGVLAVYDTVEDPSSAVVNVLGMLLGVGSIAKVARDGEGIGSVAKIRTAMKSDDI
                     ASLGKIFSDNDSKLQGIVKACKLS"
     gene            <211959..>212624
                     /locus_tag="TRUGW13939_02534"
                     /db_xref="GeneID:55990042"
     mRNA            <211959..>212624
                     /locus_tag="TRUGW13939_02534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485727.1"
                     /db_xref="GeneID:55990042"
     CDS             211959..212624
                     /locus_tag="TRUGW13939_02534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341620.1"
                     /db_xref="GeneID:55990042"
                     /translation="MTITIHHLHVSSSERVIWLCEEVGVDYELKTYNRSPLLAPPEYK
                     SLHPAGTSPVIQDGDLTLAETAACIEYIAQKYANGKLFLTPTHPSYADFLYWYHWASG
                     TFTPTVGRAMLVRAGGIPEDNLVAKLGSERFKRGLLALDNQLRDNTWLAGDDFTAADI
                     MVVFPLTTMRYFFGYGFHDHVNIANYLKRVGEREAYQRAMKTGDPDLEPALGLDHPKA
                     FGA"
     gene            complement(<213030..>214366)
                     /locus_tag="TRUGW13939_02535"
                     /db_xref="GeneID:55990043"
     mRNA            complement(join(<213030..213349,213404..213428,
                     213482..>214366))
                     /locus_tag="TRUGW13939_02535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485728.1"
                     /db_xref="GeneID:55990043"
     CDS             complement(join(213030..213349,213404..213428,
                     213482..214366))
                     /locus_tag="TRUGW13939_02535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341621.1"
                     /db_xref="GeneID:55990043"
                     /translation="MYERIQQLPVDTRKGHDAIFDGSYLNDIPAALKEWEATRVLLVV
                     STTLDTKSEVIKDLEARLAELAYVDKKVGVGSHSPYADTIDIARRVQQNSIDAVVCIG
                     SGSYSDSCKTAVILSATLPLGFSYEDMESLVDQKRGLAGPENLKSPTTKLICVPTSLS
                     SGEWNHYASGTNSKGKKQHFVQEDGAPTLIICDPRVAATIPRDLWLASGMRAVDHFVE
                     TMCSPKFTHEATPYVKSGLGNLLKGLVEYCENKSDDPSSEGLLQGISDCQRGSRLALF
                     AWIFMKVAFGTSHALGHQLGSYAGVQHGITSCILLPPVLGYTETHTDVKIRQGSHAEV
                     LAIFNETLKWNEKSASDAVTRLVGLLGLPSRLHEVGVTGDEQIQRIAELATTDVLGEY
                     GILPPLEGIKTILDTVR"
     gene            <216717..>218330
                     /locus_tag="TRUGW13939_02536"
                     /db_xref="GeneID:55990044"
     mRNA            join(<216717..217198,217267..218143,218205..>218330)
                     /locus_tag="TRUGW13939_02536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485729.1"
                     /db_xref="GeneID:55990044"
     CDS             join(216717..217198,217267..218143,218205..218330)
                     /locus_tag="TRUGW13939_02536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341622.1"
                     /db_xref="GeneID:55990044"
                     /translation="MSNRLGNFRAIYLAALCCIGSFLFAYDTGIVGGVLTLEAFENDF
                     RYTTAQATNINSNCVSILQAGAFFGCFLIWPITERFGRRLAIMGSSLVFCLGGILQVV
                     NTHSIGAFYAGRVISGFGVGAATVLVPMFSAEMSPKSMRGTLGSFFQLFFSLGVCVSY
                     WVNYGVQQHIAPSTIQWQIPIGLQLVPGGLIGLGMLLVKESVRWLAKKGRNDEALENL
                     IWIRGGDAPEVRAEFEEILAGLEEEFRATEGVTWKELLLPANRFRVFVIITMQLGVQL
                     TGNTSLAYYAPQIFKSVGAGNSSLLVTGFFGVVKVCAVSIFSIFVVSRIGRKTAFMGG
                     AAAMGCFMLAIAIIVAKEPPSTTGGVSHAGIAAIAMVYCESSAYNMSWGPVSWLYLGE
                     IFPTRIREFGIAIGAASQWLFNFMLSEITPHAISNIHWRMFLMFSIFNYSLVVYAFFV
                     LRETSGKSLEEMEEVFGSAQTAVDSEAIRAKVERSQAEHMEEKS"
     gene            <218960..>219573
                     /locus_tag="TRUGW13939_02537"
                     /db_xref="GeneID:55990045"
     mRNA            join(<218960..219112,219189..219321,219392..>219573)
                     /locus_tag="TRUGW13939_02537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485730.1"
                     /db_xref="GeneID:55990045"
     CDS             join(218960..219112,219189..219321,219392..219573)
                     /locus_tag="TRUGW13939_02537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341623.1"
                     /db_xref="GeneID:55990045"
                     /translation="MPLSTAAIQKSVSNLGCATGKVFYNGIAEVSQVAAAYGPIVADQ
                     TVKLSGHTAKLARENKALSVCVAGGIIIAAPSLVSAPVLQGLGYTITGVKAGSLATGI
                     QSAIGNVGTGSLFATAQSAGAGGAGLVALNTAIQSAGAAIMSSSGMMYLRSKL"
     gene            <220057..>220479
                     /locus_tag="TRUGW13939_02538"
                     /db_xref="GeneID:55990046"
     mRNA            join(<220057..220129,220191..220263,220320..>220479)
                     /locus_tag="TRUGW13939_02538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485731.1"
                     /db_xref="GeneID:55990046"
     CDS             join(220057..220129,220191..220263,220320..220479)
                     /locus_tag="TRUGW13939_02538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341624.1"
                     /db_xref="GeneID:55990046"
                     /translation="MAAAIKAINAKIRSNKVSDYFCSTHFWGPASNFGLPVAAVMDTQ
                     KDPEIISGRMTSAFVVCSALLMRYSLAVSPKNYLLFAMHSVNLGAQSFQGWRFINYW"
     gene            complement(<221160..>222509)
                     /locus_tag="TRUGW13939_02539"
                     /db_xref="GeneID:55990047"
     mRNA            complement(join(<221160..221769,221827..>222509))
                     /locus_tag="TRUGW13939_02539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485732.1"
                     /db_xref="GeneID:55990047"
     CDS             complement(join(221160..221769,221827..222509))
                     /locus_tag="TRUGW13939_02539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341625.1"
                     /db_xref="GeneID:55990047"
                     /translation="MPNLQTISGGITVKNCPNTLSLNFPALRNYTDLTLDEVDDITDQ
                     LNSPSSPIYDAMTGSLEVNLCNLTSIVRTAGGSLGGFNAQMSQQLTNVTMNSIDSMTG
                     SLTVENCPGISLNFANISSLSSAKLRQIASIDMPMLKNVNGDFQFDSNDGLEDLVLKK
                     LTTVGSGNSGDFMITNNPNLSHIDVRHLKSVDGTLTLSNDGALGDLSSFGKVQNVGKD
                     LTLLNSPIYAVNLGNISGVGGQFELSSTYAGLTCENFSKFKQQVSLNRPLLCGNYTKI
                     ADLPDTTTGSPGNSPSSSGNDRSSASSTTSSSTTTTTATSNPNASPSTSPGTIAGIVV
                     STVLALTLVALISVLILRRRKARQKKDALETVATPTESTRSPLFELKEDAMHPELSND
                     GQRHEMPSTIHNQVYEMPHDIEVYEMPAEPVEVASVLR"
     gene            <225035..>225914
                     /locus_tag="TRUGW13939_02540"
                     /db_xref="GeneID:55990048"
     mRNA            join(<225035..225136,225200..225253,225331..225461,
                     225518..>225914)
                     /locus_tag="TRUGW13939_02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485733.1"
                     /db_xref="GeneID:55990048"
     CDS             join(225035..225136,225200..225253,225331..225461,
                     225518..225914)
                     /locus_tag="TRUGW13939_02540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341626.1"
                     /db_xref="GeneID:55990048"
                     /translation="MAATSPYLVAGSFTKVAPHHTSVEALWDIKWRKPCSMGIYPFVD
                     GHVEDFDRRRLTEPYDPDTFAAAFFPIAKELEEKAAQAETTGDVKIASQLYLRVAALY
                     RIARFPIARSSKTSEAWTLGKAAYMKASLYLDPINTELTIPHNHSDASAGDGNIIHAY
                     LRLPPHASAIEKVPVVIFICGLDAYRTDHTSRTSEHIRRGFACLSIEIPGTGDCPAAK
                     DDPTMVKYS"
     gene            complement(<229575..>231926)
                     /locus_tag="TRUGW13939_02541"
                     /db_xref="GeneID:55990049"
     mRNA            complement(join(<229575..229667,229721..230213,
                     230275..231229,231291..231562,231637..>231926))
                     /locus_tag="TRUGW13939_02541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485734.1"
                     /db_xref="GeneID:55990049"
     CDS             complement(join(229575..229667,229721..230213,
                     230275..231229,231291..231562,231637..231926))
                     /locus_tag="TRUGW13939_02541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341627.1"
                     /db_xref="GeneID:55990049"
                     /translation="MAFKVLIAGGSISGLTLALIFERYGIDYLLLEKHAEIAPFLGTT
                     IGINPNGARILDQLGVYSELDRIGAKPDTNSYYDWQGKLLASQKPIVPLMTWLFGYSL
                     CFLNRQDLIRVLYAAIKDKSKIQTTVEIVDVLELGSRVRVLTRDGSEYLADILVGADG
                     VRSQVRNELWRVASDQEPGYIPARDKTCIVSDYSCMTGISPSPPGMEDKAILRSINYH
                     RSCAVFTQPGAKLCWWLAFFKNDGPLSHPNIPRFTVDDHERILRSYGPDKIGTSTLNK
                     IYETAHHKVLVPVEEFTLEKWHYKRIVLLGDSCHKLHPIIGQGANQAIESAACLADLL
                     HGVALENSHSSNDAIDHAFSQYHAIRYHRAVSAMHAGRLAQRIDSLDTWFFKYLALHK
                     VIKTPIESGLLASFAKMSLPAVSLKGLPQPKHPGNVLYEDQIRMQPRGRSQHTTRLSM
                     LGFLLVSGILWYTHFGFSLISPQSHRLDLYSGVQSICISGIWVIESYRLNLGALISIL
                     PFIAIAMYSNIWQISFAVYCAWYIYQSTAPGFYYPTPRAIDVGVAMSLPYTVLFAYAV
                     PVYLTAVSDSPTNLPWISAHLLFPILTYALTTLLHRTIALPTGVKIAYTGDLDIPHLK
                     RYHNLVFLIAASTHIITLATEYKRFDSLITSTRDFWTGALVVVAFLRSLRGLLFGDGS
                     IWPWGSFDRIMEMEGDYD"
     gene            <233290..>233970
                     /locus_tag="TRUGW13939_02542"
                     /db_xref="GeneID:55990050"
     mRNA            <233290..>233970
                     /locus_tag="TRUGW13939_02542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485735.1"
                     /db_xref="GeneID:55990050"
     CDS             233290..233970
                     /locus_tag="TRUGW13939_02542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341628.1"
                     /db_xref="GeneID:55990050"
                     /translation="MKFSHILTAFLATLAIASPIPEPESTDVAVAELDVRASGGGKGG
                     GHSGGHGGNGGKGDPEPKIVETTAYQVAKKAMPFYESLSKDHYYYFTMEWKRGRPADA
                     ETTEELEEVRDELGFNHIGLVVGKVTETTTGKKANKVTKKDFVAMVHDMQKQNKDPGT
                     TTYLFSKYMPKSTSSSSTKLVHGGKTTLSKANAVGKHARAYTSANPIYAAHGNNCNDF
                     VQNLISTL"
     gene            complement(<234384..>235654)
                     /locus_tag="TRUGW13939_02543"
                     /db_xref="GeneID:55990051"
     mRNA            complement(join(<234384..234727,234787..234875,
                     234929..235296,235344..235451,235508..>235654))
                     /locus_tag="TRUGW13939_02543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485736.1"
                     /db_xref="GeneID:55990051"
     CDS             complement(join(234384..234727,234787..234875,
                     234929..235296,235344..235451,235508..235654))
                     /locus_tag="TRUGW13939_02543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341629.1"
                     /db_xref="GeneID:55990051"
                     /translation="MLTAASTAMIVTMAVFMVISGLSVVLRLYLRRRKRITLKADDYF
                     VIAAWFFSAALAITNIVGVPVGGFGVPFEQFDDAQAERFLKMLFILQFWYIIAVALAK
                     LSILFLYGRVFGIGRFPISVLTLIGITTSWLISFLFATFFQVWPLRCNWVACIPTTDY
                     AVMYVLSSVTDIVIDICILGLPAFFIRKLHLNGNQKIGLIGIFGLGVFCVVSSIARLA
                     YTILFHKVNVKGNYAINFSMNIIMWSGIEVCASTLCASLPCFGPLISHFHRITPLTAT
                     ITSFMSIGTNEPTRTASKGASMHSPYASRENILGFETRTDNVIKGASSQDTSKGSEIN
                     IELGSIRVDNSFNINSS"
     gene            <239001..>241539
                     /locus_tag="TRUGW13939_02544"
                     /db_xref="GeneID:55990052"
     mRNA            join(<239001..239143,239203..239356,239429..239682,
                     239737..239780,239836..240451,240505..240565,
                     240629..240914,240972..241097,241165..241346,
                     241408..>241539)
                     /locus_tag="TRUGW13939_02544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485737.1"
                     /db_xref="GeneID:55990052"
     CDS             join(239001..239143,239203..239356,239429..239682,
                     239737..239780,239836..240451,240505..240565,
                     240629..240914,240972..241097,241165..241346,
                     241408..241539)
                     /locus_tag="TRUGW13939_02544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341630.1"
                     /db_xref="GeneID:55990052"
                     /translation="MTVPEEVDVIVCGGGSTGCVPAGRLANLDHNLQVLLVEAGEDNL
                     NNPWVYRPGIYPRNMKLDSKTASFYHSRPSESLDGRRAIVPCAHILGGGSSINFMMYT
                     RASASDYDDFQAKGWTTRELLPLMKKHETYQRASNNPDLHGFEGPIKVSFGNYTYPIA
                     QDFLRAAESQGVPVTDDLQDLTTGHGAEHWLKWINRDTGRRSDAAHAYVHGTRARHSN
                     LHLKCNTKVDKILIENGRAVGIVTVPTKWVGEGEPPRKIYRARKQIIISGGTMSSPLI
                     LQRSGVGDPEKLRRAGIKPVVDLPGVGGNFQDHYLTFSVYRAKPDTESFDDFVRGDPA
                     TQKKVFDEWNIKGTGPLATNGIDAGVKIRPTESELAAMRSWPTPDFQRGWDSYFKHKP
                     DKPVMHYSVISGWFGDHMLMPPGKFFTMFHFLEYPFSRGWVHVKSADPYEAPDFDAGF
                     MNDKRDMAPMVWGYIKSRETARRMGAYAGEVTGMHPHFAHDSPARASDMDLETTKAYA
                     GPDHLSAGIQHGSWSNPLPPAQSASENHLNSNKQGAHPEIQYSKKDIEHIEKWVQRHV
                     ETTWHSLGTCSMAPREGNSIVKHGVLDERLNVHGVKGLKVADLSICPDNVGCNTFSTA
                     LLIGEKAAMLTAEDLGYSGPALDMKVPTYHAPGETLNLARL"
     gene            <241987..>243704
                     /locus_tag="TRUGW13939_02545"
                     /db_xref="GeneID:55990053"
     mRNA            join(<241987..242032,242106..242193,242256..242414,
                     242482..242773,242823..>243704)
                     /locus_tag="TRUGW13939_02545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485738.1"
                     /db_xref="GeneID:55990053"
     CDS             join(241987..242032,242106..242193,242256..242414,
                     242482..242773,242823..243704)
                     /locus_tag="TRUGW13939_02545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341631.1"
                     /db_xref="GeneID:55990053"
                     /translation="MSTIKSVAIIGAGASGAAAAAAFASEEYFEKIRVFERRESAGGT
                     WIYDSDPSPLIKPQPGKLPTEIDPPLTIPKNLPATLEPSPQERYHKTPIYDELTSNVP
                     AIAMSLSDIPFPYGPFVPHNVPKQYIENYFSAFKADQFLVLNTTVEDVSRAPTGDDRW
                     NLTLRQYDPVEHVDRWWKEEFDVVIFANGHYSVPFVPAVKGLEAFIEKFPARVIHSKS
                     YRTPHQFANKKLLIIGNSASGHDVTAGVVKSAQLPVYQSRRSPSRWDGDKPDAGVEWK
                     PIVKEYLQTGEILFDDGTILDDIDVVIYCTGYKVSFPFWNSKANGRPIFNYKENRLIG
                     NYLHTFLTDFPTLGVIGIPRTLTFRSFNYQAIALARIFSGRNARPLPAKDEQRQWEEQ
                     RWQSVSSQHRRFHDIAWDSGETMGYLRELYEIAGLPRIEGQGQTPPILDAETRWAIKH
                     VRKYPVPGDEDEDGQTDDTDAGWSIVERGHCKDSLHFL"
     gene            complement(<244853..>245854)
                     /locus_tag="TRUGW13939_02546"
                     /db_xref="GeneID:55990054"
     mRNA            complement(join(<244853..245495,245559..>245854))
                     /locus_tag="TRUGW13939_02546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485739.1"
                     /db_xref="GeneID:55990054"
     CDS             complement(join(<244853..245495,245559..245854))
                     /locus_tag="TRUGW13939_02546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341632.1"
                     /db_xref="GeneID:55990054"
                     /translation="MYSWVSLSRRAGEPEDEEERDPTAVVAAIAKLNQLYDSGKPLFT
                     RESILYTHEQIKNPLVRGDTISVIALDGVKVDFDVDIGKVTPTYRDEDRDRELVVTQP
                     FINYEPIEHLRRDIESGYTNLYLGLCPLRLHHWQVLRDKKTKDVWELPIASCADVEQL
                     LKESIRSWEQSETCQRLKITLQDADVPCEITTVVGFACGDMTFLEGSLDRAQRSASQH
                     ALLLTLQSVLQEKNTTKKGQILCYAQDPIYNTVDKTVLENFGIEVLDDPEGFLKVDDN
                     SVVFSCAPNIPVKQVIADLARPAILIWTPPVVEKEHM"
     gene            complement(<247821..>248878)
                     /locus_tag="TRUGW13939_02547"
                     /db_xref="GeneID:55990055"
     mRNA            complement(join(<247821..248080,248139..248768,
                     248827..>248878))
                     /locus_tag="TRUGW13939_02547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485740.1"
                     /db_xref="GeneID:55990055"
     CDS             complement(join(247821..248080,248139..248768,
                     248827..248878))
                     /locus_tag="TRUGW13939_02547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341633.1"
                     /db_xref="GeneID:55990055"
                     /translation="MPVLAGKEITLNGLGLMRFTLRTGESLPQEEIFKVLKAALAAGV
                     NVWNAADFYGTPENNSLHLMNRYFTANPEDADKVVLCIKTGLLNLAPVKMDCSAAGLR
                     GFLDNALRILDGKKNIDILGCARIDPAIPVEESVRALAQFREEGLIGGIQLTEVGPDT
                     IRRAVAVTKIDMVEAEISLWATDVFQNGVVEVCAEHDIVLEAHTPLGAGMLTGKIKRL
                     DDLPENDHHQVEKLAKEKGWTTPRLALSWIKTKSKLPGMPVIVPIPGARSVERLLENS
                     QDILLASIELEAIDTVLKQFPVAGARFPPAAQAFNEY"
     gene            <250181..>250913
                     /locus_tag="TRUGW13939_02548"
                     /db_xref="GeneID:55990056"
     mRNA            join(<250181..250416,250476..250633,250693..>250913)
                     /locus_tag="TRUGW13939_02548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485741.1"
                     /db_xref="GeneID:55990056"
     CDS             join(250181..250416,250476..250633,250693..250913)
                     /locus_tag="TRUGW13939_02548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341634.1"
                     /db_xref="GeneID:55990056"
                     /translation="MVPRIKVTTDIVAISDVLTRAFSNAPVTSYVVREKNSQWTAPNI
                     PLDILKPKMLEWTTYKSRIGGELAEAGNYAAVAIWFPPGVNLPPSPDDDERVVEYRRV
                     SGEIKKQFLKGRQYWYLNMIARHPERTEPGVIRALFDPYIERARQDGVPLWLEAISDH
                     SRQVYEHFGFKTVAEFRTGLGKATPEGDLQEGGEGIRLWAMILE"
     gene            complement(<251046..>252881)
                     /locus_tag="TRUGW13939_02549"
                     /db_xref="GeneID:55990057"
     mRNA            complement(join(<251046..251840,251899..252039,
                     252190..252750,252807..>252881))
                     /locus_tag="TRUGW13939_02549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485742.1"
                     /db_xref="GeneID:55990057"
     CDS             complement(join(251046..251840,251899..252039,
                     252190..252750,252807..252881))
                     /locus_tag="TRUGW13939_02549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341635.1"
                     /db_xref="GeneID:55990057"
                     /translation="MPNISVGKRALLGRPCLTCQQRKIKCDRGKPTCERCVKAGFKCD
                     GYPVEPFVHVVPTPRNGQSNKITLKRVRNSNNNHTPIEEKPKRAQEKLQLKSLTEKIN
                     MAPENRTQVLSYFLERYMPASMTSYRTFETPSAWIKDLPNLLGRWEILDTALTALCLA
                     YIGDLHHDKTHLQESQRFYSSVLRKMGSLPLESIKSANEGVLATTMIMAMYELFHCTY
                     RGLQGWMFHVKGACRLLQLRGPPSQELPLNLSLYSRIRITAVWDAYGTRKALFLAQPE
                     WQGLSETPHDHLLDLLVFIPGLLERSDNMTAAVNESRGMNNVELFSVDDLLGCWLAIH
                     HRLTNWYSEFDAQESAGLFKIGPLEPNNHPYLEENPELHAVFPQVVTFKDTYIAQIML
                     LYWFSQVIIHTATTKLYGIRENHRASINAKFVSKNHKRVHNEDMEDAEKMGGYYATKI
                     CQSIASLREGYGFQIAMVPLWAAQQFFDASGDAEKFLWCQEVLKGFGKVGGFVLAAAL
                     GILTPKQYPGITSSV"
     gene            <254452..>256309
                     /locus_tag="TRUGW13939_02550"
                     /db_xref="GeneID:55990058"
     mRNA            join(<254452..254530,254605..254984,255042..255168,
                     255225..255501,255577..255853,255929..>256309)
                     /locus_tag="TRUGW13939_02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485743.1"
                     /db_xref="GeneID:55990058"
     CDS             join(254452..254530,254605..254984,255042..255168,
                     255225..255501,255577..255853,255929..256309)
                     /locus_tag="TRUGW13939_02550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341636.1"
                     /db_xref="GeneID:55990058"
                     /translation="MPYLGLKGNGLLTGITLSSGMGFVLFGYDDGVIGGLLTAPTFEA
                     VFNLSSNMQGTVTSLFIIGALVGCLFTGVSNGRWGRLTITHIGSVILSIGATLQAASF
                     GVPQLIVGRVVAGVGLGLVTSNVIVWQSESAPRQVRGMMVASALSLLIVGQLLAYWID
                     YAMSGYTSSVGWRFPLAFQAFIAILTSVMLFFMPESPRWLFQQDRTEEATEILRLLQT
                     HKGVVDEHALASTIADIVEALEVEKKQAGWKELLTEDAVGSRRRVLLACLLNACQAWS
                     GSTPISYYTTVIFENSVGLPHQLALLMSGFLQIWFLVASFGTWYGIEKFGRRKSFMFS
                     ATSMAIVMAILAASLAVNTHAGGIVAAIMVFLYQSFYTWGFMGGLWCYGPEILPLAHR
                     TKGSGLATACLWLSTFVVVEFVPSALDTIGWKTYIIFAVFNLAFVPMVYFLFPETAGF
                     TLEAVDLAFMDKEKGPVKRADELWQVIKRGGDIGLREEVAQEKKNQMLDVEMVENV"
     gene            complement(<256515..>257644)
                     /locus_tag="TRUGW13939_02551"
                     /db_xref="GeneID:55990059"
     mRNA            complement(join(<256515..256557,256608..257144,
                     257202..>257644))
                     /locus_tag="TRUGW13939_02551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485744.1"
                     /db_xref="GeneID:55990059"
     CDS             complement(join(256515..256557,256608..257144,
                     257202..257644))
                     /locus_tag="TRUGW13939_02551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341637.1"
                     /db_xref="GeneID:55990059"
                     /translation="MAIPTRTLGTNGPAVPALGFGLMSIGGTYGSAPSDTERTALLDH
                     AHAIGERFWDTADVYMDSEDAVGLWNKGNPEKRKEIFLATKFGIQFDPETYTQIMRSD
                     PEYVKEACEKSLKRLETDYIDLYYCHRVDGKTPIEKTVEAMVELKNQGKIRHLGLSEV
                     SAATLRRAHAVHPIAAIQLEYSPFAVDIEEPQINLFETARELGIAIVAYSPIGRGLLT
                     GRYKSHEDIKDPFLLLLPRYSKENFPKMLEVIETIESIAAKKGISSAQVAIAWVLSRG
                     ENVFAIPGTRSIKYLDENFASLNVELSLEEKNLITKIVNATKLDGGRYPDGFPDVYEF
                     GETPAL"
     gene            complement(<258849..>260082)
                     /locus_tag="TRUGW13939_02552"
                     /db_xref="GeneID:55990060"
     mRNA            complement(join(<258849..259186,259234..259298,
                     259346..259722,259783..>260082))
                     /locus_tag="TRUGW13939_02552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485745.1"
                     /db_xref="GeneID:55990060"
     CDS             complement(join(258849..259186,259234..259298,
                     259346..259722,259783..260082))
                     /locus_tag="TRUGW13939_02552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341638.1"
                     /db_xref="GeneID:55990060"
                     /translation="MSSTPTQPFVGHPDRVSPREHDVLALDAVFTFLSTISVIVRFIT
                     RRYSSEMKVWWDDWMILVAWCAALAFLVLGVVDRTIGGAGYHIDTYSREQLTTFFQLS
                     LSVTVVYNISITFSKASVLFLYERIFSVYNRLRLWIRIMLCILPAYLLSASFGLIFTT
                     NPVQAQWKYWIPHTTIDKLPFYIVTGVANLLLDIVILSLPQTIVWKLHQSLKTRISIA
                     TVFLLGGFVCISSIVRITALTTIKTNDLMFSFHNSTIWTLVEMNLSIICACLPVMPKT
                     IKLCKQKYGQSTSKLNSSQARGENDYWRSADSRNKKSPSATAVSSFSSQGYRVLPGSN
                     GIAEGAQLATLPPAHLKHNYEMTEV"
     gene            <261311..>262087
                     /locus_tag="TRUGW13939_02553"
                     /db_xref="GeneID:55990061"
     mRNA            <261311..>262087
                     /locus_tag="TRUGW13939_02553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485746.1"
                     /db_xref="GeneID:55990061"
     CDS             261311..262087
                     /locus_tag="TRUGW13939_02553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341639.1"
                     /db_xref="GeneID:55990061"
                     /translation="MSATLPSVVLVPGAWTAPKAYHKLIAALEENAFQVHVPALPTNN
                     GQQPPNSTFDADIQAVRDAVQPLVDAGQDVVLLMHSYGGIAGTSAIRNLTRKDRQARN
                     LPGGVVSLIYAAGFMLSEGQTIRTVVHAVNLPGRNSLVQFSSDNSTWFPIDPIWLLYF
                     DLPPADQEEQVQLLKWGNAAILTGQTTYAAWKDVPTLYIQSLKDRWLPPEFQDFCLHN
                     AADAGVPVRIAALDSGHSPYVNFAAELAQMTLEVALAHVS"
     gene            complement(<262617..>264919)
                     /locus_tag="TRUGW13939_02554"
                     /db_xref="GeneID:55990062"
     mRNA            complement(join(<262617..263858,263914..264584,
                     264639..264739,264792..>264919))
                     /locus_tag="TRUGW13939_02554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485747.1"
                     /db_xref="GeneID:55990062"
     CDS             complement(join(262617..263858,263914..264584,
                     264639..264739,264792..264919))
                     /locus_tag="TRUGW13939_02554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341640.1"
                     /db_xref="GeneID:55990062"
                     /translation="MDHSDIVLQEWESLEALLCGTDSATVVLTGHTLRIPDVIAVARY
                     NVRSDIDVSAIQAMERSLSMLEKRVRSGDVIYGVNTGFGGSADIRTKKLVELQRALIR
                     ELHYGILPTGERDHRQGLAKHRQDLSLESGLEATYLPRSWARASILIRINSLISGCSA
                     VRPVIVQRMQDLLTHDIIPMIPLRGSISSSGDLSPLSYICGAIQGKSTIRVLASDNQQ
                     HVYADSAFTTAGLEPVVIEAKEGLAMTNGTAVSAAVAALALHDTHNLALLAQVLTAMS
                     VEALTGTVESFHPFLSAVRPHRGQVESARNILAFLAGSKLTQVNDGAHSSLRQDRYSI
                     RTAPQWLGPILEDLSLAHHQVYTECNSATDNPLVTPEGDFIHGGNFQAKCVTSAMEKA
                     RQGIQGIGRMLFSQCTEIINPATNRGLPPNLVTEDPGISLIFKGTDLNIASLAAELGF
                     LASPVNHVQTAEMGNQSLNSLALISARYTHTANEVLSQLMAAHFIAVCQALDLRAMHV
                     QFLEGYRPEFLHLVDAYYAADTPLPDEASANLPHGVISDPQLQLVDPKPLSELLWTQL
                     LAAFETTTRMDAQQRFPAMAQSLRSVLLDHADFKTAADFIPRLQRFTEALGASLHDAW
                     CAHRDAYLVHGDAADVLGTASRAMYVFLRRTLGVPLLATRNLSTPTADESWLHGGVEA
                     PTVGSYTGVVYRALRDGVLAKVAVDILRDSL"
     gene            complement(<265752..>267212)
                     /locus_tag="TRUGW13939_02555"
                     /db_xref="GeneID:55990063"
     mRNA            complement(<265752..>267212)
                     /locus_tag="TRUGW13939_02555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485748.1"
                     /db_xref="GeneID:55990063"
     CDS             complement(265752..267212)
                     /locus_tag="TRUGW13939_02555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341641.1"
                     /db_xref="GeneID:55990063"
                     /translation="MAQTAHEESPELQFGRDEVALQGHFTDLERRKHDTRITRYPELS
                     IWQRVNSELDSFESVHHRFWWTSHTGKALAVLLYHARYPADAQYRNLKFFAEAVAPHL
                     GICPELAESETPIWPSFMTDDGTPVEISWDWGTTDAPPTIRYSVEPIGLHAGTSVDPG
                     NLSAGPSFQEQLARSLPTMRLEWFHHFQAFFGIPNINSEFRKDTRDHNSSIFYAFDCS
                     ETDITPKVYFFPKSRAKASGQSNLDVLFQAMRTAPHVTEGNFKAGDMLHAFCSNVGST
                     LLEHEMLAIDLIDPLRSRLKIYFRYRETTFNSVINIMTLGGRIQNPKLYEGLVDLHRL
                     WNALFGVSAVGQPLRAVEHRTSGILYNVEFRLGEALPVAKIYLPVRHYSTSDEAVIRG
                     LNDYFQGRQKGKYMPDYIKAMSTLLWVFAIFFYFQSFVWNILLKYSCSTPQSMRENAG
                     VQTYVGYAIRPDGTVRVISYFKPQVPVHLFESEGGS"
     gene            <267901..>272680
                     /locus_tag="TRUGW13939_02556"
                     /db_xref="GeneID:55990064"
     mRNA            join(<267901..268185,268247..268612,268680..268763,
                     268833..268972,269034..269201,269254..269503,
                     269567..269797,270767..271120,271183..271548,
                     271606..271692,271741..271880,271939..272106,
                     272186..272435,272495..>272680)
                     /locus_tag="TRUGW13939_02556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485749.1"
                     /db_xref="GeneID:55990064"
     CDS             join(267901..268185,268247..268612,268680..268763,
                     268833..268972,269034..269201,269254..269503,
                     269567..269797,270767..271120,271183..271548,
                     271606..271692,271741..271880,271939..272106,
                     272186..272435,272495..272680)
                     /locus_tag="TRUGW13939_02556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341642.1"
                     /db_xref="GeneID:55990064"
                     /translation="MDASLILSALCAICLAVQFLRTRYHGGLNVIPGPFSASFCNLWK
                     ILAVYNEDMPRRNISAHQKYGPVVRIGPKHVSFSSPEALHIIHGSRQAYPKSDFYKPT
                     AAPFEGSPLLNLFAVRDVNYHSSLKKAIGGLYTKAAVLDLESKIDTCVEMFTNQLRNR
                     TRGDSPTNVDMSLWVHLFSFDCLGELNVSKTFGFLDTGRDFNGMIEGSDKVLIKTGLF
                     GQAPFLQVMRRLMETRWGAKKLNPVLQYTITAIRQRLEKPTQTRDMLNSFIELRQAQP
                     DKLSIRDITGSIYINLMAGHDVLAVTLRAILYYVSRSPRVEDKLRAEFATIVTKYRPT
                     DAIPYTETVKLPYLGAVINESLRIHGNLGLINERVTPPEGARIDGYHMPGGTIVGVNP
                     WVIHRNTEIFGEDVETFRPERWLDGPEDSIQEMKRNLFSFGAGPRMCIGKNIAMMQIH
                     KFITEFYRHFTAELAAPEKDWHVIGNWVTKQTEMDMLVTQSKLGSFEQGYSLGAFKET
                     QETTNLNLSTMFESIQQPLFPVGRSIIVDYIATALTLFLVYLIHTRYSHGLNKIPGPF
                     LASITSLWKWDIVRREQMPFVNTQLHEKHGPLVRIGPNHISASSAESIQVVHRSKSGF
                     TKSGIYGILQPRFEGTDLHNVFSTQDAEYHAALKRTMGSLYTITAVAGLEFHLDDCTK
                     LFISKMNEIIGTKASAPVDLAAWLQYYAFDSLGAVNFSQMLGFMESGTDVDGICHLDH
                     DQMMYFAVWGQITTIERAWAKVKALATGTRKENPLFNFALDLVQKREANPIESTDMLN
                     LFLALHKSVPEKFTIRDVIAAAYINVVTAHDVVAITLRAVVYYLAKNPATQKKLQQEI
                     DDAETAGKLSHPAKYTEITPLRYVLAVTNEALRIHPSTGLILERRCPKGGVTLHGQYI
                     PEGTIIGVNCWVVNRDKGIFGQDAHEFRPERWIDSDPKDVTRMRTNMFTFGAGARNCI
                     GKNLAMMQLTKIVVELYRNFDIGLANPDKDWTVSGGWLTRQSEMDMVLKKRK"
     gene            complement(<272993..>273988)
                     /locus_tag="TRUGW13939_02557"
                     /db_xref="GeneID:55990065"
     mRNA            complement(<272993..>273988)
                     /locus_tag="TRUGW13939_02557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485750.1"
                     /db_xref="GeneID:55990065"
     CDS             complement(272993..273988)
                     /locus_tag="TRUGW13939_02557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341643.1"
                     /db_xref="GeneID:55990065"
                     /translation="MSSADLLITGATGFIGFKVLLGALQEGYTVRAAVRSSEKGETLA
                     SHPKITASNKADNLSLIEVPDITRDGAYDEAIKGVTYVIHLASPLPSPFLDPQTGIYE
                     PNIKGVSTLLVSASKEPSVKKVVITSSVFANTPFPPDPSQEITAETRVPDLPGPFDSI
                     LPAYSAGKIGALNFTERFINEKKPSFTVVNVFPGFVFGRDDRALDAKELYAGTNRILL
                     GAITGQSAPNPMPAGATHVDDAAKVHLAGLKEGMSGNFGVTTVHDFNDAWTAVQKHFP
                     EAVADGTFKQGNQPTVPVNWNAHQTEIDLNFTFKTYEDMVVDVAGQYLELSGKKA"
     gene            <275186..>276745
                     /locus_tag="TRUGW13939_02558"
                     /db_xref="GeneID:55990066"
     mRNA            join(<275186..275364,275419..275537,275589..>276745)
                     /locus_tag="TRUGW13939_02558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485751.1"
                     /db_xref="GeneID:55990066"
     CDS             join(275186..275364,275419..275537,275589..276745)
                     /locus_tag="TRUGW13939_02558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341644.1"
                     /db_xref="GeneID:55990066"
                     /translation="MSPYWQNKSCDPFTSPSNPCTLGNYVDYTANISSAEDVSQALQF
                     AQKHNVRVVIKNTGHDYVGKSTGKGSLGLWTHNLKHMEFLNYSSTEYTGPAMKMGAGV
                     QAFEAYTAAASHGLRIVGGACATVGLSGGFLQGGGHSLLSSTYGMAADQVLEWDVVTA
                     NGTHLIASPTENNDLYWALSGGGGGTYGVVISVTMKAFQDGIVGGAFLQFNKTDTTDD
                     QFWKAVEEFFAWVPDMVDSGSTALFSLSNTSFVVVPLTAPGKSADEVQDLLQPFLSKI
                     DELGVPISTSITSFPTYLEHFDHHLGPLPNGLPFINIVDVSIGGRLIPRRVLENTASN
                     LDFVEALKLSVQPGGKYQTGGVAINAAHSVAGNDPSSNAVLPAWRDSLVQILAFAPWD
                     FKASLSSNLAGDDYLNQVTVPALTAVAPETGAYLNEANLQQHHWQRAFYGANYDRLRR
                     IKKIYDPQDLFFANTAVGSEAWTPDDEGRLCRSA"
     gene            <277445..>278408
                     /locus_tag="TRUGW13939_02559"
                     /db_xref="GeneID:55990067"
     mRNA            join(<277445..277491,277545..277655,277709..277956,
                     278005..>278408)
                     /locus_tag="TRUGW13939_02559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485752.1"
                     /db_xref="GeneID:55990067"
     CDS             join(277445..277491,277545..277655,277709..277956,
                     278005..278408)
                     /locus_tag="TRUGW13939_02559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341645.1"
                     /db_xref="GeneID:55990067"
                     /translation="MPEEYPLSRDYVDFNRLNLQHYIWKDMFGYSLHPKIPRNQKSLK
                     IADVGTGTGIWLLDLLPQLDPSTELVGIDADITQVGPREWLPENLTLRQWSVFTDVPD
                     DLVGAFDIVNLRLFAFVIEDDATLLLRKLKKLLKPGGYLQWCDVDVLSFRINTASSNV
                     STHHLVQLWEQTMPKEARLFPAWVKGLPESFENEGFLDITTDWQAQKGHTGIAMHWCN
                     LPIHEMLADRLRESDPEKSPKIREVMEAASVESRKGAMYAFDRLVVVGQKP"
     gene            complement(<278580..>281820)
                     /locus_tag="TRUGW13939_02560"
                     /db_xref="GeneID:55990068"
     mRNA            complement(join(<278580..278732,278783..279247,
                     279324..279610,279673..279809,280009..280109,
                     280174..280252,280303..280317,280375..280519,
                     280594..281017,281090..281449,281513..281596,
                     281663..281717,281768..>281820))
                     /locus_tag="TRUGW13939_02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485753.1"
                     /db_xref="GeneID:55990068"
     CDS             complement(join(278580..278732,278783..279247,
                     279324..279610,279673..279809,280009..280109,
                     280174..280252,280303..280317,280375..280519,
                     280594..281017,281090..281449,281513..281596,
                     281663..281717,281768..281820))
                     /locus_tag="TRUGW13939_02560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341646.1"
                     /db_xref="GeneID:55990068"
                     /translation="MAKKLANAKFETLQLHAGQSPDQGTNALGVPIHPTSSYVFNSTA
                     HGAALFGLKEKGFVYSRMMNPTNSVLEKRIAKLEGGVAAVAASSGHSAQFLAIATIAK
                     AGDNIIATSFLYGGTSNQFRNFFPNLGITVKIVNGDDPKEFAKLIDENTKALYIESIG
                     NPRANVPDFKAFANLAHENDIPLIVDNTFGCGGYLIRPIEHGADIVTHSGTKWIGGHG
                     TTIAGLVVDSGKFDWSKNPKKFPAFNEPSPNYHGLKIYETFGRASFAVRARTEILRDL
                     GCALNPFAAFLLLQGLETLSIRVERHVSNALALAKWLEANDHVSWVYYAGLESHPSHE
                     LAKRYFKRGFGGVVSFGIKGGAAAGIKVLDSFQLVSHVANVGDAKTLALHPWSTTHEQ
                     LKPEEKIASGVTEDLIRCSVGLEHITDIIADFEQAFAAVDRDVKSKLFDSRRFTMSNQ
                     TQEIHQPGTADGWHGIIKPDGEFQPEAGRYHLYIGLFCPFAHRANLVRHLKGLQDIID
                     ISIVRPYPKGDAKGWPGWKFPADEHEYEGATVDKLYGSEYLHDVYFRADKDYKGRYSV
                     PLLWDKKTNTAVNNESLELLRWLPTAFNSLISPDLAKLDLYPEHLRPQIDSIGEWMQK
                     DINSGVYKAGFADSQETYDKNVVPVFAALNKIERVIYDNGGPFVLGKELTELDIRLFA
                     TVIRFDPVYVQHFKCNLGTIRHDYPVLNNWLIHLYWRVPGFKETTDFTHIKENYTKSH
                     YDINPKAITPMGPVPDVEDYVPIEWKDLKVGGVKLPAVLAYEAKI"
     gene            complement(<282869..>287365)
                     /locus_tag="TRUGW13939_02561"
                     /db_xref="GeneID:55990069"
     mRNA            complement(join(<282869..283240,283296..283372,
                     283421..283542,283596..283641,283692..283783,
                     283835..283843,283899..284088,284141..284240,
                     284298..284337,284411..284557,284623..284733,
                     284796..284920,284984..285039,285095..285244,
                     286234..286906,286963..287029,287094..>287365))
                     /locus_tag="TRUGW13939_02561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485754.1"
                     /db_xref="GeneID:55990069"
     CDS             complement(join(282869..283240,283296..283372,
                     283421..283542,283596..283641,283692..283783,
                     283835..283843,283899..284088,284141..284240,
                     284298..284337,284411..284557,284623..284733,
                     284796..284920,284984..285039,285095..285244,
                     286234..286906,286963..287029,287094..287365))
                     /locus_tag="TRUGW13939_02561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341647.1"
                     /db_xref="GeneID:55990069"
                     /translation="MAAKTEVDYGELPTISLAKLVKGDTATANDLVTACRDVGFFYLD
                     FRDPLTSKILEDVDKLVTITENTFQLPLDEKQYYNTEKLSTLSKTHGYKAAGLASGPF
                     QEKRDGFESYMIANNALFDLDPKMPLAAPETITSQREMLKQFVGDIHEYGLVILSALS
                     QALHIPFQESHRNTVPNTSSLGLLRYLTYGSSEKNVGHIAHTDIGTLAIVFSQTGGLQ
                     VLMPGLDEWQYIAPKPGHAIVNVGDSLTALSKGALKSCLHRVVPPPDAWNQTKYSIVY
                     LVRPEHDVNFTAGDGKDWRSLDWHNRKFAILRASHDVQKADATLTGRHGYIGLADTPV
                     LQSDDGSVDFVAPTEWEEKNLRHVCDEIPPSIFLICIGELAERFTYRCITAPMQNYVE
                     NARDDPLRPGALGRGQSIATGINYFFTAWCYMAPLIGAIMADSLLGRFRTICLGAAFA
                     SCGVLILFVTSFPMSLDKGAGLPGLIVALVLIGLGFGGIKSNVSPLIAEQYSRKPLRT
                     HTLEGGEKVIIDPNLTIQTIYGRYYWVINLGALSVIPASWLELKVSFWAAFLLPLCFW
                     ALTAGILALARGKYVVQKPTGSVLVKATQVLWLGLKGGRNLDAAKPSALAQTRPGTVV
                     PWDDEFVQELKRALVACTVFCVFPIFWICYGQTNSNFVSQAASMQTFGIPNDMMGCFG
                     PIFVLTLLPVLEKVVYPTLSRFRINPKPISRITAGFVTMACTIGYTAGIQDYIYKSPP
                     CYDHPLKGSCSDGGRLPNEANVFLQIPAYALTALSELLAFVTGMEYAYTKAPKSMRSI
                     VSSLFLLTCSIGSILGITLSPVSKDPKVLVQYASLSGVMAITAVFFLFFFRKYDKIEA
                     KMNMLDSSDDSSMTETRPQDQTERKT"
     gene            <288241..>291376
                     /locus_tag="TRUGW13939_02562"
                     /db_xref="GeneID:55990070"
     mRNA            join(<288241..289482,289752..289855,289912..>291376)
                     /locus_tag="TRUGW13939_02562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485755.1"
                     /db_xref="GeneID:55990070"
     CDS             join(<288241..289482,289752..289855,289912..291376)
                     /locus_tag="TRUGW13939_02562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341648.1"
                     /db_xref="GeneID:55990070"
                     /translation="TIVEMESNTGVNGNHKDLPPTSEYFKEWPLRPDIVHLDHGSCGG
                     CPHKVRNAQRKISDDIEYSPPSWFGKNYASGLRNSKEALAGFLNANVAGLAIMPGTTQ
                     GLNAAAFSQHFNAGDELLITNHAYSSALLILKHIAKQVNARVVIANVPFPVKSEDEVV
                     ESILSHVTPKTKFAIIDHIPSRTGVIFPIKRIVAELDSRNVVTLVDGAHAPGQIEVDL
                     RDINAPYYVASLHKWMCAPRGLGLLYVREDKIASTKPVIVARTCYYRDSHAGVHTQFE
                     HDFDWIGTFDPSTYLSLPAIVDFLSTVLPGGHRGLVQRNHHVALEARKVIHRELGIPP
                     ASPDEMLGSMVTFPLPDTIGPESPQGTLPLQKQLMEHYGIETQVYNWPQYPKRVMRFS
                     IQAHNSVQQIEYLARHLKAALKFAELAPQIPKNREGWLASYKLCNTYSATMISTQTQS
                     LNLVTGDIHSTKAPLPRQKLSDLLNPTFQDLFDLAVWRVSETVCPNPDNAPPRLFPTV
                     EKTRDLFFTHDEWAKFGDLESEYGRLCWMLSNFPERGVPLRCIDTVLDVLASPCVLSA
                     WSQVSERLKSQTHAILMDIVDIMKSRHLPVDLKTAKQDFLNVPVDYECTSDLTDNLSL
                     KLFQQSSYRMSALLLKGDFSRIVEYVQIHAFVRDPIGSFKKDFTQQAIIFKDLLNRVV
                     PMRTFSVDDQVWTSLLAQIAQESAFLADPKINDVTYVHFSRHQQLPYVYVNLYELPRA
                     EFSIPEHVVEIMHEIMQELLASGQCHIIPIIVASMPLVSDTGNKKPSNIIVDGNNRAT
                     ATMVLILLATVGLGKADVFSSFDSYCSTHNLSLKWRIDLLSVLEILYVATDSPILSLL
                     RGKQDLLSKFKDFTRLPGLLVQEPFFHTICLQRSVTGNKPHLLQPIHQIIHNDDSCGL
                     ALPARRSQAHGRPKDYILLPLE"
     gene            <291810..>292403
                     /locus_tag="TRUGW13939_02563"
                     /db_xref="GeneID:55990071"
     mRNA            join(<291810..291933,291997..>292403)
                     /locus_tag="TRUGW13939_02563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485756.1"
                     /db_xref="GeneID:55990071"
     CDS             join(291810..291933,291997..292403)
                     /locus_tag="TRUGW13939_02563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341649.1"
                     /db_xref="GeneID:55990071"
                     /translation="MPDVSKIEDLLRGLENGTYHTLGLSLGSKKVTSPGLQIAKKETQ
                     PSPTLFAPPDLPHEATYTIISLDPDAPFISWNALSPIAHWIQTGFKIDQQHQRELKSD
                     ERPIAPWAAAGPPPLAAPHRYVFLLYHQNTESAIPPDLKEKEFSITQRMRFDLDAMVN
                     QLQLGDLVAVNYFVSN"
     gene            <295442..>297198
                     /locus_tag="TRUGW13939_02564"
                     /db_xref="GeneID:55990072"
     mRNA            join(<295442..295534,295597..296761,296821..297008,
                     297073..>297198)
                     /locus_tag="TRUGW13939_02564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485757.1"
                     /db_xref="GeneID:55990072"
     CDS             join(295442..295534,295597..296761,296821..297008,
                     297073..297198)
                     /locus_tag="TRUGW13939_02564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341650.1"
                     /db_xref="GeneID:55990072"
                     /translation="MVGSLFTMKSTKHQPSTRLMRTTDDSKPFAKDMKELFATLMVSL
                     KLGPNRVRLSKIDHTFTIDEASINLGSLKFTQSARMPDPKNPNRIITTTSTTTFSMGR
                     EMARSILVDFMLARLVEPLNGTITHLSKGTVCQMTPKGIATLQIFCNRNGITAPHVVR
                     VLQSPRNRMTLLTLERAIDTDKVLIDRQTIEVIFRRFAGAEGPNVRPTSSESDNNKGD
                     NNNGVTGVKLSRDTRVNGKRYAYTFNGKSALDWLMDCCTVIDDRETTLICEQFIAHGL
                     VALIQHYDKSQFEKSSSTIADVGSSSSQFDSSRYSVYAFTSRGLKVCGWTSGSHKNSE
                     DEKASSVVGVPVCGADVSNKARLDYILADPSLRLLFREFLCASFCEENLSFYCDVSEF
                     INRYTRLQHSKGLEHMPKVQETLAAAYSLYNAFLAPGSPCELNIDHTLRNNLASKMTN
                     ISGDEKNFVTHLAEVVNLFELAQGSVFKLMASDSVPKFFRTPKYMAVLQEHELDPADS
                     SSRSSSPSTASKSTV"
     gene            complement(<298045..>299857)
                     /locus_tag="TRUGW13939_02565"
                     /db_xref="GeneID:55990073"
     mRNA            complement(join(<298045..298488,298549..298898,
                     298965..299610,299681..>299857))
                     /locus_tag="TRUGW13939_02565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485758.1"
                     /db_xref="GeneID:55990073"
     CDS             complement(join(298045..298488,298549..298898,
                     298965..299610,299681..299857))
                     /locus_tag="TRUGW13939_02565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341651.1"
                     /db_xref="GeneID:55990073"
                     /translation="MDGNNIEMGPFGVKRQTTVTIDSARPATSSKNNHHAYKKSDVGQ
                     NYVHSTGSSGRKKLDRKFDSLSILALSVTLLASWEGIASSFSTSLLNGGPSSLVWGML
                     LSLTGTMALALSLAEMASICPIAGAQYHWTALFAPPQIRPFITWMQGWATVFAWQAST
                     TSIFFLVASQIQGMVILNHPNYVPARWQGTLIMWLLTCFSFSVNVWGIQLLPSLQLLG
                     GIFHVVFFIALGVPLVLLARRSTPEFVFETVMNNGGWSSDGISWCLGMLTVTYCFLGF
                     DGAIHMSEEVRNPSKVVPRILVQSIAINGTLAFSFVLILLFCIGDLPAALNSPTGLPS
                     IEIFYSATGSIRAATVMQCGITIIGLMSSIGVVASVSRLTWAFARDGGLPFSNFFAHI
                     DSRFHVPFRSIGLVCIVVILLSLINIGSSTALSAILALSTCSLYISYIIPIVLLVLRR
                     FDQVRQPIPWGPWTLGRYGLAVNLYAIIFGTFIVVFVPFPTTIPVTADNMNYAGPVFG
                     GMALLLLVDWFVRGRRRFQGPLKELLTRNS"
     gene            <301813..>303181
                     /locus_tag="TRUGW13939_02566"
                     /db_xref="GeneID:55990074"
     mRNA            join(<301813..302010,302068..302172,302235..302459,
                     302515..302657,302717..302815,302869..>303181)
                     /locus_tag="TRUGW13939_02566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485759.1"
                     /db_xref="GeneID:55990074"
     CDS             join(301813..302010,302068..302172,302235..302459,
                     302515..302657,302717..302815,302869..303181)
                     /locus_tag="TRUGW13939_02566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341652.1"
                     /db_xref="GeneID:55990074"
                     /translation="MAITGLGAGVRPPIFPITDDDHGGFTAVSVYTLLVLSVVVVATR
                     LSARFYIGRVVQLDDYLLGGATILAIIQSAFVQLAISHGLGKKQDIVSSNNLDLFQKY
                     WYIAQILLIATIALSKLSIGLLFKNLMSKGAQFIANWTLIATIVAWAVASIVSLAARC
                     SSPHPWDFVNGKCIDQTMLFRAVGAINIITDIGLIILPCLVLWGVQVSTSKRVRIIGM
                     LSIRLAVPVAVAFQIHYYNTLAKSSDKTWMAMNASIWDQAVMNMSIIATSIPSLGRLA
                     VELQPNIGAFAMTENHGVRSRDKYAMSSLGNQYPHQMFAEQRLGTHTSVHGSVEADTE
                     SMEGLVRDGMNQNVVTIHHTIDFKVE"
     gene            complement(<303306..>305369)
                     /locus_tag="TRUGW13939_02567"
                     /db_xref="GeneID:55990075"
     mRNA            complement(join(<303306..303382,303441..303557,
                     303613..303787,303844..304575,304629..304790,
                     304848..>305369))
                     /locus_tag="TRUGW13939_02567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485760.1"
                     /db_xref="GeneID:55990075"
     CDS             complement(join(303306..303382,303441..303557,
                     303613..303787,303844..304575,304629..304790,
                     304848..305369))
                     /locus_tag="TRUGW13939_02567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341653.1"
                     /db_xref="GeneID:55990075"
                     /translation="MEVPVIICGSGSAGLCAATFLACAGIPASQIKIFERSAGPMERG
                     QADGVQCRTVEVFESFGLSEKLLRDAYHVLEVCFWADQPDGNAQKRLVRTGRTADTMP
                     GLSHHPHVILNQARINAMFLEKMNQRGGLQVDYGCAVTSVGVYSRHDNDEHPCEVKVE
                     RDGREEVFRAKYVLGCDGAHSIVRRSLGYKMIGDSTDAVWGVMDVYPRTNFPDIRKKV
                     TLHTQDGNLMIIPREGDSLVRFYIELPQGTVAKEVRLEDLHQRAQRIFSPYSMEVAET
                     FWWSAYSIGQRLADHFHKDNRVFLTGDACHTHSPKAGQGMNVSLQDGYNLGWKVAAVL
                     KGQAPASILETYRLEREKVAADLIEFDRFFVRIFSSKSSSDSHTPPESFAEHFIKAGR
                     YTAGLTAKYEDSVLTSTARSKASLAAGLTVGMRFPSAQVVRLCDSRAMQLVRAFPADG
                     RWRIVVFAGDISQESNANKLTSLANFLSSNDGPVTRSTAPDADRDSFIEPILVLRGDN
                     TKVDQEQIPDYFTPVNGRWRMRDLFKVFVDCDSYNSGHGNAYQKYEIDETKGALVVVR
                     PDHYISLVTDLEDYEGLGDFFKGFATYV"
     gene            complement(<305842..>307243)
                     /locus_tag="TRUGW13939_02568"
                     /db_xref="GeneID:55990076"
     mRNA            complement(join(<305842..306355,306413..306886,
                     306945..>307243))
                     /locus_tag="TRUGW13939_02568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485761.1"
                     /db_xref="GeneID:55990076"
     CDS             complement(join(305842..306355,306413..306886,
                     306945..307243))
                     /locus_tag="TRUGW13939_02568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341654.1"
                     /db_xref="GeneID:55990076"
                     /translation="MSQADQFPATDPAVYEEYKSKWSEIPQDEQGWLTRAREVAAVLA
                     QDAVKRDQENKSPAAEVALLKHSGLLKILGPKKYGGGEQPWNVGYKVIREVAKADGSI
                     GMLLGYHLLWSRTADIVGTTEQSDRFDKLVLTNNYFVGGAVNPRDNDLRISVDGEGIV
                     FNGAKHFNTGGVVSDLTVLEGVVDGTTDHIFAVVPSQQAGIQFAHNWHNIGLRLTESG
                     GVKIDNVRAPWADALGWDAVEHKPLPNVLQIHWGSLLLPVIQLVFGNFYLGIAIGALE
                     YASKYTVANTRAWPFGGDSKQSPTEEFYILERYGNFFAHLRAAEALADRAGDQLAAAF
                     AGHGSDHTKLTAEERGEVAEWVASVKVVATDVGLRVTSGVFEVTGSRATSLKVGLDRY
                     WRDLRTHTLHDPVAYKNRELGRYALLGEIPQPTWYT"
     gene            complement(<308168..>310005)
                     /locus_tag="TRUGW13939_02569"
                     /db_xref="GeneID:55990077"
     mRNA            complement(join(<308168..309706,309973..>310005))
                     /locus_tag="TRUGW13939_02569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485762.1"
                     /db_xref="GeneID:55990077"
     CDS             complement(join(308168..309706,309973..310005))
                     /locus_tag="TRUGW13939_02569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341655.1"
                     /db_xref="GeneID:55990077"
                     /translation="MAAITSSGLTNYFNESTLETYFGLSESNVTAYLGIPFAADTGYQ
                     NRWKPPQPRQPWNETLNATTFGPACPSSSDTYISEDCLSLNIWTNAGSVDAKLPVMVW
                     NQGSDETSDNTWWYGGGMALKDVILITFNRRDDAFGYLAHPELNSEGFERTGHNTSGN
                     YGILDQLEVLKWVQKNIAQFGGDPDRVTVAGQSFGSSQVYHAVNSPLFTGYFHGGISE
                     SGIRYPYDTLLAGLACSYVDMSSALNNGVNYTTFHNVSTIAELRTLSMEDLLTGSQDR
                     VTNETFWWVTALSTMYPLVFKPVLDDYVIPSKYIDSLVNGPANDVPVITGNTKDESGA
                     ALSTDYTVEQYEYYTYLKYGNLSAQYLKLYPDNDNQTTADLAWNAAARDTSLIGSWAY
                     ATEWYKSAESPFYTYYWTHAPPGQNMGAFHQSEIMYALNALYANVDQYPFTEVDFEIQ
                     EQMSAYWANFAKTLDPNQGNSYSGNGSLVTWSPNRPDGTQVVMELGNAFENVPIAKPE
                     QVKLIMDYFHQQTAF"
     gene            complement(<310438..>312834)
                     /locus_tag="TRUGW13939_02570"
                     /db_xref="GeneID:55990078"
     mRNA            complement(<310438..>312834)
                     /locus_tag="TRUGW13939_02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485763.1"
                     /db_xref="GeneID:55990078"
     CDS             complement(310438..312834)
                     /locus_tag="TRUGW13939_02570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341656.1"
                     /db_xref="GeneID:55990078"
                     /translation="MEPTKVPSTNYQQPVVVDAVDDLGQPTSDTKLPTETHGVDTVES
                     KIASSVAANETTELSSETAAIEEETKHDPEIAALPLQVRQLVSLEDDPNLPTITFRYF
                     LCVIIFVTPGAFISQLSYFRTTQAPYSIFFVQVACHYVGHFFAKVLPATVIRVPFTKW
                     SFSLNPGPWSIKEHVLVTLTAASGATYNLGFYPIAVAELFYGERVPAAVAIFFMWAIV
                     WTGYALAALARQLLLFDPNYIWPQALMQTTLFESFRKTDRKSPLARKQMIVFFVCFIG
                     MTLWQFLPEYAFPFTSSLAFLCWVAPENPVANFIGSGLGGMGFLNLSLDWSNINWNGS
                     SILLTPFWTQVILFIAFAFNCWVLLPAAKWGKLGSYKHGLMSNKLLTANGSSYPTMDI
                     LTSNLQLNETAYAEIGPTYTGLQNVWSMFFDYAKLPSAFTWILTFGFTRVAENFRRAF
                     KSRTKEAKAKGESINHQYHDRLNVIQRQYKEVPLWWFVSLFVVAFAILIISIGCGYLW
                     IPIWALFVALFFGGIVVVPMGWLYAISNYQVSLGTFNELIYGYLVHTAGGNNHHHPCG
                     PSVYGAIAGDAWYRAQYMLQDQKIGHYMHIPPRLVFFSQIFGSVVGVPINYGVVRWAL
                     NTKFDYLTGKTPDPLNQWTGQQIQSYNTMGVQYAIIGPKRLFSQALFSPLPWSFLFGA
                     LVPPALYVLHRFFPRWRIDLWNITIFCGGMSMFYGNISTGYTSAIIGGWVVMYYYYRK
                     RFDTWKRYGYMVAAAFDAGFNLNLLLVFLFFGSGKQIAMPNWWGNNGVSVERCFALDS
                     "
     gene            <315018..>315839
                     /locus_tag="TRUGW13939_02571"
                     /db_xref="GeneID:55990079"
     mRNA            join(<315018..315434,315495..>315839)
                     /locus_tag="TRUGW13939_02571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485764.1"
                     /db_xref="GeneID:55990079"
     CDS             join(315018..315434,315495..315839)
                     /locus_tag="TRUGW13939_02571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341657.1"
                     /db_xref="GeneID:55990079"
                     /translation="MSPKPSIVIIPGSFTGPELYTTLGSLLEGQGFEVFVGTLQSASR
                     TAPEKPATMKEDAAYFRGVAEFLASQGKDVIVLGHSYGGIVATECVKGVTKAEREVQG
                     KTGGVVRVLYLASVLGDIGQGSLEAMGGQLGPFIRILGDYMHMDGNAAAPVIYNDLPE
                     KEALEWADRGKCHSTTSFLDPLTFSAVDHVPITYIHTERDNILIPEYQKACVEKLRKR
                     NAKNVSTVNINTGHMPNVTAPEVTAKGIIDAIGAV"
     gene            complement(<315873..>316657)
                     /locus_tag="TRUGW13939_02572"
                     /db_xref="GeneID:55990080"
     mRNA            complement(join(<315873..316474,316552..>316657))
                     /locus_tag="TRUGW13939_02572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485765.1"
                     /db_xref="GeneID:55990080"
     CDS             complement(join(315873..316474,316552..316657))
                     /locus_tag="TRUGW13939_02572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341658.1"
                     /db_xref="GeneID:55990080"
                     /translation="MVRPDPSEPGADNWYMVDDPRQRKRIQDRLAQRARRKRLADSKR
                     HTPAPDMVVTRHINTEPLTPTSANQSTFVATDDDDDATYIPIPCSPDMSEFPTPVFIP
                     DDSSSNGGFSSVMPMTVWAALYINGSIMGITCSMCFPSKSKPVASNVPDILHPTALQL
                     YSIHPPWIDRFPFPRMRDNLITLIGLLEEEEFLQDLFCMSSFKIKSGGASWDPNAWTI
                     SKSFCAKWGFLFTGNYP"
     gene            <317461..>318315
                     /locus_tag="TRUGW13939_02573"
                     /db_xref="GeneID:55990081"
     mRNA            join(<317461..317965,318023..>318315)
                     /locus_tag="TRUGW13939_02573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485766.1"
                     /db_xref="GeneID:55990081"
     CDS             join(317461..317965,318023..318315)
                     /locus_tag="TRUGW13939_02573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341659.1"
                     /db_xref="GeneID:55990081"
                     /translation="MSYQYSHQDHGHPPLPPGWIAEWEPREQQYLFVDQRTGQKQWHH
                     PEMPPQGGYDDRSRGYGGPPPSGPGGYGHGPPGGRPPPGYGSPAPPGYGSPAPPGYGS
                     PAPQGYGGPPPPGYGGPPQGAYGGSQHGYGSPPPQEEKKNHNLAYGIGGGLLGAAAGA
                     WAMHEYDEHKEKERDEERREEEAERRQREENEERNLEREREQLYEQQREVQREREYEQ
                     NRQEADFERERRLEDEQRYEERRYDEERRYEDERHDEYEERRYEERW"
     gene            <319243..>321064
                     /locus_tag="TRUGW13939_02574"
                     /db_xref="GeneID:55990082"
     mRNA            join(<319243..319606,319695..319930,319985..320353,
                     320459..320938,321008..>321064)
                     /locus_tag="TRUGW13939_02574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485767.1"
                     /db_xref="GeneID:55990082"
     CDS             join(319243..319606,319695..319930,319985..320353,
                     320459..320938,321008..321064)
                     /locus_tag="TRUGW13939_02574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341660.1"
                     /db_xref="GeneID:55990082"
                     /translation="MPVFTDAVSTSVKVLSGLLAIACITLCWLFYPPIYPRNIPTIPF
                     WVTLLPFFYDVDQEETFKRYIRKPLLKHGAVKFFFGGQWNILVQRSTYLAEIFKNEEV
                     YQKSGNDKKLPHSVIAEYLGDNIISSRGNDYRTYRTVIKPGLQENFDPEPIIQNAQKL
                     YSLLRQLRTDGKSAEPNIQDVLQRYSITNILTCLLNSDLSLLDDNNADLNKLQRQVKK
                     EIFKPIFLSFPFLDRLGWLFPSRQRSRETIHAFAQELQRVVCAGHEEDSYWMASEKLG
                     SRLFAARESGIMTHKQFRDNLNVVFVAGQENPQLAMLSALYLLGKYPDVQAKLRYEVD
                     MCLDGDLSPVVLGKLPFLSSVIYESLRLFPPISQLVNRRVDRPVNLGDKIYIPRDTYV
                     GYNSYATNRDPSVWGLTADEFMPERWGTNNEDILKRFRRAKARAEFISFHGGSRACLG
                     ERFALLEMRITLFILVKNCTWTLDPHWPDRMTPAGPLYPRELRLVFDHRQG"
     gene            complement(<321709..>322392)
                     /locus_tag="TRUGW13939_02575"
                     /db_xref="GeneID:55990083"
     mRNA            complement(<321709..>322392)
                     /locus_tag="TRUGW13939_02575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485768.1"
                     /db_xref="GeneID:55990083"
     CDS             complement(321709..322392)
                     /locus_tag="TRUGW13939_02575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341661.1"
                     /db_xref="GeneID:55990083"
                     /translation="MDENILLLPIKGWFKLLSSIQRYPEAFKLCIGWILWNTGYSNFL
                     GLISSLFLQVTGFSSRDGVYQIWSFTNVIFAVLGSLSFLFLFPRARVPLKSWLYVFLV
                     VNMACVLWGCIGINDHVTIGYKHQAEFWVEQALFMSTSSALRSYNRAVYSSLLPKGSE
                     AQFFGLEITLDLATGWINPLVQSVIQDHTHNLRFPMIPNLLLMLVATVFYVWVDISKG
                     IEDAKSLLD"
     gene            complement(<323132..>323562)
                     /locus_tag="TRUGW13939_02576"
                     /db_xref="GeneID:55990084"
     mRNA            complement(join(<323132..323317,323386..>323562))
                     /locus_tag="TRUGW13939_02576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485769.1"
                     /db_xref="GeneID:55990084"
     CDS             complement(join(323132..323317,323386..323562))
                     /locus_tag="TRUGW13939_02576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341662.1"
                     /db_xref="GeneID:55990084"
                     /translation="MPSPYNTMEDRPGDQSGNAKKLATSTGQDGWGEDDSSNTTQSAM
                     GTKKALWAYLVLCFSTGPTSSMAFNYVSAAIQSAANYVGHEPGSDKPCARRGTNISCV
                     VNFGTGEVDYQSYMLISC"
     gene            <324424..>326156
                     /locus_tag="TRUGW13939_02577"
                     /db_xref="GeneID:55990085"
     mRNA            join(<324424..324729,324793..324987,325050..325185,
                     325244..325807,325873..>326156)
                     /locus_tag="TRUGW13939_02577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485770.1"
                     /db_xref="GeneID:55990085"
     CDS             join(324424..324729,324793..324987,325050..325185,
                     325244..325807,325873..326156)
                     /locus_tag="TRUGW13939_02577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341663.1"
                     /db_xref="GeneID:55990085"
                     /translation="MTAGSQSPPEATGPQAKKGEETQIQSSQQPKNDGPPAPPAYTAI
                     PTYRRTFILSIVTVAGFFGPLAGNIYLPALLVLENEFHVSSTVINATVSVFMVVFAFG
                     PLFWASFADRRGRRPLYIASIAVYILANVLLAALPSNLGALFFLRILQAFGSSAVVSM
                     GAGTVADITEPKRRARAMSYFLLGPQCGPILGPIIGGALAGGASWRWIFGFLAISGFA
                     LWVIIVFYLPETLRARVGNGQIYQEASWILWPPRFVSEAVPVEKRGPPPPKVTLSTYW
                     RLFRYPPIGISSFNTAILYSSYFCIAVQLPTALEDTYHWTTAEVGVGYVVVGVAMVIG
                     SLIGGRFSDWRRARLVSSAGEKNVGPESRLVDQIWGVFLCVAGLVMFGWFVDKSIHPA
                     AVLISTFLTGFGMSWIFVATNAFLTECVAQQAAGAFALGNMLRSPAAAVAAVVVSPLV
                     KHMGWGWCFTGLALLNFFVVGTAVLTLRTQSPRWRRERAEKIAK"
     gene            <327111..>327942
                     /locus_tag="TRUGW13939_02578"
                     /db_xref="GeneID:55990086"
     mRNA            join(<327111..327144,327200..>327942)
                     /locus_tag="TRUGW13939_02578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485771.1"
                     /db_xref="GeneID:55990086"
     CDS             join(327111..327144,327200..327942)
                     /locus_tag="TRUGW13939_02578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341664.1"
                     /db_xref="GeneID:55990086"
                     /translation="MDASKIIVLITGANSGVGYATTQVIVSNSSKYHVIMACRNVSAG
                     QEALDEIKGSSSMPAKGSLSLLQLDVSDEASIAAAAKSVENDFGHLDVLINNAGIGSL
                     VPGAHSKESLHYVFDTNVFGPILMIQAFESLLEKSTYSKGPYILQVSSGLGSFSMASD
                     TKDPFYKTTFGSYRMTKATLNMATLQSHIQLADKGFKVFAFCPGLVVSNLRGKTEEAR
                     SGWGMAGDPKLPGQGILNIIEGNRDDLVGKFVHKDGVYDW"
     gene            complement(<328442..>328891)
                     /locus_tag="TRUGW13939_02579"
                     /db_xref="GeneID:55990087"
     mRNA            complement(<328442..>328891)
                     /locus_tag="TRUGW13939_02579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485772.1"
                     /db_xref="GeneID:55990087"
     CDS             complement(328442..328891)
                     /locus_tag="TRUGW13939_02579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341665.1"
                     /db_xref="GeneID:55990087"
                     /translation="MKFAISAIACLVSVALAAPTPAPADTGITIDVAYDNTYDNKDQS
                     TSTLACSDGENGLIKKGYNTLGALPKFPNVGGAPTIPGWNSPNCGACYGITYNGETVY
                     IIGVDVAVDRFVLSQGALDALTGGQAVSLGHVTATYAPAPAQSCGFP"
     gene            complement(<330014..>330820)
                     /locus_tag="TRUGW13939_02580"
                     /db_xref="GeneID:55990088"
     mRNA            complement(<330014..>330820)
                     /locus_tag="TRUGW13939_02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485773.1"
                     /db_xref="GeneID:55990088"
     CDS             complement(330014..330820)
                     /locus_tag="TRUGW13939_02580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341666.1"
                     /db_xref="GeneID:55990088"
                     /translation="MEILKTHDVVIIRYLISAMRDVPVTFAKNMQTTFIHPRLYDPSC
                     PGPIRDMLAICQWQHKSTGFRSNILLSSQLRQKSAELYRLAKAAATIEELLAYAQSLI
                     IAQCILLFHCDNTQNNNEGSDDHVNFTTGMVTGLAQYIWQKAPVYVPQILSAWRAWLL
                     AESIRRTIIMAHILCSTFSFKQRSYSVRTPFIEALPFDLRSSLWDASSEQAWQQQASQ
                     EPLEMVSLREYSDMAVSGRATAITYFGSVVLAACKGVSVSSIYGNVEEVR"
     gene            complement(<333267..>335880)
                     /locus_tag="TRUGW13939_02581"
                     /db_xref="GeneID:55990089"
     mRNA            complement(join(<333267..333799,333852..335295,
                     335353..>335880))
                     /locus_tag="TRUGW13939_02581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485774.1"
                     /db_xref="GeneID:55990089"
     CDS             complement(join(333267..333799,333852..335295,
                     335353..335880))
                     /locus_tag="TRUGW13939_02581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341667.1"
                     /db_xref="GeneID:55990089"
                     /translation="MSQSQLSDFTSSLYSGDIDDLPSLSTQQITPSASHHTIDSGFHR
                     PDDLLVPPSLIRVGPDRRNRFVLYDKMSHNEFIDWWLQTDYGRKRKINWDSHRHTVIW
                     NSYNQVAEGVDGTPKVMCKRCGKILEHPYSLSLNSSGKAQYHGTSTIQKHLKTAGCLR
                     SEKGKKAEITKFLQKEGEISADIPFLQEDWEDDILQFLTLNRLPFHLIEHPSFKRIIY
                     KARSALVAPVIPSADTIRRRLGSLVKDRQQRVLRTLPAGSKISIALDCWTSPFSQAFM
                     AITGYFIDSDWVYREVLLGFKPLHGTHTGSYLSGVLMETLVENNIEDRVFGLTTDNAS
                     NNKALAASLQQALSDGVIITRIPCLAHVIQLSLNQLLVRIKAVPSNESAETKWTESQS
                     RLVQENAKQCQISSTLNKVRYLAIYINASPQRRETFYNLQTTNVKIVPIQDVKTRWNS
                     TFLMLRRAKRLRAIFSLFCAEYDCEEMLLSEHEWRQIDYLLCITEPFFDYTTQLSKTR
                     DVTAHYVFKIYNRLFDHLERSQTQLQRKRVPWKKQMLDALDAGRTKLDEYYAQTDTIR
                     GHIYAVSTMLAPVNKFRFFLSSDWDQKWRDIYRNAFQQALIPYQAQVKSQSQDAYSSH
                     TAAQPSSRLEEMLDGKDIQPRAMTDEISQYLDSDTVSVGPLIFWKEHQYRFPAIAALA
                     RDALSFPATGAGVERLFNTARDVCHYRRGRMKTETIEELMMFLCTSKFDIEAQEAKLL
                     EKFFSQDELEAAKEEREEKLNKDEINPISDTEEQEDELENGPENEMEDIGLDTTSLSA
                     AEPDSPGSPSLPPTCTQTRVSGRKRKSREDDIFEYH"
     gene            <365963..>366262
                     /locus_tag="TRUGW13939_02582"
                     /db_xref="GeneID:55990090"
     mRNA            <365963..>366262
                     /locus_tag="TRUGW13939_02582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485775.1"
                     /db_xref="GeneID:55990090"
     CDS             365963..366262
                     /locus_tag="TRUGW13939_02582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341668.1"
                     /db_xref="GeneID:55990090"
                     /translation="MTSPTPDKPGTVPVPNPGFIHEEKEAQDHTSTEPAQNATSKDLP
                     PQAVPQINITIDMLQTLIQGLRTTRLSHAIINKHHNTKVPDPKRFASKSIKKFEE"
     gene            <374784..>375857
                     /locus_tag="TRUGW13939_02583"
                     /db_xref="GeneID:55990091"
     mRNA            <374784..>375857
                     /locus_tag="TRUGW13939_02583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485776.1"
                     /db_xref="GeneID:55990091"
     CDS             374784..375857
                     /locus_tag="TRUGW13939_02583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341669.1"
                     /db_xref="GeneID:55990091"
                     /translation="MPVQKAIKTISPKNEGLVFDWPIPALRDDYILVKTVSVALNPTD
                     WKHIDFFAPVGCLMGCDYSGIVEAVGKDVKKPFKKGDRICGYAHGGNSIQPEDGSFAE
                     YIIVKGDTQMLVPDNVSFQDAATLGVGVATVAQSLYQSLKLALPTHPLSKEQSVPILI
                     YGGSTATGTLAIQFAKLSGYRVLTTCSPRNFDLVKKLGADAVYDYKDPQAPEEIRKST
                     NDNLTLVLDNISDEASAAFSDNALSTSGGDYVALLQKPGIPRANVRDRSILAYTAIGE
                     YFEFADPDSNTTIKFEAKPEDKEYATMFWGITEPLFAEGKLKPHPAKVNPGGLKGVLD
                     GLNLMREGKVSGEKLVYNVDETN"
     gene            complement(<376076..>378087)
                     /locus_tag="TRUGW13939_02584"
                     /db_xref="GeneID:55990092"
     mRNA            complement(join(<376076..376288,376344..376471,
                     376523..376597,376650..377261,377321..377410,
                     377492..377805,377867..>378087))
                     /locus_tag="TRUGW13939_02584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485777.1"
                     /db_xref="GeneID:55990092"
     CDS             complement(join(376076..376288,376344..376471,
                     376523..376597,376650..377261,377321..377410,
                     377492..377805,377867..378087))
                     /locus_tag="TRUGW13939_02584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341670.1"
                     /db_xref="GeneID:55990092"
                     /translation="MDEKSKANRQPDDIHVVDASSQSEVNPIDHGMFRDTSLNNHTTK
                     THPQPTSDPLDPLNWSRFQKNVVLSIVMFKYFLFTYITTTTVPSFAEIQDQFNISYSQ
                     VNWTVAIPALGLAVGPLFWSSFSDIYGRRSIFIVGTIISLVSTIGVAVADTYGGYMAG
                     RFFQGFGVSPASTVGMAVVNDMFFDFERGQKLGLWVLAIDSGLLLGPTFGGFLDVVSA
                     AWIDWFNCILFAALLVLELFFMPETLYPRSLMLQKMPKEDSFSNDIEKRPRKSAQKQE
                     TPTEMFKDLKRTKTLLFINYHPIPGICHPKPWDSVTRFFITFRYPVVAISILGYCFLW
                     YWWVLSVITMVPAAYANYSPLIQGLLFLGLFLGTLFSEIFFSGTLSDYIVARLAKKNG
                     GVRTAEMRLWLAYPAIVLTAVGLIVWGISIDKGYHWMVGQVALFLFAAGIQIGNTVTS
                     SYIVDSYPLQSMSVVTFYAVFLNLSAFIDPFFIATWQSKSGWTWCFTAQALITLIGGT
                     VVFASLQRFGGKMREKTPQPSWVNPEFDSGLQSVDFIDSSDP"
     gene            <378936..>379535
                     /locus_tag="TRUGW13939_02585"
                     /db_xref="GeneID:55990093"
     mRNA            <378936..>379535
                     /locus_tag="TRUGW13939_02585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485778.1"
                     /db_xref="GeneID:55990093"
     CDS             378936..379535
                     /locus_tag="TRUGW13939_02585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341671.1"
                     /db_xref="GeneID:55990093"
                     /translation="MAVATPRKASLPTEYTSLLPNPLDEHDSTSPDESEDTSTGHPML
                     AELWLLFKRCVPVILAYTLQNSLQTASVLIVGRSSPENLAAAAFAFMFAACSGWLIAL
                     GGTTAIDTLASSSFTGSTNKHDLGILLQRGFVVLGLFYIPVAILWAFAEHIFLFLGQD
                     PVLSRDSARFLLCLIPGGLGYIYFESMKKYLQAQGEFCL"
     gene            <379574..>380479
                     /locus_tag="TRUGW13939_02586"
                     /db_xref="GeneID:55990094"
     mRNA            <379574..>380479
                     /locus_tag="TRUGW13939_02586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485779.1"
                     /db_xref="GeneID:55990094"
     CDS             379574..380479
                     /locus_tag="TRUGW13939_02586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341672.1"
                     /db_xref="GeneID:55990094"
                     /translation="MRPGTYVLLITSPLNAYLNYLFCYTFGIGLLGAPIATSISYWLS
                     FILLVLYARFVAGSEYWGGWSWSAFDNIGPFARLAILGVIHVGTEWLAFEIVAFVAGR
                     LGTIPLAAQSVIMTADQILNTIPFGIGVAASSRVGNLLGARDAAGAARAANMAAWLSL
                     LLGGVVLAILMATKNNFALIFNDDDRVVRLTAEVLPYVALFQIADGLNGSCGGSLRGM
                     GRQHVGAFVNVVSYYCGALPLGIWLAFHGWGLSGLWAGQCIALYLVGILEWAIVFTSD
                     WKKEVERAFSRMEVHDRMEVGGLQG"
     gene            <381153..>382838
                     /locus_tag="TRUGW13939_02587"
                     /db_xref="GeneID:55990095"
     mRNA            join(<381153..381287,381355..381451,381536..381626,
                     381685..381768,381825..382046,382105..382322,
                     382378..382470,382529..382679,382748..>382838)
                     /locus_tag="TRUGW13939_02587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485780.1"
                     /db_xref="GeneID:55990095"
     CDS             join(381153..381287,381355..381451,381536..381626,
                     381685..381768,381825..382046,382105..382322,
                     382378..382470,382529..382679,382748..382838)
                     /locus_tag="TRUGW13939_02587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341673.1"
                     /db_xref="GeneID:55990095"
                     /translation="MHAHILNTLALASLAIAHGDHQQVPMSGPHKQLWYNTLPGDGGK
                     QADSVFSGISTFGRLPYFPCLASDEESYDIAFLGAPFDTGTSYRPGARFGPSGIRQGS
                     RRLNLYGGYNVPLDANPFASEIKVLDCGDIPVTSYDNDYAIQQIEEGHNSVLMRQPFT
                     DAMKPGQSRAGKTLPRVITLGGDHTITLPLLRSINRAYGPVSVIHFDSHLDTWKPKVF
                     GGAPSKTASINHGTYFYHAAMEGLLKNDTNIHAGIRTTLSGLSDYDNDGYVGFSIVEA
                     REIDTIGTDGIIQKIRDRVGTVNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTI
                     VRGLDGLNFIGADIVEVAPAYDTNAEHTTMAAADVLYEVLTMMVKKGPLSIEGSQRDA
                     Y"
     gene            complement(<384145..>386961)
                     /locus_tag="TRUGW13939_02588"
                     /db_xref="GeneID:55990096"
     mRNA            complement(join(<384145..385259,385321..386226,
                     386284..386576,386630..386862,386914..>386961))
                     /locus_tag="TRUGW13939_02588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485781.1"
                     /db_xref="GeneID:55990096"
     CDS             complement(join(384145..385259,385321..386226,
                     386284..386576,386630..386862,386914..386961))
                     /locus_tag="TRUGW13939_02588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341674.1"
                     /db_xref="GeneID:55990096"
                     /translation="MADTILSLLAKRDSITDPNNDPNVGSSRGNASSTTGDVVNDLTG
                     GGSTSSSALISTLAPALVIAAFWFGLFIICRRTQQRWYSPRSYLHNLHHHERTPELPG
                     GWVNWFAPFFQIADSHVLHHSSLDGYLFLRFLRMLCTMCFIGMVILWPVLMPIHATGG
                     GGNTQLDRLSFSNVVNPTRYYAHVVMGMIYFTYVIFVVTRESLFYANLRQTYLNSPAF
                     ADRLSSRTVLFMSVPDAYKNEKKLRQVFGDGIRRIWITSECKKLNSKVDERDKLALSL
                     EHAETKLIRAANAARLKEIKENAKKPKVCEDCEMSDSLWSRKVKRPMHRANFFGKKVD
                     SIQYYRARLAVAVQEVESLQQQHRDGDAKYLSAVFIEFNSQPEAQVALQTLSHHQPMH
                     MTPRYTGISPQEVIWSALNLSWWQRIVRKFLVQGGIAVMIIFWSVPAAIVGTISNITY
                     LASTVPFLGWLENLPAFIKGIISGLLPSAALVLLMSLVPPICRLCARKAGLPSLSRVE
                     LFTQSAHFCFQVVQVFLVTTITSAASAAVGQIIKNPLSAKDLLAQNLPKASNFYISYF
                     LLQGLSMSSIAVVQIMSALVFKILTMFFAKTPRRLFNRWTQLTGLSWGNVFPVFTNMG
                     VIALTYSCIAPLILFFAFVGLFLVYQAYRYNLLFVYNIDIDTKGLVYPRALQHLLTGV
                     YLAEICMIGLFSIKGAIGPLIIIAFYLLLTVLAHISLNEALTPLMNFLPRSLDSEEEE
                     IQANREAEAAYKYAITRHGKIWKWFHPTLYKDYADLRRKVRRDIVRIEYSEAELEKAY
                     YEPCITAKTPMLWIPKDPGGVSQDEIKQTSTVIPISDQGAHLDEKNKIQWNKDDEELP
                     MWERKVLY"
     gene            complement(<389068..>391799)
                     /locus_tag="TRUGW13939_02589"
                     /db_xref="GeneID:55990097"
     mRNA            complement(join(<389068..389327,389386..391248,
                     391318..391599,391685..>391799))
                     /locus_tag="TRUGW13939_02589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485782.1"
                     /db_xref="GeneID:55990097"
     CDS             complement(join(389068..389327,389386..391248,
                     391318..391599,391685..391799))
                     /locus_tag="TRUGW13939_02589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341675.1"
                     /db_xref="GeneID:55990097"
                     /translation="MAWQSPSAMAGNGGGLGGAPSEGVPGHPHPQGTEYTLQGVMRFL
                     QTEWHRHERDRNAWEIERAEMKSRIGRLEGDVRTSKRLQESLGKHVKMLEVALKKERE
                     TVRSLRNGENIDHVRDPKEIAKENLNKLPKSHAKSDTALEVDLDHDGPTHADLRQDTE
                     RDKSRVYLSKCAQEVSYHVIPASHPPELTNHDLQPGLYGDQQLHQQSLEEAYHQQRQK
                     QQQHQQHQQHQQQQQQNNAMVREAAMQNHQPMQSGYPDANRGPVLTDRRNMVASQPPI
                     PAAENREIPPESPGDECSEGAELNDFARAAKALDMTQQDRPRQQQKQASDDASSSTDP
                     DGWNFEEPPAAAHEQDPESAPHHRPDTDAFPKANMLPVKSLSGGSHRRKSSGASRRKS
                     SGGGAEIRDATASQQQNADTIFKVRFALRGHLDVVRSVIFTGGGSPSEPEICTSSDDG
                     TIKRWILPASYGSFGPGAGSDLDVPSYFTHRGHVGAVTSLAACPASPNFSNGGRVLGD
                     GWVFSGGQDASVRVWERGRVDPKATLDGHTDTVWGLSILPGTVGSVFGDRCSNYGGAE
                     RILLASGGADGRIIIWAVSAPPQTTSPQPGARRGGGRRANSISSGSNFPTSPQPSTAT
                     ATPFHYTMVHHIVRNDSPGVTCISPLSPTGLNFVVSYTDASILVYDTRTGEEVVGMAS
                     LETYDGTPSTGVNSVVTSTIGFDGTANLDPNRALTEEEAVVHGATGTSGGVEGVIISG
                     YEDRYIRFFDANSGQCTYTMLAHPSAISSLSLSPDGRELVSAGHDASLRFWSLEKRSC
                     TQEITSHRLMRGEGVCSVVWSRDGRWVIGGGGDGVVKVFSR"
     gene            complement(<392538..>394128)
                     /locus_tag="TRUGW13939_02590"
                     /db_xref="GeneID:55990098"
     mRNA            complement(join(<392538..393187,393252..>394128))
                     /locus_tag="TRUGW13939_02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485783.1"
                     /db_xref="GeneID:55990098"
     CDS             complement(join(392538..393187,393252..394128))
                     /locus_tag="TRUGW13939_02590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341676.1"
                     /db_xref="GeneID:55990098"
                     /translation="MSHRGGDYSPVSSGIESVSPFPPLEDYDDGETPTAIDDNEEDYA
                     LHMKIPVSRRSRTGTAHSTIYTGPLSSENMREVETRTASSTITAPNTSAESQDVDELV
                     ISPTIGVESGGAGLHPQYYVDNEFLDELENESIDFDGEELEEDDDGDDDDDDDDDDDE
                     DENEDEEAEEGNSFGGGMKDHNNNTTVHLHRPFMHSSTSLSGPNAFAPPFYNRPPTPL
                     PPSPSLTSLLRPPFSTTTSRPTTPDTSDGETPNDTEAAVAKSARIATTVPRASPKVPT
                     YEYYGFVLYLTSSLAFLIYLLWSYLPSPFLHQLGIYYYPNRWWSLAIPAWLVMFLVYI
                     YVALASYNTGYLTLPMTSIENIVDEVATVAVIDSKRRRRPGGSEKMKPGSVTSQTMSA
                     MHNRRIHGHYASGSNSSAGGDRGGGSSWKELWSESSDAVMDIPVGGVCEVLYGRDREL
                     DPELVDVEEEDDDDSHYSRYKTIASPTFLSYEDDAAARPSYRPGSSGAYSSYSSGRPW
                     "
     gene            complement(<395200..>401712)
                     /locus_tag="TRUGW13939_02591"
                     /db_xref="GeneID:55990099"
     mRNA            complement(join(<395200..395908,396128..396245,
                     396565..396868,396928..396947,397008..397037,
                     397111..397163,398613..398858,399431..399803,
                     399857..400460,400523..400765,400906..401499,
                     401602..>401712))
                     /locus_tag="TRUGW13939_02591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485784.1"
                     /db_xref="GeneID:55990099"
     CDS             complement(join(395200..395908,396128..396245,
                     396565..396868,396928..396947,397008..397037,
                     397111..397163,398613..398858,399431..399803,
                     399857..400460,400523..400765,400906..401499,
                     401602..401712))
                     /locus_tag="TRUGW13939_02591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341677.1"
                     /db_xref="GeneID:55990099"
                     /translation="MTELSFTKTFLQGVDSKPIKLPYDYVVPPEDMRLPVPYTLPRLS
                     PPHPTMAKKIKTAVAPGSSKSISVQLKSSRNPVLEFSVDNVPLTTTTVHDLREAVRDR
                     VVASDGNPPAGEKIKILYKKKPIGGSAEKTLAEILSDSEPDVFAGGKTVEFGIMIIGG
                     ASIKPEVTESPAGSAAKVTETEPLPSNPAQGPSGSQVLQTEEFWKDLEGYLELRTKDT
                     VEALRLAGIFKRAWQADLVGPARFLPQAPSGVHPIKRPSGLHLLPPTQPLPHQTYRVS
                     FASRLHKMASDGPSTPPPPAAAQSGQLPRGPLTPEQQRKIEINRMKAKALREQREAEA
                     VAKRAAPMSSSSNPQTSGVKRSFNTMTSSEGPATVRDAANNRPLESIKPAKAFSKYVE
                     YEFSKMTDTKGGFLTQEDDPHNRALHVRDGKEEQKPAHMTQKEWERKKLIDNLRRNKA
                     GPFEPGLSVLDDEANKKKCRECGTLEIDWKWEEAFKCCVCSACKEKFPEKYSMLTKTE
                     AKEDYLLTDPELRDEELLPHLKKPNPHKSTWNDMMLYLRFQVEEYAFSEKKWGSPEAL
                     DAEFERREADKKRRRETKFKQKLTDLKKRTRVEAYRRNRQGPAGGNFGDDLGGKKRHI
                     HQWGRLVENPETEMMVKTDSFRKYLSTLKCLRSLPTKSYWKTSLRAFGDELWQAINID
                     EGMIALSDDIVRETGLPLAQRCPGTILTVFIYFMVIITSTVRSTAAANARVMFIVQDL
                     YKTTTGARDIRGEETNVMPLMRVRVPESIINSASSQLSLDSLRSSSPRGCRPSDTELA
                     SHEEGFDISYGGIKYMHPKGCNITVHTAGLNGLKAAVKVSDDGRIQMGRNFQVGEDRN
                     QIIVFPSLQADKLIGKMSSEKAEAVFSEPKYALSDKPRTAYPCVIQRDQAWDIRSYPC
                     TGLGVWLIPFISCSPAYQDILQRLRDDGNSRLIDIGCFLGSDLRRLAFDGARTENMYG
                     IDIVSHWDVGFNLYRDQDSFKAHFIEADMLSVDENPALRALKGTVDVVSISAVLHQWG
                     WKNQVEGAKRVALFTKGPGSLVVGHQIGNVDSKELINEMLKLPQYRHNPESFAKLWDQ
                     VGAETGTEWTTSARLLNWEQMGWDPEDSRWMEPGVRVLDFVVTRVK"
     gene            <401985..>404228
                     /locus_tag="TRUGW13939_02592"
                     /db_xref="GeneID:55990100"
     mRNA            <401985..>404228
                     /locus_tag="TRUGW13939_02592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485785.1"
                     /db_xref="GeneID:55990100"
     CDS             401985..404228
                     /locus_tag="TRUGW13939_02592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341678.1"
                     /db_xref="GeneID:55990100"
                     /translation="MGVGRRMKKQGPPPPLDEATISMIKKRKAAEADAKAEGGKKRRK
                     AESEAEPETKKLKTKKANGVEVNGKGKKPNGAAVLANGSKAEKKKKPAQKPVEPVPEP
                     EEDDDSWGSGSAPDLDEMMEDEFGDLDNVSEGDENDVEKFDEGSVFDSDEDDHPREKM
                     FSDDEDESDAEEKLTAANIAGLSRKLDEQRELEEEEARQEIQESAMQTNIAGDRPDIF
                     GEIDAAAQAGVAPNMQLLRNRITDTLRVIGDLESLGQPGKSRADYLQLLLADFCTYYG
                     YAPFLAEKLMSLFTPTEAFAFFEANEAPRPVVLRTNTLRTNRRTLAQALINRGVVLEP
                     VGKWSKVGLQIFESAVPLGATPEYLAGHYILQAASSFLPVMALAPQPGERVLDMASAP
                     GGKTTYISALMRNTGSVLANDASKVRAKGLIGNVHRLGCKNVVVCHYDAREAFPKILG
                     GFDRVLLDAPCTGTGVISKDPSVKTNKTERDFLAIPHMQKQLLLAAIDSTDHHSKTGG
                     YIVYSTCSVTVEENEQVVQYVLRKRPNVKIVDTGLGGFGSEGFTSYMGKKFDEKMRLT
                     RRYFPHRENVDGFFVCKLKKTGPSPATGAATGSTSTAANGSKSDVSNVSGDDEDVDKT
                     PITDNDGTTAGEAGFGPFNDDQDAELIARAERNRLRRKGVNPKAVLGKQAKKTEKETV
                     EPTASASEKEDEPNKDTKNVAKESKKNKKEKEKKKPESHSESAKTSSSTSSPASKKAS
                     KGKKGQK"
     gene            complement(<404524..>406166)
                     /locus_tag="TRUGW13939_02593"
                     /db_xref="GeneID:55990101"
     mRNA            complement(join(<404524..404860,404915..405509,
                     405560..>406166))
                     /locus_tag="TRUGW13939_02593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485786.1"
                     /db_xref="GeneID:55990101"
     CDS             complement(join(404524..404860,404915..405509,
                     405560..406166))
                     /locus_tag="TRUGW13939_02593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341679.1"
                     /db_xref="GeneID:55990101"
                     /translation="MPHSSLKRADVAKHNSAEDCWVIIDHKVYDLSDFIDAHPGGSVV
                     LAQVAGKDATVDFYQLHRQEVLTKYKDLCVGTLEGETPEVIEQKPGDPSPVPYAEPLW
                     LRPEFTSPYFNDSHHRLQKAFREFTDKHITPEAQEKEKDGTYISQALIDRMAETNILA
                     MRLGPGEHLHNRTLLGGAVGGKEFDAFHDMIAAQELARTGARGFSDGNMAGMAISLTA
                     VKQWLKNKPLKDQLMEEVLSGKKKMCLAVTEAFAGSDVAGLRTTAEKTPDGKHYIVNG
                     TKKWITNGMFADYFVTACRTKKGFSVLLIPRDDNVDTTQIKTSYSTTAATAYVQFENV
                     KVPVENLLGEEDKGFVVVMSNFNHERYMMAAGVIRFSRLIVEECLKWCNQRIVFKKPL
                     IEQPAIRQKLAKMISLVESNQAWLESLTYQMCQMSYAQQAKHLAGPIALLKSHSTQSA
                     GEIASAATNIFGGRGLTQSGMGKVIENFNRGYKFDAILGGTEEILADLGVRQAVKGFP
                     KAML"
     misc_feature    complement(410694..410747)
                     /note="Short protein (TRUGW13939_02594, QKX55501.1) was
                     converted to a misc_feature."
     gene            complement(<411511..>414257)
                     /locus_tag="TRUGW13939_02595"
                     /db_xref="GeneID:55990102"
     mRNA            complement(join(<411511..411624,411686..414053,
                     414109..>414257))
                     /locus_tag="TRUGW13939_02595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485787.1"
                     /db_xref="GeneID:55990102"
     CDS             complement(join(411511..411624,411686..414053,
                     414109..414257))
                     /locus_tag="TRUGW13939_02595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341680.1"
                     /db_xref="GeneID:55990102"
                     /translation="MCIARRDGVSGSTNVQGRVVLPTNVKPTHYDLTLEVDFEKFTYD
                     GTVVIDLGVSKDTDFVSLNSKEIDIHSAIISAKGSVVESNPEISINEDVQTATIKLNQ
                     VLSAGSDARLKLTFTGTLNDDMAGFYRSSFKINGETKYIASTQMEATDARRAFPCFDE
                     PALKAKFTVTLIADKSMTCLSNMDVVSETDLQGSEKKAVKFNTTPLMSTYLLAFIVGH
                     LNHIESNSFRVPIRIYATPDQDIEHGRFSLDLAAKTLAFYEKTFDSEYPLPKMDMVAV
                     PDFSAGAMENWGLITYRIVDLLLDEKTSGASRKQYIAETVQHELAHQWFGNLVTMDFW
                     DGLWLKEGFATWMSWFSCNVFYPEWNVWQTYIIDTLQDALSLDSLRSSHPIEVPIKHA
                     DEINQIFDDISYFKGSSVVRMISKYLGEDVFLQGIRNYIKSHAYGNTETGDLWVALAD
                     ASGKPVQEVMDIWTKHVGYPVLTVTENPETSSISLKQNRFLRTGDVRIEEDTILYPCM
                     LGLRTKDGVDEDTMLMEREGEFKVDLDFFKLNADHSGIYRTSYSPERLLKLGQAARDD
                     LLTVEDRAGMIADCSALAASGYQKTSGLLSLLQGFDTESEFVVWNEMLNGIGSLRAAW
                     AFENGRIKDALKEFQRSLVTSKAHELGWQFSDKDDHVMQQFKALMFGSAGKAGDPTVV
                     KAAYDMFAAFAAGNVAAIHPNLRDSVFTIVLKHGGTKEYDIVLDRFRHAPSSDEKVIA
                     LRCLGAAEDPALVQRTLDLVMRCEVKNQDIHTALGGLGNFPAGVEARWDWLKKNWDTI
                     YVRLPPALEMLSVVVQLSTSCFCTEDQLKDVKIFFDAQNTKGYDRTLEQSLDTIRAKI
                     NWLLRDRKDVESWLSQNQHL"
     gene            complement(<414706..>418036)
                     /locus_tag="TRUGW13939_02596"
                     /db_xref="GeneID:55990103"
     mRNA            complement(join(<414706..415708,415759..416564,
                     416982..417087,417147..>418036))
                     /locus_tag="TRUGW13939_02596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485788.1"
                     /db_xref="GeneID:55990103"
     CDS             complement(join(<414706..415708,415759..416564,
                     416982..417087,417147..418036))
                     /locus_tag="TRUGW13939_02596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341681.1"
                     /db_xref="GeneID:55990103"
                     /translation="MTFAGYLFRQIFVHPNQLPPHLDLSGRTILITGASSGIGREAAI
                     KCAQYHASHLILAVRNVAKGEEVKNQILQQINSLRLSATNQKKLCKIEIWEIDLTEPS
                     SVVKFGQRAQSLDQLDVAILNAGIFSPSFTTTPATGHETMLQVNHLSNALLSALLLPV
                     LQRTAQAQGRPSRLTFTSSEVHMWTPFKEGTKPVIFNEINDPDQFELWKSYANSKLLN
                     VFWAQELCHHIKADEVIINLLNPGSVDSGLHRDFNKAVQMFDKIVGRTPDEGARLLLD
                     AALVQGISTHGKYLSENKVTPTGDVVRKDEKGKLQIKVWNETVEDLQRHASLTELSCD
                     RKTPCQHCVSRGVAGRCSYQETKPKPPTSLERGESSDSDSFGMDESSELGYMKHGPGA
                     LQEVERANFVSRPRKKQFDPSHSSQQNQRTIQRMLPKKPIIDDLIAIFFKEVNRVYEM
                     IYEPIFMRDYELWWSQLHDTGTNTDFALLLLRLCILSVQSIKDFDKDSNIQENHPVDT
                     LNSPVKLEKRLCRIAEDLDSRRPRKHSLLVVQHMFFHVCYLKNRGQIKDSWLVLADTV
                     REAHEISLHLERPGVSELDQELWRRAFWSLYIWDRFMSTFLGRWPLVPEDHCDIDLPH
                     DNIQAITTSPNILTQYTDRLFQVHVARFISHTIGSKAWKKDQYDHAIVTKSIQLFEEN
                     IIRRLPPALSVTNPDRTWDIALPSLVVKRETLHMTIYSAVAGLYRAFSNPWELPTKTT
                     SIDEENEGCDDLNVSYYCNLMSELCKVLDSSMRLYDMRPSSQTEGFFMAPMSIVEALS
                     QIGLCFRAAQSLQAAQWSIRNCETARKIDHQLRFDICEKFRRAFRMLADHSSESKIAK
                     HGAHILSEIASQIGSHYEREQTVFVAAQNFSHEQLNIDMSLPGEDISAYQTIEENEPF
                     DWTHFITSPDRSWFFEDLFLE"
     gene            <419665..>420810
                     /locus_tag="TRUGW13939_02597"
                     /db_xref="GeneID:55990104"
     mRNA            <419665..>420810
                     /locus_tag="TRUGW13939_02597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485789.1"
                     /db_xref="GeneID:55990104"
     CDS             419665..420810
                     /locus_tag="TRUGW13939_02597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341682.1"
                     /db_xref="GeneID:55990104"
                     /translation="MATPNSNTDASKAPTIATQNDNNSVLPSSAAAAVLVPSAPVPDH
                     VQKVRGVEFNDYAGRDITVAELVANMATMGFQASAIGEATRIINDMRAFRDPETGDST
                     TIFLGYTSNLISSGLRETLRFLVQHKHVSAIVTTAGGVEEDFIKCLAPTYLGSFSTPG
                     AGLRAQGLNRIGNLVVPNSNYCAFEDWLVPILDKMVDEQEESKIKAQQSGDPDDELHW
                     TPSRIINRLGKEINNEESVYYWAWKNDIPVFCPALTDGSLGDMLYFHTFKSSPKRLRV
                     DIVDDVRRINTMAVRARRAGMIILGGGVVKHHIANACLMRNGAESAVYINTAQEFDGS
                     DAGARPDEAVSWGKIKAGADSVKVYAEATIAFPLIVASTFARANASK"
     gene            <423364..>436968
                     /locus_tag="TRUGW13939_02598"
                     /db_xref="GeneID:55990105"
     mRNA            join(<423364..423871,423939..426849,426908..427391,
                     427561..427630,428008..428208,428256..428538,
                     428590..428781,428987..429060,429901..429932,
                     430613..434629,434836..>436968)
                     /locus_tag="TRUGW13939_02598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485790.1"
                     /db_xref="GeneID:55990105"
     CDS             join(423364..423871,423939..426849,426908..427391,
                     427561..427630,428008..428208,428256..428538,
                     428590..428781,428987..429060,429901..429932,
                     430613..434629,434836..436968)
                     /locus_tag="TRUGW13939_02598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341683.1"
                     /db_xref="GeneID:55990105"
                     /translation="MDIVNAATSSGPPTDPVTPPAQADITESNTPERPPDNENALAAD
                     MDTADDPLPSANQSQPETPIPTAPEAEAETETAPETTPQDTDATPEVSTAPGETQASE
                     QTEESEATETQDAPPAPAPESTEEPPSPPPEEEEPATWADIVEDTSSPDEEELKEIEA
                     GRGDYSAMEYDYWEKSFYSEVEDPEYRPAHKARLTWKIKGVRGTKENPNRAKIISSPA
                     AYIGGYWWKLKFFPRGNGVNFLSIYIECSKEMPEPDEKMLETEFTVRTGAASDDLKDT
                     QPQMHIQVPALANTKDWFENYKKCYSYAGAQPDAPESSDGSKPAWRIPAQIGVILYNP
                     KEPRTGWMQSSCHQFNPHNLDWGWTSFHGPWDEIHLRQKGQRQALLRDDTLSFDAYIR
                     VFDDPTQSLWWHTSDSEPVWDSLTLTGYRPMGDTVLNHSAEVAGLAAWVHLAPFRKII
                     QNIDVHEYRRNSNVKPRPFCEALQEFLWRLGSKTDSVQCVDTDKVTSTLRNLHEFSSD
                     VVEFWERMRRTLELELEGTGAAEELARLFDSPPVPANDASGSKIDRTLSSQLITSIRI
                     PVDKDNNVQGAVTRYFEDQSGKWSLPPVLHIDFNRQRFDHSSRQWKLLYNRVDLDETL
                     DLSQYTTNSPCSDYDLYGFIIHRGRRTSGKFFSILRPGGPNSRWLAIDDGSHNRVECL
                     TRKAALEAHVGLDKNKLKEANDKTGHDFAVAALYVRHDVVGEYLPGPLEKWDIADPLR
                     TYFETGCYPTFEEDSDKVAKPESTVQVEVYGLPTMGESLGSLFDTFDLMSQAKREKNA
                     MYLTLPKSTELTELRKKIAFAKSSESEQISTDRVRLWKIGHTNKMSYATLLFDRKEDL
                     TESLSSTETEVVRFWTHVLSEEEAKSFGIPDPTIVPKAVDDNKVEDKPESTVEVRDTQ
                     ELDEERATAEGSGTTGVSGTQAQTGATNTVSPEAQPQTEDRTETPSNVDVTMTEDEAN
                     DAAIAAAIAEDVDQMDTEPNTSSAADEQVPAPSESQPAAQDTVMEDSPVSDTQDSSSQ
                     DATDSSAESSSSVETAPDVVKPAPHMYYFIQIFDMDKQLLRPAGAFFSALDVNIKSDI
                     RKHLGWEESKDFLMWSRFDGTSITALSPGQTFSPSHGDGHCFIVGDKINKDQRSKFGA
                     AGLFTNPEHLVQYIWASSRNHPTRAFTGTKTVDATFNGDYYSGEFNKGYYHGKGTHIS
                     DNGTTYSGEFVFGERHGQGKMEYPSGDSYEGDWMEGQRHGQGTFIERKTGNKYVGGYK
                     DGKRHGKGISYWEVADEEMDLCQICYGEEQDALFYDCGHAQQRRTVAGQDAEGEFFYD
                     DDYFCIGKSAASKFASNGYKVALASRSAEDGGFSPEGYFNIKADLSDPSVVSVIYEKV
                     ERALGLPNVVVFNGANRLTTSPNDPLAASLEDIKNSRTVGFDSAYVAAQEALKAFKRL
                     PSQTQSVFIYTGNALNQIAIPGVLPFAVGKVAAAMLIEYAANAYGKDGYRFYYADQRF
                     PDGRPVGLQVDGEAHADLYWKLAQESGQSKWLVTFVKDEGRRAFAGVDFDGNTRQSPI
                     SSRTPHLSGALAGSGLERKEARGVAQTLIYSACDAPGMSSRFPPSSGFSSRGDRSPQR
                     YADRRPVSPPPAGGRDDPNTAPLGREPPRGPKALIDSSRGGYSGGGGRGRGGGYPPSR
                     GGEFRDRDRDRDRERPGGRDFRDGPPFRRDDRDRDWVRRDRIDRDFDARDGRPAFRRS
                     RSPPPPRDARDFRDSRDSGSDIVRMRRNSRDSLVSTSSNPNDGPPVGIGPPPHRGGPG
                     RGRGRGDWEGGGGGRGRGRGHFVDDRDPFRRRSRSRDGWWDRDRDRDRDRDFRDRDRD
                     HPRDVRDRDFDRRTDRFDRRDDDRRVERDERDRPADAWKKDGGPVSRPDIRIPSGPRS
                     SSIPPSASSSTSRGEPPKNLDQPGPDQFRKIPTAPARDFRRDSDRADITPARTEALRD
                     PVLPKGSPPPSAPQVPAFGSVTLPPTVVSTDKPPQPSTIPQTTQPTAPKADRPASSSA
                     ASVNSSKEVPKEAPTEPKALRNENNVPHQEPRPRRESMSEPWRQDIPPRVATTKAPPT
                     GPAASPNKSLAELSPPTAPAALLKRESALESRPPNDSFMSTSPPQGPASTSPILARAQ
                     LSPSGRGGSPQTSPRMSFSSVPTGPRAGVRPSGPWPARGGHAKSKQWVRPGYPRGPPS
                     TGGGGGGLGPRREYDDRDPSDYQPPVGDKRGDIDHRDLDERSEKAISEKPENANVDEP
                     MFLDAMPRATSTKDEDEKKPEKPQEEEDIVDKKEKEKATPGKEQGLVPIPDFTRSSDE
                     EDENEVFTEDYVQERKALFERSIRALKAELPPPTLQDPVIVDLLMKVQLLGMIADGSA
                     PEEPEPSAVETNVEQSKKVLPAETYKTEMEIDEKESVTAPAAEVTVAPPESVNKELIT
                     VESLPFLNSGPLTPLSELDVYQENSQIHERLKETTRNALSKQRQETSQNNKQLREEFA
                     SFYRPWRMAVQDMDDKKQSERKSSSPAASTPPVTPLPPPIPDGREGRRYKGNSELDFQ
                     NALRASAISAQEESERRRRTEATARPDLDREAVVPNMLPKYEVKPGVYKDTNNCVEVN
                     DAFAVYGFYPPEDDFTPEEHKLFTDAFMAYPKKWGKIADELPGRTFSQCIMHYYLTKE
                     EIKYKAKLNKRWRSQRRARKSTTRPKSNALMSDLKADGEDEETVQMTETGRPRRAAAP
                     TFGGDAATEVETSRRGGAKDSDQGEKPASKRGRGGGPGTRGGRRGRGGGAQAQQQLPA
                     PASSSNQPPAAQLSQTQFPATIAPHQPLAPATSIPPGVPLIAKQEAGTRDIHSAESMI
                     RIKEHEREATEEFIPKPARSSRNRIKDPIYVFEAAGGDHDVGGSHKPSVEMGGYGSMQ
                     PTSYWSVPEVRDFPVLLAHFGMDYDGIAGFMKTKTPVMVRNYYQRKLDSGNHEFEEIV
                     KVAEAKKMRGEPTGPLPTPNPTPKRRYEATPSAVSHRPLAPHTDVDHPDDVRLSQKRV
                     SSAMSPPPVQMRPAPDLAPDRNMGRYPPLAQATAAPLAAMPDDSRAIRQSGGPPAPRP
                     FSGPRMGFFTEGREPRTHSGTSTLAASRGQDLQPSPRVAATQGPPHPDFARLEPLPPQ
                     TLRSRVDMHVPGQYQQGAPPPLYMQQAQQGGAPGQFAQAITGSHSRHPSLNKAPGSPA
                     QGMPKHTPDVSPIRRSSFGQSQPPPSHYQYGPPIHQSSTLSPVKEPPTRSSATPAPQE
                     PPRQVPAKRSNIMSILNDDAEEPPPPRKRFASEMTSSPRMSAYGMAESGGVQGSHLRH
                     EEKPAYYSSQAPQSQQAGRYSDYPSYPPPSLGGSSASGPPNHDWMARFDPRSQSQQPT
                     EVVRATPTPTPAPASQYGSGYQPPSNSQPPTPSQSNPPGSSHRGYQGYQGAPTPPHLT
                     PSGRDAPPPSSSSVYRHQNAPSPQPRQSVLSYSSRQAPSPAQSPAAPMSIPPPRQSSG
                     PGPYSPSMAHLQAAPPPSHPLGPQHRHSHSGHQSYQQHVQAMVSGQQQQPQHSSRPSL
                     GLSGGPPTTTSYTSASQHGGPPPPHGTSRSAPLSNPPPQSLGIGRPFTPPAGVHAPPP
                     PAPSIGGMLYPPNSSSAGHLQHHASYSRHPEPSGPPPPPGHHRVYSQGGSRQ"
     gene            complement(<437183..>438276)
                     /locus_tag="TRUGW13939_02599"
                     /db_xref="GeneID:55990106"
     mRNA            complement(join(<437183..437816,437894..438079,
                     438140..>438276))
                     /locus_tag="TRUGW13939_02599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485791.1"
                     /db_xref="GeneID:55990106"
     CDS             complement(join(437183..437816,437894..438079,
                     438140..438276))
                     /locus_tag="TRUGW13939_02599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341684.1"
                     /db_xref="GeneID:55990106"
                     /translation="MSRTDDSSFYLYGIGENPAALTLGSLVLEQYWQPLIARHYTHAV
                     LKEEDLAENAYSSTVKNCVFYGRTSISPNVGLSGFDIIDLRLAWRKDNERVIMAKSGQ
                     RIILKDPESFLHNHVLTNPQAQSVLKLWLSSARSQYLTQFKWARRPKIWFLTGLYLLE
                     GTRAVVRKATSSKIEVGLSSAFVSALSAGSVPIGASISTGKGEEEWQLQMEMEDGHVW
                     AAQYRLLDAKYLLAKNSGLPEDGEESRGKMKMSLYKDILSVNTRRGAAEDGAEVGLSP
                     ETDTDKEDEAQQEEEKAYEEYMQKLEDTIRIFEKAPPRVLNS"
     gene            complement(<438819..>439670)
                     /locus_tag="TRUGW13939_02600"
                     /db_xref="GeneID:55990107"
     mRNA            complement(<438819..>439670)
                     /locus_tag="TRUGW13939_02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485792.1"
                     /db_xref="GeneID:55990107"
     CDS             complement(438819..439670)
                     /locus_tag="TRUGW13939_02600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341685.1"
                     /db_xref="GeneID:55990107"
                     /translation="MAFSPPHTTLEAYIDIPFNIWLSIILIIAYGCAIRNRGLLLLIV
                     LGCSTTIVAFDKTSTVGEMTKTMCLLPLGLGSVLAFLVASRSFQTRFLSAFTTYVNFA
                     VYGNIGMMVATPADGTLRGMCSKVACAALFIWIVQQGRRAGWRTIFLHDDLFVFTSVS
                     KSWIFAHAIYRFVLLTLPCFGSGRRHRLLEVYSLTLTFALSSTSNLPFEYCFGMADTL
                     VVPAVAGWSAIATTFNLIPRDAMKTPNNIGTSADACLGAMSLAVAMFACYKIASAPRR
                     GSRVVNR"
     gene            <441265..>444745
                     /locus_tag="TRUGW13939_02601"
                     /db_xref="GeneID:55990108"
     mRNA            join(<441265..441366,441435..441511,441572..441874,
                     441942..442199,442264..442279,442345..442440,
                     442495..442629,442690..443359,443436..444032,
                     444129..>444745)
                     /locus_tag="TRUGW13939_02601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485793.1"
                     /db_xref="GeneID:55990108"
     CDS             join(441265..441366,441435..441511,441572..441874,
                     441942..442199,442264..442279,442345..442440,
                     442495..442629,442690..443359,443436..444032,
                     444129..444745)
                     /locus_tag="TRUGW13939_02601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341686.1"
                     /db_xref="GeneID:55990108"
                     /translation="MRIHNIVNWAIALMPKVTTAFLPPPASDAVLQNNITWDNQSFFI
                     NGERQLLLSGEFHPWRLPVPSLWLDIFQKIKALGFSATSFYVHWALLESEPSVYRADG
                     IFDLVPFFEAAAEAGIYLLVRPGPYIQAESFGGGFPGWIARTNGTLRSNDSGFLDSFH
                     TYYSNTTSLIAKYQISNGGPVILLQPENEYTGSNNEFEPSYMQYIMDEARSNGIVVPF
                     LSNDPGPYGHNAPESGVGAVDVYGHDYYPLGFSCSNPDNWTSFELPTDFYQTHESQSP
                     TTPYSLVEFQGGSMDSWGGPGFDNCAQMVGAEAERMWYKNNVAAGVSFFSIYMIYGGT
                     NWGNVGYPSGYTSYDYGAAITESRTVDRDKYSELKLLGNFLKVSPTYLDVQPFNSSVT
                     MAITSDISVSPLLGLSTNSSFWVVRHTDYTSSDDTSYTMPIQTSNGTVTIPQLGGVLS
                     LLGRDSKILVTDYPLGNINLLYSTAELFTWKQFGDYIVVVLYGEIGEHEELAIGLSNP
                     DITVLEGDSSSVQHQYTGNQTILAWDITSSRLVVRVGDVYLFLLDRTSAYNFWVPQLI
                     TSETTHNYTSNATIASSIIVNAGYLVRTARLQGNDLYLEADFNATTTVEIFGAPENAK
                     NLYINGRGQNFTKDSHGFWSTSAIFETPQFTLPDLTKLTWHSIDSLPELQASYNDSDW
                     VDASLTFTANVDYKLSTPTSLFSSDYGYHVGFLLYRGSFTANGQETQLNLTTQGGGVF
                     ETAVWINDTFIGIEEGSREPRGILDYSLDGGHSQSDISWKLTGNLGGEQYVDLTRGPL
                     NEGGLYAERQGLHLPYPDVNDSTYGWGSSTPFQGIDSAGVGFWTARLPLDLPSGYDIP
                     LSFQFDQGTLSGAEYCAQLYVNGFQFGKYAPSYGPQTEFPVPQGILNYNGDNWLAISV
                     FSYNSSGASVSSLQLVNNTIATSPIQVDLTNQPAYTKRANAY"
     gene            <446006..>446512
                     /locus_tag="TRUGW13939_02602"
                     /db_xref="GeneID:55990109"
     mRNA            <446006..>446512
                     /locus_tag="TRUGW13939_02602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485794.1"
                     /db_xref="GeneID:55990109"
     CDS             446006..446512
                     /locus_tag="TRUGW13939_02602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341687.1"
                     /db_xref="GeneID:55990109"
                     /translation="MRVSTLTSVVLATVVSSAAGKATYLKSSDGDYLLGSYSTSDSGD
                     AGLLAFYPSSSPGKGQFETVSIESDTTLSFGGDFNFYLDPQFTGPENLIEEVYAFELV
                     RDDPAAAGFSWGQDGTLELSSDKFHGWVHCQGGGWTGADGNSTFFWSAAPIKTLPDGC
                     GQVDLVKA"
     gene            complement(<447199..>447732)
                     /locus_tag="TRUGW13939_02603"
                     /db_xref="GeneID:55990110"
     mRNA            complement(<447199..>447732)
                     /locus_tag="TRUGW13939_02603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485795.1"
                     /db_xref="GeneID:55990110"
     CDS             complement(447199..447732)
                     /locus_tag="TRUGW13939_02603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341688.1"
                     /db_xref="GeneID:55990110"
                     /translation="MYIRPNPPGAFAEYIATGPLGRFEGFLGSLWSASFTVVGPEYVS
                     MVAGETKLPRVYLKTAFKTTYARFAFFFIGSALAVGLVVPYNDETLLAILGGSASGSG
                     TAAAPPYVIAMKNLGISVLPHITNALLVTSIFSAGNSYVYYGSRSLYSLSLQGQAPKF
                     LRRCTKKGVPIYCLFVL"
     gene            complement(<447933..>449593)
                     /locus_tag="TRUGW13939_02604"
                     /db_xref="GeneID:55990111"
     mRNA            complement(join(<447933..448020,448086..448906,
                     449015..449073,449129..449428,449497..>449593))
                     /locus_tag="TRUGW13939_02604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485796.1"
                     /db_xref="GeneID:55990111"
     CDS             complement(join(447933..448020,448086..448906,
                     449015..449073,449129..449428,449497..449593))
                     /locus_tag="TRUGW13939_02604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341689.1"
                     /db_xref="GeneID:55990111"
                     /translation="MADITAPNLFNHPKLIPGSFLEDSGDFKHFEKDDFRFTAATKPT
                     SLTSVDHLWGSIHETSQWGSLAQNNGGMSRLSLSDQDKDVRNWFIQEAGKLNCQIRVD
                     AVGNIFAILQGENTDIPPIGVGSHLDTQPAGGRFDGILGVLAGLEILRTIVREGARYT
                     SGCTGSAVWSGHVPLREAYQMPTSDGSSTLGQELQRIGYLGRWEASHKILPLSAHFEL
                     HIEQGHRLEDARKKIGVVDAIQGIRWYTVTVRGEQAHAGATPVMNRADAVVAMSKVVV
                     KLEQLALETGVFATVGEITVESGSSNVISGLTHFTVDLRHPRESLLDEVEHCMCAEMS
                     EISQTKNGRVSFAVKRVWHSPAVFLDPLAVQCVQDAAHEVVGVDQLMPEMISFAGHDI
                     APVASNGTPTAMIFVPSLKGISHAPEEWTSKEDCGLGTEVLYHAVRKFDQHLQRKEES
                     LANI"
     gene            complement(<450077..>451672)
                     /locus_tag="TRUGW13939_02605"
                     /db_xref="GeneID:55990112"
     mRNA            complement(join(<450077..450730,450804..451332,
                     451395..>451672))
                     /locus_tag="TRUGW13939_02605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485797.1"
                     /db_xref="GeneID:55990112"
     CDS             complement(join(450077..450730,450804..451332,
                     451395..451672))
                     /locus_tag="TRUGW13939_02605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341690.1"
                     /db_xref="GeneID:55990112"
                     /translation="MSILFSYPIYHFIILRIHVLIYTLVSSLATCATILTYGKLYTIF
                     SERYVFVSSLTIFVVGSVVCAAGPSSLALILGRAIAGLGNGGILSGCNIIIARVTPLR
                     WRPFYQSLVGGIECAALASAPLIAGAIAKYQSWRICFYISIPFGAVPALICFFFLRIP
                     RSQCQQSISSARPSFLRQLDVLGMVLFVPLIVCLILALQWGGTLYAWSNFRVILPLVV
                     AGVLSPVFITQQYYARETSTLPLRLLRSRTLVSGIILIFATAGTLYVFTFYLPIYYQA
                     IRDASVLGSGLRDLSRMVGLVIALLVAGSVTSFIGYYTPAMLLGTVLMSVGAGLTSTF
                     HPSTGLGLILGSQAVFGLGCGFAFQQAYVAVQVVLPSSDIPAAISILTFAQFLGSIVM
                     LAISQNVFSSRLISGLGSMSLGLDITEILNSGAVDLKNYVPVEKLPEVLQAYNTALDQ
                     VFYIGLGAACLTVVGAVGSEWKTVKSKSKENEGSGS"
     gene            complement(<452840..>453771)
                     /locus_tag="TRUGW13939_02606"
                     /db_xref="GeneID:55990113"
     mRNA            complement(join(<452840..453244,453293..453320,
                     453382..453661,453714..>453771))
                     /locus_tag="TRUGW13939_02606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485798.1"
                     /db_xref="GeneID:55990113"
     CDS             complement(join(452840..453244,453293..453320,
                     453382..453661,453714..453771))
                     /locus_tag="TRUGW13939_02606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341691.1"
                     /db_xref="GeneID:55990113"
                     /translation="MEKAAERRRMQNRLAQRNHSSRLTFGFMSYGGENMKKRITNLEK
                     TNEYLVSKIFKENVASNPNTANQTIDIEQFLHEDSNEQFYPLPVAINTELSKTNTPKI
                     SSTLDSHAFTGESSLLDRYCNPIPQDGDDNQTAAVTLDTPANIGNVQYHSKSSEDRSS
                     VFNTSQDRIQEALRVAVANSHIECVDVLLRSGANVDQVDNNGRSLLHLCSETGNAIVA
                     QYLVRNGANTEVRDRWGLTPLLLAAHTGSAEVIKILIE"
     gene            <457933..>461978
                     /locus_tag="TRUGW13939_02607"
                     /db_xref="GeneID:55990114"
     mRNA            join(<457933..459358,459426..459468,459526..459679,
                     459759..>461978)
                     /locus_tag="TRUGW13939_02607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485799.1"
                     /db_xref="GeneID:55990114"
     CDS             join(457933..459358,459426..459468,459526..459679,
                     459759..461978)
                     /locus_tag="TRUGW13939_02607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341692.1"
                     /db_xref="GeneID:55990114"
                     /translation="MSNPLFIDNQRTHSVSELFETKWPLVSMETDPVSSSDSDHERLE
                     HQRHGQPDAKSNSTRLTTASKSSIRNSVAKTPPQIYYAAWALMSRRYADSKDIPYGIL
                     SKNADKYVIRTLQLSIEDTMKAPQLQQDILTKLESMSDEVTLNSDQLKEESWVGKIME
                     STIPSLVQIRHDDSSTVSPKFDAEKQEDSVSLNDKLVPSKILVVSICLSDASMETQIS
                     FDPVYFSQWQIENILSQFEHVASYLENSNGNIQVSKITLLSPRELNQILSWNWNEPGS
                     VTETIPDMFARQVCLHGPDAAVASWDMDLTYNELNDLSLRLASYLIQECGVQIEDIIS
                     MCFDKSAIAVVAILAIIRAGGACLHLGISNPKQRMESLIESSRSKLIVCDEVNAGKVN
                     ALGRRIVVVDKLFVDSLITPTAFSLRNIQPHNAAFVIFTSGSTGAPKGIVLEHASLCT
                     SCESFGSRMGIGPGTRILQFAAYTFDVSTADILFSIMRGAKLKANWLFLTPSVASAVD
                     SRSFSTVKTLLLGGEAPTHKNISDWAERASLHMDLQQVAVRGLLKPDNHEALSPLGCI
                     GELCVEGRTVARGYLGDEFKTQTSFIEDPSWLPLSQQKLHPRRIHKTGDLVRYNSDGS
                     ISFIGRKDRQVKIRGQRVELGEIEYQISHNVPGVNQVVVCPMQNWGPKTGEALVAFLA
                     RSQGFDTSNMEVNVGDFDSQMLDILRGARDKLSSKLPTYMLPRLYVPVTSIPSTANGK
                     LDVVYLKDIMSNISESQLVKFSLVQDSGSSEQPIENNAIALQSMWASILGLTEHDIES
                     GSNFFLLGGDSIKAIQLAEEARNKGYSSLTVSSILEHPSLLEMASNMNENNIEVTTET
                     IAEVAPFSLLPILYSSTEDLIQQCASMCHVNGAEIEDIYPCSPTQEAIFSFSMRNPGS
                     YIINETYRLGSDVNVYDFKEAWETMLAENDILRTRIIFSESYGFLQVVMKRRQIIWNE
                     SATQMSLSINSGSPLAKFGIIQTTQESSTAQFLITLHHALCDGFSLPLLLETAAKIYY
                     GKIYTPLTPFKNYIQYLSTRIQLESESAKFWEQRLQGSQTLTWPTSVDSPPEKESTKI
                     VKASVQFPEKAMQRPSDFTLSEIIQSAFSLLLGQYTRSSDVTFGLTISGRDVPLPSIL
                     EINGPTLVTVPMRVTWDQAQSVQKLVMGMRHEKAAMINHQHMGLSKIRQCRFEMERVL
                     EIKTMLVIQALNEPSDDQKRMQTRLSTSEIVASYPLTLECQIVNSNSVDIIAEFDSRA
                     IGLAEIERFTHQLGHLIV"
     gene            <462713..>472207
                     /locus_tag="TRUGW13939_02608"
                     /db_xref="GeneID:55990115"
     mRNA            <462713..>472207
                     /locus_tag="TRUGW13939_02608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485800.1"
                     /db_xref="GeneID:55990115"
     CDS             462713..472207
                     /locus_tag="TRUGW13939_02608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341693.1"
                     /db_xref="GeneID:55990115"
                     /translation="MLVGGTICIPSESDRTSDLVKSINELQANAADLTPSLANILTPQ
                     DIPSLKVMILGGEAMTATIVRKWVPHLTLINTYGPAECCIVSTTAAPAKGGLDHENIG
                     RTTCGHSWIVDPEDPDKLLPVGAVGELLMEGPLVGRGYLNEPEKKAAVFLERTSWAPN
                     GSRIYKTGDLARYREDGNIMFIGRKDNQIKIHGQRVEIGEIESSIESMENVSGAAVEF
                     VNNSHLQQTLVAFIALHDPQADRTLDEEISLTLLDSLSQIKKKLEESLPRYMVPSLFI
                     PLPVLPITITGKLDRKGLRKLIDNLTKADLVRYRLVQETFNAKDSLKNDAQIALRLAW
                     GEVLQAPLETISLRSHFFGLGGDSLSAMALANSARRHGLLLTIPHIFQTPILEEMSIV
                     ATAMTDRSDSSSYDEPFSLLPKSISAQSILETGDLQLPQHSIEDIYPCTPLQEGFILS
                     SAKVSEAYCAQHVYKVSPIVDTQTFRTAWMNLVDENAILRTRILFLNGTGSVQVIVRD
                     PESLSLVTHRTGLYDYLRQDRAKPFTYGTNLSRFALVIEEALGERYFVLSAHHASFDA
                     VSMELLLQRFSEIYSELSYQPRNPPSFKRFISHLENMDTESCRNFWTSQMKGNPSTEF
                     LRPAGTGPSNQKRNIISHEISLDSLRFVKENRRWTLETVVRASWALVIAQYSEADDVL
                     FGATLSGRTAPVDGISEIVAPTMATVPVRIAVDKGLSVEQFLDQIQRQAVDMIPYEHY
                     GLQKIQQLEPHATTFNTILDIQHKTSRRSKPWDDIMSPCKITASSEQAEAYHVQSCIM
                     ECWISQNFLELRANYDHSVVSQWEIQNILRCFGNIVQQLCYGGDKKACLISNISLCDT
                     ESFNQIMEWNTSKPTTTESMIHDLVIRTASKNPTAMAVESWDGGLTFEELDKLTKRLA
                     IHLGNLGTDFLGNLIIPICFDKSIFAVVSMLAILRVGGTYVPLDPTYPASRLCGMIDQ
                     VHASFVITSSKYHPQFEGQVENIIVLDNTLLEKLQHIQGDFPFSNPTVAIREPSPGDQ
                     AMIIFTSGSSGKPKGVVITHESFCTLAVGLGKTLNLSESSRVLQFAAYAFDVSNAEIF
                     MPLIHGGCVCIPSPEERINDLAGIINRKKVNWLYLTPTATTLLKGSEEVLTVRTLLLG
                     GEAARSDIIRTWASSVELINTYGPAEGTIWPSVALFPPGSSPLNIGQGNNCHMWLVDP
                     ENHHRLVPIGAVGEILLEGPLLAHGYFEDETKTQAAFIHDLKWARSYGNPRRFYKTSD
                     LARYNHDGTMSFCGRIGTMVKLRGQRLELGEVESYIKRCVSHTSHVCVELMKKPNNVD
                     KLVAFVTIDQEEKNEISPLLSIGEIGITSGAQSREIFDQVQKFLRSHLPQFMHPSIYV
                     PLKTMPRTASGKTDRKILREWYKQVDAALIESLSSTETIKMAPQTPKEVHLRELWSQV
                     LNRDESKIGRDDDFFQIGGDSLSAMRLAATSRDLGLSLSVTDVFLKRRLSELAACLGD
                     IHGNMPSTLEPFELLGSSKHIQRFFKRSSPLWDIHNLKNAYPCTPLQEGLISLSNKSQ
                     DAYIANHTFRLPPGVDMARFKSAWQSTVHGFDILRTRIVSDPEYGFLQLVLHNEKIDW
                     ISLGSLEDFPTGKAENETLSHLIGGSLATFYLVAPKNAGKEWTFILRLHHAIFDANSL
                     ELMLLYAKARYYSNQHIPTISSYDIFVAHVIGSRSETSKGFWVKELGSFNGSKFPDSS
                     SVIQDASQIMATYSHNTSIIHSKESPYTITTILLAAWAIVISIHSQSDDVLFGQTLSG
                     RDTPVAGITGVGGPTIATIPRRIRVHTGQLVESFLSTVQNQSAESLVHQHFGLQNISS
                     AIGSRESCDFNSLLSIETVHEITPSQSFLEEVHTTDDSRYHTYPFVVQAFLEAKTTSS
                     YSLEFSAVYDENRMDTWTVRNILSQVSHVASQLQQTSRAVREINVCSPPEKGQMEEWN
                     GNLKNSNPGQHSLIQSRILSWAQKTPNSIAISGWDACLTYRELDIFSLKLSQMLIEND
                     AFSTGAIVGICFAKSAWVAVAALAVLRTGASCLFIEPNHPLERRLEIINQAYCAIILA
                     DPSNASSALRNYAHVVEVTRPVIESNGHSSTPPAVNSHHDDTASVVFTSGSTGKPKGI
                     LLTHHSILSWFDSFSTKLNISCKTRMLQFASAAFDAFTMEIFAALLAGCCLCIPSEHD
                     RLNNLDGFIREMNVTWTFFTPTALTFLQPDKAPSLQTVVLGGETVKRHNIDQWAHRVE
                     LFSIYGPAECTICICSVRLLPPSNPTNLGHAHGSSVWISDSSNPERLAPLGAIGEICI
                     QAPQVSKGYIHDPKRTAMNFLEKSPWSSQGWQPNMSEFSMYRTGDLGRYNADGTLTYI
                     GRKDKQVKLRGQRIELGEVEDRIRLSMHQPVLVATEVVEFGGSSRGPTLATFVDIGSS
                     QEYAGQLADKKTLEAGRWNEKMDDLQIQLTKTLPRYMVPSVYVILLSMPLTATGKIDR
                     RQLLDISNRLDYTQLREFMASRARRVPTTKTELLVQSLWASSLKVSPSAISADDTWVQ
                     VGGDSIQAVHFVTKARSHGLKMTVSALLSSSTLAILAEECDKDGVNNNNTKQELPVYS
                     LDALSDNESVSPELRKQFETIYEGTRIKYIVEATDFQSEMLSAGMQRSRGWNNYLRMI
                     LGDTALDVTKAKAALQALVAHHDILRTVLLCHRGQVFQCVLESVEVQIQTSLHVDNLE
                     TVAQAWIDEDIRQPPTVDLPILRASIVTSSTNDHDCLILGLSHALYDGMSLPTIRDDW
                     SLAYHGQQLISNGPSFVVYSQELIRQKKRESHEDRALQFWRKVLGGSTMTEIVHHSLP
                     LYECPIDQTLSRKIAAPKQELSRHGFTFPTLLKSAWAVVLSRWSQRRDVVFGHLVSGR
                     AGLDVPIDGIETIVGPCINLIPVRVNVDKSNTILGLLSSIHQQHLDSLPYETTGFRQI
                     IRECTDWPNWARFSSIVQHQNIQGVDDILSAHQPTGLFCPEHDSADVWIISVPEDEGR
                     SIRIDLNYSRDTISDLLATTLVNELCGMMQLLSQQISDCSIPTLSATMPNLPQKLPPN
                     ISAEMAGIEPSSVSQAETSYKKSAISNVEEVVEECWEIAGLGVDTEETTPFYDLSGDL
                     IPALQMQSVIKEKLSLIIEVEQFVRMPTKKAQRALLRRELEKQHFS"
     gene            complement(<472502..>474036)
                     /locus_tag="TRUGW13939_02609"
                     /db_xref="GeneID:55990116"
     mRNA            complement(join(<472502..473696,473750..>474036))
                     /locus_tag="TRUGW13939_02609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485801.1"
                     /db_xref="GeneID:55990116"
     CDS             complement(join(472502..473696,473750..474036))
                     /locus_tag="TRUGW13939_02609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341694.1"
                     /db_xref="GeneID:55990116"
                     /translation="MAWLWPKKSTILPTTRETEKDNGPLDPEYLVEWAPNDPLNPQNW
                     SDSYKWWVTFQLGMLALVGSLGSSITTPADDTIAIYIGVSDELVVLDLSLYVLGFMLG
                     PIIWAPMSEIWGRRVSILPAVFCQALFCIATGVSKDASSIFVTRFFAGFFGSAPISNV
                     TAALGDMWSREKRGTAVSWYAVAVNGGPALGPVIGAALVVNPHLGWRWAAYVQAIWGF
                     VIFLLTFFCLPEVYPLVLLKRKAQNLRKETNDSRFYHPHEHLKLDVQSIMTKQLARPL
                     KMLFTEPIVTCVSFYAAFVYGVMYLALELFPIVFKQTRGWSPVVSALPFLGLLIGVVS
                     SVGVNVYNQHRYNQISRAANGIAVPEARLPPMIFGGIFFVAGLFWFGWTASPPHHWIL
                     PCLATVFIGIGFNCIFQQCLNFLIDVYKVYAASSTAAVTFLRSLMAAGLPLAAKPMVR
                     ALGIGPAVSIIGAVAVILLPVPLLFIKYGPRLRKLSKLAPEGS"
     gene            <475101..>479310
                     /locus_tag="TRUGW13939_02610"
                     /db_xref="GeneID:55990117"
     mRNA            join(<475101..478529,478588..>479310)
                     /locus_tag="TRUGW13939_02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485802.1"
                     /db_xref="GeneID:55990117"
     CDS             join(475101..478529,478588..479310)
                     /locus_tag="TRUGW13939_02610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341695.1"
                     /db_xref="GeneID:55990117"
                     /translation="MDFEERITTEIQSLFADEYRGDLANAYSEIERFKSDELTEYSAN
                     DPDKMAYFLRSIILVSMISGRLDDAYDALVQLQVLVDTDLADESNSQHTTNWGLRYAA
                     LKAYVDYNRRYPPCIPYQHELMMPVNASMIGRGIHGPTDIAMELIDNVKKYLRPNETS
                     PSYLKDVNICLALQTLIYFPMQRRTLTVKQHPMAPNGNWKNNSDGKSPEQIITEVNPQ
                     ILKLVQTPNQNGPGLQTNLYFRRLLVELHYAIDSPEKEQVTKRLYDEYHELGDKAGMA
                     NCKLIEADCLLSPPFASPVTQNLIPVHAPTASGECSLWDPVEKRILLKESDQAERYYE
                     ESLECFRESNCGRGLAAVLLRQGSILHAKACSLSLNNPGRVKLLEGVTNKYDEALKLL
                     NRDEANSQVVKTNQILLDISKGSYSSKELKQRASDIGKWGREHKNELLSFHLSVFMLR
                     FARREWERYTNFDVAMMSYECAYSCATELGALTPAFVSMCSRAEIHYETNNSTAALVM
                     VEHSINMFNAVLHYYDDLINATTDTPMGIMDRKHFIIKKFDFIWSVGQTVGGIYGRTD
                     DLDRFKSWEKRYLICFEEDENCVSQAKEYILKDTELSSWIKQNWGATVDEILDESSLD
                     TSISSKYQIANIMAKRSMQKGDWKKAESSINRFVEDVAKFKRIYTREMFRMLAYQLIG
                     ETTKIKRILDSMTDSDLFKDRIDELGQQGHYRESFFSPLSVNAIYACVIAEDWRRGSR
                     ILSLVLDMEPEFLDETSQTGSKFDISFRQVTAGIIYLNNFQSEIAFQMLLKARHRIEV
                     HRGQLSDVDAKVGALSLTRLVEVYFTLTELCLRCASAGLPVAILHSYDHGHPRDVTWE
                     EHALLFLEESRARSLLDSLESSAHSQPTESGRRMSEGIYKRRALTHLQSLSKRTAQQD
                     QELAELVSEVEGLDVESLSYSTNALINTVGSNIPPHSLFNHLSEDVVVIEGVFYHRGC
                     NLLAVTNKGVVSFHRGKTRLIELQKLVMELMQVMRVMTGTKDDDEQDRKARVKALSRQ
                     ISNILLTPFAGIIRRKRHIIFSVSEPLSAFPFSMLDFDGNPLVMHAAVSQTPSLTVLY
                     YLSQRGPQSTKPTVTVFTKSLSQDDDSSNVRNTKEVTLPMAGIEAVNISNMFSTWPIE
                     ASTLSRAQFRNHIEEHTSVLHIGTHGMIDLENPLLSSISIGEDFRVLDMSQIQSKANL
                     VVFAACLSGLGRATIGSDVLGFTHVVLGTGCQAYIGTLFEVSDFASMVLMTLFYRNIK
                     NDPSLSLVEALRRAQVEFLQFDTDKATRFIDDLLDMWNMKSTTAPDGVRNPADIVPEG
                     EYLLTLQKMLLPQLDWTSPYFWAPFVLMGYGDFCFCPDAEPVFLEGLASSPKLVPQDK
                     EDYLE"
     gene            complement(<479388..>481097)
                     /locus_tag="TRUGW13939_02611"
                     /db_xref="GeneID:55990118"
     mRNA            complement(<479388..>481097)
                     /locus_tag="TRUGW13939_02611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485803.1"
                     /db_xref="GeneID:55990118"
     CDS             complement(479388..481097)
                     /locus_tag="TRUGW13939_02611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341696.1"
                     /db_xref="GeneID:55990118"
                     /translation="MSSQYNTEPPATASVTLNTTIGPLHIALFAKQTPLACKNFIQHC
                     LDSYYTGTVFHRVVPGFVIQGGDPTGTGSGGSSIYEDPEFEYDPEARDPNEKVVFGDE
                     IHSRLRFNRRGLVGMAKSEDGTYGSQFFITLGNTEREMNGKCTMFGRIEGDSIYNVVK
                     IAEAELVEGTERPVFAVKVTGCEVGEMGQFTDKLKKRDKIARAIEQPKDEKVTIKKKK
                     KAKGAKTLLSFGADEGEDGEGDEGLAALRTKKPKFNTKLVSAGETLDMEPQTAPKTEK
                     QPKKRRHSPSPPPKQPADNRRTRPKTPDPYAQVPPKDPEEPERSPSETRPPAARPSIL
                     ERTEAEIASLKASMRRNVTTQADTGRKKSALEAMIPETSIRGRKRPPPGSTGANGGKP
                     GRGGITGEGYSTGADAETLKLFNAFKAKLESSDSQSLKNNKSKVPTEVSRENTKPSND
                     AVDDEEAETCDLHFIVNCQSCKQWAENPEGDNTDSHDQQDENAGDWMSHRLQFGKDML
                     GKDLNWKKEHKDNSDSLMVIDPREKEKEYVHRGGGKSRKTGRDREREQKRDRAGEREW
                     DRR"
     gene            complement(<481697..>483626)
                     /locus_tag="TRUGW13939_02612"
                     /db_xref="GeneID:55990119"
     mRNA            complement(join(<481697..482563,482613..>483626))
                     /locus_tag="TRUGW13939_02612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485804.1"
                     /db_xref="GeneID:55990119"
     CDS             complement(join(481697..482563,482613..483626))
                     /locus_tag="TRUGW13939_02612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341697.1"
                     /db_xref="GeneID:55990119"
                     /translation="MASGMPGKNATQPINTKVDASGPNPPTAGSEHPVLPGPVAYGLK
                     PVTRRTTDRNMTDSRLLANRKCIYERRLPGNAYITAHVERLQHGYFGSDHTSDSEIPN
                     VDFLGINFVFHPADCDNHRFKAATIRATIQNPPMGEDQYPYPQENPKFLMHAPHLIYG
                     AVSPETLQWTFSLAGSLGISDAPVAAQLSPSGSKSASYKVYEMMKIQGSSRTFRSPDG
                     PEFDVEDGEVVWSLSENPLQRSGLPREFTFVMLVQKPSPDSRLVFKLEIDPVIDTWIG
                     SYPAWWLNKSSYQPLPKRAVNFHAQVGQRFDPVDPQRGFNFSKLANSLDDYVNMPGST
                     YSSNVSPDGVYNDISGSQPIRQGGGTGNNNQTSQPIRIPEYLGYPANEVPYAPLFPPT
                     STYWETSSPFQRGWPQDDAYYGGPTGNNRGGGNSHESTINVRLVLDNGFTTQLAAAAL
                     GNRSPRASPHLRGATLGIPHASDTSPMGRRTRSLRRSRSREDLNGSASQRVYSVADTS
                     NNGEYYSAEPSPDLNDTQGTRKLSEPFITATDINHTPPHNGIRDPLIVKKTPNGTSHI
                     TTPGAFDYTYLPTASYTPPSPPNGFQGMRNISGGPLPRRSVSQRVNGSRNRYSYPSAF
                     VE"
     gene            complement(484523..484638)
                     /locus_tag="TRUGW13939_02613"
                     /db_xref="GeneID:55990120"
     tRNA            complement(484523..484638)
                     /locus_tag="TRUGW13939_02613"
                     /product="tRNA-Met"
                     /db_xref="GeneID:55990120"
     gene            <484750..>486598
                     /locus_tag="TRUGW13939_02614"
                     /db_xref="GeneID:55990121"
     mRNA            join(<484750..486193,486258..>486598)
                     /locus_tag="TRUGW13939_02614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485805.1"
                     /db_xref="GeneID:55990121"
     CDS             join(484750..486193,486258..486598)
                     /locus_tag="TRUGW13939_02614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341698.1"
                     /db_xref="GeneID:55990121"
                     /translation="MYGFLIFLFSYLTSFNWQYITATPYQNCKLLPSSPQWPSIAQWQ
                     ALNESTSGRLLAPSPLCTACHLPFNNVSCAAVGAQWANSSWHAENPWSADYNDNSCLP
                     DSTASCSALGYPAYVVEAHGASDVQAALNFARRTGVRLIVKGTGHDFSSRSSGPGSLS
                     IWTHHIRGVNVTRKDPRAMAYGGVASVEIAAGMQWKDVYATAISHNLTVVGGGDPNVG
                     IGGWILGGGHSPVSSRYGMGADQVLEMEVVTADGEYRVVNETSHSDLFWALRGGGGST
                     YAVLLSVTVIAYERLPTIGYRFSYDTVADSDTFWSLAAYFHQQLSRLSDAGAMGYYYV
                     VPAAPSSNNSSDNIGTISGFWLFPEKTLKEVGDIMSPMENYMLSSPPWAEDTITGDKK
                     VVEWTDFLTEFSQNEPQTVGFDVRLGSWLLDETALSRPLETLKTQLRKSTPPPWELLG
                     HLVAGKGVQNATVPGGSNAVSPHWRNAYSHVVIPRKLSFLDTAAKTAMTTSLRTEANP
                     ALMDLAPESGAYANEADPTISGNWQRIFFGNNYPRLLALKEKWDPEGVFWCKSCVGQE
                     LWEVVDGPDEEDRSEWGVGQIGGRICRK"
     gene            complement(<486973..>488417)
                     /locus_tag="TRUGW13939_02615"
                     /db_xref="GeneID:55990122"
     mRNA            complement(join(<486973..487301,487375..487504,
                     487554..>488417))
                     /locus_tag="TRUGW13939_02615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485806.1"
                     /db_xref="GeneID:55990122"
     CDS             complement(join(486973..487301,487375..487504,
                     487554..488417))
                     /locus_tag="TRUGW13939_02615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341699.1"
                     /db_xref="GeneID:55990122"
                     /translation="MSKITHLFTFLLSVSAVVQAVPAPAPRPSGSAHPGHPGHHGGHG
                     HGSWPPHSSRPGVPSATPTVPLPRSSPVISVSSGEPNTATFAAANSAITPSADASDSS
                     CTFSGPSGAASASESKKSCSTIVLSDVAVPSGTTLDLTDLEDGTAVIFEGTTSFGYEE
                     WDGPLVSVSGTGITVSGADGHVIDGDGSRWWDGEGSNGGTTKPKFFYAHDLTSSTITG
                     LNLKNSPVQVFSVDGSTDLTLDSITIDDSDGDSQGGHNTDAFDVGDSTGIIISGATVY
                     NQDDCLAINSGKNITFTGGTCSGGHGLSIGSVGGRDDNTVSDVTISSSKISNSQNGVR
                     IKTVYDATGSVSGVTYKDITLSNITKYGVVIEQDYENGSPTGDPTTGVPITDLTLDGI
                     TGDVASDATNIYILCGDGSCSDWTWTDVSVTGGSASEDCSNVPSGASC"
     gene            <490420..>491889
                     /locus_tag="TRUGW13939_02616"
                     /db_xref="GeneID:55990123"
     mRNA            <490420..>491889
                     /locus_tag="TRUGW13939_02616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485807.1"
                     /db_xref="GeneID:55990123"
     CDS             490420..491889
                     /locus_tag="TRUGW13939_02616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341700.1"
                     /db_xref="GeneID:55990123"
                     /translation="MATRNNIVLALASLGAIQPSSAETILGAYIFHRHGDRTAKSTPP
                     ASLTDLGYSEVHAHGSYYNSRYVANSSEAHILGLGSEVVKLSQLAVSSPSDNVLQNSA
                     AGWLQGLYPPVGGAANQTLRNGTVVEPPLNGYQLIPVSITSTGSGSESSQWLQGSTDC
                     QNAEVSSNNFFNSDIFKSYQSSSLDLYQSLSPAVNATFTEDELNFKNAYTIWDLLNVA
                     LIHNSTDSNAALANVNTSTIHELFLLANVHEWNLAYNSSDTVRAISGAVLAGQALEAL
                     NETITSNGKSKLNVQFGAYATFLSYFGLAGVASGNPDFTGIPDYASSVAWELVTNATV
                     SSDGAFPPTSDISVRFLFNNGTSSSSYDLTAYPLFGGSSLEVPWDDFVTQTQKFAVTG
                     QEQWCSVCGNTDSSCASNSTSSGSSTTTGTTNSKGSGISNVVAGVIGAMVTLGVVLGL
                     EALVLLASGLRLVRKKTLAAAAAAGATSSTSAENVGAEK"
     gene            complement(<492211..>493596)
                     /locus_tag="TRUGW13939_02617"
                     /db_xref="GeneID:55990124"
     mRNA            complement(join(<492211..492623,492690..493251,
                     493316..493403,493457..>493596))
                     /locus_tag="TRUGW13939_02617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485808.1"
                     /db_xref="GeneID:55990124"
     CDS             complement(join(492211..492623,492690..493251,
                     493316..493403,493457..493596))
                     /locus_tag="TRUGW13939_02617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341701.1"
                     /db_xref="GeneID:55990124"
                     /translation="MSDYEDEMDVDSTAKGAAMQFSSNNTNFKGKKIVSDLPVGAEDN
                     LPWVEKYRPSSLDDVQGHQDILSTINRFIDSHRLPHLLLYGPPGTGKTTTILALARRI
                     YGSKNMRQMVLELNASDDRGIDVVREQIKTFASTKQIFSVAPPAAKGSNSLGAFKLII
                     LDEADAMTATAQMALRRIMEKYTANTRFCIIANYTHKLSPALLSRCTRFRFSPLKEAD
                     IRALVDKVIETENVRIQPDATESLVRLSKGDMRRALNVLQACHASSLPLPMRNAPKDQ
                     PPPEHELITEETIYNCIAAPHPSDIREIMTTLLSTSDVTSCLNTVNTLKTNKGLALAD
                     ILSALSEQLQTLEVPAQTRISWLEGLAEIEWRLSGGGSEVIQTGGLVGVVRNGCELMG
                     DKGVTMQS"
     gene            <493930..>494822
                     /locus_tag="TRUGW13939_02618"
                     /db_xref="GeneID:55990125"
     mRNA            join(<493930..493935,493995..494040,494126..494400,
                     494471..494583,494644..494722,494775..>494822)
                     /locus_tag="TRUGW13939_02618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485809.1"
                     /db_xref="GeneID:55990125"
     CDS             join(493930..493935,493995..494040,494126..494400,
                     494471..494583,494644..494722,494775..494822)
                     /locus_tag="TRUGW13939_02618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341702.1"
                     /db_xref="GeneID:55990125"
                     /translation="MPAYHSIFLDEADLPLIGNFPLLPLRTRTRGPAYVLPALPPSES
                     DIDIDPNSESYDCIDEVLSLFRANVLFRNFEIKGPADRMLIYGILFLSECLGKVKAGT
                     SARDAEKALINTALEQFSIPGDASFPLNHAFERPRDRQDAEQLRQYLSQVRQELAIRL
                     HARLYPGGEGPSKFWLSFAKRKFMGKSL"
     gene            complement(<495021..>496859)
                     /locus_tag="TRUGW13939_02619"
                     /db_xref="GeneID:55990126"
     mRNA            complement(join(<495021..496716,496774..>496859))
                     /locus_tag="TRUGW13939_02619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485810.1"
                     /db_xref="GeneID:55990126"
     CDS             complement(join(495021..496716,496774..496859))
                     /locus_tag="TRUGW13939_02619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341703.1"
                     /db_xref="GeneID:55990126"
                     /translation="MHSVVRPHQHVVLRLPSGVYKLLKLAPGMPVSLGKFGSFYSNQI
                     IGRPFYFTYEFLDQPGDDGYALRVVPAAELHAEALISEGSAEADGVVDDVEMSNGDSL
                     PTRTNRDINDDNSSQTLTWQEIEELKRNTTGAGQEIIEKILEAHSTIDKKTAFSLAKY
                     KLRKRQKYLKRFTVLPVDVGVLTEYILQGKDPNKIMELRDEMIGLLGCWGNVHHAGNL
                     QLDDVKPGGRYLVVDDTGGLVVAAMAERMGILQPPEPEDEEETGDDDEEEKDARNNDG
                     DVADQQMPNAPEESTATDTTPQKQNNAGDYKTPQRHTTQQNATNARENTITVIHAYAR
                     PNLSLLKYFGYEEDTPDESHPLFSHLKTTTWLQLLDPHSDNIYAERPENVDEATLKSW
                     KPRQRGIYHRKLARYNRVRATVDEVRAGGYDGLVVASLMDPESVLRHAVPLLAGGAST
                     VVYSPAIEPLTQLVDLYSSDRRGAYIKKKLALEKEQENLAASSEANLASIEAALFAEF
                     TLDPTLLLGPMLQTSRVRQWQVLPGRTHPLMSDRGGSEGYIFHATRVLPVAGYVNAHG
                     VYGRKKKRKLDESGAQAPAQEVSTPSA"
     gene            <497579..>500356
                     /locus_tag="TRUGW13939_02620"
                     /db_xref="GeneID:55990127"
     mRNA            join(<497579..498221,498279..>500356)
                     /locus_tag="TRUGW13939_02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485811.1"
                     /db_xref="GeneID:55990127"
     CDS             join(497579..498221,498279..500356)
                     /locus_tag="TRUGW13939_02620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341704.1"
                     /db_xref="GeneID:55990127"
                     /translation="MVLRKQPPPGIEVPPRGANAADHRSPVSRSSVSPRSAGQRSRKD
                     SWELDTESVYSPDLRTSPAFDLMPLEEAQKSPMSSQNPWEDELVERPEGTSPMAGNSQ
                     QGIVDQRYSSQNGDANGGAPEVPPKSTDTSRIQPSSNELQPQPTTVQTAPGTQWEMAS
                     PQRFRANNPFARPRPSSPNPWEDGKSPSGQAQDPVNQAPAIPGFHQDPPERSSQTSGI
                     IPMTARLSIFDQPEDPWAQRQSQASWQEQGHSQNAQPAVQHGNGTPSEDIWQLPPADH
                     APATNTGWIANSEQGINSNSEWQAMGASLHPQSAIDQGASASNSPQSSSPHLIDLDDT
                     PARSDFNALSGESQPAAPPNDEQTPPALTQVPPTTLPPMSEAELQRFQEKQAETYAIR
                     HVNWTDTTGKLRESPVLIQNKNGPCPLLALVNGLIMRSVDNRSRSPIVRALQIRENIS
                     LGLLIQALFDELTTYENEVLPDIEALSRFLTMLHTGMNVNPRLTLESPTSAGVFYETS
                     DLRFYDAFRVPLLHGWIADPTSDAHASMTQVAQYYEDIQLLPFRKEELEDRVTQSDST
                     LNADEQRLISDIDTIQYFVDVENATQLSSFGLSHLSKTLAPGSISILFRNDHFSTLYK
                     HPQSGQLFTLITDAGYADHPEIVWESLVDVTGTNAEFFAGDFRPVGHGPSGSGTTGEP
                     QPTTGRRSVGQTARTSNSGTSAAAAERSSSPQATTEQEDADYAYALSLQFQEEARQQE
                     QEQERNRTRSGSNPQTRRSSSTVNTSSTTARGSTAGHRYTRSSSAVNRLRNQSSTSVP
                     STHSNIPMDAPSDQDNDENAPPPSYDQVTRNRSATASRTSWASSQRQQQRQSAGYSSL
                     DAEYARRGHYPGTAAAVGRRQQQQQLPPVSPAALERGTRGDRNGKDCIVM"
     gene            complement(<500993..>502696)
                     /locus_tag="TRUGW13939_02621"
                     /db_xref="GeneID:55990128"
     mRNA            complement(<500993..>502696)
                     /locus_tag="TRUGW13939_02621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485812.1"
                     /db_xref="GeneID:55990128"
     CDS             complement(500993..502696)
                     /locus_tag="TRUGW13939_02621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341705.1"
                     /db_xref="GeneID:55990128"
                     /translation="MRASERKNKSPSEYANPYFKRGHPDLLWLIQKPKNVAGQTSKGS
                     SKGTKARTEDGDEPDGEEYPDEGNREDRSRNRGQLAISTRQEAPPTDQLSGVYRELQT
                     IRQQQQIISTTISKLRREHEQLYAQAANFQEQHNRHENSINAILTFLATVYNRSLQGH
                     DSQQNIANTFAPDQGNVVDVDDDYILSSLGGDPSLATSKFKKQPLLLKAPPQAGAATS
                     DRATTLSPAASSLDGPQGRAGPRQQPMPTGIIEEVQEGNSPQPPPAAGSSFDQRKPQR
                     DIMSMIQNSNAANGIQTNFSDFPNIVSSLETSGGNSALTPKQRADTLRQMAHDSNVND
                     PTATSPNNALISPSPPPMLQNYSAQLNNTRNEIDNLMKMQAEQDRSVQNLTNLLQPLS
                     PTGQIPGLVDGHVPPPSLDLDQIFNSQDYFTDLPDLNDDNKDNIPFGDMSTAPTQTAG
                     TEGDVKDLFDFENLGNEGGGDSDLFGNSGRGAPSGYFDNYEDYTKNNSTFNNGNIIDT
                     DAGSAPGRIVETLTDSEATSPSNTADDNAAGLTAPSIPAAASTPTGSSTTHSPKRRRK
                     A"
     gene            complement(<502940..>503386)
                     /locus_tag="TRUGW13939_02622"
                     /db_xref="GeneID:55990129"
     mRNA            complement(<502940..>503386)
                     /locus_tag="TRUGW13939_02622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485813.1"
                     /db_xref="GeneID:55990129"
     CDS             complement(502940..503386)
                     /locus_tag="TRUGW13939_02622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341706.1"
                     /db_xref="GeneID:55990129"
                     /translation="MSTRKRPAPGTSPVIHGPVGSIPNYTDPNSQLSDDQFLQWGQDA
                     PVPSAAYPVDSTSFTAVPFAQNQDISASSATSSNQIARRPINQLMNRNRPYEQITTPP
                     MPEHGTGEGWGESISDLEQRALVAKRDAQAKRKQIPPFVQKLRRRV"
     gene            <504481..>512324
                     /locus_tag="TRUGW13939_02623"
                     /db_xref="GeneID:55990130"
     mRNA            join(<504481..505405,505467..505722,506301..506803,
                     506881..506912,506980..508252,508707..508756,
                     508837..509421,509481..509615,509692..510245,
                     510707..510734,511083..>512324)
                     /locus_tag="TRUGW13939_02623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485814.1"
                     /db_xref="GeneID:55990130"
     CDS             join(504481..505405,505467..505722,506301..506803,
                     506881..506912,506980..508252,508707..508756,
                     508837..509421,509481..509615,509692..510245,
                     510707..510734,511083..512324)
                     /locus_tag="TRUGW13939_02623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341707.1"
                     /db_xref="GeneID:55990130"
                     /translation="MSQLVEDHTFDFEFNRILAHARYRGCDVREVINLIPKITPGDME
                     SWYKAFVELAERAEASAGAEPRPNQYSRKITYSDRLFAASDYYRAADFFLHGHPEDPR
                     INSLWDKQAACFDAALKHYGNGTRHLVKADTFSVPLIYFKAPDGVGPAGPKPTILAGN
                     GFDGSMEEMFHVNGIAALERGYNVILFEGPGQCTVRRNQGLGFIHDWERVVTPLVDFA
                     LSKEEVDKEKIVLFGYSMSGCLVVRAAAFEHRLAATVAIDGVINTGVAFKAPEPLMKL
                     YNSGERETFDEEFRKWMFDPSTPTPSRWMYQHGLWAFNVSEPSHLFDAVKAHNLHNSI
                     QNVQCPVYIGEAEDEIFFQGQPEQLARALGSKGHLRRFTAEEGASLHCQAGAASLLNG
                     DVYPQDALPSTEGIKKQQADTRSSRAGIRDRVVQLEQMVVSLMQNPTHETPQIGLAEG
                     PRDENRCLNDTHDTSDTIGDSPNHGSLISNSSELQYVGGDHWAAILDSIVDLKEDLER
                     QEEEYAQDPHMSHVLLFYNSKAVSKIEILEALPPKQVVDRLVSQYFNCLDLAPLCLHS
                     GEFLKEYERFWDAPSETPTMWVGLLFSMLGLAALASHTSSENLHAERYDPLVDTYREK
                     TAQCLKLGEYTKPTRYTCETLYNYVVIEYSIQNDTNKDVGVLMGVLIKLAFRMGYHRD
                     PSHFPDISPFSGEIRRRVWVTLLSGDILTSTQVGMPRMIKESEYDTQEPRNLNDFDFN
                     EHTQELPQSRPETEITTSTQMIARGRMFTALGKIVDLTATTNPYSYAEVMRIDKTLHE
                     AENSLPPDFQFKPIGSTVIDPPQIIVNRLFSRLMFHKGQIMLHRKYLNVHPGSSSSDE
                     ISYAYSRKSCLEATLGVLEIQRIFDVETAPNGKLHLLRWKLSSFIRHECLTATMVLCF
                     LAQHGFEQFRQCPDFSAEHAISALRGAHDIWNRLSQSSKEARMASHAIRVVLRRLGHT
                     DFSQSTNNEFALTQADQEMISWEPGIPKSTGCANCRRRKKKCGEERPQCRACVSAGWK
                     CPGYPKRWKFVDGNAPTSALFRVTSDSIEESDYDSDLDRKSQHTAHDSAFCRRTEIIS
                     PGLVPLWPNQSRPLMSETDKAASRLISMLNDSSGQKLCQIRSHANFIDYVPSLLGNNA
                     ALDSTVASLCSLFVDALTGNRTVESLRLFGNAVTSLQLCVKNPNLRLESETLCASILL
                     QICELLKSPGNDKWIHLSKGSKVLFESVGPERCTSDLDRAMLESQRVWFMLQDLRKHQ
                     RCFLAQPEWRRVFSSHLVTPVDIRNPKLSLRSKFCDMLVDIPDVLSDVSRVLTTENNE
                     AFDDTQAERETVLACVISQKRWIEKWYATDLEPLFLRGGDSRYPNVLVAIMDFICSST
                     LLNLCDALSTLSSILPQHVLNPALTVDQLAIANWKDSVSASFAFAGGTSWVISEPLKY
                     GLLTQCGNPIKAIIIGAGPAGLAAALHLKQANNIDSTIYELRPTSGTSGGSIGIPSNG
                     LRLLDRLGLYDKLARLANTAEEFVLHSTRNDAILTEANFSGEAKERIGFGYMRVKRTD
                     LISVLLNAVQKQGIPIHYNKRIVSIDDQDENVTAVFSDSTRDTADILLGCDGIHSSVR
                     ALHVDSSIQPEYTGVSAMFALLKRSELPDGAPPITCFNSTFTTDGVLAVISCTASNDE
                     IFWFFSGEVPVPESGEDGWEEHRRKEVQEVKSSILDVLQQVQGRWGDFVRDLIRRSPS
                     ISFTPIYRMPLGKAWSRGRCLLIGDAAHAIQPHAAQGTSMALEDVFVLSRVIKQHPND
                     SVKEIFLKYDEIRRPRITRIYTASEQNGQLWKKTGPWGLWFRESMAWAVFSLPPLLGW
                     KRGVIPLQDMIYDPDETS"
     gene            complement(<512877..>515411)
                     /locus_tag="TRUGW13939_02624"
                     /db_xref="GeneID:55990131"
     mRNA            complement(join(<512877..515018,515124..>515411))
                     /locus_tag="TRUGW13939_02624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485815.1"
                     /db_xref="GeneID:55990131"
     CDS             complement(join(512877..515018,515124..>515411))
                     /locus_tag="TRUGW13939_02624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341708.1"
                     /db_xref="GeneID:55990131"
                     /translation="QGKKRKKQITPEIRSGGSRRLSATVDNIILADARVIRQPPPCHQ
                     PSIPLFSPAQWLVSSIHFIRNCCWALAIGLPPENVMGELKQSASCLICRRRKIKCDRT
                     PGSCNKCRAFGEQCMYASEAATDVGAATSANNTNSNSNNNSSSSDGVCPSDSITQAGL
                     KRRRVLRSCLECKRTKAKCSGGPVCSRCAKKGMSCLFYDQPEQDMREEPVVHRSSRSM
                     PTWLATKNLPSIDHIRELIDIYFAQIHTVRCMGFLHIPSFMERFNDPRNVYSEVSGLI
                     YIMCALAAPFYYAKLVGAAEEDLGAGVRFYDAGKGWAESAMQCVFSNYGNPSMECLMT
                     EILLHEHYLRSGDYTKGFLISGSIARRVQLLHLNMENDYDLFCQKGQTPWSFKESRRR
                     LLWACYLLDASIECGIDQLRFTSSDDAQIQLPCTDDLFIRNTPCVTEMLKRGKILPFV
                     DASLATRTADNVDMRGYYIRAIVIRSKILRYVKNMDGEIPWQANVNSQFYQLDGELKD
                     LESSITESLKMSPENVYIYKASGRLNLFFGLHILIHQTFNDLYRIGVPKLVLQNSATK
                     WVRDNAPSDFTALCYRTCVSKAVQIGNLLRDLWNCHKPSLVDLPYAVHTQICSSVLVT
                     SLTSWTESEPILPQFSHRDYQDILQTNTRILRYLQRYIKADLYYESANQALRRFNSAP
                     LSSPQPGGQGGNSVSASSTVMDPVDKSTSTSPSQFSLAYILNPLGAYPMPQKDIYGRH
                     RSESSESTVEPGLANSAGRSSPEIYSPSTDSVSSHEENFFPNPDWGTEIPIMDGMGYP
                     TFLEQAPVGAY"
     gene            <516487..>521312
                     /locus_tag="TRUGW13939_02625"
                     /db_xref="GeneID:55990132"
     mRNA            join(<516487..517495,517557..517625,517678..517854,
                     517906..517930,517980..518477,518653..520097,
                     520150..520498,520548..520679,520733..520862,
                     520912..521150,521213..>521312)
                     /locus_tag="TRUGW13939_02625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485816.1"
                     /db_xref="GeneID:55990132"
     CDS             join(516487..517495,517557..517625,517678..517854,
                     517906..517930,517980..518477,518653..520097,
                     520150..520498,520548..520679,520733..520862,
                     520912..521150,521213..521312)
                     /locus_tag="TRUGW13939_02625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341709.1"
                     /db_xref="GeneID:55990132"
                     /translation="MGDDKMVTSISATNRRFSHNDYTIAWISALPLEMAVAEAMLDEI
                     HPRLSTPRNDDNTYIFGRIHNHNIVIACLPVGVYGTNSAATIASQIRSTFGSIRFGLM
                     VGIGGGVPTTDSDIRLGDVVVSKPTRDFGGIVQYDYGKALSGGRFERTGILNKPPTVL
                     LTAVSRLQAAHMIGKNQVPTLLSEIIAKYPVMRDSFAYPSNTRDQLFHSKYDHSESED
                     TCVNCDTGSEVKRVARPSHDPTIHYGLIASANQVMKDGRIRDKLAQELGILCFEMEAA
                     GLMDNFPCLVIRGICDYADSHKNKQWQGYAAATAAAYAKELLTVVQTNQLVDTPTQSA
                     GAVFHHHETIAAGAKPSTSSAVQRSYHHDDERLLKRISSYDYEKAHRRLSHKRLTDST
                     KWFLDHPDFKAWFNEGGSSSLWCSGKIGSGKTMIATAAIDAAKYRYSELPPATVFFYC
                     QNERGETLQASYILSSFIKQLGDFLRRYSKPFSKDLAGKLQSFFGNDRIVPDFEDLQD
                     IFMQVFYDVPKTVYIVDGIDALDEENSNRFLKSIQSIFRGSRSLQGSRILLFSREQIS
                     GFINIATFIPGICQISTLGNVMGDIKRFLWVYLQLEILWSTCFTDAEIRLALNQLPKD
                     LEETYHYCIQRITSQDTDNRALKVLKWVSFATRPLHIEELKEAVAFDLSDTAWDGEKV
                     PQEDFIIGCCANLVVLDPADHCVRFAHSSVKLYLEKHRDAIASTYPINEEQGQLQCGE
                     FCIAYLSFSNFNLSVEKKGHETTSSVVPNPTFLAGEAIASPFRHFFRTPKKGKRPTTL
                     QFQRIRTSSTPDRKQFKFLDYAVKNWAPQTKWITRFSPVWDKFEQLATNFNETWNFHP
                     WDLGGRSIPSRLHSLLGWAVKERHMPLFTIALQSGKYVQQVCNLPLADESLPVLHIAS
                     KLGYHEMIEGLLKICNVDSLDVENYTPLHHAAARGHFDIVQWLSSTRGAFIDLEAKSK
                     VTPLWLAASNGHEKIVSLLIEKKCKIDAVDVFSGKTALCQAAGNGHHAIVGILLSNKA
                     DLDSKDKNGWTPLRWAAENRHKQVVRMIAENGTGGNIEYKILILGTQKSGKSTLWKQL
                     RFLSGSRATIEERALYRPIIYGNLLNSADSVLQAMQYFNVNPRDEGNQEYLEFLTKYI
                     RTANRNNPPDPKVGEAMSSLWKDESINELMKHRTELLYMYDSAPYFFNEAKRIVTQDY
                     LPTEDDIIRVRLTKTSNITSNKLYLKGIKIDIWDVGGARSDRKKWVHCFDNMALMIFC
                     ASLSEYNQTLIEDINQTCMGESLQLLEALLDSKWFLTTTIAIFFTKYDLLKKKLVNSP
                     LENFFPDYTGGNDVALATKYIVGKFEEIGKKHSNVHSYILDLTDIAKVDVVFEDVRDV
                     IVMDYIAKLEVL"
     gene            complement(<523471..>524078)
                     /locus_tag="TRUGW13939_02626"
                     /db_xref="GeneID:55990133"
     mRNA            complement(join(<523471..523836,523893..>524078))
                     /locus_tag="TRUGW13939_02626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485817.1"
                     /db_xref="GeneID:55990133"
     CDS             complement(join(523471..523836,523893..524078))
                     /locus_tag="TRUGW13939_02626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341710.1"
                     /db_xref="GeneID:55990133"
                     /translation="MASIGKCTLAAGVAMQETTLTLANINFDFAIVKFPAPLEFTGLG
                     NSLLKKRKNEAEDGRFHRAYGQRASEIAEDPNFNPTGAQVDGPFKQFVGADGRSIWAA
                     ATSRQGALRVHLLACMLARMWSGPQAVSIWSELVAGRKGMFLEQIQKEQFKLSTMTAS
                     QIEITTEELAEWDASARSASQFL"
     gene            <525208..>526754
                     /locus_tag="TRUGW13939_02627"
                     /db_xref="GeneID:55990134"
     mRNA            join(<525208..525419,525480..525652,525704..526509,
                     526569..>526754)
                     /locus_tag="TRUGW13939_02627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485818.1"
                     /db_xref="GeneID:55990134"
     CDS             join(<525208..525419,525480..525652,525704..526509,
                     526569..526754)
                     /locus_tag="TRUGW13939_02627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341711.1"
                     /db_xref="GeneID:55990134"
                     /translation="CIAPDSSGALKSLADFSDVDVGLRDHLVDLYLKLIHDKPHTLFH
                     PPTLKNQAREGSLPKTILYGVMALAARFSHDSRTRKRTKEFFNYAKEAFKMNLLDISL
                     ENIQASVLVGNLCGAEGEPEQESLFFGIAFRLAQIIHLPSGNLNEGAILREVKLRTWW
                     SLYMIDQWSSAGLGVPKQLTDDDCNPLPMVELKFWEPTPDVSPSDPTEKPGLWGYMIM
                     LAKIFGRIQNLHQRLANETLNEQEAEYITKGLSSNLECFMEVLPAEHHFSLTNLRLHA
                     AQGLGRAFVALHLGYHHYATLLYFPYLDHQLKEISNQKLYAGRCKYHAAAFSDLLKLS
                     HEEEECEAVYVIVAHMTVVSSAALLHTLLFGEYPELPDTRSRLSDNFATLLKLKEYWP
                     AVEMMIERLFTFQKVCMRSMEQIYTVDKWIVKFLLQHAFPMEESTAPSHSLSERGKFA
                     DDALSMLR"
     gene            complement(<526808..>528660)
                     /locus_tag="TRUGW13939_02628"
                     /db_xref="GeneID:55990135"
     mRNA            complement(join(<526808..527216,527269..527663,
                     527714..528008,528061..528202,528251..528331,
                     528383..528451,528501..>528660))
                     /locus_tag="TRUGW13939_02628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485819.1"
                     /db_xref="GeneID:55990135"
     CDS             complement(join(526808..527216,527269..527663,
                     527714..528008,528061..528202,528251..528331,
                     528383..528451,528501..528660))
                     /locus_tag="TRUGW13939_02628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341712.1"
                     /db_xref="GeneID:55990135"
                     /translation="MDEGKDIEGGKAHADHDEHPSRDFRQPSSASAVVWYKHPGLRRL
                     YAMMPILFLGSTINGYDGSLLNGLQTMPPWDDYFNNPTGARLGLFTAIQNIGGFCSLF
                     FASYAADLLGRKGGVLLGLLVLFVGTIIQVVPSVNSGMYIAGRFLVGLGSNVAQGSAP
                     LLITELAHPQHRGTLTTMYNTLWYLGSIIAAWTVFGTLKYNSDAAWRIPVGMQAAMPL
                     IQFLGIWLLPESPRWLCAKDRGDEAFQVLVKYHGNGDGTDHFCAWEFHEIQETIRLEK
                     ENSSNGWKLLVQTKGNRRRLLLIAMVAFFSQCSGNGLVSYYLHDILSSVGITSSYDQS
                     IINGGLQIWSFLVAIGFSSFLVDRWGRRTLFMVAGVGMLISFSVWTGCSAVYAQTGNS
                     AAGSAVIAMIFLFYGVAGFAWPGLTVSYCAEILPYNIRAKGLAVNLALTSASSVFNQY
                     VNPIGLDHLQWRYYFVYIAILVVECFSIWFLFVETKGPTLEEIAELFDGEEANVAHIQ
                     GSSKTEDR"
     gene            <529278..>531029
                     /locus_tag="TRUGW13939_02629"
                     /db_xref="GeneID:55990136"
     mRNA            join(<529278..529590,529645..>531029)
                     /locus_tag="TRUGW13939_02629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485820.1"
                     /db_xref="GeneID:55990136"
     CDS             join(529278..529590,529645..531029)
                     /locus_tag="TRUGW13939_02629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341713.1"
                     /db_xref="GeneID:55990136"
                     /translation="MSSSSSYPHFRKTETGKELIVKGNPFLILGGELQNSSLTSAEYM
                     DTVWQKLVDTHYNTVLGCVTWELIEPVEGQFDFQELDKVILGARNHGLHLVLLWFGSF
                     KNGISTYVPSWIKTDVKRFPRAKLRNAGGVLATGDVLSIFHDEAPKADAKAFATLMKH
                     LKDFDGEHSTVIMVQVENETGLLGDSRDGSAAAEKRFAEPVPQDLLAYLAKDWDNLHG
                     DFKENLTFFRAQQSAEGSSWEQVFGKDPHTDELFMAYHYSLYLNRVAEAGKKEYDIPL
                     YTNVWQNYVGDDGDNSFPVIVGGGGNPGDYPSGGGTSNVLDIWQQFAPSLDFIAPDVY
                     LNKYTSSCHKYRHRDQPLFIPEQRRDEYGARRIWAAYGSYQAIGVSPFGIDTLEPETS
                     AFTKHYGLLDSVSQIVLQAQRTSRTSSVGFFFDELPGSGPDNVKPLVINHWSHYEITI
                     EPCFVFGKRSACCGMVIHLGEAKFLLIGWGFQIRARSLLPSSTFTGILRFEEKFVLDK
                     ATGKLGTARTLNGDETRSGKFAMMPSEDPDYGGFPICVTIPARTMIAEVEFYDIADE"
     gene            <531846..>532704
                     /locus_tag="TRUGW13939_02630"
                     /db_xref="GeneID:55990137"
     mRNA            join(<531846..532265,532345..>532704)
                     /locus_tag="TRUGW13939_02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485821.1"
                     /db_xref="GeneID:55990137"
     CDS             join(531846..532265,532345..532704)
                     /locus_tag="TRUGW13939_02630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341714.1"
                     /db_xref="GeneID:55990137"
                     /translation="MSKPTIIFVPGAWIPKVSYASFLHALEKEGFTVYYAPYPSFDPV
                     DSLSASCHRDAEVIRNHVIKPLVEDQGKDVVVLMHSYASMPGSAAASGFSKTERVGNG
                     QAGGVLGLICIGAFLVPQGLSCAGLQGGKLPDWILLDQPEKGVNVADNPEKTLAADVD
                     PDLASQIAAQLKPHSNLAFTSDQPNPAWAEPSYEGRYAYIVTGDDQAVPQAAQYGMIA
                     ATGKKWIVKEIAGSSHMAPFLTKTDICIQFLNDILDSFSSA"
     gene            <535541..>537460
                     /locus_tag="TRUGW13939_02631"
                     /db_xref="GeneID:55990138"
     mRNA            join(<535541..535858,535920..536454,536514..>537460)
                     /locus_tag="TRUGW13939_02631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485822.1"
                     /db_xref="GeneID:55990138"
     CDS             join(535541..535858,535920..536454,536514..537460)
                     /locus_tag="TRUGW13939_02631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341715.1"
                     /db_xref="GeneID:55990138"
                     /translation="MYHDNPSSRSPGSQRHQQPLHRQPSRQFDAYGPMPSNPYEDPLA
                     RYDTGRLERLNPLHAGSNYGYELSGSQTWNPNGFSGAHTLGGIGSATGRMKPSGRGRT
                     GLPTTWLDHQPGASPLGGLAPGSLSGSQMQSASSQDGDDELIPTAIVIKNIPFAVKKE
                     QLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETATVIEMLNHFELQGRKLR
                     VEYKKMLPLQERERIEREKRERRGQLEEQHRPMPNSQLQTQSSMSSLASHIPATSPSP
                     VSQRGPKLADWSTDVDLNDSQTLQFYSQMLLFKEDMGREALIFPSNLTPVQRRTVHTL
                     AHNMGLGHASRGTGDQRQVHVYRPAPGSNVSPPLSSIPATVQATDASRRGLNRAATID
                     FGESRSEGPGPFNTLRGQSSTFLGVLESPGGFGNSQNLRAAKSFADLRSYTPSPVPSS
                     ASFPASLQTNGARLQHQYDAATSGTSNTPTLTPTPSGASLGMQRDDGLLVNSLGNLSL
                     GTGLGGPSSSPRRLRGMFSWEQDNQPTSAGTIGSNRSIGVGFDNQSQERIPLRQPRGP
                     APERGPGFRRQNGHQSRGSDELRSGSGVEIIVE"
     gene            complement(<539171..>539939)
                     /locus_tag="TRUGW13939_02632"
                     /db_xref="GeneID:55990139"
     mRNA            complement(join(<539171..539418,539470..539539,
                     539838..>539939))
                     /locus_tag="TRUGW13939_02632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485823.1"
                     /db_xref="GeneID:55990139"
     CDS             complement(join(539171..539418,539470..539539,
                     539838..539939))
                     /locus_tag="TRUGW13939_02632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341716.1"
                     /db_xref="GeneID:55990139"
                     /translation="MAGGKGKSIGGKGAPGKDAAGKAQKSHSAKAGLQFPCGRVKRFL
                     KNNTQNKMRVGAKAAVYVTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDE
                     ELDTLIRATIAYGGVLPRINRALLLKVEQKKKNKPEV"
     gene            <540999..>542012
                     /locus_tag="TRUGW13939_02633"
                     /db_xref="GeneID:55990140"
     mRNA            join(<540999..541255,541321..541706,541771..>542012)
                     /locus_tag="TRUGW13939_02633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485824.1"
                     /db_xref="GeneID:55990140"
     CDS             join(540999..541255,541321..541706,541771..542012)
                     /locus_tag="TRUGW13939_02633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341717.1"
                     /db_xref="GeneID:55990140"
                     /translation="MDPFNCTLQTCSIEYAFTQYQPNIAANSVYLVVFSIFLAGQVVL
                     AICCKSWSYSGLIICGMILEILGYIARILIHTNPFSFPYFLMNLTCIGLGPVLFSASI
                     YLCLSHIVILYGEKLSLIRPKTYVLFFLCCDVACLALQGAGGAVTSIAVHSEQLRQVG
                     TRILIAGLACQVGSLVAFITCSILFFVRVMNSPQLRRKDTEQLRQTRKWRYFLCGLAT
                     AVTTILTRSVFRVIELKNGFSGGLANDEVAFMILESLMVVIACIPLTTFHPGLLFGDL
                     WYKSSFFSRRNEPVLEEI"
     gene            complement(<542224..>544144)
                     /locus_tag="TRUGW13939_02634"
                     /db_xref="GeneID:55990141"
     mRNA            complement(join(<542224..542873,542933..543213,
                     543269..543478,543535..544049,544136..>544144))
                     /locus_tag="TRUGW13939_02634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485825.1"
                     /db_xref="GeneID:55990141"
     CDS             complement(join(542224..542873,542933..543213,
                     543269..543478,543535..544049,544136..544144))
                     /locus_tag="TRUGW13939_02634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341718.1"
                     /db_xref="GeneID:55990141"
                     /translation="MRQMLPTGQRMLLPAGCLTQSAGEEDVVSEQHVLAAFGPLTIRE
                     RRIGDLESKLDKLLTTISHPDNKLLDARLEPAEQASTIVSFEQASALVAHFQGSMALH
                     FPFVVFPPGTLLDEIRQSETLLLLAILAAAAYEAPARQEALVQKVQTEINKQLHSDAM
                     LTVKMLQALLIHVAWCHCHSGPERYSVYLHLAISIVDQRKIDQPKQLRTSRPRMAIGP
                     KQGFSPENPSEAAEQRALIGCYYFSSSLGVLLQKKCKFPYSSFIEECAESLAQIAEFP
                     TDHLLGHITRFQHLLEQADALSISNSPHLHASDDSGLRSSVQTLRERVRICKSRIPPD
                     LTENYLLALQKYTVELHICQISLFDRPSDSKLPPPEWSDFRIQALLDGLTVANQMFIY
                     MKCIDPQIQRASNHTEWLQIGYFIVISCKLAVASCELPVFHCTQHLREELNMPMMLDL
                     AMERMKALTVPADPNQQQGHNDPPFSHMAWLKPIQDWFNRHYAPNEPAQAGEMGYGSH
                     GLIASNNTLTFDMEEDSDYLTSMNWYDFQWSNFFPWSADDRLHEWA"
     gene            <545173..>546756
                     /locus_tag="TRUGW13939_02635"
                     /db_xref="GeneID:55990142"
     mRNA            <545173..>546756
                     /locus_tag="TRUGW13939_02635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485826.1"
                     /db_xref="GeneID:55990142"
     CDS             545173..546756
                     /locus_tag="TRUGW13939_02635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341719.1"
                     /db_xref="GeneID:55990142"
                     /translation="MGLLDLPNKLLYAISKEVKNLHYCDALSTLYAFTLTHSVLWRLF
                     EPVLYQFDMETYKGRALKWGVDNDAVETVEKSLGTRTWTPGHPMLSELLMKAAKWGFV
                     AIVKLLLDHNADINHYIVPPSSFHLYELRNPMLCAVEEGKTDVVELLLEYDKQAVKFR
                     DPVGIPGRIPAHINSPLFLAVRRIHVDIVKLLVHKGALAVGRRETSDPLVYAVLEGNL
                     ELLAALLGEVHPQDRAYKHRQDISFPAEHLANLLKKAISGDDVEVVGLLLKHGADFNK
                     MKLTSDEDYYDGFNYGHYYGEKKFERLSRHMLEYLLNNGLPLDTRKAWGTALWHNVVE
                     KRELLHLLLAHPQGPNTFRKKYPVLLERAIWRHNKDDTEFLLQQGKEWRTPADLFPGL
                     YSAIYSGYYGSAARLLSCGAPANVPPGFTFLSQEHSRYRRHIIRPLLWIATKGDNLRL
                     VKCLLEHGADPNKIAFPNHLKSAKNALQLAIDRKNTDIAELLCDYGAVAANTTSHDRS
                     YTMRVVQRGNLKLAERYLS"
     gene            <547521..>548217
                     /locus_tag="TRUGW13939_02636"
                     /db_xref="GeneID:55990143"
     mRNA            join(<547521..547537,547603..547763,547826..>548217)
                     /locus_tag="TRUGW13939_02636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485827.1"
                     /db_xref="GeneID:55990143"
     CDS             join(547521..547537,547603..547763,547826..548217)
                     /locus_tag="TRUGW13939_02636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341720.1"
                     /db_xref="GeneID:55990143"
                     /translation="MVSAQVTNLVIILGMMQVSKRVPFDNPDVLLGVRIAYAVSNLLI
                     LGVYLYVQSVINRKKDMTTLKYVEPATMGSGEEPRPVTTTVMEYDKQQLRQLMKSQMM
                     GVGMMGVMHLYFQYTNPLLIQSILPLKGAFESNLVKIHLFGKPATGDLQRPFKAAAGF
                     MNMGQGEIKSDKASIESAEKNYRGGVKEE"
     gene            <549463..>550969
                     /locus_tag="TRUGW13939_02637"
                     /db_xref="GeneID:55990144"
     mRNA            join(<549463..549474,549539..549574,549658..549671,
                     549731..549794,549858..550115,550164..550590,
                     550641..550753,550825..550882,550938..>550969)
                     /locus_tag="TRUGW13939_02637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485828.1"
                     /db_xref="GeneID:55990144"
     CDS             join(549463..549474,549539..549574,549658..549671,
                     549731..549794,549858..550115,550164..550590,
                     550641..550753,550825..550882,550938..550969)
                     /locus_tag="TRUGW13939_02637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341721.1"
                     /db_xref="GeneID:55990144"
                     /translation="MVTKIGINGFGRIGRIVLRHAFEHGEADVVAVNDPFIETHYAAY
                     MLKYDSSHGLFKGTIEHEGDELIINGKRVKFYQERDPASIPWGASGADYVIESTGVFT
                     TVDKASAHLKGGAKKVIISAPSADAPMFVMGVNNESYTSDLNVISNASCTTNGLAPLA
                     KIIHDEFGLIEGLMTTVHSYTATQKTVDGPSGKDWRGGRAAAQNIIPSSTGAAKAVGK
                     VIPSLNGKLTGLSLRVPTSNVSVVDLTCRIEKPASYEEIKAAIKKHSEGELKGIMGYT
                     EDEVVSTDILGNNASSVFDAKAGMSLNSNFVKLISWYDNEWGYSRRVLDLVLYTAKVD
                     GNA"
     gene            <551915..>555103
                     /locus_tag="TRUGW13939_02638"
                     /db_xref="GeneID:55990145"
     mRNA            join(<551915..552557,552617..552905,552968..552981,
                     553033..553171,553221..553333,553388..553515,
                     553631..553844,553892..554003,554058..554105,
                     554152..554215,554264..554356,554412..554497,
                     554552..554625,554689..554795,554870..>555103)
                     /locus_tag="TRUGW13939_02638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485829.1"
                     /db_xref="GeneID:55990145"
     CDS             join(551915..552557,552617..552905,552968..552981,
                     553033..553171,553221..553333,553388..553515,
                     553631..553844,553892..554003,554058..554105,
                     554152..554215,554264..554356,554412..554497,
                     554552..554625,554689..554795,554870..555103)
                     /locus_tag="TRUGW13939_02638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341722.1"
                     /db_xref="GeneID:55990145"
                     /translation="MEGDEDTVMGESRSLTSLAPSSLANHAATSVDGPSTTALQPSSV
                     LGLQPPAAPVLSPPGLSSDYNSAPLLTSSYTPDLHGLTRSIEDEALNAVKSSEESDSL
                     MEENSDWSADDPATSSGLTTANLATGLCYDIRMRYHCEVRPTADVHPEDPRRIYYIYK
                     EICLAGLVEDPELPNSIKPLAPRPLQRIDVRDATEEEVQLVHTDEHFKFVENTRHMPD
                     ETLILLEESRDSIYFNQLTFASALLSAGGAIETCLAVATRKVKNAIAVIRPPGHHAER
                     DKTMGFCLFNNVSIAAKVCQRQLGESCRKILIVDWDVHHGNGIQKAFYDDPNVLYVSM
                     HVYADGNFYPGGEEGNWDHVGEGAGIGKNLNIPWKSQGMGDGDYMFAFQQVIMPIAIE
                     FDPDLVIVAAGFDAAAGDELGGCFVTPACYAHMTHMLMTLANGKVAVCLEGGYNFRSI
                     SKSALAVTKTLMGEPPARLTATTASISAVQVAQTVMAAQSKYWRCMYPKAPPAQEGLF
                     TDRFHDVIRQYQAKQLYDNYKLTSLWIYRATISKSFENQVLASANYDRAVPLIVIFHD
                     PPEMMGIHHPITNKLEPHNCWMADAVKEYIAWATQKNYAVIDVNIPKHLSENGDAGKF
                     EEEDADRPTQTEELAGYLWDNYIDESTHIFFMGVGDAFFGVANLLINRDSIYQRVNSV
                     VSFVSENPVRAVASPTQTWLSRWYKDNSLVFVSYTHGLWHNEGRRKPSKRYGRLLESP
                     KVGLNEMLLHHKMEVAEWIDTRISMHISSSSEEPEDNDDAGMKKE"
     gene            <555718..>559253
                     /locus_tag="TRUGW13939_02639"
                     /db_xref="GeneID:55990146"
     mRNA            join(<555718..556236,556311..>559253)
                     /locus_tag="TRUGW13939_02639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485830.1"
                     /db_xref="GeneID:55990146"
     CDS             join(555718..556236,556311..559253)
                     /locus_tag="TRUGW13939_02639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341723.1"
                     /db_xref="GeneID:55990146"
                     /translation="MSPRSSTIRLSRAITPSLNRPTTRPRLFVLLQNEKKKKKKSTIT
                     VSTTLPRQFAACIITPPSFRRLVDPPRCFSTSPLLSSSSSFFDTAPPPPPSSTYSSPP
                     PTTMSGASHLADRLEKPELDDRSYRVIRLPNRLEALLVHDPDTDKASASANVNVGNFS
                     DDDSMPGMAHAVEHLLFMGTEKYPKENAYNQYLAAHSGSSNAYTGAIETNYFFEVAAT
                     GESSDGNGEANNGNGVTNGTSNGTSNGTSNDVSSSTSSSSSPLYGALDRFAQFFIAPL
                     FLESTLDRELQAVDSENKKNLQSDLWRLMQLNKSLSNPKHPYHHFSTGNLQTLRDDPQ
                     ARGVEIRKEFINFHKKHYSANRMKLVVLGRESLDQLESWVVELFSGVHNKDLPQNRWD
                     EVQPFSDDQLCTQVFAKPVMDTRSLDIYFPFLDEEDHFETHPSRYISHLIGHEGPGSI
                     LAYIKQKGWANGLSAGAMPVCPGSAFFTISVRLTEDGLTHHREVVKTIFQYIAMIKEK
                     TPEQWIFDEMKNLAEVDFRFKQKSPASRFTSRLSSVMQKPLPREWLLSGNSLFRKFDS
                     ELITKALSYLRADNFRLMIVSQELPGGWGSKEKWYGTEYKVEKIPEDFLGEIRGALAS
                     SPSDRIQDLHMPHKNEFIPTRLSVEKKDVAQWAKAPKLIRLDDQVRVWFKKDDHFWVP
                     KATVYVTLRNSLVWATPANSVKTKIYCELVRDALVEYSYDAELAGLDYNLSASIFGLD
                     VCVSGYNDKMSVLLEKVTSTMRELEVKPDRFKIVKERLARAYKNAEYQAPYSQVGEMT
                     RYLTSEKTWINEQYAAELEHIEADDVAAFFPLLLQQNHIEVLAHGNLYKEDALKMTNL
                     VEKTVRSRPLPQSQWHVRRNMVFPPGSNYIYERQLKDPQNVNNCIEYYLYVGSVTDDK
                     LRAKLLLFSQMTEEPAFDQLRSKEQLGYVVWSGARYSPTTIGYRVIIQSERTAQYLEG
                     RIDAFLGEFAQMLQDMTEEEFEGHKRSIINKRLEKLKNLGSETGRFWTHIGSEYFNFL
                     QHEIDAASVRGVTKADLTAFFSQYIDPKSETRAKLSIHLNSPAADIDKQLPVDTSQTA
                     EGADSLHGQKMTNGVNGEKQKNHQQTAREPIYVTNVPHFKASLPVSAGPYPVVDLYEF
                     EDFDSKL"
     gene            <562069..>565156
                     /locus_tag="TRUGW13939_02640"
                     /db_xref="GeneID:55990147"
     mRNA            join(<562069..562147,562215..562383,562438..562771,
                     562834..563137,563531..563594,563943..564377,
                     564442..564884,564942..>565156)
                     /locus_tag="TRUGW13939_02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485831.1"
                     /db_xref="GeneID:55990147"
     CDS             join(562069..562147,562215..562383,562438..562771,
                     562834..563137,563531..563594,563943..564377,
                     564442..564884,564942..565156)
                     /locus_tag="TRUGW13939_02640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341724.1"
                     /db_xref="GeneID:55990147"
                     /translation="MFQSAHSLAVAALGLSASALAIPVRRDVSADVLANLNLFEQYSA
                     TAYCASDYNAAAGATISCEADNCPLVQEAGATALYSFYDVGTGDNTGLIAKDDTNKLI
                     VLTFRGSHNFENWIANLKFAKIDASATCDGCETHDGFTKAWQSVSANITAQLSDAVSA
                     NPDYQIVATGHSLGAALATLAAVDLRLAGNKVDLYTYGSPRVGNTAFATFLSSQSGGT
                     NYRVTHTDDPVPKLPPLDFGYSQPTPEYWDTAATNASVKGTDITVVQGIDSDQGNDGT
                     PTGLDIAAHLWYFNGIAKCAMELAGPGSTGRASKRVVARASAVAMLLHGTVKPMRPVS
                     GRRRLRPLILALMVLCGIYWISTTPNHRLSTSISSSRSSSRSPASLERFSSPNAKAAG
                     AGLQVPVSAPTPASTASKKDLVVASMLGDNTTWLYDNLPDWRKNVFVVDDKTADLTVV
                     KNKGRESMVYLTYIIDNYDHLPDHMLFIHSSRYQWHNDDPYYDGVPMINRFQIPYLEE
                     VGYVNLRCAWVLGCPEEIHPMTDSDIDVVHAGAYFMNGFKALFPGTKVPDAVGVSCCA
                     QFGVARWKILERPKSDYQRYKKWLLETDLDDAMSGRIMEYSWHMIFGMEPIHCPDAAE
                     CYCKVWGLCDLNCSPWDCEDRYILPPFSNLPEGWPYIGWNGEPQDPTARDVPEVIF"
     gene            <566099..>569284
                     /locus_tag="TRUGW13939_02641"
                     /db_xref="GeneID:55990148"
     mRNA            join(<566099..567113,567244..568075,568132..>569284)
                     /locus_tag="TRUGW13939_02641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485832.1"
                     /db_xref="GeneID:55990148"
     CDS             join(566099..567113,567244..568075,568132..569284)
                     /locus_tag="TRUGW13939_02641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341725.1"
                     /db_xref="GeneID:55990148"
                     /translation="MASTALPHGEYTVGWVCALAKEQTAAMAMLDEIHADLPKPQHDH
                     NSYTLGRIGQHNVVIACLPMGMIGSSNSATVAAHMLSTFPSIKFGLMVGIGGGVPPKV
                     RLGDVVVSKPVGAYPGVVQWDFGKTRQENSFERTGSLNSPPATLLTALTKLQSKHDMQ
                     GSDIPSHLENLKQKWPKLAPQYLRSGSLKDVVFRSSYNHVEKKITENEDDWENDEEEE
                     EAQESCAYCDPAEMVKRRPPTRDMRIHYGLIASGNQVIKDAIRRNGINKKFGGNVLCF
                     EMEAAGLINDFPCLVIRGICDYADSHKNKDWQEHAAAVAAAFAKEFLSMVPSHDVEVM
                     PTIKSVYESVQEIARNISTLTQRQYNKEQKTILDWLSKTDYSSQHNDFTRNRQPGTAE
                     ELLQSDLFQKWMAQNNRILFCPGVPGAGKTMTTSSVVNYLHERFPESNTIGIAYIYCD
                     FRRQEKQSLTHLLLNLLKQFAQGPSILPQCVKRLYEKHYPRKTQPSIDEISDTLASII
                     AEFSKTFVIIDAVDECKTSDAVRSKFLHEVFNLQTKTRANLFVTSRHIPEIENEFKRK
                     RAVSFEIRASEADIRRYLDGNVSRLPLVVQENPELEEEVKVSIINAADGMFLLATLHL
                     DSLEDKVNLRQVKCYLEKLPKGTDAYRQAYEEAMERIQSQKPGFREVAFKAILWISCA
                     RRPLTPQELQHALAVVNNASALDEANITKAELIASVCAGLVIIDEESNIIRLVHYTTQ
                     EYFQTTRDTWFLNAETDIANACITYLSFSTFQSGICPTHAAFEERLRHHPLYGYAAAN
                     WGHHSREAPVELQQVMKVLEDDSQVFASAQFIMPSKDDNIYNLHLSHPLTGVHIAAYF
                     GLAKATAALCENGHDPDSESLTFRQTPLFWAAQSGHEAVVKVLLDEYGIKMELNYDDG
                     EVPVWAAAMAFEMSETLLFDLIKRLPLSPEFVPQLKRKYDEQELVSYAVMEILCIRYE
                     PYMDSRDAYREILLAWTAERHKLLEGG"
     gene            <570267..>571097
                     /locus_tag="TRUGW13939_02642"
                     /db_xref="GeneID:55990149"
     mRNA            <570267..>571097
                     /locus_tag="TRUGW13939_02642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485833.1"
                     /db_xref="GeneID:55990149"
     CDS             570267..571097
                     /locus_tag="TRUGW13939_02642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341726.1"
                     /db_xref="GeneID:55990149"
                     /translation="MLIIGLTGSIATGKSTVSSLLSSPPHNLPIIDADILARKVVEPG
                     TAGYKAIVNYFGPSTPELLLPEDPQTGQRALNRPALGRRVFGDSEERKRDRAILNKVV
                     HPAVRWEVYKSLLYYYLKGHWAVVLDVPLLFESGMDVICGAVVVVAVNDPAVQMARLR
                     ARDAHLTAEDAENRVRSQGDVREKVKKALFRNRVAEENTDKGSRGVIIWNDGDKADLE
                     REVNKAISAIQTHSPKWWSWLLLAAPPVSVAAAVWNMAVNFGLQKSWDQKAKQDRAKL
                     "
     gene            <572092..>575397
                     /locus_tag="TRUGW13939_02643"
                     /db_xref="GeneID:55990150"
     mRNA            <572092..>575397
                     /locus_tag="TRUGW13939_02643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485834.1"
                     /db_xref="GeneID:55990150"
     CDS             572092..575397
                     /locus_tag="TRUGW13939_02643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341727.1"
                     /db_xref="GeneID:55990150"
                     /translation="MSPAPVISESSPASMAKEAKGGLKMNSGTANSLTFKHYTYPASS
                     QRPPVPAPKRRRIAEPLSVDSSVSQNTANTLHENNGLCQLPHQIHFQTNSTLDGSFSS
                     QSATTDRFSRDGFDSEASNYNTPNTSASIISAISQKQSMSPSILLTTGLDTANTLAAA
                     RNPPTTTLDTKPEYEREAPDYEQFKPRSSIPSGLPGPVYAQQCITAAYSSRLNPFALH
                     EGEQEALGDHLCHLHVTTYLNIRNGILRLWTRNPMISVTREEALGCAKDARWMGLADF
                     AYEWLVRNGYINFGCVEVPEADLLPKKGRRKDDGRVIVIVGAGVAGLACARQLEGLYQ
                     QYRDRIGSLKVIVLEGRRRIGGRIYSHPLKSHKEILLPKGLRPTAEMGAHIIVGFDRG
                     NPLDPVIRSQLALRYHLLRDISTIYDIDGSPVDEVQDAMDERLYNDVLDRSGNYRHKT
                     LINTTAEGDRDMMYHGRDITVSDGVTVRQFEEARAAGTHHLLLPAARLRRGIGHNASR
                     ILPPPSSQMADAPDEELPAAMECQNMGWKLRDGVSARDDLDLDKIAKASSSQTLGAVM
                     DEGVGQYQRMLPLTPKDMRLMNWHYANLEYANATNLNGLSLSGWDQDMGNEFEGEHGQ
                     IIGGYQQLPRGLWALPTKLDVRTNETVTKITYDTTGIGKTTVHTENGPIAADHVVYTG
                     SLGTLKHRSVDFSPPLPDWKTGAIDRLGFGVLNKVILVFDHVFWDSNRDMFGLLREAE
                     VPGSMSQASYARNRGRFYLFWNCVKTAGVPLLIALMAGDAAHQAESMADAEIVAEVTS
                     ELRNIFKSSPVPDPLETIVTRWKSDKFTRGTYSFVAADALPGDYDLMAKGVGNLHFAG
                     EATCGTHPATVHGAFLSGLRAATDIMDNILGPIAVPKPLVPAKEGEVIGPYNGGFINA
                     NLAAEKVTTPKKEFTPKSKPKPKPKPKPNTTATTTLPTETPTTLSKEQQLYNDALQTH
                     LHNTIGSPPAKPGKIALNPFLTFQKDYWIRAKQKCENNKRAATNDPNAKAARDEVRAV
                     LGQMWREADEQTQRPYHEQMAVNRQTNNEVLETWKGQMAEYEKRRAEETGAWERQNPY
                     DKWVGENLNVGHV"
     gene            complement(<575544..>577397)
                     /locus_tag="TRUGW13939_02644"
                     /db_xref="GeneID:55990151"
     mRNA            complement(join(<575544..576787,576842..577306,
                     577361..>577397))
                     /locus_tag="TRUGW13939_02644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485835.1"
                     /db_xref="GeneID:55990151"
     CDS             complement(join(575544..576787,576842..577306,
                     577361..577397))
                     /locus_tag="TRUGW13939_02644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341728.1"
                     /db_xref="GeneID:55990151"
                     /translation="MRSNGGNMSRLFDVVIYLTIPAVIILHLLAAPYTKVEESFHLQA
                     THDILKYGIPSPRLGLEEVARKIASDYDHFSFPGAVPRTFVGALALAAASQPVLWLDS
                     HVDRQCLARAVLGLFNAFALLSYARGLHRAFGRATALWFLLFQASQFHVAYYASRTLS
                     NMFAFGITTIALRLVLPEPGTVAKAHSRHRVSLVLITVAGIIFRSELAVFLAMNTFFL
                     LATNRVRIISDIIPAGIVGLLVGLSTTVLIDSYFWQQFPLWPEFAAFKFNVLAGQSSE
                     WGTSPWYFYFVDALPRLLMNPLIWLVGIPASLWASATRRASVSLLLPSLAFMGLYSVL
                     PHKEWRFIIYVVPALTASAAQGAAYIWTRRAKSIVYRILALALAVSTLASFLVSTLVY
                     LPASAANYPGAYALQSVHRHADGTQPRIVLHMGNLACQTGVTRFLQLDPDDSVVSTWI
                     YDKTENETLKATPQFWSTIDYALVEDVSEVIPQSSSETETEKNTITKGKWQTIDTINS
                     FTGFRILRAGDIAQGQLEANIIRAVAGDAGVALFEKVRDGVVRRFVTRGIWVEFRMEP
                     RIRVVRNLKGDDTLL"
     gene            <577576..>578011
                     /locus_tag="TRUGW13939_02645"
                     /db_xref="GeneID:55990152"
     mRNA            join(<577576..577609,577664..577723,577793..577903,
                     577956..>578011)
                     /locus_tag="TRUGW13939_02645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485836.1"
                     /db_xref="GeneID:55990152"
     CDS             join(577576..577609,577664..577723,577793..577903,
                     577956..578011)
                     /locus_tag="TRUGW13939_02645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341729.1"
                     /db_xref="GeneID:55990152"
                     /translation="MLLFGFGRLIYVTVLLINAVCVLSEDRFLARIGWGRSQPEPGFG
                     SSYDNSSVKAKTVNLITSVRTVMRIPLILINAVIIIYELILG"
     gene            complement(<578478..>580929)
                     /locus_tag="TRUGW13939_02646"
                     /db_xref="GeneID:55990153"
     mRNA            complement(join(<578478..580560,580614..580627,
                     580679..580819,580894..>580929))
                     /locus_tag="TRUGW13939_02646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485837.1"
                     /db_xref="GeneID:55990153"
     CDS             complement(join(578478..580560,580614..580627,
                     580679..580819,580894..580929))
                     /locus_tag="TRUGW13939_02646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341730.1"
                     /db_xref="GeneID:55990153"
                     /translation="MGSFFKNLRGNAGPYSPTSGPSPPKKDPNAPPMTPLEKMLLDSG
                     PVRGDGSDKFFGMENYGNTCYCNSILQCLYYSVPFREAVVNYPKRTPIETLETALAQN
                     LKFQSPEAFAEAEAAAAKAKTAAGQSSSRSAGVTPAQPTKPEDKDSPEYKKKVAIQTL
                     PLLDTKDNSVSYGMSESLFTSLKDIFESVVASQSKMGVVRPQHFLEVLRRENEMFRTA
                     MHQDAHEFLNLLLNEVVTNVEAESSKQITDAPVDSTDSEQTVAVTDSSAPSSSTRVEG
                     STGSKTPNTSRWVHELFEGTLTSETQCLTCEKVSQRDEVFLDLSVDLEQHSSVTSCLR
                     KFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPKILALHLKRFKYTEDLQRLQKLF
                     HRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHYVAIIKTEDRGWLLFD
                     DEMVEPVDKNYVRNFFGDRPGLACAYVLFYQETTFEAVQREQEQEGLHPVNGTADVKE
                     GNGVPLSSPLNHIQTYQGPPDDDAHRFSPLKAVPTAPQMSTHPEHAFSTSPPVPPIPS
                     DPPMSLSPKKSDVHSRKERAREEKERKAAEKDKERAEKQRRKEQEAKRKEDTRREEAD
                     MKAAREASKASKAEEDRKIENGENGHKTLTGSLNRFRRSSKSLSHRFVSKEGKRAASS
                     EFPRSELLSENGSPPDPRLHEHVIEEDAPTSNPVIPETLPPSTPDASSRGKQDKDKAN
                     HKWKGFGLRKKSMSLMG"
     gene            <583174..>584968
                     /locus_tag="TRUGW13939_02647"
                     /db_xref="GeneID:55990154"
     mRNA            join(<583174..584658,584717..>584968)
                     /locus_tag="TRUGW13939_02647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485838.1"
                     /db_xref="GeneID:55990154"
     CDS             join(583174..584658,584717..584968)
                     /locus_tag="TRUGW13939_02647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341731.1"
                     /db_xref="GeneID:55990154"
                     /translation="MNGAAPAVGIARAIIAARWRTAAAAAAVVGSSPNSVWRGNNILL
                     NRPRRLSLFRPFHHVASSDSSTDAMGKDKVQFKLKTPKGTRDWVGSDTLIRDRIFTTI
                     TDVFRRHGGTALDTPVFELRDILAGKYGEDSKLIYDLQDQGGEICSLRYDLTVPFARW
                     LAMNTDVRSIKRYHIAKVYRRDQPAIAKGRMREFYQCDFDIAGANFDPMVADAEVLKI
                     INEVFSELGWNGLYTIKINHRKVLDGLFQVCGVPDDKIRPISSAVDKLDKMPWAEVRK
                     EMVQEKGLDPEVADKIETYVGKKGRKDLVEELLKDEALMANASAKQGVEEMGLLMDYL
                     EAFGALESISFDLSLARGLDYYTGVIYEVVTEGSAPAATPTAAPEAQTLQKSGKKTKA
                     VTGDDDDRSNDPTVGVGSIAAGGRYDNLVGMFQPKAQIPCVGISFGVDRIFSITKARM
                     EREENGTMRSSEVDVFVMAFGGKGFTGMLKERMDICKTLWEAGIKAEFAYKVKPKLPQ
                     QFKAAEVAGIPFAVILGEEELAAGQVKIKEMGLPEGHPEKEGVLVEISKLVDEINTRI
                     ARSATPVEVPIR"
     gene            complement(<585164..>586794)
                     /locus_tag="TRUGW13939_02648"
                     /db_xref="GeneID:55990155"
     mRNA            complement(join(<585164..586551,586626..>586794))
                     /locus_tag="TRUGW13939_02648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485839.1"
                     /db_xref="GeneID:55990155"
     CDS             complement(join(585164..586551,586626..586794))
                     /locus_tag="TRUGW13939_02648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341732.1"
                     /db_xref="GeneID:55990155"
                     /translation="MRQVNSLLRPYICPSCRRGSQYRGRRTLSSLAETPDVYDVVCVG
                     GGPAGLALAAALRASPITSKLRVALIESQDLSKSRSWSLKPDEYSNRCSSLTPTSVAF
                     LQKIGAWKHVDRSRVQQYHEMKVWDGQTGSKISFDWSVDTSPFEDVRSVATMTENANL
                     VRGLLSRIGEVDDDGRLSIFSNTTVSSIENGSKIVEEEGDGPDLSAWPVLSLSSSVSP
                     TPKKPIAARLLVGADGINSPVRSFADITTNGWDYGRHGVVATLSLAESAASSLLPDSR
                     TAYQRFLPSLGGPIAILPLPNNKASLVWSTKMENAVYLKSLPQEAFIAMVNAAFRLSM
                     VDLGYMLGLDPAAKSDKPTSSGNLLSQHEDELNWRLEHIPTQPPSNLPPLVTAVQDKT
                     VASFPLRFRHASSYISPRVALVGDAAHVIHPLAGQGLNLGIGDVAALTDTIEYAVMHG
                     MDIGDHLSLEKYMADRYLTNAKVGGMCDVLHKLYNVPGNGPVTWARSLGLDVIDKLPW
                     VKGFIMKQAE"
     gene            <590641..>592525
                     /locus_tag="TRUGW13939_02649"
                     /db_xref="GeneID:55990156"
     mRNA            join(<590641..590740,590803..590866,590924..591303,
                     591352..591924,591981..592172,592224..>592525)
                     /locus_tag="TRUGW13939_02649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485840.1"
                     /db_xref="GeneID:55990156"
     CDS             join(590641..590740,590803..590866,590924..591303,
                     591352..591924,591981..592172,592224..592525)
                     /locus_tag="TRUGW13939_02649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341733.1"
                     /db_xref="GeneID:55990156"
                     /translation="MALLLLQTAAVALTGFLLYALIFVGRRGRNLPDGPPTLPIIGNL
                     HQLPKQKMYFQFTEWAKKYGGMFTLKLGPSNVVVLTDRRIIKQVLDKRSAISSNRPVN
                     MVAQQLITEGDHMLWMDNTPAWRLLRKLIHQDLTESLCNRQHVKLQQAESVQLLHDML
                     IDTDNWANHLKRFSNSIIMSIVYGIRSPSIDAPHTKKLRDAAELWARINEFGATPPVD
                     IFPFLKWVPQRFLGNWVARATEVHDALHDLYGGLLKSVRRRRLAIGSVDSIIDRVLDQ
                     QEKNGLTDHQVTFLAGVTIKGGSDTTASVLSSFIQAMTVNPEVQKRAQDEIDAVVDED
                     HIPSWDDYEKLPYTATMVKESHRWRPVAPLSVPHALSEDEIVDGKLLPKGTVIFVNVW
                     GLHHDESKFTNPDSFDPDRYKNHPFLASEYANTPDYENRDHYGYGNGRRLCPGIHLAD
                     RNLFHAISKMLWAFKIEKGSDPKTGQAVDSDTSMATGYREGLTACPYEFPIKLTVRSQ
                     KRRETIMREFANAQENIFPQFDKSDFFK"
     gene            complement(<593058..>595171)
                     /locus_tag="TRUGW13939_02650"
                     /db_xref="GeneID:55990157"
     mRNA            complement(join(<593058..593712,593781..593853,
                     593917..594643,594788..594852,594902..594982,
                     595045..>595171))
                     /locus_tag="TRUGW13939_02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485841.1"
                     /db_xref="GeneID:55990157"
     CDS             complement(join(593058..593712,593781..593853,
                     593917..594643,594788..594852,594902..594982,
                     595045..595171))
                     /locus_tag="TRUGW13939_02650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341734.1"
                     /db_xref="GeneID:55990157"
                     /translation="MAETSHVNGFHAGDPVAEVSTDYLIVGTGPAGASLACFLAQHGL
                     TGLIVSQDPGNADTPRAHITNMAALDCLRDIGVDKDCYKIGTQGNTMGDYELASPSEP
                     LDLPQTLLEPLLIRHATLNGFKCRWDTKFISFKQDPSDEGVTTTLYDKVTGQTYRVRS
                     KHLFACDGARSPIMQQLDVPMIKRPGQGFAINILIEADMTHLMKSRMGNLHWVLTPDK
                     EHPDYAWIGCLRMVKPWHEWLCIIFPSPEAERKARHESEYIKRVREFIGDDSVEVKIK
                     GISTWMINETAAGEYSRGNVYGLGDAVHRHPPNHGLGSNTCIQDAHNLAWKVAYVDKG
                     LAGKELLGTYNAERQPVGLDVVTQANASLRNHKRIWEILGNLEPTVAARIAKFDLLKE
                     DSDRGQKSRQELAEALRLINREEHGLGIEMNQRYTSSAVLKSDQGAMPTFTTDSLEHY
                     HPTTYPGARLPHVWLTRTIPDQKHISTIDLAGKGQFALFTGIGGQGWRDAAQQASAEF
                     GVPIAVYSIGFRQEWEDQYLDWAKVRDVAESGCVLVRPDYFVAWRSQRWEGDSTERLR
                     AVVRTVLSR"
     gene            complement(<595623..>597392)
                     /locus_tag="TRUGW13939_02651"
                     /db_xref="GeneID:55990158"
     mRNA            complement(join(<595623..596412,596466..596551,
                     596620..596706,596764..597099,597156..>597392))
                     /locus_tag="TRUGW13939_02651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485842.1"
                     /db_xref="GeneID:55990158"
     CDS             complement(join(595623..596412,596466..596551,
                     596620..596706,596764..597099,597156..597392))
                     /locus_tag="TRUGW13939_02651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341735.1"
                     /db_xref="GeneID:55990158"
                     /translation="MSRTDNATRNSSYRQWPGERHPTQWDVHDANQSPAVSFLERFRV
                     ALLHSEYAEEEGESVLDAASFIGESETLNPTLTPPTDSAASYTYPMALLSDNLAMPSE
                     DELLRLQGEFYTSFKQHIFINSVDVTGTSGIIPPYLQLALACISSVTSPLAGTNEHLS
                     GSDFFITGVHLWGVMLEVDNREARLLEAVVAATLLITYGILSTDHKECRQATGLLANV
                     TTITRRLHLTDYYPPLLVPGEIPERESSMKSSLISYMLLIDVMHSVHCNTVINHSVSE
                     LWIKMPSSMHSFRTIYNLLAHDDVLPPDVKSSEDGLLLITALLSDIIYIQRCHVSLPH
                     LSTPKDERLRNPYAPLSAKSEFLRQSAGMMAALSQWENTFHDKVDNDILALYYFTKLH
                     LICPALWELPRMAGYGSICSHPVESREMEISDKAMDLAWLVLDHCDKNSKTARPNLSI
                     WLPIVLFISALVVWQRLRSRAATDLKYGTLKVLSMFEHEIARLPWPCCREMSKTLEGL
                     MQN"
     gene            <597565..>600097
                     /locus_tag="TRUGW13939_02652"
                     /db_xref="GeneID:55990159"
     mRNA            join(<597565..597612,597688..597748,597804..598348,
                     598406..598825,598875..598943,598997..599083,
                     599138..599208,599260..>600097)
                     /locus_tag="TRUGW13939_02652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485843.1"
                     /db_xref="GeneID:55990159"
     CDS             join(597565..597612,597688..597748,597804..598348,
                     598406..598825,598875..598943,598997..599083,
                     599138..599208,599260..600097)
                     /locus_tag="TRUGW13939_02652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341736.1"
                     /db_xref="GeneID:55990159"
                     /translation="MDDLIDVYPSPRRDKQCDICSRSFARSEHLARHRRTHTKEKPFT
                     CPYCHKSFQRSDVKATHVRKCHGNSPGYGDQEEDRRRKRVRIACHSCRKRKMRCDGNE
                     PCAPCNSTQTACHYPASPTSTRHAHTQLENELHLSTSNDDPRLLNTESEPFLDTEADS
                     LQTAHQEAFNLPFQGGQPMPFDTGTMVDARGLPLSNDDIIYSIPAATGGLDFWQMPPT
                     FWFDGSDLSWSDDIFDSTSPISNHVFSSSMQHLTAIMQEYFDRKSRAPSPSLNKASKM
                     WYSAPPNMDDYNKDILRVFLNIFRRYIPETFPLFIDFTVGGQNRAAYTLAIAATGGLF
                     CSVPGSAEVAKAMYNDARRLLLASFHIRNPVDEISASPQDKLLTVKTFILLKIYGLCS
                     GDKRSYEFVEAFHGNFVHAVQEYSHSCESSGLNNLNDEINTRLLETLQILDCYRVIIM
                     QRPPSLSWHHVDLFARPGTHMSHFYEISRDLTDGGHKIETSCPQEFHLPSLAGLCSYL
                     WPATYSRQNRDFGDGPSTKSTYFWEPHFAELACDNWLRTIGQTSSYASLAVYHMMNIM
                     LHANLTMLQHFAHSAPGSAARDPKNSLVAREIKTWKEGRHYEIANWHAEGIISSVEKA
                     ISTSSGKAEQQRSRSTNTEPRRLPYEAPHVPYAIYYATLVIWCGAITDEPADMSSPNA
                     QVYIARGERILSLHKVHIAQLLARVLYEIK"
     gene            <600534..>605071
                     /locus_tag="TRUGW13939_02653"
                     /db_xref="GeneID:55990160"
     mRNA            join(<600534..600736,600787..601195,601248..602357,
                     602724..602865,603417..603760,603821..604353,
                     604416..604508,604570..>605071)
                     /locus_tag="TRUGW13939_02653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485844.1"
                     /db_xref="GeneID:55990160"
     CDS             join(600534..600736,600787..601195,601248..602357,
                     602724..602865,603417..603760,603821..604353,
                     604416..604508,604570..605071)
                     /locus_tag="TRUGW13939_02653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341737.1"
                     /db_xref="GeneID:55990160"
                     /translation="MPNKLRDDLHKVDTTSFDYIYEENATIPLKEGRGVVRCNVFRPK
                     APAGSQFPVLVTYGPYGKDVHYSVFHTASFSEVPAEHHSPHSAWETPDPGFWTRHEYA
                     LVRADEVGLGQSPGVLNTMSRDTSLAFKDVIEWAASQSWSSGKVGLLGISYYAGSQWR
                     VAARRPRGLACMIPWEGMSDYYRDRCRHGGILSNTFIDFWWNRQVIVNQYGRPGRAAR
                     NYGVDTIEGNLEESELRANCHDQNVDNVVNRFLDDDYYASKDYNMSDIEVPMLSVGNW
                     GGILLHLRGNVEGFMNTGSQHRYLRLITGRHDLPFYTKECVDLQLSFLDAFLKGKDPQ
                     GWSRGEQPTVGYKVRVGDVGYNDTAAEAAYPSRSAEEWPIPETKYTKYYLTPTQGLSE
                     TRVAQNDESKISYKALGDLKNQQLIQFHSEPFTEHVEFTGHVVAHLNVSVTAQENQAS
                     QPSDIDLFLTVRHLDATGKEIYYTGTVGDPVPISKGWLRVSLRAVNEKDPRHQPWHPH
                     REYLSTDHSPLVPGEIYPVDVEIWPTNVVMSPGDKLVFEVSSGDTQGAGLFEHNSKED
                     RDEKSFGGPGFFILRYSILLPPSSTPQKTSRQQSPTQPNPVQRIGQISDVSGLSHEAR
                     PQSIRLRQNLFHSLHSALKSSEQSIRDTIAEDTNHGDWDINLEYTLAIAELRAHYDSL
                     DLEEDRKSNKLVDNPQATTGVGIVYIIPSKQNLFYSVISALTAALATGNCVILELPTT
                     LTRVSGILRTILPQALDADVFAIVSTRVSKESLSKCRILDQTRDVSDAGDVADKVDHK
                     STQVPFTKVVAVVDRSANISDAASIIGASRAAFNGQSDYSPGLVLVNEFVADDFLFHL
                     SQAIISPIHGGKAISKSSRQSKGVRDGLNQLQSELERNDNLKVILSGENGSIVEIRDR
                     TQITAGCQLDGRVITIYRITSLDDAIDLCNGAQTPLEASYVFAATTEGNYLSRFIDAR
                     ISFVNHIPCELMGTSIASTYKTNPLTYKLKVGPFAAEHPTIAPGVFPRYNPALFRSPR
                     PRLGHASQLTLLCQRSKASRSTKELDSWSRSILQEALPPTKQGSGADVGFFDQAFILV
                     GITVISVIAGGTFTMYRYAKRWH"
     gene            complement(<602624..>603042)
                     /locus_tag="TRUGW13939_02654"
                     /db_xref="GeneID:55990161"
     mRNA            complement(join(<602624..602704,602761..>603042))
                     /locus_tag="TRUGW13939_02654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485845.1"
                     /db_xref="GeneID:55990161"
     CDS             complement(join(602624..602704,602761..603042))
                     /locus_tag="TRUGW13939_02654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341738.1"
                     /db_xref="GeneID:55990161"
                     /translation="MAGTETIIEEPRTVRETLRAYDVLETGVETSSVPSQNASQQPVR
                     SERNWPSDWRRMPAYHETSRTHRISDRSAGQDLVESGIVVAMFSGVWMMGTLNRIWRA
                     TGGKLNGQIMRYPVGGDW"
     gene            complement(<605299..>606234)
                     /locus_tag="TRUGW13939_02655"
                     /db_xref="GeneID:55990162"
     mRNA            complement(join(<605299..606093,606145..>606234))
                     /locus_tag="TRUGW13939_02655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485846.1"
                     /db_xref="GeneID:55990162"
     CDS             complement(join(605299..606093,606145..606234))
                     /locus_tag="TRUGW13939_02655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341739.1"
                     /db_xref="GeneID:55990162"
                     /translation="MLEAETEAGDYWKKCGDEALAQNVKGIIMMGAHWACLNDKIEVA
                     TNPNPGKSPCPFVTPSLYKDWVPNPDLATANRCISMLKAERFNVSPNPTFDWIHDTFL
                     VLIKMFPDFTKCPPVTIISMNARYDPWYHVKVGATLRPLRKEKYLLIGTGGAVHNLYR
                     NNWIDMLLYRESLGQERPPESWALDFRQATEDVVTQNRGPALRKAMIRLMQHPAYREA
                     QATDDHWMPALFAAGAAGDWEDEADPNVLAAETWELVNMCNSQFTFGSYRTGIHKVKE
                     GQDRKEKILRPRMVGIAA"
     gene            <606708..>607301
                     /locus_tag="TRUGW13939_02656"
                     /db_xref="GeneID:55990163"
     mRNA            <606708..>607301
                     /locus_tag="TRUGW13939_02656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485847.1"
                     /db_xref="GeneID:55990163"
     CDS             606708..607301
                     /locus_tag="TRUGW13939_02656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341740.1"
                     /db_xref="GeneID:55990163"
                     /translation="MSSQSRPASEDQLSKALPSLTTYLTGHNPSTGSTTIQEKRPAKW
                     QPVDNNNMAFNVPFTTSEFPVSMNNNVDIVKHDERLQSGKLGIVNPGGTVLRFVDFAP
                     GFESAMHRTRSLDYGIVVEGAIELILDSGEKQVLHRGDVCVQRGTNHAWRNPSETEWT
                     RVVYILQDSQPVVDVGGKPLREYLGRSAGEIPASGND"
     gene            <608664..>609232
                     /locus_tag="TRUGW13939_02657"
                     /db_xref="GeneID:55990164"
     mRNA            join(<608664..609005,609068..>609232)
                     /locus_tag="TRUGW13939_02657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485848.1"
                     /db_xref="GeneID:55990164"
     CDS             join(608664..609005,609068..609232)
                     /locus_tag="TRUGW13939_02657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341741.1"
                     /db_xref="GeneID:55990164"
                     /translation="MADQKNKSSTTTAIPPRNVITTPGVIMTSGKSSSGDNASLFRSN
                     FASSPGGATPTSASTSSSTSTTAAAFFSRTSSISPTSPSSTIQYDHETYLELLAGKSR
                     SVEKTASQVYREERARKLSLRARDPAVLSGPIDLVDMGVFSTQGHVSEYLYGDGYAGK
                     KHSNGSRR"
     gene            complement(<609444..>611012)
                     /locus_tag="TRUGW13939_02658"
                     /db_xref="GeneID:55990165"
     mRNA            complement(join(<609444..610637,610716..>611012))
                     /locus_tag="TRUGW13939_02658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485849.1"
                     /db_xref="GeneID:55990165"
     CDS             complement(join(609444..610637,610716..611012))
                     /locus_tag="TRUGW13939_02658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341742.1"
                     /db_xref="GeneID:55990165"
                     /translation="MDDFNDDFDNVSWRNDAHSDASRPTTAGTDSEDPVPPGPDVNGK
                     RRMSTAEDETQAGPLADPVDLAGIGDGVLECAVDSPLKENDGTKDAYISYLVTTHTDF
                     KTFQKSDFVVRRRFRDFFFLYKTLYREYPACAVPPLPDKHKVESYVTGDRFGPDFTQR
                     RSWSLHRFIKRLTLHPVLRRAPLLAIFLESPDWNAHMRLHGGRGSTGGGTEPSGGIFD
                     NFTDTFVNAFTKVHKPDRRFIEVREKAEKLDEDLTHVEKIVARVARREADLEADYADL
                     ATQFRKLVPLEPDVEMPLQVFAASVDETSRGMKELKDHTDQNYLGSLRDMEAYILSVK
                     ALLKTREQKQLDFEALVEYRNKAVSDRDSLVNNPSSYYASNPLTSSPASFLRSKMEDM
                     RGVDHEQSRRERIRKLELRIDELTREVDSAKTTSEMFDEEVVREVADFDRIKAVEFRD
                     SLGALGEQHIEFYQGVINTWERFISEMDSEGGGDDDAFRGRSNIAS"
     gene            complement(<611555..>614110)
                     /locus_tag="TRUGW13939_02659"
                     /db_xref="GeneID:55990166"
     mRNA            complement(join(<611555..612302,612360..>614110))
                     /locus_tag="TRUGW13939_02659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485850.1"
                     /db_xref="GeneID:55990166"
     CDS             complement(join(611555..612302,612360..614110))
                     /locus_tag="TRUGW13939_02659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341743.1"
                     /db_xref="GeneID:55990166"
                     /translation="MRGFKTAALSFLLSTSLAQLVPRTYDTHDFFAIHLDDSIPPEYI
                     ASLLGAHHEGQIGNLEGHHKFSIDREQGPAVETLLEALRVQRKLRRRGGDDDNLLQKR
                     DDGLDDGVLWSQKLALKQRLHKRGPVDFPEKHVRQEAASPEGEAVSRQKRIASDLAIK
                     DPLFGSQWHLFNSIQVGNDLNVTGVWLEGITGKGVVTAIVDDGLDLNSEDLKDNYFPE
                     GSWDFNDNLPDPIPRLSDDQHGTRCAGEIAAVRNDVCGVGMAYDSKVAGIRILSKPID
                     DADEATAINYGFQQNHIYSCSWGPRDDGQTMDAPNALVKRAMMNGIQNGRDGRGSIYV
                     FAAGNGGARDDNCNFDGYTNSIYSVTVGAIDRLGNHPPYSEACSAQLVVTYSSGGNDA
                     IYTTDIGQKCTERHGGTSAAGPLAAGAIALVLSIRPDLTWRDVQYLLLETAVPVHADG
                     DEVQMTPIGKEFSHQFGYGVVDTYSLVQKAKTWELVKPQAWYTSPWLRVQKEIPEGDQ
                     GLASYFDITSDMLKQANFESLEHITVTMNVNHTRRGDLSVELRGPQGIVSHLSIPRES
                     DEADSGYEDWTFMSVAHWGESGEGVWSVVVKDTKVNERVGVFADWRLTLWGSSIDAES
                     QLPHPLADEHEDDHNIEDAQYATVSIKPHTKTTPPASATDHADRPVNEKPSEAPAKPT
                     TPAVPPTPVEEELTPTGSVVPTAVASDGFLPSFLPTFGTKPHTQIWIYASVSLILIFC
                     IGLGIYFQVQRRKRLRNNPHDDYEFEIIDEDDDDAEAPLAGRTGRKRRGGELYNAFAE
                     ESEEELLSEDEEDMYRDQPSAFNEKMQHKNEAES"
     gene            <615235..>619738
                     /locus_tag="TRUGW13939_02660"
                     /db_xref="GeneID:55990167"
     mRNA            join(<615235..618153,618207..618332,618380..618606,
                     618659..618954,619002..>619738)
                     /locus_tag="TRUGW13939_02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485851.1"
                     /db_xref="GeneID:55990167"
     CDS             join(615235..618153,618207..618332,618380..618606,
                     618659..618954,619002..619738)
                     /locus_tag="TRUGW13939_02660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341744.1"
                     /db_xref="GeneID:55990167"
                     /translation="MAAAHSRRASLSHNSNYDPTQPRPANSGLSRSISTRARQAPVPA
                     PEPAMEEGGIPPFAPAAPPAPVAPEAPQVPQVARAPPASYRNGAVPQYANPQYRSVTR
                     SFSARSRDRPQEAGFPPVRIEYGDAYGVPNEQIQSQRRAERPKSISRPFPVDAPPPPA
                     ADTAPIDSAEGLQSSSGTLARPTSGSQASPVGGPNAVRSSNPESRKPRDDHRSPLQQL
                     ETRLVGMSKEEKRARMVEAESKLREQIARRQSQRTSSGTQSASPKTETRSIRTPDGPR
                     EGNPNTRQMGSDVPRRSATIDSQTTRDSQAQQYARRQPAVDRELAPGQIQYAAVQQAR
                     KPQYTSIQDTQGRRGPIQPPQNMPRHARTVSVGGAGNRGPPEDVFAPNQNIPPNQNTG
                     SFPSRASGMSRSGSNKAQRLLGSEYAQQQPATPTGPQAAEKGLLDRETGNVPTHFAGE
                     TLNQTVKNEQPEPSESSESTPTLKKGGKRNTVSFDVPPPTPPPLNEWRQAPVARLGLS
                     HRDFERVDMDRGKAWWEQDKSTRRRLSRSLPNDYRKPIPKVNDRNRFNPPLFLKCGPL
                     LRYLGIRRTTTDGPEGPVEQEVWRGSVMIVTTDSLSTLDTPPTLRLFSQPMDLLPPPP
                     REIGEEHGSKLAPEYVDPTAGLVKVGRDGRTLYVKPVDHLEEEVDLSQVESEDGLFET
                     SPSPIDDSADGVGRAVPSNRLGSTDGEKNGFYEEIQGFRLYSDPARDVTFWRFNIEVE
                     LTDKQERVAYRINEGPATGFWVPAKGQSMNIMFHSCNGFSMNVDHDKFSGPDPLWRDV
                     LNEHQTRPFHVMLGGGDQIYCDKVVQECDLFEEWTRIKNPHSKHNAPFSAALKAELET
                     FYLNHYASWFSHGLFGLANSQIPMVNIWDDHDIIDGFGSYPDHFMRSPVFSGLGNVAF
                     KYYMLFQHQSVPDETEADEPSWILGAAPGPYITEKSRSMFLSFGKGVSFLGIDCRTER
                     MREEIVSEQTYDHIWDRCHREIVKGETKHLIVLLGVPIAYPRLVWLENILTSRVLDPV
                     KALSRAGMFSGLVNKFDGSVEILDDLDDHWTAKNHKTERTWLIEDLQDLAAEKSIRVT
                     ILSGDVHLAAIGQFYSNPSLNLPKDKDYRYMPNVISSAIVNAPPPELMADVLNKRNKV
                     HHMDSNTDEDMIPIFTHDVDGKNRNNKRLLPRRNWCSIRQYHPGTTPPPTPPDSPDLP
                     AEDIQIGKLKRTLSLGRGDGQNPRGGLFRRLSLRGPPPTKEFNLDGAQNQQRRRFSTD
                     AASRPSPEATNEPRPGVFHRRPTNLSTKAAKKAEVEGDDGPFVNLEGGLDITLNMEVS
                     PKDPAGITTPYKLLVPALWYDGGFDPEPHRIVKGWKKWLGRGKQKPATTNNNDADVDD
                     DVDHVDDENEENHDYENEDYSDSESEQAATHGQLAQPFDEPDDYTPPKRKKWLGLV"
     gene            <620475..>621717
                     /locus_tag="TRUGW13939_02661"
                     /db_xref="GeneID:55990168"
     mRNA            join(<620475..620496,620562..621461,621521..>621717)
                     /locus_tag="TRUGW13939_02661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485852.1"
                     /db_xref="GeneID:55990168"
     CDS             join(620475..620496,620562..621461,621521..621717)
                     /locus_tag="TRUGW13939_02661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341745.1"
                     /db_xref="GeneID:55990168"
                     /translation="MVHSKVVIIGSGPAAHTAAIYLSRAELKPVMYEGMLANGTAAGG
                     QLTTTTDIENFPGFPKGIGGSELMDDMRKQSERFGTEIITETISRVDLSQRPFRLWKE
                     WADGENEEPAHTADAVIIATGANARRLDLPGETQYWQNGISACAVCDGAVPIFRNKPL
                     YVIGGGDSAAEEAMFLTKYGSHVVVLVRKDKLRASKAMAKRLLANPKVTVRFNTVATQ
                     VLGEEGPRGLMTHLKVKNVVSGEEETVDANGLFYAVGHDPATALFKGQIDLDSEEYIV
                     TQPGTSYTSIPGVFAAGDVQDKRYRQAITSAGSGCVAALEAEKFLSEEESSEENPAAA
                     TETGQTRIEPAAAEQNAEAAKEKPTGSAAAEYRQNPLL"
     gene            complement(<621847..>623423)
                     /locus_tag="TRUGW13939_02662"
                     /db_xref="GeneID:55990169"
     mRNA            complement(join(<621847..623199,623271..623330,
                     623385..>623423))
                     /locus_tag="TRUGW13939_02662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485853.1"
                     /db_xref="GeneID:55990169"
     CDS             complement(join(621847..623199,623271..623330,
                     623385..623423))
                     /locus_tag="TRUGW13939_02662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341746.1"
                     /db_xref="GeneID:55990169"
                     /translation="MSLNKKYANLPDLDLAPDVYETPDLTDGASTVPTTVRNSDSDDE
                     SNPDIDRNTLNTDEARLHFLRASGVDAREVDFSDTIAAKRKAYKNRSTRRRRRQQQND
                     GDEGVDGEASDSEEEESLERKLARLRRETEELKADMQQQKDGSGGGAEAGADADGLLE
                     LSKALDTIQFASARTNAQFPDAILSQKLEAASTDKQPATTTTEKDSQKTPEKNDTAAA
                     GLLAHAASFDSRLALLEAALGVSSGSNPFIAENSTVEPSLHPILPALDHLTSQLTALT
                     STLGGPAATTTTTTSSFTPATSTPASTTAHLEALSTRIKKLTTDAESLANARRRASEA
                     ASKAAASNVRSPDPADNSSSNATEVNPNNNNNNNNNNAESSAQRDEQVAKIHALYATL
                     PTIQSLHPVLPSVLERLRSLRALHAGAAQASETLDALEKDQAEMSKEIEQWREGLRVV
                     EEKVKESEGAMKSNIDVVGPWVKDLEARIARFD"
     gene            <623984..>624829
                     /locus_tag="TRUGW13939_02663"
                     /db_xref="GeneID:55990170"
     mRNA            join(<623984..624037,624187..624648,624710..>624829)
                     /locus_tag="TRUGW13939_02663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485854.1"
                     /db_xref="GeneID:55990170"
     CDS             join(623984..624037,624187..624648,624710..624829)
                     /locus_tag="TRUGW13939_02663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341747.1"
                     /db_xref="GeneID:55990170"
                     /translation="MAAPAEITLQNLNGEFVMQSVSWMTRTALGYATVTLAITEYIEP
                     NADDDAHAPITKVDIAQTATGGIQSSEKRITDWRTRGHEDRIFGALSGQSRLVRGTSS
                     GPTLEVQTQSKDAEKVTRFLKGEILADGSAVDGFVVDTVQDKEGLSYGEGEGLWLQSW
                     VRNEKYGWSAEQIWGFEIIDGQRYHTRRVAASKGDKYVLARLVYDYQGPVA"
     gene            complement(<624940..>626770)
                     /locus_tag="TRUGW13939_02664"
                     /db_xref="GeneID:55990171"
     mRNA            complement(join(<624940..625356,625410..626047,
                     626095..>626770))
                     /locus_tag="TRUGW13939_02664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485855.1"
                     /db_xref="GeneID:55990171"
     CDS             complement(join(624940..625356,625410..626047,
                     626095..626770))
                     /locus_tag="TRUGW13939_02664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341748.1"
                     /db_xref="GeneID:55990171"
                     /translation="MAARSLARGVSALSSSSPRMVASSRSLVTAARTASWRTPSASLR
                     RSLHASARSWQAATTSAASTATEYPNSHERVATPIDTTNFIDNEFVSSQATTWIDLHD
                     PATNNLVSRVPQSTDAELKAAVASAEKAFPAWRATSIMSRQQIMFKFVALIRQHWDRL
                     AASITLEQGKTFADAKGDVLRGLQVAETACGITTQITGEVLEVAKDMETRSYREPLGV
                     VAAICPFNFPAMIPLWCIPVATITGNCVVVKPSERDPGAAMILAELAREAGFPPGVIN
                     IVHGSAKTVDFILDEPAIKAISFVGGNRAGEYIYTRGSANGKRVQANLGAKNHATVMP
                     DCNKNHALNAITGAAFGAAGQRCMALSTLVMVGETKEWLPELAERAKELKVDGGFEEG
                     ADLGPVISPHSKKRIEDLIATAEKEGATILLDGRGYKPEKYPNGNWIAPTIITNVTPD
                     MTCYKQELFGPVLVCLNVDTLDDAIALTNSNEYGNGEAIFTTSGSTAARFQKDIEAGQ
                     LGINVPIPVPLPMFSFTGNKKSVAGGGASTFYGKPGINFYTQQKTVTSLWRSEDATHS
                     RASVVMPTHK"
     gene            complement(<627290..>628461)
                     /locus_tag="TRUGW13939_02665"
                     /db_xref="GeneID:55990172"
     mRNA            complement(join(<627290..627480,627551..627718,
                     627797..627955,628007..628148,628201..>628461))
                     /locus_tag="TRUGW13939_02665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485856.1"
                     /db_xref="GeneID:55990172"
     CDS             complement(join(627290..627480,627551..627718,
                     627797..627955,628007..628148,628201..628461))
                     /locus_tag="TRUGW13939_02665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341749.1"
                     /db_xref="GeneID:55990172"
                     /translation="METPPFSALPLDPGHPPHSAWAVWGADDELGTLNHLTDNVVAAA
                     ARDGIRTGTRIGLNWTLQQMKRPPPFRNVLEHRINTIEGGGMHDDTLHFNTQTSSQWD
                     GFRHCGYENGLFYNGVAGEEILHKRTERIGIHAWCKQGIVGRGVLVDFASYAARHKLG
                     FNALSRSTISLDTVKQILEENNTVIRRGFLQAYENATAEELHQLMTSDPLEYPGVDNS
                     REFAEWLWDSGFAAVCTDSPGFEAMPPQGFFLHPVLLAGLGMPIGELFALDELAAQCE
                     KTGRATFFFTSEPLNVVGGVASPPNALAIF"
     gene            <628852..>630399
                     /locus_tag="TRUGW13939_02666"
                     /db_xref="GeneID:55990173"
     mRNA            <628852..>630399
                     /locus_tag="TRUGW13939_02666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485857.1"
                     /db_xref="GeneID:55990173"
     CDS             628852..630399
                     /locus_tag="TRUGW13939_02666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341750.1"
                     /db_xref="GeneID:55990173"
                     /translation="MFSQIKGRGLTRGITIACGAGFFLFGYDQGVFGGILTNQNFLDT
                     FNNPDATIQGQITSTYYLGAIFGAILSRFIGDRIGRRKAIMLGCTFLTVGGLLQATAS
                     TLVHMIIGRIVGGFGTGLNTTAIPMWQVETCKQHHRGRLVIMELVLNIFGIAVTSWMN
                     YGFTWLPHDSVSWRFPLAFQSFWSIVTFIFTIIMPESPRWLVSRGRQEEAKLILARLM
                     SLDVDDPEVTKVLRILTLTVTHEVENETAALSSILQNGRGQNLRRILLGAGLALMQQA
                     CGVNIIANYLPVVLTKSVGLSDRLALVLSAVYSHALTIWATTSMLAIDSLGRKPLLLA
                     GAMGQGIAFFMIAVGVRIGSYNMSIFTVVFIFVYNFFFGTSFLSIPWLYPAEINSQSM
                     RNVGTSISTATNWVFVYVIVLVTPLGIEKLGWRFYLMFGFFNLAFVPFLWLFYVETAR
                     LSLEQIDRLFEVFSIAQDQDNQSISLAQARKQVLLEAEVVGNANGKGLAAQTLATKTD
                     TIQLEEM"
     gene            <630914..>631744
                     /locus_tag="TRUGW13939_02667"
                     /db_xref="GeneID:55990174"
     mRNA            <630914..>631744
                     /locus_tag="TRUGW13939_02667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485858.1"
                     /db_xref="GeneID:55990174"
     CDS             630914..631744
                     /locus_tag="TRUGW13939_02667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341751.1"
                     /db_xref="GeneID:55990174"
                     /translation="MESGCGEGFLANLAPSIPRHRYTGISDFLLEFDEQSEKNASEWF
                     LLTDIDEKVFTVGFLNTTDDTHIAFWLWVSFDPLSRLLLFKMPPSPAHEIASLTFARL
                     FDDSLQQIGLKYAIKQLGSSPYGEGNRGRKMADFEWAPKRPPPGHHRNAPTMVLEVAL
                     TETQSKLNSDVRFWLDQARHDVNIALTLAIGQREPRITIEKWERVDDRIHRTQKIDIH
                     HQGQRNTTVVTGGPLKLDFAKVFLRAPATPKERDIVLDDEQLQFLAEEIWETQEASQR
                     "
     gene            complement(<631928..>633595)
                     /locus_tag="TRUGW13939_02668"
                     /db_xref="GeneID:55990175"
     mRNA            complement(<631928..>633595)
                     /locus_tag="TRUGW13939_02668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485859.1"
                     /db_xref="GeneID:55990175"
     CDS             complement(631928..633595)
                     /locus_tag="TRUGW13939_02668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341752.1"
                     /db_xref="GeneID:55990175"
                     /translation="MVSRLSDMFGWMASMGNVSTAACRCFPGDACWPSTVQWNDFNSS
                     IGGKLIASVPLAAPCHENGAFAAWNTEECAALQDNWFLPDTHLASSSSPMSYLFTNNS
                     CNPFLTKETNCTLGNLVTYAVNATSATDIQQTLAFAQDHDIRLVIRNTGHDYNGKSTG
                     AGALGLWLHHLDSLEYVSEYSSPSYSGPAIKVGAGVSIYEAYKYADEHNGIVVGGNCP
                     TVSLAGGYTQGGGHGPLASKYGLAVDQVLEWEVITADGSFFKALSTHHSSLYWALSGG
                     GGGTYGVVVSLTVKVHPQEAAAAAAMSFAIQNTSTGADDFWTAVTTFVESLPSMVDTG
                     LQVGWMLVPGAFIVSSASGPGISQQTIDGLFEKTILPLKKAEIPYQYSSQPFPTWLQS
                     YEAFNLPSANVSNAIMGSRLIPRSVVEDQTQNLISALQTIVQHNFVAVGNSMTVASQK
                     SSDVSVNPYLRQTIVHLSLGTYFNYQDFASNLQNQDIMTNTLIPLLAALTPNGAAYLN
                     EADFQQPDWQSVFYGANYDLLDKVKSEYDPLDLFYALGAVGSDRWEE"
     gene            <634243..>635235
                     /locus_tag="TRUGW13939_02669"
                     /db_xref="GeneID:55990176"
     mRNA            join(<634243..634681,634748..635118,635176..>635235)
                     /locus_tag="TRUGW13939_02669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485860.1"
                     /db_xref="GeneID:55990176"
     CDS             join(634243..634681,634748..635118,635176..635235)
                     /locus_tag="TRUGW13939_02669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341753.1"
                     /db_xref="GeneID:55990176"
                     /translation="MPHQKSVLITGCSDGGIGSALAKAFQSHGLRVFATARTVSTMLS
                     LEQLPAVALLSLDVTSSTSIAAAVEAVKRDTNGTLDYLVNNAAINQYSPALDIDIGQA
                     KRMFDTNYWGALEVTQKFAPLLIASKGTVVGISSISAHANIPYCSALAGSKRSLEILM
                     ETLRVELKPFGVNVLSVVTGVVRSNAQNWKHFEDWKLPDESIYKSLESQIHEHIQEKD
                     GVYNDGAVRVDTVQHARKLADKILAGTTGTIWIGGQAGAVRFATTYLPQFVLDKMVSA
                     GYGLEKLAKGAAK"
     gene            <635866..>636960
                     /locus_tag="TRUGW13939_02670"
                     /db_xref="GeneID:55990177"
     mRNA            join(<635866..636035,636112..636557,636614..>636960)
                     /locus_tag="TRUGW13939_02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485861.1"
                     /db_xref="GeneID:55990177"
     CDS             join(635866..636035,636112..636557,636614..636960)
                     /locus_tag="TRUGW13939_02670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341754.1"
                     /db_xref="GeneID:55990177"
                     /translation="MQSPTVRVAVTQLEPEWIDLQSCIDKVCKYIAEAAQNGAKLVTF
                     PECFVPGYPAWIWSRPVDPELTTRYIRNSLRRDSPEMRRIQASAAENMINVALGFSEN
                     DNNSLYIAQALLSSSGEMLFCRRKMKPTHMERTIFGESSGDSLLNVHDVGDGVGRVGC
                     LNCWEHIQPLLKFHTFSQHEELHVSAWPPLMLYTGGSELWSMSREGCRSLSQTYAVES
                     QTFVLHTTAVISQKGIDTMQCGPGLFGRPGGGSSAIFAPDGRQLSVDIPETEEGVIYL
                     NLDLDMLLIAKSFADATGHYSRPDLLSLAVSTKSKKIVTEVDTS"
     gene            complement(<637367..>638281)
                     /locus_tag="TRUGW13939_02671"
                     /db_xref="GeneID:55990178"
     mRNA            complement(<637367..>638281)
                     /locus_tag="TRUGW13939_02671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485862.1"
                     /db_xref="GeneID:55990178"
     CDS             complement(637367..638281)
                     /locus_tag="TRUGW13939_02671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341755.1"
                     /db_xref="GeneID:55990178"
                     /translation="MSLVETKFLIISDSHGQPLTSHPITEAVDVAIHCGDLTDESKIE
                     EFKRTLQYLRELKADLKLVIAGNHDFTLDVPAFQKLIQNAIPPLEEELVQKTYGGYEE
                     ARHLMESAKSDNIIFLEEGTHTFNLRNGASLRVYASPFTPSTSGDWGFQYHPSQGRSF
                     DIPENVDVVITHGPPLGVLDYTNSRQRAGCPNLFQDIARTKPRLHCFGHIHEAWGAKL
                     VTWRETLSQTPSHFTDIDNSKSTVLGNVSQLNSARQNGDVACYSAGCSIQTPDQQTLF
                     VNAALQGISGTNQVPWVIGVPLPKNLRV"
     gene            <639090..>639449
                     /locus_tag="TRUGW13939_02672"
                     /db_xref="GeneID:55990179"
     mRNA            join(<639090..639150,639211..>639449)
                     /locus_tag="TRUGW13939_02672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485863.1"
                     /db_xref="GeneID:55990179"
     CDS             join(639090..639150,639211..639449)
                     /locus_tag="TRUGW13939_02672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341756.1"
                     /db_xref="GeneID:55990179"
                     /translation="MGTEKVNPFSTKVETGSTDFGNITYEYPGVHAYYAIDCSPNIIM
                     HHQGFTEASGTDEAFNPAVQVGAIVALTAWDLLTDDAFFEVKKEWGVKLAKHLSM"
     gene            complement(<639650..>640662)
                     /locus_tag="TRUGW13939_02673"
                     /db_xref="GeneID:55990180"
     mRNA            complement(join(<639650..640548,640614..>640662))
                     /locus_tag="TRUGW13939_02673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485864.1"
                     /db_xref="GeneID:55990180"
     CDS             complement(join(639650..640548,640614..640662))
                     /locus_tag="TRUGW13939_02673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341757.1"
                     /db_xref="GeneID:55990180"
                     /translation="MYFHRRPMLWLHFYRAIVHRPQIDYITITGISQTWVRPHGPHPP
                     HLPRDPLKARIGYQGNNPEASSCTSFWRADILNPQINKISRAEQIGYAVHAHCWILVD
                     RIIGFELVEDNLKIFLNTVEKFWAENAELWLREPWYEPGSPVSNNLTSDQMDEPTWEN
                     PTILPRIQEIVEKAIRQPYADSQSRQTLSSAVSHIPLDIAIQLVEWVKPISVADTRNM
                     LTAFGWRLPDSYWKRFCKMDLIFEYGDLEKTNLPVNWQLIALATEEIMEDPEWDRNTG
                     LGTRRLIFRNLSQMKTIFLDFLTLNEPPRRKYSLRRRLL"
     gene            complement(<641429..>642077)
                     /locus_tag="TRUGW13939_02674"
                     /db_xref="GeneID:55990181"
     mRNA            complement(join(<641429..641977,642033..>642077))
                     /locus_tag="TRUGW13939_02674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485865.1"
                     /db_xref="GeneID:55990181"
     CDS             complement(join(641429..641977,642033..642077))
                     /locus_tag="TRUGW13939_02674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341758.1"
                     /db_xref="GeneID:55990181"
                     /translation="MAAPAAPAPAPPPANYLEIPAINHEIMDMDNNSTEDHMYGIWDA
                     ILNWTFPATSGYITRPQDRHGQFGGGGLGFSDFHTFQYNEATGQRSFILITQCKRYEL
                     RTRPAEWQAATEQLRDYLNLQHQTQPTHDVYGIVAIGDRVRFFKYNYQQKNVTAWRPP
                     AGGLLPLSNTVGKRHWYDLVAEAPRVQRALEYILSHH"
     gene            <643162..>643732
                     /locus_tag="TRUGW13939_02675"
                     /db_xref="GeneID:55990182"
     mRNA            join(<643162..643275,643331..>643732)
                     /locus_tag="TRUGW13939_02675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485866.1"
                     /db_xref="GeneID:55990182"
     CDS             join(643162..643275,643331..643732)
                     /locus_tag="TRUGW13939_02675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341759.1"
                     /db_xref="GeneID:55990182"
                     /translation="MGSKTEPYFPLAGYSQDGWSKDGRATATCFCGAVQLSFPTEKPG
                     LVDTFICNCTDCRKLTASMFASNFTIDDNYLIHERGQENLTTYGQSKTIGTGNTMTNY
                     FCSTCGSLMYRRGTGFPGKSILRIGTVDDFNLHETKLKPRIEQYVKDRVAWFHGGEGV
                     KQVQGYYYAKV"
     gene            complement(<646062..>647169)
                     /locus_tag="TRUGW13939_02676"
                     /db_xref="GeneID:55990183"
     mRNA            complement(join(<646062..646548,646609..646722,
                     646781..>647169))
                     /locus_tag="TRUGW13939_02676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485867.1"
                     /db_xref="GeneID:55990183"
     CDS             complement(join(646062..646548,646609..646722,
                     646781..647169))
                     /locus_tag="TRUGW13939_02676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341760.1"
                     /db_xref="GeneID:55990183"
                     /translation="MLLKATALLAAANAVLAQRPSNTSICDYYTEALLKENNATNQYT
                     LLTLLVNTAVIGNYTQPNVGVSVPGILNPDGMYNDTKVNLVPYFNGGLASSNTGGMSG
                     MAVNFLDGGGAAPLMKNMPAADNTSKQYKLLTHLYEFFGSLLGCSEVGMAGFAAYAGD
                     GSMYEVHKFMVLDPFEVGYFITQVGLSAASFGVAQSDIDAVAMSLEKLFDNRCAPKTT
                     AIEAQGPQYQSICTDEKCPLSPNSTCAAQPSMEQPLVANATLAMGEGRNASSSSSSSS
                     MSMPSGTSIPSGSSMPSGTTTGTASPMPTSEGTQLVPGMAGLAVIVAAVLFAQ"
     gene            <648313..>649809
                     /locus_tag="TRUGW13939_02677"
                     /db_xref="GeneID:55990184"
     mRNA            join(<648313..648390,648446..648558,648624..649097,
                     649167..>649809)
                     /locus_tag="TRUGW13939_02677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485868.1"
                     /db_xref="GeneID:55990184"
     CDS             join(648313..648390,648446..648558,648624..649097,
                     649167..649809)
                     /locus_tag="TRUGW13939_02677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341761.1"
                     /db_xref="GeneID:55990184"
                     /translation="MDSKSGAPSPIESVSGIEQPARDSPMEWSWLRKHTILVQAAFHA
                     AGPGLTSSLLIPATEQLAEQTISVQPASGHIWPPTSFPREHAAILCCRSGGGFAHGYG
                     TLMTARIFQSIGISTGFVIPGIIVVDLFRTEERGSKNGVWAQMVSMGAPLGGLIGGPI
                     VSYLGWQWVMWIISIICGAQLLAFILTCPETSYLHRQQSGFGAYRASELFRLQKRIPG
                     RLGCVTFAITSPGIATILPIALGKFYEFNSIAQGLFFLGPLVGILLAERLAGPGSDWA
                     MGRERRQAANEGRQERPEFRLWVGLPGYAMSIVGVIIFGVTLQARVHWIAPCIGFGIS
                     NFGLQLVTTPLKTYCVDCYASHSGSVLQMINAVRQIISFTVPFWSPILNESLGYGSGF
                     GIEAAILAAFYILSLLVLWRGASWRQSVRIRGLIKTGEELLEP"
     gene            complement(<650404..>652461)
                     /locus_tag="TRUGW13939_02678"
                     /db_xref="GeneID:55990185"
     mRNA            complement(join(<650404..650600,650650..651283,
                     651339..651881,651946..652162,652217..652336,
                     652412..>652461))
                     /locus_tag="TRUGW13939_02678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485869.1"
                     /db_xref="GeneID:55990185"
     CDS             complement(join(<650404..650600,650650..651283,
                     651339..651881,651946..652162,652217..652336,
                     652412..652461))
                     /locus_tag="TRUGW13939_02678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341762.1"
                     /db_xref="GeneID:55990185"
                     /translation="MSSTTEPDHYYDYIVCGGGTSGCVLAARLAENPGVTVLVIEAGQ
                     SSKELENVHMVGGWSQNFDSETDWNIVTEPMAGVNDRQVKLSRGRFLGGCSGCNGTLC
                     IRGCKQDYDDWTMEGWSGDEFFNAMRKAETFHSKPWFKEDAKSHGSSGPLHTEPHDLA
                     PISNLLMDSFVSQGLPLDPDMFSTGETPHGAGHVVRTVYEGLRTTSADFILNEKEQVG
                     NIKIKTDTSVNRVVLEGDAASGLRATAVQVQGADGIEHTYFARKEIVISCGAYCSPAV
                     LLRSGIGPKEELAKHGIECLVDLPGVGKNLMDHLIVFMFYETEKEGLTTDHHVYHGDN
                     FAKTYALWKEKKEGFLSTFPFGVFAFARLDERLKDEPLWKNAHRQPGRDPMGLTPKQP
                     NIEFFTTECYGGPKQYNQFPVDGKYAFSMIAELFGPRSRGSVTLNSKDPLQNPIVDCN
                     YLSDPLDMLVLSEACRFGNEIVMNGAGTKDIVKGSWPPSSGHHAFKTREEWIPYVKEH
                     ATTCMFPYFTSAACYHASGTCAMGKDDSPMAVLDNKLRVRGVSGLRVADCSVMPALHS
                     GHTQMPAYGIGERAADIIKET"
     gene            <653861..>655409
                     /locus_tag="TRUGW13939_02679"
                     /db_xref="GeneID:55990186"
     mRNA            join(<653861..654019,654080..654107,654188..654359,
                     654428..654472,654661..654676,654748..654813,
                     655071..>655409)
                     /locus_tag="TRUGW13939_02679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485870.1"
                     /db_xref="GeneID:55990186"
     CDS             join(653861..654019,654080..654107,654188..654359,
                     654428..654472,654661..654676,654748..654813,
                     655071..655409)
                     /locus_tag="TRUGW13939_02679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341763.1"
                     /db_xref="GeneID:55990186"
                     /translation="MVQATPFQTEAWTEYAFGVVILLVRIFARYQTVGIKSWQGDDYF
                     AIIALLFWTAELTMLALIGQYGTNIGWTPEQRAAFSDADIAKLEIGSKCLLAGWICYT
                     ALIWSLKSCMIFFYLRLTSGLWHQKIVKASAVFCDKCYNRCDLGLHPNTVIDPSENYS
                     KAFVAIIAVNAPCIKPLLSTANWMGSTKDKSSQNPTSGVTSGNYNLAKLRVPQNNTQK
                     GGQTTIDDQDSQEFILDRTDHYRSDTFGYTHNVSTSAPPENWPGIQVTTTYEVTKV"
     gene            complement(<658682..>660594)
                     /locus_tag="TRUGW13939_02680"
                     /db_xref="GeneID:55990187"
     mRNA            complement(join(<658682..659167,659222..659875,
                     659928..660058,660117..660399,660469..>660594))
                     /locus_tag="TRUGW13939_02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485871.1"
                     /db_xref="GeneID:55990187"
     CDS             complement(join(658682..659167,659222..659875,
                     659928..660058,660117..660399,660469..660594))
                     /locus_tag="TRUGW13939_02680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341764.1"
                     /db_xref="GeneID:55990187"
                     /translation="MRFNAALASALVSSAGLMGYVHAEDEVPAPDATSAVERPTFTPS
                     TIKGPFVEQFTDDWEKRWTASHAKKADSDSEEDWAYVGEWAVEEPTVFKGIEGDKGLV
                     LKNAAAHHAISAKFPKKIDNKGKTLVVQYEVKPQNSLVCGGAYLKLLQENKKLHAEEF
                     SNTTPYVIMFGPDKCGSTNKVHFIFNHKNPKTGEYFEKHLTSPPTPRTEKTTSVYTLI
                     VNPDQTFEILIDGESAKAGSLLEDFTPPVNPPKEIDDPKDKKPDTWVDDAKIADPEAK
                     KPEDWDEEAPFEIVDEEATKPEDWLEDEPLTIPDPEAEKPEDWDDEEDGDWVAPTVPN
                     AKCTEVSGCGPWSAPLKKNPAYKGKWVAPFIDNPDYKGPWAPRKIANPEFFEDKTPAN
                     FEPLGAIGFELWTMQNDILFDNIYIGHSVEDAAEFRKETFEVKKPIETAEEEAAKPKP
                     ETKGPSGVSFQEDPVAFIREKVDLFISLAKQDPIEAAKTVPEVAGGLGAILLATILFI
                     VGAIGASSPAPAKAAEKGKAAAGSAKEKAAEGVSSATDAAKGATKRATRSG"
     gene            <661391..>662270
                     /locus_tag="TRUGW13939_02681"
                     /db_xref="GeneID:55990188"
     mRNA            join(<661391..661552,661616..662091,662144..>662270)
                     /locus_tag="TRUGW13939_02681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485872.1"
                     /db_xref="GeneID:55990188"
     CDS             join(661391..661552,661616..662091,662144..662270)
                     /locus_tag="TRUGW13939_02681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341765.1"
                     /db_xref="GeneID:55990188"
                     /translation="MAATQNTDIPVDSNGHTNNDHLVQSTDPEHPANLIPEMCRKFYN
                     WGWVTGTGGGTSIRRGDHIFIAPSGVQKEMLQPHNMFVLQYPTPKYPPSSRKYIRKPL
                     NLKPSDCTPLFLAAFDQGAGCCIHTHSQWAVLVTLLVERDLGKEGYFEISNIEQIKGI
                     PKGKGKGNHGYHDTLRIPIIDNTPFEEDLTEGLEKAMNANPDTYAVLVRRHGIYVWGD
                     TPAKAKTQCESLDYLFQLAVEMHKLGLPWDINRNQK"
     gene            <662707..>664739
                     /locus_tag="TRUGW13939_02682"
                     /db_xref="GeneID:55990189"
     mRNA            join(<662707..662740,662805..662840,662908..663389,
                     663445..663825,663877..664479,664542..>664739)
                     /locus_tag="TRUGW13939_02682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485873.1"
                     /db_xref="GeneID:55990189"
     CDS             join(662707..662740,662805..662840,662908..663389,
                     663445..663825,663877..664479,664542..664739)
                     /locus_tag="TRUGW13939_02682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341766.1"
                     /db_xref="GeneID:55990189"
                     /translation="MDLDGAESPWGDEPSRSPGATRNGSTTESAPSRPAQDSLTPAQS
                     TRRGPKTPRKVNAQVTKLEAVDDTTDPLGPLGEGSFVEEAPAPPLKEPAASGRAVRPV
                     SDLSRTSSGAGLMDSVNLEDEQPRLKNPPPVQPPSAESPKRQVQPSISVEQAAKPTFT
                     ITVGDPHKVGDLTSSHIVYQVRTKTSSKAYRRSEFEVSRRYKDFLWIYNQLHNNNPGV
                     VVPPPPEKQAVGRFDTNFVESRRAALERMVNKITAHPVLQHDADLKIFLESETFGIDI
                     KNKENREPDLGQSKGMFSSFGISVGGGGKFVEHDDWFHDRKIYLDALENQLRALLKSI
                     DTVVAQRKGLAEAAGDFSASLHALAAVELSPALTGPLEGLSELQLRIRELYERQAQQD
                     ILTLGITIDEYIRLIGSIKTSFSQRQKSFHNWHNAEAELQKKRTTQEKLLRQGKSQQD
                     RLNQINADVADAERKVHQTRLLFEDMGRLMRNELERFEKEKVEDFKSGVETFLEGAVE
                     AQKELIELWESFLLQLDAGDEINPYYAPTPAPAAPAPPADEAEETPAKSPEEERAAAI
                     AAAVAAEEEAQ"
     gene            complement(<665567..>666175)
                     /locus_tag="TRUGW13939_02683"
                     /db_xref="GeneID:55990190"
     mRNA            complement(<665567..>666175)
                     /locus_tag="TRUGW13939_02683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485874.1"
                     /db_xref="GeneID:55990190"
     CDS             complement(665567..666175)
                     /locus_tag="TRUGW13939_02683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341767.1"
                     /db_xref="GeneID:55990190"
                     /translation="MSLNTSLRRVSSTAPSTLSSSLTRTSINTPTSTSTTTYICNQCR
                     HATLLRRPKRPYTFTQLITLSDGSTYLHRTTSPIPVYRSTRDTRNSLLWNPTSQKLVN
                     LEEDEAGRLAAFRARFGRAYDANAGASKETEEVVEKKETTADGQDQQQQQKEKKQPTE
                     AEKEAAAKAQAEAEAELQAEEDNLLDLISSFGQEQQNQGKKK"
     gene            <666863..>667462
                     /locus_tag="TRUGW13939_02684"
                     /db_xref="GeneID:55990191"
     mRNA            <666863..>667462
                     /locus_tag="TRUGW13939_02684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485875.1"
                     /db_xref="GeneID:55990191"
     CDS             666863..667462
                     /locus_tag="TRUGW13939_02684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341768.1"
                     /db_xref="GeneID:55990191"
                     /translation="MRRVPHPVAIITTTSADSTSNPNPNSTPRGMTVSSFNTVTLHPK
                     PVISFNVHHPSETLLALQSSSRFLVHLLAPGAAAARLARDFARGNENLELGDFEWDCY
                     KILPRLRRRRKRQQHSSQGKEKDEEKEEDFSFVLECQYLPDKTIQVYDHMIVLGTVEK
                     VLSASPRSSTDIDTKNHKRHDFCLTYADTRFWKMGEQVE"
     gene            complement(<667857..>670874)
                     /locus_tag="TRUGW13939_02685"
                     /db_xref="GeneID:55990192"
     mRNA            complement(<667857..>670874)
                     /locus_tag="TRUGW13939_02685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485876.1"
                     /db_xref="GeneID:55990192"
     CDS             complement(667857..670874)
                     /locus_tag="TRUGW13939_02685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341769.1"
                     /db_xref="GeneID:55990192"
                     /translation="MTRSVAAARRGHQNSTRSENGTAANGKRLNKQKSSGNLNGNASS
                     GASSNSVSQTDLRQSSDSPAVTTAKAANGAADGSKTDNVDTTYTNGTGYKANGEMAYG
                     RTNGVVGGDGTQSKISVCTNSKRQTSSVNPFTLASTILRSCPIYDTIAILIFLLQLPP
                     IVLTLVQFLFASLTFMPPGGGSGSSFTSNFDIFQGPAGTPSFGTMIAMDGFCLLLWGL
                     FMWTWAQNFALDLAHVQVAITLGGGGSGKNGGVNTMCVGTVLLLHIVRSKGVQDFVFG
                     HLIAAKLISPDILSRWSHFLPQEFRRTEPQSSPSWLRSLLAIHILAQAGTAMARRSMA
                     RNRSPQPSRSGKRVDAEASAGSQTQIDSAFESTASVPSLLGTDGPLIGPSALKESRDR
                     LHSAKKRRRQANQVRSRQPFWAALASTKVTVMREYEHSRAVSKTTRGLPMTEDDLQGI
                     TLDDGLIWVTNVDSSTIKFAAGDFAVGDEATAATVCEDGRLENNEVEPFYVCVNGALW
                     ATANITKVCDGPKGASAVQWRGEISGLAPNCAYTCSFVRSDTDEEIGSMSVKTPAAPD
                     ADQSAVTTMPTPPRPFHRPSSPTTTLRNSIINAESKLNEKRSRLKKAKNDHKILISRI
                     RKELDNFNHRLSSGNDENRQKQRSLQLERNIRQTEEATAALETQLDTMESIPEEEMAA
                     WTAQKTEFERELESLNTAKQEVLEARTTVARDLASLESDFNAAVQKRERLQGRKARLN
                     EQYERIISANAQGLNERERRAAEQFAREQDQAKIEANFNEQLTSISRAIQDYQLRTNQ
                     LWQQASAIEQAIQQQQQQMLVETGPLTPEGTLPGTHLLSEESESTNNVNNLTITPANS
                     RSILGAGFSTLRSSPHQSASSANNGMTSQTASPLQSTLQNPVGYQASPRLNVANYLGG
                     RDFGYRDRSSSNRSARSSLYADYDFDLNRFLPDPVERRDSGSDGKGYASPTYGAIGSH
                     FTRAGSRGSGGSSGGSGSGSGSGSPRSTRAEGL"
     gene            complement(673681..673789)
                     /locus_tag="TRUGW13939_02686"
                     /db_xref="GeneID:55990193"
     tRNA            complement(673681..673789)
                     /locus_tag="TRUGW13939_02686"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:55990193"
     gene            complement(673885..673998)
                     /locus_tag="TRUGW13939_02687"
                     /db_xref="GeneID:55990194"
     tRNA            complement(673885..673998)
                     /locus_tag="TRUGW13939_02687"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:55990194"
     gene            <674639..>675382
                     /locus_tag="TRUGW13939_02688"
                     /db_xref="GeneID:55990195"
     mRNA            <674639..>675382
                     /locus_tag="TRUGW13939_02688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485877.1"
                     /db_xref="GeneID:55990195"
     CDS             674639..675382
                     /locus_tag="TRUGW13939_02688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341770.1"
                     /db_xref="GeneID:55990195"
                     /translation="MTKPKTLLLLGGMTPDVTALYYNTINSVVRSHLGGRSSAPLYLY
                     NADLETMIQYASRKDWASFASVYKDPINALSHRIDGVVVCAILAHKVSKQLSADSSVP
                     LLHIADCVSTHLKAMYPHIKRVGLLGPKATMVDAEDADFFVGRLQSPQHGFSVLIPQG
                     DEHIREVDRGMIEEVAKGRASVTESTKAMFVSEARALVDRGAQAIILGSTDLGFVFQQ
                     ESLPAGIPLIEPAEIHAKQVALWALNQSS"
     gene            complement(<675537..>676751)
                     /locus_tag="TRUGW13939_02689"
                     /db_xref="GeneID:55990196"
     mRNA            complement(join(<675537..675896,675972..676160,
                     676226..676237,676293..676301,676353..>676751))
                     /locus_tag="TRUGW13939_02689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485878.1"
                     /db_xref="GeneID:55990196"
     CDS             complement(join(675537..675896,675972..676160,
                     676226..676237,676293..676301,676353..676751))
                     /locus_tag="TRUGW13939_02689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341771.1"
                     /db_xref="GeneID:55990196"
                     /translation="MASRRILERSRYHNFNTPYRISTQLFSSSTPRCDNGAAAAAASS
                     AAAAPQPTTSPNTVPSKPHTVDPRWLTTIKRRIGKCLMFGLQPAQVDVAGSILQQVAR
                     DWRELIAGSEGFLTGENRRSVFRHSVVWGEMDVMAHDSPDYDNIGHVNNVTYLRYAET
                     ARVNLMRNYAMHVDPAHKTDWLNTVGNKGTGLILQSIKLDYKFPMTWPDKITVYHRLT
                     QDPSATLAKSFFQQEVLILSEAKQRPAARCLEQNALYDYKLLRKAPSPPEFLLEQFKR
                     TWELQEQSKREWQQRIADIEDRVRSLEVESWDREDAVEMFGTANKS"
     gene            <677050..>677496
                     /locus_tag="TRUGW13939_02690"
                     /db_xref="GeneID:55990197"
     mRNA            join(<677050..677095,677144..677287,677341..677353,
                     677445..>677496)
                     /locus_tag="TRUGW13939_02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485879.1"
                     /db_xref="GeneID:55990197"
     CDS             join(677050..677095,677144..677287,677341..677353,
                     677445..677496)
                     /locus_tag="TRUGW13939_02690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341772.1"
                     /db_xref="GeneID:55990197"
                     /translation="MANQELRRQVIRIYKELLFMGRDYPLGYDYFRARLHRAFLSKAH
                     LSDDKEIEEGIKRAEFVKKEIEALYYLKRYRALKQRYETQ"
     gene            complement(<677657..>678883)
                     /locus_tag="TRUGW13939_02691"
                     /db_xref="GeneID:55990198"
     mRNA            complement(<677657..>678883)
                     /locus_tag="TRUGW13939_02691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485880.1"
                     /db_xref="GeneID:55990198"
     CDS             complement(677657..678883)
                     /locus_tag="TRUGW13939_02691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341773.1"
                     /db_xref="GeneID:55990198"
                     /translation="MNFPPPPMASSYVHPNMTPLGPYTSDPRFAAATASMASRTTSSF
                     SSAGAAASSSSLSPPPDYVAQPFTRVNNRTYFRDPDNPYPLPCDLAEIHRQSLRTMTM
                     LEVFGAPSCAPRLQGKRPKRVLELACGSGLWSSACHNHFASYGEKDTSFIGLDITSVA
                     PDLRKMGVNWQFVRHDLRKSSLPFPSEHFDFVFIKDASLCQSATAQQVDLLSEPLRVL
                     NRGGILEVWDSDYVFRALLPNPTPPPQLAEKDHDRAHSTATYTVSSATPFAAAQNKYL
                     IDYNSWVEKAFEKRKLTAMPCATIGLSFTAEADAFTNMGGRRIAIPLGGDVRWENTTK
                     QMKLTPDQLALRQTALVTIIQMIEGMEPILREASGKTQNEWDKWWASMTADLLQKNGL
                     ANGECLEVGAWWGQKK"
     gene            <682484..>684803
                     /locus_tag="TRUGW13939_02692"
                     /db_xref="GeneID:55990199"
     mRNA            join(<682484..683552,683605..>684803)
                     /locus_tag="TRUGW13939_02692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485881.1"
                     /db_xref="GeneID:55990199"
     CDS             join(682484..683552,683605..684803)
                     /locus_tag="TRUGW13939_02692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341774.1"
                     /db_xref="GeneID:55990199"
                     /translation="MADGLYRSQQPGAGQFLFQTPSFQNTHLQQAFLRNHSSSPSRVK
                     HNNNNNPLPPSRSPPPALGAAALSYNNMYTQGHQGQHAAMMNGSQAHRGFAMQMPKFQ
                     HQTHHPHHPQPHHAHHNQASHQLTHQPSYTAGALASTTPHFTPSHMQNGTPAHVEDDI
                     DESMNEHWQQQLQLAAEARQATSPHYYARTIAQQTKGIQLAPSQTDGTDNAGDNRPSA
                     AVSKDSKRQGWTSLDFTSQGLRAISTALFNYRFLSKLYLSNNKLKSLPSSIGQLRSLT
                     HLDLSGNDLTELPAEIGMLTNLRTLYAFDNHIQILPFEMGYLYRLEMLGIYGNPLNEA
                     LSSQIKTHGTKALIKYLLEEMTVHLPPSDRDWIVLDETSKSAHSPTDRITVLSYNILC
                     DQSASPSHYGYVPSRALTWEFRRDMILSEIRGHDADIACLQEIDGGNYNDFFREQLAY
                     NDYKGVFWPRGRAMGMHEEEAKTIDGCATFFKTSKYILLDKQVINFGQTAVRRPDAKG
                     QDDIYNRLWQKDHIAVVVFLENRMTGTRLIVANCHLYWDPAFKDVKLIQTAIMMEEIT
                     KLADEYAKFPACTDKTAFRFSEAESGGAQDSTTPVEPAPSMEYSSGDQIPVLICGDFN
                     SAPGEAAYNLLSHGKLIESHPDLQQRLYGNLSRVGMTHPFKLKSAYNAIGELSFTNYT
                     PDFTSILDYIWFSSTTLHVTGLLGEVDREYLKRVPGFPNYHFPSDHLAMLAEFSVKGK
                     KGKVVEADFGPQRDK"
     gene            <685646..>686769
                     /locus_tag="TRUGW13939_02693"
                     /db_xref="GeneID:55990200"
     mRNA            join(<685646..685714,685796..685850,685901..685970,
                     686028..>686769)
                     /locus_tag="TRUGW13939_02693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485882.1"
                     /db_xref="GeneID:55990200"
     CDS             join(685646..685714,685796..685850,685901..685970,
                     686028..686769)
                     /locus_tag="TRUGW13939_02693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341775.1"
                     /db_xref="GeneID:55990200"
                     /translation="MATDQEGSLVLPDGTKLYTKTWKPEGTPKAIIAFYHGFSDHSNS
                     WYQFFPNLASSGFEVHSLDQRGWGQSSASNRKLRGDYGTTDVVMADLHFFLQSLVPFT
                     QQGSIPLFLMGHSMGGMNSLYYALNPESPYHRNAATTREFKLAGVVSIAPLVAIHPTT
                     QPLKIIEYAGKLAAKLVPKWTMVQDIDPMWVSRDDAVVEAIRKDGLLCHKTGTFEALA
                     GMLERGAWLDGLHKDANVINTAADGVPPLLVAHGTSDRITWFDATKRLVEAVQVKDKT
                     FNEYDGGYHKLTNDSNGVAEQFTADVVEWLNGKIA"
     gene            complement(<686840..>688448)
                     /locus_tag="TRUGW13939_02694"
                     /db_xref="GeneID:55990201"
     mRNA            complement(join(<686840..687850,687968..688038,
                     688108..688254,688325..>688448))
                     /locus_tag="TRUGW13939_02694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485883.1"
                     /db_xref="GeneID:55990201"
     CDS             complement(join(686840..687850,687968..688038,
                     688108..688254,688325..688448))
                     /locus_tag="TRUGW13939_02694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341776.1"
                     /db_xref="GeneID:55990201"
                     /translation="MARFLQSLRSVLGLRLPPPASSSPPRPSFTRSGDCDYSIFREGD
                     RAIIHAKVPYLTKPLKHGERTEVSRGVIHHDDIIGSRVWDPIKAHKGSLFRLSLPTLE
                     EYVVYTPRLVTPIYGADANLIVSLLDIHVLPPPSLPPASDGATPLEILEAGTGHGSLT
                     LHLARAIHAANTQPPPIPKNSQVRILANRPVRPYADAAETTSATAAARQEEQAENTEQ
                     KQWDEWRAQRSAVIHTVDVSSKFSTHAEKTVRGFRRGLYAGNVDFHVGPVEEWIADQT
                     RQRSSNNNKKAFLSYAILDMPSAHQRIPHVAPVLKRDGVLVVFMPSITQIGECVQLIA
                     REKLPFVMDKVVELGTGLSSGRMWDVRVAVKKSRADPSSWVESSRSEAADSSVSEEDG
                     SSGSSTSSTSSEGPPEGPSEPAAEDNNVLVCRPKVGLKIVGGGFIGIWRRIEDRPQLV
                     "
     gene            <689550..>692721
                     /locus_tag="TRUGW13939_02695"
                     /db_xref="GeneID:55990202"
     mRNA            join(<689550..689651,689704..689780,689833..690138,
                     690189..690337,690397..690545,690900..690956,
                     691018..692399,692469..>692721)
                     /locus_tag="TRUGW13939_02695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485884.1"
                     /db_xref="GeneID:55990202"
     CDS             join(689550..689651,689704..689780,689833..690138,
                     690189..690337,690397..690545,690900..690956,
                     691018..692399,692469..692721)
                     /locus_tag="TRUGW13939_02695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341777.1"
                     /db_xref="GeneID:55990202"
                     /translation="MGSIALPYIQSNPKIIFFTDFDGTITLEDSNDYLTDELGFGYAK
                     RREGNREVLSGRATFRDVFREMLESVKPGFAECIEILKSKMKLDPYFLEFYNWAKENN
                     VPIVVVSSGMIPIIQALFEAFLGHTPDPRHLTIVANDVESRDGKDINSPGGWQIKYHD
                     NSHFGHDKSLEIKPYAALPADKRPTLLYAGDGMSDLSAARETDLLFAKKGQDLVTYCE
                     ENGVPFTVFEDWSTIFATTKAIYQGATSAKKVAAQAVEHLQPQAADSRFATDGRLPKM
                     TRRIIRTGVQLTVFGFVVFLLILFIDKRFRVLPNSIHGHLPTHHPGLVVTDVTITTCS
                     AVNVFSSCRLDPSVWYRVDKDLYLGNTWSSSAYVHYQRKREEDLLDTDKVVVDLRISR
                     VDPNSVKDKSSSLPGEWESRPGGIWLKRSSEPHVSDSKNALTSLDILFGADAVDPRPK
                     WEVKDTPILLNSRTENTEARITVRRGVPPTIKKPVPRINESDRFKIMQAADLHLSTGT
                     GICRDPVPEERVPGEKCEADPRTMEFVEKLLDDEKPDLVVFSGDEVNGETSKDAQSAV
                     FKFVKPLVERKIPYAVIFGNHDDEGNLNREQLMDLLKDLPYSLSSAGPEDIDGVGNYV
                     IEVLGRSTTHHSALTLYLLDTHSYSPDERQFRGYNWIKPSQIKWFKNTSQGLKKKHDQ
                     YTHMHMNMAFIHIPLPEYRGNDIRPWKGDWREAPTAPAFNSGFMDALVEENVLFVSCG
                     HDHVNDYCMLNRDDKEKPNLWMCYGGASGFGGYGGYDGFVRRMRFYEFDMGPGRIVTY
                     KRLEYGDTESRLDEMMIVDAGQVRDM"
     gene            complement(<692898..>694335)
                     /locus_tag="TRUGW13939_02696"
                     /db_xref="GeneID:55990203"
     mRNA            complement(join(<692898..693480,693564..693982,
                     694045..>694335))
                     /locus_tag="TRUGW13939_02696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485885.1"
                     /db_xref="GeneID:55990203"
     CDS             complement(join(692898..693480,693564..693982,
                     694045..694335))
                     /locus_tag="TRUGW13939_02696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341778.1"
                     /db_xref="GeneID:55990203"
                     /translation="MNKSMQARHIFHNHPLHYNTLLSLARPQPPPHPPLWRRPVASMP
                     PRKDSIPHETRTVAEPRQNKLYPVRLAHIEQINPTIRLLRLALPAESLSDDETDDLPQ
                     EPFSFLPGQWLDVHVPGIQQAGGFTITSTPSDAHPLPTPDANATVIQEGSNNKVPSQH
                     VEISADSNGRYPYVELAVQNSPSNPPAAWLWKPTKEILGREVNVRVGGSFVWPPAATI
                     LPPTQINKVVLVAGGVGINPLISILSHITELASTPCSPQHQQEEKPPHTKPPTIHFLY
                     TTRIPHAEKLLLDGKLSTPQASITREALDEILFLSRLRRIVHRVSSCSKNNNMQIKLD
                     VFLTNIPPRDDSSPSVLAQATQSLNEDGGGGAESKNNIHVHGRRISKQDLDGAVVGAA
                     GGESTVCYVCGPPPMTDEFVGHLGSLIGSDRVLCEKWW"
     gene            <695188..>696275
                     /locus_tag="TRUGW13939_02697"
                     /db_xref="GeneID:55990204"
     mRNA            join(<695188..695423,695492..>696275)
                     /locus_tag="TRUGW13939_02697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485886.1"
                     /db_xref="GeneID:55990204"
     CDS             join(695188..695423,695492..696275)
                     /locus_tag="TRUGW13939_02697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341779.1"
                     /db_xref="GeneID:55990204"
                     /translation="MVFIPRKYRHHRVVLYLMAAECPIVLPVLILTGIAAHNTYTTKL
                     WQDGANNGFNSAPNQVVYALTNGRTYKVPIVWSSLLYNYDLVLGVLSTFILLTKIPVH
                     ILHFFHPPFSAIVHGALCVLYGCAAGFQAGSDTTDSRHPQNGPPWYITKPCSVAYSPG
                     NIGYCQQAKSLFAVTVIATTIYFAQTVLALISCFVSKEEKEAYRQRQQEKQDERDAED
                     RALREYEEILKSPGFGPGMPPVTPGFVAPMPSAYFPGGNNSNNPLQSPYTPRFGGYYA
                     PGKDNNYSPMTMTPATNSATSDLPLRNAASVFDAKPASFSTHISVAEVEQQPYFPPPP
                     KKATK"
     gene            complement(<696587..>700069)
                     /locus_tag="TRUGW13939_02698"
                     /db_xref="GeneID:55990205"
     mRNA            complement(<696587..>700069)
                     /locus_tag="TRUGW13939_02698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485887.1"
                     /db_xref="GeneID:55990205"
     CDS             complement(696587..700069)
                     /locus_tag="TRUGW13939_02698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341780.1"
                     /db_xref="GeneID:55990205"
                     /translation="MAVSPSSAGTPPHMATTTLKVEGMTCGACTSAVESAFSGVDGAG
                     EVSVSLVMGRAVVHHDPTTLSPSQVAALVEDKGFDAEVLSTDMPQSTADGSSLPTTSV
                     TTIAIEGMTCGACTSAVEGGLTNVPGIQSVNVSLLSERAVVEHDASVVPPAQIAEIIE
                     DRGFGATVLDTQLNQPTDGQDTATQSQNMSTTVAIEGMTCGACTSSVTNAFSSVEGVV
                     QFDISLLAERAVVVHDPQMLPADKIASMIEDVGFDARIVSSTPQTGVVSKTSKPLRLT
                     LYGLQDTASAIALEELLSQRAGINSASIDFITSRATILHNPAVIGIRSVAEAIEEAGY
                     NALLTESDDNNAQLESLAKTKEIQEWKRAFFTSLSFAVPVTLITMIFPMCIPFLDFGS
                     TRLFPGLYLGDVIALGLTLPIQFGVGNRFYKSSFKSLKHGAPTMDVLVMLGTSAAFFF
                     SVFTMLVAIFGSGHERPSTVFDTSTMLITFITLGRWLENRAKGQTSKALSRLMSLAPS
                     MATIYEDPIAAEKAAEEWNEKGDREPASQTANTGLRSVPTELLQVGDIILLRPGDKVS
                     ADGVVIRGRSYLDESMITGEAIPINKKKGSTVIAGTVNGAGSLDFKVTRTGSDTQLSQ
                     IIKLVQDAQTSRAPIQRMADIVAGYFVPIIIALGLFTFTGWMILSHILPHPPKIFIAP
                     SNGGKVMVCLKLCISVIVFACPCALGLSTPTAVMVGTGVGAEHGILVKGGAALEAATK
                     INHVVLDKTGTLTEGKMSVAEAKLEPTWTSNDWRRKLWWQIVGLAETNSEHPVARAIV
                     AAAKKETGVESEDPLDGSIGTFDVVVGKGISAMVEPTSAVERTRYRVLLGNAVFLRGS
                     GVTVPESATIEATDEPIVSSKSDESAGFTQIHVAIDGHYTGTISLRDALKATSVAAIA
                     ALKKMGMNISLVTGDTYAAALSVARAVGIPSDAIKAGVSPNEKKEIVESFQADGDRVA
                     MVGDGINDSPALATATIGIALASGTDVAMEAADIVIMRSDDLLAVPAGLSLARTIFNR
                     IKLNLVWACVYNIIGLPFAMGVFLPFGGIALPPMAAGAAMALSSVSVVGSSLLLKFWQ
                     RPKWMNAARLEKEVEMGLVQSNGKGLWKENLVSGSAGAVSLARAVLAKTVFGKRSVQA
                     REEEGYVPLQTVEH"
     gene            complement(<700853..>702214)
                     /locus_tag="TRUGW13939_02699"
                     /db_xref="GeneID:55990206"
     mRNA            complement(join(<700853..701844,701915..702048,
                     702108..>702214))
                     /locus_tag="TRUGW13939_02699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485888.1"
                     /db_xref="GeneID:55990206"
     CDS             complement(join(700853..701844,701915..702048,
                     702108..702214))
                     /locus_tag="TRUGW13939_02699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341781.1"
                     /db_xref="GeneID:55990206"
                     /translation="MISTLYRIITAFGPPTVEKDNGSALKFGILGAAQIAPMTLITPA
                     KSHPEVIVQAVAARDRSRAEAFAKKHGVPEVKDSYQDILDDPNIDAVLIPLANSFHLE
                     WSIRAIRAGKHVLLEKPSVNTAAEAEILFNMPELSQPNAPIILEAFHNRFHPAVQLFL
                     SFISPRDVEHVYTDCMVPWWMVDNNNIGYQYELGGGSMMHLGTYTFAILRMIFNDEPE
                     ECLTCKVGTLEDGVHDKCDADSTTTFRFPNGGMAEAKSTFRGPILWKPSEARVTHREV
                     FVEDKSLPATQEKVRVRKVTIHGFLNAFIWHRIDVEDSYIVRNKENPQQILKKWVESK
                     SHKAYSYKEAGGKWANLPGEDWWMSYRWQLEEFVNRIKGRQAAFWISGQDSINQMKMV
                     DMAYEKSGLGLRKTGSFR"
     gene            <702620..>703853
                     /locus_tag="TRUGW13939_02700"
                     /db_xref="GeneID:55990207"
     mRNA            join(<702620..702664,702764..702854,702922..>703853)
                     /locus_tag="TRUGW13939_02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485889.1"
                     /db_xref="GeneID:55990207"
     CDS             join(702620..702664,702764..702854,702922..703853)
                     /locus_tag="TRUGW13939_02700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341782.1"
                     /db_xref="GeneID:55990207"
                     /translation="MALAPVAKRSSVTQNVTPTNNDTWGQIKDPVERKKKQNRLRQRA
                     WRERRKEAKRPIWTSYDNNNAWKGYGMLVISNHLQDSDKTDFARSSTINSLRNSSGCS
                     GDLQYSWFDTCGIIAPTVEHAKTSIPLSSTTTTTTKRHQVIPPLMPYSTPNTNPYIRK
                     PYPLIFPLSADHRLITLVQYNVIRAVIFNMTLLSIQDYLPEGCMETLGVIPLDDDTPL
                     DMIPPDLQPTPLQKQMPKNSTISNHQTLTNNSLQLPYWIHALPFPTFRDNLIICSASK
                     VCDFKDLAQDLGEGLYKGFDDAERRGLLVWGNPWSGQDWEISDGFVKKWGFLLKGCWD
                     VIEATNRWRELRGEKRLVLEV"
     gene            <705236..>706154
                     /locus_tag="TRUGW13939_02701"
                     /db_xref="GeneID:55990208"
     mRNA            join(<705236..705256,705349..705648,705819..>706154)
                     /locus_tag="TRUGW13939_02701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485890.1"
                     /db_xref="GeneID:55990208"
     CDS             join(705236..705256,705349..705648,705819..706154)
                     /locus_tag="TRUGW13939_02701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341783.1"
                     /db_xref="GeneID:55990208"
                     /translation="MTPTKTQTVYWTSAFGEIPVAEDKLAAKSDVIDYVSSTDIEVHA
                     ESRMIGDAAGLGAFEKILRRLSELDGKVTALRGENTLFNVAIVSLMEKSPLLETKIPL
                     FNVAIKNGSTIIGLYRLQYDVVCHAFKKTYGYRYKEIPQVVPEEVVHVFDMRSNLMHL
                     HYWNRDTSKIRESRRDNLKQRCDEILKIWFSGTSYSREQTEIKLKSMIRDYWRDDKEP
                     "
     gene            complement(<709045..>709371)
                     /locus_tag="TRUGW13939_02702"
                     /db_xref="GeneID:55990209"
     mRNA            complement(<709045..>709371)
                     /locus_tag="TRUGW13939_02702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485891.1"
                     /db_xref="GeneID:55990209"
     CDS             complement(709045..709371)
                     /locus_tag="TRUGW13939_02702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341784.1"
                     /db_xref="GeneID:55990209"
                     /translation="MEGADAVIEGLQKAIGHVRTFHGLTAQTIHLTGDGTAEATTYCA
                     AGHFLGEKSFLAEARYFDKLVKVIEGDSILWKISYRLTTMMGVPRGDVSMFSIDLNEW
                     ANSLQA"
     gene            <712902..>713885
                     /locus_tag="TRUGW13939_02703"
                     /db_xref="GeneID:55990210"
     mRNA            <712902..>713885
                     /locus_tag="TRUGW13939_02703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485892.1"
                     /db_xref="GeneID:55990210"
     CDS             712902..713885
                     /locus_tag="TRUGW13939_02703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341785.1"
                     /db_xref="GeneID:55990210"
                     /translation="MSSRYVAVHTSPKGPGDARPTALQIIEDEQLTGKLIGKVVFITG
                     CSSGLGIQTARALLATGATLYLTARNLEKAHSALGDLAENKNVHLLEMDLNSLSSVRS
                     CAALFLSKSSSLSLLICNAGVMVPPEGRTADGFETQFGTNHLAHFLLVQLFKDTLIAS
                     ATTKMSSRVIMLSSSGHRMSEVQFDDYNFDEGYDAWKAYGQSKTAMIWTANEIERRYG
                     STGLHAYSLNPGMSASGLQKNVTADMMEEWSQVPGLQEAFKSQEQGAATTVWAAVAQA
                     LEGQGGQYTENCQVVGEMAADAGPLDPGYAPWVSDSEKAQKLYELSLKLIS"
     gene            <715046..>715582
                     /locus_tag="TRUGW13939_02704"
                     /db_xref="GeneID:55990211"
     mRNA            join(<715046..715265,715319..715355,715456..>715582)
                     /locus_tag="TRUGW13939_02704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485893.1"
                     /db_xref="GeneID:55990211"
     CDS             join(715046..715265,715319..715355,715456..715582)
                     /locus_tag="TRUGW13939_02704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341786.1"
                     /db_xref="GeneID:55990211"
                     /translation="MTINHVFVWASKANFQFLRSFYRAVLQPIDYVEMICASENTLIG
                     YGSDYPYFWLKQLPDAKAPLPTHIAFDAPNQEAVDHFYQLALQHGGRGNGPPGIREEM
                     SRQPYYAAFISDMDGNNIEIVHVPK"
     gene            complement(<716502..>717940)
                     /locus_tag="TRUGW13939_02705"
                     /db_xref="GeneID:55990212"
     mRNA            complement(join(<716502..717308,717611..>717940))
                     /locus_tag="TRUGW13939_02705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485894.1"
                     /db_xref="GeneID:55990212"
     CDS             complement(join(716502..717308,717611..717940))
                     /locus_tag="TRUGW13939_02705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341787.1"
                     /db_xref="GeneID:55990212"
                     /translation="MPFPSSPITIDEAVAFFLHSYVLRHGEIANAHFTHQQMINSTKS
                     SEAVFWGVGAVGMASLANIRKSKALNLIATRKYISALKLTAASLQDTTLCKSDETVIA
                     VVLLGMFEMADCLRVGTKVPTPIVELSKAAENLRPPGEKYADILVDIVSRLTTLRADI
                     KSRRVTDWLTILDMAVEIDQSFTQWASDVPARWRYTTSFHHSDNNVILGNFPKCMNYT
                     FCGRFDIYPDLWATNVWNYYRATRMITNWMILDLLAHTPTETFNCLPETINTLRQKAE
                     ENKILLAEDICASVAFSFDPVGCQSIVLGQRLPDSTYTPSGCLGGSLLISPIAVAVWI
                     SRSQPYLRMWMLSCLEHIAHDMGIGRAGAVFRLLEENKTNDGDS"
     gene            <718832..>720500
                     /locus_tag="TRUGW13939_02706"
                     /db_xref="GeneID:55990213"
     mRNA            join(<718832..718963,719028..719263,719327..720345,
                     720418..>720500)
                     /locus_tag="TRUGW13939_02706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485895.1"
                     /db_xref="GeneID:55990213"
     CDS             join(718832..718963,719028..719263,719327..720345,
                     720418..720500)
                     /locus_tag="TRUGW13939_02706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341788.1"
                     /db_xref="GeneID:55990213"
                     /translation="MLTHRVVTFALLLWAKNICATGHPNEVASQRSISASNATAFAVT
                     YGYPLTQYAATFDSLLASNGSNTLYHDRTTASASSAAIVRPNVDTLYSKAAIDLSHYD
                     VALTIPSVDDNRFYVFPFYDLWSNNFANLGALNSTLPGKYLLKFVGASERVGFESPPS
                     NSEYLGIINFPTVYGLIFPRVLLRNNSSTELDAVHTIQDQMELEEIPRRTGRIAPKLS
                     AELFGNGSISPLAAKSSAAFDLNEITNLLKVVARFTPHNPPAEKREAQVVQQKLEKAG
                     LDNGHYTPPHGLNFTIIQKEMYAEILSITNFLQNFNNDWIDFLPRYSGNFLNQYGVRS
                     YIAYTGYLQLVQYESLYPEYEPGFVLSKNQSYVLTFPSGKPPVINAGFWSLTVYNTSS
                     YLVQNPLNRYSLGDRSNLTYPDGDLIYGEDISDRNDAFSILLQSADVPPPANWTSNWL
                     PTPAGGGNFTVNLRFYGPTQDLTAGGSYIYPVVAKQSSV"
     gene            complement(<720923..>721635)
                     /locus_tag="TRUGW13939_02707"
                     /db_xref="GeneID:55990214"
     mRNA            complement(join(<720923..721187,721245..721346,
                     721406..>721635))
                     /locus_tag="TRUGW13939_02707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485896.1"
                     /db_xref="GeneID:55990214"
     CDS             complement(join(720923..721187,721245..721346,
                     721406..721635))
                     /locus_tag="TRUGW13939_02707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341789.1"
                     /db_xref="GeneID:55990214"
                     /translation="MTEHTVTITITTTTTVTKSMVTTTTDACKPTDLVKLIGIQMFGQ
                     ARDIVSVLIPTLSLMFALCVGLWLAHRHIVVRPRQEHEYAMALLETQRASVTAPPPGT
                     SIHVPRIPYERWRPNRPNLWKRFCGLFMGHRNITLSYQPTNLFSTRLSEPPAGNNPPN
                     PPNPVHFNLELPILASNGTGRPQVRGEGDGLENLVEGD"
     gene            <724058..>724661
                     /locus_tag="TRUGW13939_02708"
                     /db_xref="GeneID:55990215"
     mRNA            join(<724058..724417,724479..>724661)
                     /locus_tag="TRUGW13939_02708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485897.1"
                     /db_xref="GeneID:55990215"
     CDS             join(724058..724417,724479..724661)
                     /locus_tag="TRUGW13939_02708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341790.1"
                     /db_xref="GeneID:55990215"
                     /translation="MKLFERIEEQLLLYKKSNALTKLLNFEKRFVSSHSLDSQLKWIN
                     RQFQEQLNGIAICEREIYLNEQISALEKQAKGSPLSDEQTQQLKRHEEELRNLDMEWW
                     LHKRTMSRNMVDQPKGPAKEGDAVTLTVDVARLPEFVLEGHWKFIARLFTVDAVFVEG
                     DVRKFQKSSQILIAYAKGHR"
     gene            <725537..>726594
                     /locus_tag="TRUGW13939_02709"
                     /db_xref="GeneID:55990216"
     mRNA            join(<725537..725795,725891..>726594)
                     /locus_tag="TRUGW13939_02709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485898.1"
                     /db_xref="GeneID:55990216"
     CDS             join(725537..725795,725891..726594)
                     /locus_tag="TRUGW13939_02709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341791.1"
                     /db_xref="GeneID:55990216"
                     /translation="MEQAQSRALEALQPFILLTTSSMASSPRYIANIITNATSHPNTF
                     VFAELLETPAIQSLRSLETPGEYRGYLKLLEIFAWGTWQEYQSTPDLPELSNEQALKL
                     RLLTLLTISSTARPLTYQGLMEALSIPNASELESLVTTAIYSSLIKARLSPASNPPTV
                     NVTAVAPLRDVQPQTVSSMISTLTEWEDRCGDVISGIEAEIAKIKDQAVKNRRRERER
                     TQILEKAIANGNGTASRSSRNSKSNARGSKAGFRTGGQASGSNTNKREYSGDDIEEDD
                     GYFDNGSDGGVDTVGSQMDIDEGSGASRGATRQAKRLLGVGRKS"
     gene            complement(<727125..>728316)
                     /locus_tag="TRUGW13939_02710"
                     /db_xref="GeneID:55990217"
     mRNA            complement(join(<727125..727361,727412..728114,
                     728162..>728316))
                     /locus_tag="TRUGW13939_02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485899.1"
                     /db_xref="GeneID:55990217"
     CDS             complement(join(727125..727361,727412..728114,
                     728162..728316))
                     /locus_tag="TRUGW13939_02710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341792.1"
                     /db_xref="GeneID:55990217"
                     /translation="MASTLSLEIEKRRRLPTLFEVLSRYTLAPVDLFSFYIYMRDQQR
                     SVDYLDFWLDVSQHMSLCRHYVRELRRSVLVATPEGGSRPSSTILENIPDIPAEGGPS
                     GFRGASTEKDADSRLSAFLRSENPAQPSPTASVYSERFPSEERPPRPSFMDSTPETHQ
                     DSSNSPGHTVARTDIRRSAEKILYTYLIRDSEREIILPEEMVETIIEKVERDSRDDPE
                     VFDQAKDYVFQAMERDAFPGFLQAKALGNLVPLSILSRLAFGLVCFWGAFWASFFVVL
                     TDKPRSTRCWVILPFIVASYFITTYQYKIDPVMAMLGFSEYTFMNWQRIQEPYVRTLL
                     NKRAMVTLAYALLIAAALSILFILVPGTVL"
     gene            complement(<729013..>730579)
                     /locus_tag="TRUGW13939_02711"
                     /db_xref="GeneID:55990218"
     mRNA            complement(join(<729013..729033,729092..729799,
                     729852..729966,730027..730235,730288..730338,
                     730392..730489,730561..>730579))
                     /locus_tag="TRUGW13939_02711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485900.1"
                     /db_xref="GeneID:55990218"
     CDS             complement(join(729013..729033,729092..729799,
                     729852..729966,730027..730235,730288..730338,
                     730392..730489,730561..730579))
                     /locus_tag="TRUGW13939_02711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341793.1"
                     /db_xref="GeneID:55990218"
                     /translation="MSSASEDMAKRKASEEADTPDSKHRNKKARTESPGNETKDDTAE
                     KLPLKIVPFPEKPAVIEERTGDIEFRVVNNDGDRESFIILTGLKCIFQKQLPKMPKDY
                     IARLVYDRTHLSIAIVKHPLEVVGGITYRPFKGRKFAEIVFCAISSDQQVKGYGAHLM
                     SHLKDYVKATSDVMHFLTYADNYAIGYFKKQGFTKEISLDRAIWMGYIKDYEGGTIMQ
                     CTMLPKIRYLESGRMILKQKEAVHAKIRAFSKSHIVHPPLKEWKNGVTKIDPLTIPAI
                     KESGWSPDMDELARQPRHGPNFNQLLHLLNDMQNHSAAWPFVQPVNRDEVPDYYEVIK
                     EPMDLSTMEEKHDKDLYPTPQDFVRDAMLIFDNCRKYNNETTPYAKSANKLERYMWQQ
                     IKGIPEWSHLAENH"
     gene            <730904..>731310
                     /locus_tag="TRUGW13939_02712"
                     /db_xref="GeneID:55990219"
     mRNA            join(<730904..731003,731063..731092,731153..731207,
                     731265..>731310)
                     /locus_tag="TRUGW13939_02712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485901.1"
                     /db_xref="GeneID:55990219"
     CDS             join(730904..731003,731063..731092,731153..731207,
                     731265..731310)
                     /locus_tag="TRUGW13939_02712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341794.1"
                     /db_xref="GeneID:55990219"
                     /translation="MSLNELWEASSAPYHPIVSKESQFAVGFTLLLTTLILTGLFGLN
                     RSFVNITLLGLPASLAFGFGAVFMICAVGVYV"
     gene            <731480..>732616
                     /locus_tag="TRUGW13939_02713"
                     /db_xref="GeneID:55990220"
     mRNA            <731480..>732616
                     /locus_tag="TRUGW13939_02713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485902.1"
                     /db_xref="GeneID:55990220"
     CDS             731480..732616
                     /locus_tag="TRUGW13939_02713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341795.1"
                     /db_xref="GeneID:55990220"
                     /translation="MEPIFSAVSNNANHLYTLLRCIGFASKASVQLTPDGIRFSVEEN
                     RVMQGLAFLDKALFTTYTFNPPTTGQDANDMDDEEQDNTIHPQFLVSLSALLETLQIF
                     GIGDTNLPSSSFSNPAPQSSAAGAFANPALLLGRSCTLRYQNIGSPLSITLSESGITT
                     TCELTTYESDDPSFGTAAGELDIPLQRDAIIMKIIMRSAWLHNAITELDGTNPTVLSI
                     SASSKKEPFFALSGSGGPFSESTVEFSIDKNHHDNDLNHKPLTRDGEAPSRRTKFAPT
                     VTETFQVTPPSSMGSRVKENYRFALIRKAARAMAAATKVSIRGDIQGVLGMQFMIELG
                     DNGNASGGNLPNEGVSRNVSFVDFRFVPLIDEDDGEEEDEMISF"
     gene            complement(<733000..>737190)
                     /locus_tag="TRUGW13939_02714"
                     /db_xref="GeneID:55990221"
     mRNA            complement(join(<733000..733008,733060..736746,
                     736797..736898,736958..737021,737098..737125,
                     737184..>737190))
                     /locus_tag="TRUGW13939_02714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485903.1"
                     /db_xref="GeneID:55990221"
     CDS             complement(join(733000..733008,733060..736746,
                     736797..736898,736958..737021,737098..737125,
                     737184..737190))
                     /locus_tag="TRUGW13939_02714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341796.1"
                     /db_xref="GeneID:55990221"
                     /translation="MLAKIDKLSILGVRSFDNTRSETIQFHTPLTLIKINRLKTIIEC
                     LKYATTGDLPPNSKGGAFIHDPKLCGEKEVLAQVKLAFKATSGAKMVATRSLQLTVKK
                     TTRQQKTLEGQLLMVKDGERTAISSRVAELDQIMPQYLGVSKAILDSVIFCHQDESLW
                     PMSEPSVLKKKFDEIFEAMKYTKAIDNIKVLRKKQNEELAKFKIMEQHSKEDKDKADR
                     AEKRSIKLQEEIEALREETHNLSQEMRNAAELADKAWKESESYAQVLGALEGKRIEAR
                     SVQTSIDNLKRHLVELDESDEWLQSTLEQFEARQIQYQEQEETLKEKYMEIKGRIENT
                     RHQLGLKQAEHGKHENDKAQFERQVERRENMVREISRRNNIRGFDDTLDEAQIDEFMH
                     KMRKMIKEHNQALERTRKEGQLEIRETQNALNQISQRKSTLQEVKNLARKQISDNDKE
                     VASVQSRLNEIDVDEGKIAVFESKKEGVQSRLDGFKEALRNSTWDKDIQDSNNDLKSL
                     EDKSAQLNAELIAGTKRAGDLARLDHLKKELKDRERQQETMSGAHGERLSKLVTQNWS
                     PETLENEYHRVMEDETKSVTIAERDRDGVGRQLDQVDFKLKNTRADLQKRQKERDECV
                     KKIREAIDDDPTEYPDVLQTRQNLLDQTRKDAEQFAGMHEYFNMCLDALDKKKMCRTC
                     MRPFKNDTEMRSFRSRVEGLIKKNFSSSDEDLKQAETEYEAARIVSTDYDTWVRLTEN
                     AIPELEKEEEQFQSQKEEYLIKIEDHDKTVDNLAEKKREVESLSKTVTSIVRVAGEIK
                     SLQSQLAELTSKQQGPESSRTLEDIQTEIAGLGEKTRAIKMTVTKLSNEKEQCRNDLN
                     KSELELRDVKSSLDNASYQLEKKSGLLARIEEYKTSNVKQRGSIENADRDIEQLLPEM
                     SKAQAKYDDISQRVEAKERELQQDLTKLSDSLRQLDLANDEIKSYQDRGGPGQLARSK
                     QDLGGIHQTIESLEAEQSEITREINKISTQLTDSENTKRQYSDNLAYRQACQTLEEVQ
                     EDVRQLEEQNAEVDRGRFKEESERWTRKHNALAAQQASKMGEMKSKDDQLMQLLADWN
                     TDYKDAAVKYKEAHIRVETTKAAVDDLGRYGGALDKAIMKYHGLKMEEINRIIEELWQ
                     RTYRGTDVDTILIRSDNENAKGNRSYNYRVCMVKQGAEMDMRGRCSAGQKVLASIIIR
                     LALAECFGVNCGLIALDEPTTNLDRDNIRSLAESLHDIIRTRQQQSNFQLIVITHDEE
                     FLRHMQCGDFSDYYYRVSRNERQKSIIERQSIAEVM"
     gene            <737713..>739015
                     /locus_tag="TRUGW13939_02715"
                     /db_xref="GeneID:55990222"
     mRNA            join(<737713..738898,738954..>739015)
                     /locus_tag="TRUGW13939_02715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485904.1"
                     /db_xref="GeneID:55990222"
     CDS             join(737713..738898,738954..739015)
                     /locus_tag="TRUGW13939_02715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341797.1"
                     /db_xref="GeneID:55990222"
                     /translation="MALPGSDMASVFDLDLADLDLVLDDGDDQGQDSIDSADGRRMSI
                     DDDGMDIQEPQLDNMGSQKSATSAATDFTRRRNWTQRILAEMKDMLVVLSSDGKVLYT
                     SPASASITNYEPKQLGGKFLSEFMHDDDRSLFIREFNECIATGHRLRYHFRFRRPNSE
                     YVILEASGHAHMADEKTTLGTGQEGNACHGFFLVCRPYPTKTTALLDSFLEHKVENIR
                     LIRRIGDLKNEEEEELRAQQQWIRQSDNSETISPDDENQGFDSGPTTSAEQGMMLPPA
                     RPSASNSGQEGYSFMAPLDGNIDTSSRSDTSVVDGIEMLTGLRYAEGERSRGLSTGAR
                     DGGLIQGPPEINHMSASSDDNDKKKKIKTSEEYVCTDCGTLASPEWRKGPSGPKTLCN
                     ACGLRWAKKERKRQGSIQSSTQF"
     gene            complement(<739624..>741181)
                     /locus_tag="TRUGW13939_02716"
                     /db_xref="GeneID:55990223"
     mRNA            complement(join(<739624..740117,740174..740804,
                     740878..740926,740980..741025,741172..>741181))
                     /locus_tag="TRUGW13939_02716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485905.1"
                     /db_xref="GeneID:55990223"
     CDS             complement(join(739624..740117,740174..740804,
                     740878..740926,740980..741025,741172..741181))
                     /locus_tag="TRUGW13939_02716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341798.1"
                     /db_xref="GeneID:55990223"
                     /translation="MSLDEGLLETVAQDGLMEYDRWPAQLEPLLERLDQIVRNEFPMP
                     KVPQQLASSFVSHPSSFQSSYPIHDSLQSSNKENAPPADQPLYSETQETLEQSALNTD
                     GPHQTLHGDTDADCLPPTLLSLLASIKSTLRTYFVSNPPHTIQRLAELILRPTRQYRT
                     LPAYLRAVDRVVSVSSSADIFPLPHTGGPGGTELSNGITNGTSSHPVVTDDSLGSDES
                     LGGALLTPIPWLANPDLEVAHADMVAEGAVPLRTDAAVTQGELIRQEQEAGLIANSQP
                     SPHSSNSLTENGDGDDRSSPQPDEVPHARGPSVVGVEDLGLQDGKGVEMTLSSSNPDQ
                     EGNDGADASPNPSSETLEVQPSDNGDADGDIVLDDVSAPKESASAKTETDDGSEAPEI
                     DAKEQNELASNVDATNE"
     gene            741755..741860
                     /locus_tag="TRUGW13939_02717"
                     /db_xref="GeneID:55990224"
     tRNA            741755..741860
                     /locus_tag="TRUGW13939_02717"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:55990224"
     gene            <742233..>744126
                     /locus_tag="TRUGW13939_02718"
                     /db_xref="GeneID:55990225"
     mRNA            join(<742233..742701,742764..742861,742911..743868,
                     743930..>744126)
                     /locus_tag="TRUGW13939_02718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485906.1"
                     /db_xref="GeneID:55990225"
     CDS             join(742233..742701,742764..742861,742911..743868,
                     743930..744126)
                     /locus_tag="TRUGW13939_02718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341799.1"
                     /db_xref="GeneID:55990225"
                     /translation="MMWNSPKVGILGGGQLGRMLTESANRLNIDVRILDAENAPAKQI
                     SAHENHTVGHFNDQQAVQELAKTCDVVTAEIEHVNTQALEAVASQVKIEPSWEAIRII
                     QNKYDQKKHLSKFNIPMADYRELTQNTPEELVQIGEQLGFPLMLKSKTLAYDGRGNYP
                     VKSKEEIPAALEALKERPLYAEKWANFTMELAVIVVKTNDSVLSYPTVETVQEDSVCK
                     LVYAPARNVSDIINKKAQELARNAVAAFKGKGVFGVEMFLLEDDSILLCEIASRVHNS
                     GHYTIEGCGLSQFDTHLRAILDLPIPAQSVELRQPSVMLNIIGGATPDSHLKVAERAL
                     SIPNASIHLYSKGAARPGRKMGHITVTAATMYEAETFIQPLIDTVDEIRAQRSDIKTA
                     AAKSGASKPTPTVGVIMGSDSDLKTLVPGLKLLRDYFGIDPEVEITSAHRTPNYMAEY
                     AEKAASRGIKVIIAAAGGAAHLPGMAAAHTALPVIGVPVKGSALDGVDSLYSIVQMPR
                     GVPVATVGINNSINAALLAARILGSYEPAVQRKVEQYAENAKVENLELKGVKMRELGW
                     EKYFEQM"
     gene            complement(<744647..>746323)
                     /locus_tag="TRUGW13939_02719"
                     /db_xref="GeneID:55990226"
     mRNA            complement(join(<744647..744927,744998..745133,
                     745199..>746323))
                     /locus_tag="TRUGW13939_02719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485907.1"
                     /db_xref="GeneID:55990226"
     CDS             complement(join(744647..744927,744998..745133,
                     745199..746323))
                     /locus_tag="TRUGW13939_02719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341800.1"
                     /db_xref="GeneID:55990226"
                     /translation="MLSNLQPRGRRLTMGITVSCGMAFMLFGYDQGVFGGILSCQSFQ
                     ATFDNPDTTVQGQMTSSYVLGSVFGAIIAMFAGDIFGRRRSIALACFFCLFGGLLQAT
                     SYTMPHMIIGRIVAGLGVGINTTTVPMWQSETCKPEYRGKLISLQLTHLVMGYVLANW
                     INFGFTYISTESISWRFPLAFQCVLAILTVVWIPFMVESPRWLCLRGRPTSEIQDVIV
                     RLLDKEPHDEQVIDMLQTIQNMVAHEAETQGAGLRDIFHNGPQQTFRRILLGAGVNFM
                     QQFGGVNVVAYYLPVVLKRSFGFSDRMALILSAVDSMQWMFWTGMSTFVIERIGRRRL
                     LIFGAAGQSLCFGMAALGLGINTKALNGVAVAFLFLYYFFFGLSFLAIPFMYPSEINS
                     HRTRNLGSAIAMVTNWCGVYAIVSVTPVGIENLGWKFYLIFAIINLVWVPVCWYFYVE
                     TAGLSLEEVDRLFEIKYESGNGMTYREAALKAKEETREDREDRNASLGDKESKHESEF
                     ADGEA"
     gene            <746896..>749246
                     /locus_tag="TRUGW13939_02720"
                     /db_xref="GeneID:55990227"
     mRNA            join(<746896..746942,747009..747761,748196..>749246)
                     /locus_tag="TRUGW13939_02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485908.1"
                     /db_xref="GeneID:55990227"
     CDS             join(746896..746942,747009..747761,748196..749246)
                     /locus_tag="TRUGW13939_02720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341801.1"
                     /db_xref="GeneID:55990227"
                     /translation="MASNLTAIVTGSARGIGRAIALRLAREGYSVCINDIPSASAEIN
                     ALVNEINKTTPSVSSKQPRAIGITADVSSSAQVTDMVTETVSRLGPLTLMIANAGIAP
                     AQPILSVTEEDIDSIFNVNFKGTFNCYSQAARQMIRQGDPETCAGINRYKIVGCASIA
                     GFKGLPTLGIYSASKFAVRGLTHSLAAEMARHKITVNAYAPGIVGTAMWDELDEAIGQ
                     VEGRAKGESLKLYSKDIALGRTGTPEDVAGLVGGFLASKDSDYVTGQTMKCRSHEVRV
                     QVAYCGICGTDIHEYLGGPILAPKPQQTHPHTGASLPIVLGHEMSGTISELGENVKGL
                     SLGQKVVVNPSLGDSQYGTDPCVSCQAGRPNTCSQATFYGLSAPGGGFANEITVHQAN
                     IMPVPENVPLKLAALAEPLAVAWHMVRVSGFVKGQNVLILGAGPIGLALLMILKAKGA
                     GKVIVSEVSSMRMQYAQQLGADKVVNPMGGSADTPDPVMATVRELTGEGVDISYEASG
                     LQATLDTAIAAVMPGGVIFNVAVHEKRLQVNINDLVLTEKKMTGGISYTSEDFQGVLE
                     LLASGTIPAEKLISSVVPLANIIEDGFQELINNKTKHVKILVQANRDLED"
     gene            complement(<749600..>751519)
                     /locus_tag="TRUGW13939_02721"
                     /db_xref="GeneID:55990228"
     mRNA            complement(<749600..>751519)
                     /locus_tag="TRUGW13939_02721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485909.1"
                     /db_xref="GeneID:55990228"
     CDS             complement(749600..751519)
                     /locus_tag="TRUGW13939_02721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341802.1"
                     /db_xref="GeneID:55990228"
                     /translation="MDNHDHCVLISSRRGTYDRKAFRKGSSNSDKESPNHQKVKQQEQ
                     CKAHITMQGSASNIDFSPSETSQNAPINPTIRTASNTSNAPETRSVTAQFEDYLAWQT
                     ERNQRQHKPILLGEPSPLTFALEDSPQKSSPSLHAASEHIRDSSNLEVIRQDIHPPHL
                     DAADIAYLESKGCFTLPPERMLSDLLKAYFTRFHPLYSIVNTQEVENCHREKRLPWIL
                     LHTICFIGATFCDLAVIHRSEFASRLDARRYFYHKATALFNIGYDRDKFILLQATIML
                     SFWGPEMQSYWNSCSWVGFAVTFAISLGIHRPVASSNVPHTHKSLLRRLWWTLVVRDS
                     CCSVLLGRPFQINLSQSDTGMLTADDFTHESPESAFYQTQVSRLSKILRDIMQVRVGP
                     ANHDLTRETVHSQLDEWHLDFRLSLNQWTGDVSPPFACSTGLELLYHYYIILLYIDSP
                     SFSQPGPIQQDLVYFSARTISSNAITLLTKTTVCALPHELFVGFFVAGIVLYRLMEHA
                     EDSVAQMAQASLDNCRVILNEIQEAWGPGHWAMQVFDFLCLNRNENTRSPTNTGDIQQ
                     DRSAPGHRLDLLGRGSEDRGAFGHLDDNDILLGSNWDPMIREDFTEDMENHLFLPNIL
                     PLNADGWSFFQPHMY"
     gene            complement(<752358..>754327)
                     /locus_tag="TRUGW13939_02722"
                     /db_xref="GeneID:55990229"
     mRNA            complement(join(<752358..753604,753664..>754327))
                     /locus_tag="TRUGW13939_02722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485910.1"
                     /db_xref="GeneID:55990229"
     CDS             complement(join(752358..753604,753664..754327))
                     /locus_tag="TRUGW13939_02722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341803.1"
                     /db_xref="GeneID:55990229"
                     /translation="MAATIAEQPIPSHMRPVPGSFNIPVAKFPPVVKPASTTNPGEAA
                     SKLVDTFNHALEKKDFTTISNLFVEGGYWRDHLALTWVFRTASTPPAILDFLQGSSQS
                     RDGFRLRKIALDTSTAVRAPKITPLDPAGEVLGIQFFITVETVIGSGTGLVSLVEQEG
                     TWKIFTLYTRLEELRGHEEALNGRRVPGVQHGGRPGRKNWAERRQAESDFSSSDEPAV
                     VIIGGGQAGLTAAARLKMLGVETLVVDQNERVGDNWRKRYHQLVLHDPIWYDHMPYLE
                     FPAHWPIFTPKDKLAEFFEAYTKLLELNVWTRTELVHTHWDEAAQSWKVILNRKRADG
                     TSEIRTFRPRHIIQATGHSGKKNQPVLKNIENFTGDRICHSSEFPGARKDAQGKKAVI
                     VGSCNSASDIAQDYLEKGYDVTMVQRSSTHVVSSKAITDIAFKGLYEENGPPVGDADI
                     LLHGLPTPVLKARQVGLTKKTREHDQVILDGLKRAGFNVDMGPDDGGLLIKYFQRGGG
                     YYIDVGACQLIVDGKIKIKQGQEIEEVLPRGLRFADGTEIEADEIILATGYQNMRTQT
                     RLMFGDAVADKVSDVWGFNEEGEMRTIWQKSGHPGFWFHGGNLAMCRYFSKPLALQIK
                     GLEEGLYQYGEI"
     gene            <754853..>757288
                     /locus_tag="TRUGW13939_02723"
                     /db_xref="GeneID:55990230"
     mRNA            <754853..>757288
                     /locus_tag="TRUGW13939_02723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485911.1"
                     /db_xref="GeneID:55990230"
     CDS             754853..757288
                     /locus_tag="TRUGW13939_02723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341804.1"
                     /db_xref="GeneID:55990230"
                     /translation="MEKRRQNLSCEECRKSKKACDGYLVNSSLGAKDSNVLVSCSYCL
                     RTKKRCSLNPRWAQVYQPGDRQENGLPQRKRQRFQDNESPNSFFGTTIVPDLDSVTQF
                     FQPPPPSHSSDGIGWDAPFTTSPYDSIAPPSTGSTNLREASYGDQDLDQIQYGGLDCF
                     MDPAMTDCSPISDLSQVFSMHRSSISAPWEDRKRKQWRGSRDSGSLQEYSDMSLSPFD
                     ADHAAMTKTNKTLISQSLLRIYHDVLENNLGCWLAEDTCPYKMRSRRHDELVSIQNPG
                     TTRNSRMEWGGVWSNRMYRRVKQLDLVAQSAKLISLTASENKAASKALDLVIIAFATQ
                     WRQGDRNTWENETEDAMFGDEFERTFQQTIWEQAKKALHDVSDLECYRVVFAELIFGL
                     VLKPGPSHEFDGRATENRDRSVKSSILPRVMDIIVQSGPPVFMERAARKINALKFRYE
                     AREAGFQETMRTFSNSTARDEKAPQQFSSEHRQTVGLLYWLAVMFDTLSASMNKRPVV
                     ISDEECRHDAAQEEASDHTQISILSRRWKLDLYAQDDPEKPLQLYWPCPYEAATRAIS
                     RSAAVKVLLFRHISYLQNALRRSEHGHVIEEIINTTISVYHYWGKTHGVFFRDLTSNY
                     DSIPPRIKSWFLCIAIPWHLGCLMLADLIDFVDDNGLGLGNAERVDTDMAMTMRRTSS
                     IELADLAVATTPPADMTKTQLPDFHFAVNESPLLTEPWTVLLIRAFTKAAIFHLTEAE
                     DKLRKLGWSVLGQEREMLRMSIAHGESCVRALRFLGAKSGIAGAISKVLFQSLDLYKR
                     QEDGFLSSQGLVF"
     gene            <760464..>760784
                     /locus_tag="TRUGW13939_02724"
                     /db_xref="GeneID:55990231"
     mRNA            <760464..>760784
                     /locus_tag="TRUGW13939_02724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485912.1"
                     /db_xref="GeneID:55990231"
     CDS             760464..760784
                     /locus_tag="TRUGW13939_02724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341805.1"
                     /db_xref="GeneID:55990231"
                     /translation="MAGTADTKANSNRRKQKSIISQWQPLRDSAWDKAHGLRFVRRTH
                     REASGIVRYGTGKELQDDEECGCVTCTPSRPSSHSPHRNSVVADARVSGANPVTTSVE
                     YAAD"
     gene            <761291..>763369
                     /locus_tag="TRUGW13939_02725"
                     /db_xref="GeneID:55990232"
     mRNA            <761291..>763369
                     /locus_tag="TRUGW13939_02725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485913.1"
                     /db_xref="GeneID:55990232"
     CDS             761291..763369
                     /locus_tag="TRUGW13939_02725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341806.1"
                     /db_xref="GeneID:55990232"
                     /translation="MTLQIPENGLSLWRGDQPGHASPDPLSKPTQIMRLNLAQDTVDE
                     LVDSLRNDQKARLKLGKHQTLFYGSKSQPFHASLEHHRSELYRMDTSDRENLYFSGVL
                     SHSLEVQKAKEATAGADEALATLELSMNALERGKESKKTQLVNIKSDGKRSHTKAGLL
                     SKTDLEKERFFNNRSLPNSPSLGGIRSPASVPALTPTSSPPSQNKRKVRLDALKVPFM
                     HLLAVKPITIKDLARTTRSSQDDCLELANKYAVPVKSNNPPTYTLKDRSYKELDIWNF
                     PFPHESDRNSAIERAISAFDRQRLSASDKHWQLLNSKEERAKGICKSKLKLQTGPQPP
                     QIKVHASEETAKESGRDETMTGNETDRTNGRLTPTAIAAVSTKTAQPKKKSVPAKSNN
                     STLTGRVTKRTDKKAPAKPDGKFKSAEFVHDSDEDLDMADAPISAPSPTPPKKQPTEA
                     RKPAPKPKIETKPAAIKTPTAARSPVAKSQVTMEPRPRNLKKVPASSNGTSSKALPAS
                     RQTKPTSPTKPSPLASSPPTNASDFDNSTQNSGQTSSSSSSPLMTQVSRQPKARPATT
                     TKLKEAARPNGVVKPLPNALKRKTPAEPTPAGRMNGDDVKRRRPLHSPSGTSSGSASP
                     PLNRDSLRQQLRQKSVEFKKLYSRYRTLHDSLVKQTDPTPSDLTRLRQLHNRVLQMKK
                     DIWAEDRRLQ"
     gene            <764228..>766491
                     /locus_tag="TRUGW13939_02726"
                     /db_xref="GeneID:55990233"
     mRNA            join(<764228..764278,764346..765915,765986..766171,
                     766223..>766491)
                     /locus_tag="TRUGW13939_02726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485914.1"
                     /db_xref="GeneID:55990233"
     CDS             join(764228..764278,764346..765915,765986..766171,
                     766223..766491)
                     /locus_tag="TRUGW13939_02726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341807.1"
                     /db_xref="GeneID:55990233"
                     /translation="MAPQKGSEPGRRNPTVLVTDSRDQQPQRPGRRPAQPATRLITVD
                     NVLQYASDVPSMQQRRPPQQRPQMRPRSRLSASAGLTTGANVPGTTATTTAGRLAAQA
                     RLPPRSTKVTEKLVLLPETDADELAKEEEEDERAGGGRAGRDGAEDDELAAAAVDEEL
                     VQKLAQERNLDPDTLRQRLELAAQQRLHGDFGVDNDLAPLLAEEEALRQRFVSPEKAK
                     SYAERLPKARRAEKLPRVTAYCTAQGFKMGATASFVKEWHGARTKLYDDCLYVAYHLP
                     LLSGRGGYRIRSSPVLKDVGGKIVLDEEIERNERRDYHEEYDVEEHEHSVGGRGDNPR
                     GDEAGGHHEDEQQQRHADSSSESDQPSPGGEQDESSDPAHHKVQPVVRRISPNVFNYA
                     EMFVFSYGVVVFWNCTERQEKDILADLTFSSSVTTAGPSISLATLPLPEEDFETEEFH
                     FEYSTQISRPRVYNDMITLRSGDHMIKLAISHGIAQSTKLCFFEEAMSKEMTEAKDIP
                     RRLAMTGKLGMKRDEVFRILGRLFKSRVEVNLSSNMLDVPTFFWESEPTLYPLYIAVR
                     EYLEIKPRIQVLNERCRVFLDLTEILSDSIADNNESHQTWIIIILIVISIIVTTGEVI
                     LRFGLLSGNHTAANPTGPSFATALIMNLMGRSGPAASSSQTGSLTGVGVGSGAECVCP
                     AVSTGNLTW"
     gene            complement(<767107..>768530)
                     /locus_tag="TRUGW13939_02727"
                     /db_xref="GeneID:55990234"
     mRNA            complement(join(<767107..767880,767931..768070,
                     768131..>768530))
                     /locus_tag="TRUGW13939_02727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485915.1"
                     /db_xref="GeneID:55990234"
     CDS             complement(join(767107..767880,767931..768070,
                     768131..768530))
                     /locus_tag="TRUGW13939_02727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341808.1"
                     /db_xref="GeneID:55990234"
                     /translation="MEITTILNRKASAFAADPHLQAQLAQAVQFHAQEMSEHPSQPGD
                     HAVLGYPPGTQPIHQMSHVPPQGMHHPGNGVPLMPNPYMHGGFPGNPQQMAPAPQPVQ
                     PTRSGTEPAPRIFHCSTCQKGFARRSDLARHERIHTGVRPHACEWPGCGKQFIQRSAL
                     TVHSRVHTGEKPHMCERCGKPFSDSSSLARHRRIHSGKRPYKCPYANCQKTFTRRTTL
                     TRHQNHHTGTIEEAAAQTEASLRQNKERGGRPGDGMYSETGSGQSTPSPGQQMSMGLN
                     SELPPLNVLRPSGEYYLTNGSIPPHVRGDFQQGSPRASPTATSPSLSSYSGHPRPSMT
                     SHPTGYGPPQPLEPPANTDHRPGSVTGSPHMSSMGWASPSHGSIPSPGSAQDYNYPEQ
                     NGPVYPNAMPPHMYFPNSTIRRPGSTEPENYEMKPRIGDAWSTAV"
     gene            complement(<771110..>772105)
                     /locus_tag="TRUGW13939_02728"
                     /db_xref="GeneID:55990235"
     mRNA            complement(<771110..>772105)
                     /locus_tag="TRUGW13939_02728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485916.1"
                     /db_xref="GeneID:55990235"
     CDS             complement(771110..772105)
                     /locus_tag="TRUGW13939_02728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341809.1"
                     /db_xref="GeneID:55990235"
                     /translation="MASSSLLRPAAATARTLLRESTRRCHIVQILRHHSSSSSSVSAD
                     ELAHFSGLANSWWDPMGPSRVLHLMNPTRHDFIASCLAESTPAAANSQGLRYLDVGCG
                     GGIFAESLARTLPSSQSTELHPRTKAASITAVDPSASLIKIARDHARMDPTVFELLQR
                     GTFRYENTTVESLSETSTGDSQQQVSTQDKFDVVTLFEVIEHVDPQTSSAFLAHCLRL
                     VRPGGWLIGSTIARTIPSFIVNKMVAEAPWPIGVVPWGTHEWSKFVNADELRGRVEEG
                     LMRALDGRAHRAGGEALEGMRWKVAGVVYVPGWGWKMVAGGEDWGNYFWAVQRGI"
     gene            complement(<772541..>776641)
                     /locus_tag="TRUGW13939_02729"
                     /db_xref="GeneID:55990236"
     mRNA            complement(join(<772541..772860,772915..773017,
                     773077..773253,773299..773685,773744..774006,
                     774056..774905,774962..774976,775025..>776641))
                     /locus_tag="TRUGW13939_02729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485917.1"
                     /db_xref="GeneID:55990236"
     CDS             complement(join(772541..772860,772915..773017,
                     773077..773253,773299..773685,773744..774006,
                     774056..774905,774962..774976,775025..776641))
                     /locus_tag="TRUGW13939_02729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341810.1"
                     /db_xref="GeneID:55990236"
                     /translation="MEPSENAGEPETRRVFDEIGPLNSDPQDHPQSLEDITPGNGNVS
                     SKRKEKTPLSREFASREDIEPSISGALAIREPLSKEGQRTRTTTTHNKSSKSDDKEGK
                     RRSTIATRRKSSKPDDKDRGPRKQGENSNENPNEKSNENLNGNLEETLLEAARSGNIN
                     TVEFLLNAGVSCEFTDRDNRTPLLCAVEENHSEIVDLLLRRNADWNATDKWGRTALHI
                     VSSGQGYKIALRLLNIKGIRKNAKDEQDETPLHLAVRNQHLDTAKLLLNSEAKVNEKD
                     KKGFTPLHLAAARGVPIMVETILSSNGIEVDARAINGRTPLMLACGRAASKECEAVVK
                     LLLHAGTDSTLKDKDGRTALLESIKYDKVEIMRLVLENLERKDGQERKELVQQALFEA
                     AVQDSRRIARVLIKKGAIIGEKDPTSQNTAMDIANDHSSQKVVAVLLENGGQLVGQGP
                     SMGDWLQNPQSKVETTESMLKDSAVDLTFGFQSTIASFPYDDGWGKYRIKRPQLRSVL
                     YDHSPGPIQYDLKGGKSNSKDFRWLHVPANNIVWVNELINRMYKERHPEKASYIQEKC
                     KYLFGEEIWTRHQYQMSSTSVAHRRFIRPTCQPVKLDYDDYDDYDMMMVLPYIHWETK
                     GGREQMTDVMVKAMKRRLNDSQAPSTLKELKEALVELEKARKSKAIDPDYGTSSVSSS
                     DDSSHDSYTSTISSAAEETDYETDPDTDSISGTVSENESIHARRAPVKKNVEQEKGIK
                     KRISKIVKVAKEPRTQDEKLILAYMFDDIPLHFRRTLDQYKYYALPTTEYRDDDQVVS
                     RYFKKTWPENDNENLVLMVDQLWLWILDKDTVVTSFPQRWNKSGKKTGKDPDPNNDSD
                     IVESIIRQIGKKDRRPLRHVFDLAELIVGKCVDTMFQHSDIANEKLRFAEFFEVSIGN
                     VTNEETKMFNDFKDLSKRLATDDRNILNSDGLKEDLKKLFDISKETELVKEIKDIRDE
                     LHIISTVLDDQEKVLVDMQEAIQYMKTNKSKDGWSEGGESKELRAYDLLKRVRSHKAV
                     VQGFDKQAEKTYAALKDLLDLKQKQGNSALSFVYYTHILSANVSEARTQGKQAADTAR
                     QGQTIMLFTIITVFFLPLSFMTSFFDLDIAEFVRNSEGELGLGYISKIMFAVTIGVVA
                     ISLFFAFGWELFLTYWKKFLLGTRAIAVEKLYSRRRSTSPVWEYERRSPPKGKKWSRW
                     PWSERRTSMSSSYHSYYSYDGSASSRVIINDESSDTWSS"
     gene            complement(<777683..>781102)
                     /locus_tag="TRUGW13939_02730"
                     /db_xref="GeneID:55990237"
     mRNA            complement(join(<777683..778989,779040..780032,
                     780081..780828,780887..>781102))
                     /locus_tag="TRUGW13939_02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485918.1"
                     /db_xref="GeneID:55990237"
     CDS             complement(join(777683..778989,779040..780032,
                     780081..780828,780887..781102))
                     /locus_tag="TRUGW13939_02730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341811.1"
                     /db_xref="GeneID:55990237"
                     /translation="MKKTPTQSFSTHPFLLSTDDLARHLSTNIETGLSNASVSAVQAE
                     YGPNKLSSEGGVKWYSILLKQASNAMILVLVLAMALAYGVSDYIEGGVITAVIVANVV
                     IGFYQEFRAEQKMDALRSLSSPSATVLRGGQTDTVPSAEVVPGDVVLITTGDTVPADL
                     RLVETMNLECDEKILTGEAIPVAKDAGFQTENESIGVGDRLNMAYSSATVTKGRGKGI
                     VVYTGMYTEIGKIASSMQGKDRKKNRSMSVKRGGAFQPVKGGSLRIWDGLGRFLGLTT
                     GTPLQIKLSKLAYALFGCAILLAIIVFGVNKFHVTNEVAIYAISTGIAIIPESLIAVL
                     TITMVVGMTQMRRRRVVVRQLSALEALGGVSNICSDKTGTLTQGQMVARKVWVPGVGI
                     YSVNKSDDANNPTRGVVTHNPAPESKSEAEQIQEKRRQEMDQARSTAGLKFDLPSEKQ
                     HKQEEEDTDVQADGAPLLPEVNPDLEKFLFSSALCNLATIRQNSESGAWQAMGDPTEI
                     ALQVFATRFGYGKKVLEKERGWEQLAEYPFDSSIKRMSVIYKRDGDRPVIYTKGAVER
                     ILDLCTSIGGQHNEKMTDKVKDKVLEQMGFLADQGLRVLAITQRSTPEKWQKGDELAR
                     DEVENDLTLLGLVGLYDPPRLETKDAVKECTTAGIRVHMLTGDHPSTATAIAKDVGII
                     PRDTGILSAEAAASLVKTNAEFDGMTDQQIDEMPTLPLVIARCDPHTKTRMIAALHRR
                     KCFCAMTGDGVNDAPSLKAADVGIAMGMGGSDVAKSASDIVLTDDNFASIVNAIEEGR
                     RMFDNIQKFVLHLLASNVAEVVLLIVGLGFQDTQGISVFPLSPLQILWINMLTSSFPA
                     FGLGREKASSSIMRRPPHDTKKGIFTWQIIVDMIVYGIIMGTLTLMTFVIIVYGVGNG
                     TPDLGIDCNRHDSESCHVVFRARAAVFAELTWLILMSAWEFKHLRNSMFNLDPLRTAH
                     NTARSWFFWDLWENQFLFWAVVIGALSVFPAVYIPGLNTNVFKHKGITWEWGLSFGAV
                     IIFVVGAELWKAIKRRTGWFSEHEASYSETSEKELGLRQGFFSFAKTLTRMSEKSFF"
     gene            complement(<781958..>784152)
                     /locus_tag="TRUGW13939_02731"
                     /db_xref="GeneID:55990238"
     mRNA            complement(join(<781958..783172,783229..>784152))
                     /locus_tag="TRUGW13939_02731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485919.1"
                     /db_xref="GeneID:55990238"
     CDS             complement(join(781958..783172,783229..784152))
                     /locus_tag="TRUGW13939_02731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341812.1"
                     /db_xref="GeneID:55990238"
                     /translation="MPSYFYHIALELFSPPDRDTDYSSTTPQSSSLSYESAREALLPF
                     QRRRDNKTTSRRSREAITLEPLESGSADVHGNTVASRRSADGRDQCPSSPSLPLRFAK
                     DNFSTFENEHIQPDHRLDHISIQSIDMIAPDYGHPKRADEHFARSDEIATGIGTDILG
                     GLHTKGKYVPLDQTLPDSIFGIVHLYRDAKETPSLAVDDYPSYLKGSSAARQPRDHNG
                     GEDRQSFGGSSMSLPDDDCTTLCILAVPSYMSPSDFLGFVGEATRDEVSHFRMIKTAR
                     ANRYMVLMKFRNGKKARDWQRDWNGKVFNSMEPETCHAVFVKSVEIEATRPTPISRIS
                     DVSRQSFSSTSLVTNPARSLGAAATSPGPSSTSLSTRPIAPPTPSLVELPTCPVCLER
                     MDETTGLLTIICQHVFHCTCLEKWKGSGCPVCRYTLDDFALRSQVAMDGTEPECGVCH
                     SELNLWICLICGCIGCGRYDEAHAFAHYKETSHAFAMDLSSQRVWDYVSDSYVHRIIQ
                     SKTDGKLVELPAADNSALDPPDWTDAVPREKLENMSVEYTHLLTSQLESQRAYFEEIV
                     ERAADKASKASAAASAALEVANAATEKLQDLQLRYDTISKDNVPGLEKEKDRAARRAD
                     KFEAMARKLEKEWREEKAMNDNLVQRVELLTQETTKLKADNADLTEQNRDLTFFISGS
                     EKLKDQGDDVVEGTVSIPENSKRKGKGRRK"
     gene            <789305..>789949
                     /locus_tag="TRUGW13939_02732"
                     /db_xref="GeneID:55990239"
     mRNA            <789305..>789949
                     /locus_tag="TRUGW13939_02732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485920.1"
                     /db_xref="GeneID:55990239"
     CDS             789305..789949
                     /locus_tag="TRUGW13939_02732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341813.1"
                     /db_xref="GeneID:55990239"
                     /translation="MYKDATEIFFRNNTFVVPPRTCKFWAHDGDNGWISGQGYMRVDD
                     TGWYPASFLKFLSLFPDSTRHLLRSIQLVMPRRFRYGYLAQGSNGHADWLATIDFIAT
                     AFPVSNLTLTVDFPVTFGLRPEWQLKEGETVEQKDRRMWREYKRILEPLGRLEGLQNL
                     FVYTGWPIGKENFHRRAKQEQFLEKRVMGEAYDSYARGKPVVPSSRELEMFIRT"
     gene            <790827..>793072
                     /locus_tag="TRUGW13939_02733"
                     /db_xref="GeneID:55990240"
     mRNA            join(<790827..790908,790969..791251,791301..791395,
                     791448..791475,791532..791921,791989..792052,
                     792110..792145,792194..792328,792384..792664,
                     792720..792927,792995..>793072)
                     /locus_tag="TRUGW13939_02733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485921.1"
                     /db_xref="GeneID:55990240"
     CDS             join(790827..790908,790969..791251,791301..791395,
                     791448..791475,791532..791921,791989..792052,
                     792110..792145,792194..792328,792384..792664,
                     792720..792927,792995..793072)
                     /locus_tag="TRUGW13939_02733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341814.1"
                     /db_xref="GeneID:55990240"
                     /translation="MSEFPVGEFLFKRIQELGIETIFGVPGDYELALLDLVEPAGLKW
                     TGTPNELVGAYAADGYARQKGAGALVTTFGPGELSALCGIGGANCESVPIVHIVGYPT
                     EAAQKSGNILHHTLGDLKYDHYVKMSSELSCATTVLHDPATAVAEIDRVLNAMIYHSK
                     PVYIGISEDVAYAKVSVSTLDKKLVHSLPVGDLAVETRAISDIIAKLEASNGAVIIVD
                     GGANRSSWAPFVDPLVDALKVPVFVTCLGKGAVDESSPYFGGAYGGIDSWPNVVKMVE
                     SSDCILWLGRLPSDFNTGAFTEHVNPSTVIDFQRFSIEIGETKFDAKISHVLPKLIEA
                     IKGNASLTSRPTRPLVSQPPLPRKPASDLITQDWVWERLSSFLKPGDLLVSETGTAQF
                     GVLGTRLPSGASHWTQAVWGSIGYATGAAVGASIGAKETGKFKRLVLLTGEGSLQMTI
                     QAFSLLNRHGIVPIVFVLNNAGYTVERYFHGWGAIYNDVPDWDYGKIFSGMAPNSGAR
                     GYKITKRHDMDALLDDPEVQNATYPQVIDFALAKDDAPTPLKLVFKGKKQG"
     gene            complement(<794165..>794959)
                     /locus_tag="TRUGW13939_02734"
                     /db_xref="GeneID:55990241"
     mRNA            complement(<794165..>794959)
                     /locus_tag="TRUGW13939_02734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485922.1"
                     /db_xref="GeneID:55990241"
     CDS             complement(794165..794959)
                     /locus_tag="TRUGW13939_02734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341815.1"
                     /db_xref="GeneID:55990241"
                     /translation="MHVPNQEGYSPLSWAFQAGDEAMIRLLLENGANPNEPINDIKPY
                     IDLPIADETFGSPQVPLFLAARGGHENIVKFLLKNGADINHFKYVPDTSTDIDNLVCP
                     LSLAATKGYHGIVEVFLDSGTNIFLCHIGLREAMKSGRPSIVSLIMHKGIRSNWLIAD
                     HGESLLFHAASTGYIDVVRILLDKGVNPNSSVMQKPTPLCCAAKRGHLAVALLLLSRN
                     ADPNIASPLFCAIVNDQVAMAKLYCNTAPCWMFSTKVLVFFCRWPQ"
     gene            complement(<795116..>796327)
                     /locus_tag="TRUGW13939_02735"
                     /db_xref="GeneID:55990242"
     mRNA            complement(<795116..>796327)
                     /locus_tag="TRUGW13939_02735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485923.1"
                     /db_xref="GeneID:55990242"
     CDS             complement(795116..796327)
                     /locus_tag="TRUGW13939_02735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341816.1"
                     /db_xref="GeneID:55990242"
                     /translation="MENRFLDYPLYDYAARNWGYHAKRQSLGPPNYCLKLLENDQKAA
                     TCAQVRDITSNTRSAGLHMAAWFGLESEVEALLKRNHQPDVTDLWNKTSLFIAVREGH
                     EAIVRTLLRHGANPQFQDLTGRTPLSLAAELGRGSLINLFLKLGLDPDVADEYGWNPL
                     FYAANCGHMEAVKLLLDAQADVEKKDRYNGMTALSWAAWEGHLPIVRFLLDKGVRPDP
                     TTPQEELLHWAAKYRFTSLIKILLEEGADINKRDSQSGWTPLSHAVMHQHNELAALLV
                     ERGANLEYRDKFSRTPFFHALERINPTHRRKLSSPYGLCRLDPLTWTDENISQLLLKK
                     DPNLLHCRDDFSHSPILLATKNRRDAILQIIENRQKYSEIISTEIEIILRTIHALRYD
                     VSKYKDKFLLL"
     gene            complement(<798100..>798648)
                     /locus_tag="TRUGW13939_02736"
                     /db_xref="GeneID:55990243"
     mRNA            complement(<798100..>798648)
                     /locus_tag="TRUGW13939_02736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485924.1"
                     /db_xref="GeneID:55990243"
     CDS             complement(798100..798648)
                     /locus_tag="TRUGW13939_02736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341817.1"
                     /db_xref="GeneID:55990243"
                     /translation="MLDEVHGNPPQPSTDHNVYHLGSISGHNIVITGITQARNVIAAT
                     VITQMQITFPNIHFGLLVGIRGGVPIIIKEGIIQLEHIMISKPIGLYSNTIQYDHRKA
                     KTNKFIRIGALIPPPPVLLQATQALNVQCVRSDNNPLLKNIQHINTTKKGLHHFQFPG
                     FKRDYLFPAKYTLYPCSTRGVI"
     gene            complement(<800116..>802598)
                     /locus_tag="TRUGW13939_02737"
                     /db_xref="GeneID:55990244"
     mRNA            complement(join(<800116..800216,800270..800468,
                     800523..801374,801432..>802598))
                     /locus_tag="TRUGW13939_02737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485925.1"
                     /db_xref="GeneID:55990244"
     CDS             complement(join(800116..800216,800270..800468,
                     800523..801374,801432..802598))
                     /locus_tag="TRUGW13939_02737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341818.1"
                     /db_xref="GeneID:55990244"
                     /translation="MSNLNIANDGLVDLDYESRNYLQASGWSVSVDQNAQRPDGGREM
                     PPLQTSGHAYDQTMPPDAHLLPEWTSFQQPLPAQLHYSQVETTAPQFSSSFGVPLQTS
                     PVDLLPVSQAPLDTRGLIDGSYLGLSAPVDIMPFTYPDFQELMSFPNNLHDLTPYPGA
                     PHPVAESSSPTDTYLEVRSLTSSSSDNGWATVDHRHQLDTYPEQSIFINPTHTLHDRT
                     LSESSYSDFEPNRASWSGSWVDVQHPINSPGSDSNLESVYLPSADRRISLDHASHGSV
                     SPTAVSPIAITRPIPVPTKKSSSPIIRSPGSQSLSSSSSSATSPPGRKNSRKSPISAK
                     TAETKVRKQSQMGKPETTEKRIGKRKGPLKPDQRKQASEIRKLRACLRCKFLKKTCDK
                     GEPCAGCQPSHARLWQVPCTRIDIKEIGYFMKDWKADYERHITMGFSVGNIKGFSEQE
                     RTLFVTHGYGQIMPITAREVYVRDEECFNMDWVEAVEQDMSQFEVSTMKLSAGIEGIS
                     PALLSDYLDRHIDGNGSFEKFVDDYFEGTPFLTEMLKTAFRYYFRTKLPVIRKALKLI
                     LAYNLTLHVTMVEGIGEDEGFTGKIQGENSRFSGKTMAPVMINFQIKCAMASMWRELQ
                     KDVLEELSALYSSVYSGDKLKNWPTIFILASILLAVWEEMQFDCYYRVPDAAAVDKFC
                     HDMESTPVGVIVGLFQAISQKLPTFADWETGKHHQLLNSNPDVCQTMTEVRHHVTRHD
                     SYLRGRSGSKFNRNDFDCLSNKFLSRLVIRAN"
     gene            <805133..>807115
                     /locus_tag="TRUGW13939_02738"
                     /db_xref="GeneID:55990245"
     mRNA            join(<805133..805623,805743..805898,805974..806048,
                     806121..806260,806321..806441,806501..806770,
                     806833..>807115)
                     /locus_tag="TRUGW13939_02738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485926.1"
                     /db_xref="GeneID:55990245"
     CDS             join(805133..805623,805743..805898,805974..806048,
                     806121..806260,806321..806441,806501..806770,
                     806833..807115)
                     /locus_tag="TRUGW13939_02738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341819.1"
                     /db_xref="GeneID:55990245"
                     /translation="MPVVAASGRGRRKVRFPAGNSSNNRLQNKTTAHNNNNSSRLHPA
                     SGQKHSMAATAAQELRIPSIFRELPQLRDLLTTQTSTVQDETVEKCLPLLRGTDGSLR
                     GNVNELGLAHLLRDYHIDYLYDSLEDYPETFVSLDSSRPWMSYWALASLTLLGEDVSK
                     YRERVISTISPMQNDTGGFGGGHGQMSHLASSFPAVLCLALVAGQAAYKLVDRRAMWL
                     WLGKLKQPDGGFQLVAGGEEDVRQAWRGAYCAIVIISLLDLPLELPPESEARKHGLHT
                     FVSGLPEYLSRCQTYEGGLSGKPSAAEAHGAYAFCVLACLCILGKPDEMITRYMDVPL
                     LLSWLSARQYAPEGGYSGRTNKLVDGCYSHWVGDCWPLVQSALRGATDSAPSVDSNLY
                     SREGLARYILNCCQNKIGGLRDKPGKQPDSYHTCYTLTGLSGLQHQHYYTETTQSQSN
                     TISGGVFSSAFCWKSVPSIDAGSEGRDIFDDGDRLASFHPLYTIPHKNAEALRRWCEE
                     RPI"
     gene            <809963..>810579
                     /locus_tag="TRUGW13939_02739"
                     /db_xref="GeneID:55990246"
     mRNA            join(<809963..809987,810170..>810579)
                     /locus_tag="TRUGW13939_02739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485927.1"
                     /db_xref="GeneID:55990246"
     CDS             join(809963..809987,810170..810579)
                     /locus_tag="TRUGW13939_02739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341820.1"
                     /db_xref="GeneID:55990246"
                     /translation="MYYILYLASLCKRRRWSEPHYDAFRSTSGFTAVVRVNNREYKAD
                     TICENEVMARENAAMRAYLICRNFSVNDGMYPAGHDHGGVMQGVPVAIGTGRRARYGD
                     ESDATSSAGSRSGGSSPESHEGGRLARGRRQGVPTRALAYQY"
     gene            complement(<810204..>810387)
                     /locus_tag="TRUGW13939_02740"
                     /db_xref="GeneID:55990247"
     mRNA            complement(join(<810204..810281,810331..>810387))
                     /locus_tag="TRUGW13939_02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485928.1"
                     /db_xref="GeneID:55990247"
     CDS             complement(join(810204..810281,810331..810387))
                     /locus_tag="TRUGW13939_02740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341821.1"
                     /db_xref="GeneID:55990247"
                     /translation="MVMASRIHSIIDREVAADQIVSALYSRLLTRTTAVNPDVLRNAS
                     "
     gene            <811313..>812915
                     /locus_tag="TRUGW13939_02741"
                     /db_xref="GeneID:55990248"
     mRNA            join(<811313..811661,811712..811792,811843..>812915)
                     /locus_tag="TRUGW13939_02741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485929.1"
                     /db_xref="GeneID:55990248"
     CDS             join(811313..811661,811712..811792,811843..812915)
                     /locus_tag="TRUGW13939_02741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341822.1"
                     /db_xref="GeneID:55990248"
                     /translation="MEVLLRSAGRRSSRTLLSLHHPHRSISLCQAWNHTTHRKCHFSS
                     STIQHHSARPAAIPRGHARLFATKQSQNASENASLDEAVEYVKERQKDSPWQREGSQT
                     PPVRRQRSASAMTKGKLLTTPSRLLKLILPVTTSDYNGDRKDVEPLALLLHPQQPLSY
                     LERLIQAEVPPVKGDDGQLRPPHVSFFAVEIQDEHIKPKGEKHKRVPSEEIDQDEETE
                     EQEEVSAGQKSAAQQSASNLRGGPGEGGVEMYGDLGGAEPETVDKDSFVRWSSSTEIG
                     DFIRDAARVKEFQVDIQGSPLGRISVGVPSFNDRTYYLRMRLRKISKKLRDLAIIKQE
                     CDKLAHRGGQRVALGGLGVMVTWWFVVYELTFETDYGWDTMEPITYLVSLSTLMGGYT
                     WFLYHNREISYRSALDFTINRRQQQLYQAKGIDLQLWESLIEEANSLRRETKTVAEEY
                     DVDWNEKADEQDERVTEALKHQRRQKERNMDRDRKKEEEEEEEKDTHGGD"
     gene            complement(<813285..>813977)
                     /locus_tag="TRUGW13939_02742"
                     /db_xref="GeneID:55990249"
     mRNA            complement(join(<813285..813576,813716..813888,
                     813954..>813977))
                     /locus_tag="TRUGW13939_02742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485930.1"
                     /db_xref="GeneID:55990249"
     CDS             complement(join(813285..813576,813716..813888,
                     813954..813977))
                     /locus_tag="TRUGW13939_02742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341823.1"
                     /db_xref="GeneID:55990249"
                     /translation="MAPAHETSQDDNFAELQEHADLIDSDTFEQILEMDDDEDDREFS
                     QGIVYGFFEQAESTFENMDKALNDKNWDSLSSLGHFLKGSSATLGLIKVRDACEKIQH
                     CKEELPDDQADKDKAIDGIKKTLKEVKSDYEEVAKILKRFFGESPESEKDEKAPESPE
                     SD"
     gene            complement(<818353..>819906)
                     /locus_tag="TRUGW13939_02743"
                     /db_xref="GeneID:55990250"
     mRNA            complement(join(<818353..818514,818583..818870,
                     818927..819567,819635..819713,819787..>819906))
                     /locus_tag="TRUGW13939_02743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485931.1"
                     /db_xref="GeneID:55990250"
     CDS             complement(join(818353..818514,818583..818870,
                     818927..819567,819635..819713,819787..819906))
                     /locus_tag="TRUGW13939_02743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341824.1"
                     /db_xref="GeneID:55990250"
                     /translation="MLSTLRVTSRQAVARESGMRALLTGVRAGSTWANVPQGPPDAIL
                     GITEAFKADSFGEKINLGVGAYRDDKGKPYVLPSVRTAEDKVVASRLDKEYAGITGIP
                     SFTKKAAELAYGANSPALKEDRLAITQSVSGTGALRIGGAFLQRFYPHAKKLYLPTPS
                     WANHNSVFKDSGLEIGTYRYYNKDTIGLDFDGLVADLKAAPENSVILLHACAHNPTGV
                     DPSQEQWRKVSDVVKEKGHFAFFDMAYQGFASGDADKDAFAPRYFVEQGHNIALCQSF
                     AKNMGLYGERVGAFSLVCASAEEKKRVDSQLKILIRALYSNPPIHGARVASTILNDAE
                     LNKQWLGEVKGMADRIIEMRALLKKNLEDLGSKHDWSHITNQIGMFAYTGLKPEQMDV
                     LAKEHSVYATKDGRISVAGITTANVKRLAESIFKVTG"
     gene            complement(<820494..>822488)
                     /locus_tag="TRUGW13939_02744"
                     /db_xref="GeneID:55990251"
     mRNA            complement(<820494..>822488)
                     /locus_tag="TRUGW13939_02744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485932.1"
                     /db_xref="GeneID:55990251"
     CDS             complement(820494..822488)
                     /locus_tag="TRUGW13939_02744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341825.1"
                     /db_xref="GeneID:55990251"
                     /translation="MADALSIEQNNKIRVALGLKPLPVPGADPAAGPVFKESQDSSDD
                     DDEEPGSTLESREAQGFQNWQKLQDEADAKRKREEKNAAIKRARDLARRNAKLEGTGL
                     GDADAGDLDTKAWLSQHKKLSKKIEKDRARKLAEELAERDQVTDYNATDLAGVKVAHE
                     MGDFDGSEEHILTLKDATIDENEAEGDELENLDIVDQDKLKERLDLKKKRTAYDPTEA
                     DGTAPILAQYDEEIDGKKRKHFTLDAKGSTVEERDAKRQHVSEMLKKQALNLDILEDA
                     PVSDYMDISEVKVKKPKKKKAKSTRQKAVDEDDIFPLPDASNGDTTIISGNASQPAPK
                     KIQQNASFVDDDDLQASLAIQRRAAFKKRKKLRPEDLARQLKEEDSQTPMDVDNGDGA
                     DEEEAGLVIDETSEFVSNLQRPVVSERTQRKPTAPAEDEGKDQSPESEDEDVDMEAAH
                     NAAYAEAAAETADGDQKTKISGTGLDEESTLDEGLGSTLSMLRQRGLVEQTEASSLNA
                     LHRDRQKFLQDKYRRESDAEKRARGQRERDRTTGKLDRMSAREREEYARHENKQRDQQ
                     ESRHVADVFNREYKPDVQLKYVDEHGRLMNQKEAFKHLSHQFHGKGSGKMKTEKHLKK
                     IEEEKKREAMGALESSQHTGMNSAMGATAKKNRQAGVRLA"
     gene            complement(<823124..>823791)
                     /locus_tag="TRUGW13939_02745"
                     /db_xref="GeneID:55990252"
     mRNA            complement(join(<823124..823428,823503..>823791))
                     /locus_tag="TRUGW13939_02745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485933.1"
                     /db_xref="GeneID:55990252"
     CDS             complement(join(823124..823428,823503..823791))
                     /locus_tag="TRUGW13939_02745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341826.1"
                     /db_xref="GeneID:55990252"
                     /translation="MASPGLAVDRIPPSTASYIFATAILAGVTGYFIGQGSSLNIFRS
                     PPNVDDESDLEDEEEDDDEEEEDDTAELATFEGNHDEVKLVLVVRTDLGMGKGKIAAQ
                     CSHATLACYKYYLSKSPNSPILKRWERGGQAKVALQVKTEEDMLLLQAQAISLGLCAR
                     VIQDAGRTQIASGSRTVLGVLGPKSMVDQVTGQLKLL"
     gene            complement(<824197..>825079)
                     /locus_tag="TRUGW13939_02746"
                     /db_xref="GeneID:55990253"
     mRNA            complement(join(<824197..824248,824299..824696,
                     824753..>825079))
                     /locus_tag="TRUGW13939_02746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485934.1"
                     /db_xref="GeneID:55990253"
     CDS             complement(join(824197..824248,824299..824696,
                     824753..825079))
                     /locus_tag="TRUGW13939_02746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341827.1"
                     /db_xref="GeneID:55990253"
                     /translation="MRVISLVAALPALAAAQAQIPLGDQVRGWFDKVKSFVPSTPPAP
                     AAVPVENVAQKAAGKIAEKVVTPLNLNNWDSVLEPSAQPQEWLVYVTGGNKTCLGRCG
                     QPDKAWNDSVPLFAADPTSPNLATLDCEKESILCSVWAAGPPTVWHFQLPQVHPGEAR
                     PPVPLHIVNLNHTTVTPETVYEIHGEKTWQKEDAYEGLLHPFDGQLAEYGLNVPLGYV
                     MYGFSVVPSWLMMIGISFLSRTVMGRRMRNPGQIAGRGGN"
     gene            <826316..>828187
                     /locus_tag="TRUGW13939_02747"
                     /db_xref="GeneID:55990254"
     mRNA            join(<826316..826373,826436..826677,826735..826815,
                     826877..826922,826991..827039,827092..827216,
                     827276..827355,827411..827570,827619..>828187)
                     /locus_tag="TRUGW13939_02747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485935.1"
                     /db_xref="GeneID:55990254"
     CDS             join(826316..826373,826436..826677,826735..826815,
                     826877..826922,826991..827039,827092..827216,
                     827276..827355,827411..827570,827619..828187)
                     /locus_tag="TRUGW13939_02747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341828.1"
                     /db_xref="GeneID:55990254"
                     /translation="MCPGADHTPNGHANGANGDNFENHNGYTAIETRQNPHPSPPVTR
                     NPYGHNVGVTDFLSNVSRFQIIESTLREGEQFANAFFDTEKKIEIAKALDDFGVDYIE
                     LTSPCASEQSRMDCEAICKLGLKAKILTHIRCHMDDARIAVETGVDGVDVVIGTSSYL
                     REHSHGKDMTYITNTAIEVINFVKSKGIEIRFSSEDSFRSDLVDLLSIYSAVDQVGVH
                     RVGIADTVGCASPRQVYELVRVLRGVVHCDIETHFHNDTGCAIANAFCALEAGATHID
                     TSVLGIGERNGITPLGGLMARMMVQAPDYVKSKYRLEKLKDLEDLVANAVEVNIPFNN
                     YITGFCAFTHKAGIHAKAILNNPSTYEIINPADFGMTRYVHFASRLTGWNAIKSRAQQ
                     LKMEMTDAQYKECTAKIKALADIRPIAIDDADSIIRAFHNNIKQGTDKPLLDLTEEEK
                     AQLAEKEKELAQEGQAVAA"
     gene            <828963..>830859
                     /locus_tag="TRUGW13939_02748"
                     /db_xref="GeneID:55990255"
     mRNA            join(<828963..829063,829134..829611,829665..829798,
                     829848..>830859)
                     /locus_tag="TRUGW13939_02748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485936.1"
                     /db_xref="GeneID:55990255"
     CDS             join(828963..829063,829134..829611,829665..829798,
                     829848..830859)
                     /locus_tag="TRUGW13939_02748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341829.1"
                     /db_xref="GeneID:55990255"
                     /translation="MASSILSASMQSKLAAAFPRNLGSAASTVLTLDAIKNIVFVLFI
                     LRYTRKTFDSIRGYGIFGSIKNVYSMVRLWGFSLFLRAPGVRGEVDKQVTTALTKLEE
                     KLVQRGDASSRNLVLPKEGWTAEKLRGELQTLAGMKHARWEEGMVSGAVYHGGEDLLK
                     LQTEAIGTFSVSNPLHPDVFPGVRKMEAEIVAMVLSLFHGPSDGAGVTTSGGTESILM
                     ACLAARQKGYTERGITEPEMVVPETIHAAFFKAGGYFGIKVHRVPCPAPDYKVHVPSL
                     RRLINRNTVLIAGSAPNFPHGIVDDIPALSRLAVSYKIPLHVDCCLGSFVVAFLKKAG
                     FPSPYEEEGGFDFRQPGVTSISVDTHKYGFAPKGNSVLLYRNRSYRNHQYFIFPDWVG
                     GVYASPSIAGSRPGALIAGCWASLMSIGEAGYIASCHQIVGAAKKFELAVREDPVLSA
                     NLEVIGNPEVSVVAFASKNVGIDTYDLADGMSAKGWHLNALQDPPAIHVAFTRPTAVA
                     VEKLQTELTEVVNAELEKAEERARQGKSYARQRGDTAALYGVAGSLPDKSIVNRLAEG
                     FLDTLYKS"
     gene            complement(<831209..>831496)
                     /locus_tag="TRUGW13939_02749"
                     /db_xref="GeneID:55990256"
     mRNA            complement(<831209..>831496)
                     /locus_tag="TRUGW13939_02749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485937.1"
                     /db_xref="GeneID:55990256"
     CDS             complement(831209..831496)
                     /locus_tag="TRUGW13939_02749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341830.1"
                     /db_xref="GeneID:55990256"
                     /translation="MTTYFRITLMRSAIGLPARTNMVLHALGLKKRMATVFYPVSLDV
                     AGQIMKVKELVSVQEVDEPLTKAQVHMQRKPDLGYYIEQTSEQQWEGRRFG"
     gene            <832167..>834443
                     /locus_tag="TRUGW13939_02750"
                     /db_xref="GeneID:55990257"
     mRNA            <832167..>834443
                     /locus_tag="TRUGW13939_02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485938.1"
                     /db_xref="GeneID:55990257"
     CDS             832167..834443
                     /locus_tag="TRUGW13939_02750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341831.1"
                     /db_xref="GeneID:55990257"
                     /translation="MDTGEGPDKVAAIPRLAELLRHPEDLDKISVLKLEYQRKKAAID
                     AQLREGLRDQLETVQQSLGILTEGQRQISKTRDELQGIDKMCAESQTTVEDFSQIDRL
                     ARIQRNFEAVVMMKRGLESFGADLAKIEDLLREDDEDLENQPNLLKAHILISQLRDFS
                     DEALDQIRRAKDESSEATLLDYFQGLDSVIDWFDDHVGTACMNLIPLVQSDNNSMVVR
                     LAIVIAKEEKNDEQVSALQEAQRDHEELANRFKSMNIGPKTVRGYKAKFLQAIELYAQ
                     TQFDAAREDFLADPDSLEKSLKWFFNDLFTVQQGMQPLMPKKWKIYRTYTKTYHRMMH
                     DFLISLINDSELPPDNLLAILHWTPKYYKKMSKLGWKSADLTPNILDDRELELVRQWQ
                     SVIVDAVDEWMDRIFEVERVSLVERSPDALEANSEGHFRTKTLGDMWRMLNEQVGAAS
                     ASDRADVIEGIIDSMFRALKGRQTAWQTVVDEECAKYNNVALDQAEGLQPLQDWLVAV
                     ANDQIACIDDNEEAGQFGYLTRFKRDIESLVTPNYMDERATTELDALRDGYVDLSTHC
                     LTQFANLIFTVDFRTTLPEFFTPRWYGEFAIKRVTSTFEDYMADYGSVLHPSLTEILV
                     EELSDELLVRYLSAIRNRGVKFRRQDPFTEKFKDDVLTVFAFFQKFPDSFQTTIKHKW
                     RLVDWLVRLLEADKGAGVVNVYESLRTEYWDLQMSWVEAVLRARDDFERSMINSIKAR
                     AAEMNIERGLETIMSKVK"
     gene            complement(<834639..>835793)
                     /locus_tag="TRUGW13939_02751"
                     /db_xref="GeneID:55990258"
     mRNA            complement(<834639..>835793)
                     /locus_tag="TRUGW13939_02751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485939.1"
                     /db_xref="GeneID:55990258"
     CDS             complement(834639..835793)
                     /locus_tag="TRUGW13939_02751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341832.1"
                     /db_xref="GeneID:55990258"
                     /translation="MLGTSRPPKGKSPQAKEKRPPLTHFLCFPLVTETSLPLLEKSFS
                     HFRDNIPQRRKTMTDHSLKPRPPLFPDSAIRPVGTLHLTLGVMSLTTRDRLDEATSFL
                     DSLDIEQMLRETTSNDADISQQQQQSAEEENSLAPISVSLQSLYALPKAKAATVLYAK
                     PVDPTSRLYPLGVKLRERFVEAGLIQPDFLKTKPRKGSKVIDNNNTSQNDIPAQAETP
                     KPKLRPLLLHATIVNTIYARGGHSAQNRGKDRRRGGPLTFDARDMLTHHHDFYTDDTC
                     VEAKKHDVSDSSFLEDAESDRSSESNDEPSSSMSTQEEAHPSRTVQQITPETTDNEKY
                     PFVWARNFHIEKVCICEMGAKAVVDGDGDPLGARLGQKYRVVAERSLPSF"
     gene            <836243..>836993
                     /locus_tag="TRUGW13939_02752"
                     /db_xref="GeneID:55990259"
     mRNA            join(<836243..836638,836715..>836993)
                     /locus_tag="TRUGW13939_02752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485940.1"
                     /db_xref="GeneID:55990259"
     CDS             join(836243..836638,836715..836993)
                     /locus_tag="TRUGW13939_02752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341833.1"
                     /db_xref="GeneID:55990259"
                     /translation="MLSRTSRALVPSLRRNIAAAPASRAKLQHLVAFQQPAAAQHQQK
                     KTTIPQRQRSFHTTPAIHKGITPESADPQAPNPQPNNAAAAAGASHVIEATPLSDQNY
                     HEVSEIYLDELLAEVERVQEEGSDVEAEYSAGVLNIVVPGVGTFVLNKQPPNHQIWLS
                     SPISGPKRYDWVVQGDQMHEKQDTRGFISGQWIYLRDGSNLTDLLNDELTLDLPEDIY
                     SEKDGE"
     gene            complement(<837404..>837724)
                     /locus_tag="TRUGW13939_02753"
                     /db_xref="GeneID:55990260"
     mRNA            complement(join(<837404..837463,837527..>837724))
                     /locus_tag="TRUGW13939_02753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485941.1"
                     /db_xref="GeneID:55990260"
     CDS             complement(join(837404..837463,837527..837724))
                     /locus_tag="TRUGW13939_02753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341834.1"
                     /db_xref="GeneID:55990260"
                     /translation="MADDEQLSIYDEIEIEDMTYDPNLQIYHYPCPCGDRFEIPIDSL
                     RDGEEIAVCPSCSLMIRVIFEPKDLVKEETKEAPAQVEVKA"
     gene            complement(<837942..>839201)
                     /locus_tag="TRUGW13939_02754"
                     /db_xref="GeneID:55990261"
     mRNA            complement(join(<837942..838218,838286..838827,
                     838898..838996,839058..>839201))
                     /locus_tag="TRUGW13939_02754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485942.1"
                     /db_xref="GeneID:55990261"
     CDS             complement(join(837942..838218,838286..838827,
                     838898..838996,839058..839201))
                     /locus_tag="TRUGW13939_02754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341835.1"
                     /db_xref="GeneID:55990261"
                     /translation="MIPPCDPTILDKNPQFKKLHQHLTTNLLSPNGTTRADEADHARK
                     AVAEELRGLQIRSAKRDILKNATRRVALDSHGGLPKDLQDNHAIIALFLDSTTATAVS
                     DEDATSLLERDIEMFLNNVHVLAAHISENVALDIEALRSIADETTNSMVDNPSNRPRK
                     RTRPSSFNNNNARRNTAQQQPQLSSQLTDRTRQLRELQISTLPAARRQMAVTAAGVLA
                     ARAQVIERTVVLLERTKHGVLSRATKAQADHLATVAEGMNGKAQVMKLEALTTIYTPE
                     TTAALEDYRKHLRDTHARLEETQNIAVQTLEEYERVGAQLGKDGQLVSGPMADIARRY
                     GALTKEVEAVRADMSRLRM"
     gene            complement(<839923..>842336)
                     /locus_tag="TRUGW13939_02755"
                     /db_xref="GeneID:55990262"
     mRNA            complement(join(<839923..842179,842236..>842336))
                     /locus_tag="TRUGW13939_02755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485943.1"
                     /db_xref="GeneID:55990262"
     CDS             complement(join(839923..842179,842236..842336))
                     /locus_tag="TRUGW13939_02755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341836.1"
                     /db_xref="GeneID:55990262"
                     /translation="MATPPPEGAAVLKEGKPLAAPALNDVTPASSLNRSPDSLLNGKV
                     EKAALNAAAVDANKEAAPTLNGQDAAQSPLANGANGKPAVPDSPAPDNNNNGIDSIKV
                     ATTKPDPDAKSPGIAPKEATDSPAAAKSEDVESAADDIKPAPDTTDTNHLEVQTSLPH
                     HPTPVKESPSADHEMIADQEMIDAPLSPAKVSRQREVDSEEEPAAKRTKTNGEDASPK
                     TTQAPPMADQVQPSPPSPARTMSGEITPLRQKFLVKALTNIKRANDSRFYREPVDPVK
                     LNIPSYFTVITQPMDLSKIDDKLKKGQYTAVEQIVADVELMTGNAARFNGPDHIVSLE
                     GSRLKGLFQKQLEKLPRPDEVEEKKPKKLPIPKEHIPRREPRVATQPPPKQNNATSPT
                     FALNPEGLPTIRRDSTNPDGRPKRAIHAPKRDLLYSAKPKKRKFQYELKFCKGILSDL
                     YDDKLFLLANPFYYPVDPVALNIPTYHSVIKKPMDLSTVQTKLNAGQYENAKEFEADI
                     RLMFKNCFKFNIPGDPIYQAGQKLEEYFSAKWANKDAWLEENDPDNHQSGSSDEDSEE
                     VESEEDGDQEKLLALQRQIAEMSKQVEAITQKKKKTPPASKKTAKSKSGKKDSKKSSK
                     GDKRSKHGKSDKRNVTYHEKQIISNGISTLPDKKMQEALRIIQSNVPALKGTQETEIE
                     LDIDELPNEVLVLLLKFVKKNAPQVMEDEDMSAPISSTAVQSKPKKNKPMSKFEQEAQ
                     INMLQGSLSRFQGGGAQHSPEPMRSVEADDSSDESDDDSEESEEE"
     gene            <844098..>846667
                     /locus_tag="TRUGW13939_02756"
                     /db_xref="GeneID:55990263"
     mRNA            join(<844098..844645,844708..>846667)
                     /locus_tag="TRUGW13939_02756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485944.1"
                     /db_xref="GeneID:55990263"
     CDS             join(844098..844645,844708..846667)
                     /locus_tag="TRUGW13939_02756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341837.1"
                     /db_xref="GeneID:55990263"
                     /translation="MAKKSSRQPASKTSSAAAPAASAATAAGSRSSILRAAFSPSEYQ
                     LALFASVIQGLDSQHLRIHDIHTGVLQCEHAVTPRESITSLDWGYFPNQRDSNTPKKK
                     RKRNSNVHENGDAVVAFGTSSSEIRMYSPEEDKILGTLTGAHDGGIRDFKFTTGKSAA
                     QGWSIGGDNKLVQWDLRTGQSIKTIHIPTSSTPSALSRPALSTPSVICASQTPFILDV
                     ENPEAQPLTFPAMANPIHTLFSSSTNFSKDDTFLAADSARYVTVFDPETKGIAHSLIA
                     ENDVLAVSLYSSSDEEDAQSKQVLAVLVNDGTVELFNRPFLQLGNSKTTSLKARAKQM
                     TRKADAVVKIVNPESRKGVSVVQTNFQGSELFIAWAEGGVNVVFERVNWQSKDTEELA
                     LSGVTEISGRKSGSVLHSTTVKEARNASKSHVNENNAAVDSGAFADDVEMNGTNDDDI
                     DAISISDEGDSSEDEAKKPQQRQTNNTLTNGAGSKDDVEMQDADSGVEEDDEDVGGEP
                     SFGELAQRNSAIDVEAELEEDNTGAGALVPGTSSKKVYQIPSGVSLSTVLSQALKTND
                     VEMLESCFHTSDLNIVRATIQRLDSTLAGTLLQKVSERMASRPGRYGHLLVWVQWTCI
                     AHGGAIAGNADILKRMTSLYKVMDQRSRSLPSLLLLKGKLDMLDAQVNMRQSMSDTRK
                     HEADDEEILENVTHYAGVNDDSSEAGQRRKRKAISHLEEADAEDIDELQNGFGSDLDD
                     DEDDEGSEEDADEDAGLIDIEAEEYAGSSDAEESLEGHEDDDDEEEGDDDSDAGSDMV
                     DFIADSEEDVSDEGAVPAPPQKKAKLGGGKSRKGGRS"
     gene            complement(<847372..>850093)
                     /locus_tag="TRUGW13939_02757"
                     /db_xref="GeneID:55990264"
     mRNA            complement(join(<847372..849023,849076..>850093))
                     /locus_tag="TRUGW13939_02757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485945.1"
                     /db_xref="GeneID:55990264"
     CDS             complement(join(847372..849023,849076..850093))
                     /locus_tag="TRUGW13939_02757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341838.1"
                     /db_xref="GeneID:55990264"
                     /translation="MDITPYSTSEESHHSKTKVFHSPQYLQATFSLRDDSTPTVCQPP
                     RQQLDTDHLSSTSPSDDDHQSFTSHKSQTARESASEKARTKNKIDKSNTKSFVSLVRA
                     KAPEARSRLAAARLFAHDVLALAADTPDRFIPRRSDHSIFTTKHRIRKDPWDLTVNEK
                     LLRQQECSENPFDRRPSQGILPSSLLNRRGLLQAPHMSPHLVDDQALPSQQSSSTGRR
                     ITPRQVSVGGIWNVGGSSIATGDPRLGSTYERGDIYEDKAATPIHVARYEYSTHISSS
                     EDLEMNQSRLAIAFDVDLIRPQLTICKLTTPNETRLSPSSPQYERFKCPLVWKDCEWK
                     RAELSNFHTKRRRSKKAKERVPFCILVTPGILDDFYCSVLAYSHTIKILAYAIMDIVY
                     LWSTSTCRAVAAFPAGHPNSDHVTALSFSSPEGQKGILAVATWRGYLYLWSLVKPQPR
                     RIWQYHISISCVAFKQTTTRRLSTIFSGTEAFVEDLVVGDRAGIIWYYCVESSNLDTL
                     SKVTLLARIDAHCGCICGISWSPDNKYLATSGDDDACLLFDLNRILGGHHSEGSPLIG
                     DYLLPGVQPLEADSYSMTGIRFLHIFRRLSRLATGSSLSRRSRSAPNLVHESSTSDNL
                     EQSLRAGLDMNQNRPERRPEAWRQRRSSFTGSNISDNFQAARILGLQDFLPGLSIGPL
                     DSQGVQTAKGIPYNSQKHRFMHRSAVKAIAFAPWQPTLLATGGGMSDRTVHFYHTPSG
                     SCLAKIYVWAQITGLVWSTTQREIAVILGFSEGEHPFRIAVFAWPSCEQTAAIPWNIN
                     LYGQVFPDLHVSERALAAIIIPRFRCPPCDGEGDASSADDECIAIISKGHIRFYRIWS
                     KTRKSFGGSAGILHSAILESLDGIENPGNEVIR"
     gene            <850494..>851676
                     /locus_tag="TRUGW13939_02758"
                     /db_xref="GeneID:55990265"
     mRNA            join(<850494..850595,850654..851236,851300..>851676)
                     /locus_tag="TRUGW13939_02758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485946.1"
                     /db_xref="GeneID:55990265"
     CDS             join(<850494..850595,850654..851236,851300..851676)
                     /locus_tag="TRUGW13939_02758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341839.1"
                     /db_xref="GeneID:55990265"
                     /translation="HGVPRQSKKAVENVEQKQQEIQKYRDLDRSVQDKIAGRCFTPET
                     LQQISELLKENPEYYSVWNYRRLIRQHEFPVAAPSDQPGIDQVAAIIKSDLEFLFPLL
                     RSFPKCYWIWNYRLWILDEAKRLLPRPIAHEFWQKELALVGKMLSVDSRNFHGWGYRR
                     HVITELENFSADEDSVKQMTQAEVYYTTKMIGANLSNFSAWHNRTKLIQKLLDEKKAT
                     DEERKKVLDEELALSHKALIDPYDQSLWFYHQTLMCVFDPSLAARTMAPNLSNSQRLE
                     YVENEKEEIKDILDECTDCKWIYQALVECNLITAKIKGAMPDDDRSEVLEWLGVLIKL
                     DPLRRGRWNDIEKSLGEYE"
     gene            complement(<852133..>853711)
                     /locus_tag="TRUGW13939_02759"
                     /db_xref="GeneID:55990266"
     mRNA            complement(join(<852133..852557,852613..>853711))
                     /locus_tag="TRUGW13939_02759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485947.1"
                     /db_xref="GeneID:55990266"
     CDS             complement(join(852133..852557,852613..853711))
                     /locus_tag="TRUGW13939_02759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341840.1"
                     /db_xref="GeneID:55990266"
                     /translation="MGFHSTRVLVLAATVLTVALVVSRIRRFLVRRQFARLHGCKPIV
                     RRANKDPFFGLDRMYSFIQAAREHKALETARERHRALNYTFTSKQLLNSSILTSEPEN
                     IKTVLSINFKHYGLGHRLQQFEPLLGKGIFDTDGDHWAMSRALIRPNFTRDQVADLAS
                     FEHLIKDFFALIPRDGYTVVDLQSLFFRYTIDSATEFLFGQSVGSLRMTGSDLSFAEA
                     FNYSQEAITTRGMLGQLHRFYSDPKADQSDRICREFAQQFVDEAVRIVQSEEKEDKNE
                     GSETKRQKYIFSHELARRTSDKRRILDELMNVLLAGRDTTASMLSNMFFMLAKHPAVW
                     SKLRREVASLEGRLPTYEELRNLKYLRCCMNESLRLHPVVPLNERKALQDTVLPVGGG
                     KDGLSPVFVPKGTFVGYNIYAMHRRTDFYGPDADQFRPERWENGRLQPRWEYLPFNGG
                     PRICVGQQYALTEVGYVTVRMAQEFQTLESRDPGPWEESLTLTLSSRNGTKVCVTPA"
     gene            <854788..>857557
                     /locus_tag="TRUGW13939_02760"
                     /db_xref="GeneID:55990267"
     mRNA            join(<854788..854823,854888..856438,856494..857435,
                     857492..>857557)
                     /locus_tag="TRUGW13939_02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485948.1"
                     /db_xref="GeneID:55990267"
     CDS             join(854788..854823,854888..856438,856494..857435,
                     857492..857557)
                     /locus_tag="TRUGW13939_02760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341841.1"
                     /db_xref="GeneID:55990267"
                     /translation="MASSPEPKDFAEDSFEDVSEERTQTPPPSLPQSSSTRSLTDRRL
                     SNGSVTTPRAENAPPLPSAPVDSDSEDSVDDNSPLHSEVEDTPKRTKYQKSPLLTAHR
                     LSTTSLDEVNLAGNKDEEKSPGASSPESQSHSASPDIGSPDSTTAKQSVSSTFMSSLS
                     SVPWPAAAKPTAPPAVPPAQPAPPAPPGRKLTSPFAWLSRASTSGKDPRSPPVGSTDT
                     RRNTAASVSTLNTFDEGDSLSIGSRKPGLRDQFKLLRLREEGPDVDQASIASGQASVS
                     QGAGTPTEEHKDNISVSSPAVAASGSFPAVNPNLAPGTVSGISTSATDAAVPVDWELW
                     ENIVNNGPEALTGANSDELNAAIKRGIPQTIRGVIWQVLADSHNPELEEMYRDLVARG
                     TNKERHISVNGTQSSIHSEKASVASSRSSIRSDHSISPSLSSHVTPSSSPDAEKAIKD
                     QLAAEVARKKKAKEDVEAIRKLEKAIRRDLGSRTSYSKYFVSQGSQEALFGLCKAYAL
                     YDEAVGYAQGINFIAMPLLFNMDEAEAFGLLVKLMNKYGLRDMFIQDMPGLHLHLFQF
                     ERLLEDLEPALYCHLRRRGLSPQLYATQWFLTLFAYRFPLQLVLRIYDLIFEEGLEST
                     ILRFGVAIMRRNSEALLGMKDITSLSQFVKEKLFDVYIDQQPSASSILESGFFGSSGG
                     SEKEVYRSDLMVQDACEIPLTPELIRSYTTEWEEKTRVEREREQELEGLRHTATSQAA
                     RIRSLEEHAEKSDQEHVQLASELVRMKVENEELSDANESLQVQVQELKIVVDKQPAEV
                     EEKLQTEMERIMKRNMEVQNENRNMEEQMSDMERDLVDTKMKWAELSENHEGLKQKWA
                     DLRKALDG"
     gene            complement(<858362..>858886)
                     /locus_tag="TRUGW13939_02761"
                     /db_xref="GeneID:55990268"
     mRNA            complement(<858362..>858886)
                     /locus_tag="TRUGW13939_02761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485949.1"
                     /db_xref="GeneID:55990268"
     CDS             complement(858362..858886)
                     /locus_tag="TRUGW13939_02761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341842.1"
                     /db_xref="GeneID:55990268"
                     /translation="MPSVPLFPPQKTGSSSSQSTFSPLPPLLQTPSGLAILELQGTIN
                     IPSWSTTATDKDGDVTYNDDDSLDKDTPDGGKTIETELGRLIFPDYVDGMDADNNKWM
                     KRAYMFIGRYQRMTGEVKKLAKPLAVIQRRQTTENGKGKGEEEEEGGDELEIVEIIKY
                     KIIFASRPEPVGIE"
     gene            <860050..>860889
                     /locus_tag="TRUGW13939_02762"
                     /db_xref="GeneID:55990269"
     mRNA            join(<860050..860184,860242..>860889)
                     /locus_tag="TRUGW13939_02762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485950.1"
                     /db_xref="GeneID:55990269"
     CDS             join(860050..860184,860242..860889)
                     /locus_tag="TRUGW13939_02762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341843.1"
                     /db_xref="GeneID:55990269"
                     /translation="MDSTEDDTEISRRQELQLEKPGDQGLSSDGFDDKLDDQEPNNFS
                     ASEDSSHVTRKPAAASGTCSLTWVSAEAKERDNCRKMRMNMEFVAPKSPVVPANLKEW
                     LIHRASVLEIKARYIKSRIPDSKGDDEEKAQLVFHDWKWRDTRSFVLSQETIWRNHGT
                     ENPSRNQAPWPDSSERKHEGYQRVRSGYKRFLPLPRVPGNQTVNWKQRSPIATYEFDR
                     VGQPIGIGGTVDTDEMMEEFIGKKFLAEIDTLNFPKQCNHLH"
     gene            complement(<861102..>861701)
                     /locus_tag="TRUGW13939_02763"
                     /db_xref="GeneID:55990270"
     mRNA            complement(<861102..>861701)
                     /locus_tag="TRUGW13939_02763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485951.1"
                     /db_xref="GeneID:55990270"
     CDS             complement(861102..861701)
                     /locus_tag="TRUGW13939_02763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341844.1"
                     /db_xref="GeneID:55990270"
                     /translation="MAPSEDSILNNFLLSPASLPTIISLQKFTELFPRRLHSHPQIKV
                     LYRELQELRSQDMDAVTEHILDEVKEGARQRADLLRAARASGVDGFNDDDRREMDIDL
                     QLFGPASNTTETVGFHPYSSLISEMENACSTLEQEIEATEQDAASTLSEMKKTVSELS
                     DLRYGKFNKPGMTVDDLVGETVRGLKSLQGACDHHSNHT"
     gene            <862621..>863952
                     /locus_tag="TRUGW13939_02764"
                     /db_xref="GeneID:55990271"
     mRNA            join(<862621..862781,863023..863254,863304..863688,
                     863741..>863952)
                     /locus_tag="TRUGW13939_02764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485952.1"
                     /db_xref="GeneID:55990271"
     CDS             join(862621..862781,863023..863254,863304..863688,
                     863741..863952)
                     /locus_tag="TRUGW13939_02764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341845.1"
                     /db_xref="GeneID:55990271"
                     /translation="MAPAGLNYSRDERVLCFHHEVLYEAKIMDLKHSVPDDRKSPYEY
                     LVHYKGWKNTWDDWVPQERLRKFTDENRELAAQIRREVTAQNWAKNNANAKIPKRRGG
                     SDSGRGSEERQSSVPAKGNKRGRDNEIEKEDQFHSRPSIRIMLPDNLKALLVDDWENV
                     TKNQQVVALPAPHSVNGILQTYSDEEKPKRINTAEKDVLQEVISGIKEYFDKSLDKIL
                     LYKFEREQYRLLRQKWETGAENYADKGPLDIYGAHHLLRLFAVLPELIAQTNMDQQSI
                     NHLREELSKFSIWLSRHSEQFFSNKYINATAEYMEKATGVPIQNPGTATSRLV"
     gene            complement(<864345..>866762)
                     /locus_tag="TRUGW13939_02765"
                     /db_xref="GeneID:55990272"
     mRNA            complement(join(<864345..865044,865104..865514,
                     865571..865905,865956..866068,866126..866279,
                     866350..866430,866484..866606,866679..>866762))
                     /locus_tag="TRUGW13939_02765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485953.1"
                     /db_xref="GeneID:55990272"
     CDS             complement(join(864345..865044,865104..865514,
                     865571..865905,865956..866068,866126..866279,
                     866350..866430,866484..866606,866679..866762))
                     /locus_tag="TRUGW13939_02765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341846.1"
                     /db_xref="GeneID:55990272"
                     /translation="MEASPLTQQARPEIFQPKIVQLYETLFKLENHVEPSEGFWREFF
                     LLPPDTVHLHRILDGFTADDTLLLQAVTQQVFARAIREAVAGVAPNDAHALETLTTFL
                     GSVLIKKYTNPSSDIITVLAGLDEGDQVFTEFVGMLDKIIRNGARFDLRLKAVRTAIA
                     MVSGAYKTGLVSYFTHRDIFPSIMKFIHDSETHLQILDPFLLLGLLANYNKFEFQNPY
                     QQRLGDFVNEVTIQKIVKGTGLSCAGLRNGYVAIQDDLPEGWTLSNTLVFFGLRALAG
                     SPKDKAATSSSEEIKETFAAQPVPEAAVLLATYDFVSANKLFGYNLVTSVPEKRNEES
                     PFSSFLSLTSYLLQHAYRSERVATYSELNLSVLRILVEDPVLCKRICSDEGKCHVRLC
                     RQRQPHLPLVSGERVLATVIFDIMIDTMTHNLRRRLDVNLYCHTIGILTRIFTYLASN
                     RTRLTYHWSELWRTLLSLMRFLTTYVSDVSLNPRINTLTTSLVDLIAFCLSAGDTFLP
                     DPVSYDDLFYKIVETGPVIARFRDVYNIVPFANQQAPAESSSKEVPTAETPDKNIAAI
                     DILISVSTHFHSLLFQTDNTTTEPSNGAAADSVPKPITAARKKNLGPREVHQIIKQGY
                     DTLSIQTREGLNRWDKWRETDSKLELKRAARCAVEDAKRFLL"
     gene            <867635..>868381
                     /locus_tag="TRUGW13939_02766"
                     /db_xref="GeneID:55990273"
     mRNA            join(<867635..868274,868344..>868381)
                     /locus_tag="TRUGW13939_02766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485954.1"
                     /db_xref="GeneID:55990273"
     CDS             join(867635..868274,868344..868381)
                     /locus_tag="TRUGW13939_02766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341847.1"
                     /db_xref="GeneID:55990273"
                     /translation="MLRFARVSGCACTARLFSSYRGGYQSSRRDMQTATAFRPHTLPD
                     NFPPPRNTGVPDTSIAADAPFNTAKPAASSSTSQKSPVSLREGEAQKSAPPQSTFTAA
                     SADSTTKPRRSRLRPRKAAMVLTPLAVSQLKSMLSQPDPKMIRVGVKNRGCSGLAYHL
                     EYVEKPGKFDEVVEQEGVKVLIDSKALFSIIGSEMDWQEDKLSQRFVFRNPNIKEQCG
                     CGESFMV"
     gene            <868920..>869909
                     /locus_tag="TRUGW13939_02767"
                     /db_xref="GeneID:55990274"
     mRNA            <868920..>869909
                     /locus_tag="TRUGW13939_02767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485955.1"
                     /db_xref="GeneID:55990274"
     CDS             868920..869909
                     /locus_tag="TRUGW13939_02767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341848.1"
                     /db_xref="GeneID:55990274"
                     /translation="MDASTHSPESLDTDPDLYLTVRFSASIPDVQLEIASPSTTTAAG
                     LKQLIRQKLPRDLSNHRLRLIYSGRGLEDAVSLTTSLKLSPSPRTGTPLSARIDIPET
                     AGEDASKGKGKEVVRNASLLNTPRLYVHCSIGDIILSPSDLATEAALASTLTQDGGDS
                     TAESSSSTGGQKLQPNEERAATITPAPRGFDRLLAAGFTPSEVSALRSQFLALQSVSH
                     TPDTMPSGSELRELEDRWMDEGSGAMGAGALGGGGTTFGGGGGDDEGGGLGTGSHGAL
                     DDMLWGAVMGFFWPIGCAMWLRREEGVWSWRKGLAVFVGVVVNIGFGAARVMN"
     gene            complement(<870185..>870937)
                     /locus_tag="TRUGW13939_02768"
                     /db_xref="GeneID:55990275"
     mRNA            complement(join(<870185..870207,870278..870686,
                     870758..>870937))
                     /locus_tag="TRUGW13939_02768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485956.1"
                     /db_xref="GeneID:55990275"
     CDS             complement(join(870185..870207,870278..870686,
                     870758..870937))
                     /locus_tag="TRUGW13939_02768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341849.1"
                     /db_xref="GeneID:55990275"
                     /translation="MANPLDTDAGSELFSSYEAELKLIQADINQKLDQVAEASGEQRK
                     AAISHTERALDEANELLDQMRMEKQNIPSAARSKVNVRFRNYSSDIDGLKLKLKSLSD
                     DRRALFGDRYTDDPEAGDAHMEQRQQLLSGTERLERSSARLQESQRLALETEDIGRGT
                     LADLEVQRQTIERTRQNLHQSEGYVDTSIKTLRGMARWLQIGL"
     gene            <871893..>872855
                     /locus_tag="TRUGW13939_02769"
                     /db_xref="GeneID:55990276"
     mRNA            join(<871893..872105,872169..>872855)
                     /locus_tag="TRUGW13939_02769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485957.1"
                     /db_xref="GeneID:55990276"
     CDS             join(871893..872105,872169..872855)
                     /locus_tag="TRUGW13939_02769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341850.1"
                     /db_xref="GeneID:55990276"
                     /translation="MRFIKEHSDLPVPRVFAYEVDDKNLVGAAFILMELLPGSVAMDA
                     LGGYEVHRGVIPRKYRENFYRSVAKCHVQLTSLRLPKIGTIVRNCEGGYDCGPLPGIG
                     GPFDTATAFFEAWADSVKFKWDKERIMNMMQRGPIPGEKMVEIIENFPSQLKAMASRL
                     STCNEGPFPLTHDDFLHSNIMVDEGSFDVTGIIDWEGACTVPCELVAFPDFLTAMPVS
                     FDLPQKYDRHGQPLDEELQEVWRERGDYIEMVRSMEHADSLLSTCLSSKKIQAIAYSY
                     GAYTSVGKLGFYDRVIKELDVLG"
     gene            complement(<873629..>875221)
                     /locus_tag="TRUGW13939_02770"
                     /db_xref="GeneID:55990277"
     mRNA            complement(join(<873629..874139,874194..874325,
                     874378..874747,874798..875017,875078..>875221))
                     /locus_tag="TRUGW13939_02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485958.1"
                     /db_xref="GeneID:55990277"
     CDS             complement(join(873629..874139,874194..874325,
                     874378..874747,874798..875017,875078..875221))
                     /locus_tag="TRUGW13939_02770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341851.1"
                     /db_xref="GeneID:55990277"
                     /translation="MVQISEVKGGTRENRTMAHTHIKGLGLRSDGTAESAADGWVGQP
                     TAREACGVVVDLIKAKKMAGRAVLLAGGPGTGKTALALSVSQELGTKVPFCPIVGSEL
                     YSAEVKKTEALMENFRRAIGLRVRETKEVYEGEVTELTPEEAENPLGGYGKTISHLIV
                     GLKSYKGTKKLRLDPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDLEA
                     EEYVPVPKGEVHKKKEIVQDVTLNDLDMANARPQGGQDLMSMLGQLSKPKKTEVTEKL
                     RAEINKVVSRYIDQGVAELIPGVLFIDEVHMLDIECFTYLNRALESPIAPIVILASNR
                     GNTVIKGTGDVTAAHGIPPDLLARLLIIPTHPYSPDEIKTIIRLRAKTESLNITDPAL
                     DKISEHGSKISLRYALQLLTPASILARVNGRPGGIDVADVAECEDLFIDAKRSAAIVN
                     QGNGSFLP"
     gene            <875656..>876318
                     /locus_tag="TRUGW13939_02771"
                     /db_xref="GeneID:55990278"
     mRNA            <875656..>876318
                     /locus_tag="TRUGW13939_02771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485959.1"
                     /db_xref="GeneID:55990278"
     CDS             875656..876318
                     /locus_tag="TRUGW13939_02771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341852.1"
                     /db_xref="GeneID:55990278"
                     /translation="MLLPSSSLRAAFRGLSLHSTTPAKRSFSTSLCLQSRKKLSEAIP
                     PYPYKPNYVYKQADTGLYGGAAIQFGNKISKGRNKGKTRRAWKPNVRWKKIHSEALEK
                     DLFLKVTRRALRTIEKSEGLDNYLLSDKPARLKELGLTGWELRWKVMQTPKIQEKFRQ
                     ERKALGLPEAPPTFEEWVKEKTKNKRSKGDTAFTSSLNIKSRVSPKRPASPKVKSTEK
                     SK"
     gene            complement(<876610..>879257)
                     /locus_tag="TRUGW13939_02772"
                     /db_xref="GeneID:55990279"
     mRNA            complement(join(<876610..876834,876894..877330,
                     877393..877745,878202..878877,878934..879146,
                     879224..>879257))
                     /locus_tag="TRUGW13939_02772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485960.1"
                     /db_xref="GeneID:55990279"
     CDS             complement(join(876610..876834,876894..877330,
                     877393..877745,878202..878877,878934..879146,
                     879224..879257))
                     /locus_tag="TRUGW13939_02772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341853.1"
                     /db_xref="GeneID:55990279"
                     /translation="MSTIDIVVNPRGKPIRRLPKELTVSTTSPTSDIYNTIAQKSGYS
                     VHRLRITKGGDGSPLSNGSETVQETGLKAQSVVYVKDLGPQLGWRFVYIIEYLGPLAI
                     PPLFLYLLRPYLYFNFEQLAEPSQLQVLVCALLVIHFLKREFETIFIHRFSLATMPAR
                     NIFKNCGHYWALAGVNIAYWVFRPDSPTATDALNPVLYNVGLALFVFGELANLNAHVI
                     LRNLRRPGTTERGIPRGFGFGLVTCPNYMFEIIAWIGIYLLTGLSWSVFLFIVVGTLQ
                     MWAWAKKKERRYRQEFGDKYKRKRFAVLPPLLISRSCRLYLFYDPHSAMHYALPPRKS
                     STAPPFPPRSSLSSFQRRRQLKTVGIVLFVIFSGLFLLSRYSHTPTSGVIRAAIPAGT
                     PAIVLVTLFDSEVLSQNYAQNIKNNREDYASRHGYATFFANASDYVYTLTEGQPRNWV
                     SVPAVRHAMSEYPHSTYFFFLSAHALIMEPRLSLMSHVLNPAQLQTLMIKDQSIVPPD
                     SVIKTFSHTTAKDVDLVITQDAEDLVPDSYIIKQGQFARFFLDMWYDPLYRKYNFARA
                     EKHALDHIVQWHATVLAKLALIPQRTINSYSKDSPDAAYDGNYHEGDFIIHFNGCDAL
                     GRSCEEEMRPYYSMWQRNSAN"
     gene            <881113..>893340
                     /locus_tag="TRUGW13939_02773"
                     /db_xref="GeneID:55990280"
     mRNA            join(<881113..881160,881228..888839,888891..888974,
                     889037..892792,892849..893193,893246..>893340)
                     /locus_tag="TRUGW13939_02773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485961.1"
                     /db_xref="GeneID:55990280"
     CDS             join(881113..881160,881228..888839,888891..888974,
                     889037..892792,892849..893193,893246..893340)
                     /locus_tag="TRUGW13939_02773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341854.1"
                     /db_xref="GeneID:55990280"
                     /translation="MGRIKKVAGSKHEATISPYMSEFVKLATGISLAKLPSHLATLPR
                     TWPFPRGDLYHWIPLLDRFDDILTKVIDQYGLNAGPQTVPFQRLVLSDALNAEGLKDE
                     AEISQTLDSVGYGPEGDRELVESILDFSQLLQEKCGNRSLYNSSDRLNDLLNTTSNTL
                     LLITLRLALCLAQRYHARQRNASTTHFQQALLAAHYSIDLEKVQKLASPFPQPTSLTK
                     PPTAPFSPAADTKDKEKSLLTGHDANDVINLLREKTGWEEWGNVRAVYYPSSASDQEN
                     PKPDSRQSEQFHSQAPTTPTPPRRSATLPTPRLGRTISAEDSPLIHGTTPSAKPADLP
                     VNSRSVEVPAVTVTSTDIEAILDSKLSDVPSDSKYDFLHRVRVARSLVTSETTREQIL
                     SIRILALTNLAYIYPEAIMQQKILQQDSDQPKRLQSVYQLAELAHLGASGDLPTLRTT
                     QTFALYALDALTKHKGRSADVCAALNVNVNHGILMFLTRKAITELSTDEEGGDESDEW
                     RDALFLLLRTLPGSSTRTPETLIAAGLIPMFVDVLNLRTEKARRVYPRVLEFLDTFVH
                     AVRDALGTLATAKGFDAISDLIGHETKSAFDKVNEGVGIPAEFRTPSVDYNIPYFQQQ
                     SLRWLFRFVNHIMQHNGGGFDRLLRNLVDSPPLLTALRLIFENACVFGSHVWSGAVNI
                     LSSFIHNEPTSYAVIAEAGLSKSLLEAIILENLKVPETKEPTTTLEEGESTTEPSDSS
                     TGRPPAPKVNYTLARGQEQKLARGILPAAEAMSCIPQAFGAICLNSAGLELFQASGAL
                     DSYLEIFESPAHVKCMDATLVRSLGTTFDELVRHHPALKESVMSAVLVMVARVGLLCK
                     KMAYNGAGAKLWTKDEQGNLSVIGGKHALPIEIGEPFEATTERDGQFSYPPLQEVTLP
                     NGGTLTLGQVPETKPPTPQNTSPDADEWGLTVANYIYPVMRFLGAFFENQINCTYFIE
                     TGGVEFVLDFATLPSLSSDFQSRQANSEFAQLVHMMAETKPHLVLPSLIKRTQDSVNR
                     LADFWKEPTADGFFTPLTKPDLGDSNESDSGDLIWSRGTYYLKHLVAVHVLTDTLREV
                     YTPPIYQTRPSQQTSAFSQVNLTDQYAALITDLGQLHAACVWEEILLQKNLPKRWLEA
                     TNVRSYDLGSDEANNALGLSSDNTQRNAAPDTEEERPASAGTTAEPERTSNSAVPATA
                     DEGARAGEEEDPPFKNTQALRYLLSSLPTTITGYFHLLGHGTLVKRRNDPYVKQNALL
                     VADAIAGTVLRQLQLGAPNRASGVKERFSYLIVILSAFSQLLFETPVERSHSHCLTSI
                     LFAFKKQNGLKVIKNLCELFLQEIKELAPQVGKFDDPNKSSRLASAYGGIKIILSFFS
                     EITSARESNHLQAGGENTREPFNPAQFLVDLRMEVLPMARELWCSDFVDQASSSILKC
                     LVDILRSTLDGDHESGAATQKNRSFVADPPRRTMSLNRDRVTMLIERGFDTELSREAL
                     YRCNNVLAAAEDYCRAQTWLRPPPRFSPGSDLEATTRTTGATEDTSVADTPPFNNLTV
                     SDRNAALARLFGEGSTRFTPGDGNEIGEHESGHNTEFLARALNHIFNDSETIGNDPLE
                     EASQESRRVAPSESVAQPTDRRREVTTIGDLDVERDKVRTNLIERCLDVLNIHHDVTF
                     ELADLIAAATKKHRDPEGFRKEVGETLVQSLVSLQMEGDLQPSGKKIAAYANLLALVL
                     QDKYIYTATVDELKDCFVTLLGFIKIPPSDKPTEETSPWIGQVLLVIEKLLSDDAQPP
                     QIRWTPPQSVDDSIDSGGAELEPPLLALDDKIQLFDALLDILPRIGKDNSLALSVCRI
                     LVVLTRSRQIAVRMGEKRNLQRLFVMMKQLSSSANDKLQGAFMLVLRHIVEDDETIRQ
                     IMRSEITSNFESRSSRQTDTTAYVRQMYHLVLRSPEIFVEVTNEKLKLQRYDPNQRPQ
                     NLALKVTAPTTTTEKPDLAEKAIDSVESNETAGAKDKGKITDIKPPVVENPDGVIHYL
                     LSELLSYRDVDDKEPSQENVEGPTVDRPEAQTDVEMSASAEDPSPSSSTADLTNTRGS
                     KKSEKPPFKADDHPIYIYRCFLLQCLTELLSSYNRTKVEFINYSRKADPLATTPSKPR
                     GGVLNYLLNSLVPIGTLEHDETVSFKKRSNTSACAMRVLVALCTRTGEFGGNNRRRNA
                     EEEEEEIELLFVRRFVLEHCLKAYRDAMVSNELLDLKYSRLMCLADLFDKMLSGYTFA
                     GGDTTYPSSTRQLAKTMFEKHFISALTASIADVDLNFPASKRVIKYILRPLNKLTQTA
                     VILSETLSISTLGETEDDEISSATSVSDVDDNREETPDLFRHSTLGMLEPSHEEETSE
                     DESEEDDEMYDDEYEDEMDYDEDLPEDHGEVVSDEDEDLEGRGPIEGLSGDPGMDIEV
                     LLDGDDDEDDEDDEDDDEDDDEDSDLDDEDEIMAGEITGDNANDSLAGDEDDEWESED
                     VSEDNEEAAEMLTQFENELADIRQVDQHGDGQRFEDIFRVLHDAGGGVDDFPGNSLRD
                     DVQDELLDDEMNEDEDDDDEVDELEEELDEMDEDQVSYDEGLDDEDIEPWGWEGEEAP
                     VPRHHHHHHRHMRGMPAAWTTLPGSISRHGIIPIPPYRSQRNQAASRNNDDGTNPLLT
                     RSDRGPEGPGQTRGTTNEAFTDWVHGVDSTSGNRLLSMDSPVSFVNAIMQAIEGQGGP
                     GFGVVSRPDGIHVHVDRRAIMPSNRIQGIFELGRSQNASSKSRDDPSQAISFALATTT
                     ARWQEEARILFSNNYVEKTQRVVNSLLRVLVPPSIAEEKQRQKEEDEARKRREEERAE
                     RERLERLAKEEEEREKARKEEEEAARRREELERQAELRASTVEAEEVDEAMEDVDSAA
                     SVAEAAAEPQEAGPSEPVQRVFTTIRGRQVDITGLEIDPEYLEALPEDIREEVIMQQL
                     AEQRSQAVASGEEPTEISQEFLEALPAEIREEILQQEAAARRRRERDSARRQATSTGA
                     PVHAEEMDPASFMATLDPSLRQAVLADQPDEILATLGPEFLSEARALPGRRLTQFGDV
                     GRGEQRHHDEAHDEETRKPQRRQIVQILDKAGVATLLRLMFMPLQGNARHQLHDILHN
                     VCENRQNRIEVISLLLSVLQDGSGDVAAIERSFSHLSLRAKMPATQKTPQSSKRSLPS
                     QAATSANSEVTPLMVVQQCLSTLSFLTQYNPHISWFFLTEHDSSSMLKLKSLRRGKGK
                     DTKENKYALNSLLSLLDRKMIMESPNCMEQLSNLLNTITQPLTILLRREKERQDEAKD
                     KEPQITDVDAQDATSSAPRVAQSTESQDTQMAEAAVDAPNTSADEDKSKKRMIEPPVV
                     PKYNLQLVVGILAAKECNGKTFRDTLSTINNLSAIPGAKDTFGQQLISQAQSLSEVIL
                     VDLDALLPHIEHASSGTDMQGLALSKFSPPSSDQAKLLRVLTALDYLFDPHRVDKIKG
                     AEPESAPKEDVLRTLYENSSFGPLWNRLSACLNVIRQKENMLNVATTLLPLIEALMVV
                     CKNTTLKDAPLSRHGREFSVASPPPDAGSGMESLFFNFTEDHRKVLNELVRQNPRLMS
                     GTFSLLVKNPKVLEFDNKRNYFTRRIHTRGTEARHPHPPLQLSVRRDQVFLDSFKSLY
                     FKSADEVKYGKLSVRFHGEEGVDAGGVTREWFQVLARGMFNPNYALFIPVASDRTTFH
                     PNRLSGVNTEHLMFFKFIGRIIGKALYEGRVLDCHFSRAVYKSILGKSVSIKDMETLD
                     LDYYKSLLWMLENDITDIITETFAIETDDFGETQVIDLIPDGRNIPVTQENKEEYVQR
                     VIEYKLAGSVKEQLENFLKGFHDIIPPDLISIFNEQELELLISGLPEIDVEDWKNSTE
                     YHNYSASSQQIQWFWRAVRSFDKEERAKLLQFVTGTSKVPLNGFKELEGMNGFSKFNI
                     HRDYGNKDRLPSSHTCFNQLDLPEYDSYEDLRQRVHKAITAGSEYFGFA"
     gene            <894023..>895197
                     /locus_tag="TRUGW13939_02774"
                     /db_xref="GeneID:55990281"
     mRNA            join(<894023..894093,894160..894251,894332..894704,
                     894771..>895197)
                     /locus_tag="TRUGW13939_02774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485962.1"
                     /db_xref="GeneID:55990281"
     CDS             join(894023..894093,894160..894251,894332..894704,
                     894771..895197)
                     /locus_tag="TRUGW13939_02774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341855.1"
                     /db_xref="GeneID:55990281"
                     /translation="MATNSIKLLTGNSHPELAKLMADRLGTELTKILVLQYSNQETSV
                     TIGESVRDEDVFILQSTKPNDINDGLMELLIMINACKTASARRITAVIPNFFYARQDK
                     KDKSRAPITARLMATMLQTAGANHIITMDLHASQIQGFFTVPVDNLYAEPSTLKWIRD
                     NLDVENCVIVSPDAGGAKRATAIADRLDLQFALIHKERARPNEVSRMVLVGNVTDKIA
                     IIVDDMADTCGTLVKAADTIMQHGAKEVNAIVTHAILSGNAISNLNGSCLRRLVVTNT
                     VPHAEKKEACDKIETIDISPTLAEACRRTHNGESVSFLFSHAVE"
     gene            <897224..>898543
                     /locus_tag="TRUGW13939_02775"
                     /db_xref="GeneID:55990282"
     mRNA            join(<897224..898054,898109..>898543)
                     /locus_tag="TRUGW13939_02775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485963.1"
                     /db_xref="GeneID:55990282"
     CDS             join(897224..898054,898109..898543)
                     /locus_tag="TRUGW13939_02775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341856.1"
                     /db_xref="GeneID:55990282"
                     /translation="MSSPIRIAISGGGLAGASLLYALLPHAHLDVHIFESAAAFKEAG
                     MAIGLARNALAALDLIGPSAAECLNRAGAVPMRGVRFMLAQGDNAGNTIDETEDGQRV
                     TSIVHRAALLREFLVNVPPDRMHASRNLDHFDRNSDGSLTLHFTDGTTHECDILVGAD
                     GIRSTVRKLILGEDDPAASPRNTGAWCVMALKPYAEAQTSIGNGPVNIEDAREYMWIG
                     NGTYLLHNLLNQGQLVQVVIASHEKDAESSDCWHRTVSADEIKKLYQGWPSHLYKAVD
                     ELFCKQPEQPGMYLWEHPPARTYVSGSICIMGDAAHATTPWQGSGGGMSIEDSLILST
                     LLGRAKTAAEAQTALKVYDHVRRPRTQRIVESSREMGLIVSGLKEEMGLNLEKLSEEL
                     LPRWDFIIDFDIEKHRDEAVEMMEREFKS"
     gene            complement(<900220..>901716)
                     /locus_tag="TRUGW13939_02776"
                     /db_xref="GeneID:55990283"
     mRNA            complement(join(<900220..900316,900372..900789,
                     900846..900900,901468..>901716))
                     /locus_tag="TRUGW13939_02776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485964.1"
                     /db_xref="GeneID:55990283"
     CDS             complement(join(900220..900316,900372..900789,
                     900846..900900,901468..>901716))
                     /locus_tag="TRUGW13939_02776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341857.1"
                     /db_xref="GeneID:55990283"
                     /translation="PRVSQPTHNTTSLSEISTHSAEADLERRLQHSTVDNPRLRLDRA
                     TLVKMKLNISYPANGSQKLIEIDDERKLRAFMEKRMGAELFKITGGNDKQGFPMKQGV
                     LLPNRVKLLLSDGHSCYRPRRTGERKRKSVRGAITGQDLAVLALSIVKQGESDIPGLT
                     DVVNPKRLGPKRATKIRRFFGLDKKDDVRKFVIRRTVTREGKQDYTKAPKIQRLVTPQ
                     RLQRKRNRIAIKRRRAEAGREAANDYAKLLASRVQEEKAKRSELRKRRASSLRK"
     gene            complement(<902294..>903046)
                     /locus_tag="TRUGW13939_02777"
                     /db_xref="GeneID:55990284"
     mRNA            complement(join(<902294..902630,902682..>903046))
                     /locus_tag="TRUGW13939_02777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485965.1"
                     /db_xref="GeneID:55990284"
     CDS             complement(join(902294..902630,902682..903046))
                     /locus_tag="TRUGW13939_02777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341858.1"
                     /db_xref="GeneID:55990284"
                     /translation="MASTKSHKKTKSRHRHRVNFLENPAAHFRKHRKAPVRVLVSTAT
                     HLVPGDGYFERTTFIANVVCQHHWGEDFKLGRDRLETRDADFAFDNRTCYFLIDHGKS
                     PKGGDKNVPILRYRWTGTALRLVREPLPYIVRKKIKYVPFTPAPPKDPRRFTARQKRK
                     HILMCLRRDMALSRLEFRFLRENREHARWLRRKLEPMRWSKFKSLEAESREVEETLAS
                     STIRPIEPEEPKGSC"
     gene            <904274..>905593
                     /locus_tag="TRUGW13939_02778"
                     /db_xref="GeneID:55990285"
     mRNA            join(<904274..904528,904587..905317,905398..>905593)
                     /locus_tag="TRUGW13939_02778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485966.1"
                     /db_xref="GeneID:55990285"
     CDS             join(904274..904528,904587..905317,905398..905593)
                     /locus_tag="TRUGW13939_02778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341859.1"
                     /db_xref="GeneID:55990285"
                     /translation="MRYTTRLNVLVGLAFLSFLIALRLVYVSDYGLPIRGKWDSWADV
                     KAPPLASSPDHRLVVFGDAWSYTGARLHDRGKGWPEWVCTSWPCRLETYAQQDHACQG
                     PFCGSVVDDLELQKITSDLNELREPLPDLRAQVDQWLTSEHEAMLKDPAGGDMHARMN
                     DTVFAVSFVVWDIWKFLHAPLGDTIKSSISRSIDSLFEQLNRLPAESGFGDVRVVLML
                     SIDPTFLPAFDATAGQKDMVSIVEQWNRELQEKAREWEGGSMYIFDTNEFLLDQVRGY
                     QYYAAGMLDANGLWEENPWDDVEHPCVESTGKWMTFLGNESKTCENPDKFLFWDGLHL
                     GPTANELMGTEIFHSIESSWIENNDAVAPEPENHEAEQTDSTPINRRTSRRNAGVSFG
                     R"
     gene            <907466..>915038
                     /locus_tag="TRUGW13939_02779"
                     /db_xref="GeneID:55990286"
     mRNA            join(<907466..907904,907973..908118,908174..909449,
                     909914..909999,910064..910895,910948..913642,
                     913908..914135,914210..>915038)
                     /locus_tag="TRUGW13939_02779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485967.1"
                     /db_xref="GeneID:55990286"
     CDS             join(907466..907904,907973..908118,908174..909449,
                     909914..909999,910064..910895,910948..913642,
                     913908..914135,914210..915038)
                     /locus_tag="TRUGW13939_02779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341860.1"
                     /db_xref="GeneID:55990286"
                     /translation="MSFDRVLPRPQALYDESANRVHRTTTSSLLEHKIMHDSTRLMSI
                     IDNMPRSPASIPRSNDSDSCSTALGQMNLSSINKEKIAENGHLQPSIASPSRQHDTSG
                     GSTIELPLRERSAPGSPTKLESAKEAASQFCLCQPDPKIPRPRNAFILYRQHYQAAVV
                     AQNPGLANPEISKIIGEQWRALSTDTKEEWKALAEAEKARHQQQYPDYRYQPRRFGRD
                     GFGRNGSVSTGSQLGSTTCNRCGGRLMNPPSTPHTPLTATMPPLSSRSSQGGSTPPHN
                     GSSRGSKPERRSNSMQLFSESDRRMSQWKEADPAPGEAKRRRLNSTAFQRTDSPDSEP
                     YSLSSQKTYISRPGVGFFRSHVDPGPKTPNGRVPRRGDGDGHSDPSLILPPLKSNGLA
                     ARSQTDTVMNIPVLNKIKVLANISPPLSDRSESQPKGVVVAIDGQDPAQVRVMMEHLG
                     RMMSQDSKYIVRIFEGPDMLSRRGSTTGQMGDATVDYLNVISAWHRISDDIVQFVSSD
                     LPVSESKDSSRTGTPQSDTARSTERSLSPSVINENAIPVALVPRYQLTTADAFACTIP
                     IKDRYALLDHWQWMASLWRACVGPDVTIHIRECDRDEMERHGSGNPVEIRLTEALEYG
                     VGKMSPAAVADPILVAGEIELRVSVNQIDSFPLSKSLNAETLSIPSEDAKPLPYSLPI
                     SDLPGTTSSQRLRTTPHKGDYLPVGILRRNDQIDLQSPKSRRFPDAELASLEKQGWIK
                     LRWHAYESHPGWSFVQVYVLPHDVARNLIPRTSNTLRKSLKLVMSSIDRSPAAFNGQF
                     EPISSEQEKDAAEDESLWYIFNTLNNPDPVIENVHDADGRLAMEELMSSSTTHDTNSR
                     MSYGVFGLKTPLHPYQCRSAATMIQREVHPKQMLDPRLQTYTTPHGEEYYYDKEDAIL
                     LREKRLYSEACGGILAETMGCGKTLICLSVILSTRGHVPRIPIEYQDTSAPVRSTTGS
                     LVEMAAATAGRFSVSWRSYFQHLRDSGMNYERCVKACERNRGHYTIPPPPSRYQSRGG
                     WLARPPAIKLYLNSGTLIIVPPNLVDHWASEINAHTEGLRVLVLSGRHDKIPPADELP
                     QYDIILFSRTRFEKEAGEPETNRRFPQPAESPLKKFHWLRIIVDEGHNVAGHGHKSST
                     MHMLDQLHVERRWVVSGTPSNGLYGAELSIASQQTLTTDTESAEDATSSTLHSRKRTG
                     TRTDEELKDVDKLRLIVVEFLKHKPWANSRSDDPANWTKYIKPIGEDGRRRKSPSLRA
                     VLQGLVVRHQLDVINDELPLPRLYNKVVSLEPTFYDKMSLNIFLLSLAVNAITSERTD
                     LDYMFHSRNRKHLSVLINNLRQAGFWWTGHKEKEIKATMDVAVKYMEKNREKMMANDV
                     KLLSEGIEIARRALSCKSYAAFYHFDELGVYVQDFPEHSRRIWSLVHDRDNSNDLLLG
                     ISQARLAQSFVISNLIDEDPSDGLAGAGITARRELSQRSQKPTKKANESGAADTLTHK
                     NKPAENRIPRKTFHKGVTMKLPQKSPLTGTKVIATASAKLTYLLDKVQELHKAEKIII
                     FYENNNTAFWIAEGLEMLGIEFRIYANTLKTSQKAAYLSLFEESSSVRILLMDLRQAS
                     HGLHIASASRVFIVNPIWRPNVESQAIKRAHRIGQIKPVFVETLVLKDTLEEKMLHRR
                     KEMSNSEMQHAEKDMLEDSTMSSIIQNEGFYPLPENDELIKPAYLQEPSGFFDRHELP
                     IPDDYVDALSAVLNYPVTPTKRRAVDYQIVESDVSPEHTPKKKKKKVGLRFQVVGENG
                     VIMTPPRGSRSPEASGMVTPEGTPMTPRGNETGSPAPGSSFFINTRAIFGPKFEAMTD
                     DSNRASAKKSAKTIIIGLSGPSSSGKTTLARLLRSIFADEKRVRTFIIHEDDFYHSDD
                     KIPVTKTARGELVQDWDTAGAIDIDFLASALAYVRKNGRLPPRLQSKEDQNDATNPDV
                     EEARIQDVSRVVRERIASEYSKPDTTKEGGEEVPLTIAFLEGFLLYAPPVAEDASHIL
                     RSVHDGIDLHLFLPAPYDTVKARREARSGYVTIGPAPTPTAERSAEAEHLGHSSVNLD
                     EKDDSAPQNFWTDPPGYVDDIVWPMYVQDHAWLLMPEGEDSSKQSLAAASGTRNESEL
                     LKLAGQGVNLRTDTGVLIAPGKGEKPMTEILDWAVDEILGFLKV"
     gene            complement(<915166..>915878)
                     /locus_tag="TRUGW13939_02780"
                     /db_xref="GeneID:55990287"
     mRNA            complement(join(<915166..915277,915340..915382,
                     915433..915460,915519..915549,915603..915704,
                     915763..>915878))
                     /locus_tag="TRUGW13939_02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485968.1"
                     /db_xref="GeneID:55990287"
     CDS             complement(join(915166..915277,915340..915382,
                     915433..915460,915519..915549,915603..915704,
                     915763..915878))
                     /locus_tag="TRUGW13939_02780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341861.1"
                     /db_xref="GeneID:55990287"
                     /translation="MGSMVLPHLQNAWQVDQAILSEDERLVVVRFGKDSHPDCLRQDD
                     VLSKIADRVKNFAVLYLCDIEQTPDFNAMYELYDPMTIMFFFRNKHMMCDFGTGNNNK
                     LNWVLEDKQELIDIIETIYRGAKKGRGLVVSPKDYSTRYRY"
     gene            <916477..>918393
                     /locus_tag="TRUGW13939_02781"
                     /db_xref="GeneID:55990288"
     mRNA            join(<916477..918254,918321..>918393)
                     /locus_tag="TRUGW13939_02781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485969.1"
                     /db_xref="GeneID:55990288"
     CDS             join(916477..918254,918321..918393)
                     /locus_tag="TRUGW13939_02781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341862.1"
                     /db_xref="GeneID:55990288"
                     /translation="MIAQRTTSLLTIVAIVGFVLVIFSKSSGTIQSESSEPSVKFGPS
                     RYIPIPSKISFDDLRHPFRPVAHKPPEQDHSTSGESKWYSDWQWLNPFSSSITLDEHR
                     TVLPPLPARPPIYTFYEPNKDNDDAEQKADSELLLAWRRAWYAKGFRPVVLSRAEALN
                     NDLYQEFQLRMQQLKLDPVLELDFVKWLAWGNMGTGLFADLRCFPMARYDDNTFTFLR
                     TGALPTHITRFDKLDRALFAGEKTVINDAIKAATQALDKYKDKLPSSIMNLIPSELLK
                     VEATNALAYYHSSTITSLYPKLAEIHVSSTASGRMTLVELINAHLHTTFLNSFPSGIA
                     VLKPLPEHTTALIEPALNLAKSLVKCPPSELPSCPPNRPNCQLCDPASKPVPITQPQT
                     FKNLSTAYTIGALPHPYTLVSLQHSSEEVDVKYIRRETQRDPWLLEVTKELLGEERGG
                     SSRAVAFKEAVAGDPYTWRTFWMTVETFPAQPGQDLPPTLLDELEWYFGFKIPRDAIK
                     KVEDKKVEDSKKAEKGDKKPEDAQKEGDKKPEVKEDTPLEKEYKLIGKARELLSDKQA
                     SRLSIRNVAEAWNLADVEVWRFVQAYRARSAVERAQFEQEEKNFVGVKST"
     gene            <918981..>923242
                     /locus_tag="TRUGW13939_02782"
                     /db_xref="GeneID:55990289"
     mRNA            join(<918981..919214,919275..919478,919538..921504,
                     921559..>923242)
                     /locus_tag="TRUGW13939_02782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485970.1"
                     /db_xref="GeneID:55990289"
     CDS             join(918981..919214,919275..919478,919538..921504,
                     921559..923242)
                     /locus_tag="TRUGW13939_02782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341863.1"
                     /db_xref="GeneID:55990289"
                     /translation="MAPSIEAVSAPAVPAEKISSLVQLTQDYHDTIRFYLNGTRVVLD
                     EVDPELTLLEYLRGVGLTGTKLGCAEGGCGACTVVISQINPTTGKIYHASVNACLAPV
                     VSVDGKHVITVEGIGDVKSPHATQQRMAVGNGSQCGFCTPGIVMSMYALLRNNPEPST
                     HDVEEAFDGNLCRCTGYRPILDAAHSFTAAGGCNNAQVNGGTGCCMEKQNGANGCCKS
                     NGVANGTSNGADEVTKQLPRPDFIPYSPETELIFPPALRKHEFKALAVGNKKKKWYRP
                     VTLQQLLEIKNTYPSAKIIGGSTETQIEVKFKAMRYDPSVYVGDITELRQYTLNDDHL
                     ELGANVSLTDLENICDEAVKKYGEHRGQPFVAIKKQLRYFAGRQIRNVASPAGNLATA
                     SPISDLNPVFVASNTVLVAKSLTQETEIPMTQFFKGYRTTALPADAIIASLRVPVAQK
                     GEYFRAYKQSKRKDDDIAIVNAALRVSLSETDDVLSANFVYGGMAAMTVPAQNAEQYI
                     IGKKFSDPATLEGVMNALEKDFDLRFGVPGGMATYRKTLALGFFYRFYHEIMSTLNVA
                     ENDNYQDITDEIERNISTGHKDHYASDAYRQEVVGKSGNHLSALKQCTGEAQYTDDIP
                     VQKNELYGCLVLSTKARAKILSVDAEAALDIPGVFDYIDHRDLPSPAANWWGAPNSDE
                     QFFAVDDVFTAGQPIGMIVATSAKIAEQGSRAVKVDYEEMPAILTIEEAIEADSYFNH
                     FRHIKNGDIEVGFKEADHIFTGVSRMGGQEHFYLETQACVVVPKPEDGEMEVFSCTQN
                     PTETQTYVAQVTGVAANKVVTRVKRLGGGFGGKETRSIQLAGICAAAAHKTRRPVRCM
                     LNRDEDIITSGQRHPFLCRWKVGTTKEGKLVAFDADVFANAGHTQDLSGAVVERALSH
                     IDGVYNIPNIHVRGWACKTNTVSNTAFRGFGGPQGMFMCETMMEEVADHLGMSSDALR
                     ELNMYKPGDKTHFNQELKDFFVPLMYKQVKEESSYMERRQAVDEYNRTHKWSKRGLAL
                     IPTKFGISFTALFLNQAGALVHIYHDGSVLVAHGGTEMGQGLHTKMCMVAAQALQVPL
                     SDVHISETGTNTVVNTSSTAASASSDLNGYAIFNACEQINERLQPYREKMPNATMKEL
                     AHAAYFDRINLSANGFYRTPDIGYVWGENKGQMFYYFTQGVAAAEVQIDTLTGDWTPL
                     RADIKMDVGRSINPAIDYGQIEGAFIQGQGLFTTEESLWHRGSGQIFTKGPGAYKIPG
                     FRDIPQIFNVSLLKDVNWENLRTIQRSRGVGEPPLFMGSAVFFAIRDALKSARAQWGV
                     TDVLELQSPATPERIRVSCADPIVERARVHPREGEKSFFVAI"
     gene            <924090..>925648
                     /locus_tag="TRUGW13939_02783"
                     /db_xref="GeneID:55990290"
     mRNA            join(<924090..924774,924837..>925648)
                     /locus_tag="TRUGW13939_02783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485971.1"
                     /db_xref="GeneID:55990290"
     CDS             join(924090..924774,924837..925648)
                     /locus_tag="TRUGW13939_02783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341864.1"
                     /db_xref="GeneID:55990290"
                     /translation="MTLVEMATSHPDFQIPPLSLPREVIMMFTVCSAQGLVQASLAQS
                     FIPNLLIGETFKAQSSDTAWYPAAYGLTSGTFMLAFGRVGDMIGHKKLFVGAWAWSSL
                     WALLAGISVYSDSQVFFDICRAFQGMGAAALVPSALAILGSIYKPGPRKNLAFSLYAS
                     GAPIGFTLGAVFAGLLAQLASWPWAFYINAIVCLIYAGLALVFVPNLGKRPNSKKESF
                     DYLGTFTIVSGLILLNFAWNRAPESGWKSAQCISTLVIGLLLIIAFFPIEKRTAHPIV
                     PVAEIDENAAWILLIEGLAWSSFGILCYYSINFAIRIRGKSMLTAAAYLAPVPPAGLA
                     ASIMTSILLSKGLMSPPGILAFSLVWFCIGNIVLATMPVDQTYWRDIFWAYLLSPFGM
                     DMSFPAGTLILSDLLPAERQGIAASLIATIVYYSQSLGLGIAGVVETNVAKGSVVRGY
                     RGALYLAIGLSGLGFFVAVAFVVLSRVRSSREKTRSGEIQNAVADAEN"
     gene            complement(<925964..>928237)
                     /locus_tag="TRUGW13939_02784"
                     /db_xref="GeneID:55990291"
     mRNA            complement(<925964..>928237)
                     /locus_tag="TRUGW13939_02784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485972.1"
                     /db_xref="GeneID:55990291"
     CDS             complement(925964..928237)
                     /locus_tag="TRUGW13939_02784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341865.1"
                     /db_xref="GeneID:55990291"
                     /translation="MRLFGRTIFPMLPPYGAHEGPNAAPPYADPDKPTPYLGIKSRLS
                     QVWINRWTILILLVLVRVLMAITSLNGDMDNAQSQALSACNSVQSMGSAMASLPHYMS
                     HGVNELTAQGITKTVHGLVDVLELMITGVEGLVLFYIDFLVQTYLCLFTLVARGAAEM
                     ALSIASDVTNWLNKELPSIENGISDVVSDVESGLSKLNDSINDIKKGCDNFITKGLCD
                     DLPTIPTIDLTSQMDNLKNLKIPTSVNDDISKANSTIPTFDQVKNATSTAIKFPFEKL
                     KDEVKKHLGNYSFDSSTFPVPEKQALSFCGKDDGIDKFFDGLADTLVEARKIFIAVLA
                     IIAVLACVPMAFVEIYRWRTTKQRAEMVGTAHDSLDVVYLISRPHTSSLGMKAATFFN
                     NSRHQVLVRWVFAYAFSVPALVLLSLGLAGLFSCLCQYILLKSVEKEVPELTAQVSQF
                     ADKVVTSLENSSVHWAQKANSVLNSTQSDINHNVFGWVNVSTSALNNTLNVFLKDSND
                     VINKTFGNTPLYGAVKGIFDCVVEMKVESVEKALTWASNNAYITIPTLPNNTFSVGAS
                     ASMDSGDSFLSDPGSTTSNQITEVVTKVTNKLQKSIETEAKISSALVLLWVLIVLMGA
                     MRAFFLCCTRQRVRGDGGGQRPVGQGGFEPVEPPMVMTGGGVVDSRGTTAAAAAATIP
                     ASREVEHNHSASSRAVPTERDRNDPFQQAEYEYQDQKMGFAGERDYSAAVHPTDSGNM
                     NTRQSWYVEYGRDEKRR"
     gene            <931304..>934552
                     /locus_tag="TRUGW13939_02785"
                     /db_xref="GeneID:55990292"
     mRNA            join(<931304..932101,932161..934003,934071..>934552)
                     /locus_tag="TRUGW13939_02785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485973.1"
                     /db_xref="GeneID:55990292"
     CDS             join(<931304..932101,932161..934003,934071..934552)
                     /locus_tag="TRUGW13939_02785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341866.1"
                     /db_xref="GeneID:55990292"
                     /translation="PYHIESQTHNMFSDRMMGHVSSCSSASGVMSPQHQTDTVTNDDA
                     GPQKIEPVCEERVQDLTHTEHLSPATGPSFFHHFRSLFVSPEFFPNSITIEYKNWHNS
                     DIQCRALAVPPPPACELSEERPVMAQPVKDGRLILHAIIPKDYPGGKEGFSSTSAKFL
                     RNEQTFGITHIYFGEDDISGYLKMVSDSFKEQSKSSSRSKNKEPKGKAIKWKNPVTAF
                     GCRYVWAHDLATPHLLYFRIRPTWVDLPALAVVDTTHDGYMNELGNSKERFVQLALPQ
                     IHLSVIIKNYKQLFQQSSQEQPAIPGVEFDPTQAWWWNIVQENQRRRHLAQLAAAPEP
                     VTESTAVEDVTRVTGSAGYSPESPTDQPVLSEAPDDDSAGREVFQTAPCDEDVAGLAD
                     AFLTTGTTIEVSEEHKDEQGKEQEVITDGSNLAHVEDDNIQPSQLTKETLAEERGLDT
                     GLFESEPIEKVETHDSSSTLRSETTESLEEHEDKFVTSGDDIIEKATAKSNLTQATAK
                     TEATSTETASSVGEKSDIGMSQTVSKSKKKKSKKKKTANKSDQAISEKASVGETETAT
                     AERSSLDTVPDDDPSWNIVTHAKKRQGLTKSKSHESSCQDINQTSSNMRGARGSAPYR
                     GAIAPPPPPPQINDSEFPRLPAVPENSSVHHTTSLNLARASNNASRSAHSNNKYNNNN
                     VQIASSNRPVTVPVTPNTTVQPLAPPFWPRARGRVQPGPGAFIQLDSTGFPCSMENCD
                     KRCCSLDYTSIICPRCGPLSEVRYCGKEHLFADVKTHWQWCGQFTFVVPARGNLPVVQ
                     SPPLVPSFYMWDNPERFRLALHHAVDRRADYFVFSDWIDYMRHGQPKDILNIRCPTQV
                     THKVSFSDPVMKDRFHRILGVCLMLSPVQLEFVNYLFRMIRDNLREQGVWNDNLNEAV
                     LYQMTLEFGVDLQDWFTGTRHACEVEWAGWNRCRGCRDITCLMEYKDGVKSTLLEQKT
                     KDLEANFWILRAHRYTHPDIPGMSQEAIQRRTRGEGFPDVIPEDQRLFIRGPGWDHAA
                     GGFEIEDYGG"
     gene            complement(<936201..>937184)
                     /locus_tag="TRUGW13939_02786"
                     /db_xref="GeneID:55990293"
     mRNA            complement(<936201..>937184)
                     /locus_tag="TRUGW13939_02786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485974.1"
                     /db_xref="GeneID:55990293"
     CDS             complement(936201..937184)
                     /locus_tag="TRUGW13939_02786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341867.1"
                     /db_xref="GeneID:55990293"
                     /translation="MRLEVSSSSYHSQSSSPPPSHTTAHKMIALASASATPSVTQNTT
                     NTKRPKLSLQTASLPIAFGKSSTGLARTCATASPTVRNTFNNAYETTRPLSTTDSPSP
                     CRLSNNSKGPRYPSPFSHHYRTSDAAPYQQPLGVRSILQNSPLKKMSVRRQSMSMSAG
                     ALTENRRVLFPVKKQVTFHYQLEEEIRTVKFVARHSDLDSDSEPEPQAELESEGDTSS
                     DSTGSHSDSHSSSGEDDGDIKNPLPQRKRRKSIPSERKIRAAALRDGLNEDHYAASLT
                     TVSQTDRSKRRCKWRWTLGENTADSELESVPSVLPTDRLEKNDELATTTCL"
     gene            <938798..>940640
                     /locus_tag="TRUGW13939_02787"
                     /db_xref="GeneID:55990294"
     mRNA            join(<938798..938836,938891..939178,939246..>940640)
                     /locus_tag="TRUGW13939_02787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485975.1"
                     /db_xref="GeneID:55990294"
     CDS             join(938798..938836,938891..939178,939246..940640)
                     /locus_tag="TRUGW13939_02787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341868.1"
                     /db_xref="GeneID:55990294"
                     /translation="MLRRDDRRIIIHFDYDCFYASVLEAENPALKSLPLAVQQKQIIV
                     TCNYEARKRGLRKLQLIKEAKQICPEVVIILGEDLTKFRDASKALYAHLRSFLWGQKA
                     ERLGFDEVFMDVTDMINHNVGLLNPNDLVHSFFCLDQQDPTQGFEFDATKFCGPTFPS
                     PCHNPPGGDRMDLLTYRLVLGSHLAHYIRSSLDHECGYTATVGISTSKLLAKLVGNVN
                     KPNIQTTLIPPYTHSFDNADLSNVIQFIDDHEVGKIPGIGFKSAHKLRTYFLRREPTS
                     QPYTERDHNDQVKVRDLRLSPGMGAPKLLDLLGGAGAPKDIGVRIWELLNGVDNSEVL
                     EARAVPTQISIEDSYQGINHFEEAKKKLQILATSLVKRMRTDLVEDNDDGTGRWLAHP
                     RTLRLSTRQRSPRNADGSREYSYANGRISRSAPAPSFLFNLGEGIESIAEKLVEESLV
                     SMFRKLHPDKSFGELSLINIAVTNMVESAGDQKQSSGRDIGQMFKNQESSLKKRPEGT
                     YSDRQPQHRQNSSPSWEANTPLDEATWEESEDEEESPLAHTCDICGAHIPAFALPAHA
                     LYHAAPD"
     gene            complement(<941339..>942106)
                     /locus_tag="TRUGW13939_02788"
                     /db_xref="GeneID:55990295"
     mRNA            complement(<941339..>942106)
                     /locus_tag="TRUGW13939_02788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485976.1"
                     /db_xref="GeneID:55990295"
     CDS             complement(941339..942106)
                     /locus_tag="TRUGW13939_02788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341869.1"
                     /db_xref="GeneID:55990295"
                     /translation="MANQVSLMDYLQHGPIPLPVIDQGQSPRNERNDSYSSDDITSVG
                     HWAEFNLTSIQQQYGAVLAAACIADEVFPPSPPRPVNSKSAVRSRINAYLTNRVVRAL
                     RCGFAHITSTNQLAGLSVLNYDTGTLAATIDNFVPDLGFFDPSPPVETRPNRAPGDIK
                     PSFKWSLELRNHPTAGIRSEFRQALSQVNWYMNQHHARYGFIITDRELVAIRRLDSNG
                     NLELSASIPWDANGTAAQPQLTVLLGLWYLGMLAAND"
     gene            <943712..>946262
                     /locus_tag="TRUGW13939_02789"
                     /db_xref="GeneID:55990296"
     mRNA            join(<943712..943781,943847..945035,945095..>946262)
                     /locus_tag="TRUGW13939_02789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485977.1"
                     /db_xref="GeneID:55990296"
     CDS             join(943712..943781,943847..945035,945095..946262)
                     /locus_tag="TRUGW13939_02789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341870.1"
                     /db_xref="GeneID:55990296"
                     /translation="MRFGSSWLSAAFSAAAVFLQCVDGNSHAPQPIRYVFDLEDVVIH
                     TPSHRVHSHSSFDVTFSLHNHEQQIKLKLEPNHDVLAEDAQIDYFNPDGSIGHSEPIN
                     RRDHRVFKGTSWTEIEPGHWTRVGWARLYVTRDGPEPLFEGAFSLMHDYHNIKLRSSY
                     MNTWRDVDALPEERDDDYMVVFRNSDMVAAEQEHTELKRSLAGVSCQADKLDFNSDPN
                     HPVFKPPQSPNVAFMPVDQFFGLSRRQSDTGDVGGNTGGINLASTIGSTAGCPTTKKV
                     ALIGVVTDCSFTNKFSSDQEARSDIIKMVNTASTLYENTFNISLGLKNLVVNTNQSCE
                     NSGTSTTPWNVPCTTGNITTRLDDFTKWRGEQNDTNAYWTLMSACSTGAEVGVSWLGQ
                     LCVHGDSNATVAGANVVVKTSTEWQVFAHESGHTFGAVHDCESDTCQRGLQKTSQCCP
                     LTSTTCDANGKYIMNPTTASDLENFSQCTIGNICSAIGRSSVQSECLVDNKGVVTTTG
                     SQCGNGIVESGEDCDCGGTAGCGSNACCEPTTCKFKSTAVCDDSNEACCSGCQFSAVN
                     TTCRAADGPCDVAEVCSGTSGDCPADKHLSDGTSCQTADETGLACASGQCTSRDLQCR
                     TVLGSVLGSNNTYACDDSSCTIWCASSVLPSNECGSMQQNFLDGTPCDGNGHCSNGRC
                     TGSSVGGKIKSWVDDHKPLVIGLAAGIGGLLLLMILSCIFSSCRRRHRARKFRPSQPG
                     GAYGRRLSRGGGGAGGWAGPMPQGPPRGGNPNNMQPPSGFYAAPAYPPPPPAYGEHNR
                     GMPMSQSRYA"
     gene            complement(<946807..>947677)
                     /locus_tag="TRUGW13939_02790"
                     /db_xref="GeneID:55990297"
     mRNA            complement(join(<946807..947307,947369..>947677))
                     /locus_tag="TRUGW13939_02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485978.1"
                     /db_xref="GeneID:55990297"
     CDS             complement(join(946807..947307,947369..947677))
                     /locus_tag="TRUGW13939_02790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341871.1"
                     /db_xref="GeneID:55990297"
                     /translation="MASSSHPPFGSRSAYAGAGSKLPDRSNPVPFSASAFSRNRGLGG
                     VNAEIAQQQQQLQQSQQHPPPAPPAHTQSHAAGPMGQDSGAANPLGRLTEEQREEISE
                     AFTLFDLDRDRHLDYHELRVALRALGFTLPKQELISLLTTYGVPRPQVQQQQQQGQGQ
                     NGPQPQPSSQNKINPPPHPSSLLMPLSAFQTVTAHKILERDPREEILRAFELFDEGGK
                     GYIDLEDLRRVARELGETGLEEDELRAMIEEFDLEGVGGVTRDGFLSICWQ"
     gene            complement(<948338..>948889)
                     /locus_tag="TRUGW13939_02791"
                     /db_xref="GeneID:55990298"
     mRNA            complement(join(<948338..948543,948606..948768,
                     948824..>948889))
                     /locus_tag="TRUGW13939_02791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485979.1"
                     /db_xref="GeneID:55990298"
     CDS             complement(join(948338..948543,948606..948768,
                     948824..948889))
                     /locus_tag="TRUGW13939_02791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341872.1"
                     /db_xref="GeneID:55990298"
                     /translation="MAVGGCFCGNVRVEYSGQPIKAALCHCIDCRKLTGTLFTYSFIV
                     KNTDLKVTGSPKEVPKTADSGNYIKNYFCPDCGTPLYGMRVNSDGAAADGVTVLRAGI
                     FDDLEVLNEHKAELEIYVDGRVNWLTAVEGADECVGMPPPSS"
     gene            <949850..>951445
                     /locus_tag="TRUGW13939_02792"
                     /db_xref="GeneID:55990299"
     mRNA            <949850..>951445
                     /locus_tag="TRUGW13939_02792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485980.1"
                     /db_xref="GeneID:55990299"
     CDS             949850..951445
                     /locus_tag="TRUGW13939_02792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341873.1"
                     /db_xref="GeneID:55990299"
                     /translation="MVSCPICAKSVRELNINAHIDSDCQKFIDEPGSSQAESASSQKS
                     APVASFFQPSSARKANTAQPPTPSSPSSTQKNGAKGTLSTPLQEDQKRKRTEPPAIET
                     EADPLPKRPKTNAIQKVAPLAERMRPKNLDEVCGQDLVGPNGVLRSLIEQDRVPSMIL
                     WGGAGTGKTTIARVIAAMVGSRFVEINSTTSGVADCKKIFAEARSELNLTGRKTILFC
                     DEIHRFSKSQQDVLLGPVESGVVTLIAATTENPSFKVQNALLSRCRTFTLDKLTDDDI
                     ASILKRALVTEGPSYSPSELVDDELIGYLATFSDGDARTALNLLELAMGLSTRASMTK
                     DILKKSLTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLGRMIQSGEDPLYIAR
                     RLIVVASEDIGLADNSMLTLAISTHSAVEKVGLPEARINLAHATVAMSLSPKSTRAYR
                     GLNNAYAALAEPGTASLPIPLHLRNAPTRLMKELGYGREYKYNPNYKDGKVVQEYLPE
                     KIQRLKFLEDHDLGHLEDPELFS"
     gene            <953981..>955774
                     /locus_tag="TRUGW13939_02793"
                     /db_xref="GeneID:55990300"
     mRNA            join(<953981..954054,954124..954192,954253..954337,
                     954396..954501,954571..954643,954708..954861,
                     954918..954931,954991..955414,955484..>955774)
                     /locus_tag="TRUGW13939_02793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485981.1"
                     /db_xref="GeneID:55990300"
     CDS             join(953981..954054,954124..954192,954253..954337,
                     954396..954501,954571..954643,954708..954861,
                     954918..954931,954991..955414,955484..955774)
                     /locus_tag="TRUGW13939_02793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341874.1"
                     /db_xref="GeneID:55990300"
                     /translation="MSATTARADPFKPAARVAGQRQDVWSIVNEAAAASPVQPIVNMG
                     QGFFGYNPPKFALDAAKEALDKVDCNQYSPTKGRPRLKKALANAYSKSLGRELDPETE
                     VSITTGANEGMLSAFMAFIEPGDEVIIFEPFFDQYISNIEMPGGTIRYVPLHPPKDGA
                     TRTSSAAEWKVDFDQLEQTINSKTKMIVLNTPHNPVGKVFSREELERIGALATKHNLI
                     ILSDEVYDRLFYVPFTSIATLSPELYERTLTVGSAGKAFYATGWRVGYLIGPPHLVKY
                     VAAAHTRICYSSVSPLQEASAVAFEKAEGEGFWEQSRDEMRGKVDLFCKVFDELNIPY
                     SDPEGGYFVLANMASVKLPEDYPFPPHVANRPRDFKLAWFLIKEVGVAAIPPTEFYTD
                     KNAHIAEDYLRFAVCKNDDVLETAKERLRGLKKYITQ"
     gene            <957086..>959238
                     /locus_tag="TRUGW13939_02794"
                     /db_xref="GeneID:55990301"
     mRNA            join(<957086..957262,957321..957510,957569..957600,
                     957658..958780,958861..959075,959131..>959238)
                     /locus_tag="TRUGW13939_02794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485982.1"
                     /db_xref="GeneID:55990301"
     CDS             join(957086..957262,957321..957510,957569..957600,
                     957658..958780,958861..959075,959131..959238)
                     /locus_tag="TRUGW13939_02794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341875.1"
                     /db_xref="GeneID:55990301"
                     /translation="MASQPSDEPSDPGSKSHSPLSDRTSHAEIGISETSGRVILGSND
                     ATYVGATHWAAILDDIEEVKGYFSETGEETSLGDHDLSLLFNSTGSTATREDLLAALP
                     EPNIVNRLVSRYFNSNSPAMHIIHKPTFQKNYKKFWADPSSSPISFIALIYSMMCLGI
                     FAELGAGEENADVSSTPTETIQIYRRCCAQCLALSNYAEHPGTYTLETFLLYMECEFV
                     LSKGDQMSCYLIGGVAVRLALRMGLHRDSENVQGNITPYQGEIRRRVWHLLVQMDLLV
                     SFHNGLPSMVQAVKSDTQEPLNLLDQDFDEDSTELPPSRPETEITCMSYTLAKGRLAR
                     VFGKIIEQANLLTLPSYTEVTALDQELQQAFSATPPFLCVVPMDHCITDTAELVIRRF
                     SLAVLFQKSRCILHRKYLMKQKENVDFSYSKKSAIDASRELLRMQSEVHDATQPGGLL
                     YKDRWVISSLAMHDLLLAAVILYLCLIQESIDVSPTLRDQQTPNTHQTEIIEALEGSL
                     HSIFQRHGLETDVCTGVDDAITLGRFGGGQFEGLGDAFPFPSPTIQSNIDFVSMPPDI
                     IGEITDISMDFDWDFFDNHVRHTQINNQSWPDTPFHNFNSREENNSSP"
     gene            complement(<959296..>960476)
                     /locus_tag="TRUGW13939_02795"
                     /db_xref="GeneID:55990302"
     mRNA            complement(join(<959296..959523,959584..959652,
                     959712..960026,960090..>960476))
                     /locus_tag="TRUGW13939_02795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485983.1"
                     /db_xref="GeneID:55990302"
     CDS             complement(join(959296..959523,959584..959652,
                     959712..960026,960090..960476))
                     /locus_tag="TRUGW13939_02795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341876.1"
                     /db_xref="GeneID:55990302"
                     /translation="MVSLLSAIFPPVPSFTEKDLPVLTGKVFIITGAASGVGFELSKM
                     LYVAGGSVYVTARSVPRCEGAIEKIKAQTSGRKAKGILKPMVVDLADLNTVKAAVEEF
                     LRQEIRLDLLVNNAGVMNTPVGSKGKQGHDLEMVTNCLGPYLLTKLLEPILIRTAALS
                     SPFSVRVVFVVALMQLFTPTSAMSFDGDGNPKILPGDNYMQSKPGDNYMQTKVGGTWL
                     AAEFANRLANKCILSVSVHPGLMRTELQRNMAVSARVGMKLLFKGPVYGAYSELFAGF
                     SPKLKAENNGGYVLAWGRIAEVPGYVTDGLKSKEEGGSGGAKMFVDYCERETIRFQ"
     gene            complement(<961707..>965504)
                     /locus_tag="TRUGW13939_02796"
                     /db_xref="GeneID:55990303"
     mRNA            complement(join(<961707..963092,963147..964634,
                     964688..965062,965119..965154,965214..>965504))
                     /locus_tag="TRUGW13939_02796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485984.1"
                     /db_xref="GeneID:55990303"
     CDS             complement(join(961707..963092,963147..964634,
                     964688..965062,965119..965154,965214..965504))
                     /locus_tag="TRUGW13939_02796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341877.1"
                     /db_xref="GeneID:55990303"
                     /translation="MAPQGGSGGHWSAANPIPTIQKFVENLDQDKRDRDQQIDDEIKR
                     RQQDANKSKQAVDREVAELANKKARQVTDPVTGREVSIADVGKEYMEDIESPSLTVPN
                     ANLDKPTTVKTDPSQEFAEYKNNQDITAPPEPIAQGTTSDVPIHGEKTNILFHPTPSV
                     SYQPMFKELEKRANGLAAGIALAVIVLGRAFGGSLWGLVPLSFCLASGVYLWMKEVVR
                     SGREYEWHSEKLRGETATANLLPESVEWMNALLGVTWGLLNPEMFAGVADTIEDIMQA
                     SVPGVIENVRVSEIDQGNNPIRILSIRSLPDDHVQDMKENIRKEDKKNKDPQEAAADE
                     EGGDYYNLEVSFAYHAQPTGESASEKARNMHMQLVFYLGMKGLFGVPFPIFTELIELI
                     GTVRLRFQMTPQPPFAKSVTFTFMGLPHVRAGCVPLVKKGVNILNLPLISNFVNYAIG
                     AAASLYVAPKSMSLDLSMMLKGDDIQKDTLALGVFWIRIHRAVGLSKQDRRGSNGGGS
                     DPYINLSFSKYGKPMYCTRVITDDLNPIWEETAALLVTPELIKADEQLSVELWDSDRN
                     SADDIVGKVELSIQELIQHPGKMYQQVSKLKGMDDDSSMPGELRWEVGYFGKPRMRPE
                     LRTDGKNRELPENLRHDPALQDEKGIINTDEEDAVTHTPPDPLWPSGICSIVIHQIVS
                     LQLENIKGTQGSRKGKEFEPAKSYGENTEEQGKELPTSYCTLLLNDQLVYRTRPKAVS
                     SRPIFNAGTERFVRDWRSSIVTVTVRDQRHREHDPILGVVSLKLSDLMKTSSQVTRWY
                     PLDGGIGFGRIRISLLFRSVETRLPPSMLGWDVGTFEFLSDRITLKGFSQTAKLWLRT
                     GGSTGKISKKLCKQDGDSQYFDLSDESRKPRLPVKHRYRSPVVFEIRLPGKRSTAAYA
                     TLWLQHLVDNENTSVDIPIWTTKRGDRLVQNYITEENAHTLGLDTLDDLTEVGRIQFT
                     GRFSPGMDESHEHFVTDNDSRETFETWEACQAEGVRSRYVSVEIPKAVREMHEKSLVQ
                     GRDVIREANPSERKRWVAKDGVDWSGTFGEDPIDFVNGKPTTNEAINGAIDESNHVAE
                     NDDDNDDAEDNDDDSSDDDDDDTKTNSTGLTTSSSAGQSSRAGNRSNKRSEHRKQRGL
                     MQWKPARNASFAKDEASFALKKLKKKFGMGDLTGREPGVETETGA"
     gene            <966368..>967321
                     /locus_tag="TRUGW13939_02797"
                     /db_xref="GeneID:55990304"
     mRNA            join(<966368..966503,966579..>967321)
                     /locus_tag="TRUGW13939_02797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485985.1"
                     /db_xref="GeneID:55990304"
     CDS             join(966368..966503,966579..967321)
                     /locus_tag="TRUGW13939_02797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341878.1"
                     /db_xref="GeneID:55990304"
                     /translation="MSSPEESPAQRAARQRRERREAKIKAGGSARLDKITSLSGRTPA
                     STHDNISPSPSPQPPSRTDSPAIPPSLSPEAFSRPSPPVDGPSGDDMRAQQEYLKALL
                     RSNPAEQQNQQQIDQDPMLKLLSSMMGGIPGAENTAPGSGLTPPPPGNNLKPDDLAGA
                     LGIPPFLSKFLLGGGSAPMSPAQKKQERVWKLLHTVFSLLIGVYLVILVGSSIATYGG
                     SPPPPAAAQNPFVVFMTGELLLNGLGILLGTSQQGTLALGKQLFSSLVRDGSIAVFIL
                     GVGSWWNGGWQVLGSY"
     gene            <969007..>971330
                     /locus_tag="TRUGW13939_02798"
                     /db_xref="GeneID:55990305"
     mRNA            join(<969007..969042,969106..970350,970412..970672,
                     970730..970859,970921..971195,971271..>971330)
                     /locus_tag="TRUGW13939_02798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485986.1"
                     /db_xref="GeneID:55990305"
     CDS             join(969007..969042,969106..970350,970412..970672,
                     970730..970859,970921..971195,971271..971330)
                     /locus_tag="TRUGW13939_02798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341879.1"
                     /db_xref="GeneID:55990305"
                     /translation="MSEGDVKPPTPVVAEAHDVDTFHVPEAFYKKHPTRPHLKNFDHY
                     KQLYDESIRDPNTFWARMARELLSFDQDFHTTHSGSFANGDNAWFLGGKLNASFNCVD
                     RHAFKNPDKVAIIYEADEPSEGRSITYGELLREVSQVAWVLKSQGVRKGDTVAIYLPM
                     IPEALVAFLACSRIGAVHSVVFAGFSSDSLRDRVLDADTKFVITSDEGRRGGKIIGTK
                     KIVDEALKQCPDVRGVLVFKRTGADVPWTKGRDLWWHDEVEKYPNYLAPEPVDSEDPL
                     FLLYTSGSTGKPKGVMHTTAGYLLGAAATGKYVFDIHDDDRYFCGGDVGWITGHTYVV
                     YAPLLLGVATVVFESTPAYPNFSRYWDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHK
                     MEHLRVLGSVGEPIAAEVWKWYFEKVGKEEAHICDTYWQTETGSNIITPLGGITPTKP
                     GSASLPFFGIEPAIIDPVSGDEINGNDVEGVLAIKQPWPSMARTVWGAHKRYMDTYLN
                     VYKGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALLEHPMVAEAAVV
                     GIADELTGQAVNAFVSLKSGNESTDQVRKDLVMQVRKSIGPFAAPKAVFAVEDLPKTR
                     SGKIMRRILRKILSGEEDSLGDISTLSDPGVVAKIIDTVKASRK"
     gene            <972199..>978957
                     /locus_tag="TRUGW13939_02799"
                     /db_xref="GeneID:55990306"
     mRNA            join(<972199..972298,972575..972670,972952..976676,
                     976821..977045,977103..978779,978844..>978957)
                     /locus_tag="TRUGW13939_02799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485987.1"
                     /db_xref="GeneID:55990306"
     CDS             join(972199..972298,972575..972670,972952..976676,
                     976821..977045,977103..978779,978844..978957)
                     /locus_tag="TRUGW13939_02799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341880.1"
                     /db_xref="GeneID:55990306"
                     /translation="MSFGGGFSGFGQNNQQQQSSGFGSSSFGGTNTGGFGSNAANTNP
                     FGGNTGGSVFGNTSGGFGSGGGFGASNTTTQPNSLFGGNKPSGFGATTSSGGGIFGNN
                     TATSGGFGGGAAGGGGGFGSTGTTGGFGSTAATGTNAFGANKPGGFGTTTNTTGTGGF
                     GSGGGFGSTGAGATTGTGFGSSTGTAFSGQIPPPDGTANTPFNPVTEKDPSSNTNNVY
                     QSISYMQPYSRYSFEELRVADYQGGRRYANASGQPGAFGSSAFGSGFGAQQNTGFGSG
                     AAAAPAAGGFGAATSAPAFGGAAPTQTATGFGSGTTGTGSLFGAAKPATSLFGSAANN
                     AASTQSSLFGGNTATAGGFGQTANTGTGFGATGGSVFGNNQQAQQQPQQTKSLFGGGS
                     ATTGFGTGGGFGANTTTTPSNPFGGNTTSAFGNQQQPAGTGTSAFGGFGAQPQNQSQA
                     KPGGLFGGGTQQQQGGTGLFGNATTGTSLFGQSNQQQQQQPQQAGGSLFGAQPQQTGT
                     GVFGGNQQQEQKPSLFGGLGSGTNTNTGTGFGLGGAQNAQTGTPSLFGNTQAQSQQQK
                     PGSLFGTGGGSLFGQSNTNQNTGSAFGSQPQQQQAGSFGASSLFSQQNQQQQPAQQQP
                     APGSFQASLLDGNPYGNQSIFSGLPVPNAPSPGPLATPLSASMKQKQRTPLPVYKITP
                     NAANRLITPPRRQGYGFSYSTYGSPSSASSVSSLTGSLLGNSVRGGNINGSLGRSFGK
                     SFSTSNLRNSFDPDSESVLTPGAITGGQASRYSSGSLKRLTIDRSLKSELFTPTALSA
                     TPITNGEYVPQSTEKLKKRVSFDAPTDGALVRTETETPETTAEELGFIRSARKPEATN
                     GTNGSAAQRKPEMEVRGKELAVVPEHTGLATTNGTPSPVTTDPQPGQYWMKPSRLELS
                     KMSREQLKHVENFTVGRQKCGQVTFGEPVDLTNIDLDSILGDIVKITVRSITVYADDA
                     SKPPLGKGLNVPSTLRLENSWPRGRDKKVSSSINSGPFYDKHVQRLQRIKDTEFVGFE
                     RDTGVWIFRVPHFTTYELDYEDDEGESLNQSTLSAGPDTPTPKARSPATENTFNSEIN
                     STFSLDESFVGSMAGVDDDTFDFKKRKMVPGAFGDQMMQAEDEGVNSAGEDGDGSFLE
                     DGSTGSVIERDAEDDMTESIGSETGSIEDEDMEMAGSFPIPHQTVEHDDTARTGFSAL
                     DVTSDSMRLGTPTKPRLDLSGDWAQQLQRTISPRKQDRETLRVKQGDAFVDKSRLTEI
                     KQQAQPASASPSKTFTSSIDVMQSLFSQPSKSPGKKQKGKLKAFELPHSKTPKTFASS
                     SNELSASDDAFHQTYKPRWGPRDSLVEINDNNGDLQQPSSEFWLPTASFNGVNIRPFK
                     GVPESVNILESQRRQSSIREVDGIPYARNEKTDFQSFTQSSTGASLQAGYERFIWQLT
                     NILFNDEIEDDISAGVPPQLRKKFLHRIKKDRLSRLWESLVREKYGQDLEAIVAPEER
                     AVAFLTFHRVEDACKALVESGNLHLATMLAQIGRDKTSRLDMQRQVESWRQHNVFSEI
                     SEPIRTLYELLAGNTLRSVGRPSGAPEDRASTFTFSERFELNWVQAFGLRLWYGITED
                     QPIEAAVSLFLHDITAGDERAYPVPLHMEAEYAEKRQSNLTGLQESPLWVLLKVYAAA
                     AAPGGTSVSDLSVNLPEAILPEAVSGSCLSSRLSFQLHQAITTTVGYNEHIVINKARA
                     DQLTWNYAWELIASGSMEPALFVLLHLSRATDREHAVKETLGQFAATLPRPTTEDGKV
                     DAGWTYLVNELRIPELWVWVAKALFARYSGDYANEVGYLIRARNWNEAHATFCRLVGP
                     RTVIEHDWNILRQLLTGFGDSPDQKVRGWGSGGAVYEDFLRLVTAHGRRDQSVLKRLI
                     GSLVIMGEKIKQTPGAEVLEERVAFMEMSKVVAGWCARDEDGVELSAILKLPLTGDAR
                     LMHTAEISRRYYSMVMASAH"
     gene            <979564..>981324
                     /locus_tag="TRUGW13939_02800"
                     /db_xref="GeneID:55990307"
     mRNA            join(<979564..980687,980763..>981324)
                     /locus_tag="TRUGW13939_02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485988.1"
                     /db_xref="GeneID:55990307"
     CDS             join(979564..980687,980763..981324)
                     /locus_tag="TRUGW13939_02800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341881.1"
                     /db_xref="GeneID:55990307"
                     /translation="MASKTDESSYIPTPHQDESSPTQKPESIHSDAEKRSQSIDDNIN
                     EKIIEDPTTDIEAQNLAKSTTNKSEKPFTAFANYQIWFIVAMASAASFFSPLSGQIYF
                     PVLPILTKNYGLTPALLNVTVTTYMIFQGLMPSFMGTFSDASGRRPAYILAFIIYTAA
                     NIGLALQNSYAALLVLRCLQSAGSSGTISFGFAVVADVVTTAERGKYMGPMASGIMLG
                     PALGPVIGGLLAQFLGWRAVFWFLVVVSGSFLVIYAVFQPETHRQIVGDGSVTPSEGW
                     RLSLVQYIATKRKVARMSAEEKKEYEKTRLGLKEQQTARKLGFPNPLKSFAILLQKDA
                     LALVVYSGLMMFGNLVLMTATPTLFPGIYGLNELEVGLCFLPLGVAAAVGSIINGKLL
                     DWNYRRLAAKHGMAIERKRDQDLTEFPIEKARLQMAIGFASGIALLYIPYGWALQYHA
                     HLAAPMVIQFLIGCCTVCTSNSLSTLLADLFPGQVATASAAQNLVRCWLGAVGAAVVD
                     SMLSGMGTGWCFTFTAFMLLAGVGLLWVEMKWGMGWRQKRWAQDKAKKEAASS"
     gene            complement(<981517..>985753)
                     /locus_tag="TRUGW13939_02801"
                     /db_xref="GeneID:55990308"
     mRNA            complement(join(<981517..982674,982741..982812,
                     982870..983266,983462..984731,984783..985042,
                     985122..985685,985743..>985753))
                     /locus_tag="TRUGW13939_02801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485989.1"
                     /db_xref="GeneID:55990308"
     CDS             complement(join(981517..982674,982741..982812,
                     982870..983266,983462..984731,984783..985042,
                     985122..985685,985743..985753))
                     /locus_tag="TRUGW13939_02801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341882.1"
                     /db_xref="GeneID:55990308"
                     /translation="MDQSRNKADAVLRAHSLLHEWVLQHGGRLDERTQFARDDQRGVH
                     IQVKPDQSANLPRKTCVIKLPLALTMSYFDAIDYRLPGNDEASFSSHGVVFPKPFMTS
                     IGSEETTAFFLMGQYLKAENGFWYPYIRSLPRPDELTTPLFYSDDDLAWLNMTSLAAA
                     REQRLQIWRTNYEKGVACLREFQFEGVDAYSWELYLWASTIISSRAFTAKVLAGVIPM
                     DQLAEDKISVLLPMVDATNHRPLAKVEWQAGTDSIGLAVMEDVTPGSEIGNNYGPRNN
                     EQLMMNYGFCIPNNPFEYRTINLRAPPGSPLAQVKAQYEQHFSKASSNTDSEDKYYVF
                     SINYHHTNNAASQQPLEYSVFSPDLLNTLSIITANDRELEAIEMDENGFRIPVEKYGN
                     SRNFVAALNQIVIELLSYVQRLQASVTQLGEPRNLHQAYAKQYRESQIRLSQAAAFIA
                     NWVISRSRSSDASSESDAEGCEKLLARVPSNVFDTNTAEKIKTKILAQTSLLPEGNRR
                     GELFLFQELFHLLPTDMSDLCRECLGQISTQARRVVVISDDMGGGQKDGGNSGPHGLF
                     DYSLFICFLVAAYRQNPSRISPRLRSWCEFLLTRYTAPPNDVSWTLPDEDDEAILSAF
                     DSLIDDHTPAENFTPVASIVGATPATGERAVNDWWLSPNWIRWAWLVLEQEMVRNVVD
                     EPLEYIIYGAEKGMKTINLFKPTRGSRQQSLELQLPPPGDIFSPPRPLAPLGVQFKML
                     SRAAVPSASSLAQISSRALPSTSAAVRLSTPAQTTRSFATVQDGSTPKKQHGGLADQD
                     RIFTNLYSHHGADLKSAMKYGDWHRTKDIVLKGHDWLISEIKASGLRGRGGAGFPSGL
                     KYSFMNFKDWDKDNRPRYLVVNADEGEPGTCKDREIMRKDPQKLIEGCLVVGRAMNAT
                     AAYIYIRGEFYHEATILQRGIQEAYQAGLIGKNACGTGYDFDVYLHRGAGAYVCGEET
                     SLIESLEGKAGKPRLKPPFPAAVGLFGCPSTVTNVETVAVVPTIVRRGPSWFAGFGRE
                     RNQGTKLFCISGHVNNPCTVEEEMSIPLRELIDRHCGGVRGGWDNLLAVIPGGSSTPI
                     LPKAVCDDQLMDFDALKDSQSGLGTAAVIVMDKSTDVVRAISRLSHFYRHESCGQCTP
                     CREGSKWTQQIMSRMEKGQAREREIDMLQELTKQVEGHTICALGEAFAWPIQGLIRHF
                     RPELEARIKQYEQENGKQPFAGGWAPGTRNEGKLIAPGQ"
     gene            complement(<986296..>990325)
                     /locus_tag="TRUGW13939_02802"
                     /db_xref="GeneID:55990309"
     mRNA            complement(join(<986296..986958,987507..988205,
                     988265..989605,989660..>990325))
                     /locus_tag="TRUGW13939_02802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485990.1"
                     /db_xref="GeneID:55990309"
     CDS             complement(join(986296..986958,987507..988205,
                     988265..989605,989660..990325))
                     /locus_tag="TRUGW13939_02802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341883.1"
                     /db_xref="GeneID:55990309"
                     /translation="MFWRFGGYATISTVDTLLDKPDVSLEELLDEAELISELKQHNTK
                     LIEYLREDHILKRLMEYVVAPPLINEEDDDDAADEPDSAARQGDDEPSEEKEKHDLLD
                     PEDLDRAEKQRSKFAYIACEILSSETWSILESIMLNEAYLRDFWAFVKRPAPLDSLQA
                     GYFTKVNEVLFDKKTEEMLDFFKSLPDIIPSILQHIDNPMVMDLLLKIISLEKVEGGQ
                     GIVDWLKNKDLIPTLLSYISSDYPTSVQTSAGDFLKAIITISANATQSEQSCIGPNSL
                     TRQLVSAERVEQLIRLMLLGGNSLTVGVGIVIEVIRKNNSDYDPDTAGGPDSSPSLYD
                     PIYLGILLRQFSTHIPDFMDLIVSPKHSVIVDGKATMVDRGQLKASWGNKIEPLGFDR
                     FKTCELMAELLHCSNMGLLNEVGSEEYIRQRDLEREMLVRQGAFDINRDHDSSAEYNE
                     NEGDFGQDSTAESQSRAPGAANPSDDDGFEDVSSSGVLVEGADAAARNTNTAAKQTEG
                     HTQPPGLHIEDSIVEETLNDLSGSSKIESSTPIEPSVGPLSPTEAGVTEKVGEIALEN
                     QSSAVNIPAGATSQQSPVLSPHAEDTPAPLFAPPNQEEQDVQAVPDNTSTETPVGTET
                     PGNVDSNPIEDEYTPQIQYDAPGQPVVGDFLKIQFVEHKVVPTILGFFFRFPWNNFLH
                     NVVYDVVQQVFNGPMDRGFNRSLAIDLFHTGSITERIVEGQKRSDESQSTRNMRLGYM
                     GHLTLIAEEVVKFTERHPPEILSQTVMDKVLHNDWIEYVESTLSETRERDNAILGGVR
                     PDIMGHRQAVMNAVGTAQGLTGSNALANAGLNGGGGGGNGYSFENFDSMTHGSASSGA
                     FGLGGSSSLLSGFGSSSDDEDEDMEDQDDEDLRDTTDSTAGGGSENVSSSSSQPIPIL
                     APPPAPLNIVPSRARRQLAARLALHKQQAEAAQNSEGSSRANDVHENDEQWQSNPFVI
                     AGLEDDNTASAGPAATEFTAVESNESPPSPTFHTGFTPPKSPSTNSSDEAAEEVNETV
                     RRKVRVPLEVDDDDDEYGEFRSGDIRDSDEEEEAIINESLGYSSFFGPSRYGGYNRPY
                     GRDGFDDDEGNDSSDGEDGLVEILVPGRKSTSSN"
     gene            <992030..>992783
                     /locus_tag="TRUGW13939_02803"
                     /db_xref="GeneID:55990310"
     mRNA            join(<992030..992095,992199..>992783)
                     /locus_tag="TRUGW13939_02803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485991.1"
                     /db_xref="GeneID:55990310"
     CDS             join(992030..992095,992199..992783)
                     /locus_tag="TRUGW13939_02803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341884.1"
                     /db_xref="GeneID:55990310"
                     /translation="MNRLFGSKNTAPKPTLDSAISNVDNRASSIDVKLAALNSELSTY
                     QSRLAKMRDGPGKNALRQKALKVLQRRKQYEAQRDQLSQQSWNMEQANMMQDNLKNVM
                     TTVDAMKTTTKTLKKQYGKIDIDKIERMQDEMADLMEVGNEINESISRAYDIPEDVDE
                     ADLDAELEALGEETMFESQLGEEAMPSFMQDEVAPPTFIDEPPEQGKVKEAAGGVG"
     gene            complement(<992991..>994804)
                     /locus_tag="TRUGW13939_02804"
                     /db_xref="GeneID:55990311"
     mRNA            complement(join(<992991..993804,993868..994139,
                     994193..>994804))
                     /locus_tag="TRUGW13939_02804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485992.1"
                     /db_xref="GeneID:55990311"
     CDS             complement(join(992991..993804,993868..994139,
                     994193..994804))
                     /locus_tag="TRUGW13939_02804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341885.1"
                     /db_xref="GeneID:55990311"
                     /translation="MNQTSRTDDVVDHPGWNQNPPLLSAEETTRQDLNGIVNLREQRD
                     HTLQNTDARETPTQIDVVQPQDENAETTPPSKNEDAANADNQPQKRARAATLKLSIRR
                     FLRPFVKFASFVGPGFLVAVAYIDPGNYATDVAAGAESRYALLFVVLMSNLFAVFLQT
                     LCIKLGSVTGLSLAENCRVHLPKWMNMALYILAESAIVATDIAEVIGSAIALNLLLKI
                     PLVAGCVISLVDVLFLLIFYQPNGSMWGLRAFEFFVILLVVSVVICFCIQLSLIKEQS
                     VGTVLRGYIPSAAVVRGSGIYQSCGILGATVMPHSLFLGSGAVQPRLREYDRGKGYIE
                     ADNGEEDDVDWRPSLQAIRSCMNYSIVELALSLFTFALFVNSAILIVAGAALYGTPGA
                     GNADLFGIHRLLSQSIAPAAGTIFGLALLLSGLSAGIVCTIAGQMISEGMIQWTCRPW
                     IRRLLTRAISIVPAVIIAAAIGRDGLNTALTASQAVLSVILPFVTAPLVYFTCRNKFM
                     TVGASRDTSVDSGHNEVQPEEVKMRNSWPVSALAIAIWLAITIMNVALLVLVGLGLA"
     gene            <996177..>998723
                     /locus_tag="TRUGW13939_02805"
                     /db_xref="GeneID:55990312"
     mRNA            join(<996177..997133,997184..997770,997829..>998723)
                     /locus_tag="TRUGW13939_02805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485993.1"
                     /db_xref="GeneID:55990312"
     CDS             join(996177..997133,997184..997770,997829..998723)
                     /locus_tag="TRUGW13939_02805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341886.1"
                     /db_xref="GeneID:55990312"
                     /translation="MASYAQPPAIFDETSKPSGLRSFLSSRAHKRSPSAGDALLARSN
                     APGNDSLGAAGFLPADHPHALPLGERAHNRDAGGSSRPSRKGDKLHHKTKSSVSLKAL
                     IGEREKKDTRSPDSPEEGSLERTMKKVKSSTSLSAILKRSYRGRKGEPPNETKERENQ
                     RPKSDFSPPIWAQFATQPLEDASGSVSVPDHGRSLEEEVSLYTPKNYDPSKQRNFYDY
                     HQPTLVTKPRPKSDYISSGTTKMREMLGHIQRIPSDKQRNVEKQVQNQGFGDVRSSQD
                     SKRSSNPGSNRVMAAVSAFNAKEAGTRRSVDSKQIESEFEKLLDARNIPQNMRDKMRS
                     LDTNIKADFIQKNRTDGSCPNSATSSTFDSAGRRGRKDTRPNSIHSPDKSARSRSRAR
                     SPFSVSKGDSSPKKHQKSDSASSIKRPKSSDLGRPYSSMLPGASTSATSLQTTAHTDT
                     AADPADFIHYMREVQKPELVEVGKLHKLRLLLRNETVAWVDSFIADGGMDEVIQLLYR
                     IMKVEWREEHEDNLLHETLLCLKALCTTSLALQRLATVAKDLFPALLSMLFDEEKKGP
                     SEFTTRGIILSLLFTYLSTSSVEAMPARASEILGFLRDPCPENQKVAFIANIYQPRPY
                     RVWSKEVTNVTKEVFWIFLHHLNVIPMARQEDDQEQSYLARHFPVPRPPVPAAPYVGG
                     VEWDATNYLASHLDLMNGLIACFPTREQRNTLREELHASGFEKVMGGSMRTCKEKFYG
                     AVHDCLRTWVSAAREDGWDYRFVREGPEPGSPSKSPKKSCQKKQAEEPPKLALVMDFE
                     NKAPARESDVGGWI"
     gene            <999195..>1000009
                     /locus_tag="TRUGW13939_02806"
                     /db_xref="GeneID:55990313"
     mRNA            join(<999195..999317,999409..999742,999799..999866,
                     999920..>1000009)
                     /locus_tag="TRUGW13939_02806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485994.1"
                     /db_xref="GeneID:55990313"
     CDS             join(999195..999317,999409..999742,999799..999866,
                     999920..1000009)
                     /locus_tag="TRUGW13939_02806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341887.1"
                     /db_xref="GeneID:55990313"
                     /translation="MAAPRRLVSIASLAVRLTPSRLSHTRSAAICACPNLRVPALNHT
                     TALTLLSSRAFSTTPASHSASPFRLSSKDKNAPRENDSQEIPEEGYGEEEHIYYSPHQ
                     PKREWPPVMSKLSPKHQLRLERKYRRRAALKYARPRWVKATKLAQWGIIIFVMVYSAL
                     FMEWGKEDEEQPFKDFRKQFFDTFNSIVSTPQPPGRKIDSKEDK"
     gene            <1000532..>1001901
                     /locus_tag="TRUGW13939_02807"
                     /db_xref="GeneID:55990314"
     mRNA            join(<1000532..1000541,1000600..1001041,1001103..>1001901)
                     /locus_tag="TRUGW13939_02807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485995.1"
                     /db_xref="GeneID:55990314"
     CDS             join(1000532..1000541,1000600..1001041,1001103..1001901)
                     /locus_tag="TRUGW13939_02807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341888.1"
                     /db_xref="GeneID:55990314"
                     /translation="MSQAQQRLTQVSSHLSGSKSSSIHDKHPDDIVVTAALRTPITKG
                     GKGGFKDTAASDLLVGAFKGLISRSGIDPGLVEDIAVGSVLPPGGGATEFRAAALVAG
                     FPETAAVRSLNRQCSSGLQAVVDIANAIKAGVIDVGVGAGVESMSLQYGPGAVTEFSD
                     LLENHIESANCKVPMGVLSEKMAKDRGVTRAEQDAFAASSYQKALKAQKAGLFNEEIH
                     PLEVKWTDPKSGEEKTITVKTDDGVREGITAESLGKIKPAFAKDGSIHAGNASQVSDG
                     AAAVLLMKRSTAEKLGQKIIGKYVTSSVVGVKPLLMGIGPWKAIPVALEKAGVAKEDV
                     DIYEINEAFASQAVWCVKELGLPIEKINPKGGAIAFGHPLGCTGARQVSTLFSELKRT
                     NKKIGVTSMCIGTGMGMAAVWVAE"
     gene            complement(<1002289..>1008306)
                     /locus_tag="TRUGW13939_02808"
                     /db_xref="GeneID:55990315"
     mRNA            complement(join(<1002289..1002351,1002410..1007786,
                     1007876..>1008306))
                     /locus_tag="TRUGW13939_02808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485996.1"
                     /db_xref="GeneID:55990315"
     CDS             complement(join(1002289..1002351,1002410..1007786,
                     1007876..1008306))
                     /locus_tag="TRUGW13939_02808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341889.1"
                     /db_xref="GeneID:55990315"
                     /translation="MDGQTTPRVSILTSDNFHNGAEISRATSPGGQPPETNGAKKARV
                     RPRTYPYFQYLPYATEDDKQREDNLHEILKCLYVAVKAGDFSPGAVHWTRELRGWLSL
                     KFDPTREERVKLVRLYYELSLAPGIDPNVAERFASMFMLLTKRKHYLRPAKDLTLDWR
                     PLFKEIKTFVLPTESGLVHSTNLKRNIKTLTKLCAFSQLYFDPCEVPAMLEEFLPHYT
                     TSFAEGAFVVVGLMNLLLPTSPGPESREDLRPQTYLPTYFHLWSLVNRSKTFDMNFLD
                     LLSRLARDSLSASHIPFSEYGIYTKEQSSLIFTAVLRLLEIPVGQATSPYSALVDITS
                     GLGIMLDRDSRKHPVAHHIARWIVMSLSPACLESQDSILAQLEGLIQAVETFFHPSNS
                     GNWTKTLAQLVYYLADFFVMRWNRERSGEMDIPADRRLNEPLKKRFVLCLRDVIFMGI
                     YAKSGTAMNFSLSTLQSLAYLEPHLILPGALQRIYPSMQGLVEVHRTTSSLRSLQVLS
                     RIIVRTRGFRCHMTTLLGLALPGIDANDLEKSMHTLSFIQAVCYNIPFEDLTKGRDDV
                     NCSMLAMQWITGEVERMETEGANVEINYDTDLSDETEEMILRSSTAGFGEFLISFLGR
                     VFTLLENLPDASRVRSGSPEENVVNTLPATLMPLLSALSPELYDMALQKVVDFVANHV
                     IHQARDAMAFICNAVCKVNPEKALKRFVPLLVQGIRSEIDENGAASTRTTGSEVLPRD
                     RALVWNVSMLSMCVVHVGSAVLNHKQDLLDIAIYMQEKCKGIPTIHVSNFIHHLLLNL
                     TVTYTLDYRLFEAEDIKDGIKIEHWGYRPDPQNLNINWHVPKQEEIEFAVTLFENQAE
                     TALNQLTALTDETSNVARDGSGKEWSDEVTRKLVLLRLITSGISVLFDPKEAAKSDDS
                     SESSDVEMIEANGDEPEDENGDALDNTDEATVKETFNYPTGYSLSEGEPLYKKIHSIR
                     RRAGHVLHNVHRFLTEKQEDDVPCFGALYTAYRSWFIDVGIERSAHVLDRVTRLLAAD
                     IHPYKVSGIRKDYPRPLLIRRANVYHIQRLRHNAAPRPRSKVDEMLFLDLAESSVSLY
                     TDIRRNAQNAGESALKAVWGSRLLVIPRLLEALQKALKENDHARIKGALYSLLYGSLA
                     KTAGRHWKYTPVIVRAFIDASSVDKPSVQKLCSGAVYQIMDYGRPMERMAVLNEEIVN
                     SIAPQETVDSKIEQKRSSISQRRVAIEKKKADLAEELVGLARTSHWKIASRAASIVVS
                     MGLRFDYIASDNLIDLVTTGSIDTHPGLRGMYSQAMIALFTMIDVRAICSHSYENYIL
                     GNQHFPARINVATKRYEQGWTEEYLSSFAKSEAEYYVDHDFPGWLVWSEKMPAYKSNI
                     TKDIEYDETEWKVRSHMGKLFDRQWFSKFFMYLKQEPRDASADKFRMACAMMLLYVFE
                     LMFRDGLTAATFDEIKEEIEIVFEDGSDKHQHRATAEILGALISSVTDTDVEKRRIVW
                     EYAFPMVRKIFTDGLTPENSGYWTTFLHMVLQCRDPRRAWPLVDWLADFRLDMSSNAA
                     FKESSRISLLHQCIIDAGWHFQLEKPIVADFIAHLDHPYKGVREAMGHTLGSIYRTRY
                     HESHPDVDSLVKKQSSSSSIGSYPYEPSPEFSAMIRSVFERLRAWRHERQPGQQTPSS
                     YTSGSKTVLLWLDSTLSSHECTQLVPFFADIFTEELLHMMDIKEDPELQSLAYHVFRH
                     LPNIPHPAESNSPFVDNLIHIGQQSTSWHQRLRVMINMQIIYFRRLFLLSASDRNKLF
                     ECIATMLQDSQHEVRVGASATLSGMIRCSPIALRDEYVKKFQKRFTETLAKNPLPKKP
                     KNHVGRSSAVSSRTATPTPEHTKLIIVRHAAVLGLGALIQAFPYASPPPIWMPDALTT
                     LSTKAASDPGVVGQSVKSIISEFKKTRQDTWHIDQKAFTPDQLEDLAGVLWKSYFA"
     gene            <1009745..>1011681
                     /locus_tag="TRUGW13939_02809"
                     /db_xref="GeneID:55990316"
     mRNA            join(<1009745..1010022,1010088..1010372,1010439..>1011681)
                     /locus_tag="TRUGW13939_02809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485997.1"
                     /db_xref="GeneID:55990316"
     CDS             join(1009745..1010022,1010088..1010372,1010439..1011681)
                     /locus_tag="TRUGW13939_02809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341890.1"
                     /db_xref="GeneID:55990316"
                     /translation="MSKSLFAAPDAGRGPRTAFENGYNQKPSTLDPSYRITEQPIGTK
                     RPIRVACMGAGYSGLMMAIVFSQQMKDSNAELVIYDRNTDLGGTWLENRYPGCKCDIP
                     AHNYAYSFAPNPDWPNYYATSEQIHEYMHGVADKYDCNKYIRYSHTIKSAVWNEDKAK
                     WALEVETIDKAVINDEVDVFINAGGVLNNWKWPNIEGIHTFKGKLMHSARWDQDYDFS
                     GKKVANIGIGSSGVQIVPQLAKVAGSMDVYIRTQTWISPAPGINEPTENDPDMDTEYN
                     FTEETLQMFQDPKLLRDYRAAIMDRRSNNFKRAIAESDLQKRAQELFRKSMKDRLGDT
                     PKGQQAAQYLLPDFPVGCRRQTPGPGFLEALTQDNVELRWDDVSQITEKGIITRSGEE
                     KEYDVIVCATGFDTSFRPSFPLVGRNGVNLAHKWETDLPQAYFGLAVPDMPNYFSFIG
                     PNSTISNGSLVLGIQATAVYIYKWLQKLQTEMIRSFEVRHDVNDEYNQHMQRYLERTV
                     WTRGCRSWYKRGTVDGPVVAVYGGTTFHFMEAIKTPRWEDFYIDRLPEAQANRFAYLG
                     DGFTKRETHGGSIGATQTIDFDEYWRLFVLPDIHD"
     gene            complement(<1011969..>1013037)
                     /locus_tag="TRUGW13939_02810"
                     /db_xref="GeneID:55990317"
     mRNA            complement(join(<1011969..1012261,1012343..1012637,
                     1012704..1012778,1012849..>1013037))
                     /locus_tag="TRUGW13939_02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485998.1"
                     /db_xref="GeneID:55990317"
     CDS             complement(join(1011969..1012261,1012343..1012637,
                     1012704..1012778,1012849..1013037))
                     /locus_tag="TRUGW13939_02810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341891.1"
                     /db_xref="GeneID:55990317"
                     /translation="MASWTHLVRFIAIEDNQTHLGQLVDPSRDAGRDAVDGRDIAVYL
                     LDGTIFDGRVTREILHVKQVLSPISKEDCNYIRCLGLNYMDHAKEANLPLPKAPVLFT
                     KPRSALSDPFPAPINIPKCAQDETSDYEAELCLVIGKTGRDISEEEALDYVLGYSASN
                     DVSARALQRLTAQWSFSKGLDGSCPIVAPSAIPDPQGLEVTAIYNGETVQQGQTKEMI
                     FSIKKQISYLSQGTTLEAGTVILTGTPAGIGALRQPKIVLRDGDEISVHISHIGTLVN
                     RVRYDTR"
     gene            complement(<1013431..>1014409)
                     /locus_tag="TRUGW13939_02811"
                     /db_xref="GeneID:55990318"
     mRNA            complement(join(<1013431..1013720,1013792..1013897,
                     1014100..1014204,1014269..>1014409))
                     /locus_tag="TRUGW13939_02811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035485999.1"
                     /db_xref="GeneID:55990318"
     CDS             complement(join(1013431..1013720,1013792..1013897,
                     1014100..1014204,1014269..1014409))
                     /locus_tag="TRUGW13939_02811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341892.1"
                     /db_xref="GeneID:55990318"
                     /translation="MANEFSAKYTNANVGQDAAHYDSELFLRLHDRMARLLPSSELAA
                     ALLVAILCAQSRGDTVVRLFQDIAKEKSEAEVRAIFIANLDYTTRGQETTTTLYRGVA
                     NSEVRQMTQQYFPEMSYYGRTTIFGFLVGSSPIFELKDTEILVAGSIAALGATRQARS
                     HVKCSISVGNSVETVLAMIDTVKEVVAWNRRPLQGEIDVGQLAKELEQTMAEQ"
     gene            <1014666..>1016389
                     /locus_tag="TRUGW13939_02812"
                     /db_xref="GeneID:55990319"
     mRNA            join(<1014666..1015481,1015547..>1016389)
                     /locus_tag="TRUGW13939_02812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486000.1"
                     /db_xref="GeneID:55990319"
     CDS             join(1014666..1015481,1015547..1016389)
                     /locus_tag="TRUGW13939_02812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341893.1"
                     /db_xref="GeneID:55990319"
                     /translation="METLPPFSKTTVLVIGGGPTGLTAALLLARYGLRSIVIERHFTR
                     SGQPKAHAINPRSLEIFRQIGLDTVQLRGLGVKPEDGDTVRFAVSMSGEEHGTLPYER
                     QGEETRAITPEPLFNIPQPVLEDFLWKAVTKNEMITSYRGMQWDCCSQVDGTRLSSKI
                     TDRSRGCSKIIESVYILDCGGANSRSRQPLEIPFSPLPEYGQTEVHHVSVHIRADLTR
                     FNPGTLWWISSSLVEGTFICYNRSSDWVFVTYYDPKTTPREKFSEEYCHTMIDNAIGE
                     HVPYEILSITVWSTWPRTAEFYQSKKFPRAFVMGDAAHAFPPTGGLGVNTGIADAHNL
                     AWKISAVEQSWADERILASYGNERRPVAIANARQSVKNQVKLRNLKAALKNPPSNSDP
                     VDASKWTEWKRRLETELQQNSEHFDSINLQIGYVYGPGEYSDEPCDNYTPRSIPGARL
                     PHAWISRDDEIISALDLVDGNSFVLFTKYQDLSRAPDAENVLVPIRTLYVGVDFTLLD
                     ESWLDVIGISEEGSSLLVRPDQHILGKVKSIDEVQRLLTEALIS"
     gene            <1016830..>1018140
                     /locus_tag="TRUGW13939_02813"
                     /db_xref="GeneID:55990320"
     mRNA            <1016830..>1018140
                     /locus_tag="TRUGW13939_02813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486001.1"
                     /db_xref="GeneID:55990320"
     CDS             1016830..1018140
                     /locus_tag="TRUGW13939_02813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341894.1"
                     /db_xref="GeneID:55990320"
                     /translation="MTATKSQYPPSTKTEGLPYYTPANNPGAALNPQEPNTPTLFRPL
                     QIRDVILKNRVAVAPMCMFSCESDPTSPAVGALTDFHVAHLGHFATKGVGLVMIEATA
                     VQATGRISPNDSGLWQEGTDSEQYKGLRRVVNFVHSQGAKIGVQLTHAGRKASITTPW
                     LVEIGSSSRADESVGGWPSDVVAPTGGEEFKWAPGDKKFWAPREINVSEINELIQAFA
                     RSAKLAIQAGVDVIEVHAAHGYLLHEFLSPVTNRRNDHYGGSFENRTRIIHEVTTAIR
                     AAIPVGTPLFLRISGSEWLEECPVAAETGSWDLSSSIRLAKLLPQFGVDLVDVSSGGN
                     HKDQRIQPHSNYQVDFAARIRREIRACRQTTLVGAVGLITEAEAARDIVQGADEVFSN
                     DQEPKADVILMARQFLREPGWVFAAAKKLNVPVSITNQFSRGLL"
     gene            complement(<1018410..>1020440)
                     /locus_tag="TRUGW13939_02814"
                     /db_xref="GeneID:55990321"
     mRNA            complement(join(<1018410..1018632,1018702..1018805,
                     1018881..1019489,1019542..1019719,1019790..1020072,
                     1020128..>1020440))
                     /locus_tag="TRUGW13939_02814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486002.1"
                     /db_xref="GeneID:55990321"
     CDS             complement(join(1018410..1018632,1018702..1018805,
                     1018881..1019489,1019542..1019719,1019790..1020072,
                     1020128..1020440))
                     /locus_tag="TRUGW13939_02814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341895.1"
                     /db_xref="GeneID:55990321"
                     /translation="MIESPYQVDIPVTDVASFVFSSGTPLSREAPQYFDAACPLKCFS
                     LTQAEGFVKQVARGLELLGLQPNDKVLLYSHNRLFFPVLLWGVLAARCVFTAASPNAS
                     VTELEYQVRNSDAKLVLAGSEQVSVALEAASRAGLSRNQVYLFCDPEEDTNSHQSQNI
                     REWTEFWRSAAEVRSWSWKKMSSLEEAQETTAIINYSSGTTGLPKGVEISHYNVVANS
                     TQLLFKRTVISNTQKGLTRKARLDVSGERWLAPLPMYHAYGQAYYCANAARLGAKVFI
                     MKSFNVQKYLLYLDIYRITFMTSAPPILVTMSKQSNPGRYNLRAIETVVSGSAPLSPD
                     LGRIIEKMYLHPGVKVKQGWGMTETTCSVTGFAPDDDDDGRSIGWLNPNCAARIQPLD
                     DRNFDGVVPAGTVVGEIWVAGPNIMKCYYKNPTATADTIVESNGRRWLKTGDIGYIDE
                     RGCLYIVDRLKELIKVKGLQVAPAELEQYLLTHPDVADAAVVGAKLNDGEYPRAFVVR
                     KEGIVTSTELLDLIKGHFAPHKWLTGGLYFIDSVPRTGNGKVVRRSLSAIDPKSLATR
                     AKL"
     gene            <1021004..>1022264
                     /locus_tag="TRUGW13939_02815"
                     /db_xref="GeneID:55990322"
     mRNA            join(<1021004..1021157,1021276..1022044,1022102..>1022264)
                     /locus_tag="TRUGW13939_02815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486003.1"
                     /db_xref="GeneID:55990322"
     CDS             join(1021004..1021157,1021276..1022044,1022102..1022264)
                     /locus_tag="TRUGW13939_02815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341896.1"
                     /db_xref="GeneID:55990322"
                     /translation="MADFSEFKGPSAEWLVLDPDIPPRSDLSVEELKRVTNDNREESA
                     AQAMVNEGLRRKVQIQDYSIIARDGEPLQGRSYRPAGVPLSQPLPVYIHLHGGGHLFG
                     TLASEDATCSRIVASVTEKGVPLVVFNINYRHTPEHRYPTGWNDVEDAFVWVHENIVE
                     IAGLVDQIAVGGISAGAQLAASLTLSQLHGENKRLSACPKIQGQVLMIPWLVQMDSYA
                     PRQEMLRSPELSSLVQCARAPILPTSQIQLFSSLLGVDGLDYAANYRKLNPGNATAEE
                     VKDLPPTAFGVAGNDPLRDEGLFYAKLLSENGVPTNINVFRGLPHGFRRFGHRLAASK
                     RWDNVMSDAIIWALSKPSANFFEIKAD"
     gene            <1022718..>1024914
                     /locus_tag="TRUGW13939_02816"
                     /db_xref="GeneID:55990323"
     mRNA            join(<1022718..1022780,1022833..>1024914)
                     /locus_tag="TRUGW13939_02816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486004.1"
                     /db_xref="GeneID:55990323"
     CDS             join(1022718..1022780,1022833..1024914)
                     /locus_tag="TRUGW13939_02816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341897.1"
                     /db_xref="GeneID:55990323"
                     /translation="MSTSRSSKRVTRACDYCRKKRLKCTGQRPCLNCQLYGANCSTSD
                     IPKPLESSGGRLKRKRGPAREQIDQPQEPQEHTQVSNDAEQRTPTPRTWNLANQHVNH
                     PQDLQEPAQHSDDIEHTPRVWNPTTESEMHSLVEATEIAPDFDQYASDLGLVLTPFWP
                     PNSLLPLPSNGLGAAEDGMVANMPSYSTHLPTPRLSDETHSNSVFQTMEFGQTMNAAP
                     FNSSSHPEAIDFPPSRSAHELFLRKGPSGSKFIGMGSVGSTILECLRYSVSAHSGSIE
                     STVLDHLVHGIRHVDELSLSATFDCPPLPERDFAERGVQAYYDFLHLLYPIMEVDFLH
                     QWHQFYDESNYTITPTSYSRLCLVVSIGNIISPSRADINTLEIAQRLQEKAWGLIDRV
                     LASPFMESLQVTLLHTIFLLCCGKTGIAWTTCGMAVRVAQSLGLHQHTPIQLGLSPEN
                     ISLRARLWSVAYSLDAFLSLSEGRPSSITGSLNLGVSYRLSEQECSSVPTRSPAVFIH
                     DWDIGLAVIANEVLTLLKNSKSLVTTLAQIAEIDTELLAWKDAIPMEFRPDQEIFAED
                     PFYSLVAILHLKYHNLMRTIHWISLTLSSDAVDLSRLGARVRSSENICVTSSRSVIEV
                     LNGMSSQRIAGSPGAFIVPYCMAAISVFYRQILKEPTRPGARTNLEHMRNGTVHITTL
                     LDSGIGSRRHFRTLFEVMLRVAEDVVQKAVVL"
     gene            <1025206..>1026788
                     /locus_tag="TRUGW13939_02817"
                     /db_xref="GeneID:55990324"
     mRNA            join(<1025206..1025242,1025302..1025501,1025570..1025652,
                     1025706..1025915,1025968..1026103,1026156..1026323,
                     1026375..>1026788)
                     /locus_tag="TRUGW13939_02817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486005.1"
                     /db_xref="GeneID:55990324"
     CDS             join(1025206..1025242,1025302..1025501,1025570..1025652,
                     1025706..1025915,1025968..1026103,1026156..1026323,
                     1026375..1026788)
                     /locus_tag="TRUGW13939_02817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341898.1"
                     /db_xref="GeneID:55990324"
                     /translation="MSANFRDFIPPRDHPRVKNLDKTDVKSYSKNALGGPVVRKIVSN
                     WAAKLDEPYFGITCDGKLRENLFELADEGAPVDQMVVCANRMIDLFTPTKLGQFCHEI
                     DSDNWRKWSNPEFLIYSTGIRLEDLHENQIQAIMDLVQASTSSTGYSRIVGAMQTNEF
                     LGALCGAKTILNKHSYQFSLYGKPSLTEPWGYSLFGHHLSLNIFVLGHQITTSPIFLG
                     AEPNIIDSGPDAGVCILDTPGHLPLLLMQSLPPNLQKNAQIFKKMQDEKMPDDRWNPA
                     DQRHLAGAFQDNRIIPYEGIQATSMPQSQQDQLLQVLSFYLDILPTKAHLARMQQIKQ
                     HWEETYFCWIGGYGDDDAFYYRIQSPVILVEFDHHSGVFLLNKEPAKYHIHTIIRTPN
                     GNDYGREWLQLHRKGSLILSSNQ"
     gene            complement(<1026918..>1028003)
                     /locus_tag="TRUGW13939_02818"
                     /db_xref="GeneID:55990325"
     mRNA            complement(<1026918..>1028003)
                     /locus_tag="TRUGW13939_02818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486006.1"
                     /db_xref="GeneID:55990325"
     CDS             complement(1026918..1028003)
                     /locus_tag="TRUGW13939_02818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341899.1"
                     /db_xref="GeneID:55990325"
                     /translation="MSAITVNPVHPNPKDSIRSTWRRQDRSQWSIYHWIYEWGDLHAV
                     DLDRKVPVFAKNDKIPYIPDWYLQRFIIFYSALPLVVHQLFTHFSGMNFHPVVAYIYY
                     YLAGRFFLSREILTMRELGHTYGFLDGDKHERDGVPDVGVKKALLSIMMAAMGRPLMT
                     VLLTYNANEAPLSSINWKSLPIEAILYGIVLDFWFYWYHRIMHEVNGLWKYHRTHHLT
                     KHPNPLLTIYADHEQELFDIWGIPLMTFFSMKFMGLPMGFYEWIICQNYVVFSEIAGH
                     SGLRLHAATPNLTTWLMRMFNAELVIEDHDMHHRRGWKNSFNYGKQTRIWDRIFGTCA
                     TRIESVKENVDYSHPVPFPLFGVKVRA"
     gene            complement(<1028593..>1030344)
                     /locus_tag="TRUGW13939_02819"
                     /db_xref="GeneID:55990326"
     mRNA            complement(join(<1028593..1028790,1028843..1029207,
                     1029274..1029822,1029877..1030066,1030132..>1030344))
                     /locus_tag="TRUGW13939_02819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486007.1"
                     /db_xref="GeneID:55990326"
     CDS             complement(join(1028593..1028790,1028843..1029207,
                     1029274..1029822,1029877..1030066,1030132..1030344))
                     /locus_tag="TRUGW13939_02819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341900.1"
                     /db_xref="GeneID:55990326"
                     /translation="MDSDKPRLNWRTFALCVIISFGQFVGAYESVIIGTTLQKPDFMR
                     RMGLWDINGNETSRYSSLEGAIVGLFQAGAVFGSLIVAAVMERWGRKAGLIFGSLISL
                     PALAGMTGSMNVAEFLVFRFIAGLGTWACGSAASVYIPELAPPAYRGFFAGLNGVMIG
                     FGVASASYTGMGFYFCDNEVVSWRAPMGIPLFAPILILCAIPFLPESPRYLLLKDRPE
                     EARRIFDRLNQSSSANPSLLDEEFSQIQQQAAYDRILDSSWKGLFIRPAYRKRIILAC
                     MLSSLNQSTGVLVINNYGQTFYETLGFSPSARQLLQGNRDIIAFLGNFLGSWIVDRVG
                     RKPLLLFSLAGCFCCILLEGIMVHVYAYSDNFGGKNAGVALLYIFLFFYAVGIDVGTY
                     VYLGEMFPNHLRVKGVGMSLASLNVTATVYLSVTGTAIASIGWKFFLVFAAITFCGMI
                     WIYFFLPETRRLPLEEIEALFGNAEDTMVFISPANRGLEGERAGQEKGAVEHVE"
     gene            complement(<1032619..>1033476)
                     /locus_tag="TRUGW13939_02820"
                     /db_xref="GeneID:55990327"
     mRNA            complement(join(<1032619..1032712,1032769..1033179,
                     1033232..1033368,1033420..>1033476))
                     /locus_tag="TRUGW13939_02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486008.1"
                     /db_xref="GeneID:55990327"
     CDS             complement(join(1032619..1032712,1032769..1033179,
                     1033232..1033368,1033420..1033476))
                     /locus_tag="TRUGW13939_02820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341901.1"
                     /db_xref="GeneID:55990327"
                     /translation="MTVVISAHIPLASVADRDKCMQYLSLVRDVASETQENEPECLAY
                     CWARPADGHTDVPAVVQGLEVYNTPEALSVTHRSSAPYKNMRQVVANTGLLSRPKGGV
                     PTYVPAGTGFLSKEGTPETVSSENWFIVVEYTARGQENLNRLLEKEGFLSRDIESVGG
                     VLTLVCFVPDSHEEEIPVTIFLRVSSKGDDLDAVKERLQRFEDEAASDGEVTQKRFWE
                     GQGFGFFRKRSYID"
     gene            <1033759..>1034628
                     /locus_tag="TRUGW13939_02821"
                     /db_xref="GeneID:55990328"
     mRNA            join(<1033759..1033998,1034054..1034121,1034177..1034316,
                     1034372..>1034628)
                     /locus_tag="TRUGW13939_02821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486009.1"
                     /db_xref="GeneID:55990328"
     CDS             join(1033759..1033998,1034054..1034121,1034177..1034316,
                     1034372..1034628)
                     /locus_tag="TRUGW13939_02821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341902.1"
                     /db_xref="GeneID:55990328"
                     /translation="MSTLDHDFIQQLAALGTPYPRLKWYIGAIVALSALNYPEEIGPL
                     YTCLLDKYIAPDDHYEQTRKIKEALVKACGLHGAAKTGNAMRALYAVTPAHLIDKTCY
                     RENDVDDTAAYARGDEFLKSLYPDVPDLNTEDDFVRKTSPDYFHVVSRLFYPRIFSFN
                     QILDKLESSQAIVSSLIGIDCTGQARNHMRGMMWNGATRDEVTMVRDVVVRIAERLGV
                     QFKAGPIAVPEIPIFQ"
     gene            complement(<1034742..>1035401)
                     /locus_tag="TRUGW13939_02822"
                     /db_xref="GeneID:55990329"
     mRNA            complement(<1034742..>1035401)
                     /locus_tag="TRUGW13939_02822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486010.1"
                     /db_xref="GeneID:55990329"
     CDS             complement(1034742..1035401)
                     /locus_tag="TRUGW13939_02822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341903.1"
                     /db_xref="GeneID:55990329"
                     /translation="MSNYYLLLFLQPRKTRTSDFSQWRREIFSMLLELTPHMYLDAVD
                     DPDTETNKYRHVNVYRLTESTSPPTDSQIETQLLYLHSGNHHLSAFHWHIYSSIAETR
                     LAEPLSAHTVVTVGITIPTTDAAELDRWYAQEHMPALATVRGWQAGTRLQLLSTSSSS
                     KPEKDVVEYATPYLAIHEWAERNELGGEAWKKAVFTPWSERIMTELQSAPVHRHVWVR
                     V"
     gene            <1035649..>1037007
                     /locus_tag="TRUGW13939_02823"
                     /db_xref="GeneID:55990330"
     mRNA            join(<1035649..1035735,1035784..1035915,1035979..1036032,
                     1036094..1036294,1036347..1036776,1036838..>1037007)
                     /locus_tag="TRUGW13939_02823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486011.1"
                     /db_xref="GeneID:55990330"
     CDS             join(1035649..1035735,1035784..1035915,1035979..1036032,
                     1036094..1036294,1036347..1036776,1036838..1037007)
                     /locus_tag="TRUGW13939_02823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341904.1"
                     /db_xref="GeneID:55990330"
                     /translation="MGLRVLIVGGGLAGLATALVLRRSAHQVQVFEASQLEFSDTVGP
                     LVHIGPKSNELLQQWQFDAAVARGVLVKEAPEFNFDGTLQTKNESQPPGWVYYERSRL
                     HQALLDSCRALEEAGQPVKISLGTRVTAVDPETASITLNDGQLIQGDVVIGADGFHST
                     ARQNIASKSPPGSSGPPTVAVNFKVDVTQFGHNSVVQRFQSEPQRYEKWIGAGLELKV
                     SAVEPESLLLFDCNVQSAPPTSDLIKDTILKTFESAYPDFTQLLAAIEPRDIYSWTQP
                     TLPRVQRWTFGRLALVGDAAHPFLPHELPGTSQTLNDAATLGTQLPSSIGVDEVPVRL
                     AAWETPRQDRVKTIQRGERPWLG"
     gene            <1037223..>1038431
                     /locus_tag="TRUGW13939_02824"
                     /db_xref="GeneID:55990331"
     mRNA            join(<1037223..1037410,1037470..1037566,1037625..1037707,
                     1037766..1038175,1038235..>1038431)
                     /locus_tag="TRUGW13939_02824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486012.1"
                     /db_xref="GeneID:55990331"
     CDS             join(1037223..1037410,1037470..1037566,1037625..1037707,
                     1037766..1038175,1038235..1038431)
                     /locus_tag="TRUGW13939_02824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341905.1"
                     /db_xref="GeneID:55990331"
                     /translation="MSPGLTQPIPAFDDLPLRPGDPHHSAWGLWQKPALGALNYLTDE
                     TVLRAVQEEVRCGERVALNLPLDAVKPALLGRVDFERKMINKAPRVINDDVITFNTQT
                     SSQFDSFRHFAYQAEGQFYNGVTQDDIHGTRESTVNGIDGWADKAIAGRGILVDYASW
                     VATQRQIGSYDAMATHAISVDGIKTILAASNTQPRAGDILFVRTGYVGAYLGLDDAGK
                     QDLQTAKHSWPGIEQGEDMARWLWEQQFAAIVADNPSLECIPPVDEEWLLHPILLAGW
                     GTPIGELWDLEALAEVCRRRNRGSFFVTSVPLNYTGAVASPPNAMAIF"
     gene            complement(<1038515..>1041006)
                     /locus_tag="TRUGW13939_02825"
                     /db_xref="GeneID:55990332"
     mRNA            complement(join(<1038515..1038899,1038955..1039567,
                     1039630..1040061,1040283..>1041006))
                     /locus_tag="TRUGW13939_02825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486013.1"
                     /db_xref="GeneID:55990332"
     CDS             complement(join(1038515..1038899,1038955..1039567,
                     1039630..1040061,1040283..1041006))
                     /locus_tag="TRUGW13939_02825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341906.1"
                     /db_xref="GeneID:55990332"
                     /translation="MPNRILPSVPLAVLGRVSLPPASRAPFSSSTAQPCSSSSNRTAA
                     DRLATGLLKNKEWASNYPAQFPSLATGQQPEILWIGCSDSRCPETTILGLHPGDVFVH
                     RNIANIVHQADLSSACVVEFAVNYLKVKHIVVSGHTKCGGVNAALGNSKLGILDTWLL
                     PLRNLRQQNLKSLQSLEPDEAISKLAELNVIDGVQKLKQLGVVIDAIENRGLQVHGVV
                     YDVATGLLRTLNAEDESHEATKAPSGPPAERADPPALSAAAPACCSLSTLTIIATSDL
                     ENIWIKASKAQPGMDCATAVQSAYVKHPIRSLAALFVVWKALLFLVVANCPGPGYDTS
                     TTLLTDADESARILKFVRWDAIYFVRAAERGYLFEQEWAFSYGRVLKVFTSAFIGGSI
                     HPTEIAITGVILSHVTHFLSVLVLYGLTKIALGSETARERALCFVSAALHVISPAGAF
                     LSAPYGEPVFSLLNMAGLYVYSLAILAEQTESWTRRDLSFVLAGSLFAGATFVRSNGI
                     LSGTLFAYDAIMGVNEVLARGLSFGVIRRTAFVVLGGSIVALGMIVPQYVAFKVYCSD
                     PDSARPWCERLLPSIYSWVQATYWNNGFLAYWTVPNLPLFLLAAPILAIMFYSALVAV
                     RGQLGQSSYFAPDHIAVRQSIVMRLAIPQGILAILALTNLHVQIINRICSGYPVWYWF
                     LAALGDTRAFGVSVKAIALYAGIQAVLFGSFLPPA"
     gene            complement(<1041659..>1043125)
                     /locus_tag="TRUGW13939_02826"
                     /db_xref="GeneID:55990333"
     mRNA            complement(<1041659..>1043125)
                     /locus_tag="TRUGW13939_02826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486014.1"
                     /db_xref="GeneID:55990333"
     CDS             complement(1041659..1043125)
                     /locus_tag="TRUGW13939_02826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341907.1"
                     /db_xref="GeneID:55990333"
                     /translation="MLFNLGFTADAAAAHAEEEKTTTTKPRRLIMPLPSLPDLFASKN
                     STPTPTPPLSSKPSHQTITSLSADNNDDEDNDDDDDNDDANPTTTVPRPATARARAAR
                     PKTLFQFAHPVASQRHRRLTLRPKLLLQLHESSAMSRPFPKYDVLPASIAPRLACKFP
                     KLFASLRGLGPRDLVVVTSDMYEQHVDDDRSDWSEDSSQDQREIVATIRQPLIKDDPQ
                     SRCASVEIVSGLGTSWTGVPLPNGSYELVCSADLQQKQRKARWVARDKGIRKASGSGN
                     NSSVDGLKRFTFSVIDPNSRRHPVIASLTRNGIDVFEQYAYPAAVSSSDETSSSPPQS
                     PRELIDLDEELRVLIVTSGIWIAFMEGWAKNSSDALCPTEASQPSLRSKSSTFPGAER
                     NPPNERFLSAADASSRTTKNRSSTQSEVGPLRQGTLRAAKSRYRQSLSAENHDQKWTN
                     LQKHEADAESEIAAENNQASKGKSWRRLSAMFGKNKGS"
     gene            complement(1045301..1045389)
                     /locus_tag="TRUGW13939_02827"
                     /db_xref="GeneID:55990334"
     tRNA            complement(1045301..1045389)
                     /locus_tag="TRUGW13939_02827"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:55990334"
     gene            complement(<1045761..>1047847)
                     /locus_tag="TRUGW13939_02828"
                     /db_xref="GeneID:55990335"
     mRNA            complement(join(<1045761..1047701,1047758..>1047847))
                     /locus_tag="TRUGW13939_02828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486015.1"
                     /db_xref="GeneID:55990335"
     CDS             complement(join(1045761..1047701,1047758..1047847))
                     /locus_tag="TRUGW13939_02828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341908.1"
                     /db_xref="GeneID:55990335"
                     /translation="MEPLQPSSLRIRASWDGDINRAANVCVTVEVETKPNSRLLLLNR
                     VKNTGLSHSMVWRIRSLGQEVPAVDVTDSKSILAHQVDYIPPSPPRKLFASSRGYQDE
                     YGIQEKPDSFFQDWLSSHDTKETLDDQTSTSSEPKQEDATEETAQETAFDTVEAESPL
                     DALCVDEASEISLGEQNLDRWIDMNQSIEQYFDDSFLDLPPSPTPSSQDLIPWASTKE
                     IMDRLKAEEERDPLSFSSEVIVAPPPRDPGIVHQDGQMFLDFPGSVEAKIYRVDLHFL
                     KYVREGQNNWLELDLSQIGMACPEVQGLFVLEMPWECEFSTPDLSDKQAANGHLEYQF
                     SPQYLRAIAFRRREDRDCTTVSSNASNVEPHTSIESEPEDSTLNTQSSQQQISGEPLQ
                     PTDEIEFIKPTMPSSQAGRPRRTTTSISRDFFHQFLVFVFFAMVAVFTATGGPPEAIA
                     TPANTWSTLRGVASDMRRQGSSIQTMVMETVRDAQLLHGWHVYRALWMDALTNEEPDV
                     SIKKSAICLPIDVMMQELAAVCLATGDIDMVIQDSATASHLTGNVTVFEESNRAGSST
                     GDNMLFQYSATVGDIGVLTQGSTAAGFPTEDTDTYEILATSTVVFSAENASISTEETG
                     DGYWGTWSLIGRNFLSRIGCSTSAHCIMVAAAEDDDPQWEVFERYRCDAKNS"
     gene            complement(<1048613..>1050444)
                     /locus_tag="TRUGW13939_02829"
                     /db_xref="GeneID:55990336"
     mRNA            complement(join(<1048613..1048885,1048976..1049531,
                     1049595..1049703,1049761..1049807,1049868..1049952,
                     1050029..1050177,1050232..1050301,1050360..>1050444))
                     /locus_tag="TRUGW13939_02829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486016.1"
                     /db_xref="GeneID:55990336"
     CDS             complement(join(1048613..1048885,1048976..1049531,
                     1049595..1049703,1049761..1049807,1049868..1049952,
                     1050029..1050177,1050232..1050301,1050360..1050444))
                     /locus_tag="TRUGW13939_02829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341909.1"
                     /db_xref="GeneID:55990336"
                     /translation="MLSNTSSDFELTVRQQPKQARVAGGKEKERKPVDPPPIIQLKVR
                     EENTYLAQHYLQSPYYFMCCSLYHATEDHPVHYNQPSTAMAGTLVSSLHRLKDTDNTD
                     GGFFVFGDLSIKVEGTYRLQFTLFEMQKDNVVALKSILSDPFSVMLPKSFPGMHESTH
                     LSRSFADQGVKLRIRKEARNVMKRGGARPEEYAPSLPRSPERTTMPQMVPSAFAGYPQ
                     PGYYTPVQPSKRARTSVDMDSRAVYEPDARFTHGYQQSIYPPQTGAYQNPMGFGYSTG
                     QTAMPEYGIRQPQAMATAGSSYGTSEDPMLAMRSPSAAGYINPQRYPPYTNAQLSYGL
                     PSQQMPQLPDSQRNPQANLQPLVTGQSVNQQTTGSVSTASAMPDVYQRSQFETSPTVL
                     PPIHRNHHSPNQIAGDNVSDRFYTSPDQLVPPILNSHTLNTVDMDRPGSSTTAFDLSG
                     SSHDIRR"
     gene            complement(<1051355..>1052932)
                     /locus_tag="TRUGW13939_02830"
                     /db_xref="GeneID:55990337"
     mRNA            complement(join(<1051355..1051601,1052359..1052470,
                     1052532..1052770,1052826..>1052932))
                     /locus_tag="TRUGW13939_02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486017.1"
                     /db_xref="GeneID:55990337"
     CDS             complement(join(1051355..1051601,1052359..1052470,
                     1052532..1052770,1052826..1052932))
                     /locus_tag="TRUGW13939_02830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341910.1"
                     /db_xref="GeneID:55990337"
                     /translation="MVSVGITQRFAPAKVASDFASLSLQRQYYGSRGAVTESCPLSAV
                     CFMELAISSSLLDRGPRLLTFGTFRLEFPTDQAPFLLSSSRYFGKIPINGVRATSRSV
                     SLPAQGSRFNHNRIEFFSKSPSRQGEVAVAVAAVVDEEKEGTLLPALPQHRQVPREPK
                     EGFYFPRHPSTGALARGSGPPPHDCWCGKEPWFAPWESVSSSNGRPALVALPATIAPP
                     WTAKRGAGWAKGLLCG"
     gene            complement(<1055614..>1058916)
                     /locus_tag="TRUGW13939_02831"
                     /db_xref="GeneID:55990338"
     mRNA            complement(join(<1055614..1058138,1058190..1058237,
                     1058298..1058377,1058429..>1058916))
                     /locus_tag="TRUGW13939_02831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486018.1"
                     /db_xref="GeneID:55990338"
     CDS             complement(join(1055614..1058138,1058190..1058237,
                     1058298..1058377,1058429..1058916))
                     /locus_tag="TRUGW13939_02831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341911.1"
                     /db_xref="GeneID:55990338"
                     /translation="MAATMPATHDELTLDAQPPLVDSDQDAEGEEDTDLYQMDQQLQD
                     AVQKADADDEAEDADSPSEPLLEDNKSYEESGGENEDEVSAASEDEGVVKAPRLRRHQ
                     KRSGAASNSDGNEPDLDVPFENGSDRHSSSDESDVEAEDWDVESNERDDVEGDKGPRG
                     NCIFCGQDEDNDPSEDFEEYLTCAVCGDHSHRQCAREQNAFSDTEEAENWRCVTCVQN
                     KLEPDPGQQAAARRRAAAQNVSRDLLAASAGSEGPESHSIFNNLIVDDDPMDGSRSLR
                     KRKNSSAEAQDLPLLRKRLRRTPSQGAGDSADGSIDADGLLRNRPRRGRRPDKELCRI
                     IEKDDNKCVVAFHLDFVKLAKILNSRPRPSKARRRKPPKPAPVEEEPLAHFAPIIPTY
                     TSPFYTFHDRDADDSKSKPYGGILSEADADTSRTLPTQLDREKFESARRKAEEDWQKK
                     IRESDPVGEVNHRASQKVSGPPSKIKWINFGGYEIETWYAAPYPEEYSRNKVLYICEF
                     CLKYMNSDFVAWRHKLKCPAKHPPGDEIYRDGSISIFEVDGRKNPVYCQNLCLLAKLF
                     LGSKTLYYDVEPFLFYVLTEFDDVGCHFVGYFSKEKRPSSSNNVSCITTLPIHQRKGY
                     GNLLIDFSYLLTRVEKKTGSPEKPLSDMGLVSYRNYWRLVLSYQLRDQKTPISIAELS
                     DRTGMTADDIISGLEALRALVRDPVTKTYALRLNYQYFEECIQNWESKGYVKLNPVSL
                     LWTPYVMGRNNQSHYDRAQLHTVAQRDDAEEEEEDEEEEAPAVGGRSPKINGITNPIS
                     EGLPYAAAGPPSTTALSLASSSNKVNGDHDATTEPPNPAARIPPSRFQIHPPVQGPVF
                     KRRPGRPWGSKTNHSRLSYNSGSRTARSTPRRTSTSLYGVGTPASTGGSASRRARSGL
                     GAELGLSVESPFRSGSFEDSQAIEDDDDDGGDGPRGGLEVTADSATAMDIFSTSADPD
                     QQVNGFDISDTGTAQEETGDNEALSTGNSTPRRTRRAIVDERERSTKGKPASPTINGN
                     GSDIDAEGEIDDEVQL"
     gene            <1059579..>1060074
                     /locus_tag="TRUGW13939_02832"
                     /db_xref="GeneID:55990339"
     mRNA            join(<1059579..1059626,1059685..1059781,1059907..1060001,
                     1060054..>1060074)
                     /locus_tag="TRUGW13939_02832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486019.1"
                     /db_xref="GeneID:55990339"
     CDS             join(1059579..1059626,1059685..1059781,1059907..1060001,
                     1060054..1060074)
                     /locus_tag="TRUGW13939_02832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341912.1"
                     /db_xref="GeneID:55990339"
                     /translation="MGVPFEAFLPYGIIVGMYIVTGVGLTATKYYSNEHKKARWNRDV
                     WDKVVMDRDLRLTGSWRGQSTNAEAPAGFEYSNPWKLEKRTH"
     gene            <1060955..>1065360
                     /locus_tag="TRUGW13939_02833"
                     /db_xref="GeneID:55990340"
     mRNA            join(<1060955..1061161,1061215..1061290,1061350..1061666,
                     1061727..1061825,1061874..1062036,1062200..1062356,
                     1062466..1062604,1062659..1062737,1062794..1063029,
                     1063092..1064330,1064395..1064962,1065020..>1065360)
                     /locus_tag="TRUGW13939_02833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486020.1"
                     /db_xref="GeneID:55990340"
     CDS             join(1060955..1061161,1061215..1061290,1061350..1061666,
                     1061727..1061825,1061874..1062036,1062200..1062356,
                     1062466..1062604,1062659..1062737,1062794..1063029,
                     1063092..1064330,1064395..1064962,1065020..1065360)
                     /locus_tag="TRUGW13939_02833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341913.1"
                     /db_xref="GeneID:55990340"
                     /translation="MVALTAFLAKHCTRSTPLYSKISPVSISGIPRNQSISRVTGHYF
                     PLRTMSSAKTLEEKIKALEELSACDISDALLKLQKLPPGAQPRAGQLADLSPISPYIG
                     RRADKPKIIAPAVTFQFIPKGDPAPAVEDPEVNGFPSGKHWVDWTQPGTITVINQPPG
                     QYCAVLGGIMAARMSYLGVKGVVANGRVRDLAELSNSGLHVWSKATTTVGTGAEAKAG
                     LRNVPIDFNGVTVNTGDIVFCDPLEGVVVIPKELLDDVLELCPKLIDQDDKVKAEVEN
                     GLSVFEAMQKHHHVTKSTITGRQPVQYSLPPPPPPSSTARGSSYSFWLPKATETAFTH
                     KGQLLLLSFIMAPQDTFFRSADMSLTQLYIANEIGREVVSALGEVGEVQFRDLNPDTN
                     AFQRTFTKEIRRLDNVERQLRYFSTQMEKADISMRPSSEFANVLAAPSAAEIDELAER
                     SESLEQRVVSLNDSYETLKKREVELTEWRWVLRETGSFFDRAHGHTEEIRTSLDGDGD
                     ADGDEAPLLQDVEHRGQNGDTQGQSFSVMNIGFVAGVIPRERIGSFERILWRTLRGNL
                     YMNQSEIPEPIIDPTTNEAVHKNVFVIFAHGKEIIAKIRKISESLGANLYGVDENSEL
                     RRDQIHEVNTRLGDVESVLRNTKNTLDAELTQIARSLAAWMIIIKKEKAVYHTLNQFS
                     YDQARKTLIAEAWCPTNSLSLIKTTLQDVNDRAGLSVPTIVNQIKTNKTPPSYIKTNK
                     FTEAFQTIINAYGITKYTEVNPGLPTVITFPFLFAVMFGDMGHGFLMTLTALTMIVFE
                     KALLRTKLDELSYMAFYGRYIMLMMGLFSMYTGLIYNDIFSLSLDIFPSQWEWPQNIQ
                     EGQAVVATLKDGYRYPFGLDWNWHEAENALLFTNSFKMKLSILLGWSHMTYSLCLQYI
                     NGRHFKSKVDILGNFIPGMIFFQSIFGYLVLTIVYKWSIDWSARDQAPPGLLNMLIFM
                     FLSPGNVKDEDVLYPGQATVQMVLLLFALVQVPIMLFLKPYWLRAEHNKARGLGYRGL
                     GEQSRVSALDEDGDLDGHPYEGGRDSLASDGEGVAMIAQDIDEGEHEEFDFSDAMIHQ
                     VIHTIEFCLNCISHTASYLRLWALSLAHQQLSIVLWKMTLGGSFSVEGGTLRVIMIVC
                     TFYLWFFCTVAILCVMEGTSAMLHSLRLHWVEAMSKHFIGDGIPFQPFSFKTLLEEDP
                     VD"
     gene            complement(<1065727..>1066857)
                     /locus_tag="TRUGW13939_02834"
                     /db_xref="GeneID:55990341"
     mRNA            complement(join(<1065727..1066669,1066739..>1066857))
                     /locus_tag="TRUGW13939_02834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486021.1"
                     /db_xref="GeneID:55990341"
     CDS             complement(join(1065727..1066669,1066739..1066857))
                     /locus_tag="TRUGW13939_02834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341914.1"
                     /db_xref="GeneID:55990341"
                     /translation="MATNAPSAVGQEKINTDIVTLTRFLTEEQTNYPEASGDFTLLCH
                     ALQFSFKSIAYYIRRATLINLTGLAGSSNTTGDDQKKLDVIGNDIFISAMRGSGKVRL
                     LVSEEEEEAIIFDEHPDARYAVVCDPIDGSSNLDAGVSVGTIFGIFRLPDQVLGANKT
                     VSAKDILRSGTELVASGFTMYGASAQLVITMRGGSVNGFTMENSLGEFILTHPKMQMP
                     TKRSIYSVNEGNSMYWDEWVNDYFNSLKFPGEGGKPYSARYIGSMVADAYRTLLYGGI
                     FAYPADKKSPKGKLRILYECAPMAMIFENAGGLAVNSHAERLLSVVPEHIHDRSGVFL
                     GSKDEVQKAIDIYHKHHSK"
     gene            <1070269..>1074485
                     /locus_tag="TRUGW13939_02835"
                     /db_xref="GeneID:55990342"
     mRNA            join(<1070269..1070273,1070522..1070931,1070998..>1074485)
                     /locus_tag="TRUGW13939_02835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486022.1"
                     /db_xref="GeneID:55990342"
     CDS             join(1070269..1070273,1070522..1070931,1070998..1074485)
                     /locus_tag="TRUGW13939_02835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341915.1"
                     /db_xref="GeneID:55990342"
                     /translation="MPWSSTSSPALGATHSPIAGSSPTSRRNNAIQPPALTTALSGVP
                     FQSLSAGSRLGYTPSPATSFSSPFSQTQSPYLPSPSVAIPGPSPMASRVPSSSYNAPY
                     NPQEWAPMGGGGGSQITHLAQPQQRSNVVRVAPRSSDTQLSPPPPYTPRHQATSPQDH
                     TSVPTPSLQGRPRDAPVLPQDAHSMGYRNSGSQSRPLSMISQNDGSANWQNAYISPPP
                     PPPGPSRSSPIVTVDPYRGGFEPGLGISRPGSTASHYAVAPPQQSPYGYAETTPQFEH
                     PPSSRRAVSTGALQSTGSSRASSASQSRSPPRTRWEPGMPLPPPPPGPPPGRSQSASG
                     SSDASSRRALHASIGRGPPILGTALGRVPPTPADWVEEPTVPTREVHENSSLHINTEV
                     IPPSSQSLSKRPESGERSSSSQRGSGLFRTLAVRDSSAKGIRERRIESRHKRNNVSED
                     LTTMSNNHHQSSNPWEEFPNRITPSNLVLSSAERNDPTASGHRQGSSKPLTSARSSKS
                     EDVPSSSRSRTSSGLFSGRSSFSTPKPDSIFSHQEITPTPPFSPDLNSPYSKDQHNVS
                     SSKALPTPPHKSAQEVKSASRLGVSKPEERPVSHLLHLPNEIVSVPAPLLPRRMSIEQ
                     APSMDSIIHQGPSPLDGALSRYQAVLDKEAASTNEADALKLFIDFMISESRIRRQLYP
                     KAFNDGGFDIDGARQKLFSQEIPQEKPAKIKLDTSFKQTSPSRGANGASGGVSRPESA
                     WWNNYQPCLSPIASISIENDEMSSRGRPPSRWWESKTGSSSEGAERRAQRSKRESKYM
                     GVPRELREAMQMGYNGTLREAEEEQGAGSQDAPSLGYGPHEYPPEKVGWHEDDSQDLA
                     QPQVYTPRNVYGHDTRQYKLDISRLVTLPPPYPRHHPAVNNSHPDLVAYRTTVRSISD
                     LSEVKATRQRNQLQAETLRQEHDQKIQESRRQFRENIQQQIQQGGISYAEAAEAEAAL
                     EVDENRMEKDLLQGQFDSYQSTVMKPLHAILSDRVMKATDCINELSGKLSAATQHENP
                     NQTQEEGDEKPELLEQLTQLKWLFEAREQLHREIYELLGESNEKYRAVVTLPYKQSKN
                     EEKIRETDTFFVKDALDRRVQYETDSLSRIDAFMDIVEENVKRGVETHLSAFWDIAPS
                     LLTLVQQAPANLSDFQVLIPTSEYDENPSYYQFPLQYLYSLLSHAEKSTYQFIESQIN
                     LLCLLHEVKTGVMSTSCKLMEAQRIRRGEPEDFIGREMQKLRAREERDLTGDLKERVS
                     TVEVQWTEALGGEIQGLRERVKDHLMTQGGWDDIEQLE"
     gene            <1075374..>1076687
                     /locus_tag="TRUGW13939_02836"
                     /db_xref="GeneID:55990343"
     mRNA            join(<1075374..1075596,1075676..1075758,1075839..>1076687)
                     /locus_tag="TRUGW13939_02836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486023.1"
                     /db_xref="GeneID:55990343"
     CDS             join(1075374..1075596,1075676..1075758,1075839..1076687)
                     /locus_tag="TRUGW13939_02836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341916.1"
                     /db_xref="GeneID:55990343"
                     /translation="MALHNPNNWHWVNKDVSAWTKNYLQETLSKLSAENDGVTAKIEK
                     VLSMDGDVDVSQRKGKVITLYDVKLQLEYEGKTKDDETVSGTINIPEVAHDTEEDEFV
                     FDIEAYTDAASKQPVKDLVRSKLVPQLRVELSKLSKTLVVEHGKDIQHAPGSNPSSGF
                     ATPTFQAQKSASPAAASTKTSTANTGKVSVNTTTVTASDEFRTTAEELYTTFTDPQRI
                     AAFTRAAPRQFDGAEVGGKFSIFDGNVSGEFVKLESPKSLVQKWRLAQWPEGHFSTQE
                     IFFDQNDVDRVTVMRVTWTGVPIGQEEVVQRNWEGYYVRSIKQTFGYSPPSSFRTPNP
                     RVQSPVSSSSSSSTYFTSSSFSGTIVLICFLFLLLGIGLARYSEILPNIL"
     gene            complement(<1077024..>1078543)
                     /locus_tag="TRUGW13939_02837"
                     /db_xref="GeneID:55990344"
     mRNA            complement(join(<1077024..1077986,1078045..1078331,
                     1078388..1078441,1078492..>1078543))
                     /locus_tag="TRUGW13939_02837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486024.1"
                     /db_xref="GeneID:55990344"
     CDS             complement(join(1077024..1077986,1078045..1078331,
                     1078388..1078441,1078492..1078543))
                     /locus_tag="TRUGW13939_02837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341917.1"
                     /db_xref="GeneID:55990344"
                     /translation="MVNQVAGSKVLLLGSGFVTKPTVDILDQAGVEVTVAARRLEGAQ
                     NLAAGGKHTKAISLDVTDDAALDRELAKVDLVISLIPYTFHAQVIKGAIRTKKNVVTT
                     SYVSPAMQELEEEAKKAGITVMNEIGLDPGLDHLYAVKTISEVHNAGGKIISFLSYCG
                     GLPSPEDSDNPLGYKFSWSSRGVLLALGNAAKYYKDGAEFSVTGSELMGEAKPYFIYP
                     GYAFVAYPNRDSTPYLERYSIPEAQTVVRGTLRYQGFPRMIKTLVDIGFLNETERDFL
                     KTPIPWREATKQILGAASSKEADLISAISSKTKFVDNEERDRILAGLRWIGIFSDDAI
                     TPRNNNALDTLCATLEQKMQYGPTERDMVMLQHKFEIENKDGSRETRTSTLVEYGDPK
                     GYSAMAKLVGVPCGVAVKMVLDGTISKKGILAPMTMDICAPLIKTLKEDYGIELIEKT
                     L"
     gene            complement(<1078992..>1080253)
                     /locus_tag="TRUGW13939_02838"
                     /db_xref="GeneID:55990345"
     mRNA            complement(join(<1078992..1079963,1080029..>1080253))
                     /locus_tag="TRUGW13939_02838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486025.1"
                     /db_xref="GeneID:55990345"
     CDS             complement(join(1078992..1079963,1080029..1080253))
                     /locus_tag="TRUGW13939_02838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341918.1"
                     /db_xref="GeneID:55990345"
                     /translation="MSTSMHLGQLRKWVAASPPVEFVVNRVKELLIGAVRQGPIPQHI
                     AFVMDGNRRFARTHGIETIEGHHLGFEALVRVLEVCYKSGVKVVTIYAFSIENFNRSQ
                     FEVNGLMDMVNVKLAQLSQHGDILDRYGACIRFLGRKDLLRPDVVAAVDRAVEVTSRN
                     GDRVLNICCPYTSRDEMVGAIRQTVVDYSTPLRETRGNRARTPFSESHITSNLRAQAL
                     DTRFQDKNDESDSISAESQDDENAFTTRDGLEPKGCDTPSSFSSSTTLHLGGQTEDFS
                     GKGSPLSRPIDDDDSGFPSPESITVQTLSDHMYTKGNPPVDILIRTSGVERLSDFMLW
                     QCHENTEIVFLDVLWPEFDLWQFLPVLWKWQRRMTKSWTGESDDWKGTSTSPQAATAA
                     TAIKTY"
     gene            complement(<1080860..>1083259)
                     /locus_tag="TRUGW13939_02839"
                     /db_xref="GeneID:55990346"
     mRNA            complement(join(<1080860..1082032,1082090..1082358,
                     1082414..1083011,1083089..>1083259))
                     /locus_tag="TRUGW13939_02839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486026.1"
                     /db_xref="GeneID:55990346"
     CDS             complement(join(1080860..1082032,1082090..1082358,
                     1082414..1083011,1083089..1083259))
                     /locus_tag="TRUGW13939_02839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341919.1"
                     /db_xref="GeneID:55990346"
                     /translation="MANQQYIPPQVGWMYDLVLWTFSVLIDLFFREVHPRGSWKVPKR
                     GPLIIVAAPHANQFVDSLVLMRVIRTEVHRRISWLIAEKSFKRKFIGLLSKGIGAVPV
                     SRAMDNMKVGAGKIYLPDPINEPTLLRGYGTKFDGPGFEPEGTIHLPTINEKSYSATI
                     AEIRGPEELVLKKPIKEKDALYQLTGRDDITDDGKFTGTASENGSSDFQGSKFKVAPH
                     VDQTAVYKAVFGRLSHGGCIGIFPEGGSHDRPELLPLKAGVAIMALGSLAENPDSGLK
                     IVPCGMNYFHAHKFRSRAVVEFGTPIDIPPELVEKYKRGERREAVGELLDTIYHSLLS
                     VTVNGPDYKTLMVVQAARRLYNTKGKKLPLPMVVELNRRLVRGYTHYKGDPRIIKLEN
                     SIESYNKELRLLGLRDHQVEYANFSIIQVLFTLVYRLSKLTLLTVGTLPGLILFAPVF
                     VATKSISRQKSKEALAASTVKLQGRDVMATWKLLVALAFAPAVYALYTTLFTYWTYRN
                     RIQGYVPEWVPLWAMVLLGVVLFPTITFAALRIGEVGMDIVKSLRPLILSLNPSSANT
                     LVKLRTRREELSHEVTEVINTLGPDLFPDFDSARIVADPFRDSDQAVHVEEAKEDGEP
                     RPSSLKRDSYTTQEPLPRNESFHNLASIGFFSTRPPSRNSASGRAPAGTTGAFLTAPS
                     ALDSNEGLDEISKRIHSAMRERGQERRRRSEDMSWDMASTGSATPPEEEDMKEK"
     gene            complement(<1087832..>1089880)
                     /locus_tag="TRUGW13939_02840"
                     /db_xref="GeneID:55990347"
     mRNA            complement(join(<1087832..1087867,1087932..1088589,
                     1088793..>1089880))
                     /locus_tag="TRUGW13939_02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486027.1"
                     /db_xref="GeneID:55990347"
     CDS             complement(join(1087832..1087867,1087932..1088589,
                     1088793..1089880))
                     /locus_tag="TRUGW13939_02840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341920.1"
                     /db_xref="GeneID:55990347"
                     /translation="MARPSTADGRQHGESASNDDVGEPSRRLTVNLEELKLGDVPEGP
                     LNKDEFLELCRSDPGGLFEGLFQHLSMQEKRLEEALAESSNNDTEEIDSMREEIQNLK
                     SNLADHRQAMSELITERDAAIANTSPAGGDHKKKTTKLPDGQLLSDGIDPKYESWEID
                     VENKLEANADHYPTALARMAYVKGMCKGEAANHLLPRFRKDSAQRYQDVGDIFEHLRT
                     IYMDENRVINAKMELRRLAMRDSKFQIFLSKFTLLAQEAGLALSEWKEELYHKLSFDM
                     QRAMIKESTDPMVSYQTFVQGCHTTANRLEQIAEGERRARSRGIGSSKGHSQGGHQSN
                     TSGGSKPKNEAPQPQLSWEEKKKLMSEDNMTVSIQLAKNGYSICTKALADTGANGFAF
                     LDVFLAEKLARHFQTYTVPVSEPCGVRGYDGKTVEPVTHLMILTLVVDGRMQRHLPFL
                     LVRLGRHDVILGRMWLEKYNVLVDCRNRRLLWPEDVSLKDQMEREQFIRMPKTILRRN
                     GPVNLEHQADMERRDRLMEEPVPLLQPEPQRKAPAVTGRTQRTQSRMELQKMEKALRS
                     ENATGPFGSTKEASPVQSSELPDSIVV"
     gene            <1091965..>1092754
                     /locus_tag="TRUGW13939_02841"
                     /db_xref="GeneID:55990348"
     mRNA            join(<1091965..1092120,1092194..>1092754)
                     /locus_tag="TRUGW13939_02841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486028.1"
                     /db_xref="GeneID:55990348"
     CDS             join(1091965..1092120,1092194..1092754)
                     /locus_tag="TRUGW13939_02841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341921.1"
                     /db_xref="GeneID:55990348"
                     /translation="MLSDKEGFVRLPNEHIIFTSPPRTTLSLKPNSGKESFSISSSSG
                     SLYLTNQRIVYLPSQQNPAFQSFTTPLLHIYDSHVSAPFFGPNVWTAIVRPVAGGGIP
                     ASIQVVELKFSFKEGGAFDFHSNFERIKDRLGQAVEHAREQGPATSQATPGRGVDFTH
                     VHLDELPAYDGARNPSQVGDNNNQHQSSNSATQASTTESAGANTDFAPPPMEPPPGYE
                     EVQQQSVAAELEDRLRRTSS"
     gene            <1093192..>1093867
                     /locus_tag="TRUGW13939_02842"
                     /db_xref="GeneID:55990349"
     mRNA            join(<1093192..1093495,1093625..1093744,1093803..>1093867)
                     /locus_tag="TRUGW13939_02842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486029.1"
                     /db_xref="GeneID:55990349"
     CDS             join(1093192..1093495,1093625..1093744,1093803..1093867)
                     /locus_tag="TRUGW13939_02842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341922.1"
                     /db_xref="GeneID:55990349"
                     /translation="MGLADLFSDVISSFGFSEAQAEAPPAEENDTNAAAEEQEDSKPA
                     EEEASEETAEDATEQPEEEAEAEAEGEEAEEEEAGEEEEEEEEEEEEPEDIKPKLEEE
                     CANSSHCAPYKHHFDECVERVTSQQEEGDGKVTEDCVEEFFHLQHCATQCAAPKLWKT
                     LR"
     gene            complement(<1094313..>1096154)
                     /locus_tag="TRUGW13939_02843"
                     /db_xref="GeneID:55990350"
     mRNA            complement(join(<1094313..1095131,1095201..1095549,
                     1095615..1095727,1095790..1096012,1096075..>1096154))
                     /locus_tag="TRUGW13939_02843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486030.1"
                     /db_xref="GeneID:55990350"
     CDS             complement(join(1094313..1095131,1095201..1095549,
                     1095615..1095727,1095790..1096012,1096075..1096154))
                     /locus_tag="TRUGW13939_02843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341923.1"
                     /db_xref="GeneID:55990350"
                     /translation="MRSPASGCSSTPPPDQVQKHSTAILYLSIAMSIFSKASAGQSHA
                     TASGPAKHGKAAEMPYPKNETNYEVEIAATRGSFRVYKRRFFGLCQLVLLNIVISWDW
                     LTFSSISSTSAEYFQVSESTINWLSTAFLFAFCVATPAVMYMLNKGGPKSVIITASVL
                     ILIGNWIRYAGTKAQGGIFGVVMFGQLLLGFAQPFALAAPTRYSDLWFSEQGRTSATA
                     FATLANPLGAAIGQLVDSFWTVKPSDIPNMVLWISVIATITCIPSLFIPARPPTPASA
                     SAAVAKTPFGESIRGIVRFREFWLIFIAFSVYVGFFNSVSTLINQILLPYGFSETDAG
                     IAGGVLIVAGLISSAIVSPINDRYKQYLLVIRICVPVHAISYIGLYFAPSSPYGLAPS
                     IVVCALLGVSAFALLPVVLEYLVEITYPYSPEISSTLLWMGGQLLGGIFTIIQTELKA
                     GQDGAHPPQNMKRSLIFSAVIACVVALFPLTLNVIGPKIVNRRLEADWNDIHHAHNRD
                     LDVPLQNRNNTAEARVTDQ"
     gene            <1101874..>1104294
                     /locus_tag="TRUGW13939_02844"
                     /db_xref="GeneID:55990351"
     mRNA            join(<1101874..1102041,1102099..1104126,1104193..>1104294)
                     /locus_tag="TRUGW13939_02844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486031.1"
                     /db_xref="GeneID:55990351"
     CDS             join(1101874..1102041,1102099..1104126,1104193..1104294)
                     /locus_tag="TRUGW13939_02844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341924.1"
                     /db_xref="GeneID:55990351"
                     /translation="MNVASMRSSMSSYGDPRYLSAAYPSGAVSGVPSKVLVDGYRGTS
                     DLSTDDRSQYSGSGMIPPISSAPSIDVTDPVLMHLLTETAIGDSTGYEILPFETVEEL
                     KREYAILSSRVEGTKRKLALETKLRDAAQSLRRLPGPQTNGHINGDMNGMAVDSGDDE
                     FAVSSQKCEDLAQELWSMEQRSQTIHKQLLEHTAGILQLTHRGLKKNINRNGSINGAN
                     GVTRGSVFEFDDRSLYKSLDNLDDVNPSALRDAEQKLEQLNGRLRDMLLQQDDYGAEP
                     LPQKSGEDDGSPAYIQAHLAYLENHLDALQTRDQTRDLQGNGVDAGAGTGAGVSSVEM
                     ESQISSLNGRLHMLLGQAGSHLSPTLPPPPSPSGEYLHTHMDYLRSGFDDLQARVEGL
                     QDQKTILTTQIQQQRELNSKSDAEKDAHVGDLTRQIIEGRKEFELSERELQSVRDELE
                     LVTEQLNAVKEQNSLGQQATAGLESERNGRLQAEAELEAERNARLQAEAELEAGRNAR
                     SQAEAELEAGRDAHLQAAAELEAERNGRLQAEAEAKRVRDEMTELESEFARAQTELTV
                     VKAELDGAYGTRAERAAEAAANPALQRELDGLTAKNVSLAEELAAVRAGQANSGNGGS
                     GNKGELQNRVEALEKELRDTIEDYEVMTKASIEFEKEREKYEGYIDNLRDRCEQLEAQ
                     LGDERITWMGISQQMATRDVATETTSTMVLKNEFKKMMRDTRSENMKLLRAEQEERKK
                     LEALVRSLKMETTMGKSNISQTPVS"
     gene            complement(<1105112..>1107770)
                     /locus_tag="TRUGW13939_02845"
                     /db_xref="GeneID:55990352"
     mRNA            complement(join(<1105112..1107504,1107569..>1107770))
                     /locus_tag="TRUGW13939_02845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486032.1"
                     /db_xref="GeneID:55990352"
     CDS             complement(join(1105112..1107504,1107569..1107770))
                     /locus_tag="TRUGW13939_02845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341925.1"
                     /db_xref="GeneID:55990352"
                     /translation="MDSEQPSGAALSKPGLTAASLAASFKLDEGYSDDTKSQPENDAA
                     VAQSEEAMLLPQCIFSHTEAERAELAYTILRSLRTSTIASVVDRLTPRLHMDPVFKLP
                     PEITAEVFAYLDLTTLLTASLASRSWRNRIFDSRLWRDLYIREGWRLDIDAIRRYERL
                     HSELASHNRKSRARHDDSDVSEPQLKRRVTEAGLSPRGPATQAPQPSSSWNEQHQPVE
                     ADVPESPHDAEGDREMRDVYSEGRPLSSIPSPPSAKSSSLLIRSPNGSPKINWPHIYK
                     QRRRLEDNWFKGRFTNFQLPHPAHMEEAHTQCVYAIQFVGRWLVSGSRDRTVRVWDLD
                     SKRLWHPPLLGHSTSVLCLQFDPSPEEDLIISGGSDKNVIIWKFSTGEKIQELHNAHE
                     DSVLNLKFDKRYLVTCSKDKLIKVWNRRDLSPLDKDYPTFHRGPAVKYPSYIIDTAFV
                     SPSRIEAELANHHMKSLEPFSLLMTLDGHGAAVNAIQINDDEIVSASGDRLIKVWGIR
                     NGACLKTLMGHTKGIACVQFDNRRIVSGSNDDTVRIFDHSSRAEVACLEGHSNLVRTV
                     QAGFGDPPGAEEALRLEALAVDNDYWDAQRSGNVPDYQQRSSRRTATNRNAGSRNPRD
                     VMALGARIPPGGGGSRWARIVSGSYDETVIIWRKDRDGKWLVSHRLRQADAVVNATAT
                     ALHRGREAANRAMLRAIPALHHQQAIHPPPQPAAQNNNTPPAGNANGNNNDNQGVGGT
                     NTAAQPQPPPPQQQPQPQQPNQAAPPNNNHVPNPLAVLQQAHALNTLVAQTQANNNAQ
                     PAHAHQAHRQAPHIPNPGVPPASRVYKLQFDARKIICASQDPRIVGWDFAAGDEEIIE
                     ASQFFLGL"
     gene            <1109577..>1112670
                     /locus_tag="TRUGW13939_02846"
                     /db_xref="GeneID:55990353"
     mRNA            join(<1109577..1109999,1110051..1110608,1110693..1110941,
                     1111014..1111200,1111259..>1112670)
                     /locus_tag="TRUGW13939_02846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486033.1"
                     /db_xref="GeneID:55990353"
     CDS             join(1109577..1109999,1110051..1110608,1110693..1110941,
                     1111014..1111200,1111259..1112670)
                     /locus_tag="TRUGW13939_02846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341926.1"
                     /db_xref="GeneID:55990353"
                     /translation="MDPPSGNGVPYGGPVAEDNIINRRGGESIYQTIVHLKRRLAEVP
                     GFDGHLVEMEAEEEVSGDLVASLWKCFRQGYPLLTIFNASQPDEVQQIDPEKVPEAKR
                     PKAATFKFLQASMHDLGFAQQDCFLITDLYSDNITGFIKVIKMVNRVLDSLEIQGQLR
                     RPSLAIPGLQGDQGTVKLTKRQHILKELLETERDYVHHIQNLQALKKELDETGALTGD
                     KSHQIFSNLNILLDYAQRLLIRMEQHYALSEERQDWGRLFLESEAALRQYEPFIANQL
                     LCDEVCLQEWDKIRLAPRSTDLKQMVAMPATLNSFFVKPFQRLTKYPLMLLELRKQIE
                     NEDLQSNITRAVDMIQSVLDLANLAIDEEHLKSAMEDLAHRVDDWKTLKVEAFGKLLR
                     FGTFTVLKGDTNKDAEREFHIYLFERILLCCKDVNPNKQKTKLIGSKDKPSGNLKGKA
                     RLQLKGRIYMANVTDIVVLQKPGSHRIQIFWKGDPGVVDNFIIRYTNEDIMKKWHKDI
                     EMLRQEQAGQRNVRHTGTSDSEFMYMQNMQGMVNPYQQEYDAEEDSQVQSGSFSEFPV
                     SRNASSTSLRARSATGGSSGSIALPGMRAPPRFPLPDLPPALHTQLSNGSLSPGERFV
                     QDSSYFSPITETPSTRSSSQSTFNYSRQMSSSSTVWSEESNRYTAPALSSRMSKDGPN
                     HNPYFSGATPNSNGANGRVQRPSLPPMSIQGQPMNTMSQRVRSASSPDIHNHNPSRYA
                     NGGHTMQTIDNVPVPPIPPQLANMRAPVNRSQNNSPTNGNLPIRSAAQTPVSGSRHTP
                     SGGYHDQPYTSALATSQSSLSKNPLAEAGMLESEVSGASGPVMPTQLKAKVSYDGSYV
                     TLVIASNILFRSLTDRVDAKLARFTQRSIGNNTARLRYQDEDGDFVTIDSDEAVQLAF
                     MEWRDQHQDVISQGQVGEIHLFCQAVDP"
     gene            <1113787..>1118336
                     /locus_tag="TRUGW13939_02847"
                     /db_xref="GeneID:55990354"
     mRNA            join(<1113787..1113871,1113940..1114415,1114464..1114749,
                     1114803..1115386,1115643..1116948,1117076..1117107,
                     1117220..1117579,1117647..>1118336)
                     /locus_tag="TRUGW13939_02847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486034.1"
                     /db_xref="GeneID:55990354"
     CDS             join(1113787..1113871,1113940..1114415,1114464..1114749,
                     1114803..1115386,1115643..1116948,1117076..1117107,
                     1117220..1117579,1117647..1118336)
                     /locus_tag="TRUGW13939_02847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341927.1"
                     /db_xref="GeneID:55990354"
                     /translation="MSFSGRRLSILRPSDARRLSTVKDLSLNEQQSETHRDFRAAHEG
                     HKPHAGLDPSRASTGVIWCTERANEHGFSEHPHEWANLGQGAPEADDDIVGSFPRPTS
                     IPVDSASREYGPTAGIKPLRAAVARLYNEQYRQGKESQYTWENVCIVPGGRAGLIRIA
                     AILGNSYLSFPIPDYTAYSEMLSLFKNFSPIPIPLAENDGYHIHPDKIAEEIARGTSV
                     ILTSNPRNPTGHVVANPELARIQDICRGRATLILDEFYGGYNYTTDCDGTTLSGAENV
                     VDVDEDDVLLIDGLTKRFRLPGWRIAWIVGPKEFVDALGSAGSYLDGGANVPFQEAAV
                     PMLEPSLVKREMVALQDHFRTKRDYVLGRLHEIGFRIKDVPQATFYIWLDLTSIHPPL
                     PESANVNDGLNFFNALLKEKTIVVPGIFFDLNPAKRRDLFDSPCHHFVRLSYGPKMDV
                     LKQGLDGIERVIRRARGENIGPTLEDEQASQQLYTTHELRVESELSLTSNHPINKNAS
                     STMAVNILRILNSTVYSVLAIVLFGLTLLTPADFIYQCWQNRRLTNIFIVAGVYVVTV
                     LLALLVYASRIYTLRTGLGAIPKAWIPVAKGEVGKSVQRLVDEGRRRSAIIAYQARPR
                     DLFSEDYTNNNNTHDEELSVNVERPPWGPVQHAGWSAPSSLDLPGLRYQRVIEELPHL
                     IEAKAVSLAPSDSLVASANNVFGADDNDVDDRYNIPDPRVVEILQRPATMGLRDYVAH
                     LTTLGLIDPPQLGAEFLALYEQARFSARLLVEDEFRRLMSIFAEILRGMRAIDDKILQ
                     EIFYAADNYSESSESFIGPSDEEGETDTLGTDSLHRQPSTTYSSAGGDTSSSLRSVRT
                     APMVQPASSSSAVGSSPSKRSLHRARSNISQNSSGGSVIRLVKTRSPEDLPYAINMGA
                     KADQIRSGRMQKFLRRGAELLTPRTGSPANANDNDGDGFTTASSHTALFPAVNHAVDG
                     DDCDRDCASCTIHYPARFDVELNDTLYGNVNGWATHALVATGKTDWVRDVADEKGSVM
                     EAIERGGAEPLNGKLKLSASNIPVPDEYHEADDDANRPTTVALFPAFTIIDHVTPALA
                     PDLIRYFVNPSITTTTPLRSIPIAPATLAVEGEEGEKETPLRARPSPHAAVILLCSQR
                     TRDARCGQSAPLLKREFERHLRAQGLYRDMNDERPGGVGVYFISHVGGHKYSANVIIY
                     RRRDFEWYKKEETQEEEEVDGAVQGIWLARVRPEECENLVRFTVMQGKLVKPDQLRGG
                     FDRERGLTSW"
     gene            <1121365..>1122457
                     /locus_tag="TRUGW13939_02848"
                     /db_xref="GeneID:55990355"
     mRNA            join(<1121365..1121418,1121501..1121692,1121744..1121823,
                     1121881..>1122457)
                     /locus_tag="TRUGW13939_02848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486035.1"
                     /db_xref="GeneID:55990355"
     CDS             join(1121365..1121418,1121501..1121692,1121744..1121823,
                     1121881..1122457)
                     /locus_tag="TRUGW13939_02848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341928.1"
                     /db_xref="GeneID:55990355"
                     /translation="MAPGGGRDFNCSWDKCGKSFNRKSDLCRHYRIHTNERPYHCTVA
                     DCNKSFIQRSALTVHSRTHTGEKPHVCDHDGCHKAFSDSSSLARHRRIHTGKRPYICQ
                     EPACEKSFCRKTTLTKHQSRSHPQDDSRLSSVETTPEHVYQTPVVSSMAPTQYMLAQP
                     APSLYQQQDFYQTPHSMPSHSMPLAQPPSLVPHHHPVSTVHAPPAAVAPVDHQHQQYA
                     QMMQQQQQQPRYNPTPRPTSYIPTEYPPQPPPPYPGHHHPHTMVSDAHPMMMSYQPEY
                     QYKPPPARILNSQEGTDWGFLGIS"
     gene            <1127248..>1128673
                     /locus_tag="TRUGW13939_02849"
                     /db_xref="GeneID:55990356"
     mRNA            join(<1127248..1127336,1127416..>1128673)
                     /locus_tag="TRUGW13939_02849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486036.1"
                     /db_xref="GeneID:55990356"
     CDS             join(1127248..1127336,1127416..1128673)
                     /locus_tag="TRUGW13939_02849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341929.1"
                     /db_xref="GeneID:55990356"
                     /translation="MSNPEDEPRLQIAPEKLDENIVVLITGANTGLGYSTCCRLVDEF
                     AKSYPDTYRLTVIFTTRRPPAQVRSTRDDLTKYASRHGDQLASRVQFLAETLDLFSLH
                     SVRALSRRLNRNFTKLDAIILNAGWGGWSGLNWPKAVFSVLTDMVNATTWPTYKLAKA
                     GVTTPRQTQLAEEEPLSAVFCANVFGHYMLAHNVMPLLRRSGKPNGPGRVIWISSIEA
                     TTTVFDVDDIQALKSEAPYESSKALTDILALTSDLPSTAPWVKSFLAADSSESESSKE
                     PSTTTGPPPLNYLSHPGIFGSSIVPLIMPLWYCMLAAFYISRLLGSPWHTVTTYLGAN
                     APVWLALSPQEILDEAEKPYRENGGGHAKWGSSTDRLGRPRVANTELDGWGYGGVVGR
                     PPVVPEDRSRRRKPGMKLQTAEDRLQFEELGRRSWQYMEELRVEWDRLLDVSEKSQ"
     gene            complement(<1129475..>1130860)
                     /locus_tag="TRUGW13939_02850"
                     /db_xref="GeneID:55990357"
     mRNA            complement(join(<1129475..1129494,1129555..1130431,
                     1130508..1130654,1130744..1130787,1130854..>1130860))
                     /locus_tag="TRUGW13939_02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486037.1"
                     /db_xref="GeneID:55990357"
     CDS             complement(join(1129475..1129494,1129555..1130431,
                     1130508..1130654,1130744..1130787,1130854..1130860))
                     /locus_tag="TRUGW13939_02850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341930.1"
                     /db_xref="GeneID:55990357"
                     /translation="MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVESLAAA
                     GVTDIVLAVNYRPDVMVAALKKYEEQYNVKIEFSVESEPLGTAGPLKLAEKILGKDDS
                     PFFVLNSDVICEYPFQQLADFHKSHGDEGTIVVTKVDEPSKYGVVVHKPNHASRIDRF
                     VEKPVEFVGNRINAGIYILNPSVLNRIELRPTSIEQETFPAIVKEGQLHSFDLEGFWM
                     DVGQPKDFLSGTCLYLSSLTKNNSKLLAPSSEPFVYGGNVMVDPTAKVGKNCRIGPNV
                     VIGPNVVVGDGVRLQRCVLLENTKVKDHAWVKSTIVGWNSSVGKWARLENVTVLGDDV
                     TIADEVYVNGGSILPHKSIKQNIDVPAIIM"
     gene            complement(<1131413..>1135037)
                     /locus_tag="TRUGW13939_02851"
                     /db_xref="GeneID:55990358"
     mRNA            complement(join(<1131413..1131854,1131906..1132294,
                     1132707..1133072,1133128..1134936,1135008..>1135037))
                     /locus_tag="TRUGW13939_02851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486038.1"
                     /db_xref="GeneID:55990358"
     CDS             complement(join(1131413..1131854,1131906..1132294,
                     1132707..1133072,1133128..1134936,1135008..1135037))
                     /locus_tag="TRUGW13939_02851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341931.1"
                     /db_xref="GeneID:55990358"
                     /translation="MALSASVNMPAAKSELLSTMSTAGFQWKRAHRVSGLLQSTSFFG
                     QSTLRTVMLSRASKPLQSSRQYSSLLHDNSRLLRRPTSMGLSKADQQHRSLFGGLSHN
                     LLAQKERAANSNPSSASAQNIFYQSLLRANMPAIIVERHRTGQYASNSATEAIYAQAI
                     QRLGGDAAVHGASQNLDAEQLQSVGQAVAAHAHGSQVGMSTKHSGTGAKESPLYVVVE
                     ESLGSSVFRWVKFFLYFGFFAYMSLVLITILVETTGLIKNVRGTQTNEATPQQQKARF
                     SDVHGCDEAKDELQELVEFLLNPERFSTLGGKLPKGVLLVGPPGTGKTLLARAVAGEA
                     GVPFFYMSGSEFDEVYVGVGAKRVRDLFNQARAKAPAIIFIDELDAIGAKRNERDAAY
                     VKQTLNQLLTELDGFSQTSGVIILAATNYPQLLDKALTRPGRFDRRVVVSLPDVRGRM
                     DILKHHMKNVQISTDVDVAVVARGTPGFSGADLENLVNQAAVHASRKRLDRVGPRDFD
                     WAKDKIMMGAEARSRIIQDKDKLLTAYHEAGHALVAYFSPSATPLYKITIVPRGMALG
                     ITHFLPEMDTVSRNYTEYLSDIDVSMGGKAAEELIFGPENVTSGISADIQQATETAFT
                     LITRFGYSKKLGNVDLSSNYDKLSSETKQEIEGEVRRLVEEARDRATNILTEKRNELE
                     LLTKALIEYETLSKEEMEKVLKGEKLDKMQSLPAAPLKLPDALATTRIKPVPQSRKTV
                     RPKRPEYEDRNVQPRLPETRERELSVYEPGQQQTLGHLLKLPVELRRRIYDAVLGHRK
                     VHVLFAFAPWMYRKQITGKKEILEWRWWHSICTSDQTESIWRDPCKNKPPNGKPKLDF
                     AILLTCRQVYSEAIDILYSTTTFDFRTRQLLCAFPSLVLPQRFALISSIEMEWEFIDL
                     GLSYSNAAEQTRLYQDMWAMLAAMPNIRHLKIAIGTYECPRPAPPGLKEVWLGPPKQL
                     GRMEVFVLLVPLSYMEVLKPGVDEGANFTLEPFHDIYGG"
     gene            <1136011..>1136991
                     /locus_tag="TRUGW13939_02852"
                     /db_xref="GeneID:55990359"
     mRNA            <1136011..>1136991
                     /locus_tag="TRUGW13939_02852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486039.1"
                     /db_xref="GeneID:55990359"
     CDS             1136011..1136991
                     /locus_tag="TRUGW13939_02852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341932.1"
                     /db_xref="GeneID:55990359"
                     /translation="MGAPSGRLRWDEVDLLQAAVPPFHAPNKTSKSASSVAADNVKWR
                     VLQGQQATDLVSAQDQDTLFLNTVDLQPKAPGDVLLSHFYEHSISIRDTHYLSDSSYD
                     ETTMSLDDSNAIESVASGDSHSNDTHFDFSGEIYDLGDIPNAAYLRSIIPQTMSVTLV
                     VAVLGINPPRRVTARYSGQQFDILELVVGDETKTGFGVTFWLPVVERARQKKIDAERD
                     DGYKKKLSGLRPRDIVLIRHVGLSFFQDRVYGQSLRKTMTKVDLLHRRPLDANDPGGI
                     YSARTINAAKRENKLLYKVQVVHDWTMNFVGMKIQDRGGSAGRPLPPDTQ"
     gene            complement(<1137221..>1138931)
                     /locus_tag="TRUGW13939_02853"
                     /db_xref="GeneID:55990360"
     mRNA            complement(join(<1137221..1138173,1138232..1138385,
                     1138440..>1138931))
                     /locus_tag="TRUGW13939_02853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486040.1"
                     /db_xref="GeneID:55990360"
     CDS             complement(join(1137221..1138173,1138232..1138385,
                     1138440..1138931))
                     /locus_tag="TRUGW13939_02853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341933.1"
                     /db_xref="GeneID:55990360"
                     /translation="MSQSSLKEEPKPPLDAPGTSELNDSPVNLSDVASSKEEDISNEK
                     RELKESDCYETLGYCWPRWKKWSYLVSVAFVQVSMNFNTSVYPNAIIPLSKAFNISEQ
                     HARTGQMAYLVTYSIGCELWAPWSEELGRWPILQLSMFLINIWQILAGLAPNWGSHVV
                     ARALGGLSTAGGSVTLGLIADLYEPETQQFPLAFIVLSSCIGTSIGGVIGGPIERFLT
                     WRWFFWIQLIFGGVTQAIIFFMPESRSTILIDKEAKRRRETGEDPNIYGPNELKNPRI
                     SLKDAGRIWIRPFHMLVREPIVLCLSLLSGFSDALIFTFLESFAIVYEKGWGFGILAQ
                     AWAVIPINAAYVIAYFTYFPWFRRDQSIRQARGNDALVPERRLKWLLFLAPLEPIGLF
                     GFAWTSLGREHNVHWIGSMIFSACVGIANYAIYLSSVDYMVASYGVYSASATGGNAFA
                     RDLLAGISAMYATPMYTNIGNKYPVEYASTILACMSCLVVIPIYVFYWKGPQIRANSK
                     FASTLAADRKENEGRRASRINSEP"
     gene            complement(<1145487..>1147574)
                     /locus_tag="TRUGW13939_02854"
                     /db_xref="GeneID:55990361"
     mRNA            complement(join(<1145487..1145930,1145989..1146155,
                     1146209..1147203,1147270..>1147574))
                     /locus_tag="TRUGW13939_02854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486041.1"
                     /db_xref="GeneID:55990361"
     CDS             complement(join(1145487..1145930,1145989..1146155,
                     1146209..1147203,1147270..1147574))
                     /locus_tag="TRUGW13939_02854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341934.1"
                     /db_xref="GeneID:55990361"
                     /translation="MATSLSTTNSAPHSRRASRISRSRPNSRPHSRRQSVITKTTTDD
                     GARSLIQDETRRTDNLKDRFIGAIDQGTTSTRFIVFDGTGLPIASYQSEFRQIHEHSG
                     WHEHDPKELVASVEKCIDETMKTFLALGHSRSDISTIGITNQRETAVVWDWETGEPLH
                     NAIAWPDTRTKGMVRELRNKEGADGLDKICGLPLSTYPSSVTLMWLLRHRPEVKKAYD
                     EGRLAFGTVDSWLLYNLNGGVKNKVFVTDVTNASRTMFMNLHDLKYDDKLLEFFGLDQ
                     TKIRLPKIVPSADPKEFGKLYRGPLAGTTITSCLGDQSAALVGHCAFEPGHAKNTYGT
                     GCFLLYNVGEKPVISQHGLLATVAYQLGTDRKPVYALEGSIAVAGSGVSFLMNNMGFF
                     RDSKKVSEVAETVPDNGGCVFVTAFSGLFAPYWIDDAKGTIFGITQHTQRGHIARATL
                     EAACFQTKAILDAMAKDSGHKLADLAVDGGMSNSDICMQSQADIIQIPLERPSMHETT
                     ALGAAIAAGFASGIWSTYEELRHMNRANRAVFRPYLDVQESSLMYKQWTKAVEMCRGW
                     LDASEIGMEEDDEDDEDEEESEDEDEEVGRVGGPSIVLSPAEQSSVSRAVSDMAIIED
                     SDDEVAISSGSE"
     gene            complement(<1150535..>1153081)
                     /locus_tag="TRUGW13939_02855"
                     /db_xref="GeneID:55990362"
     mRNA            complement(join(<1150535..1150684,1150746..1150953,
                     1151013..1151101,1151162..1151783,1151847..1151907,
                     1151958..1151993,1152058..1152148,1152219..1152375,
                     1152458..1152696,1152791..>1153081))
                     /locus_tag="TRUGW13939_02855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486042.1"
                     /db_xref="GeneID:55990362"
     CDS             complement(join(1150535..1150684,1150746..1150953,
                     1151013..1151101,1151162..1151783,1151847..1151907,
                     1151958..1151993,1152058..1152148,1152219..1152375,
                     1152458..1152696,1152791..1153081))
                     /locus_tag="TRUGW13939_02855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341935.1"
                     /db_xref="GeneID:55990362"
                     /translation="MSPSLELPSWYPDWAPGPSSRPEQQQTPRREDPTLPFPFLSTPD
                     RNRNPDPPSSIETSTHGEIECRDGFTRPPPITIDVLPRKDRTVNRKLKGIHLFMITIN
                     GTLGTGLYWRGGQILELGGPLAVLLSFLLVGLLSVAVMQCITEMLCIWPIPGAMSLYV
                     SEFVDPELGIAVGVAYWFTYSVSFSAIIATSAAEFGFWPGIGGNSGINGGIIYLCIPL
                     CLVLLNALEIELFALFEVFTGTIKLLFLVVIAIVLVVLNFGVGPSQHGYIGTRYWSEP
                     TAFDSDAASNWATAFLMSISIATFAYVGVEIVAASALEARWPRRNEKDEARKTSDMSL
                     IGNSVKFTAVFFSVLATFAYSLTGVLASFDIPRDDCQLPRLSWVNSTVTQCYEPPTSN
                     TTSAFVAIAVQSGIPHLADVFNVFLVFTSLSCANTNLYVASRALFGLTSRLDGGSGQS
                     WFLRLLSWFGKTNRHKVPMRAMIFSAVSFWWVPFLQLRGGTDTRTTIGMFVEVLAEMG
                     SVGVLIVWLCECLAFIRFYHCIMAHRKVLQEQNISHVRRWDEDDYPYRSHGQPMTAYA
                     AFTGCFVVLVVINGVSLWKGFHDLPFLSSYVIVLAFLALWVLLKLVRDGGEANWSFVD
                     LSNPQKVINKILTLHDIRMGTAS"
     gene            <1153587..>1155806
                     /locus_tag="TRUGW13939_02856"
                     /db_xref="GeneID:55990363"
     mRNA            join(<1153587..1153715,1153781..1153903,1153960..1154002,
                     1154308..1154440,1154507..1154694,1154754..1155457,
                     1155546..>1155806)
                     /locus_tag="TRUGW13939_02856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486043.1"
                     /db_xref="GeneID:55990363"
     CDS             join(1153587..1153715,1153781..1153903,1153960..1154002,
                     1154308..1154440,1154507..1154694,1154754..1155457,
                     1155546..1155806)
                     /locus_tag="TRUGW13939_02856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341936.1"
                     /db_xref="GeneID:55990363"
                     /translation="MPNLGEQQQQAISQNTSYRYLSKSRLQELLERLFPGQTEFNIQM
                     RDDQWCFSAPRKVEDVSTWAQQLAFRVSMTNGEAITERHRCAIPKQQLQQKRVLLTEP
                     LHLIEVDQQQPARCSAHLQLSTAQELAAHFDQNRDYSCRLISICQRNSWQPLQTSRSM
                     LDLIVAKNSISSQFWDLPSCFYRRNLEVEEVFCVPYSETREGPITEISYTLKYPEYKP
                     RTNEWVIRQTGIHHRFNSTTGQSVYVLFNPVPSSKVHLAAQERLRDNSQETKTEPFWL
                     HRILFATYFPAWRQYIAALEREFLPIANGVNVAYIDEPLRVGFENLSTTMSLQKRFLQ
                     ISTLLAPAADVLDAMDILLKSISQTIATHPGTQKFKNYNRQCIAYSRMATNLQHRSQM
                     TAQLLTDTLSFRDQVVAKQQNENMLQLNKSAVFVTFLTLFYLPASFLTSFFGMNFFDL
                     DQDAKRIVGTPMIWIFIISTIFLTAITVFIYYWRVQREAKRRVIPRIQIDWNWKTMTR
                     GLEMRKLNLDMSQKDSQA"
     gene            complement(<1155858..>1159026)
                     /locus_tag="TRUGW13939_02857"
                     /db_xref="GeneID:55990364"
     mRNA            complement(join(<1155858..1156301,1156385..1156646,
                     1156710..1156924,1156980..1157262,1157366..>1159026))
                     /locus_tag="TRUGW13939_02857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486044.1"
                     /db_xref="GeneID:55990364"
     CDS             complement(join(1155858..1156301,1156385..1156646,
                     1156710..1156924,1156980..1157262,1157366..1159026))
                     /locus_tag="TRUGW13939_02857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341937.1"
                     /db_xref="GeneID:55990364"
                     /translation="MASEKSYDNLCHDIYMRLYSQLERKDEERYRFAPAGTAKGVLHR
                     DILMRFFQSLLSRRRNAIDEFGLSEEDLVHRINERQLHNFLAILMFATCRIQAAKIFT
                     TQLVAGDEWPVMSSAGNKFHVLPAGREELLELFHDDIVTVDKFLTTQACFCPVTIQRR
                     EEVIVRSLEEHRLPYIAEKLLSQGSFGIVYKVKIAKGHFYDSRSETVNPDYTEIARKD
                     YRISENAHIEHEIMGKILNSSSWECRNIVENYGSLHISPTKYSLFMPLAICDLMAYMR
                     EIRQTKPGDVIEKAKIIKSAIGLAAGLNFLHNKLKTSDEEDLVCYHMDLKPDNILIFR
                     ETSNNETNYIWKISDFGMARVKLRNRYHNSESERDFNSWFVQHKKTQDQSSLATLNRR
                     GEGTYLAPESISAIPSMKTESDVWSLGCVISVVFTYLEEGGDGVARYQDARLKDNQAD
                     GIDRFFLRGTRFTSSKVHPIIKKWHSGLIDKAGQRDDREGRAVKFILRYLEKSVFEIN
                     QAKRDGVIAVEEALRETFRKYKELEAARENIPEKRKRLSSSVKPLRWHSSDDPQVERW
                     NLFPSEAFKGCAISPDGNLVAYWTDDKISLYTSESLRLQNLHTASPASNYLLETKYNT
                     TRMWKAVALTQRYLVASTTGGDFQCYIFKLEGGTSVDYSLDRCYKVSLPRSEISKLAI
                     SPDNKDLACILHNKEEPQSTSTLIRAPLSELIRIGEKPHNYPVKGALVNEFAIDDQLD
                     THDDDPWWLGKLDWPGTDITQFLFSTTSDIYLVVRPELTARSIEHKIPIIHIDLRTKR
                     LDTLIIGSLGADSIPSSTLFTTFAPFRKQAATCAVVTREKQLHIQNLMGNGLSPAIQN
                     RINNYRVLKLMMGWHDEKMFALGTPPASHKMLLLEMTIPQSGADKIYVKELAQLPGLS
                     CDDEFVEMLSDDKSEQRHVLIATLAGANQCAIYRVPLLAS"
     gene            complement(<1159815..>1160927)
                     /locus_tag="TRUGW13939_02858"
                     /db_xref="GeneID:55990365"
     mRNA            complement(join(<1159815..1160240,1160297..1160521,
                     1160589..1160642,1160700..>1160927))
                     /locus_tag="TRUGW13939_02858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486045.1"
                     /db_xref="GeneID:55990365"
     CDS             complement(join(1159815..1160240,1160297..1160521,
                     1160589..1160642,1160700..1160927))
                     /locus_tag="TRUGW13939_02858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341938.1"
                     /db_xref="GeneID:55990365"
                     /translation="MLYRMSAARAAFRAASASNSSAVARSALCSNVFKAQLTSAARPS
                     ARFAAGSSKLALAAHKPVTTALVRYSSNKSQPIVPEDEDVDMMAGVKNDVKVIKETFT
                     LDEVPKEALYFGLAGVIPYVATSLNTCYLAWEINSQALGGSGFLLSSETASLLLHLTE
                     PIQVGYGAVILSFLGAIHWGLEWAGYGGKHGFRRYATGCIAPAIAWPTLLFPVEHALI
                     TQFLAFTFLYYNDARAASRGLAPHWYGMYRFVLTFIVGASIVATLVGRERISQSGTAE
                     HTLTEKIQALLFLRKKEIEEAKLRAEEEKNADLE"
     gene            <1162265..>1171857
                     /locus_tag="TRUGW13939_02859"
                     /db_xref="GeneID:55990366"
     mRNA            join(<1162265..1171292,1171347..1171763,1171817..>1171857)
                     /locus_tag="TRUGW13939_02859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486046.1"
                     /db_xref="GeneID:55990366"
     CDS             join(1162265..1171292,1171347..1171763,1171817..1171857)
                     /locus_tag="TRUGW13939_02859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341939.1"
                     /db_xref="GeneID:55990366"
                     /translation="MLEGVVANLLNRFLGMYVKNFDAKQLNIGIWSGDVKLHNLELRR
                     EALDQLHLPLNVVEGHLGQLTLSIPWSNLRGKPVRVDIEDVFLLAAPRENSDYNPEEE
                     ERRAHVIKIDKLESAEILRERNTDGMSQEEQRRNQSFTESFMTAIVDNLQISIKNVHV
                     RYEDSIASPGHPFAVGITLKELSAVSTDSAWRPTFIQSTSGNTHKLAVLGALAVYWNT
                     DTELMGTGSGADFGAQAQGIEHGELMSRLKQGIDLDENNQYILRPVSGRAGLEMDKTG
                     KLDRPRMKTRLLFNELGFVLDSDQYRDTLMLVDLFHYFLRHQEYKKLQPSTTPKEDPR
                     AWFRFAGNAILSKIHDRNRRWTWAYIKERRDDRLSYIDLFKKRKREEALSPDQSTELD
                     ALERKYTYEDLRFWRSLARNQLRKENVGVKKPQQTQTWGEWVWGSKKAEDEPEAMTEE
                     QRQELYNAIDWDEKKALAESVDLPRESVKLQVNSSLRAGSLTLKRDPHGEATEVMKLV
                     FDNFKAKALQRPDSFFLALDLGGLRVYDGTTKGSIFPQIVRVKDAGDHDGDADSIKSQ
                     NLDAEEDSDETVVENSLFHLQLEQNPLESDADTAVKVRLKSFEVIYNPTFVVEVARFF
                     KPPERHMESLGALLDSAGATVQEIRQQTRAGLEYALQEHKKVDAQFDLQAPLIIVPES
                     ITKESSLCLILDAGHISVNSELVNRETMTDLQSKQKRQYDEEDYRHLEDLLYDKFLIK
                     LDSTQVLIGPGIEATKSQLSTNDPTKDLHIIDRINVDFVLEFCIVPKSTDLTRTRVSG
                     HLPELHASMSDKKYKNLMKLIDISIPRFEEATDQPPSKRITPADNAPDKAAPNRARSA
                     SFQPSTAREIPLVDDESDTEDSDKVTVTDNKEQTVALHQRDFEFKFTVGTLRGSLFKA
                     DPKEEKPDQLLVELIAEGFQLDYYLRPFDMVAEVTLKSLSVDDYIEENPAPEFKQIIS
                     SKGFNAEEDKDLFNLKFIRVKPESPEFKSTYEEVNTNLDIAVSTINVVVTRRTLLTLL
                     DFVLITFTNPNQPKELDQREESAIKDVEEETPQEVGKIRIKSNLKSIALILNNDGVRL
                     ATLSLNTADVGIFLVGKAMQIQSRIGSLTLIDDVNVGASADSSLRRLLTIEGEDFADF
                     RYQTFDPESSEYPGYDSEVFLRSGSIKIQFLEEPYRKIVNFLVKFGKMQAIFNAARQA
                     AANQANQLQENASRMRLDIVVRTPIVVFPKPLVDNRPRDSITAELGEIYASNTFVPLD
                     DRKDSPAVNVITTGIRNIRLISDFHFEDGTHEQLEMIQKVNLDFSICYLEHQQDQPRP
                     DIEVEGTMSPIKLRISQAQFKFLLDITKTVPTVLTPDSKQQELEAMKSLPTTSTEPVT
                     QESGIQTGLKKTIQSPEIEKDKETWVKLDMIFKVDSIGLELLLAKENKPVGQVEEASL
                     SKFSLNDTRVKLRMLSDGALESELLIHSFSIRDSRSQETNKFRKIMSLINTDVQQQFM
                     ASVSMSPGPNRHVIAMLTIDSPRIILAFDYLIALQSFASEAFAQEAAHEIEEDVETPE
                     EPETASSASGGYTATVGQVHGPAAEKGQMTFSFRADIVDAQVIMIANPTISNTEAIVL
                     GTKQVLFSHQNVSTLQINKVGMFLCRMDKFETSRLRILDDFTLELSIDSRPQDKGSAL
                     TSIDVHVEPLVLRLSLRDILLATQIMNKVSEMRTGPPEEEGIDEPKRIKEVTGETTKS
                     KRRSSNRGRSSSGVTGSKAGGNLIPEQRLEPQQVAVIKKEELGAQIDGIRVILIGDLH
                     ELPLLDWSVKKFNVDVRDWSSTLNADTTFDTFVNVYNFSKSAWEPLVEPWQLGFHMAK
                     EINPDVLSIDAYSHKNMELTITSATIALASKSFQFLKTDEDVLSKPRGADAPYKIRNY
                     TGFDLRVWADVGAEENGPAAKLSDGEECPWRFEDPTTMRENLTPEGNAGLVGVKLDGS
                     GFDSISHIPVIREGETLFNLKPKKDKVLHKLLVDVKLGTDNVKYVTFRSPLQLENNTQ
                     IPVEMGIFSPDDGHLLKIEKILPGDARPAPVGSAYLHQVVVRPDQGFGYDWSNEQLYW
                     KDLLRRPTRTITCASESGQQSPPFYFQLNASYDKRDPIINVYPHMKIRISAPVEIQNL
                     LPYDFKYRIYDKNTRKDWTNFLRKGGVSPVHVVELSHLLLLSIDMQDSVFRQSEFAII
                     NGSAQDFRREESLSLKDENGVQLKLKLHYFNVPDSGGAFKVSVYSPYLVLNKTGLSME
                     IQSKAFMQSARSAAGQGINADASAGHAKPYMFSYPTDDQKNRSIIRIGDSQWSKPQSF
                     DAIGSTFEVVVPAKTSRAEFHAGVSVIEGEGKYKLTRVVTITPRFILNNKLSEDLQVR
                     EPGTSNVVTMKGGDLVPLHFLRQVPEKQLCLCFPGVNNQWSSPFNIADVGTAHIKLAK
                     ASQRQRLIKAEVVTENATIFIHFSMETRHWPFSMRNESDMEFIFYQSNPNVEEEEYDD
                     SNSGWRPIRYRLPPRSIMPYAWDYPAAKTKSLVLNCNGKERHIRLAEIGNLIPMRVPV
                     QPNSSSQKIVDINIVAEGPTQTLALSNFKPSKSIYRQQKEQTSQTSLATGFEVKVENS
                     DITFKAQLRLGGVGISLINQTMKELLYCTFREIEIKLNESKVYQTLDTTVKWIQIDNQ
                     LYGGIFPILLYPSVVPKTGKEMEAHPIFHVMVTRVKDDSYGVLYIKYATLLLQQMTLE
                     LDEDFVFAMLDFAKVPGASWSIEQEGKLCDENLDIPEPRYDEVTQDVYFELLHLQPMQ
                     VDISFMRTERVNAEDKLQPSNPFMFFVNVMTMSIGNVNDAPVRLNALILENARVSVPL
                     LITNVRKHYTQEFLRQVHVVLGSADFLGNPVGLFNTVSSGVADIFYEPYQGLVTDRPQ
                     DLGYGIAKGAGSFVKKSVFGFSDSMAKITGSMSKGLAAATLDKEFQDQRRMSKARNRP
                     KHALYGVTSGGDAFARSLASGIGGLARHPLQGAEKGGFGGFMKGVGVGMLGAVTKPAI
                     GAFDLASNLAEGVRNTTTVFDADGLDRVRLTRFIGMDGIVRPYSQREALGQFWLKTTD
                     DGKFFKEDYIAHLELPGRDMIVLLTYDRIMLVRSNKLRFEWEIKLTDIQTISKERTGM
                     SITLKGGANGPFIPVQDESGRNWLYKQIAIAVNAFNEKYNAKG"
     gene            complement(<1172240..>1174636)
                     /locus_tag="TRUGW13939_02860"
                     /db_xref="GeneID:55990367"
     mRNA            complement(<1172240..>1174636)
                     /locus_tag="TRUGW13939_02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486047.1"
                     /db_xref="GeneID:55990367"
     CDS             complement(1172240..1174636)
                     /locus_tag="TRUGW13939_02860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341940.1"
                     /db_xref="GeneID:55990367"
                     /translation="MDYDDEDEFPRPSFAGQKRKVEKMSSSDEEEAAAARPSFGFQSF
                     QRAASRSESPPTMTGLGGGGGGARRSPWNNNNNMSASETPNQRSRGGGGAGKKQGSAP
                     AGGNSFAARMMAKMGYVDGQGLGSAGHGIVNPVEAQTRPQGLGLGAVKEKSKQARDEE
                     KRQAAAKGEVVEDSSDEERQRRQKRKAQQRKQEGRSGASTPAGPRKPRFRTAREMEVE
                     AEGLEVPSVLMSLVDATGKEQKVLTSTAGLMTPMEFVNQEEGEALKIARRARHDLEAF
                     VDEWKGLTERKKFIEFEETQVVHEIDTQQVKADQLTNLVSAISELQVSQDQDDITTLF
                     EGVTSKLELIEIEYRDLIDEYRLSDAAVAAIHPLFRKAVEEWEPLKDPTYLVAQLRRL
                     LPLLSRPRSENAEERQRQSTTSYETLIYSIWLPRVRSVLLNEWDVYEPSPATSLIVAW
                     KDVIPSFVYANVLDQVVVPKLSAAIKEWRPRASRHHKTSSQPGSRFPWWLFTWLQYLN
                     ERHTDPRHATGLLSDVKRKFRVVLDKWDLRNGLVGGVELWKEALGSEFDVTLQNHLLP
                     RLARHLRDDFEVNPQDQDLAAFEDVLKWKDYYKPKVFGLLLVAEFFPKWHNILYVWLT
                     NEPNFEEVGEWFTWWRSQVPSDLNEIVAVDDEWTKALKMMDLAAQLGDRAATELPQPE
                     ITPSAAPAASTNLRPDKVVVPPAAAAAKAKPQPAEVAFKDIVEDWCAEQGLIILPLRE
                     AHPQNGQPLFRITASASGKGGAVVFLQGDVVWAQNRKARDTWEPMGLEDRLVDRAEGK
                     "
     gene            <1175066..>1176032
                     /locus_tag="TRUGW13939_02861"
                     /db_xref="GeneID:55990368"
     mRNA            join(<1175066..1175201,1175334..1175740,1175811..1175878,
                     1175942..>1176032)
                     /locus_tag="TRUGW13939_02861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486048.1"
                     /db_xref="GeneID:55990368"
     CDS             join(1175066..1175201,1175334..1175740,1175811..1175878,
                     1175942..1176032)
                     /locus_tag="TRUGW13939_02861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341941.1"
                     /db_xref="GeneID:55990368"
                     /translation="MSASLLRSSAARTALRTGATAPRSSMAGLAGTSFVRTKVTLPDL
                     AYDYGALEPSISGKIMEIHHKGHHNVYVTGYNTNIEKLQEAQAKNDIAAQIALKPLIN
                     FHGGGHLNHSLFWENLAPKSAGGGEPPSGTLAKAIDETYGSFGEFQSKFNTALAGIQG
                     SGWAWLVKDKDTGDISVKAYANQDPVVGQYTPILGVDAWEHAYYLQYQNRKAEYFKAI
                     WEVLNWKAAEKRFGA"
     gene            complement(<1176545..>1179474)
                     /locus_tag="TRUGW13939_02862"
                     /db_xref="GeneID:55990369"
     mRNA            complement(join(<1176545..1178731,1178780..1179027,
                     1179081..1179146,1179204..1179284,1179345..>1179474))
                     /locus_tag="TRUGW13939_02862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486049.1"
                     /db_xref="GeneID:55990369"
     CDS             complement(join(1176545..1178731,1178780..1179027,
                     1179081..1179146,1179204..1179284,1179345..1179474))
                     /locus_tag="TRUGW13939_02862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341942.1"
                     /db_xref="GeneID:55990369"
                     /translation="MSFLDPRQPVTPGPSSSPLQSPFLQRTRGVSPTRRTSSRRLSSR
                     TSDRVPTLPRSSSRKISRSNPPHVNNDIAKSQISNMNSRPQTPTRRDSGSTDTGITLV
                     NPTSAILQGLIKEQRASRGSRKVASDMTDSVVHTTPPSQSHEDSPSEKQRRLGNALSA
                     GIRQPRDMGIREMDQYVSRINKLNFDLKLDIFHRTQQMGVLEKKLQRMQSMEQELERM
                     HDIEDELDELREVEQTNDRLREANEQLQSELDKRDQAISEAVDMICQLESKVDELQAG
                     RSLPPSLTATPQLRNGLGLSTPELTEASTPKAELLVDIPDRTSSRRGTRRRARKMPSF
                     LHDANKSNAALRSLYLTDENKSTRSVSASTMTTTADSTAEPPSPRLSILSECSYFNPQ
                     DLQPNNSERISSEQLNPLGVAAEDNSSMLLDISHSNDQRASDVADWVQPQAASSGSLR
                     RSRTRALSDVSRSTQVPHATLGDPFQPGHLSKSFHAESPIHLFGGRLPPTPDTMSTFR
                     FGGGSGSNASFSMEKPGTNHAMPGTPSSIHLRLGRPRSAGEMATRPGTGVSGVSDGID
                     TTMSVDTQQELAGGSHHNASGLFHSFNHYGRGSYKATRLLGPGSPSNPRLSCYGGDLL
                     FNGEGVEDIVSVAHEDHFPAELAASPPLSPQEWLEAAKTEDPLEKAAPERESNATKHI
                     AESYELDQTDLADANDANTEDPPLPRNTPLRLRAWADDAQTVAEAQPRRRLSLRPKFL
                     SRNRQAEPRSDPVALNPESSPVPPKTTLLTIPKHRRAGSGPVSVPEDLSRLGTPEVSR
                     TNPRPLPKSLAELRPSTASRPATSDSSEQRRKGSSFLGWMKGSSNKESELPAGNMLLP
                     RSATERPKSTVSADSRALDVCMAYGDASNKVDDEPGWRARRRSRRLA"
     gene            complement(<1180901..>1181775)
                     /locus_tag="TRUGW13939_02863"
                     /db_xref="GeneID:55990370"
     mRNA            complement(join(<1180901..1180971,1181024..1181132,
                     1181209..1181398,1181488..1181546,1181609..1181677,
                     1181734..>1181775))
                     /locus_tag="TRUGW13939_02863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486050.1"
                     /db_xref="GeneID:55990370"
     CDS             complement(join(1180901..1180971,1181024..1181132,
                     1181209..1181398,1181488..1181546,1181609..1181677,
                     1181734..1181775))
                     /locus_tag="TRUGW13939_02863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341943.1"
                     /db_xref="GeneID:55990370"
                     /translation="MSYYDIDAILTDAQKLPCTFELEVPGLGFVEGNPGENVKAGTQV
                     DLPLWLGEMLSIGARLGTSRLVTLDLPSALSERVLNALRADPRTVDLRNLAPHFYSLG
                     VRILELFEEEEMGDVLSDTFTKRASEVANHAHNLRGALGDGVEFLRGLDETERQLFRI
                     AHDSAKEIRIWAGEAKKPK"
     gene            <1182841..>1185723
                     /locus_tag="TRUGW13939_02864"
                     /db_xref="GeneID:55990371"
     mRNA            <1182841..>1185723
                     /locus_tag="TRUGW13939_02864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486051.1"
                     /db_xref="GeneID:55990371"
     CDS             1182841..1185723
                     /locus_tag="TRUGW13939_02864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341944.1"
                     /db_xref="GeneID:55990371"
                     /translation="MAYNAVAQLDDLNDAASQSSDSDASHAPGSPVALEPPIESKSAP
                     GEPVVAVAPLASLINRTVSRDYEMVEDDDYEEYAAVDPSLISPATITAPSQSLATVTP
                     NDAPATGAPIVDAVSHPDTTATTTENGLPPSASPGPLARTPSVSSVDLRHPTPDLQSL
                     QGAYVGNIERLEKSAERLSMTSSDLGVELRKLDMEQKRRESTSSSVQQGPESPSRQFS
                     STSVSNSIIGLNSTARSGGYSPAAFLTSPRGSILSGSRLRSTSLSSPLQDIQEPKPNE
                     DAVQTHEDQDKNVHLSYELPTPELLPEDGTERRELRLVEPTDEIPDRPLTARSTDTYQ
                     QATNLFLDFDGVHFVPHPRDPSLSHQPPVRKSKRASTAKHFDKPQAGQDMIYYPAPIP
                     KILNLPQKLSKRPQISEHEKRRTQLLNDALATDKNDGHTIDNPAGKRMSEIPAQLRAS
                     AFFDRPAVPLDVKIKNKSAVDTLESILDASARAPVTAFVDHPIVGSAGREVYSTVEKK
                     RSSRMLGEKKDRRSTLQPHDGLDSQSSLGPVHSDVEEHEGRALHGEHSDSGRSRSHSS
                     DVSTSDSSSDEGESADELDRKEEEEYDESKYTGRPTTLLAELQMRKHELKQRNRTAAT
                     SFPNGLHSTLLQLDAVAQAQSRQRRQKRVTLAWDTQATNEADEADDEDIPLAMLYASK
                     NPALEERPLGLMERRDMEENEPLSKRRARLRGEVPEAPPNKRSSTMLRVPAAESDSEN
                     EGETLAQRIRRLKAEKLDKSKSIISAEFESEIMTELGKLHEPVDPVVPAPKKTQTPSR
                     PREPAAEEEETLGQRRKRLQAEARIRKTQSTADMNARRSMADILQTYPSQHAYGASVD
                     HTQNAHASWNPRTAYQHNRVSTMYTLPPSMMYQAGFGQVPGHDLQAAHGNHAYNTSFM
                     PNAQMGMNVGFAPGLPPLGSAQMNPADVDPRQRDVIDRWRQSVTGL"
     gene            complement(<1186254..>1187466)
                     /locus_tag="TRUGW13939_02865"
                     /db_xref="GeneID:55990372"
     mRNA            complement(join(<1186254..1186851,1186906..1186975,
                     1187035..1187228,1187291..>1187466))
                     /locus_tag="TRUGW13939_02865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486052.1"
                     /db_xref="GeneID:55990372"
     CDS             complement(join(1186254..1186851,1186906..1186975,
                     1187035..1187228,1187291..1187466))
                     /locus_tag="TRUGW13939_02865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341945.1"
                     /db_xref="GeneID:55990372"
                     /translation="MSSNKLHQLGKNGPLVPSLGFGLMGMSTAHYGAIPGDEERFALL
                     DRAVEIGATFWDTADLYGDNEELLGKWFRRTGKRDQIFLATKFGYVSHSKTYGTDSSA
                     AYCKEACAKSLETLGVDQIDLYYLHSANPETPIEETMRALVELQKEGKIKHIGLSMIS
                     SSTLRRACKIGTVAAVQTEYSIFSREIEGSAGTDLLATCRELGIAVVVATPLGRGLIT
                     DAFRKGEAITPGVPDSRKAAFPRFSEENTPTNTATVDQFKSFANKKGCTVAQLALAWL
                     LKRGDDIFPIPGTKRIRYLEENWAAQRVLLSDADEAEIDAFLESAIIAGPSVPPQFAS
                     FIFKDTKEETA"
     gene            <1188486..>1191713
                     /locus_tag="TRUGW13939_02866"
                     /db_xref="GeneID:55990373"
     mRNA            <1188486..>1191713
                     /locus_tag="TRUGW13939_02866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486053.1"
                     /db_xref="GeneID:55990373"
     CDS             1188486..1191713
                     /locus_tag="TRUGW13939_02866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341946.1"
                     /db_xref="GeneID:55990373"
                     /translation="MPPSTVFSYWRRDHRRTSPAPGSESPLGLSPSAFADAPPQLPGL
                     PPSTTLGDTIVESTTSSTTTTGPPEPLPLVPSFFEKTGDISDEKSLAFGLTPQHSLSN
                     LRAPSPSLENLVRLHSCPEDVNFAQESPSQEHAVNLDQIQTNHPSKANGSWRLGFKQN
                     AATTNPQTDDSKTTSRSEATGKSLLINTNVNGTSGFVGGASLKDYKSTQSRQDSEQSA
                     EPTQQKLGRRTKLHRLNPISLLAHRRSSQIAHSRQEDSNFSGQNGVPAIPDDYDPRIR
                     GSIVHDFSAPRPRRNAPGATNVQDTIKEEDQSKDKSEQHKRHSEYSPVFKEHFSEDRK
                     VLQVENKGYLQSSLLTEAHLNERDSSDLPAFARKLPFSIPENNDQSIEPSAEVSEQVP
                     SKRASNSRKSAESSRQVPMRLKSDASRFSFDMGGVESSTQEKLLEEKHKEKEAARKES
                     GRQSRSSYSDFDEDDFDYDALEDDSFFEERIPGVNTDADYDDQFSGFAGVVKTPNPLF
                     VPVLPPIAASPISPMNPYKNTLNTTAGAVPEIVINPVDASASPHLESSRSLSDYGDEE
                     GETEKDATFEHVAPAEPEPRPRPVPQAETKEPQQYDEDEDDIYFNDGDIDIDDFPTVD
                     ANEGAFDESIFDDENGELYERKFYPGTVIPITAQNEPDAEPPRQSMDSTASKATHLRQ
                     VPSLASEFRPESWDIQNEAAATFPGGDGPKKPPGGVLSEHNLEAFHSALARVADEAAA
                     DHLLHRNISLSETSVGQESISQNADSHPGLISDDSRLSHTMGAEDAVDDFNYDDDDAF
                     DDDLIIAEANADALENDDEGFYGEEFGFYARDDENCDSQLTYGGYFGPGAGGINRSHS
                     GGANFHGPSLTPITERSEWSTRNSIVSLTTHGQPNPLPNPGLAQLVDFGNLDDDISFE
                     ALMRLRRGAFGGSNGSLRSSAGSLSPQGGPYGHSNRASFMSIPEDSPVDLNSGTEFPS
                     HLADYSAGAETDSFPSSEEHSSPGSPTMVSGLSADPEHDASGEDALGTTPKPSHSRAS
                     SSASISYKQETVEDGSPKWVLERRRTGDSGEMEVYQREVLEGSRI"
     gene            <1192782..>1196276
                     /locus_tag="TRUGW13939_02867"
                     /db_xref="GeneID:55990374"
     mRNA            join(<1192782..1193024,1193231..1195257,1195310..1195683,
                     1195738..>1196276)
                     /locus_tag="TRUGW13939_02867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486054.1"
                     /db_xref="GeneID:55990374"
     CDS             join(1192782..1193024,1193231..1195257,1195310..1195683,
                     1195738..1196276)
                     /locus_tag="TRUGW13939_02867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341947.1"
                     /db_xref="GeneID:55990374"
                     /translation="MLRATALKKATGSSLLRSSTACSACRRSYTLATTSSKRAVATAG
                     ARSNFQLTGRKPLAVIDRAAAGRREYAQSAEETSQGVDSNDSFLQGNTANYIDEMYLA
                     WRSDPSSVHISWQTYFKNMEDGNMPISQAFQPPPTIVPTPVGGVPQHMAVAGHDLTNH
                     LKVQLLVRAYQARGHHKAKIDPLGIRGDAEAFGYHRPKELELDHYGFTEKDLDQEFSL
                     GPGILPRFETETRKKMTLREIIAACEKIYSGSYGVEYIHIPDRKPCDWIRDRFEIPQP
                     YKYSVDEKRRILDRLIWSSSFESFSATKFPNDKRFGLEGCETLVPGMKALIDRSVDYG
                     VKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFSGTTEPSDEGSGDVKYHLGMNFERPT
                     PSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNKDEKDYDTAMGVLLHGDAAFAAQ
                     GIVYETMGFHALPAYSTGGTVHIVVNNQIGFTTDPRFARSTPYCSDIAKAIDAPVFHV
                     NADDVEAVNHVCQVAADWRAEFKRDVVVDIVCYRKQGHNETDQPSFTQPLMYKHIASQ
                     KSQLDTYVEKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPTGKEWLTSAWNGF
                     KSPKELATEVLPHLPTGVEAETLKSIGDKIGGAPEGFNVHRNLKRILGNRKKSVDEGQ
                     GIDWATAEALAFGSLVKEGHHVRVSGQDVERGTFSQRHAVLHDQESEATYTPLQHIDP
                     DQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQFIASGE
                     VKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLSNEEPRIFPSPDKLDRQHQDCNM
                     QIVCMTSPSNLFHILRRQINRQFRKPLIIFFSKSLLRHPLARSELEEFTGDSHFRWII
                     PDDAHGTAIDEPEKIERVVMCSGQVYGALTKYRDSQGIRNTAITRIEQLNPFPWAQLK
                     ENLDSYPNAKDIVWAQEEPLNAGAWSFVQPRIETLLNATEHHNRRHVLYAGRSPSASV
                     ATGLKGSHLKEEQDLLNDAFTVHQERLKGE"
     gene            <1196864..>1199070
                     /locus_tag="TRUGW13939_02868"
                     /db_xref="GeneID:55990375"
     mRNA            join(<1196864..1197283,1197441..1198129,1198192..1198958,
                     1199009..>1199070)
                     /locus_tag="TRUGW13939_02868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486055.1"
                     /db_xref="GeneID:55990375"
     CDS             join(1196864..1197283,1197441..1198129,1198192..1198958,
                     1199009..1199070)
                     /locus_tag="TRUGW13939_02868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341948.1"
                     /db_xref="GeneID:55990375"
                     /translation="MAANNAATAAGSALSQVSSSRNMARQTRTNPSRTSKTVARSFQF
                     YGQSSTADSPQVASSSAAVPHGLYPALTHFTDTITALPREFRRHNSLLKEVDAKAWAL
                     EENLHQLLLTASESRPVPYPPNPAPIVDGVVREYGVSQDDPQNTESQESRHRRLLFDR
                     IRRSLTDLMMTADEKNHVITNANDELDHQLFRLKTVFPYISGEVSEEARLGSLTHWAY
                     TNRTASKPVTTANERPRREAASSASHFVQALHESEGVTHRGDARREPSRKQRRNHADL
                     DSDDIRTVNHRKGGAAKARANAGDNADSGMPTSAPKRRKVVEKPTPVLAGGTAMERSV
                     SAVTNNGRAVSKDSLNTEVKKRVRAPNAVSTAGRKRNNTVTSTADSPLVSSPVVGTFN
                     PPRSAPSPGPTTNNRPQSSRAQQPAAQASSRQRPPSASSRSNNNGKPVDAKANFPRES
                     SIKEATPPVPSGAAIRQLEVERENPDTKLNTATDKGERVETKLLDGSNGSEQMSPVIP
                     AAAQTKGRSSKTSTPIVSTFPESQTRGRSSRNNAESAPKRGHKKSVSVSTTYKPRPTA
                     TRDEESSHEGDDEEDESEPRYCYCNQVSFGEMVACDNDSCPTEWFHLSCVGLTKPPGR
                     NVKWYCTDCKENAKRGRSTAK"
     gene            <1200933..>1202944
                     /locus_tag="TRUGW13939_02869"
                     /db_xref="GeneID:55990376"
     mRNA            join(<1200933..1201443,1201530..>1202944)
                     /locus_tag="TRUGW13939_02869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486056.1"
                     /db_xref="GeneID:55990376"
     CDS             join(1200933..1201443,1201530..1202944)
                     /locus_tag="TRUGW13939_02869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341949.1"
                     /db_xref="GeneID:55990376"
                     /translation="MGGPTTSVAPENQSPRIPVRTIREDLSRDSSESPSRSHSRSDSV
                     RRGSFGSVKEDVDGIAQTFVVSHPPTTLQQQQQPGSKHTTGMTAAVEHMPDFCCPCGG
                     FLGWKQIRLRGRKLSRSYSDLRRLGAVSSSSEWVWDTSDGRPALGEPLPEQKAKKPRL
                     SIEELPVEVLIQIISYLEVELPPNGYTPRNIDLISCLLTSRTLHSATLSVLYRNITVP
                     HSVIFSKLLKHVVNYPALGTIVRRLDFSHFTSIGLGRTRQMNAEIQNLTAKTLLQCLD
                     LFPDLMEVLLQEHVETDINSAVVSKIFGGLPNLRAVDLCGCSSQAFSTGFLEAFKIST
                     DIPAYFPRLKRLSLHECSGLSPAVFQTLLPRLVNLTHLDLGHTQITETALFSLSDTAQ
                     LTHLNLSKCTRLSGPQVIKFLTTHPAVTESLVYLNLMTDPSRYRLLEEEDVTALLPNL
                     PSSLKSLNLNGARVTSEHAPLLLPLTKHLEELGLSGADLSINDLNSFFVPPVQQSEAG
                     ADVDGNVDQTWQPPALHYLDLSRVPQITLPTLFNSNKCVLVSPRSMPLAVIELSEKLI
                     TPLRDRTKSTRSNGWVIREIGRRGWYVREPVKTDVVVADDGSRWWKMGARWWGMRKIP
                     VTVGEVGGIYGHYMFKK"
     gene            <1203599..>1205585
                     /locus_tag="TRUGW13939_02870"
                     /db_xref="GeneID:55990377"
     mRNA            join(<1203599..1203743,1203817..>1205585)
                     /locus_tag="TRUGW13939_02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486057.1"
                     /db_xref="GeneID:55990377"
     CDS             join(1203599..1203743,1203817..1205585)
                     /locus_tag="TRUGW13939_02870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341950.1"
                     /db_xref="GeneID:55990377"
                     /translation="MAAAPSSSASYKKKDGTLTVAKDHKSISWIPAAGGAGGAVTVAV
                     KNMTNLQQTPANNPKVMLKIFAQQNDTQENYVFTFTSGANARTEADAIKEALSAAITA
                     AKAASAPAAVPEVSTNDGVSAAMAMANAISSAGTGQAAWDDDNKLKTDAELQQSLLKC
                     DPNLQRMFMESLRTKPESLSGGNFVSQFWSTRVHLLRAHAIERAQLRGSYNVLSSLRP
                     RTDNNVTKLNISKEQIQLIFNQHPLVKKVYDENVPKLSEQQFWSRFFQSRLFKKLRGE
                     RLSESDATDNVLDKYLTVDEHADRVTDTHVPHFLDLAGNEVNHSQRQGNRPDFDMRPA
                     SIEKVPIIRTLNALSEKIMANVAPADGDPSAPVGMDEETYNNLVLQDLKGDEEQNRIM
                     LNIRDQSRFFAQGKEREGKEGDLLAKQNPEQIITSMRGDVAKTFAAGGLFHLGKIIEP
                     DEDDSDEENAAAPKKAVGSRASLRQASTQIFDAIRERRAQTEVSPNAGTWGLSTTLFD
                     RLTLTHATTTEFLHQFWHAFLSGNPERAGELASLVESLSRAMDRIKAVAADAETEKQA
                     EVNRLKQNARDVFAATGKKIRVNLAGVGGGEKVVNQLLGPTISALSLASNKYKDALAE
                     ATAAASREDSLAP"
     gene            <1206523..>1207595
                     /locus_tag="TRUGW13939_02871"
                     /db_xref="GeneID:55990378"
     mRNA            join(<1206523..1206789,1206864..>1207595)
                     /locus_tag="TRUGW13939_02871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486058.1"
                     /db_xref="GeneID:55990378"
     CDS             join(1206523..1206789,1206864..1207595)
                     /locus_tag="TRUGW13939_02871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341951.1"
                     /db_xref="GeneID:55990378"
                     /translation="MLSSGFTNAPVTKFLVIYIVASSIALSIFDAKHLAHILVVPHLW
                     QYGQFSRILLWQVAGYANSTEVLFAAMLAYHLRVVERMWGSRKLATFLLSVLPYTTII
                     APLVLSLVLRPLSFNNLNYLPSGPTAIIFSVLAQYHATIPHTFKYRISTSGGSTGRRN
                     PNAANSSDNNNNNNNNNNNNNNNNQVQNSKPSLTILLSDKSTTYLVAAQLALSQFPAS
                     LLPAITGWAVGVAWRADLLPVSRGIARGWRVPAWIVGEKEPARRSSPASASATAAATG
                     GAGGSGEDSEQYENLRRRLDAASAAAAAQQAAGSSVAGESEQRQRRPLLERFTNAF"
     gene            <1208047..>1208857
                     /locus_tag="TRUGW13939_02872"
                     /db_xref="GeneID:55990379"
     mRNA            join(<1208047..1208615,1208674..>1208857)
                     /locus_tag="TRUGW13939_02872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486059.1"
                     /db_xref="GeneID:55990379"
     CDS             join(1208047..1208615,1208674..1208857)
                     /locus_tag="TRUGW13939_02872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341952.1"
                     /db_xref="GeneID:55990379"
                     /translation="MPGRLEGKIAIVTGGGSGFGAGIAQKFVSEGARVLIADLSEENG
                     SKIAQSLNCSFARADVTKRADWEALLQTALDTFGALDIVVNNAGSTYHNKPTETVTDD
                     EFDMVMNVNVKSIYLSSSVLVPYFLKNQRKGSFIQISSTAALRPRPGLTWYNASKGAV
                     STATKTMAVEYGPKGIRFNAICPVVGSTALTHLFIGKPDTEENRAGFVSTIPLGRPST
                     PADIANATCYLASDEAEFITGVDLEVDGGRCV"
     gene            complement(<1208960..>1210867)
                     /locus_tag="TRUGW13939_02873"
                     /db_xref="GeneID:55990380"
     mRNA            complement(<1208960..>1210867)
                     /locus_tag="TRUGW13939_02873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486060.1"
                     /db_xref="GeneID:55990380"
     CDS             complement(1208960..1210867)
                     /locus_tag="TRUGW13939_02873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341953.1"
                     /db_xref="GeneID:55990380"
                     /translation="MAFSPGSVRHVNITSPFWSSMLSRSRLITIPAIIKTQKSLGHWY
                     CLTWKEGHEIKPHAFWDSDIYKVTEAACYFLMKHDDADLYDEVEKVVDMVRAAQHEDG
                     YLNSYYTVRGIQNRWTNVRDMHELYCLGHLVEACVAYETLTGSGRLLEPVMKALRHVD
                     SVFGPEEGKLHGYPGHQEIELGLLRLYDMTSDPLALKLAKYFILERGKKDANGEVFYD
                     HEAKARGGDPYDHMGSEMLAHYTKPRDYEYHQAHAPLAEQDEIHGHSVRAMYFVTAGT
                     EYVRLTGDTEVKDALQRLWRNTIHKKMYITGGLGAMRQWEGFGAEYFLSDTEESHGCY
                     AETCATFALIIWCSKLLRQELRSEYADVMELALYNGFLGAIGMDGKSFYYQNPLATCT
                     GRPKERSTWFEVACCPPNVAKLLGSLGSFIYSHHENLVAVHLFIDSDFTVPESNGTTI
                     QQKSSQPWEGSVELNVQGPQAIRLAVRIPNWVGTEYTCSVPDGEVKDGYLYLPSVTNT
                     KVTLTFSVKPRKVYAHPKTGKDEVCIMLGPLVYCAEDVDNPGVDIHDLALVDDPVVAD
                     VPKTIASVEDIVTVETQGKYLVNQNWNSLYGSEPWKYSETTRKVVFVPFFLRMNRGGN
                     GGMRVWMKRIT"
     gene            <1212445..>1212840
                     /locus_tag="TRUGW13939_02874"
                     /db_xref="GeneID:55990381"
     mRNA            join(<1212445..1212547,1212605..>1212840)
                     /locus_tag="TRUGW13939_02874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486061.1"
                     /db_xref="GeneID:55990381"
     CDS             join(1212445..1212547,1212605..1212840)
                     /locus_tag="TRUGW13939_02874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341954.1"
                     /db_xref="GeneID:55990381"
                     /translation="MSFNNNNDNFGGNQGNQGNSDESGGFGSLLNKAEGLINQGGSNN
                     NSNNNNNNNNNQQSGSGNGLDQNIDNTVDNVVDKLADQYIPQGTDGIANKEINNAING
                     AINDQANKFF"
     gene            <1213561..>1216022
                     /locus_tag="TRUGW13939_02875"
                     /db_xref="GeneID:55990382"
     mRNA            join(<1213561..1213611,1213667..1213690,1213742..1213863,
                     1213919..1214382,1214438..1214730,1214782..1215482,
                     1215539..>1216022)
                     /locus_tag="TRUGW13939_02875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486062.1"
                     /db_xref="GeneID:55990382"
     CDS             join(1213561..1213611,1213667..1213690,1213742..1213863,
                     1213919..1214382,1214438..1214730,1214782..1215482,
                     1215539..1216022)
                     /locus_tag="TRUGW13939_02875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341955.1"
                     /db_xref="GeneID:55990382"
                     /translation="MAEASEAPGGTGVYRRACDQCRVRKIRCDKEIPCSNCVSAQRKC
                     NSNSLLQKPRETRHRVLISHQYERKIDSFEARFNGIEELLRNLTTSINSNNGSKPNTA
                     STTAEPRPVYNEPRPPSSEGDKQPQQEPFEGNSSMTAHTVFASNFLKQAVTSTPLGRQ
                     LSPDFQNALGSLQRIVHSQNKKSIPYDSKFAHRKPLPKGGFSQLPLPPTEVVLKLLRE
                     IKTAPPMTFMMSCAFISVDDFVESCRKVFFATEDYSLETFIIVNAGLHHLFEEKSVTG
                     ESMSEEFVKYHYLCRDNLETALANLPFFFHPKKEMIEALLLGVTYSIGISKFTLAWEL
                     NSAAAGMCRTLGWHRLSDTGDEINQKNASTFWFCYTLDKSLSLRFGRSSIFQDWDIST
                     PRRFGNGKPDPLQGSLETWMESSRIQGDMYEHLYSPAALSRPAEQRVEIAQLLVVRLK
                     QLWQQMEGFSAALKREKRAMVEARVQDVRDQEWRMTNLDMMLKAGEVSHWTALTLVYR
                     AIPSVHSSYNAECIEAARTAFRCHEECMNLTSSSLFAKIGYLHWTILFTPFTPFIVLF
                     CHVIETSNMDDLKRLAQFVTSLLPALSMSQPVERLHRLCQVLHQVAGLYVEARAKAKQ
                     QDKEEMGMLGNNINDFDMYLSQLGLVPRQTTTTTTTTSSSSSSGSTDFGMLVDDDESA
                     QQLAGWFSGNSHVMGLMEEEDLSEFLLDVQ"
     gene            complement(<1217369..>1218844)
                     /locus_tag="TRUGW13939_02876"
                     /db_xref="GeneID:55990383"
     mRNA            complement(<1217369..>1218844)
                     /locus_tag="TRUGW13939_02876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486063.1"
                     /db_xref="GeneID:55990383"
     CDS             complement(1217369..1218844)
                     /locus_tag="TRUGW13939_02876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341956.1"
                     /db_xref="GeneID:55990383"
                     /translation="MPRFEDSDLGADLPESLSPRDSRPSVTIDAGLPLPIPADPVRRN
                     RRESEVVEVPASRSSISDAAQFMHNLSLQPSMLDRRASRNSFGTSLPIPRSSRPSRLS
                     SVVNADGSGAVSRDILASQVQDMAQEKVLAAKNMAFAFDIDGVLAHGNKAIPQAKEAL
                     KMLNGDNELGIKIPYILLTNGSGKTEEERCQQLTDVLDSPISVDQFIQSHTPMRALSE
                     YYETVLLVGGEGFKCRDVAVEYGFKNVYTYHDILAWNEEISPWRAHRSEKEIAQASPI
                     DFSKVKFDAILVFSDSRDYSTDFQLIIDLLMSEDGYFGTKSKNPGAGSIPIYFSQGDM
                     LMPTAYKGPPRMTQGAFRISIETMYKALTGTDLERVVYGKPELATYKYADEVLKSWME
                     EIHNENKIPANVYMVGDNPASDIIGGNMYGWNTCLVRTGIFQGGPGENDPKSPANFGV
                     FDHVLDAVKAVVRKELGKEFKFKWNEKLNPVLHGDGISAIE"
     gene            <1220631..>1221646
                     /locus_tag="TRUGW13939_02877"
                     /db_xref="GeneID:55990384"
     mRNA            join(<1220631..1221038,1221095..>1221646)
                     /locus_tag="TRUGW13939_02877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486064.1"
                     /db_xref="GeneID:55990384"
     CDS             join(1220631..1221038,1221095..1221646)
                     /locus_tag="TRUGW13939_02877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341957.1"
                     /db_xref="GeneID:55990384"
                     /translation="MSDGKTFTLSNGVTIPAVGFGTFANEGAKGETYKAVTHALRTGY
                     RHLDCAWYYLNENEVGDAVHDFLKETPSVKREDLFITTKVWNHLHRYDDVLWSINNSL
                     EKLRTSYIDLFLIHWPIASEKDGQEKPKIGPDGKYVILKDLTENPQETWQALEQAYNE
                     KKTRAIGVSNWTIKGLEQLLSFAKVKPQVNQIEVHPFLPNNELIQYLFKHDILPQAYS
                     PLGSQNQVPTTGERVSENKTLNEIANARGSTLAQVLIAWGIRRGYVVLPKSSNPARIE
                     SNFQSIQLSDEEFAAVNAVADDRHCRFVNMKDTFGYDVWPEEA"
     gene            complement(<1222643..>1223323)
                     /locus_tag="TRUGW13939_02878"
                     /db_xref="GeneID:55990385"
     mRNA            complement(<1222643..>1223323)
                     /locus_tag="TRUGW13939_02878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486065.1"
                     /db_xref="GeneID:55990385"
     CDS             complement(1222643..1223323)
                     /locus_tag="TRUGW13939_02878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341958.1"
                     /db_xref="GeneID:55990385"
                     /translation="MTISVAILVYPDSDILDIAGPLGILSTSTLHDNAFSFTILAQHE
                     LTKTCSHMRIPRDMSLDHARQDNILSSFDVLLVPGGSLEGLTGIAQDAESAEVQFVKA
                     FASIQLHHKKRRPRTVFSVCSGALMLATAGVLVGKTVTTHHLALDALRKQCAKHAGPE
                     TTVVEECRYQDGGLTENGVRVLTAAGVSAGMDAACYFIAREFGVEQADCAARMNEYEW
                     EDVYSLRG"
     gene            <1225614..>1226727
                     /locus_tag="TRUGW13939_02879"
                     /db_xref="GeneID:55990386"
     mRNA            join(<1225614..1225628,1225687..1225790,1225875..1226407,
                     1226462..>1226727)
                     /locus_tag="TRUGW13939_02879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486066.1"
                     /db_xref="GeneID:55990386"
     CDS             join(1225614..1225628,1225687..1225790,1225875..1226407,
                     1226462..1226727)
                     /locus_tag="TRUGW13939_02879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341959.1"
                     /db_xref="GeneID:55990386"
                     /translation="MIPDQVLPFVCLPHFQRFESCLSSSSLFSVDDQIRQIFPLPSNK
                     MPSGVAQRPLAVAQAPLPDVLVGNHHTKSSALHNIHFVGTISPWTNFENDVHSFCAGI
                     NWAQYTHVLTYKGKTSKPWNLDQDQTDTGDEAALQGKFRAHLGEPVTAICTVTGRHAQ
                     VTDFRATDVVPIDRSTPDLAIKVGDTLAGVGKAKVFWVRDHHLGHASGKILHLRHVLG
                     QIALYMKIYKVKCGFHTTYKETIFLKQERTSSGWVLYYSDPIQHDAIGDRSNGTVSLR
                     ECFLYLVDEAIKSPVADNNELQWVSPDRH"
     gene            <1227624..>1229974
                     /locus_tag="TRUGW13939_02880"
                     /db_xref="GeneID:55990387"
     mRNA            join(<1227624..1227767,1227819..1228318,1228368..1228941,
                     1229006..1229353,1229409..1229492,1229553..1229898,
                     1229946..>1229974)
                     /locus_tag="TRUGW13939_02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486067.1"
                     /db_xref="GeneID:55990387"
     CDS             join(1227624..1227767,1227819..1228318,1228368..1228941,
                     1229006..1229353,1229409..1229492,1229553..1229898,
                     1229946..1229974)
                     /locus_tag="TRUGW13939_02880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341960.1"
                     /db_xref="GeneID:55990387"
                     /translation="MDSSGLQDLPGSLSLGSTLPSGFDHNDPQPFQGFSRSIEHGMPA
                     TTTFPLTQQSVVQPPRPGNFDPRDNNANNPRYQAPPPPRSAQGVNTTTSTSNTTHMGP
                     NQPVQRSIALASSRVTADDVGELSWIPPLIPSMGEAIANHASTVQSQEAVSFLSGSPG
                     AVMESKDSHFGSMKIVPNPPDLDAWRERLFNVDEPITLTEEQYILPIPPAGSFAVFKT
                     YFPHVDNVYSHRSTQKYKRKPFVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARERDL
                     CDVKIKITEHYPGTTPTADSELGESIDMLSTVSHSTAAAAFFVNGAHSRGEGQQQQPF
                     GILAPNPTLPTAHPGSRGQKYYTIQRVNGNGGNGKTDGIGGGHRHTLDESDRVKKNSV
                     HRHLVKVSKEKKDEQTQPTIYHNMATGQAQLTVKKRSKECDLKLYGNCSWQVDIISIP
                     TLMHQIITVNSSPFVQKVWIALEMKGIPYQYIEVDPQIKKPDLLLAVDPRGPVPSLRD
                     GSWGCYESNVLLEYLEDVDVGIPLLPPGDAKLRAHCRLWADHIGRSIIPSFYKLLLEK
                     DPLKQRATAEEFKVHIAKLVNASHAQGPFFLGPAMSYVDIQIAPWILRLSRVLKPFRG
                     WSESEMGARWANWVQAVEENEHVKATTSSDEVYLDNYVRYFECAQTNNDS"
     gene            complement(<1230048..>1231036)
                     /locus_tag="TRUGW13939_02881"
                     /db_xref="GeneID:55990388"
     mRNA            complement(join(<1230048..1230738,1230808..1230917,
                     1230974..>1231036))
                     /locus_tag="TRUGW13939_02881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486068.1"
                     /db_xref="GeneID:55990388"
     CDS             complement(join(1230048..1230738,1230808..1230917,
                     1230974..1231036))
                     /locus_tag="TRUGW13939_02881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341961.1"
                     /db_xref="GeneID:55990388"
                     /translation="MSAEQNNVPDAWETDWEMLADKQDQTPESADKKVSSKVTKAQRR
                     AAQAEFNRQLWAEADAPQTFHYLESKADVVPLKQEFKPAVTVLSRRPQMASRNGDAAT
                     AGLSALNLGPDGKELYDSDEEANKAPEMTPEERHAKALKDREEKQRKYEEVRERLFGN
                     SSTPGSGASSPGGTPPPSRHQSSGGEGNRGRGRNRGGGRDRDNSNREKRDSPGASNNN
                     MGKQRQLYDPNYAAKSNSTYLQRRDRPQQSSTERSDTEQQVPKQPIRNPRGPDSNGRG
                     GFGFGPRGRGA"
     gene            <1231465..>1232494
                     /locus_tag="TRUGW13939_02882"
                     /db_xref="GeneID:55990389"
     mRNA            join(<1231465..1231727,1231781..1232092,1232174..1232251,
                     1232329..>1232494)
                     /locus_tag="TRUGW13939_02882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486069.1"
                     /db_xref="GeneID:55990389"
     CDS             join(1231465..1231727,1231781..1232092,1232174..1232251,
                     1232329..1232494)
                     /locus_tag="TRUGW13939_02882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341962.1"
                     /db_xref="GeneID:55990389"
                     /translation="MADDGSGYDDPVCFSSAWEGKAIDFKYKDPESKFIAGTWKLGKK
                     QYERPRLATNWEFSMGLVSESEAMFECNNTDNPDETALMIIYMQVPRRSTEFLPPSER
                     KAQATDKLPHAPANQLWALTTLHKHNSHSSLKLYGYKKSKQNDSGLVPGGYILYLLVQ
                     KYPGVSLTEDSFWQLSLPERDEIRQALKATLLDCLDKGINNYEDDISKIRWMREKKKV
                     FHACSPKQDGEDENGEDEWRDNIWYYWGLVAKKPDWRYDKNDNGKKLDPSRWVL"
     gene            complement(<1232748..>1236137)
                     /locus_tag="TRUGW13939_02883"
                     /db_xref="GeneID:55990390"
     mRNA            complement(join(<1232748..1234129,1234201..1234540,
                     1234690..1234768,1235569..1235623,1235688..1236014,
                     1236128..>1236137))
                     /locus_tag="TRUGW13939_02883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486070.1"
                     /db_xref="GeneID:55990390"
     CDS             complement(join(1232748..1234129,1234201..1234540,
                     1234690..1234768,1235569..1235623,1235688..1236014,
                     1236128..1236137))
                     /locus_tag="TRUGW13939_02883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341963.1"
                     /db_xref="GeneID:55990390"
                     /translation="MSADPDGDSEMLSSSGSASPTGARTPTFNPISELSPPGSQTASH
                     HGGLGEPSTIGSPTASFDQHGRANTSNPQQQQQQQQPKEPFGASWNNQRAQEEYTRAL
                     ESVVDRDFSLQEFGDPFDESDLLEESVGKHGGCVDDDGRFPGHLAPTNTHIPVNTVTD
                     QISFTPTAAAKRTVPRAWERVPSTAFLSRHKSRKIWKRFRKSMESLRGRTAVSKIEEK
                     EFKSEINASANADYRRVVKRQRVDADHEQDAQTERGRSFLETKWEFEIGKRRRKLVVL
                     TQQQQDGEQSFDSEETPRQVDELLEESTRLTSPETEPYAAAGVLSQDSKAIRDLDTSR
                     AFGNAVNPTIEIANSEAAAEIAEIVARQEPKLVRSALRMNSLDGEDVALLSEFLSRAQ
                     AKRAANAAMIPTKKAEETTSLNSPIVRSRRALEELDKNSPSPQKSQQVSTPTKGIDKA
                     VESPTPKALSSHEANEDSAREESSPTTRRRSTRTKLPKAPPQAHSQRPAVPNQIPVRR
                     ANGTEFVFLQRTEAQELALVTRKNTRRNKGNAVLPKQFLHNCKKGRSEDEASPQQSQE
                     DGESKGRAPRSPSRSKQVCWRDEELVEYAPERQFEALELQSPERKTGKSRTHALPATP
                     SKKVRRVNMAPAPAISNNPIIKPLSVGTPIPKRKKLTPKAPSTDSVSIKPAEPAVIKS
                     SSVPKLAVQKASAIPKSRSLLKAPTSITSSSAGATPVAKRLRAKKIHA"
     gene            <1236461..>1239110
                     /locus_tag="TRUGW13939_02884"
                     /db_xref="GeneID:55990391"
     mRNA            join(<1236461..1236539,1236603..1238567,1238638..>1239110)
                     /locus_tag="TRUGW13939_02884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486071.1"
                     /db_xref="GeneID:55990391"
     CDS             join(1236461..1236539,1236603..1238567,1238638..1239110)
                     /locus_tag="TRUGW13939_02884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341964.1"
                     /db_xref="GeneID:55990391"
                     /translation="MVQLGSKDSSLFRQVVRHYENKQYKKGIKTADQVLRKNPNHGDT
                     QAMKALIMSCLGQLEEAFVLARTALKNDMKSHVCWHVFGLLYRAEKNYEEAIKAYKFA
                     LRLEPDSQPIQRDLALLQMQMRDYQGYIQSRSSMLQSRPSLRQNWTALAIAHHLAGNL
                     TEAENVLNTFEETLKTPPPRADMEHSEAVLYKNSIIAESGDLERALEHLETAGKRSSD
                     TLAVLEMRADYLFRLGRKADAEAAYTALLERNSENSNYYDSLIKAKEIAPTDHKSLKA
                     VYDEWAEKNPRGDAPRRIPLDFLEGDEFKDAADIYLQRMLRKGVPSLFANIKVLYDSP
                     AKRDTVQELVEGYASGKAQPNGSSDNKTNGDSTDFEASTFYFLAQHYNYHLSRDLQKA
                     LAYVEKAINLVPKSVDYYMTKARIYKHYGNISKAAEIMEDARKLDEKDRHINTKAAKY
                     RLRNNQNELALDDMSKFTRNETVGGALGDLHEMQCVWYLTEDGEAYLRQKRLGLALKR
                     FHAVQNIFDVWQEDQFDFHSFSLRKGMIRAYVSMVRWEDHLRDHPFYTRVALSTIKAY
                     VLLHDQPDLAHGHMFASLNGAEGEDRKKALKKAKKEQQKLEKAEAERQDLKKASAATA
                     KGSDGETKKEDTDPTGTKLVQTTDPLKDSLKFLAPLLEYSPEDIRVQAAGFEVYIRRQ
                     KYALALKCLLAAHAIDSSDPTLHVQLLRFRLALNNVSEPLPEKISDVVLNEFEAILPK
                     SADLQKWNDSYLASHKTSANHIRAVLSARLLLTPEAKAESEKEFISTLDLDSTTMETA
                     ISGLDTLDEWKSSAATKQAYIETAQKRWTEVSAFNTTASS"
     gene            complement(<1239778..>1241424)
                     /locus_tag="TRUGW13939_02885"
                     /db_xref="GeneID:55990392"
     mRNA            complement(join(<1239778..1241255,1241313..>1241424))
                     /locus_tag="TRUGW13939_02885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486072.1"
                     /db_xref="GeneID:55990392"
     CDS             complement(join(1239778..1241255,1241313..1241424))
                     /locus_tag="TRUGW13939_02885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341965.1"
                     /db_xref="GeneID:55990392"
                     /translation="MAEPSPSANTAASSQNAPPKAPPKAPPKPQNPVFKMMGLPRFRL
                     RLPSRNWMIFLTITGSFTAAITYDRRQKKHIQQKWSDLVAHIAKEPLPLEQSRKRLTI
                     FLSAPPGDGLRPARDYFKEYIKPILVSAALDYEVIEGRKEGEVRAGLADKIRKYRRQA
                     GEQGHSAEEPSKESAIAEARERMGVTEEPGPRGDIVIGRHTWKEYVRGLHEGWLGPLE
                     TSPPPPPQPAATEPVPKAAETTADATRPTVETVDAVVDMLPDTPVITTEDGSPSETPD
                     SNKAQDENTETEESKKPKGPTPAYISPTQYSAQRLPPTIPAAFEASSPIQFPHLLGFL
                     NTPIRLYRYLTKRHLADAVGQEVAAAVLASASRPYNEGSRPFDGMAFDASSTDSSDSL
                     SQTTYEQQTLLEHEEQEWHKSVRKEAEDRKYQLENANPSSTNDPHITKLLNEEREWAD
                     EVVIDPRIASRMHRYILSSEEEARANRIASGQEWILGEGEKPKKLSFLQRAWINYGYG
                     EDPELAKKKPIIGNLDNENGE"
     gene            <1242466..>1244566
                     /locus_tag="TRUGW13939_02886"
                     /db_xref="GeneID:55990393"
     mRNA            join(<1242466..1243097,1243161..1243664,1243721..1244197,
                     1244254..>1244566)
                     /locus_tag="TRUGW13939_02886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486073.1"
                     /db_xref="GeneID:55990393"
     CDS             join(1242466..1243097,1243161..1243664,1243721..1244197,
                     1244254..1244566)
                     /locus_tag="TRUGW13939_02886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341966.1"
                     /db_xref="GeneID:55990393"
                     /translation="MDPNNNRLHLNFGFNDRNYNAANNRVYPTTPSTFPQPIYQGQDY
                     MDPHGAQGNPYPQQQQQQQGYFVGNAYPQQAHYPVQQQPYPPQNLQSSQPAYGARPPY
                     GANDGTNGLIQQFSNQDLSASPRAGLAPRSGSPAQRPRTAGSTGPQQQAQQGGHLAPN
                     RTSKPPGEEEELQRYPERYSENVHKRGKAAKELINVFFQENIERARERNMRSANLDKL
                     MHSNSMPELKKRSEVDALAKKEADFLRFLRTKETPSNFQTIKIIGKGAFGEVKLVQRK
                     SDGKIYALKSLIKTEMFKKDQLAHVRAERDILADSKDNPWLVKLHASFQDNAYLYLLM
                     EFLPGGDLMTMLIKYEIFSEDITRFYMAELVMAIEAVHKLGFLHRDIKPDNILLDRGG
                     HIKLTDFGLSTGGKKQHDNAYYQNLLKNSTSKDKNRNSGFFSDAINLTVSNRGQINTW
                     RKSRRAMAYSTVGTPDYIAPEIFNGQGYTYLCDWWSVGAIMFECLVGWPPFCAEDTTD
                     TYRKIVNWRECLYFPDELVLSRESEGLIRSFLCDPEHRVGNDGGQHGGATQIKTHPFF
                     RGVVWDQLRKIRAPFEPRLSSNIDVSYFPIDEIPQEDTSAAHRAQVRAMPDEQEAEMS
                     LPFIGYTYKAFNAFQAN"
     gene            complement(<1244975..>1245750)
                     /locus_tag="TRUGW13939_02887"
                     /db_xref="GeneID:55990394"
     mRNA            complement(join(<1244975..1245667,1245739..>1245750))
                     /locus_tag="TRUGW13939_02887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486074.1"
                     /db_xref="GeneID:55990394"
     CDS             complement(join(1244975..1245667,1245739..1245750))
                     /locus_tag="TRUGW13939_02887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341967.1"
                     /db_xref="GeneID:55990394"
                     /translation="MDYQNRAGSKFGGGGVASQSASNADRRERLRKLALETIDLDKDP
                     YFFKNHVGSFECRLCLTVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKAGQDGVMP
                     GAMGVQVKKNVVKIGRPGYKITKTRDPMTRQLGLLFQLQYQEITPGIVPRVRFMSAFE
                     QKIDEPDKNFQYLLVAAEPYQTCAFKLQARDIDRREERYWTWFDEDSKEFWVQIMFKT
                     EREERYSGVPGLAPRP"
     gene            <1245955..>1249106
                     /locus_tag="TRUGW13939_02888"
                     /db_xref="GeneID:55990395"
     mRNA            join(<1245955..1246655,1246708..1246798,1246848..1247984,
                     1248282..>1249106)
                     /locus_tag="TRUGW13939_02888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486075.1"
                     /db_xref="GeneID:55990395"
     CDS             join(1245955..1246655,1246708..1246798,1246848..1247984,
                     1248282..1249106)
                     /locus_tag="TRUGW13939_02888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341968.1"
                     /db_xref="GeneID:55990395"
                     /translation="MSRKYTTGQRLSFDNALCTVRYVGPVKGTEGEWLGVEWDDPVRG
                     KHSGEHKGKRYFTCSSLSLSLSLSLNLFLFIMLISNLGISKQQTAASFVRPTRRIDQP
                     QGFLEALRQKYASEFEEELAKRKATGNDEVQMNELISFNGKVVEEVGFEKIRKQLAEL
                     QDLKVVLLDNQCVAGVFGRDDDEQKRLYREELDKIEQTCPKIAELDLSRNLLYRWKDV
                     REICEQLQQLKSLKLNGNRFEKVHPGLVFERISELHLDQTFMSFEEISSLTMQFPSLT
                     SLTISTNHISTISSSLPATLRNLTLESNDITTLSSLKLLAQIPNLERLSVRGNDINTT
                     ITSQSNSNEEAGLFEFSKTLTSLDISRNQIDSWLFINDLPRIFPGLESLRISGNPLYD
                     RAIASTNITGLPENPMTVDEAFMLTLARLGNLTSLNYSKITQNDRTNGELYYLSLIGK
                     ELSAFPASDEERILATHPRYPRLCEIYGEPAIRRRSDTFLGKNMRPGSVAARLVNFKL
                     YCQAAPPLETGARPDEEKREHEYEIPRTFDVYRVKGIVSRLFGFAPLRFRLIWETDEW
                     DPVEEFNLGGEEWDSDDEDDEEEEAISKDTADQPNTRKEAITPTVTKDDGRKFVRREV
                     ELIDSTRQVGFWLDDSTREPKYWCKQCQIYIRDTAFEKTQHEATGKHQGNLKRFLRDI
                     HRNKEREQRDTARTTNEVERLRSLVSGKPAPATTKTDATQNRPSASSNIPRQATAEDR
                     KKQVSQLVEMGVAVPEQYRRDMAIAGDWQTVSITRIEKGEEGPRLNTGVRKRKHEENE
                     AEEYEAQAALESNVRKGWGSATRSYPGATEDTDDLEALLSRTKTVKRDEDADTKPEPD
                     TEDAVKESPEGEAGLSKAEPGLIKEDPDSLELSGAVLPKSEDQEAAPAIVFKKRKSKA
                     TKK"
     gene            <1250355..>1252635
                     /locus_tag="TRUGW13939_02889"
                     /db_xref="GeneID:55990396"
     mRNA            join(<1250355..1250996,1251275..1251692,1251752..>1252635)
                     /locus_tag="TRUGW13939_02889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486076.1"
                     /db_xref="GeneID:55990396"
     CDS             join(1250355..1250996,1251275..1251692,1251752..1252635)
                     /locus_tag="TRUGW13939_02889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341969.1"
                     /db_xref="GeneID:55990396"
                     /translation="MSESQLDPQTDPTLLDDPASGSELPPLPPISSEGTETPTIPAIS
                     PELAVPDPASTTTTTTTTTTTTTPATTFTASAPVPQAPPPLPPAPAPYNHNVADPAPG
                     PAAPAQISSFSTMPAPLSSMASSQPPPEVSSPNPQAMQAQAPIGAPVSPVMSSMSPMG
                     QYASSYSPGMAQLGMQGGQMSYQLPGNARSRAHQREVKRRTKTGCLTCRKRRIKCDEG
                     HPVCRNCVKSKRECLGYDPVFRQQTTPSEIRPASSSQPALIQENHNPYPSAPPGYVPA
                     ASQPFAPSVQSDSSVKSFDLPNNHQSTVEPSVAESDTMSALASVQDTIDGSISQPAGT
                     PSTITTPALMPPSGQVGKQEKVKIQDLLALQGIAPPSPYPIVPIQQTRLDQIQTVYLH
                     TYAPAIDRFLETRWFRDKGLSQLLTNAQLMAQYSALIDAFSDPKISEPAVRGRVESFE
                     ASVVWDTMSICRSARHLVRNGNPEPMQEYDLLTTANRFDVLEALITDDYLKENPLQED
                     LAREPPPNPNSLQDQLRRRSFNFWDCIGHFLTLHDIEASSAVEIDETLTRCRGLLDQI
                     ENRDVVYSIAIGRHLGQRLSDYPRNRPENSSDERNTNTKLLVAQRFIEEESKDKGTTQ
                     VVKRLCGMVNRLWELKSILLPRI"
     gene            complement(<1253060..>1256752)
                     /locus_tag="TRUGW13939_02890"
                     /db_xref="GeneID:55990397"
     mRNA            complement(join(<1253060..1253158,1253223..1253462,
                     1253516..1253925,1253995..1254209,1254272..1254334,
                     1254656..1255443,1255499..>1256752))
                     /locus_tag="TRUGW13939_02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486077.1"
                     /db_xref="GeneID:55990397"
     CDS             complement(join(1253060..1253158,1253223..1253462,
                     1253516..1253925,1253995..1254209,1254272..1254334,
                     1254656..1255443,1255499..1256752))
                     /locus_tag="TRUGW13939_02890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341970.1"
                     /db_xref="GeneID:55990397"
                     /translation="MTLEDFEKSLAESHEQKESEGSKDKDRSRHHRHRHHHRHRSSSR
                     SRETRHGRDRHHEDSDRHRQKRSRRDDNGEDEESRHKRRHRHDSSHDRDRPKTEADPV
                     ASNSNESHLKRDSWMEAPSSIDIDYVQRPERRLQEQPQAKMLESDLTTKIHQREINDH
                     LRDLRDGKVAEEIETTTAQHDVNYTFGDTGSQWRMTKLKAVYREAKNSGRKVDEVAIE
                     RFGDLRSFDDAREEEVELDRRDTYGESYVGKIKPSGELFQERKLEQGSRRSSRQEDKD
                     IEPNVQEQGKSMEIEPPTGTTQLLDATALNRLRAKMMKAKLKGSAEATELEEQYNAAA
                     ALMANRKEGDVVVLGVMENRMLAGSSRGEVKPVENRRGRERGQVQENDDMSIEDMLRE
                     ERRSRGQAGGEGMRLAERIAKDAKFDNDLEYMDDNAAKLAKRVQKSELNLKNTAISEF
                     HKMNRVLDNCPLCHHEDTSTPPVAPVVSLATRTYLTLPTEPEISDGSSTIVPIQHRTN
                     LLECDDDEWEEIRNFMKSLTRMYHDQGRDVIFYENAAHPDRKRHASLEVVPLPYSLGE
                     TSPAFFKEAILSADSEWTQHRKLIDTLAKSRQGLGKLAFRRTLVKEMPYFHVWFELDG
                     GLGHVVEDSRRWPRGDLFAREILGGMLDLEPDVIKRQGKWSRSGDRRVEPFRKRWRNF
                     HIQICTMTRPKALLLGNIDHAGKTWEALSNVAELVTTQAANRTEFIQECKAGKLDGVV
                     VAYRTFGSFGITGQFDEELVSVLPKSMLFLAHCGAGYDQVDVHACSQRNPPIRVSNVP
                     TAVDDATADVNMFLIIGALRNFNAGMHALREGKWRGVPAPRLGHDPEGKVLGILGMGG
                     IGRNLKRKAEAFGMKVIYHNRRKLSEALAAGAEYVSFDELLATSDVISLNLPLNAHTR
                     HIIGKPEFEKMKDDVVVVNTARGAVIDEAALVDALDSGKVYSAGLDVFEEEPKIHPGL
                     TRNPNVLLVPHMGTWSVETQTSMEEWAIANVRQAVEQGTLKSIVPEQVDL"
     gene            <1257036..>1258423
                     /locus_tag="TRUGW13939_02891"
                     /db_xref="GeneID:55990398"
     mRNA            join(<1257036..1257102,1257264..>1258423)
                     /locus_tag="TRUGW13939_02891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486078.1"
                     /db_xref="GeneID:55990398"
     CDS             join(1257036..1257102,1257264..1258423)
                     /locus_tag="TRUGW13939_02891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341971.1"
                     /db_xref="GeneID:55990398"
                     /translation="MAATAAPGETASPVAVVCVGMAGSGKTTFMQRINSYLHSQRKAP
                     YVLNLDPAVHSVPFESNIDIRDSINYKEVMKQYNLGPNGGILTSLNLFATKIDQIIAL
                     LEKRTAPTDPANTSGRPIEHILVDTPGQIEVFVWSASGSIFLETMASSFPTVIAYVID
                     TPRTSSTSTFMSNMLYACSILYKTKLPMILVFNKTDVQDAEFAKEWMTDFDAFQNALR
                     QEEEAGAFGAEGGAGGFGAGSGYMGSLLNSMSLMLEEFYRHLSVVGVSSMTGDGVEDF
                     FQAVEEKRQEFERDYRPELERKQQARAEEASQRREVELGKLMKDMAVSNKKAPRRDAP
                     ETVSDAEEDPLDDDAIGGNESDGLSGDSDSASAVGDDTGLSQRYQQALGESSESQQLT
                     QEELSFMRYLRTSNPQ"
     gene            <1260790..>1261765
                     /locus_tag="TRUGW13939_02892"
                     /db_xref="GeneID:55990399"
     mRNA            join(<1260790..1261049,1261118..1261384,1261462..>1261765)
                     /locus_tag="TRUGW13939_02892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486079.1"
                     /db_xref="GeneID:55990399"
     CDS             join(1260790..1261049,1261118..1261384,1261462..1261765)
                     /locus_tag="TRUGW13939_02892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341972.1"
                     /db_xref="GeneID:55990399"
                     /translation="MALWFRRLLPRKGRGSSRPVNDPDAAPPKQTSPNSSVTELTHHS
                     QHVQDGRKSRRTREEIADLNAKYASRIGMPNSSQYQLMVAGDPYRVLNCPQLMGGKVE
                     ARRFCAKYNLDDQVLEDQSDMPLDDVFKELRKAREAMLRSIIGRVGQGPVIEPPFHFS
                     YGCNIVLGDKFYANVNLRIMDSALVVIGNNVLIGPNVTIVTDLHNKDLETRRNVYSSP
                     VVIEDDCWIAANSVILPGVTIGKGSVIGAGSVVARDISPGSVAMGTPARAQGHRPGLY
                     "
     gene            <1262242..>1262901
                     /locus_tag="TRUGW13939_02893"
                     /db_xref="GeneID:55990400"
     mRNA            join(<1262242..1262434,1262492..>1262901)
                     /locus_tag="TRUGW13939_02893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486080.1"
                     /db_xref="GeneID:55990400"
     CDS             join(1262242..1262434,1262492..1262901)
                     /locus_tag="TRUGW13939_02893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341973.1"
                     /db_xref="GeneID:55990400"
                     /translation="MDVSFFFFLPPPCLIAAILMASLKAFYVYTYVASAWLAVQGFFL
                     ATAPKFIVTLLLDDSRVQPTDIEAYLSRSLGLTLLAIAMLIISLSGLLPLTSPTDAIS
                     VEETDARAPYAVSALLITTLLHGALAFYNYTCYVSTSQTAMALGMVGSTIVAATGVWC
                     LLFATDKGRISRRTGADKRTSGFPFKNTEADKRHPERKQL"
     gene            complement(<1264966..>1265634)
                     /locus_tag="TRUGW13939_02894"
                     /db_xref="GeneID:55990401"
     mRNA            complement(<1264966..>1265634)
                     /locus_tag="TRUGW13939_02894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486081.1"
                     /db_xref="GeneID:55990401"
     CDS             complement(1264966..1265634)
                     /locus_tag="TRUGW13939_02894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341974.1"
                     /db_xref="GeneID:55990401"
                     /translation="MGHNPHSYLIGDDPTLASAEMNDIWEDPFLSTANIPSRNDYSAL
                     PRPTGNIAGVYTADELHPSYLHVSLSTYTPNILDKLPGRNQPLGLTPWATPWEGKGTS
                     QFLEELHVSQSFYNTSDDDIESAPVPGLTRSPASSARTMLTPPTTPTTSTTSSPRSRQ
                     KSKRRLSSHKAPSPPIKFVHDELSMPANFQANPNAHARFKYHDDGTREYLNSPRKRQK
                     VSSI"
     gene            complement(<1265857..>1267305)
                     /locus_tag="TRUGW13939_02895"
                     /db_xref="GeneID:55990402"
     mRNA            complement(join(<1265857..1266019,1266072..1266417,
                     1266473..1266622,1266668..1266769,1266858..1266920,
                     1266970..1267114,1267162..>1267305))
                     /locus_tag="TRUGW13939_02895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486082.1"
                     /db_xref="GeneID:55990402"
     CDS             complement(join(1265857..1266019,1266072..1266417,
                     1266473..1266622,1266668..1266769,1266858..1266920,
                     1266970..1267114,1267162..1267305))
                     /locus_tag="TRUGW13939_02895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341975.1"
                     /db_xref="GeneID:55990402"
                     /translation="MLDFNDEASGHEKTYTSFGQLPAHVDREKPPPRKAPFSTISNHA
                     FVHTTELILPKDVYNAVWSSMRSRLEQPQYIQVIMPLSSLLEGDFFNAFIKTGSALML
                     SEGRPGVDDVYSVRDGVVTLELGKEKYERSGLTGKPIRSGARKHAKERFTVDLDLRQP
                     SMLHGKKGFERVAWAFRNVLNASLTWLLLVDSSVSVGSLDQAMSLLAKHQPRIATCRF
                     TETVHPHMYTPPLSTDEVASLASETDIEDYCNDLSEWLALVSLESPRILVGDDIDPYL
                     SRYSLPQSDPERPQPSSTLVTLRWHGAMTANWITQLFLSLLHEYRNRTDEVNDWASLS
                     ATAFNRHAVENADGYNIMAWHSNHISWEFVGASQRA"
     gene            complement(<1268145..>1269411)
                     /locus_tag="TRUGW13939_02896"
                     /db_xref="GeneID:55990403"
     mRNA            complement(join(<1268145..1268795,1268865..1269177,
                     1269293..>1269411))
                     /locus_tag="TRUGW13939_02896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486083.1"
                     /db_xref="GeneID:55990403"
     CDS             complement(join(1268145..1268795,1268865..1269177,
                     1269293..1269411))
                     /locus_tag="TRUGW13939_02896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341976.1"
                     /db_xref="GeneID:55990403"
                     /translation="MASRQPDRRFIHKDRFGYLFGSLKTQNYQDPAARGPGSHIIRTL
                     AWNPTGQLIATGSANRTLRIWNPERANARYSTELRGHSAGIEKVLFNPVRDAELASCS
                     SDGTVRFWDVRSKTCVSRLDVGGEAFTLSWSADGKVVIVGRKDDTLVPVSIESLSTPT
                     IMTNGATTEKATSTYTTLPSQPQNTQTNATTFSHHVPTESAPDLDFLATTGDGTVKIF
                     SYPSFTLRHTLNAHSSACLALSLAPTARYLAVGGSDALISLWDTTDWVCRRTVSSEGS
                     GTIRDVSWSFDGRFLCGASEEVGASGLEIFHAETGDSVHSIPVTTSGIPAVAWHPTRY
                     WLAYSSMADSGNAGGLRIVGAAGGGL"
     gene            complement(<1269998..>1274811)
                     /locus_tag="TRUGW13939_02897"
                     /db_xref="GeneID:55990404"
     mRNA            complement(join(<1269998..1270672,1270730..1270966,
                     1271024..1271512,1271574..1272093,1272155..1272428,
                     1272499..1272871,1273086..1273212,1273276..1273282,
                     1273557..1273632,1273699..>1274811))
                     /locus_tag="TRUGW13939_02897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486084.1"
                     /db_xref="GeneID:55990404"
     CDS             complement(join(1269998..1270672,1270730..1270966,
                     1271024..1271512,1271574..1272093,1272155..1272428,
                     1272499..1272871,1273086..1273212,1273276..1273282,
                     1273557..1273632,1273699..1274811))
                     /locus_tag="TRUGW13939_02897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341977.1"
                     /db_xref="GeneID:55990404"
                     /translation="MLQTRLLSRTLQQLPYRCASPLAVRFYATAVQETEKAPESSSYD
                     PDAFAPPPPRGEVGVHVRRYKPRTPGVRHLRRPINDHLWKGRPVHKLTFPKRGQAKGG
                     RNHTGRITVRHRGGGHKRRIRMIDFARADPGPHAVERIEHDPGRTAHIALLRSKETRK
                     LSYVLAADGLRAGDVIQSYMAGIPQDLWDSMGGVIDPGVLAARTAWRGNCLPLHMIPV
                     GTLVFNVGMRPGKGGQLCRSAGTFATIIAKGTEQQKNEERKQQLEAEAGIEKVEQKRL
                     TQREKQKAERNAEHVTIRLQSGEVRLIHKDCCATVGVASNPNYQYTQIGKAGRARWLG
                     IRPTVRGVAMNAMDHPHGGGRGKSKGNVDPKSPWGIPTKSGYKTRPKRKVNKNVVVPR
                     VRNQDKSQSPVVSPEIRRQPQTDFDLQMTERDFGHSQMSLYCELETSCMYSGVQLATP
                     VYHSPPLHSEDRLLNTLWPIMSSQEQESFNDFSGQPMSLDISEPHAASTNDDDNNYVP
                     RPKRMACVVCRKRKLKCDGKKPSCGTCARVGHNCAYDEVRKKSGPKRGYVKQLEARLA
                     QVETLIKSQESDSQPTSRHSQPPTIANPGISDFSSISNTSPFQQLPDGLGSQSFSGNF
                     LSNDPNLSTDSSWEIISLGLEEPLPTKEVVDDLTSIYFDRVYPASPMMHRPRYYAAMD
                     LAPNMRPPVCLRYSMWALAASITPKYSFLEEHLYARARKYIQLDEMKGHGEHMVTIAH
                     CQAWLLISLYEFKQMLFPRAWVSVGRGARLASMMCLNRLDGVGLDVKHCIPPPRDWIE
                     REERRRTFWIAFCHDRYASIGTGWPMMFDERDILTNLPASDDAFLTGKAEVAPTMKDV
                     LAGDIANLSPLGSVALMSCIFGLNLTHLHRPDSQDRENDVNGEFWKRHRAYDNILLNI
                     SLSLPNSLRLPRGIKNPNIIFANMSIHTSTICLHQAAIFKAEKNKLQNQIAAESKRRC
                     IIAADQVASIMRMISHTDLSTMNPFCAFCLYVAARVFVQYLKSRPDDQAVKSSLHFLL
                     TALNALKQFSSLTESFLIQLDVDLAGTEFASMTTSKMGRKPTEQNDISDCVHIARLNS
                     SPENARETSNTNSPDSRVSNNFGSLPNRQRGPNPSHQGSTNNSVNANPSPGFDDLHAW
                     PTSEMNISLANDNTNSSSEKASPATMNSSSNTAITPPSVDRPLSNTQPPNGSNNTKDM
                     ATPDPLNHDFNNMYNNMDFSKSVLFDATTLNSELDPTGMENPFALNAGWSHPIEQPTG
                     LEDPSLEMTDDMDPFSNRQFEQMLEGMGWNGWPQ"
     gene            <1276318..>1277817
                     /locus_tag="TRUGW13939_02898"
                     /db_xref="GeneID:55990405"
     mRNA            <1276318..>1277817
                     /locus_tag="TRUGW13939_02898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486085.1"
                     /db_xref="GeneID:55990405"
     CDS             1276318..1277817
                     /locus_tag="TRUGW13939_02898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341978.1"
                     /db_xref="GeneID:55990405"
                     /translation="MSSFDVLQTRSLRQRTITNENDENGTSTRVTRAKAAALTTSDIT
                     TAAKKPLQSKKANTSVPTANGAQRRRPALGDVSNVTKTDLVDAKDGKKAAVKGGLTSK
                     ATSQAGGVQKLSRTNTTRAALGVKDNNTKKATVEVKRPGSGSGIGGSSMKRSSSQKSV
                     KEQTVHNEEPPRKKVDVEKKKSEITKPQAVVENVVEVKATEIPLADEPLDLDTEDLDD
                     PLMAAEYVVEIFDYLKDLELETLPNPDYIDHQPDLEWKMRGILVDWLIEVHTRFRLLP
                     ETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIASKYEEVLSPHVVNFSHVADEAFS
                     DKEILDAERHVLATLDYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMELSLLDHRF
                     MAYKQSHIGAAAMYLARVILDRSEWDATLAHYSGYTEEEIQPVLQLMIDYLHRPVAHE
                     AFFKKYASKKFLKASIVTRQWAKKYHSLYIESSIKVNESYEAHNKCNAE"
     gene            <1278906..>1279686
                     /locus_tag="TRUGW13939_02899"
                     /db_xref="GeneID:55990406"
     mRNA            join(<1278906..1279184,1279258..1279360,1279430..>1279686)
                     /locus_tag="TRUGW13939_02899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486086.1"
                     /db_xref="GeneID:55990406"
     CDS             join(1278906..1279184,1279258..1279360,1279430..1279686)
                     /locus_tag="TRUGW13939_02899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341979.1"
                     /db_xref="GeneID:55990406"
                     /translation="MPVHPTLPSPTCPFCAIAAAYPPIPPSSALQRVSHPPTQTSSNE
                     PSSRAFLILATQHVLAFLDIMPLSRGHILLTTRNHWEKVGDVGVRVGEEIGKWLPVIS
                     RVTMRVIFGEESLAEDQHWNIVQNNGERAAQVVPHVHFHIIPRPPLLSSSATRQLSSW
                     TMFGRGQRDDLDDDEGEELARLLREELAREVKRVKRDEGVDLDVDIDHKLKL"
     gene            complement(<1279848..>1283756)
                     /locus_tag="TRUGW13939_02900"
                     /db_xref="GeneID:55990407"
     mRNA            complement(join(<1279848..1279901,1279953..1280080,
                     1280150..1280355,1280414..1281339,1281413..1281568,
                     1282070..1282471,1282528..1283076,1283129..1283439,
                     1283513..>1283756))
                     /locus_tag="TRUGW13939_02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486087.1"
                     /db_xref="GeneID:55990407"
     CDS             complement(join(1279848..1279901,1279953..1280080,
                     1280150..1280355,1280414..1281339,1281413..1281568,
                     1282070..1282471,1282528..1283076,1283129..1283439,
                     1283513..1283756))
                     /locus_tag="TRUGW13939_02900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341980.1"
                     /db_xref="GeneID:55990407"
                     /translation="MDLVQSPDLDEALKKPLVDLDAVESGADPEHGAANTFTDEALKD
                     LASPSHDGEEESDEDEWETDSLYEEALHFVRDDQLSSVPDSCTPQEAAAYRKRLHEIG
                     KVEFVEETIGKNTITAKKLLTAFGIVPPSFLEDAPDDAYHPLLGIVISREFAKRQKLE
                     EYNTIQDAVELLEKSKNIIVITGAGISTSLGIPDFRSKDTGLYSRLEHLGLSDPQEVF
                     DIQLFYEDPSIFFSVAKDILPTEKKFSPTHAFIKLLQDKGKLLTNYTQNIDNIEANAG
                     VSREKIVQCHGSFATATCTKCAFNVPGDAIFDTIKAGNIPECKACKERLALQPQGMKR
                     KRSSNGSHPNRKKGFLGDDSEEDDYDIPTPGVMKPDITFFGEDLPDEFGRRLVQEDRE
                     LADLVIVIGTSMKVAPVADVPSLIPSTVPQIYISRTASIPYWYKYIHSANSKQPVSHI
                     GFDIDLLGDCDVVVSELCRKSGWDLQHSMIPKDQNVDVIKEEGYESRYTFRVIHLVLT
                     RFLNVKSNMEYVIRFAQIHESFRRAEIEALATLVGVDVEFVWYDNYSPFCVAKFPDGE
                     AARKVVSRSILAQDVYELWGRGVSHAELLADIKSRTESRWKDYERVSVHMVFDSFSRK
                     RSQAEKMKLFQTFFEYVGLKGPIDMHNAQEEFAIFEDYVSSKEASDLRKGAGAVQEEA
                     SESAHQGVGDTPLKMALFGRWICRSNRDTIRKYDLKKRKYIATTSMDAELSLVTANMA
                     LAAPGKIFFDPFVGTGSFLLAAAHFGAMTLGSDIDGRSFKGKQPITKESPAGLSSNFA
                     QYGTESKFLNAFTSDLTNTPIRQVPFLDGIVCDPPYGIREGLKVLGAREGRSTEPMFI
                     DGKPAHTQPGFIVPKKPYGFVRMQQDILCFAARTLVEGGRIAMWMPTSDDQEIELMIP
                     TTPSLEIVNVSVQQFKGWARRLLTYRKLPEGEVSLDTRIHRATDDAQGVTADDLNEFR
                     RKYFMPNKEKLKKPKKPET"
     gene            complement(<1285818..>1287089)
                     /locus_tag="TRUGW13939_02901"
                     /db_xref="GeneID:55990408"
     mRNA            complement(join(<1285818..1286487,1286545..>1287089))
                     /locus_tag="TRUGW13939_02901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486088.1"
                     /db_xref="GeneID:55990408"
     CDS             complement(join(1285818..1286487,1286545..1287089))
                     /locus_tag="TRUGW13939_02901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341981.1"
                     /db_xref="GeneID:55990408"
                     /translation="MKNKKDSPKQKKSVLNGVGGSISKPQMAENTTELLEKATILLQT
                     GQAEAALPLAQRVLELSPENSPESLSAVNLIGEINVELGDIDAARQSFLHAVQIDPEG
                     TIPESQGGGAEKFLWLAQLSEQGGADSVGWYEKGVGALRHIIQSLEQSTQPADATLCE
                     EKRKKLATALCGVVEIYMTDLSWEEDAETRCETLITEALLVAPNSPDCLQTLASVRIS
                     QSRVDDARASLSRSLDIWKELPPEDLRIPDFPTRISLSRLLMEVDMELQALQVLERLI
                     LEDDESVEAWYLGGWCLYLMAEKEKENAASSISAQSTEERRHDSMVASREWLKQSLKL
                     YARLDYEDERLKLHAIDLIQDLNNELGQDNDDDSESESGMPGGDEEEDLDEEIEALSD
                     DDDDEDHEMKDL"
     gene            <1287467..>1288248
                     /locus_tag="TRUGW13939_02902"
                     /db_xref="GeneID:55990409"
     mRNA            join(<1287467..1287533,1287617..>1288248)
                     /locus_tag="TRUGW13939_02902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486089.1"
                     /db_xref="GeneID:55990409"
     CDS             join(1287467..1287533,1287617..1288248)
                     /locus_tag="TRUGW13939_02902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341982.1"
                     /db_xref="GeneID:55990409"
                     /translation="MGREDQIEEREVLDSIFPDEISDLSETSYRITITLDIDQEEESE
                     EEAPILILQISYPEAYPDVAPDLEISTPPNAPKHSRFDVQEDKAHLMEALQPSIEENL
                     GMAMVFTLVSTMKEAAENLIMDRVTSEKNAREKEIAKAEEEENRKFQGTLVNKEKFLE
                     WREGFRKELEEEEQRLREEKEAEEKKKKTSAREETKLTGRQLWERGLAGKGDYDEDGD
                     DDVAVAAEKLQISS"
     gene            complement(<1288601..>1289618)
                     /locus_tag="TRUGW13939_02903"
                     /db_xref="GeneID:55990410"
     mRNA            complement(join(<1288601..1289305,1289358..1289518,
                     1289573..>1289618))
                     /locus_tag="TRUGW13939_02903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486090.1"
                     /db_xref="GeneID:55990410"
     CDS             complement(join(1288601..1289305,1289358..1289518,
                     1289573..1289618))
                     /locus_tag="TRUGW13939_02903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341983.1"
                     /db_xref="GeneID:55990410"
                     /translation="MKWSRGPSSGVHRFACLSLYRALLRQSHRLPPTSTETENIRHLV
                     RTKFDRYKGIQSPTRILHCLQAGYEALDLLHSACSENKDSLARIQLLLQSSRSRTPTS
                     TPKDENISTPVSRRAEKRAENIEFQRQSRWTHPKVEPILSRPRPVVAGRRKVPVFVNA
                     RGVPFLRIKKPQPQILSQIIRQKHAYKDKLIERRNRLLLEYYFAKDEEDWDRILNGES
                     ITNATHWSKEPLWLEGSWPESVWASFQQSNDDNYIYERKNLNLARELWQVVLDERELA
                     EKEKAEGKDQDSEIHVGSKSMDSDLAR"
     gene            complement(<1290199..>1290840)
                     /locus_tag="TRUGW13939_02904"
                     /db_xref="GeneID:55990411"
     mRNA            complement(join(<1290199..1290259,1290314..1290393,
                     1290446..1290571,1290625..1290704,1290771..>1290840))
                     /locus_tag="TRUGW13939_02904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486091.1"
                     /db_xref="GeneID:55990411"
     CDS             complement(join(1290199..1290259,1290314..1290393,
                     1290446..1290571,1290625..1290704,1290771..1290840))
                     /locus_tag="TRUGW13939_02904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341984.1"
                     /db_xref="GeneID:55990411"
                     /translation="MAKIPRNFRLLEELEKGEKGQGPEACSYGLADGDDLMMTNWNGT
                     ILGPPHSVHENRIYSVNIHCGDEYPDSPPTLYFVSKINLPCVDPRTGKVDLGKLPTLA
                     TWKRDYTMETILLELRRFMALPQHKKLSQPPEGSNF"
     gene            <1291408..>1296869
                     /locus_tag="TRUGW13939_02905"
                     /db_xref="GeneID:55990412"
     mRNA            join(<1291408..1291485,1291546..1291612,1291677..1291850,
                     1291903..1292109,1292168..1292256,1292310..>1296869)
                     /locus_tag="TRUGW13939_02905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486092.1"
                     /db_xref="GeneID:55990412"
     CDS             join(1291408..1291485,1291546..1291612,1291677..1291850,
                     1291903..1292109,1292168..1292256,1292310..1296869)
                     /locus_tag="TRUGW13939_02905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341985.1"
                     /db_xref="GeneID:55990412"
                     /translation="MSSQILQAELANLIQESKRKHSDLRNAAEQSLSELKALPSTSEA
                     QITADLIRRPNFISPFLLACQTRQIKLAAIGAVCIQRLATSHALSPERLGDTLSALRE
                     AAGLSQDVQLKILQTLPALLHNYSDQLSGELLAHTLEICATIQVSKVAAVSNTAAATL
                     QQLVISVFEKVVAEDGNPSRSTTTKSVPVENASIDIGIAAYDALQILGDLCHLVEGEK
                     LDFLQIKGLSPVFVLELIESVLVNNIKLFRSHPEQLHVLRDRLMPLTVRYLSERHNFP
                     QTLRITRILLILLRNFMSLLPDECEMALGLLIHLLEPDVSVSWKRVLCMEVFRGLHAE
                     HGLVRLAYALFDETEGRKTIVKDHMASLLRLASEKPSIIGVSHQSTVPSGVSHSRSNT
                     EDQITLEAGGVAGVIGAAVNAADENVTGISNQWSTVRAPYLELLDKSEAPTPPETYIY
                     SLVINCISSLSEGLARFILPLTVTESRGKRKKKTTMHDREQGSTGELQRSNSTRSTAS
                     DSKRQTVPLNPLTLEDHPQIAAIKSSAGIIESCWPAILATCSTFLYAALDAEFYHNLV
                     RSFQKLAHVAGLLRQAAARDAFLTTLGKATIPVDGVTASRNGSNTQQSDAPETTGENA
                     PQSALETPEASMGVSRTSLSTRNLLCLRALLNLGIALGPTLDLSAWSILFETLQNADL
                     VIKLAAVTSTKQAANVGNVDNTSQAGQDIPKANMGNEILAVQTVASRMFESTAEYPND
                     SFEAVLKALLNLAFNSRQSSTANPLSPAQSSPSRRMGRVHQTTRSISLAAGKFRIQDD
                     ELNFVLDKTRDLGSANIDRLSSVGQEEDAIWGILNANLNEIITSSDYNSAIRLKASKT
                     LNTIILQTMKDDYLEGDLRNALQLRNLQSLQSQIESLYRQRAQPSAVDMESHEQALDT
                     LKVMLEQYGETFVSGWDLVFELVSSVFDKKGLDPDGNNTAKNEKDTSLKPRNFTARSP
                     RLIRSAYNSLQLIASDFLTLLPPSCLLNLVDSFSYFASQDSDFNISLTTTTFFWNVSD
                     FLQSQVGKFSIEDSMDTTISEESLTKLTNDVDIPTSRGALWLILLLHIVGLTTDKRPE
                     IRNSAIRTLLRIFDAYGPQLSPKAWNLCLNRVLFVMMNDVQNGTLEATTSKEDVGQAK
                     AWEETAVIMIRGSSDLIGSFFDQIAKDARFDASWKRFLGFFQALVQINTHEVVEAVFK
                     SLYEILEHAETPGSLNNEAVQLAWLLWVNNHPSINAESLNMEESNQDALLAYLRSFQQ
                     IYKLYKSSIGDEQVQQILQHLRVAVWNSVISRYSVDVEHQSTLQELVIECTKALCHDK
                     PESQPAIITCLADFDDAALTQWSPNRDRSRPSLVAFSKAAIDLSSWYITEHGIKADII
                     SDGSLVSLLQHLAHPILRKYDWNGRDHEPLIWQKATTSAINIIRVVVPYVEKRYDALE
                     RSHITQFWTSIVEIARGIITAQIRGEVDISPGRIAADEEFDIQAFHTLKPLIIPSFGS
                     SHIPDSIQRTFSCALVQSSFIYPPQRMDKPIETLLAKPLHDLYKVRRGRTFTPVPIAR
                     SHIAYALVDTMFELARAINPPSAAAKDPSPQNSTESRITLARSIMPYLILRVSLPLKS
                     YIADQPLRGRMPQPAPAHRELVHILKGLADLESEPVAIPDAPNGFVSSSTKSHQLQYR
                     KHLGWMYPLLVKCVHVTGKATERGDRAVLENLVRILDAVGDCQNLEDGDDDEGDED"
     gene            complement(<1297276..>1298822)
                     /locus_tag="TRUGW13939_02906"
                     /db_xref="GeneID:55990413"
     mRNA            complement(join(<1297276..1297487,1297786..1297902,
                     1297963..1297987,1298047..1298519,1298603..>1298822))
                     /locus_tag="TRUGW13939_02906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486093.1"
                     /db_xref="GeneID:55990413"
     CDS             complement(join(1297276..1297487,1297786..1297902,
                     1297963..1297987,1298047..1298519,1298603..1298822))
                     /locus_tag="TRUGW13939_02906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341986.1"
                     /db_xref="GeneID:55990413"
                     /translation="MAPFFFSTPVDIDIVLEDTDDRQAVDVKLDKDRREKAPLYMDGE
                     SIKGAVTVRPKDGKRLEHTGIKVQFIGSIEMFFDRGNHYEFLSLVQELAAPGELQHPQ
                     TFPFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVIREKDLWVYSYRMPPETNSP
                     IKMDVGIEDCLHIEFEYSKSQYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGAAP
                     NQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKYSTRYYLSLVLI
                     DEDARRYFKQSEILLYRQAPEIAPTPEVAQQQILQKQQIQRHHQVLVGPNKNPQYIQP
                     PPPAQQEVEPAGSA"
     gene            <1300472..>1301234
                     /locus_tag="TRUGW13939_02907"
                     /db_xref="GeneID:55990414"
     mRNA            join(<1300472..1300714,1300779..>1301234)
                     /locus_tag="TRUGW13939_02907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486094.1"
                     /db_xref="GeneID:55990414"
     CDS             join(1300472..1300714,1300779..1301234)
                     /locus_tag="TRUGW13939_02907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341987.1"
                     /db_xref="GeneID:55990414"
                     /translation="MLSANNDKPANALSTPVFNMPTSTTTSSKAYYRMDSHERRGVET
                     QPLQHIWIVTGPAGSGKTTVAQKLQAELGLPFLEGDDFHPPANKEKMGNGTPLNDMDR
                     WDWLISLRDAAVNTLSTPESDNASQVPSGVIMSCSALKLKYRDVIRVAAYDHPSVRIH
                     FIYLKADENALMARVMGRSSHYMKENMVRSQFEALEDPCDEKDVLAVDVDTSPEEAQR
                     RVSETVARKLAEYK"
     gene            complement(<1301506..>1303122)
                     /locus_tag="TRUGW13939_02908"
                     /db_xref="GeneID:55990415"
     mRNA            complement(join(<1301506..1302594,1302656..1302727,
                     1302780..1302883,1302951..>1303122))
                     /locus_tag="TRUGW13939_02908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486095.1"
                     /db_xref="GeneID:55990415"
     CDS             complement(join(1301506..1302594,1302656..1302727,
                     1302780..1302883,1302951..1303122))
                     /locus_tag="TRUGW13939_02908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341988.1"
                     /db_xref="GeneID:55990415"
                     /translation="MSLLHCSRRLLSRSTYRSGHSIALQSLALAGLHSRRAFHGSAAC
                     WGTRSQVLKDVGEGITEVQIIQWYVEEGAHVEEWKPLCQYQSDKAVDDITSRYAGVIK
                     KLHFQTDDTVPTGKALCDIEVDDAQYPDDAVVVAQPEPVESQPAQQPTEVSQLDTSEA
                     VPHVPEEKPQSKYASLATPAVRGLLKDLNVNILDVTGTGKDGRVTKDDVQKFAATRGQ
                     QPITTTQQTAAVPAARPATTIDTQQSETREPLTHMQSQMFKTMTKSLQIPHFLFTDEL
                     NIDAVTTLRRKLSSDPTSAQKITSLSFIVKAVSLALEEYPILNAKIDTTDPKKPTIIM
                     RRNHNIGVAMDTPQGLIVPNIKNVAARSISDIAAEISRLSALGKEGKLTPADLTGGTF
                     TVSNIGNIGGTYVSPVIVSSEVAILGVGRSRVLPVFDEAGQVTKAELVNFSWSADHRV
                     IDGATMARMANKVRDFIESPDRMLLRLR"
     gene            <1303843..>1305255
                     /locus_tag="TRUGW13939_02909"
                     /db_xref="GeneID:55990416"
     mRNA            <1303843..>1305255
                     /locus_tag="TRUGW13939_02909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486096.1"
                     /db_xref="GeneID:55990416"
     CDS             1303843..1305255
                     /locus_tag="TRUGW13939_02909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341989.1"
                     /db_xref="GeneID:55990416"
                     /translation="MVAQALTIRNLTSTPIELKLVERFRPQEKKDSIEGFGALAKNLT
                     RMVTNVTRSSNTAEPLAHDAKPFAHQDVNVHVNPFATTKTEIKTFENDDKERLRLVFE
                     VQGERHQITTPVPTVESAEMKPLSDNPRHKLTGVFITQESHLAIFSSANLQAWMRELK
                     DEIPLSALSIPGTHNSATCHVAPPSVRCQSVSPKEQLENGVRFFDVRLQPQYPDDASK
                     EDLIIVHGAFPISLSGNKYFRELIRDVEDFLDRNPSETLIISLKREGTGNATDEQLSR
                     TIRDHYAKPGSRWFTEPRVPKLGEVRGKIILVRRYNIGEHLKKAHEGRGFGIDGGGWA
                     DNTPNANCPSGLLCIQDFYDVLETKNIDKKIQYVSEHISRAGAVRYPFGGDPNQKHPF
                     FINFLSASNFWGTDTWPEKIAAKLNPAITKHICLQHCNHPDGDWGTGVLITDWVGLDG
                     DYDLWRCIVGMNAKLKLRNN"
     gene            complement(<1305417..>1306445)
                     /locus_tag="TRUGW13939_02910"
                     /db_xref="GeneID:55990417"
     mRNA            complement(<1305417..>1306445)
                     /locus_tag="TRUGW13939_02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486097.1"
                     /db_xref="GeneID:55990417"
     CDS             complement(1305417..1306445)
                     /locus_tag="TRUGW13939_02910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341990.1"
                     /db_xref="GeneID:55990417"
                     /translation="MAPRLRVSTSDISRAVRRQRGLRVEYQHATTTSIRAASTATAMA
                     STTTVPPPSIEKMNKRPPRIARTAFVQPPSHRRPEERRSQLLRQYTSLIRTAPLMVFF
                     QHNNLQSTEWAAIRRELVQALQKVDEQHAAEGRNTVPLAPHVKLQIIQTRIFEVALRI
                     VDHFRPENATGGAKSAEEMLTHDLSREAHNAVYHLKGKHELATLLSGPLAVLSLPNVS
                     PEHLKAALSILAPKASGFSAPSRKANPGYHELTVQDGLHKMMLVAARVDGQVFDLEGT
                     KWVGSIESGLDGLRAQLVYALQGIGGGVTSALEGAGKSLYLTMESRRSVLEEEQKGES
                     GENGEKQS"
     gene            <1307148..>1308510
                     /locus_tag="TRUGW13939_02911"
                     /db_xref="GeneID:55990418"
     mRNA            join(<1307148..1307468,1307539..>1308510)
                     /locus_tag="TRUGW13939_02911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486098.1"
                     /db_xref="GeneID:55990418"
     CDS             join(1307148..1307468,1307539..1308510)
                     /locus_tag="TRUGW13939_02911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341991.1"
                     /db_xref="GeneID:55990418"
                     /translation="MAEADTPEPVSISPLLKRLAYPATAEIQVSAEEIAAAFALIFEN
                     RLSVIQTAALLTLLHSTGKDRDSKVIALCSHRMREAASTVDRAQLRAAVKSRGRSEGR
                     YHGGLCDIVGTGGDSHSTFNVSTTSSIIASALLMVAKHGNRSQTSFSGSADVLNCVVP
                     VPPKISAVKASDIARVYEKTNYLFLFAPNFHQGMKYADSVRRGLGIRTIFNLMGPLAN
                     PVDWALEARVVGVAYQSLGPVFIEALRLGGSRKALVVCGEEDMDEISCAGPTNCWRLA
                     EDPESTSAAHADEDDDDDDDEDDYFKKKPLAKFDTFQLHPSDFGFPTHPIEEVYTKKM
                     PKENAAKLMSILRNELSPDEPLMHFVLINTAALLVTSGVCESDTSNMGPGDDGKVITE
                     RGPGGGRWKEGVRRARWAIENGQSLKVFEQFIEATNNL"
     gene            complement(<1308893..>1309200)
                     /locus_tag="TRUGW13939_02912"
                     /db_xref="GeneID:55990419"
     mRNA            complement(join(<1308893..1308917,1308995..>1309200))
                     /locus_tag="TRUGW13939_02912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486099.1"
                     /db_xref="GeneID:55990419"
     CDS             complement(join(1308893..1308917,1308995..1309200))
                     /locus_tag="TRUGW13939_02912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341992.1"
                     /db_xref="GeneID:55990419"
                     /translation="MSREAYQVPSLDTNGGGAASGASAFATSSDSAVRYICGDCDHKF
                     VLQQNSSLRCPDCGHRILYKERTKRMVQFEAR"
     gene            complement(<1309564..>1311386)
                     /locus_tag="TRUGW13939_02913"
                     /db_xref="GeneID:55990420"
     mRNA            complement(join(<1309564..1311225,1311279..>1311386))
                     /locus_tag="TRUGW13939_02913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486100.1"
                     /db_xref="GeneID:55990420"
     CDS             complement(join(1309564..1311225,1311279..1311386))
                     /locus_tag="TRUGW13939_02913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341993.1"
                     /db_xref="GeneID:55990420"
                     /translation="MSAILSADDLNDFISPGVACIKPVETLPQKGTNNSEEYEVTTED
                     KVQPAPQSTAQISLTDCLACSGCVTSAEAVLISLQSHSEVLNTLDAYQPAPFVHGQDG
                     HITLPRKLEEDEKIFIASVSPQVRASLAATFGVSETKAGFMIDQFLGGPQGLRAGGEH
                     QNGFTWVVDTDILRQIVLTLTAEEAAQNLQGGDSPTNKEQTASPKRPILSSACPGWIC
                     YAEKTHPYVLPHLSRLKSPQALAGTFLKSILSRVLGVSPSQIWHLAIMPCFDKKLEAS
                     REELTDEAWSYDGINTSQSPVRDVDCVITSRELLMLASTRNINLSSLPLKPLSSTYAP
                     HFPEAAVDSFLFAGGPKQNSFYGSSGGYLYYVLSSFQARHPGSNIITQRGRNSDVLEY
                     SLVSESGQPIIKAARYYGFRNIQNLVRRLKPARTSRLPGANRRGPAGSNAAPGLDHIY
                     VEVMACPGGCTNGGGQIRIDDAREANSSLLGSSLDESSNQTQKSSLQEQRAWLARVDE
                     AYYSADDSEEESEYAATNMSIPDVEARVHGILKHWTDLTGINLEKLVYTTFRKVESDV
                     GKDKSVNDTSRVVELAGKIGGGW"
     gene            complement(<1311873..>1313044)
                     /locus_tag="TRUGW13939_02914"
                     /db_xref="GeneID:55990421"
     mRNA            complement(join(<1311873..1312398,1312452..>1313044))
                     /locus_tag="TRUGW13939_02914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486101.1"
                     /db_xref="GeneID:55990421"
     CDS             complement(join(1311873..1312398,1312452..1313044))
                     /locus_tag="TRUGW13939_02914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341994.1"
                     /db_xref="GeneID:55990421"
                     /translation="MPELAEVSRIVHFIRKHLVGKTLSVVQAQNDDIVYGKVGTSAAE
                     FQKAMQGNKIIGAGQQGKYFWITMSKAPHVVMHFGMAGWLKIRDADTYYYRTTKAGDS
                     EWPPKHWKFLLETDETPKTEAAFVDFRRLSRIRLVDCPADDIRKHTPLKENGPDPLLD
                     KDIFTAEWLTNKVKSKKVPIKALLLDQANISGIGNWMGDEVLYHSKIHPEQYSNTLNN
                     EQIIQLHKSIDYVCTTSVDLLADSEKFPEEWLFKHRWGKGKKNQASVLPNGNKIVFLT
                     VGGRTSAVVPAVQRKTGPVAKDVTSDNESDNATKTPANSKRKRTNVKKEDEDEDHAPK
                     RAASKRRIKNEDEAPIKKEELESPNRTSGRRRSARSTK"
     gene            <1313446..>1314109
                     /locus_tag="TRUGW13939_02915"
                     /db_xref="GeneID:55990422"
     mRNA            join(<1313446..1313518,1313586..>1314109)
                     /locus_tag="TRUGW13939_02915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486102.1"
                     /db_xref="GeneID:55990422"
     CDS             join(1313446..1313518,1313586..1314109)
                     /locus_tag="TRUGW13939_02915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341995.1"
                     /db_xref="GeneID:55990422"
                     /translation="MSKPLPVSSPSLSPQFCFNERVLRDFLRLSRTTIDDSITQNLNA
                     LLRPSREGFDPSSTDVRQLDATERRRLSSEACGSFKNDILFPSWQTRSDVLNYCASVA
                     TSPDPEDPDIIARQVESTKEQERVVNDRLDPYSSRYFPREARTESLANLVRNERSVEQ
                     IIRTRTWGVVAERCDATGSWEDALDRWREQKHIQRQTS"
     gene            <1315045..>1320353
                     /locus_tag="TRUGW13939_02916"
                     /db_xref="GeneID:55990423"
     mRNA            join(<1315045..1315283,1315504..1315550,1315602..1315763,
                     1315823..1315847,1315914..1316444,1316498..>1320353)
                     /locus_tag="TRUGW13939_02916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486103.1"
                     /db_xref="GeneID:55990423"
     CDS             join(1315045..1315283,1315504..1315550,1315602..1315763,
                     1315823..1315847,1315914..1316444,1316498..1320353)
                     /locus_tag="TRUGW13939_02916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341996.1"
                     /db_xref="GeneID:55990423"
                     /translation="MAEVVGLVSSIVALIELSAKIAGLSYSYARQVKNAPKTQKQYLQ
                     QVSSLIEVLYRVEQAIAVSESTGLLPVRPPSLNEDAITSTATYQKISSIHYEQDRNLL
                     LTWVPTPSIPLRQKPSPCSGTGRWLLGTVAVQAWLSKSTELLWCYGQPGVGKSFLASV
                     MIDHLLEKREHDSLVIYFFCDFSSRNQVTTKDILQYLLRQIVDQGSEKMLSTLKGACG
                     DPSALQNANKVVQLLALAASVQSIYLVVDGVDELKTLNELLEHILELAKSKMRIMVTS
                     RDLPQIRRKMSTTLRLNIKPTEHDLRLYVNMRLQDSDFVEEAAKDSSLIDDIVSKTGN
                     IFLLTRLLLDELLDLVTIYQIRKALERPPQGLQQALEATLQRIDAQPLARRTLARRLL
                     SWIMLAERRLKMNEVVTAFAVEDGEELHPDNMPSADILHQVCAGLVILNKDDNTVGLV
                     HVFAYELLHNLLPKRQSHIDIAQTCLRYLSLKPLGGGPCASAAEMLNRVDSLPFLEYS
                     SKYWGHHVISGDCEKELESLILELLDDSRLSDSAFQALQFRREYASTGTAEELFQSLP
                     INSHALHLAAYWGLTRITGKILEAGAPPSPVDSHKWTPLHWACANNRLGVAELLLSRG
                     ADVNAQDNQGWSPLFWSAFVGSNLMVHLLLCNGADHLARSTLGWTALHWAISGGHTEL
                     AKKLLDHHLESQSPKPLFHRMTMKEIEAYANTTSPLDVVAGDQDYDIFTALTNHLQTS
                     RGTITDAGFNEIWKRESFDVPVSFNLWRTMTKGERINGRDWQYHGTIRIENSLEKRES
                     GPNNWKSSLLISAIRDQQLSSVELLVKAGADMENNRALFMAARRQDPRYVQCLLENGA
                     NPNATDHYGRTPLHDAIMDGFVETVGALLDGGADVNKPVTRDFDSIRVDKVDIEMVNY
                     SIECNDIGSTALILASGFVQREHYGTERFQTQPSGFELITQITQLLLSKGADPGLKDP
                     SGRTALHYAMLRPHLPWVKLLIDAGCPVDAVDCNGSMPLHLLAVRQEDGLDGHDLKAI
                     VCLLLNGKCENGQADILNQPVPATSAIQDTRSSRKKNLMYFYEVEHGFESFHRTLKRA
                     KGFEEGLTPLTMALKAGSWTLVQVLLELGATFPTHLNLTPILTHAIKSAEPSMKSLLI
                     LHGARPSPGAIYDLVNSFVAQTTPDTITNPAEGKDVMSDFKRSLEELASAGADVNFRQ
                     NEETPLVAVATKCGSETAIQALLDAGSDVYTTLSKTFDPILALVISGQSVHLDYLLDY
                     SVAHPRKGHWSNHLNEVSHESDPVMRVCRSLQKAKVINRTNSDGRTLLHLVAQQGNIA
                     LVTALVSCGAKTDIVDSTGWLAVHCAGFAKQNSVLSYLLLEQSTKSSSKEMQKVISKD
                     DNSTNAHNMLDVAVLDGNIDMVSSLLNFGGNSNSTIHKGGKHYTLLGYAAEQGEREIV
                     SLLLDHGADIEKENKCGWRPVHLACYRGHARIAEILIEAGADVHVATVEWNEPHIRPQ
                     GIYQGTPWTGQPLHLAAMSGLAGIVQLLLEQGVDIHASTGVDSGSSYGPTALHLALDT
                     SHWYGNRCGDILDSGRLQIAQWLVGRGAMVQGVIPDSLHHIRKFREFPGLWDALVAGD
                     KNESSNISS"
     gene            <1321220..>1324537
                     /locus_tag="TRUGW13939_02917"
                     /db_xref="GeneID:55990424"
     mRNA            join(<1321220..1322168,1322349..>1324537)
                     /locus_tag="TRUGW13939_02917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486104.1"
                     /db_xref="GeneID:55990424"
     CDS             join(1321220..1322168,1322349..1324537)
                     /locus_tag="TRUGW13939_02917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341997.1"
                     /db_xref="GeneID:55990424"
                     /translation="MANLDRVHEDYQIGIICALAVEKAAIVAMLDETHPKRKDKGDEN
                     EYTLGRIGVHNVVVACLPAGMIGNVPAAIVAKNMQRSFPIKFGLMVGVGGGVWSKKHD
                     IRLGDVVVSEPTGTHGGVVQWDFGKLGMDGKFQRIGCLDKPPQALLQALQALKVSDIT
                     DGVNMEEPISQMIRKKPQMAKYYRHPGIEKDLLFKADYEHEGDETCDGCDAESIVQRP
                     DRNDLTPRIHYGNIASGNEMIKHGATRDKIAEDEGVICFEMEAAGLMDSFPCLVVRGI
                     CDYADSHKNKLWQPYAAATAAAFATVLLGFIYEQEVIKTPSPPKPLRLLPFGRNRGFV
                     GRQPQLKQLINILHDDDSGEDCQRVALVGLGGVGKTQIALECAFQIQEVLPGCSVFWV
                     RASDTTSFDNSYRDIAQQLKIPGLENDKADVKQLVKTRLCQDITGKWLMIVDGANDYK
                     IFYSGNDDNGFSALSKYLPSSPLGAILFTTRDRGAATKYACSNAINVEEMDDGESREL
                     LQRSLQNQQLIKDKDSVTTLLKYLVNLPLAIMQVAAYLNAKMCTIVEYLEVYEESNDN
                     IVKLLSKNFENIRRYPDMKNPVATTWLISFELIQVRDPLAADYMAFISCIREQDFPRD
                     LLPPASKYDKTEAFGTLKAFGFIKERLSGASYDMHQLVHIAMQNWLKLKNQWKSWNEK
                     TLNQITNVFPWPQHGNRDIWMTYLPHVQCVINMFEKTFGEMKDLPLSLLHNLGEASRI
                     IGKYAEAEAMNRRVLQYRETVLGKDHPDTFNSMNSLALSLRLQGKYAVAEEMHRRALQ
                     CREIFLGKGHPDTLKSMNDLALSIHLQGKYAVAEEIHQKALSLRVIRFGKDDPSTLES
                     MMNLAASLLKQGKYSEAEAIQRQTLQLKETLLGKEHPDTFGSMNDLAESLRGQGKNLE
                     AESMHQKTLRLREALFGKDHLYTLESMNNLALSLRGQGKNSEAEVMHRQAIELGSAAL
                     GNNHPSTLNSMNNLALSLYQQGKYAAAEGIQRRTLQLRKIVLGKDHPSTLTSMHNLAE
                     TLRKQGKDTEADAIH"
     gene            <1325029..>1325512
                     /locus_tag="TRUGW13939_02918"
                     /db_xref="GeneID:55990425"
     mRNA            join(<1325029..1325267,1325329..>1325512)
                     /locus_tag="TRUGW13939_02918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486105.1"
                     /db_xref="GeneID:55990425"
     CDS             join(1325029..1325267,1325329..1325512)
                     /locus_tag="TRUGW13939_02918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341998.1"
                     /db_xref="GeneID:55990425"
                     /translation="MADKSLKSTCHCGAVTVIVPRLPEEINECQCTICRRYAAAWGYY
                     KVNEVKFDLKEGAKLSQYVWGDKEKSFNFCESCGCVCYWWPFEEKTPDGGAAEFGLNT
                     RNMDPMEILHVDRKIERSWVFQPINNKDMAHEQDKAKY"
     gene            <1329782..>1330938
                     /locus_tag="TRUGW13939_02919"
                     /db_xref="GeneID:55990426"
     mRNA            join(<1329782..1329838,1329900..1330279,1330390..1330454,
                     1330532..>1330938)
                     /locus_tag="TRUGW13939_02919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486106.1"
                     /db_xref="GeneID:55990426"
     CDS             join(1329782..1329838,1329900..1330279,1330390..1330454,
                     1330532..1330938)
                     /locus_tag="TRUGW13939_02919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035341999.1"
                     /db_xref="GeneID:55990426"
                     /translation="MAKIALTDPELHGPSNCLKALIAIEVLYLTSLACIKISFLLFYR
                     RLFGGKTYNILCSIIMAIIIIWAIAGSFVGIFTCSPVHAFWTFSLLPTAKCINTQHYY
                     IGTWMPNLITDLMILCLPQLKVWKLQIDMRSKIAVGMVFLLGSFVMIASIIRFTTLFQ
                     VDLADITWTMSTLAIWTSVELLTAVASSCMPLMRPIYLKAVSAVLKQFGIRSTKLGGS
                     TGFSGDDRTALSGTGKAPTHRRRRPDFERLSDIEGSEEFTMEPIPQTTTVIENNRTMH
                     EYNGSDSKGVTVTRDWSTSSWKEGNE"
     gene            <1332289..>1333248
                     /locus_tag="TRUGW13939_02920"
                     /db_xref="GeneID:55990427"
     mRNA            <1332289..>1333248
                     /locus_tag="TRUGW13939_02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486107.1"
                     /db_xref="GeneID:55990427"
     CDS             1332289..1333248
                     /locus_tag="TRUGW13939_02920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342000.1"
                     /db_xref="GeneID:55990427"
                     /translation="MQFCGAVRYRLPLNIETAKDVLVEIEPADSAVYKNLLSNPDIQP
                     TVTDAVWLPSITHAESISKTPDSRVVLHFHGGAYVLNSPRDDSMQYGPKKLCEMQLAD
                     AVLCPTYRLSSGPRSSYPAQLQDAITAYDYLIKNRKNSPSQIILSGDSAGAHLAILLL
                     RHLMVNPELGLPLPRALLLYSPWLDLTPEGIRINDKNERDYLTEECLGWGATTFTPVG
                     VSPTEEFISPGLHSFKSPVPVWVQAGAAEVFYPAITRWVEEMRKAGSTIDLHDMKDMP
                     HNIFVVGGAFALDDEVSRAIKAAKMFLETINLNSAVEKSGCRL"
     gene            <1334218..>1342405
                     /locus_tag="TRUGW13939_02921"
                     /db_xref="GeneID:55990428"
     mRNA            join(<1334218..1334299,1334350..1335130,1335213..1335324,
                     1335374..1336178,1336260..1336403,1336476..1338721,
                     1338784..1339020,1339092..1339781,1339849..1340055,
                     1340124..1340201,1340265..1340339,1340395..1340747,
                     1340818..1340986,1341053..1341361,1341416..>1342405)
                     /locus_tag="TRUGW13939_02921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486108.1"
                     /db_xref="GeneID:55990428"
     CDS             join(1334218..1334299,1334350..1335130,1335213..1335324,
                     1335374..1336178,1336260..1336403,1336476..1338721,
                     1338784..1339020,1339092..1339781,1339849..1340055,
                     1340124..1340201,1340265..1340339,1340395..1340747,
                     1340818..1340986,1341053..1341361,1341416..1342405)
                     /locus_tag="TRUGW13939_02921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342001.1"
                     /db_xref="GeneID:55990428"
                     /translation="MGSLDTHAELATNGNHSNYEPIAIIGMGCRLPGGATSTSKLWDL
                     LLKGRSGYCQVPSSRFETSLFHHPDATNSVEENKTGGFFIQDDVRSFDNTFFGVNNME
                     ATYMDPQQRQLLEVCFECFESAGETLEMLSGEDVGCYVANCIIDFLVMQFKDPQQFHR
                     YSATGLGSNFLANRISHAYNLKGPSVVLDTACSSSLYALHSACSALHMGECKSAVVAG
                     ANFIQSPEFHLLMIKGGFISPTGTSHTFDTAADGYGRGEGVAALYIKRLSDAIRDGDH
                     IRSIIRSTALNSNGHTDGIAYPSVSGQEAVIRKAYAMAGLPTTETDYIETHGTGTTVG
                     DPVEVEALSRVFNHKTDSPISIGSVKPNLGHSEAASGLASIIKVTLALERNIIPPTIG
                     IKHINPNLKLVERNFQVPTEPTSWPPTVIQRASVNSIGFGGANAHAIIDSARPYTSLS
                     HNNSHPISPSRIGKYTLLTFSAHGKQSLMETVTSLGLIQLDRQAVLDLAFTLASHRSK
                     LADRGYLLIENGDADHDLRPENLQMLDPNNRHIRLPIAFVFTGQGAQWPNMGRELFTS
                     FPVYRRTIQCLDFHLKQLAHGPSWTIEESILEPASSSLMGKASRSQTVCTAIQIALVE
                     LLQDWNIVPEVVIGHSSGEICAAFAVGYLTAAEAIAIAYYRGMTVSKIEKEGSMAAVG
                     LGRTESEQEIASLGLQGQIRVACVNSPRSSTISGDASAINSFTESLQNKDIFARKLKT
                     DLKAYHSDHMQVVSQEYEDLVESVYSKRPTTAKSRCLNQKMFSTVTGGYPAAENLVDT
                     PGYWRINLESPVLFSDGLQKLMENSYHLIEIGPHSALQQPINEVHESMDEGKGPYVYS
                     PTIIRGKDAEQTMLRLCGQLYLHQQPVTLNKANRVCSMKDTHDGFTTRCKLIHDLPTY
                     NWNHKGILYHESRVSSGYRQQKHGNHELLGSLVPGISEQSSQWRAVLNTKDVPWLDDH
                     KLGSSTVFPGAGYLALATEALFQLQQSNRSGIQGVTFRQVHISNVLVLNEDTDVDLFT
                     DLRPAQISSVSNSEKWWSFEISSVADNVSTIHANGQIAIRLENCFPSPKFEGLSVESM
                     EEQATRTWYDRLTKEGLRFGLHFQSLSKIYNDGAKILSQTISETDLLPDGLRDQEPNY
                     LIHPITLDALLQTSIIASAGGSVSRLKAKVPVSIGSVDIIMPSATDYQGPCTIYADST
                     NVGFGVVNVNAELRSSSETVLVRINDIRMVAYGESNVETGLFDEKRHPVLRVLWKPHI
                     TTLKPGSSAQLTSYIDRFAKSLDENPLCKINSDLGQFAGTIDLLSHSNPRLRILELGT
                     GDIRYSALLLDLLRADSSLRHFRTYDKAELADDGRILGGKVQDISELEQWETQKSEIK
                     SDAAFDALIIPPMTPGLKISDILTERTMRLLTPEATIVFVSSGSDEHTADMAKFSVVS
                     TVPRESQGRHVAIARSIETVTRVHSQERQSVIIVERNNTHEINPILQNMLSEYFGQSI
                     DRIDFEDLYASIIPTGCIIISTIELEQSVFETPNEDDIERIKAITNNASIIVWLTGGA
                     LFKAKNPSFGLTSGFARTLKLEQPSTNMFLIDFDMEIESLDTCAANTISVIHQGIHAT
                     KPEFEFLQHDGVLYSCRFVPDESMNERFRRGQNADTVAIPLNEAGHCQLDIQRPGQLD
                     SLHFKQFISKDSQVAPGYVEVKVQAVGLNAKDMYALHRRVDTKESTCSLEFTGFVHRV
                     SSSESQFKPGDRVVVMAPSHFGIFECVPEWACCLLLDDEDFEICSTIPVVFGTAIYAL
                     QQSAQLRPGESVLVHSATGGLGIAAIQIAKLIGAEIFATVGTQEKRDFLIKNFGIEED
                     HIFSSRDSTFLPGILKTTGGHGVDVVLNCLTGDLLHDSWSVCAEFGRFVEVGKYDIVS
                     NGKLDMGIFARGTTFTAFDLSDMFWSKNEKHHNIWSSLLTKAMQYYRQGKIKAVNPLK
                     VFDVSEVTQAFRYFSLGSRIGKVVVSFSNQQSSLSVVPIKFKTILSPDKAYILIGCLG
                     GLGRSLSKWMFDRGARKFVFLGRSGADRGPARKLINELKVRGAETTVIRGDVSDAADV
                     NAAVAQIQDSIGGVVHAAMGLDLALINELTSRGWRAGIDGKVQGAWNLHNALSNRSND
                     LDFFLMTSSIAGSLGTATESNYCAANAFLDAFARYRRRNGLPATALGLGMISEVGYLH
                     EHPEIEALLLRKGVHPINEDELLQIVDIALSPDLVNTSARNSSDLPADYISEAQILTG
                     LEALGLQKILAMGWERPTQVLDDPHTAIIAGGYTTLIEMAKNSGGEGKNQNKSNGNTD
                     LLKPVSTALDVQISASTSKSDNDSNNNPQPSEGLIEAVQNVVSVKISALLLVPTEQLT
                     TDKQLSDFGMDSMLAAEFRGAMFRTFRSDVPFTTLLDHRTSIRSLACLVGGQLLKKAL
                     SKT"
     gene            complement(<1344337..>1344657)
                     /locus_tag="TRUGW13939_02922"
                     /db_xref="GeneID:55990429"
     mRNA            complement(<1344337..>1344657)
                     /locus_tag="TRUGW13939_02922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486109.1"
                     /db_xref="GeneID:55990429"
     CDS             complement(1344337..1344657)
                     /locus_tag="TRUGW13939_02922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342002.1"
                     /db_xref="GeneID:55990429"
                     /translation="MIVRLVSGSFLPDHNGVPVILFSFTGDTRGRMLKARMNEKSLVN
                     RESEFYDFSPRVGAHLILFVRYMTSRLQGTTQTLDRPEIRSSIATYIESYTIDHLEAS
                     GYIR"
     gene            complement(<1344938..>1350155)
                     /locus_tag="TRUGW13939_02923"
                     /db_xref="GeneID:55990430"
     mRNA            complement(join(<1344938..1347835,1347895..1348389,
                     1348450..1348545,1348593..>1350155))
                     /locus_tag="TRUGW13939_02923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486110.1"
                     /db_xref="GeneID:55990430"
     CDS             complement(join(1344938..1347835,1347895..1348389,
                     1348450..1348545,1348593..1350155))
                     /locus_tag="TRUGW13939_02923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342003.1"
                     /db_xref="GeneID:55990430"
                     /translation="MTTKQNSIISANSRTKLGNFRYIPRTEKTEMTSPKKSAIEVSDA
                     TSANADKENQKSWMNGVARPPKSPTKSQTSIPLKESKQSKECPKTPANRIPLADLISN
                     AEDAINLVPEKEMTPDDYISWQPAPPQSSGAASGTKGRGKKRRHSSSPTSSPGKSLKS
                     GKAKEPFDLKTFQALLKTPQSDIATDLWNNYVGKSKLEGALDIPAKFANLSSSPRTPT
                     ISEKTGRDSSALRRSTSCNADWPSSNAKRRRVDGYQGTRAARDIFSRSRSNVLDSGSS
                     RKMSFLLDKIQNSLANSKAFTKTAPPSSPPTQDDRREPSPSPSRSKPNGKFAAGQHIP
                     EVAMERNNSVDQPQTRPKDKISSSSSEFSDDEFDDDILALVESATDPFTDSSKPNDKM
                     SETPINRSSFNLQQSPCPVQNPNKERAATSKLQNQSDDEFDDDDDFGEGMEELLAQYD
                     DKGSRQNGTISSDTKEVKAQTSAISNVSRLGEITGVQSDTNISLDDEFDDDELDLDGI
                     DQDAVNVAEHQDQKPRAQQAIKRYLIIQIAQSQYVNQKGRVQSEQVLSVEDERTRFSN
                     VITLRDSWFDSPCTKNSYIHLIGDFDNNGHCIVDDSHNMIILHPDHLISATVVADAVT
                     CQRRAVLQDRIKATSDINRPQIFGHILHEVFQEAMKANQWDLSWIQTMVERVLVRYVE
                     SLYAIHMSMNEAVEYVMSKVPELQAWAEVFLRSSPSAESLVEDRHGSKANLSINKLLE
                     VEEHVWSPMYGLKGNVDATVQVVYNDDTDNNQKTLTIPLEVKTGKKDTSHSHRAQTAL
                     YTLLLSDRYGKPSHRAGNRTLFANFFLLLDIEITFGLLYYLEMRKMFRVRGIRHELLQ
                     MIQERNRLAGYVREKTELPPMIKRPHMCKQCYSKTACFVYHKLVDNGDGETSGVGDKF
                     EEVVGHLNPQHAEFFKKWDSLLTKEEKDMMKFRRELWTMLSKEREALGRCFGEVILEP
                     GYSYEDENAPKINRYQYTFVKAKPLPGFSFTESQITMGEPIVISDEKGHFALANGYVL
                     KISQKRITVAVDRRLHNARVKGKGFDPHANQSFRGIMELENNNPSSSSAVDDGEEQMI
                     YRLDKDEFSNGMATVRNNLVCMMEKDLFQAQQLRKLVVEGQAPSFKIPSSSFELSSSA
                     KSGLNVDQKRAIDKVMSAKDYALVLGMPGTGKTTTIAHIIRALVSQGKSVLLTSYTHT
                     AVDNILLKIRDDNIRILRLGATSKIHSEVQQFADLAAVPKNTIEELKESYEESTVVAT
                     TCLGVNHQIFNQRVFDYCIVDEASQITLPVCLGPIRMAKTFILVGDHYQLPPLVQNKE
                     AQQGGLDVSLFKLLSDANPSSVTNLEHQYRMCEDIMLLSNNLIYSGRLKCGNSQVASR
                     TLVIPNLKEGLKSHHVTSLSQMSSGRCLGPSHGRCWIKDLLDPSAKTRLVNTDTLSGL
                     APEIVAGSRMTNPSEVTLCAQLVDSLVSSGISPREIGVITFYRSQLSLLRHTLRRHSP
                     ELEMHTADKFQGRDKEIVILSCVRSNNDKQVGELLRDWRRVNVAFTRARTKLLVIGSK
                     STLRDGDELLRKYVALMEKQQWVYNLPKDALEDHVFESSDDQALSPTQRRTKPAAATS
                     PRSMDLTPSKNNPKRKRQSPTTTTTTSLSPSDGNRVKKAKLKTPEKRGSRGFNTDKIL
                     HARPILNDLVNEFLE"
     gene            <1350774..>1351251
                     /locus_tag="TRUGW13939_02924"
                     /db_xref="GeneID:55990431"
     mRNA            join(<1350774..1351033,1351167..>1351251)
                     /locus_tag="TRUGW13939_02924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486111.1"
                     /db_xref="GeneID:55990431"
     CDS             join(1350774..1351033,1351167..1351251)
                     /locus_tag="TRUGW13939_02924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342004.1"
                     /db_xref="GeneID:55990431"
                     /translation="MPSRNPSLLLRSRCLLRQPQALRSFSTRSELRAADHGSHYDPPG
                     GYLFGVKPGEKYKKEGWENIWYYGFIGSLVAAGVAYVFKPDTSIQTWALEEARRRLEI
                     EGILEDPEKAQK"
     gene            complement(<1351637..>1352589)
                     /locus_tag="TRUGW13939_02925"
                     /db_xref="GeneID:55990432"
     mRNA            complement(join(<1351637..1351993,1352048..1352126,
                     1352179..1352465,1352527..>1352589))
                     /locus_tag="TRUGW13939_02925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486112.1"
                     /db_xref="GeneID:55990432"
     CDS             complement(join(1351637..1351993,1352048..1352126,
                     1352179..1352465,1352527..1352589))
                     /locus_tag="TRUGW13939_02925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342005.1"
                     /db_xref="GeneID:55990432"
                     /translation="MAHNLAQCQVLVKKAVAAGAKALFLPEAADYIGSSGAETVSLAR
                     SVEQSEFVQGLRKEAKEARLPINVGIHEPAQGGSKVKNTLIWINENGDIAQRYQKIHL
                     FDVEIKDGPVLKESASVEKGMDILEPFETPVGRVGLAICFDLRFPEISLALKRQNAQL
                     ITYPSAFTVPTGRAHWEILLRARAVETQSYIIAAAQAGSHNDKRLSYGHSMIVNPWGE
                     IVAKLGGDFSEPEIATADIDLDIVARVRRDMPLLRRTDVYPEV"
     gene            <1353049..>1356191
                     /locus_tag="TRUGW13939_02926"
                     /db_xref="GeneID:55990433"
     mRNA            join(<1353049..1353244,1353307..>1356191)
                     /locus_tag="TRUGW13939_02926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486113.1"
                     /db_xref="GeneID:55990433"
     CDS             join(1353049..1353244,1353307..1356191)
                     /locus_tag="TRUGW13939_02926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342006.1"
                     /db_xref="GeneID:55990433"
                     /translation="MKSLRRDFSSNPHAQNVSSKVFIRSTKSGKVQKIVRELYLRQDI
                     PCSSKLCTTCPAHAPADANGNIVPFVLSDQPAGSKAFPKGHYIVPDTNALLNGMDLFE
                     HTGAFYDVIILQTVLEELKNLSLPLYNRLLSLIKSDEKRFYLFFNEFRLETHVRRDPN
                     ESINDRNDRAVRAVANWYGKHLQKSVKPGKSIPVIVVLTDDKENLRKAKEESVVALSL
                     SDYVSGLEDSDLLLDMINDSREEKGKKTELFYPEYYSMSKMMTGLRAGTMHQGVFNIS
                     PYNYLEGTVNVSAFDKSLLILGRDNSNRAVSGDVVVVEILPKDQWKSPSSKIIDEEAV
                     TKNDNPEDEENETVTTDREKKALQEEVKKAHGKNAEGKPQPTARVVGIVKRNWRQYVG
                     HVDASSTSLQTNSGRRQQTVFVLPMDKRVPKIRIRTRQAADILGQRILVTVDGWDRDS
                     RYPTGHFVRSLGELETKGAETEALLLEYDVQYRPFPKVVLDCLPTEGHNWKVPVSKED
                     PGWQSRRDLRDLLICSIDPPGCQDIDDALHARPLPNGNFEVGVHIADVSHFVKPNNAM
                     DLEASLRGTTVYLVDKRIDMLPMLLGTDLCSLKPYVERFAFSTIWEITPNAEIVSADF
                     TKSVIRSREAFSYEQAQIRIDDASKKDELTESMRTLLHLSKVLRQKRMDAGALNLASP
                     EIRIETESELNDPLTDVKTKAHLATNSLVEEFMLLANITVASKIYNAFPQTALLRRHA
                     APPPQNFEDLATQLQKKRDLRLDVSSSKALADSLDRCVDPQNPFFNTLIRILATRCMT
                     SAEYFTAGAHAEADFRHYGLASPIYTHFTSPIRRYADLIAHRQLAAAIGYTSAEGLSR
                     RRQLEDVCKNINYRHRNAQFAGRASIEYYVGQALKARGEMMAKNKGGDKNVGVDEEGY
                     IMRVFENGVVVFVPRFGIEGVVRLEDFMLPGDKERPDVHDNEQRRDIAHRRESEFDPE
                     ESTVRVWDKNHPEPERSLQAELFEKVQVNVSSVKEEGGRGAGKRKVRILILGKA"
     gene            <1356933..>1359394
                     /locus_tag="TRUGW13939_02927"
                     /db_xref="GeneID:55990434"
     mRNA            join(<1356933..1357014,1357088..1359021,1359080..>1359394)
                     /locus_tag="TRUGW13939_02927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486114.1"
                     /db_xref="GeneID:55990434"
     CDS             join(1356933..1357014,1357088..1359021,1359080..1359394)
                     /locus_tag="TRUGW13939_02927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342007.1"
                     /db_xref="GeneID:55990434"
                     /translation="MIHRHRVKDPSRKVSPPGPTYMSDDQVANYLKQLRSGPPSRPGG
                     SRPLPSRTSIRASPPKPREEPPPRAASALSMNKRDSFSAENLDQDPYPRAASAMSHSR
                     RSGQFGSAGRPLVRPPSGYGMDRNTSPEAKIVPQVNSISPSGLYRESGQRWMEKQEAR
                     SLRDALEEMDLQEEERLYAGAQDEATKLVWEHQNPGLAYKNPHAAYHNPDLSGTNRFR
                     QHLDKGSHARRQSTPAFTDASSRHRTSLSGSESSMETSSPDNYNEQSSKSSFKKKGRV
                     NFALPPDDSAPNPRDKPPSRPRTVSSESSKGIFRNPEDSIYEEPEEPNNGPETRGPPA
                     PAPSALKVKPRNSLPQGAGSAAPRFSNSPFDRKLNKVDIYRNPPTQSRNPLYTTNSST
                     PPSSGGSKEEEEKKEEPLPHKDGKEIRGDDIRAATSMKFKDRSGKLPMPTAVSDRPGQ
                     PIVSFDPSWKPQDEQPQRSRESSPAVPAINVSEAPAIPTISLPDDSNDNSPVVVTPPV
                     TEPSKERNNRTSKPVPNSAPEKDQRPVDPKRMAPTSQSKWYSPFTRSGVPTATCENCA
                     LPIEGRVVTAARSRFHPECFSCFHCGTGLECVAFYQEPEATRDERIANTSNDDPADQG
                     LRFYCHLDFHELFSPRCKSCKTPIEGEVVVACGAEWHVGHFFCAECGDPFNQETPFVE
                     KDGFAWCLRCHSRRTASRCLGCKQHVMDDVVVSAIGGQWHEKCFVCHECGGDFGPDGR
                     FFVKEGEPKRTAKGRIIGGPVQLAICEPCEARRLKA"
     gene            complement(<1359814..>1361040)
                     /locus_tag="TRUGW13939_02928"
                     /db_xref="GeneID:55990435"
     mRNA            complement(join(<1359814..1360574,1360644..1360831,
                     1360886..>1361040))
                     /locus_tag="TRUGW13939_02928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486115.1"
                     /db_xref="GeneID:55990435"
     CDS             complement(join(1359814..1360574,1360644..1360831,
                     1360886..1361040))
                     /locus_tag="TRUGW13939_02928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342008.1"
                     /db_xref="GeneID:55990435"
                     /translation="MGTARKKALHRDEYKKQRQEAQIAGKEVELPRKKFYRQRAHANP
                     FSDYALKYPLSPAHMDWASHYPGFVNPDASQTTLAGTRKLLKDVEVADIGCGFGGLLI
                     GLAPVLPDTLMVGMEIRAQVTEFLIARIAALRAQQVQLRSGGQVSASSTKATNPSEAK
                     ETQAQEIDIPEDAPALPGAAEENTAIVSGGYQNITAIRANTMKFLPRFFGHHQLSKIF
                     ICFPDPHFKARKHKARIVSSSLNAEYAFVLRPGGLLYTITDVEEYHRWILEHFGVPIP
                     EVETTAPAEPSEQSEKKDEEQDGADSDSDDESGQARVKELFERVSDEELAKDECARVM
                     REETEEGRKVARNNGPKFVAVFRRLPDPEWPTS"
     gene            <1361681..>1362569
                     /locus_tag="TRUGW13939_02929"
                     /db_xref="GeneID:55990436"
     mRNA            join(<1361681..1362256,1362326..1362401,1362457..>1362569)
                     /locus_tag="TRUGW13939_02929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486116.1"
                     /db_xref="GeneID:55990436"
     CDS             join(1361681..1362256,1362326..1362401,1362457..1362569)
                     /locus_tag="TRUGW13939_02929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342009.1"
                     /db_xref="GeneID:55990436"
                     /translation="MSSSSPPNSFLSAPTTAGSVLTPASTISSRDPSIRTAAATATGG
                     LPTDNDSTTTTHPRQKTPSGFVFPSDYDFPALFTLQPNALTRQRQMKLWADLIVDWCR
                     YHRTFRLSLVDAVDLPLFYNARMRKRVGMQDARTIIDWMAKSQEDGGGGKRAEWLPPT
                     PGGGSRSAVGEKTTAWIWWRRPEEWATLVADWIDETAQKNTVLTVYELIHGDATISQE
                     FHDIDPEVMLKSLNILVKRGKAQIFGSDDEKGVKFF"
     gene            complement(<1362745..>1365512)
                     /locus_tag="TRUGW13939_02930"
                     /db_xref="GeneID:55990437"
     mRNA            complement(join(<1362745..1363398,1363447..1364872,
                     1364928..1365364,1365423..>1365512))
                     /locus_tag="TRUGW13939_02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486117.1"
                     /db_xref="GeneID:55990437"
     CDS             complement(join(1362745..1363398,1363447..1364872,
                     1364928..1365364,1365423..1365512))
                     /locus_tag="TRUGW13939_02930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342010.1"
                     /db_xref="GeneID:55990437"
                     /translation="MTDQNGGHLLSQSKICVVCSPELGQDTAMQLDILVKDNGGEVVI
                     HEEPSPFPPIQEFTHIISSTADFPAYQSACDALIPVVKPQWLQTSITKNKLANPRQFN
                     PDPRLFFSDVVVTCGDIPDGDKDAIIGGVMAMGGLYSPRVTSQVTHLVDLSMDSDKAK
                     TVLAKKMGAKIVLPHWFDDCLKLGRRIDERPYTLPNPEILHAGPNAPIRGAGNPDIVG
                     ASTPEPTELPTPSSSPYQNRNSSRNLSVFEGKHVMLSSDLGIGSHLLESIEDLIRQGN
                     GIVTKDLTKADMFICRYREGFEYRTASRWNKDVGNLSWLYHLITHNTWTSPLKRLLHY
                     PIHRDGLPAFKGLRISLSNYAGEARAYLENLVQAIGAECTKTLKQDNSHLITAHGNSE
                     KCTAAKEWGLQVINHLWLEESYAKWKMLPVSDPRYTHFPRRTNLGEVVGQTKLDRNVL
                     EQVFFPAEANADESRVMQSKDQNIVANPENNKNMNPPKVRAKSAAQSPAPTTTTTQAA
                     TPHTGKSSRKVSSLGEAKTPLASRFLEDGKENDTPSTNSSRKSKDAAAARIHSIAPDI
                     ALYEKEKKRVGGVIYGGRRKTDADLVPPNTKKRRSAEPEEEDEIEDDKGDPKRQKKAK
                     LPPISIHLVITGYQRWIGSIKKEDSDKRQLRDLGIAIVQDAKKCTHLAAPSILRTPKF
                     VNALAYAPVIVNVDYITQCLEQNELLDPSNYALKDKTTEKKVGFTLAAARERAKKNQN
                     KLLRGYKVCCVETIRGGFDAFKSIVEANGGECTLFRGRVSINDTRRDDSSSDVEENNV
                     DHSMKNDVFLLSGEEPEHAKLWPRFRQMVFEVGKTPRIVNVNWLLDSAMSQEVRWKDD
                     YEYITNEEDSSD"
     gene            <1366230..>1367732
                     /locus_tag="TRUGW13939_02931"
                     /db_xref="GeneID:55990438"
     mRNA            join(<1366230..1366421,1366479..1366617,1366686..1366794,
                     1366850..>1367732)
                     /locus_tag="TRUGW13939_02931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486118.1"
                     /db_xref="GeneID:55990438"
     CDS             join(1366230..1366421,1366479..1366617,1366686..1366794,
                     1366850..1367732)
                     /locus_tag="TRUGW13939_02931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342011.1"
                     /db_xref="GeneID:55990438"
                     /translation="MSFPFRVVEHVVPGQYIREYPRATSTSQEETLHLAVKQYIPLDN
                     PNPKPGDVTIIAAHANGFPKELYEPLWEDLHARAKRQGFQIRSIWMADVAHQGQSGVM
                     NDNKLGNDPSWYDHSRDLLHLINLKRDEMPRPLVGIGHSMGGAQLIHLSLSLPRLFHS
                     LVLLDPVAQRETTQYPEKFEGRYVPLNTILSTHRRDTWASRKAALESFNRSPFYKAWN
                     PRVLERWVQYGLRELPTLTHPLPSTDQQKTSERPVTLKTTRHQEVFTFSRPNYDYDTT
                     TDKPASILDTPDLIPNERNPHPFYRVEPIQIFNNLPHLRPSVLYIFGGQSNMCLPHMM
                     EDKLNTTGIGAGGNGGVAAGRVQSVLFEDKGHLLAQEAVVECADAAAGFFGAELKRWK
                     VEEGAFKGQWDRKSKVEKVTVDERWLKEVGPPPSRPPRNTDGNSKSKL"
     gene            complement(<1368143..>1369282)
                     /locus_tag="TRUGW13939_02932"
                     /db_xref="GeneID:55990439"
     mRNA            complement(join(<1368143..1368299,1368355..1368879,
                     1368927..1369117,1369175..>1369282))
                     /locus_tag="TRUGW13939_02932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486119.1"
                     /db_xref="GeneID:55990439"
     CDS             complement(join(1368143..1368299,1368355..1368879,
                     1368927..1369117,1369175..1369282))
                     /locus_tag="TRUGW13939_02932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342012.1"
                     /db_xref="GeneID:55990439"
                     /translation="MATTKEHWPHFPFIPYPPSKAGYWSPVTSTLNWCEEDYYATPYS
                     AEIVNSLTNLLFLWLGIKGILNIRKHGHDSVFQVAFAGYLLVGLGSFLFHSTLKCNGI
                     DPMQLVDELSMIYTTCLMCYASFSYSRSTPTRVFLALALAGLAVFITLYYHYLQDPVF
                     HQNAYALLTTVVVLRSMYTMEVALRPKWRKSREEDRLAREKKGLPVLSKERQEYENQR
                     DIKTLKTMWFMVVFGLSMFLGGFGIWFLDNQFCGTIRQWRQTIGLPWGIFLEGHGWWH
                     LMTGFGAYLYLIWGIWLRHILNERQDEYMLSWPHVWSFPEIVRAPIKKNL"
     gene            <1370059..>1370538
                     /locus_tag="TRUGW13939_02933"
                     /db_xref="GeneID:55990440"
     mRNA            join(<1370059..1370088,1370148..1370314,1370373..>1370538)
                     /locus_tag="TRUGW13939_02933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486120.1"
                     /db_xref="GeneID:55990440"
     CDS             join(1370059..1370088,1370148..1370314,1370373..1370538)
                     /locus_tag="TRUGW13939_02933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342013.1"
                     /db_xref="GeneID:55990440"
                     /translation="MSIPPEALQKLVQEIESQAIASQQQIGVVKAQISTKQRDIRLLQ
                     LTSSELASLPKDTNVYEGVGKMFIHSPINTVDKRLSSETETLKNDITGLGKRLHYLET
                     THQKSKEHIEQIFKGSSA"
     gene            <1372327..>1373909
                     /locus_tag="TRUGW13939_02934"
                     /db_xref="GeneID:55990441"
     mRNA            join(<1372327..1373532,1373585..1373650,1373700..>1373909)
                     /locus_tag="TRUGW13939_02934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486121.1"
                     /db_xref="GeneID:55990441"
     CDS             join(1372327..1373532,1373585..1373650,1373700..1373909)
                     /locus_tag="TRUGW13939_02934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342014.1"
                     /db_xref="GeneID:55990441"
                     /translation="MPRRYILDDSESSSSEFSETDISLSSPHGRRRVKRQSFSRSRHR
                     VSPDSNAYLNPNLISTVRRSASTGGNRRRRGGDEPMVIIDVNNDVRNRQDSRDRHDRY
                     ERTDRHDRHDRHQRIVDFDDDDIEVLRPHRRNRASSNVSATRTPSPRQQQRDWEVLMD
                     QRILARNDIRQDLEITKQQQEIDRLERQLSRHQEKKRSEKSERRESHSRHRFEEIHYE
                     DDLAEKLRKLDRLEKVKRNEEEQRLAEVRAKVKRLEEMERKAEEEEEAKRIAHERHLK
                     EIEERENIKAEKDRLKKELQDEEARKALEESERKKELAILKAQAVDEWKRAEDSKRLK
                     EIKEKEQKDKEFKERLRAEFGYSEEQIEKLLNKEKKDEEKKDKKEKEKEKDKDGKLVI
                     LEPEKTTFIKVHRKWLLPQTLDAFRLPWGWDERDPNYIIIKQFITEEFQEELFSHSRR
                     IREGKLVTETSTTLTELKVNDHKKDKMYLVRKKNPSGKAWIFT"
     gene            complement(<1374209..>1375286)
                     /locus_tag="TRUGW13939_02935"
                     /db_xref="GeneID:55990442"
     mRNA            complement(join(<1374209..1375167,1375238..>1375286))
                     /locus_tag="TRUGW13939_02935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486122.1"
                     /db_xref="GeneID:55990442"
     CDS             complement(join(1374209..1375167,1375238..1375286))
                     /locus_tag="TRUGW13939_02935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342015.1"
                     /db_xref="GeneID:55990442"
                     /translation="MAHASPAVSPSNKVPASSKTTFHFLAGLASGLTSSILLQPADLL
                     KTRLQQSTRTASLSATLRSIISSPNPIRSLWRGTLPSALRTGFGSALYFTSLNALRQE
                     VARRGPAMALAGSSAANTINNNKNGYSSSALPKLSHTANLLTGAVARTAAGFIMMPVT
                     VLKVRYESDYYAYRSLGSAARDIFRTEGIRGLFAGFGATAVRDAPYAGIYVAFYEQFK
                     RNLSGFWAGSTSTNNNTNISSSTVNFTSGALAAGLATAVTNPFDAVKTRIQLRPEKYR
                     NMFHALKLIVKEDGGKGLFRGLGLRMGRKAISSALAWTVYEELIMRAEKRWSVQEGMS
                     L"
     gene            <1377860..>1378398
                     /locus_tag="TRUGW13939_02936"
                     /db_xref="GeneID:55990443"
     mRNA            join(<1377860..1377984,1378032..>1378398)
                     /locus_tag="TRUGW13939_02936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486123.1"
                     /db_xref="GeneID:55990443"
     CDS             join(1377860..1377984,1378032..1378398)
                     /locus_tag="TRUGW13939_02936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342016.1"
                     /db_xref="GeneID:55990443"
                     /translation="MKLSAALAGFSVLASILAFPAPYQNSTTLSVRILKLLLTGFARV
                     TATPSSAITTGSSVSSPSAVITGIPHVTTTPMVNVTVPPLIHPNGTSIISISPVVNGT
                     GHGNTTAHCDLKNPKTWGPPFGPGCKIPPGWVKNGRPDAPAHGWYRNHPRRFLPIGRI
                     MEV"
     gene            <1382038..>1382982
                     /locus_tag="TRUGW13939_02937"
                     /db_xref="GeneID:55990444"
     mRNA            join(<1382038..1382266,1382323..1382558,1382632..>1382982)
                     /locus_tag="TRUGW13939_02937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486124.1"
                     /db_xref="GeneID:55990444"
     CDS             join(1382038..1382266,1382323..1382558,1382632..1382982)
                     /locus_tag="TRUGW13939_02937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342017.1"
                     /db_xref="GeneID:55990444"
                     /translation="MPYQPLLQPEDDNGSDVEPAKEWCHFECQRCSKRRSSPVVKALY
                     MALLVSYTANLFFVYQRYIVPWELAGKLPSKFAHLKHDVPVEMTSHSNFDSLNRTIQD
                     QAWADPNLESWGLFLALNDDYSASMGLPYSQRWPWDSHKGTYIPIAAHELHCVHLLRS
                     VINENHDGLPRDNQTWPYSHALHCLNVLRDSVVCHADDTPMYTGRLHKNILEEQPKAG
                     VGMVKMCRNWSALVSWARERSACYKPIHWFEQGFDEIERYKFCPDKSTPWKPV"
     gene            complement(<1383847..>1384386)
                     /locus_tag="TRUGW13939_02938"
                     /db_xref="GeneID:55990445"
     mRNA            complement(join(<1383847..1383968,1384060..1384259,
                     1384322..>1384386))
                     /locus_tag="TRUGW13939_02938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486125.1"
                     /db_xref="GeneID:55990445"
     CDS             complement(join(1383847..1383968,1384060..1384259,
                     1384322..1384386))
                     /locus_tag="TRUGW13939_02938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342018.1"
                     /db_xref="GeneID:55990445"
                     /translation="MLSARERRLQDELLRTFACRSDFVLPASILNTIKNFSPELTLGF
                     YVLCGNMIFSRITLASFTLWSFLTAIASGHPMPSVSEANLAHYHACKAALADDSAPAK
                     PSADRTKDCEAILKYKQGAALMDFKV"
     gene            <1384795..>1385781
                     /locus_tag="TRUGW13939_02939"
                     /db_xref="GeneID:55990446"
     mRNA            join(<1384795..1385465,1385514..>1385781)
                     /locus_tag="TRUGW13939_02939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486126.1"
                     /db_xref="GeneID:55990446"
     CDS             join(1384795..1385465,1385514..1385781)
                     /locus_tag="TRUGW13939_02939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342019.1"
                     /db_xref="GeneID:55990446"
                     /translation="MDNIKEGTVPFSISQIGTTCQTYYKIVGNLSSKSPRLVILHGGP
                     GTGHEYLLSFSRLWLDFGIPIVFYDQIGCAASTHLPETAGDETFWQESLFLDELDNLL
                     DFLQLRDGPGYHVLGHSWGARLAAAFATTHPRGLRRLVLASGIASTATGTEGVRILCR
                     QLPSDVQMALNEEEQKGDFDSARFRNAMDVFYRNFFCRVDPFPPKELLPAFKHMSEDK
                     TVRGTVAGPSPLSCTGSFRNWTCIPRLHRIAVPTLLYNGEFDSSHDIAIVPFFEHIPC
                     VRWFTFPNAGHMCHLERPELAAKVFKLVGKFLMQES"
     gene            <1387361..>1388430
                     /locus_tag="TRUGW13939_02940"
                     /db_xref="GeneID:55990447"
     mRNA            join(<1387361..1387496,1387551..1387763,1387839..1388262,
                     1388316..>1388430)
                     /locus_tag="TRUGW13939_02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486127.1"
                     /db_xref="GeneID:55990447"
     CDS             join(1387361..1387496,1387551..1387763,1387839..1388262,
                     1388316..1388430)
                     /locus_tag="TRUGW13939_02940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342020.1"
                     /db_xref="GeneID:55990447"
                     /translation="MRNPLFSAVGRHLRGILLSFISLPLWFGNIRRSLGLLDPSPATT
                     HSALTSSIKPPKEAIRHRYLPISIDVSTSHGNIGPGRRIDNIYSGLGASIARMVKYIE
                     VELGGYSALISDHYRTETQAYYFLMLEAGLSVVVANLPSLWLFFTSILPEKVANSVHS
                     ISSLSSLELPWRSDRGSNSSANAAGHDASISINNRCLDVSSGLAQISHCHLVVEQSLH
                     DNPKGQAFEAIKLHNVAIGGSQEQMRSVAEGQIIVENTIRLALVSIYVLALRFSLFAT
                     SLDSIYGNHHHSWHTSQHD"
     gene            <1389509..>1391233
                     /locus_tag="TRUGW13939_02941"
                     /db_xref="GeneID:55990448"
     mRNA            <1389509..>1391233
                     /locus_tag="TRUGW13939_02941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486128.1"
                     /db_xref="GeneID:55990448"
     CDS             1389509..1391233
                     /locus_tag="TRUGW13939_02941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342021.1"
                     /db_xref="GeneID:55990448"
                     /translation="MQSLANSARSHPPGSLRLKPVESDKEIVFTAIVRPKPGGSRLPD
                     LANWQAIPIAERTFLSSAEYEESYGCSRDDVLSVSSFFEEQGMTVRSSHVGAGTVEVQ
                     ANAPQIQHLFSVRLHYYEGHFRPAARKRRDGNEAQEETYIGFEGALSLPVALHEKVVQ
                     IFGLDTRTFGASGGFSGDPPNSKRLMVAELAALYKFPAGVDAGDQTIAVFSGEGNDKN
                     GKSLSNYSPSDVEAYFNYQTIGYNSAPTVVPISLDVGPNTYTNDPSNPTQELSQDIMT
                     VATIAQGCTVNVYFSDLTEQGWLVFLTRVLFPRTGEKRPNIVSMSWTMYDEQTYRDSL
                     SFLFQRLAVVGTTVFGISGDWGANNNVIDGQPHVGWPGSDPWVTCVGGTVVGEVRSSG
                     HFTEHAWSDRDNANSQFTIDGHLGVTGGGMSRVFATPPYQLAAGIRAVTDSDSKRLSG
                     GRFIPDITGMVGFRGFIIDGKRNYFIGTSCSTPLYAGLFAALSSVLKVSFGPLNTILY
                     HLDGDLYRDVTFGHNDSGDTPDCSYFIASQGYDAVSGLGSIDGLKILEEFRKIYHSKS
                     RGFGRFPN"
     gene            complement(<1392453..>1393580)
                     /locus_tag="TRUGW13939_02942"
                     /db_xref="GeneID:55990449"
     mRNA            complement(<1392453..>1393580)
                     /locus_tag="TRUGW13939_02942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486129.1"
                     /db_xref="GeneID:55990449"
     CDS             complement(1392453..1393580)
                     /locus_tag="TRUGW13939_02942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342022.1"
                     /db_xref="GeneID:55990449"
                     /translation="MTQVGNIVAAARSGNEAEINRFLDQGTDVDSKHGGRTALYAAAK
                     ENKVDAVRLLLQRGAQTDFQTSEGWTPLHVAVFYKAKDAVQELLHHHAELEAKIFKGE
                     LTPLWKAAERGYTDIGKILLDHGANIDTKSEQDVTPFYKAALEGHLDFLTMLLDRGAQ
                     TDGHIKSGWTALHAAAYYCHKNVVEILLRRCPNLLEVMIPKTSNTPLLLAAEVGDVKI
                     CKMLLDSGANVEKQNCKGLTPLHWAAKGQGSVVQLLLKRGANVGAKTEDDRTPLHIAA
                     SEGHKGIVILLLQSDSNRRARTRNWKTALDLATEKGHEEIVKILSSKSIPSFMGFNDN
                     EVGGGGGGGGGGGGGGGGGGGGGGGAKVFISVTQTDGTFGI"
     gene            complement(<1396501..>1397340)
                     /locus_tag="TRUGW13939_02944"
                     /db_xref="GeneID:55990450"
     mRNA            complement(<1396501..>1397340)
                     /locus_tag="TRUGW13939_02944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486130.1"
                     /db_xref="GeneID:55990450"
     CDS             complement(1396501..1397340)
                     /locus_tag="TRUGW13939_02944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342023.1"
                     /db_xref="GeneID:55990450"
                     /translation="MKGDPEFVILKYSTWLDAVKFEDKILGSIVRHYLRPTNAYVPES
                     PLQYNGDELVEGSFTDFVVESCSSELRDTNASLQSVAGFTLRGSATDTVHLQGKFIRY
                     KRLQQHDRFWLQLSQDEAVRASVPAWMSTFNSRAKPVCLVVGIMICEDVDVSFAGKQS
                     IEREGNVELPLGMITLAAGVPNPLGNTGNPQAHLSDSSNKATIFKAKSGNSKIFALEL
                     RKVTTAFLRRRELRLKDDGPDVDNGRLLGNSDDEEEEEEEEEEDELVLEDISIEDFAE
                     MDV"
     gene            <1400908..>1402158
                     /locus_tag="TRUGW13939_02945"
                     /db_xref="GeneID:55990451"
     mRNA            join(<1400908..1401197,1401258..>1402158)
                     /locus_tag="TRUGW13939_02945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486131.1"
                     /db_xref="GeneID:55990451"
     CDS             join(1400908..1401197,1401258..1402158)
                     /locus_tag="TRUGW13939_02945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342024.1"
                     /db_xref="GeneID:55990451"
                     /translation="MESCSPSPVSKSPPDRRPARRTNISRTPASSESRQILRNTGAEN
                     ALQVLRRLQKHSTSTLHGDEEIKLHLSTDQYLQLLKALESDQALDNYTKCKARWDYDP
                     STSLIRFRMPTPVHEFFAVSVANEICEHLREIASNKNAAGEFAALIANGGSSRMILKD
                     GDTKLPVYPQREPDAQFQHPDALYPGVVMEISYAQKGSDLRKLAWDYIMHSNGNIKVV
                     IGIDINYGDTKESTLSLWRSSYIKEEGEELDILEISQDIKNQVTMSFHLHTERTANQS
                     QPFRAQDGSPVNIKESVRFKLSDFAPDQLSAGFQGIEICIKYEKLAEMLNRAEQMHQA
                     RELRPGIKSERQTRKRKLSSSAADEIKTDDEAKYSLAEKKAEASSTAYDVDFVPVPPR
                     KRKG"
     gene            complement(<1402794..>1403894)
                     /locus_tag="TRUGW13939_02946"
                     /db_xref="GeneID:55990452"
     mRNA            complement(join(<1402794..1403185,1403243..1403303,
                     1403354..1403474,1403559..1403798,1403848..>1403894))
                     /locus_tag="TRUGW13939_02946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486132.1"
                     /db_xref="GeneID:55990452"
     CDS             complement(join(1402794..1403185,1403243..1403303,
                     1403354..1403474,1403559..1403798,1403848..1403894))
                     /locus_tag="TRUGW13939_02946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342025.1"
                     /db_xref="GeneID:55990452"
                     /translation="MAPLVWLVTGCSSGFGEQFVYQILARGDKVIATGRNAATKLTHL
                     EGTGAAILDLDISLSADETALKVEQALQIYGGIDVLVNNAGYIESSPIEELVPERLLR
                     SYNTNIFGHYNVTRALLPHMREKRSGVIGFVGSQAGWMGDPSATAYVSSKFALEGIVE
                     CLQKEIAMFGIQVTIFEPGYFRTQALSQQNIQHEPGKIPAYEEFNKAVIQYEKAVYGN
                     EPGDPVKAVSRMIDVLTGTGTAAGKPFPPRMPLGTDGLKVMRDKCQDTLKMLDEWEDF
                     IVSTDFTKEG"
     gene            <1406769..>1407593
                     /locus_tag="TRUGW13939_02947"
                     /db_xref="GeneID:55990453"
     mRNA            <1406769..>1407593
                     /locus_tag="TRUGW13939_02947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486133.1"
                     /db_xref="GeneID:55990453"
     CDS             1406769..1407593
                     /locus_tag="TRUGW13939_02947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342026.1"
                     /db_xref="GeneID:55990453"
                     /translation="MKQSLLYLVAALGSLSWCEERAPFTQPLDLEASRYQASRILRIL
                     KRDDNCPADYSGCSDQGDSNVCCRSGTTCTVDAANNIACCPTGAACTGTLGATATGDS
                     NGGGGGGAQETSTTSGFMFPHSTTAGATTTSASLASITGSTIAGAAYPFIYIPTSFAN
                     AATCVSYYSFCQEEYTSCVASLGGQHGVTVAGGGGGGVTVAGNPALTTAPAAVSICSS
                     LSTRACYGLEEGYCSSFGSATASGGDFVTGSNAPQRRSSLSEIMLAAAAGALGMFL"
     gene            <1408688..>1409872
                     /locus_tag="TRUGW13939_02948"
                     /db_xref="GeneID:55990454"
     mRNA            join(<1408688..1409744,1409799..>1409872)
                     /locus_tag="TRUGW13939_02948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486134.1"
                     /db_xref="GeneID:55990454"
     CDS             join(1408688..1409744,1409799..1409872)
                     /locus_tag="TRUGW13939_02948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342027.1"
                     /db_xref="GeneID:55990454"
                     /translation="MRAFSTVTTLSFMLAALSQLAQSTPLPPDESLAQPAQPEESESE
                     SLEERSSCSNPCGYYQQLCCTSSQTCSTNSLGQAECVDGSGSASSSGSWQYYTTTFTQ
                     TDLATVTSVYSSYITAPPSTTATCAVSLGESTCGTSCCSAEETCDNGVCVMGSSTEDA
                     ATGTASPATRPTSSGAETITATASATTTVAFIAPVATNGSSVVTGASGGHSGLSGGAI
                     AGIVVGVIAGVFLLILLCICCCIRGAVDGLLALLGLKPRKRKDTTYVEEHVSHHSHGA
                     APPPRRTWFGTRPSRPENEEKKKSGLGMVAWIAIIVGAVALCLGLRRRHKEEEEKSEY
                     SYGPGSSYYYSDYTYPSEMQAQRTAERGNLDRIGGRHVGDKN"
     gene            <1410277..>1410871
                     /locus_tag="TRUGW13939_02949"
                     /db_xref="GeneID:55990455"
     mRNA            join(<1410277..1410441,1410500..1410614,1410684..>1410871)
                     /locus_tag="TRUGW13939_02949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486135.1"
                     /db_xref="GeneID:55990455"
     CDS             join(1410277..1410441,1410500..1410614,1410684..1410871)
                     /locus_tag="TRUGW13939_02949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342028.1"
                     /db_xref="GeneID:55990455"
                     /translation="MAATTEETPWHAAFPAPKITAASISRDDILQWLQGQEHVAGRDF
                     VLVDVRRTDFEGGTIKGSLNFPAHSFYLTVPTVYAVLSAAGIKDVVFYCGSSRGRGPR
                     TAGWFADYLESQGNTSIRALVLKGGIKGWVAAGDEYTALVSGYEASVWKSEQS"
     gene            complement(<1411967..>1412974)
                     /locus_tag="TRUGW13939_02950"
                     /db_xref="GeneID:55990456"
     mRNA            complement(<1411967..>1412974)
                     /locus_tag="TRUGW13939_02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486136.1"
                     /db_xref="GeneID:55990456"
     CDS             complement(1411967..1412974)
                     /locus_tag="TRUGW13939_02950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342029.1"
                     /db_xref="GeneID:55990456"
                     /translation="MPCRPAIASMSLGRAWVHEMPEKMKQAAEAGFQGIEIFYEDLEY
                     LAKKYGDNTKDENILAAAKEVRELCDGLGLDIFGLQPFLFYEGLVDRQEHERKIVKLK
                     LWFRIAKVLGTNTIQIPTNFQQEGTSGDIDLITRDLIEVADLGIKEDPPVRFAYENIA
                     WGTHIDTWEGMWDIVQRVNRPNFGCCLDTFNIAGRVWADPASPTGKTANAENDFQASM
                     ERLRNTIDISKVYYIQVVDAERMDQPLVEGHPFHVDGQPPRMSWSRNARLFAYETDRS
                     AYLPSVEVAKVLLNDLKFEGWVSMELFSRTLADPEPTGPREHAQRGIASWKRLQSDLG
                     L"
     gene            <1413281..>1413730
                     /locus_tag="TRUGW13939_02951"
                     /db_xref="GeneID:55990457"
     mRNA            <1413281..>1413730
                     /locus_tag="TRUGW13939_02951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486137.1"
                     /db_xref="GeneID:55990457"
     CDS             1413281..1413730
                     /locus_tag="TRUGW13939_02951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342030.1"
                     /db_xref="GeneID:55990457"
                     /translation="MPSILLINGPNLNLLGTREPHIYGTTTLQDVENTCRKISAQHNV
                     TTETFQSNHEGEIVDRIQQARGNKIDFIIINPAAYTHTSVAIRDALAAVSIPFIEVHI
                     ANVYARESFRHHSYLSDKAAGCVIGLGTFGYEAAVQSAILQLKRGSN"
     gene            complement(<1413819..>1416099)
                     /locus_tag="TRUGW13939_02952"
                     /db_xref="GeneID:55990458"
     mRNA            complement(join(<1413819..1414025,1414084..>1416099))
                     /locus_tag="TRUGW13939_02952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486138.1"
                     /db_xref="GeneID:55990458"
     CDS             complement(join(1413819..1414025,1414084..1416099))
                     /locus_tag="TRUGW13939_02952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342031.1"
                     /db_xref="GeneID:55990458"
                     /translation="MAVRVFETASRAYASNTSLVLVGFFGSGKTTIGIIASMKLNAKL
                     IEFDTFFTNKVGSTPQSYLASVGSVKYREVEFQVTNDLLSAHKNGCVIVGIGAMGSRQ
                     QKALLQEFSQTHPVVYVRRDRTELQKFLGCTDEKLHQTFTAGNDFYESCSNFEFYNLT
                     QRTTSLDAASTSHLRLKEVEKSFQRFLHHLYGMEQTRPYSPDPFTPEYTYALQVPLSW
                     FEDSHRDYKELETGADAINLIIDLGSNPTAESLSMQIATIRTNSRVPVIFDVDKNAQL
                     DQESHFKLVKIGLRLAPDILTVPLVWSDELVNKVASQKGSTKFIATYHHRCDWRHSEL
                     SAPCERAASLGFDSIRITSDCKAPACNIHCTSFAMQAIENYDIPTSAYIMGRAGSTSV
                     CFNPILSPVCLPSRRDNGVSLREAQKALYASFIRSRSKFTLFGKDLWHSPSPAIHNAA
                     YETFGMPHTFHKLESNNFEEIWSLLNDDAHGGVAVSLPYKTTVLALLDDISPAARDIQ
                     AVNTILLDRSATTENEKSKPIMRGYNTDHIGIRDCIYRNLSPANTIRDGSTALIIGAG
                     GMARAAIYACHKLGLRNICIYNRTLDNANKLAEYYNEWEKERFSNSHKSLRVQVLSSL
                     DCPWPEGLRQPTIVISCIPVYQIGNQPSPSLQVPDHWLQSSTGGVCIDLGYQREETNL
                     LKLMREKAFEGWTLVNGLDVLIEQAIAQFELFAKRPAPVHIMRTAIRPFFKTHSETSS
                     "
     gene            <1416407..>1418404
                     /locus_tag="TRUGW13939_02953"
                     /db_xref="GeneID:55990459"
     mRNA            <1416407..>1418404
                     /locus_tag="TRUGW13939_02953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486139.1"
                     /db_xref="GeneID:55990459"
     CDS             1416407..1418404
                     /locus_tag="TRUGW13939_02953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342032.1"
                     /db_xref="GeneID:55990459"
                     /translation="MSDDVPPAKRQRVGRACDPCRKRKSKCDGNRPCCLMCQSAGRIC
                     LYDDAIRRRGLQSGYVRGLEALLGLMLQRLPKTETQLEKLLRKQDIKDQLAQNKNAEK
                     SARVWYRSAISKKINALLEPCQTEGEPGSPMSEDESPALDSLQIEEGDDHHDEINLGA
                     ESSVHIQHNGAMTCSTTESVEKNTPRLDDASWDIFQQPFPSNTVELVEEYFTYTHSWF
                     PILERRRIMRAMHNHDPPLERNRRLIDIGYQMTLWAIAAYTSIGQSPRSQASGILDSR
                     RIEACIRARAALDSQIFTLGHIQAILILVLLHLKLTHLRTAWILISQATRMVVMIDNN
                     QRTERYTHVFHGCVILDNFISALLGTSPCLSAHEQTSHGLIEDHDEGLEEWDLWNPSS
                     HDPLFPRHIVPGSPLRALSTFNLSFQLMCRVSNIYGGTCNEQHLQLTFEELQTWRSQL
                     PSHCQWTGSLDSMKPPLLTLHLSWNFIMATALSRMTSPSPSLEGLCEKIVISTLDMSQ
                     KFIELTGINRAPPLIIGCVIQARRLLSHVASANCESTSTLDQHLSEVLENFRRQWEAN
                     EAHETEYQEFIIPQIDLRDIHGQNPMLHDSTDSSLIATITNYFNTDGEPFNAATEPSE
                     KSHVFSDPTVPATTSSHTDQAMENGFDDLCEQMAASIPAAR"
     gene            complement(<1418619..>1419542)
                     /locus_tag="TRUGW13939_02954"
                     /db_xref="GeneID:55990460"
     mRNA            complement(<1418619..>1419542)
                     /locus_tag="TRUGW13939_02954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486140.1"
                     /db_xref="GeneID:55990460"
     CDS             complement(1418619..1419542)
                     /locus_tag="TRUGW13939_02954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342033.1"
                     /db_xref="GeneID:55990460"
                     /translation="MTGTSATTNAADLRAFSYLVGIGVTHSIAPPMHNFISKSLGYDW
                     NFIAQECATVEDAVKLFRLPTFAGGVVTMPYKQTIMEHLDGLDEYSIKIGACNNVYRA
                     ADGSLRGTNTDWRGIKGCLTGASDNGREKPAFIIGAGGASRAAVYALHDQLGCNPVYI
                     VNRDRAEVEALLHDTESYGPGLSVVHLQSLKEAQQVPQNPFYIVGTVPDFEPKSPEEL
                     TARDILDFFLQFSTKGVLLDMCFKPRRTRILKLGEKRGWHTVEGTMIIAHQIDEQYRL
                     WCGEEKAEDIPRQEAWKVLQKAAEDSLSINF"
     gene            complement(<1420071..>1420851)
                     /locus_tag="TRUGW13939_02955"
                     /db_xref="GeneID:55990461"
     mRNA            complement(join(<1420071..1420650,1420724..>1420851))
                     /locus_tag="TRUGW13939_02955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486141.1"
                     /db_xref="GeneID:55990461"
     CDS             complement(join(1420071..1420650,1420724..1420851))
                     /locus_tag="TRUGW13939_02955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342034.1"
                     /db_xref="GeneID:55990461"
                     /translation="MLDLHSLPAGSRPEHAVRNNGPDNLALERYKLRELAEGWPMYRD
                     ACEWENLKSIFHPDAYVYTTWTGKTHHLDFFEASKAGMDKGAFIMHRIHGSSTDITPD
                     AKRAVTKMKATITQRFTIDEAEVDAESDCRFIFFWEKDTASGNWGARFVRHWYEKDKL
                     IPVNPTKVPHLDENKLKEYPSGYRYLAYCQEATMGVKVLRDLPGHRRENDNVNGKKHD
                     LLYWQAKQWLDGESIDI"
     gene            <1421223..>1422893
                     /locus_tag="TRUGW13939_02956"
                     /db_xref="GeneID:55990462"
     mRNA            join(<1421223..1421742,1421800..>1422893)
                     /locus_tag="TRUGW13939_02956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486142.1"
                     /db_xref="GeneID:55990462"
     CDS             join(1421223..1421742,1421800..1422893)
                     /locus_tag="TRUGW13939_02956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342035.1"
                     /db_xref="GeneID:55990462"
                     /translation="MAVNGLPSPDVLSANYAAGRQSCVICLAHQDLTELGTTILKRAS
                     YGAAVSELRVDQLKTHGGGIASAEYVSSQIRYLRETTGLPILFTIRTVSQGGKFPDNS
                     ADDALHLMLVAVKEACEYIDVELTWPKAVISGIVSQKGNSKIIASYHNWTKGISWSGS
                     LLKDSYEGANRFGDIIKLSITSTYLSDNHELALFIRDHQKQSTKPLIAVGMGAHGQLS
                     RVLSPISMATHPLLPTATAPGQMSVARINEVLHLIGRIPKKKMFIIGHNISHSLSPTI
                     HNAGFAELGLPHHYSIHQAPQIDESVEKILKDPDFGGASVTYPHKLNIQPFLDSISEN
                     AVSMGAVNTVVVGQSADKPDQRILIGENTDWVGIRNCIKGSPVTLDSSSTPLVIGAGG
                     AARAALYALQRLGISNVTVVNRSKERAEGLASSFTTLNISILTSLQQVDAPVSCIVAC
                     IPADDITEDDIPSKLFVSGKPGILVEMAYRPNVTALMKAVRRLGSWSVSNGVEVLREQ
                     AYAQFELWTGYRAPVLAIEEALISAASYL"
     gene            <1423316..>1424670
                     /locus_tag="TRUGW13939_02957"
                     /db_xref="GeneID:55990463"
     mRNA            join(<1423316..1423781,1423844..1423999,1424060..1424435,
                     1424490..>1424670)
                     /locus_tag="TRUGW13939_02957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486143.1"
                     /db_xref="GeneID:55990463"
     CDS             join(1423316..1423781,1423844..1423999,1424060..1424435,
                     1424490..1424670)
                     /locus_tag="TRUGW13939_02957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342036.1"
                     /db_xref="GeneID:55990463"
                     /translation="MLQAQTQHVFSHQHQYPQAEPSWLHQQQQQQQQQQQHHQAQHQH
                     QHTSIAQQHAQAHAAAAAAVAHQQHYNRIVMAGNNSVAVAAAGNQGQSSANPAGADAA
                     GAGLEGVHTEDNRKIFLWVTELLDPNRRETALMELSKKREQVPELALVIWHSFGVMTA
                     LLQEIISVYPLLNPSQLTAAASNRVCNALALLQCVASHNETRTLFLNAHIPLFLYPFL
                     NTTSKSRPFEYLRLTSLGVIGALVKNDSSDVINFLLTTEIIPLCLRIMETGSELSKTV
                     AIFIVQKILLDDTGLNYICATYERFYAVGTVLSNMVTQLVEQQTVRLLKHVVRCFLRL
                     SDNNRAREALRQCLPEPLRDATFSSVLRDDAATKRCLAQLLINLSDNVDAGSTAGAGM
                     "
     gene            complement(<1425985..>1427505)
                     /locus_tag="TRUGW13939_02958"
                     /db_xref="GeneID:55990464"
     mRNA            complement(<1425985..>1427505)
                     /locus_tag="TRUGW13939_02958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486144.1"
                     /db_xref="GeneID:55990464"
     CDS             complement(1425985..1427505)
                     /locus_tag="TRUGW13939_02958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342037.1"
                     /db_xref="GeneID:55990464"
                     /translation="MSSKSALKRVSALALVGAGSLARAGPCDIYASGGTPCVAAHSTT
                     RALYDDYTGALYQVLRGSDSSTTDISPLSSGVADADSQDSFCKGTTCLISIIYDQSGS
                     GNHLTQAPPGGAASGPEANGYDYLASAIGAPVTLNGQKAYGVFSSPFTGYRNNDVNGT
                     ATGDDPEGMYAVFDGTHYNTGCCFDYGNAETNSRDTGNGHMEAIYFGTGDGSGHGTGS
                     GNGPWIMADLENGLFSGYDHINNDADPTITSRFVTAIVKGEPNQWAIRGGDATTGDLS
                     TYYSGVRPDGGYSPMIKEGAIILGIGGDNSDSAQGTFYEGVMTTGYPSDDTESKVQAN
                     IVAAGYATTSLTSGPELTVGDTITLRVTTSCCSTRYIAHTDDVVNTQVVTSSSDDTLQ
                     KQASWTVQTGLGNDACFSFESVDTPGSFIRHSNYELHVNANDNSKGFSEDATFCPQSG
                     LNGQGNSFRSWSYPTRYWRHFNAIGYIASNSGPHSFDAAASFNDDVSFVVGSGFDS"
     gene            <1429288..>1430557
                     /locus_tag="TRUGW13939_02959"
                     /db_xref="GeneID:55990465"
     mRNA            join(<1429288..1429621,1429680..1429790,1429842..1429933,
                     1429997..>1430557)
                     /locus_tag="TRUGW13939_02959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486145.1"
                     /db_xref="GeneID:55990465"
     CDS             join(1429288..1429621,1429680..1429790,1429842..1429933,
                     1429997..1430557)
                     /locus_tag="TRUGW13939_02959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342038.1"
                     /db_xref="GeneID:55990465"
                     /translation="MASLAKLRFFFSLFFYVLPIAGFRILGAIVRAWMKKLPLGPSIW
                     NAFAGTLMANTPPKQLQAILPSTLDVYNAWTLSQGNKSKVDVLAADGSTRLLWIGPEK
                     GNKVILFLHVGGYVMPLSRGHLDWMEHVRNEAYTSRIELSVCFLAYDLIPANPYPRQM
                     VQAIFALRHLLSMGYKPSEIIIGGDSAGGHLSLSLIAHLHRHRTFRETTNSAIDLDGR
                     IRGCFLVSPLSSFNFDTPSYKRWLSSDVLSRKVVGEWGDHLVRNSPWYEEISVGKGWG
                     MALDVPESWWENIDVVDRVFVTGGYEEVFCDHVQQLAKMLRRNVAKGDVELYMANEAH
                     DGPFMDFAAGRPPSETTRTITQFVITSFKDE"
     gene            <1430972..>1432070
                     /locus_tag="TRUGW13939_02960"
                     /db_xref="GeneID:55990466"
     mRNA            join(<1430972..1431086,1431136..>1432070)
                     /locus_tag="TRUGW13939_02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486146.1"
                     /db_xref="GeneID:55990466"
     CDS             join(1430972..1431086,1431136..1432070)
                     /locus_tag="TRUGW13939_02960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342039.1"
                     /db_xref="GeneID:55990466"
                     /translation="MTDNTFDWLAEKAIGWIHTPPVNKIDTHHHIVPPFYAKAIEEQG
                     GDPSGWPTPHWSSLGSKLLMKRVGVKTAVVSITAPGACILPDRHARAQLARQLNVYSA
                     ELRDKDPQSFGFFVSLPDILDTEDSLAEITYGLDTLGADGVTLFTRYGNSNTYLGHPA
                     IEPIWIELNRRHAVVFIHPTHPVDTNPVNPKLPQPAIDYPHETTRTAMDMITNETRLK
                     YPDCKVILSHAGGALPYLISRVTTPMRKAPNFTVSHRIGTTHAKALKAFRSFHFDLAL
                     SSSPHVLDMLLKTVPSDHILYGSDFPYAPITAHPAFLEDLEEYEMDQELRDKINFGNA
                     RKLFPRLASRGDGSL"
     gene            complement(<1432730..>1433881)
                     /locus_tag="TRUGW13939_02961"
                     /db_xref="GeneID:55990467"
     mRNA            complement(join(<1432730..1432966,1433028..1433266,
                     1433330..1433434,1433500..>1433881))
                     /locus_tag="TRUGW13939_02961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486147.1"
                     /db_xref="GeneID:55990467"
     CDS             complement(join(1432730..1432966,1433028..1433266,
                     1433330..1433434,1433500..1433881))
                     /locus_tag="TRUGW13939_02961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342040.1"
                     /db_xref="GeneID:55990467"
                     /translation="MTTKRGFLPREGLYIDPIVASLRKILHPLFTLSLLYFVQGGEFN
                     STATFYQKLVQYIAATSTLLWVNNYLSVKSRNNWTIDNAWDWKKELVVVTGGSGGIGA
                     GVAQRLAAMGARVVAVDIIPLTYKPVDGRISYFRCDLSDEKEIAALCDTIKSEFGHPT
                     VLINNAGLSRGRTVVEGTYSDNSVTLKTNLLAPFFLTKEFLPAMIRQNHGHIFNVSSM
                     SAYIPPPGLADYAASKAGLIAFHECLCQEIRLQNAPKIRTSLIVLSFTKTPLFKGETN
                     QSRFLMPLLHVDTVVDAIVDTLDSGLSETIFLPGIFGYLAGLVS"
     gene            <1434381..>1435255
                     /locus_tag="TRUGW13939_02962"
                     /db_xref="GeneID:55990468"
     mRNA            join(<1434381..1434434,1434554..1434595,1434648..1435067,
                     1435148..>1435255)
                     /locus_tag="TRUGW13939_02962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486148.1"
                     /db_xref="GeneID:55990468"
     CDS             join(1434381..1434434,1434554..1434595,1434648..1435067,
                     1435148..1435255)
                     /locus_tag="TRUGW13939_02962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342041.1"
                     /db_xref="GeneID:55990468"
                     /translation="MTSPGGAGVLNLGGNWVMDKAKSTGLDAVLTLQGIGWLTRKAVT
                     ASTVNLKITQGSHADTDGVESTEWITLEQVLTGGLRGAPEVRSLSWADFKHDDTLFGP
                     VIVRSHYVPGAKKPDGRIYPVLEVQTQVDRFNIESWLTAAVITDQKTDNLEKAFMHDY
                     ICSVSTGWTAEQVWALETTEEGTLLTRKVAVVKGFSTETAHVFYKRQ"
     gene            complement(<1435682..>1437529)
                     /locus_tag="TRUGW13939_02963"
                     /db_xref="GeneID:55990469"
     mRNA            complement(join(<1435682..1435795,1435867..1436014,
                     1436069..1436409,1436482..1436816,1436902..1437303,
                     1437355..>1437529))
                     /locus_tag="TRUGW13939_02963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486149.1"
                     /db_xref="GeneID:55990469"
     CDS             complement(join(1435682..1435795,1435867..1436014,
                     1436069..1436409,1436482..1436816,1436902..1437303,
                     1437355..1437529))
                     /locus_tag="TRUGW13939_02963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342042.1"
                     /db_xref="GeneID:55990469"
                     /translation="MASKTSEIPSFSQIACVGAGLSAVALGATLKRWYGLDDIHFFER
                     HPTSGGTWYINSYPGCGCDVPSALYSFSFALNPSWTKLMPSNEEIKKYVDDVVNTYNL
                     RPKMTFATEVIRSVWREDASRWQLFLRDLKTGREYTHECQILFAATGQLVEPRPCEIP
                     GAPDFHGNIFHSARWDKTVNLEGKNVVVIGNGCTAAQIVPALINDGKVKSLTQIVRTK
                     HWIFPAANFNYGRILQWIFRNIPLAMRLHRFHIFLIAENDFRLFPMTKHAAKLREKRR
                     RQVEKYMREAAPEKYHDLLIPEFDVGCKRRIFDPGYLESLHSDKILLTDAKTQRIVSK
                     GIETDKGFFPADVIVLATGFQTNRFIPYMDVVGRNGEDVTQHWAKYDGPAAYNCSALN
                     GFPNFFMLLGPNAATGHTSAMMAAENSVNYALRVLKPVLDGDVASVEVTAEAESNYAY
                     WVQYALNKRVWNAGCVSWYLNDKKWNSMSYPWTQGHYWWRSLFPIWSDWNIKVS"
     gene            <1438611..>1440834
                     /locus_tag="TRUGW13939_02964"
                     /db_xref="GeneID:55990470"
     mRNA            join(<1438611..1439524,1439582..1439986,1440037..1440046,
                     1440117..1440327,1440398..>1440834)
                     /locus_tag="TRUGW13939_02964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486150.1"
                     /db_xref="GeneID:55990470"
     CDS             join(1438611..1439524,1439582..1439986,1440037..1440046,
                     1440117..1440327,1440398..1440834)
                     /locus_tag="TRUGW13939_02964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342043.1"
                     /db_xref="GeneID:55990470"
                     /translation="MGSTSFEVGETPNHGRLERPQQGKTSTERPAGEQRDSTNLHESP
                     LFNDNEGHITGMGQLSVPDGEPKSRSTRVQFYGGSSTASLMRLARESMPLQLADSSHA
                     EPAFNTKLQDTFTDHRLDEFVMPPRALADHLLNCFFEKVYILYPFFHRPSFEAAYRNI
                     WCAEDEPKAPITDLRIGLGSKADSGSKSIVFHCALNMIFALGCHFADIAPDEREPVAH
                     SFFLRAKRFIGLDILELNTLGVVQTLLISALYLQSSPYPSRCWNSVGVACRVALGLGL
                     HGSDILASLKPLESDIRRRTWYGCVMLDITLSMTYGIPSMTTHLAPVPPPSDSDTSHD
                     QGDNEGPCLMAFYIQAIKLYDILDRILADVYKAWRGRSRQGQQSSKSPWTTSLEGLDT
                     VLDIERQLNWFETNVPSFLKWNSAPSATYTERQSNLAITQQRNVLHARLAQRESGSTD
                     RGRDGNEWQANWTSDKIPTQSILYSSMSSKCATACVMSAIDLTHLVHETYQTNVADAW
                     WYNGFYVSTAAIVLLMSFSAPSILDSIAINKARNAWREATTILAYMATFSRSASNTLQ
                     FLEAACRQTVAAVPSDSHSHSQQPGAELAGDASSQIPNNILQSYDTYDHPDNSDLTQA
                     PFFNWEEVAENLGPSLDDLGFLTRVDFPNSFGLD"
     gene            complement(<1441284..>1442042)
                     /locus_tag="TRUGW13939_02965"
                     /db_xref="GeneID:55990471"
     mRNA            complement(<1441284..>1442042)
                     /locus_tag="TRUGW13939_02965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486151.1"
                     /db_xref="GeneID:55990471"
     CDS             complement(1441284..1442042)
                     /locus_tag="TRUGW13939_02965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342044.1"
                     /db_xref="GeneID:55990471"
                     /translation="MGVHTQLEGAWAHISTTYKPGMIEFMGSVFGQVIGFIVPATVYL
                     MIDTLFPKFSQRHKIQGARRQPKPQQIRHCVVICLSNHAWLATLHFLSHYMTDFNHSY
                     LEMAPTLPSLTTFVADFLFGLLAREVLFYYVHRALHHPRIYVYIHKMHHKYITPVAFA
                     AEYAHPVEHLFANVLPITLPLYLKGTHFLSFLAFSIFELWEAAADHSGYDFLKLPPAE
                     LHDLHHEKFRVNYGTIGLMDWIHGTNVVGWDRRG"
     gene            <1443549..>1446352
                     /locus_tag="TRUGW13939_02966"
                     /db_xref="GeneID:55990472"
     mRNA            join(<1443549..1443719,1443844..1443941,1444010..1444229,
                     1444279..1445118,1445180..>1446352)
                     /locus_tag="TRUGW13939_02966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486152.1"
                     /db_xref="GeneID:55990472"
     CDS             join(1443549..1443719,1443844..1443941,1444010..1444229,
                     1444279..1445118,1445180..1446352)
                     /locus_tag="TRUGW13939_02966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342045.1"
                     /db_xref="GeneID:55990472"
                     /translation="MVSRKRAHSEMEAEPVKKAEDQSLLQKIRNCWEFSSLMQYIFIF
                     GKVMKIDEDFGIEDLEMECLKPEASDKLMDIGLSLLKFVSSHRGLSFENFDEYTRRQY
                     NAKAPHLVNPFGYDEEPNKFRDFDVFLKLQVLHRLSQWTLWNPDRIREKMPEQKETEQ
                     TQWRVEEFGWDSDDRSYYVLDDNRLYRRSDPPIPAAAPARPKANSKKAKAAARSSKRR
                     RVSTRSEADNEEETENGQDASEDPSGGFKWECIAVSLPEYQEFIESFRKTRDPNEKSL
                     RDRLIEGVLPILEKAQEAEERKRQKRDKELFNLQLIAGAKRSSRLQEKHDKERRDKEA
                     EEAVRKHELELAAARKDQENQRKMEDERQNRIMTRERRIKDRETKRILQEEEMNRLEE
                     EQKKLESGEGRVSERHLKAEMDKRKKELEELAEEDQWIFDCAGCGVHGENIDDGSHSV
                     ACDRCNVWQHSKCLGISQEEAEKDDFHLVCNDCKRREEEAKRPKIPPLKFRIGSASPA
                     TAKAPAKKEEQSPLVPKTSQPLSTAATNIPQPALLPHRAQSNGAHPPSPERRSQPSSN
                     GQHLSFDTFAAPASPSKVPTASPSKASIGPASSPLGLPPQPAFNQHYPQQPVQRSSSA
                     LQDILSGNPLSSHRPSSSHSMQSQAHPSPIQNRPSMSPTQGNRDVGPLAGFPHSTPAN
                     GSLPSTPFGQHMAARPQVPLSSSFDRRTSFSDSFSYATPPPPGPQSNLTLSGLSPTKN
                     SNSPRPVTAGSGVGSAAILPPIHRLEPSPKLMGRSSADAPIPPPVKMMTPEQEERRQR
                     ENQAAAAAAAAAGLDPGSRASLPSLASWPDVQQRQ"
     gene            complement(<1451541..>1452062)
                     /locus_tag="TRUGW13939_02967"
                     /db_xref="GeneID:55990473"
     mRNA            complement(join(<1451541..1451653,1451783..>1452062))
                     /locus_tag="TRUGW13939_02967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486153.1"
                     /db_xref="GeneID:55990473"
     CDS             complement(join(1451541..1451653,1451783..1452062))
                     /locus_tag="TRUGW13939_02967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342046.1"
                     /db_xref="GeneID:55990473"
                     /translation="MKEEREEKRSEREREESGAICTRQARRKDGGKKRAGKQQASRKE
                     RRSAGNAGQPHREQHRQGADRRRAPETAAVEVETEAETGARFVESETRAQLAQLGPTA
                     ALYNPFRPNQAGGRIGTSASSGQLVRAT"
     gene            <1452156..>1453760
                     /locus_tag="TRUGW13939_02968"
                     /db_xref="GeneID:55990474"
     mRNA            join(<1452156..1452281,1452348..1452419,1452483..>1453760)
                     /locus_tag="TRUGW13939_02968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486154.1"
                     /db_xref="GeneID:55990474"
     CDS             join(1452156..1452281,1452348..1452419,1452483..1453760)
                     /locus_tag="TRUGW13939_02968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342047.1"
                     /db_xref="GeneID:55990474"
                     /translation="MSARAPPAEADRGRQWYQFQHGAGNPVTMSPPSSTSRMTSRPTY
                     VPPPGFSPGTVASMAPLQIDETSQYASTPELSTETDLLSNPSNSASMFPSNDYTMPGG
                     QPSASTAPKVRVLKAPRVRRRTKPAKVDRASNPVIDKPLSELTKHLGHIPLKNMRQWA
                     HRDTEERLREVQKKNGKIARPMNSFMLYRSAYADRTKEWCSQNNHQVVSRVSGQSWPK
                     EPTHIREEYELLALIERDNHQKAHPNYKFAPNKTQTPPRKKRPLQDEASEGEESDLRG
                     PSHSSPALPNKMARTSGLSSSLTSRDSTPLDTHDNLLEGYPAGTWQLSGGRPLVPQVF
                     PSTETGYFMPPNPNMMRAPDEGHPPSGAGLMTGHYGTSTSLVGIPGGVHQDLVRSYPN
                     GHAVSHMEEPQLDPQLLSSDVAPGELRAFNRQNFPYWQGGQDLGSYLPLAGNLSFDHV
                     NYANTPGIDENGDIWAGCEDAASEVGKDLDGWLQQSTYPSQ"
     gene            <1454615..>1460779
                     /locus_tag="TRUGW13939_02969"
                     /db_xref="GeneID:55990475"
     mRNA            join(<1454615..1454641,1454701..1455293,1456035..1456213,
                     1456278..1457600,1457654..1457853,1457902..1459346,
                     1459411..1459431,1459593..1459702,1459912..1460039,
                     1460089..1460249,1460313..1460469,1460528..>1460779)
                     /locus_tag="TRUGW13939_02969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486155.1"
                     /db_xref="GeneID:55990475"
     CDS             join(1454615..1454641,1454701..1455293,1456035..1456213,
                     1456278..1457600,1457654..1457853,1457902..1459346,
                     1459411..1459431,1459593..1459702,1459912..1460039,
                     1460089..1460249,1460313..1460469,1460528..1460779)
                     /locus_tag="TRUGW13939_02969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342048.1"
                     /db_xref="GeneID:55990475"
                     /translation="MYGELGNKLVQHAKRTQTLNYLPPYQTEIVRSVAREVRDLDRDV
                     AHHLAPFEGSAGGFNPSSQPAIACALLVDHLCMRRNKRCLLAYHRTRAEKLEDMCWRG
                     VDILEHQYQQQQQQQQQNAGEGEESGGGGVGQSSSLSPEEEEYFRQYSDMLAAHKGQW
                     TDIDLTGSLEPPKDLFIDVRVLRDAGEIQTEYGCVSFLSLLFFSLLWQDSSSYNYNDA
                     AASSSALAIQDSTASANSISKAESSLLSSSNVKTPSRSFYHRSFHGSLDPAQYSSHGV
                     REQSAELASLAISDADTSTSLDDIPQSLDLFRRNRHNSNNTDHNYDALLQPGTIEEGG
                     SSDSGSPTPTQLSSSALTAMICDPARSSFGNNNAVPLDTEISEEVAVEGDDERTSLLR
                     RRTHSKDLSYGTAATDLEGQSVLYVQRRSPVQDAYSRVGTLFSVAIHPKSWDRRAIWK
                     EGVVRPVSLLPAVFLGLLLNILDALSYGMILFPLGEAVFSDLGSDGISMFYVSTIISQ
                     LVFSSGASIFKGGIGSEMIEVVPFFHKMAFMILNRVGEDNPKSVLATTILSFSISSVL
                     TGLVFFLMGVCKLGSLIGFFPRHILIGCIGGVGWFLIATGVEVSARLPGSLEYNVPML
                     QKLFSLDTVFLWMIPLCLAIFLLVLKRVIKSNFLVGGYFILVGALFYVIKFIARIPME
                     SLRGNGWVFQAPAASNPWWHFYSLYDISAVNWSALADTVPAMFALTFFGVLHVPINVP
                     ALGISTGEDNLNVDRELIAHGVTNALSGSVGSIQNYLVYTNSLMFIGSGGDSRLAGIM
                     LAAATAGIMLVGPVIIGYIPILVVGALIFLLGIELMEEALVDTWGKLHRLEYLTVVII
                     VVTMGAWDFVIGILVGIILACVNFVVQTSRKSAIRATYSGEFTASTVRRPPIQQRFLK
                     DAGKQTLIIKLSGFLFFGTIVKVEATVRGLIDEEAFNRRPIRFLVLDFSRVNGLDFSA
                     AEALTRINRILGKRNVQTLISGLDVEGEVGKSLHNVGLFADESLVQIFEDLNSALEFC
                     ENEYLTIFYNRKEALTKRLEEQQQQQQQAQYLDVPRDDNSSSSKQPAFTDLYGHSPRR
                     TYLQQAALQTLSQDEHAVRAPQKWMTYRQPLPLLLQAFHDLTHKTEDFWFPACAYFRR
                     EAYARNTVLYREGDAPQTFYLLESGMLRAEYTLPQGRYSELIVAGRPCGELPFFGDTP
                     RTATVRVDQDCVAWCLDVARWEELRAAEPGLAQELLMVSLKLTAERMDSITSHVLAIA
                     GNVTPTPIAKTFGLDHVCALCSIAGPAKTSDSDFVLSCPFFFSVSFKRLKVAAVKMKS
                     AVLVLISSAALALAAPAPAPSPKNTDFEIWQTGIPSSTSAKSLLAKLSVGSGDEIDGY
                     ERDKFKTWIQQGDNCDTREYVLKRDGTDVKVDTACESTSGTWTSPYDEKEWTSASDLQ
                     IDHMVPLKNAWNSGAANWTASQREDYANDITRPQLWAVTSSVNESKGDRSPDEWKPPS
                     DDFFCTYAEAWVEVKSHYGLTITDAEKSALGDMLDSC"
     gene            complement(<1461169..>1462937)
                     /locus_tag="TRUGW13939_02970"
                     /db_xref="GeneID:55990476"
     mRNA            complement(join(<1461169..1462368,1462424..1462625,
                     1462675..>1462937))
                     /locus_tag="TRUGW13939_02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486156.1"
                     /db_xref="GeneID:55990476"
     CDS             complement(join(1461169..1462368,1462424..1462625,
                     1462675..1462937))
                     /locus_tag="TRUGW13939_02970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342049.1"
                     /db_xref="GeneID:55990476"
                     /translation="MSAEAPKIVEETPAAVPAVETPVETPAAAEPAAETPAEPATEAA
                     AEAPAAEPAAETEAAAEAPKEEAKEEVTAATEGTLGYKGPGLVKSFRFAKRFFYFSDE
                     AVEAKNLSTYLASEKASAAAQRTAAWATQTGKGLLFYTKRAEDKATPAGIFNLSEVSD
                     VNKEGSNEFSFKTAGHKHTFQASGTERDSWVAALTAKTQEATAEKETITESEGFKGEL
                     EKLSKPAAVAAAAAVAGATAVKAAVTPEKDTKETEAAAEDKKEDKKEEKKEDKKSRSQ
                     SRKRASIFGSILGKKEKEEVKEETPGAAEETPAEAAPAEEAAAAEPAAATEATETPAA
                     EAAPAETAAEATPAEEKKEEPKSATKSKRASIFGNFFNKVASPTKEKTEEEVVPVAST
                     APQLENPVDESAAKPIEPETVTDAPAAEAAAAETPAEEKKEEKKEEVSAETKEKRRTS
                     IFGTLGKKVKAETGSDGEGKKAVNKLGGLFRKPSKAVKSEEKKDKEVAPAEEAIPEGE
                     DKAAAPTEETPAATTEAAVEKADETAAAPAEPVNVAPAAAPVQAAA"
     gene            <1465973..>1466671
                     /locus_tag="TRUGW13939_02971"
                     /db_xref="GeneID:55990477"
     mRNA            join(<1465973..1466205,1466275..>1466671)
                     /locus_tag="TRUGW13939_02971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486157.1"
                     /db_xref="GeneID:55990477"
     CDS             join(1465973..1466205,1466275..1466671)
                     /locus_tag="TRUGW13939_02971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342050.1"
                     /db_xref="GeneID:55990477"
                     /translation="MKTRITKNKATAKAKKNNPARETILNNQLSQTEPVYFWHAENDD
                     GYLGQWYQSQFTWRKPIDGKDGESEELLYHTAEQYMMHRKSLLFAPDSPITAQILAVG
                     QPAPHPRQLKKLGRQVPDFSDEVWKRERYGIVLQGNLLKFSQSDELKGKLLATGDREL
                     VEASPRDRIWGIGFGKVKAGQNRERWGLNLLGKCLMETRRILKEGSQAA"
     gene            <1468204..>1470177
                     /locus_tag="TRUGW13939_02972"
                     /db_xref="GeneID:55990478"
     mRNA            join(<1468204..1468371,1468600..1469329,1469426..>1470177)
                     /locus_tag="TRUGW13939_02972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486158.1"
                     /db_xref="GeneID:55990478"
     CDS             join(1468204..1468371,1468600..1469329,1469426..1470177)
                     /locus_tag="TRUGW13939_02972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342051.1"
                     /db_xref="GeneID:55990478"
                     /translation="MPCSARHFEAGDEAEPTISLERARRQSAPVAPYESHVGPAAKPI
                     YPPSGLAPHKPRTTPLSPPPTDTIAPSWTIPNTNLPSLQSRPSGSLNFGSASRSSSSP
                     FSTTLPVTSVTTDNQQQSWLPTPPLQQPLAPYQNSTVNHNNNNSLHEDFVLYPSTPVS
                     RPQVNLWDENSPALLSANPKYSVNSTTNNNNHQNLVNRRHTLHSSVNVHQLPRKQVQQ
                     FKKFTPQSPGLPSSTSYRFSPAAGQKRLAQRLYANSPRLNRPAVPLFNSIENNQSQFE
                     TKNNINNNNTQHRRVMSSSDIISDFPMDLFDISTASPSLDDLTSPASSMMQSPITPFE
                     DYSHLASYSAAPAPPGTVSPKDLALKDPPVSCPPSSFSTDIGTPQSLFDSPDGLFSHS
                     ISPAFANADYDLPASNNWDPLMTSEGYLHGDVDIKPSISDLLISDTAGTESRPGKRTR
                     SVSSPSPAKSPKKRSKSVGVKKPSPPKGIDEEVPYDPNDPVAARRYRNTLAARKSRCK
                     KFNERQMHLEQIEELEQQVAALQKKVAFFESFAPSDVTYPG"
     gene            complement(<1471413..>1473251)
                     /locus_tag="TRUGW13939_02973"
                     /db_xref="GeneID:55990479"
     mRNA            complement(<1471413..>1473251)
                     /locus_tag="TRUGW13939_02973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486159.1"
                     /db_xref="GeneID:55990479"
     CDS             complement(1471413..1473251)
                     /locus_tag="TRUGW13939_02973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342052.1"
                     /db_xref="GeneID:55990479"
                     /translation="MCGIFFSLSASEHVLPKEKTVTWLRNRGPDNYHVHRVQLSCGAT
                     DPGKVAAGAAASETVYLTFVSTVLGLRGDHITSQPLVDPESRSVLCWNGEAWKVFGEA
                     VQGNDTELVFQRLVEASKPSDDDDHDDNNSRVGSASKTLVRLTNVINNITGPFSFVFY
                     DGFHQRLFFSRDCLGRRSLLHTLDEDGTIRISSICDDDGASSTPFEEVETDGLHMIDL
                     SRMSKQDSEARLPYRVEVIPWSHEEDTSTTPSLKNPIPLMNRSLPTSRPPALTLSSPS
                     IEQLENELRRSLETRIRDVPLVATESNAAKIAVLFSGGLDCTVLARLAHDTLPINEPI
                     DLLNVSFENPRVAAALKAKSQKENTKMGSIYENCPDRITGRAGHAELQRVCPGRVWRF
                     VAVDVPFTEFTLHREEVVQLMRPHNTEMDLSIACALYFASRGQGTIDSSTEEEKEAYT
                     TTARVLLSGLGADELFAGYGRHGVSFSRSGFPGLIDEIDLDVGRLGKRNLGRDDRVIS
                     NWGREARFPYLDEDFVSWATQTPVWQRCGFGTAKRLEEDDDALIEKDVQKSDEEEALD
                     PEKKSLRLLALRLGMTQTAREKKRAIQFGSRTAKMESGRTKGTSII"
     gene            <1473600..>1478177
                     /locus_tag="TRUGW13939_02974"
                     /db_xref="GeneID:55990480"
     mRNA            join(<1473600..1474887,1474942..1475019,1475070..1475245,
                     1475295..1475794,1475849..1475920,1475972..1476016,
                     1476590..1476630,1476718..1477006,1477070..1477527,
                     1477915..>1478177)
                     /locus_tag="TRUGW13939_02974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486160.1"
                     /db_xref="GeneID:55990480"
     CDS             join(1473600..1474887,1474942..1475019,1475070..1475245,
                     1475295..1475794,1475849..1475920,1475972..1476016,
                     1476590..1476630,1476718..1477006,1477070..1477527,
                     1477915..1478177)
                     /locus_tag="TRUGW13939_02974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342053.1"
                     /db_xref="GeneID:55990480"
                     /translation="MSTPEQSLSSPVEESSKSGAGEHGSQQGSIKASTANNMAQQEAD
                     SGEELIHIDPSPLEEQVADHDQQLNQGLQHLSISSQKPQHLSLQTNLDVPPPPPQKDE
                     TYIDPTPKTPQASHSPIRLQTQSEYTEKELPDVPQVDTTPQPQKDVEKEEAAAARKSE
                     DDQSEIQSIMEQFSHETNGLRETEIMSPRLEFAEQFKGKGTQFPPRRSSLDAESIPSS
                     IGRPSLPSPIVVPKPSPHSASETPGTPRSVSSLTGMPPPEPEPDQPFDFHRFLEQLRH
                     RTADPVAKFLRSFLMEFGKKQWLVHEQVKIISDFLAFITNKMAQCEVWRHVSDLEFDN
                     AKEGMEKLVMNRLYGQTFSPAIPAPPSVPRSVSRSKRRELERLHGPGRRGQHQEDVER
                     DEILAQKIRIYSWIRPEHLDIPALGSNGRRFINLAQQELAKIKGYRAPRDKVICILNC
                     CKVIFGLLKHSKNPDTSADSFIPLLIFVVLKANPEHLVSNVQYILRFRNQDKLGGEAG
                     YYLSSLSGALQFIETLDRTSLTVTDEEFEKNVEAAVSAIAQENLKAESESSTSAHVTP
                     RASTDAERQHAQRKEGPPPQSSSSSAGEGENAPVAGLLRTIQKPLSTIGRMFADEPEQ
                     GSSGQPQPTTLAGPAVPVAPGPRPAGFDAQEAAARQASAEAAEARKIQRAEHQDVVET
                     LSAMFPNLDRDVIDDVVRVKEGRVGLAVDACLALSSTDLMFTNSGIADVLYICLSSPH
                     GLLVPNNQLIYPSNTPSTPFYALLNRISALPIMATPPLSENKQKMARGELYYAFTPEL
                     LGERTRCKAAVRAFNAVAGVASRRESVRLWREIVGDSTPLPPELPDAAADEAQFDDDP
                     VVEGGLYMDYGTQVKLGKGVYINAHSTWIDTCTITVGARTLFGPNVSLYSGTHPLDPE
                     LRNGTNGPETGKEIHIGEDCWLGGNVTVLAGVTIGRGSTVGAGSVVTKVCSRRMCNLD
                     NAAYMQTCTGFDPFHKNQYRYQTPPPCPSASSTRLASTQTLTATPILPPTRPTKTKQA
                     QPPNKTDTQEVEQRQRALRPVALNVRMQSIRAARRARDG"
     gene            complement(<1480161..>1481348)
                     /locus_tag="TRUGW13939_02975"
                     /db_xref="GeneID:55990481"
     mRNA            complement(<1480161..>1481348)
                     /locus_tag="TRUGW13939_02975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486161.1"
                     /db_xref="GeneID:55990481"
     CDS             complement(1480161..1481348)
                     /locus_tag="TRUGW13939_02975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342054.1"
                     /db_xref="GeneID:55990481"
                     /translation="MHYTSFFICFVAVFLCFAAHRTDGLPSSKHDTGARFALAMEEGN
                     QLIRLLKGCDQSLDRVSITTNVNCTSVPSGFPETCKKLTALLEKLLNSHHSIVPRSIP
                     DMDQIPIGPGPQYGLQHTVSETARDVQVERNSLASRSYDIIARAADRNHRREVCEAKA
                     CPKKGLEKACTAKKLQPKTAATCKMCCPTPDPKLIGEHCQARWKRERKAFYVVCFVLI
                     GITLVSGLALRLRRAYVQKQQQPQTEEDKQTGELYHYDGAKSSKSYDGAKSSTSLRQS
                     SQTDGPSLDTVDQDEKLDELWEEDEGDIGSSAAHKKWKQLGLLSKNGRKRVQDLFDVE
                     AMRSRREVGNPPRQQSDDKIPVMPRAPNATVRQMNQGSRRGRLERQSSHVELRQVPYG
                     GTA"
     gene            complement(<1481611..>1483642)
                     /locus_tag="TRUGW13939_02976"
                     /db_xref="GeneID:55990482"
     mRNA            complement(join(<1481611..1482520,1482574..1483179,
                     1483239..>1483642))
                     /locus_tag="TRUGW13939_02976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486162.1"
                     /db_xref="GeneID:55990482"
     CDS             complement(join(1481611..1482520,1482574..1483179,
                     1483239..1483642))
                     /locus_tag="TRUGW13939_02976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342055.1"
                     /db_xref="GeneID:55990482"
                     /translation="MSSAFLDHPVLKVSRPVAACSRCRTAKIKCDGKLPSCSACERAN
                     KASSCSGASDEFARGKERSYVASLEGYCERLEKRLADVRQRQQSRMLTAAGDGGQVPQ
                     SSITAFAAENTSSVAHRKEVSDIDDLVGDFGFLSVNATSRDFRGITSNVSFAQLLLTT
                     STVEPLPPFSSRNLPPRHEATRLIQHYFDNIYSQLPFFTETAFWTSVEAVYQSEGRFA
                     KPIDNWMLRMVLAISHASLSPRNQDGNNQFTFSMVSSALEYSDEVLHPGSMRGIQAIL
                     LLTLYSLFDPVHFRPRFLVSFAARVMVDLGLHQDPPAEVLSDRAVLEQRRRLFYCLYS
                     LDRVICTALKFNFSFSDASVNVALPHATSSSNPTTEGFMLSNLEPAIHLFKLRRILSP
                     GYQEMYGNGRSPSPQPLLLTWKLCAEARDWYDQAPTNIPSSFNLLYRLELLYSTIIFL
                     SPSYRDPVICDFSKALLFDRCIDYISQFHQVVVNSSGLPLATYLDIQRVRGIGQRFVT
                     ILNEDYDLLVSNRVPDVPAVPPGTPEPPYLAAEDRINCHARALRCLIYIEDILQYGVQ
                     RWNTRRDYDDFVRDSAGVKAQLEQQRSPYQRAHAMPPQGFVSAGVPVAANGYQGMQLY
                     VNAGQAYYPNMTSRE"
     gene            <1485944..>1490796
                     /locus_tag="TRUGW13939_02977"
                     /db_xref="GeneID:55990483"
     mRNA            join(<1485944..1486084,1486158..1486656,1486721..1487483,
                     1487551..1488574,1489477..1490029,1490126..>1490796)
                     /locus_tag="TRUGW13939_02977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486163.1"
                     /db_xref="GeneID:55990483"
     CDS             join(1485944..1486084,1486158..1486656,1486721..1487483,
                     1487551..1488574,1489477..1490029,1490126..1490796)
                     /locus_tag="TRUGW13939_02977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342056.1"
                     /db_xref="GeneID:55990483"
                     /translation="MGEHKSRPSSRPVFTDPWKPGAPLKGIQDAPDGRIAHTLTACTR
                     CRQRKSRCDPGIPRCEPCQRSNSRCVYYDPARNMPIPRTYIVQLQEKARALELEIHEA
                     EKEVQHAADAELMARGAGRIKFTPTDEPRYLGPSSGIAITRLVMELAKQNTDSKSIKD
                     VVPEMTAQEIRDMFTKESSKPTSKVYPMISSMPQEELPPRELTYKLIDLYMVRGQAML
                     PVLHEPTFRQDAEDVFVGSNDPVKNFELRMVIAISMQKLSTDYAGLADSYYLAALPFL
                     EPSIKPMDIKSLQCLLLIAQYSLVTPTRTASYWVVGVAVKLAQELGLTEEATITKSPT
                     GGPLNVLEVDLRRRLAWVIITMEFGLAHSLGRTNSFCVSHDHLDINFPELVDDRFITP
                     QGILPGSKPILAKCIAIHFFKMRLLQAEARRVLYLNKRETPVDHQDPWFEQFGAKLDH
                     WVASCPKQDGGSGLGETWFVGRKNTIVVLLYRPSPQIPEPSAEAARKCYDACVFNVTM
                     HREQMATGSVDLTWVSTQALFMAISTLLWTLSYPEIRQEHSIDEVKSYLQIALEGVMI
                     SAQRWPGCESALHLYQSLISACLKSYGTTESFVVHSPSTHPSPVSTHEAVTPPTMSSP
                     SSNSHYSAQTVTPSSQFVSDVDIKTSLSREHTPVYSPVQNMAVPTSQSPLKQSNIHPT
                     TSSPLAQPPPAPLHHPLYDTRQPYAPMNANYCDPNFDPGTPFNSFPSVVTGLPGWDPN
                     YTVATTRGSSLSYVGANVDPMFWMGNFGDQYSQYSNQPGPWRGRTLSQEEQVELMDSL
                     ADNIPDVSSLLVNRSPQRSNTLGPQTPTSPPLMSVGAQSYAANPANPHTSPSHTTSNG
                     RPLSSPSSTPMSTQTSQQPTVSVTNSFPTPASSISGHHRNVTPAEDSDAVDKSWAQGT
                     QHSNMALSTDMMDIDKKEHRRSDHDRNQVPGATDVGGLPSSADADMMDVDSKVPRFIA
                     DDPSIDALQKDLGTAFHLCKTAPTITGPDPSLDLISLYGLGPIGRSVMRADPITGEKI
                     NRLRKSYEGKLKGLGLAGRNKAVKNESPAGGLRALTMWPEEEWRNQKVYGKEIKVADI
                     DSVLQNLQTRAMKMEPGLLPNNDYWEDVLGHEKPSKHISVDGGKRSVSTPNPNRPTVQ
                     VNGVGAPGTTDAERARPTRGKKRHYDDNSFMGYGEGYVDDEDESAFYSNGEDRSGKKK
                     RKKVDSPRAFAF"
     gene            <1491773..>1492369
                     /locus_tag="TRUGW13939_02978"
                     /db_xref="GeneID:55990484"
     mRNA            <1491773..>1492369
                     /locus_tag="TRUGW13939_02978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486164.1"
                     /db_xref="GeneID:55990484"
     CDS             1491773..1492369
                     /locus_tag="TRUGW13939_02978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342057.1"
                     /db_xref="GeneID:55990484"
                     /translation="MSDKFHKALAAIDAAHSEDPNLKKIDDNSDNTIPYELHYAQKMT
                     SYLNAYNANASELLRLAIRAQHLRRWEVPRSSYPATKAGYFGWRTYLKNRQAELAQEM
                     CAAAGYSQPEAERVAALVRKEGLRQEEQETQTLEDVACLVFLDDQFEAFEQEINDEEK
                     MVGILKKTWAKMSDKGRGMALQITMSDRCRGLVQKALA"
     gene            complement(<1492564..>1493702)
                     /locus_tag="TRUGW13939_02979"
                     /db_xref="GeneID:55990485"
     mRNA            complement(join(<1492564..1493095,1493163..1493523,
                     1493588..>1493702))
                     /locus_tag="TRUGW13939_02979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486165.1"
                     /db_xref="GeneID:55990485"
     CDS             complement(join(1492564..1493095,1493163..1493523,
                     1493588..1493702))
                     /locus_tag="TRUGW13939_02979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342058.1"
                     /db_xref="GeneID:55990485"
                     /translation="MALLFLKQKLFPTWCNGNQRSSPRDRYLKKNCSPSSDLRRPLLP
                     DSDNLDGSTVDGGSDRDVEAQMTSPYSTFASGPPDDDDETASSSSGTSTRSRVDPRLI
                     SDAILGLSDGLTVPFALSAGLSAIGDTKVVVIGGLAELTAGAISMGLGGYVGAKSEAE
                     SYNATVREVNDLIGRPDETRSIIQSTFAAYNLPPHAVYEIVETLQADPDRLRDFLLTF
                     HHQETEPGCNQAYVSALTLALGYFIGGFVPLVPYFIVSEVLVAFYYSIAVMAVTLFVF
                     GYVKTCVVRGWNGSANIQAGIMGGLQMCVVGGLAAGAAVALVKLINGDDQSANPKVKA
                     E"
     gene            <1494876..>1495487
                     /locus_tag="TRUGW13939_02980"
                     /db_xref="GeneID:55990486"
     mRNA            join(<1494876..1495302,1495390..>1495487)
                     /locus_tag="TRUGW13939_02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486166.1"
                     /db_xref="GeneID:55990486"
     CDS             join(1494876..1495302,1495390..1495487)
                     /locus_tag="TRUGW13939_02980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342059.1"
                     /db_xref="GeneID:55990486"
                     /translation="MVRNPITTSREKASDNVESRLEKRLTRYVDNGNLMCLTENYPLI
                     PGDPRYFMTLDEASKAINSVCMAWQYVELNPSAKPGFKNTYYILDDAQDQGGTNITVS
                     VTYNGGKTCPSPPLNFWIDRNLAGDGQSHCLDRLYTIINGCDTQKQTEYWKQGGTFFR
                     DCATWEIWKSLHFS"
     gene            complement(<1495654..>1496886)
                     /locus_tag="TRUGW13939_02981"
                     /db_xref="GeneID:55990487"
     mRNA            complement(join(<1495654..1495972,1496005..1496231,
                     1496287..>1496886))
                     /locus_tag="TRUGW13939_02981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486167.1"
                     /db_xref="GeneID:55990487"
     CDS             complement(join(1495654..1495972,1496005..1496231,
                     1496287..1496886))
                     /locus_tag="TRUGW13939_02981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342060.1"
                     /db_xref="GeneID:55990487"
                     /translation="MVAGSLMYNALIDYWTLTGDDQYNSIIKQGMLSQIGSDGDFMPA
                     NQTSYETSSEQASWALAAMNAAEAGFLTDDGSNSSWVMLAEKVFSEQAARWDTKACNG
                     GLKDGIFPFQTSYRTKGAFSNGLFMQLAARLAVYTGNSSYNEWPEKVWKWSESTGLVD
                     SNYSIYNMLDTESGCDINDPTMWTAEFGAYLSTAAIQYNPTSGSSIWKSRLDGVLSRA
                     TEVFFNIDPDVMVGTGCEFVQSCNEEIGIYRSVLARALGDIATFAPYLKASVTPKIQN
                     AKDTFCNFSWMSSRNTAFTGLGQQISALQIVLANLDRPQLATANQTGSGDGSESTGSS
                     STSTSAPSSTQSTATPTASGDTGAGNRLVGSVCGVFAGVVAALFLPL"
     gene            complement(<1497866..>1498369)
                     /locus_tag="TRUGW13939_02982"
                     /db_xref="GeneID:55990488"
     mRNA            complement(<1497866..>1498369)
                     /locus_tag="TRUGW13939_02982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486168.1"
                     /db_xref="GeneID:55990488"
     CDS             complement(1497866..1498369)
                     /locus_tag="TRUGW13939_02982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342061.1"
                     /db_xref="GeneID:55990488"
                     /translation="MASLVRHFKSLLSKPVANNGSQLRDHQANERTFLSWTRMGLAFA
                     AMSIALGRLGLIDHLIHSNYSPDYNNNDNNNNTKDKITTADKPKTQPIHSAEILASQI
                     CQILSGWSFGYGFFRYVSVRRNLLKGRFVPALWGPVFMTFGSIGSLGAILYKDDIFPR
                     SKLRVQV"
     gene            complement(<1498902..>1500107)
                     /locus_tag="TRUGW13939_02983"
                     /db_xref="GeneID:55990489"
     mRNA            complement(<1498902..>1500107)
                     /locus_tag="TRUGW13939_02983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486169.1"
                     /db_xref="GeneID:55990489"
     CDS             complement(1498902..1500107)
                     /locus_tag="TRUGW13939_02983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342062.1"
                     /db_xref="GeneID:55990489"
                     /translation="MSGLEAVGVVSSIIQIADLGARVALKLCTFCHKVKQAEANIQNL
                     SKDISLTCNVLRQLSDNLKQDDQIQLYSQNAFETAQEILDECGRIFRSIESAMDQDLP
                     PFDTSFETKKSNPFLKFSRKLNVVFKEPQLNVLQTNLDSLKNTMLLMLNVIIYTGQLK
                     NREIETSKTGQKELVEILAQQKHESDQKFERLTRAIEGVQLDDKNPVTINTVDVYDSD
                     SPALPTKLAELAYRPEVTADQFTLITSEIETYSALIKGILKRVQTTDALLATNRYERI
                     KQAVLDAHARELRIFSTEYGEDGAQLFAKLCQGPLFDGIYQRFVKEQLVHVVAETNRG
                     REKELRLQKVEPEMFKFEGSVSFSEEKRRANIFMYIWTGTGPVLSLGCNFTISLALTL
                     LCGRLSHGL"
     gene            complement(<1501362..>1502201)
                     /locus_tag="TRUGW13939_02984"
                     /db_xref="GeneID:55990490"
     mRNA            complement(<1501362..>1502201)
                     /locus_tag="TRUGW13939_02984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486170.1"
                     /db_xref="GeneID:55990490"
     CDS             complement(1501362..1502201)
                     /locus_tag="TRUGW13939_02984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342063.1"
                     /db_xref="GeneID:55990490"
                     /translation="METHPLSAHEIGEGLPVLIIHGWELDGKAEELDFEPIFTTKAPG
                     LRRIYVDLPGMGTTPANNVKDLDDIYLRLIQFIDARIGKSKFLLMGSSCGGYLARALA
                     QKYIGQVDGLLLRVPLIEPKNELRDLDGFQPLVRNEQLVSSMPSEDKALLGDVHVQTP
                     AYIKSLKAKYEAIRPSLNAADKEALGPIREDPQRYQLSHVAAADDNNKFFAPTLILCG
                     RQDEVVGYRDSLRLLELYPRSTYAVLDRGRHDLPVDENGLFEALVRDWLTRVGEWRVR
                     ADK"
     gene            <1504351..>1504788
                     /locus_tag="TRUGW13939_02985"
                     /db_xref="GeneID:55990491"
     mRNA            <1504351..>1504788
                     /locus_tag="TRUGW13939_02985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486171.1"
                     /db_xref="GeneID:55990491"
     CDS             1504351..1504788
                     /locus_tag="TRUGW13939_02985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342064.1"
                     /db_xref="GeneID:55990491"
                     /translation="MTLLWSFDSRRSSIHSSRSSSLTSSQNNAHSNSNSNSNSDHPNQ
                     PNDINMNMAELAFARPPSELLAVPRPLPMPLAGITKLRDRLSFKHARAALAEREILKR
                     ENRCKRPLTARNVDTFLIEQDLNDARIRRADNLHVSQWLQQLP"
     gene            <1505519..>1507793
                     /locus_tag="TRUGW13939_02986"
                     /db_xref="GeneID:55990492"
     mRNA            join(<1505519..1505543,1505593..>1507793)
                     /locus_tag="TRUGW13939_02986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486172.1"
                     /db_xref="GeneID:55990492"
     CDS             join(1505519..1505543,1505593..1507793)
                     /locus_tag="TRUGW13939_02986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342065.1"
                     /db_xref="GeneID:55990492"
                     /translation="MPKKVAIIGAGPSGLVMAKTLLHHYPPGHFAPVIFESRQTVGGL
                     WAVTGPNEKQTSFIDAEMRTNLSRFTVCFSDFSWELNVGGVGVDDTFPRAAQVNEYLD
                     KYAARYIPGHVLRLGCRVLNTRRNSDGWIVKWENDKDVQKEEETFDYLVVASGYFSSP
                     HIPSIRGLDSFSPERVIHSSSLASAKGRLFTELSNLPGKLLVVGGSMSGAEAASSLAL
                     ASSSSSNNIQIHHLATRPFWAVPTYLPDASSGSFLPLDIVMYDLARRPHGDIQYSLNP
                     TAPPERALLVNKYFSTILGSDQSDVARFSHDGAAAAADDLDQRPPWVAVTDHYAEFVR
                     AGDITTSLGRVEAVNWPAGSDRGTVQVRESSSSSSTTTIKDVAGIVLATGFTPFNALA
                     FLPDDVLAALEYAPDDPVFPLVLDEKATFHPAVPDLGFVGMYRGPYWGVMEMQARSLA
                     QQWDRQDTNATALQMRNPRLSLSSSSSSASRRTQFPMGDYVGLMETFARELGIQRTSL
                     LFGTETPPPPPGGKNERTGPAVPVRYSVQSTTNNKNNNAEIAATHSALSDLLRPAGER
                     WPHRQHALSQAVFRALHGSWRVEQKLGEEEEEALLFSGSATFRPRAVSSLSLSSSSSS
                     SSAGIEYLYHEEINKNSCDAVFSISENFIHINQPDTTLSRHIEFVAIHPDQDQDQDGE
                     QYQYRHSARGIFSDNPSKKTCEYVFHIKGVQIVSWQETIISSPSEEKQIKTYTRFPSY
                     K"
     gene            complement(<1508254..>1509381)
                     /locus_tag="TRUGW13939_02987"
                     /db_xref="GeneID:55990493"
     mRNA            complement(join(<1508254..1508326,1508375..1508439,
                     1508496..1508989,1509042..1509154,1509212..>1509381))
                     /locus_tag="TRUGW13939_02987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486173.1"
                     /db_xref="GeneID:55990493"
     CDS             complement(join(1508254..1508326,1508375..1508439,
                     1508496..1508989,1509042..1509154,1509212..1509381))
                     /locus_tag="TRUGW13939_02987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342066.1"
                     /db_xref="GeneID:55990493"
                     /translation="MAQIRGTAGYNLGHQNRFAGGPGGLDATSDPSPLDAIREQTSKI
                     EDWLDTVSDPIKPYVPAIGRFLIVVTFLEDALRILTQWNDQLLFLRDYRHIPWGITHM
                     FLIFNVVAMLISSTLVIARKHSEYAVGGLLGVVITQALGYGLIFDLNFFLRNLSVIGG
                     LLLVVSDSWVRKKYMPAGLPQLDENDRKMYVQLAGRVLLILLFIGFVFAGQWSFWRVS
                     VSIIGFVACVMVVVGFKAKMSAVILVVLLSIFNVLVNNFWTLKPHHPNKDFAKYDFFQ
                     VLSIVGGLLLLVNMGPGQFSVDEKKKVY"
     gene            complement(<1510289..>1511446)
                     /locus_tag="TRUGW13939_02988"
                     /db_xref="GeneID:55990494"
     mRNA            complement(<1510289..>1511446)
                     /locus_tag="TRUGW13939_02988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486174.1"
                     /db_xref="GeneID:55990494"
     CDS             complement(1510289..1511446)
                     /locus_tag="TRUGW13939_02988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342067.1"
                     /db_xref="GeneID:55990494"
                     /translation="MNPYVSWAIILVVTGSLGYYYSNTGKPRGRTPVRAVPEKVEAPA
                     PAPKQKKPKPRKSPEPASAAPQQKASSPAPPVYTADDEEDVDTRDFAKRLAAARTGVA
                     VGDAKAKPHKEKRSKAVPTAAAVAAAAPVESAASSNGADADDDLSSTENVAVSSTDVS
                     DMLEKPAPGASVLRLTGSVESKEKKQKAQVFKPVETKKQRQNRQKNEARKQINQEAEA
                     ERRQLLEKQLHTARQSERQEAARQKPAAAPQSNAWSSASKTNGSPAAAPVAAAPAASN
                     GTLLDTFEPAAPASSSKPAGTWTNNLPPEEEQMRILGVSQPDEDWTTVPSKKEKAKKK
                     AKADESANEASASEAPAVVAESKPIEAALPPVAQVPIPRGKNHPLDSDWAA"
     gene            complement(<1512710..>1515562)
                     /locus_tag="TRUGW13939_02989"
                     /db_xref="GeneID:55990495"
     mRNA            complement(join(<1512710..1514110,1514165..1514650,
                     1514706..1515292,1515355..>1515562))
                     /locus_tag="TRUGW13939_02989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486175.1"
                     /db_xref="GeneID:55990495"
     CDS             complement(join(1512710..1514110,1514165..1514650,
                     1514706..1515292,1515355..1515562))
                     /locus_tag="TRUGW13939_02989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342068.1"
                     /db_xref="GeneID:55990495"
                     /translation="MRRILNTALWASLAASATAATVDDCPGYTLSNLVQSQSSWTADL
                     SLSGDACNVYGEDINDLKLLVEYQTDSRLHVKIYDAQEQVYQIPKSTLSPPTGQDGSS
                     TSNSSDLVFSYTENPFSFAVQRRSNQETLFNSSGSNLIFESQYVRLRTSLPLDPFLYG
                     LGEDSDSFVRETNNYTRTLWNIGIGMLPAHSNLYGSHPIYIEMRNGTAHGVFLFNSNG
                     MDIKINQTEEDGQYLEYNTIGGVLDFYFLAGPSPADVSRQYAGVVGTPAQQSYWTYGF
                     HQCKYGYQDVMMVADVVYNYSQAQIPLETMWTDIDYMDLRRTWTLDPQRFPLHKMQEL
                     VSYLHDHQQHYIVMVDPPVSLNDSDSYNKALSSDSFLRNSNGSIFVGTMWPGAVSYID
                     WYHPNAEAFWTGEIASFFDAKDGLDVDGIWIDMNDPQNFCDYPCQNPVQSAIDNDIPP
                     APPAVRTTWPPLPGFPADLQPPASDASENVVTPRSPYPRSISATSANVTGNMTGLAGR
                     NLNTPPYALNNSIGPLYTGSIWPDLVGYGGYVSYDTHNIFASGMIAHTREGLLKRRPN
                     ERPFIITRSTFAGDGRKTGHWTGDNGSEWAQYLISIWQNMEFASIFQIPTVGADVCGF
                     NLNTTEHLCARWAMLGAWYPFYRNHAGDTSNFQEFYRWPLVTEAAQKAIRTRFALIDY
                     FYTAFTQQTVDGSPTTIIPLFYEYPNDVATYNISYQFFFGPSVLVSPVTVENSTSVEL
                     YLPEDIFYDYWTGQQVNGTGSTITLDNITYTDIPVHIRGGSVLPRRLNTDAVNTTTQL
                     RDQDFEFVIAPDADGKATGNLFLDDGLSLDSESSTLSVSFDNGHLAVTGSFAYSVDVK
                     VVSATVLGQGNGTSSYGESYSLNRTLNAAWSTDLYGH"
     gene            <1517671..>1519104
                     /locus_tag="TRUGW13939_02990"
                     /db_xref="GeneID:55990496"
     mRNA            join(<1517671..1517774,1517827..1517996,1518047..1518081,
                     1518129..1518422,1518481..>1519104)
                     /locus_tag="TRUGW13939_02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486176.1"
                     /db_xref="GeneID:55990496"
     CDS             join(<1517671..1517774,1517827..1517996,1518047..1518081,
                     1518129..1518422,1518481..1519104)
                     /locus_tag="TRUGW13939_02990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342069.1"
                     /db_xref="GeneID:55990496"
                     /translation="GIDDILAMLLAFAASPDEVDVLLISLTFGNIEVQNCLRNVVSML
                     HILDREIQWRKDQGKPEGFDTLRVRKPVIAVGAQEPLDDQKMLADYFHGKDGLGGIHF
                     SHPHLTPGESWEHLFAPISDPDVLPNVTSSTSHQSFVPSRQHASDEILRVLQENEADT
                     VTIVAVGPLTNLALAAAKDPEAFLRVKEVVVMGGAIHEAGNVTPVGEFNAYADSVAAA
                     RVFALTSPNPRSTLPLSTKLQPYPAQLSKQLVLKLFPLDITLQHNLSRGDFDHTIAPL
                     LQAGSPLAEWVSAFMAHVFQTLERLHPGHEGSSAKLSLHDPVCVWYALTADDARWKAT
                     RTSPEDIRIETVGQWTRGMCVIDRRNRHKVDSEVESHSDHGLWLNSRAGNRIIRMEES
                     PGGDSFGLVLLKKLFG"
     gene            <1520045..>1520838
                     /locus_tag="TRUGW13939_02991"
                     /db_xref="GeneID:55990497"
     mRNA            join(<1520045..1520715,1520778..>1520838)
                     /locus_tag="TRUGW13939_02991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486177.1"
                     /db_xref="GeneID:55990497"
     CDS             join(1520045..1520715,1520778..1520838)
                     /locus_tag="TRUGW13939_02991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342070.1"
                     /db_xref="GeneID:55990497"
                     /translation="MYVQNLFTLSVAALAGSAIAAEYNGGEIPAALRQGRGKNRASSS
                     AAMSMMATPSSSSAAMSALPSSAMMMMVTVTVTPTVTESPSAWPSPSSEWPSTSPTAW
                     PSAAPSPSASPSSSVAMQRSFTPKVSPSSSHLRSSSATHAAMASSTPLIGKIGVPVND
                     LVDNKDDKSKQPFQNKAGKDKPAPAAQIIGTDDMRVNTKDDCSLRCQSLAEQCVELLP
                     KDNDFCWTQYPDCQNRCVTQHVGTA"
     gene            <1521545..>1522943
                     /locus_tag="TRUGW13939_02992"
                     /db_xref="GeneID:55990498"
     mRNA            join(<1521545..1522219,1522278..>1522943)
                     /locus_tag="TRUGW13939_02992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486178.1"
                     /db_xref="GeneID:55990498"
     CDS             join(1521545..1522219,1522278..1522943)
                     /locus_tag="TRUGW13939_02992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342071.1"
                     /db_xref="GeneID:55990498"
                     /translation="MPPRLPPTPAASGELHIKDRPIDSMSEHSFALPPAALSPVVTDD
                     SNSNSNSRKTSVVFQTPVSPASPDIGGRRMSTTSSRGGTKRAAATLDEFNLPPPPTRT
                     RKIIQMKPKTLSSSSAGAAGSASQSAPKSTGKSNTASSKPTAAGAANTSTTTTATTSQ
                     QPNANGSKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFSTLKDMIPACRGQEM
                     HKLAILQASIDYMNYLEECITELKSASSGKHSTANTPIMRAPPGPPSPTSPELVMTER
                     ADEECFSASSASSSVAASPALSPHTGPTTTHQFQSIDSSSSSYYPILPSPALGPVQFQ
                     QQYQNNNNNNNNSWRAPSQPLASATPSPAILPQQHHRYSVSSSYASSSTSTSGTTALE
                     NDSMIDHEASAALLMLNMDRRGGVEESAQRSSLAAEATARKRKMGMSVRDLLAP"
     gene            complement(<1523793..>1525031)
                     /locus_tag="TRUGW13939_02993"
                     /db_xref="GeneID:55990499"
     mRNA            complement(<1523793..>1525031)
                     /locus_tag="TRUGW13939_02993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486179.1"
                     /db_xref="GeneID:55990499"
     CDS             complement(1523793..1525031)
                     /locus_tag="TRUGW13939_02993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342072.1"
                     /db_xref="GeneID:55990499"
                     /translation="MWLARGVQSAVFYYATCTPCATAVDRRRRKRDAARAQREQAKST
                     VIVTDQPRPFAQPTPFSTNSGWAEEITLGPGPPTRRHRAKNCQSDGMAPPRLSATSST
                     TIEDGPPSEREKTLKASLGERFHWTRYQREDEVLWGEEGEEEEQQQSARFPGRARAGT
                     SHSNKYYVGRAPPVNDLHPPIVSGPTSRAETRWMMQPPPTARVMAGKARHDSVRKSKA
                     PSTRRAAARLDIKIEETAEEYDDLQEGQSIPMPDRKSWFAAGTSLNNRKATDKKRRPP
                     PVAVIKDFDRDYISSEALSDCSPRYPPAATLASRPESMAHIRHAYDEWHLPISSTRSD
                     SPSSLGSDSFHCPDTPYSRPESKRTEDSGKAFRSPYDNIASPMGRPDDKGIEAIRVEV
                     DEPKSREQMRPLKWRWSFDV"
     gene            complement(<1526338..>1527097)
                     /locus_tag="TRUGW13939_02994"
                     /db_xref="GeneID:55990500"
     mRNA            complement(join(<1526338..1526706,1526765..>1527097))
                     /locus_tag="TRUGW13939_02994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486180.1"
                     /db_xref="GeneID:55990500"
     CDS             complement(join(1526338..1526706,1526765..1527097))
                     /locus_tag="TRUGW13939_02994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342073.1"
                     /db_xref="GeneID:55990500"
                     /translation="MPELLDIIYPWPVVSTLALYLGVGDLIQLSRVSTGCRAALHGFP
                     RPRPDDGAGDWIRVRAEIFIGMHQSSYWRNLKSIAQMSCAEANHRRGYRAELCRYCSI
                     PVCDACVVRESFGQGTSAWRTRTRHLCVDCWASGTPHKNRNFSKPPSATVKYSFAPGD
                     GDFCRCTATDGWLCAGCRKKQCTDVAAQRERCFGEGCSRLAGLEKERRSVCLWCDMPC
                     VVISTTRATGIIQGR"
     gene            <1527800..>1528155
                     /locus_tag="TRUGW13939_02995"
                     /db_xref="GeneID:55990501"
     mRNA            join(<1527800..1527824,1527884..>1528155)
                     /locus_tag="TRUGW13939_02995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486181.1"
                     /db_xref="GeneID:55990501"
     CDS             join(1527800..1527824,1527884..1528155)
                     /locus_tag="TRUGW13939_02995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342074.1"
                     /db_xref="GeneID:55990501"
                     /translation="MSLTSYINKKVLVITVDGRTLLGTLLSTDQLTNLVLTQTVERII
                     RTADDPEPSSEIEHGLYLIRGDNVVVCGEIDEAIDADVDWSKVKGEVIRGTKNL"
     gene            complement(<1528848..>1530294)
                     /locus_tag="TRUGW13939_02996"
                     /db_xref="GeneID:55990502"
     mRNA            complement(join(<1528848..1530113,1530169..>1530294))
                     /locus_tag="TRUGW13939_02996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486182.1"
                     /db_xref="GeneID:55990502"
     CDS             complement(join(1528848..1530113,1530169..1530294))
                     /locus_tag="TRUGW13939_02996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342075.1"
                     /db_xref="GeneID:55990502"
                     /translation="MPPPPPPPPPPPPGMGGPPPPPPPPPGGSKSAKPAKGATQDRSA
                     LFADITKGAPRLKKAVTNDRSAPLVASDNKPSAPAIGGAPAIPGMPKPPGGLAPPVPS
                     ANRLRSNSEGRPGASDGGDSGVAAAPQLGGLFAGGMPKLRSRGGGVDTGANRESSSYL
                     SDSEASRPKPPTGSAPRPTIGAPKLPGSRPPPVPPSGGDGPAVNPLVANLRKPPPRPA
                     SRPSSAISAISFKSAPEVPPPRAPPPVPGSSRPPPPPPTVSSRKPSGTAPAAPPPPPP
                     PPVTSTPPSAPPQPPSNAAPRLPPSAPPPPPSSAPSIPNGASPAASIAVQAARNAFGN
                     SHAPSAPPAPPPPPPAVSAPSLPAAPPPPPPPASPPAAPLAPPPPPVSAPPTRSTLDP
                     SAYTLTNGSSSPASHTLSHSPSPGPTRSVQDNRFRFQDESLFPKPRPFAGGVRRYRAG
                     RGSSVPLDLSSIG"
     gene            <1530669..>1531934
                     /locus_tag="TRUGW13939_02997"
                     /db_xref="GeneID:55990503"
     mRNA            <1530669..>1531934
                     /locus_tag="TRUGW13939_02997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486183.1"
                     /db_xref="GeneID:55990503"
     CDS             1530669..1531934
                     /locus_tag="TRUGW13939_02997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342076.1"
                     /db_xref="GeneID:55990503"
                     /translation="MRGIAIRPQRTLRVQGPICQFCQFSTRPELSASPKLQGEPLRKT
                     QQHAVYQPRNPDFRRSYAKKLTPNSPNTATNRLNSLAQTANSSSGADRVVDDIREKFQ
                     SIVQADKAAPEEEVVALLQQCLQTVESYANPAEQREKGTSNATSSLLDLADTAEAHAA
                     RPDKGQRRRATDTISDMVDELLLNDKVFISTETLELYTKIQSLLKRGNHFPRIFSLFA
                     NKPIPQPGTSPIKFSEPNPADVKNAVPSELATMALDVALSQKNLPLALAIIDTTFCAP
                     AFYRAKMFKKAGVPLGGLVAAPLASYVVATWAASLQNTMDPSMATGIAFTATLAYIGF
                     TSSVGVIAITTANDQMERVVWSSGIPLRHRWLREEERAALDKVAVAWGFKDVLRRGEE
                     EGEEWENLREFIGMRGMILDKTELMEGMQ"
     gene            complement(<1532122..>1534023)
                     /locus_tag="TRUGW13939_02998"
                     /db_xref="GeneID:55990504"
     mRNA            complement(join(<1532122..1532384,1532448..1532641,
                     1532703..1532880,1533305..1533955,1534011..>1534023))
                     /locus_tag="TRUGW13939_02998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486184.1"
                     /db_xref="GeneID:55990504"
     CDS             complement(join(1532122..1532384,1532448..1532641,
                     1532703..1532880,1533305..1533955,1534011..1534023))
                     /locus_tag="TRUGW13939_02998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342077.1"
                     /db_xref="GeneID:55990504"
                     /translation="MSSFTQPTELRPQDQLIAIAAMADVYLVPKPAQSQPSDISLLIE
                     RYRTTRLTALQLDPDAFGSTYAREIQFTDEIWLSRLLNPLSKTLVSVDVKPPPTEPVD
                     LARHEWLGTATILGPKVLSETKGSSLWTTYTRDNSNDPPDWPAVKDSNAIYMIAGVFV
                     HPSRRRQGRGKRLIRAVVSTATEEAKSAGASRVTILLEIESENQVPDRLYESAGFWAV
                     DREAGVRQNVQQLLEYSQNEKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPNVPRP
                     GMTICVIGDQHDLDRSKHLGIESASVDDLKKLNKNKKLIKKLARKYDAFVASETLLRQ
                     IPRILGPGLSRAGKFPTPVSHAEDLEAKVTEVKSTIKFQLKKVLCLGVAVGNVGMTED
                     ELISNIMLAINYLVSLLKKGWQNVGSLVIKASMSPPKRLY"
     gene            <1537851..>1538578
                     /locus_tag="TRUGW13939_02999"
                     /db_xref="GeneID:55990505"
     mRNA            join(<1537851..1537998,1538071..1538315,1538370..1538435,
                     1538486..>1538578)
                     /locus_tag="TRUGW13939_02999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486185.1"
                     /db_xref="GeneID:55990505"
     CDS             join(1537851..1537998,1538071..1538315,1538370..1538435,
                     1538486..1538578)
                     /locus_tag="TRUGW13939_02999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342078.1"
                     /db_xref="GeneID:55990505"
                     /translation="MGLVVSKLLDRLWGKKEMRILMVGLDAAGKTTILYKLKLGEIVT
                     TIPTIGFNVETVEYKNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRIVE
                     AREELQRMLNEDELRDALLLVFANKQDLPNAMSPAEITQQLGLQSLTRRAWYIQSTCA
                     TTGDGLYEGLEWLAETLRKTGRD"
     gene            complement(<1540514..>1547523)
                     /locus_tag="TRUGW13939_03000"
                     /db_xref="GeneID:55990506"
     mRNA            complement(join(<1540514..1542971,1543854..1543981,
                     1544037..1544971,1545025..1545050,1545107..1545779,
                     1547117..1547227,1547292..1547392,1547453..>1547523))
                     /locus_tag="TRUGW13939_03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486186.1"
                     /db_xref="GeneID:55990506"
     CDS             complement(join(1540514..1542971,1543854..1543981,
                     1544037..1544971,1545025..1545050,1545107..1545779,
                     1547117..1547227,1547292..1547392,1547453..1547523))
                     /locus_tag="TRUGW13939_03000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342079.1"
                     /db_xref="GeneID:55990506"
                     /translation="MSLTPLSCQLMGWRGSGGGGASIVGVFYAMGGILMILGGLLEFI
                     LGNTYSFVAFTGFGGFWLATAISLTPSANATGAFTTGAESTVGVEYYASYVADVLQTR
                     TASIELQNGGPIGSQHGHNNNDDNDIASQPNDGITLPNSSTLESTSVPVSDMESATPM
                     LKTHQIVVIMLSLCASSFVSALDITIVSTALPVISGYFHSTSGYTWIGSAYVLANTAT
                     TPTWGKISDIWGRKPLLLAALTVFFFGSVMCAVAKSMTVLIAGRAVQGVGAAGLNILV
                     NICISDLFALRDRGMYFGLLSVVWACASGIGPVLGGVFSQELSWRWCFYINLPFVGAV
                     FCLLWFVLKLETPKTPVWDGLKAIDWMGCLLVIGGTLMLLFGLDFGGVTHPWTSTTVI
                     CLIVFSIFIGALFVVNEKKLAKYPIIPMDLFQYRSGIGSFVLCFCHGFVFTGQAYYLP
                     LYFQSILGLSPVKSGLYFLPYILAICFSGALTGVFIQKTGRYMPTTYLGLALMTLGVG
                     LLINLDIKLNWTKLIIYQIISGVGIGLNFESPLLSLQAIVGAHNATTATSTIGFVRTL
                     SSAISVVIGTVVFQNQMVKQGPSLVAALGPQLGGLLAGGDAAANIDAISALPPAQQLV
                     ARHALYQSLRAIWIMYTGFAGAGVVAGCLMAAHPLSKEHEAAVLGLHPRDGPAETRDS
                     TRYRDTNPWSRKTDRLDPEKASSSYDSSLSDDDPVYSDTSRVTSGSLSSRIPMLGSPS
                     RRRGPRTKGFMPHRLMRCFCLAVFIALLLFVLNLFRFTLFGQAEQVPIEVPKPVPKPH
                     MWESFPFLERYHGGLRSLVVAKDNVPEYPGDGTPEDLVLPPGDEQEKEKEQEPQEDGK
                     KTAQKRSNSNTFSSSAYNPYPNYKAQEYLQKYGQKVDCFLDEDGKVRIPQVQHYPGVP
                     QGFPDPIMGSNAMLGIQDDVCFDRFGRLGPYGLGYGVKKGGTGAGMEGDREGADRVWE
                     DVPPVDFRQVNWAAAQNRCIIANRHRFAELPEPRLDRTFVMPLGTPPQLHVETLPPAE
                     ESAKGSDHLPRTAVLVRTWFDFHYTEEDIMYLRSLISELSLMTGGEYTVHFLIHVKDD
                     NLQIWSDDETYDRVLRDSLPEEFRGMGTLWSERQMNLIYGGLQESFERGLPVHGVYRS
                     TFMPVQYFSHLHPEYDYVWNWEMDVRNTGHWYHFFDKARNWARKQPRKGLWERNSRYY
                     VPSVHGPWEDFMHTVRVQTELGTNNPNNMWSAVKDSEDTSDPNHKDHGRHGDKFIWGP
                     ERPHESDVMELDVDGVPPTTIEKDKYDWGVGEEADLIVLNPLYDPEGTTWLLRNDVTG
                     YNRDEGLPPRRAAIITASRLSRKLLSTMHRETSMKRHTMFSEMWPATTALHHGFKAVY
                     VPHSMYIDRKWPTRYVEAVFNGGRNGASGGARTSIFGDREHNFRGTTWFYSAGFSPNL
                     WRRWLGYRVDNDGGEEEELAGEGRICLPPMLLHPVKDVQLVIDDGGIPAEDQISDQVR
                     EPDRPQ"
     gene            <1551758..>1552114
                     /locus_tag="TRUGW13939_03001"
                     /db_xref="GeneID:55990507"
     mRNA            <1551758..>1552114
                     /locus_tag="TRUGW13939_03001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486187.1"
                     /db_xref="GeneID:55990507"
     CDS             1551758..1552114
                     /locus_tag="TRUGW13939_03001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342080.1"
                     /db_xref="GeneID:55990507"
                     /translation="MKFFATTAIFSLLGATLAAPSAAPLDRRLKVDGVLACLDPTVTL
                     VINELKSLEQTKVDKLIHDLLSGAEIKSELESVGGITQDVTQLLSCLSLGLGDVDAQL
                     GDTVIGLLESLHLVPS"
     gene            complement(<1552846..>1554881)
                     /locus_tag="TRUGW13939_03002"
                     /db_xref="GeneID:55990508"
     mRNA            complement(join(<1552846..1553855,1553903..1554555,
                     1554611..1554720,1554771..>1554881))
                     /locus_tag="TRUGW13939_03002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486188.1"
                     /db_xref="GeneID:55990508"
     CDS             complement(join(1552846..1553855,1553903..1554555,
                     1554611..1554720,1554771..1554881))
                     /locus_tag="TRUGW13939_03002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342081.1"
                     /db_xref="GeneID:55990508"
                     /translation="MEDSPPAVRALREKFGDRKPPDIRRKITACVACRKQKIKCHMIY
                     GQTPCSRCKKRGLSCTVNRSLQMLLEDDVTWKDSVSNKLQQLEDCITRIATKVDIPDI
                     HLQPRNHSETPSPPAAVVFSKSSSQTPISSVGEERLSPRTWAVVMDPRGGPASIPASC
                     VSEIRTTASLGQLPCSDRLDLITTGILSSHQALSLFEIYHSRLDHFLYRILGDHTSLD
                     SVRTGSPLLTAAVCTVGALHSSSLGHLFETCYREYRNLVATSSFSPGMKADDVRGLCI
                     GAFWLHELSWALVGTAVRVGSGIKLHHGIYRALNGDREGYLQTRLYCLLYVCDHHFSV
                     AYGRPPMSREGFIIDCASQFLETEHATEDDARLVSQVKEWSILGKVFDTFGVDVDTPI
                     PPHSLPQLRRFSIALDSWHADWNEAFKANQNVGNYPQKGVGLHYHFAKLYLCSHAFRG
                     VPPAQDSRQCLTPEMEEVANIGVLSAMSILRVIVSDDEFQSFLNGLPLYFDTMIAFAV
                     VFLLKIATKYATAIRIDTAQILTLVTQIVIALRDITRNMHRQHLLVTIAAGLEKLLSK
                     CQESAHHIQKSISHPAQASYHAQNDTSWMESITDFDFLTNFSSVGDWSFDYSAPITPR
                     HTT"
     gene            <1558601..>1559362
                     /locus_tag="TRUGW13939_03003"
                     /db_xref="GeneID:55990509"
     mRNA            <1558601..>1559362
                     /locus_tag="TRUGW13939_03003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486189.1"
                     /db_xref="GeneID:55990509"
     CDS             1558601..1559362
                     /locus_tag="TRUGW13939_03003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342082.1"
                     /db_xref="GeneID:55990509"
                     /translation="MMNQNSTQSHAPERCKIPELRLTSSTRSSSERRNSGISEPTEPL
                     PWNHAHVLGMRLRHAELQTAVQSWILNELGMAMYQLYQEFQPRMPTSTQPPQMHQQMQ
                     TLLNSLWDAVPDLTLRESMRERAEHALAQKGLAERGFDVQHPPFYRPYVPATTMGMEP
                     FQLRCEDVQTAPEEPCSIEIHKQGHSQPIVRLPQPDEKKYGLGENGPRMATAETPGTE
                     YQLVNGACHILSADVECCVDVSCKQQEGMTADMDG"
     gene            <1560133..>1562291
                     /locus_tag="TRUGW13939_03004"
                     /db_xref="GeneID:55990510"
     mRNA            join(<1560133..1560787,1560850..1560956,1561014..1561549,
                     1561627..1562080,1562142..>1562291)
                     /locus_tag="TRUGW13939_03004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486190.1"
                     /db_xref="GeneID:55990510"
     CDS             join(1560133..1560787,1560850..1560956,1561014..1561549,
                     1561627..1562080,1562142..1562291)
                     /locus_tag="TRUGW13939_03004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342083.1"
                     /db_xref="GeneID:55990510"
                     /translation="MASLTEAEKKANHVISLPKPPRVSSLGKPVDAQAVAQQWLSGLE
                     TALSSPSITSDQIENLFHSDSYWRDHIALQWDFRTIQSVSKITSFLQEFQPVCQLSKL
                     SLQADGKYVPHISTPEDGNPGIDFLASMFHFETKVGQGTGILRLTLNDAGDQWKAYAI
                     YTSLQELKGVEEPLGPKRVYGTLDSMPNGSAGGTWKERREKTLKLEGGQQPTVLIIGA
                     GQSGLNLGARLQSLGVSTLLVDKHERVGDNWRKRYRTLVTHDPAEFTHLAYLPFPKNW
                     PQFTPKDKLGDWFEAYASIMELNIWTSTTVSSASFDDNKSEWTVVVTKPDGFERTIRP
                     QQVVFATGHSGEPKIPTFPGQDNFKGTIYHGSQHRDASEYDVRGKKVVVVGTGNSGHD
                     IAENFYENGAEVTMLQRQGTYVLSLDKAVFMLHEGTHDEWGPPTEQADIWGESLPYPI
                     GLAFSVYLTQRISVVDKEMLEGLDKAGFEVYKGIDNGGISRLYYTRGGGYYIDVGASK
                     HIIDGNIKVHKSPEGIKGFEPHELVLADGKKLDADFVVLATGFDNMRTTVRKVLGDKV
                     ADRCKDVWDLDEEGELQAIWRPSGHPNFWYMGGNLALCRIYSKFLALQIKATEQGLIP
                     KVQPNGLPN"
     gene            complement(<1562494..>1563312)
                     /locus_tag="TRUGW13939_03005"
                     /db_xref="GeneID:55990511"
     mRNA            complement(join(<1562494..1563020,1563084..>1563312))
                     /locus_tag="TRUGW13939_03005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486191.1"
                     /db_xref="GeneID:55990511"
     CDS             complement(join(1562494..1563020,1563084..1563312))
                     /locus_tag="TRUGW13939_03005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342084.1"
                     /db_xref="GeneID:55990511"
                     /translation="MYRLVVLASLVLSVMAQQFTEAPVITGNKEVVYTASLFNSKAST
                     IRGNISATAGPDGIGLWFRVSLTGLPENVGPFPYHVHNDKVPSDGNCTAAGSHLDPYN
                     RTEVPPCDSSQPATCQLGDLSGKHGAATVASGVTDFYVEYTDYYLSDRSESIAFIGNR
                     SIVVHAANGTRLNCGNFVLGSDQLPVPFSQPRPSSSASIPPAKTVVPIATPASSSAVT
                     PNPSNAIVRGAASKATGMSLGGLIMAIAAFALF"
     gene            complement(<1564080..>1566434)
                     /locus_tag="TRUGW13939_03006"
                     /db_xref="GeneID:55990512"
     mRNA            complement(join(<1564080..1564249,1564314..1565043,
                     1565103..1566132,1566198..1566283,1566357..>1566434))
                     /locus_tag="TRUGW13939_03006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486192.1"
                     /db_xref="GeneID:55990512"
     CDS             complement(join(1564080..1564249,1564314..1565043,
                     1565103..1566132,1566198..1566283,1566357..1566434))
                     /locus_tag="TRUGW13939_03006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342085.1"
                     /db_xref="GeneID:55990512"
                     /translation="MSDQIASPPKSRIRTACRRCQRRKIKCGGEFPSCSSCQKAGVSC
                     VREGKQEVQRSYIAGIEQRVKWLESLVRESRPDINLDSGPGNAADNTAPNQPNLPEGV
                     TLPSPSSPMRFENLGRLPEEPLGGNAPARQAEVEIQLENPIEAPRHRHLKQAHEIGLV
                     SLSPGGEARYIGPSSGYFFADLVFSRAGRRSQTRPRARATEKISHLVESPVASLPARE
                     DDAIKISSNYFQTTHLVYPFLHEQSHIKDIHLMYENSPAITPHVSFHVYMVLAIACCN
                     LSRQHKSQLPAEGYFNAAMKYFPGSCQENSLKGVQCLLLLIIYALHNPSCSVNIWNLL
                     YQCLASLIDLGLQRDIKVLPGLEVSLLEQEMRTRVFWVIYTLDRTLAILMGRPIGIRD
                     EACELRLPMDISDSQYEAGLTQERCADTPPTHITYAIHMFKLARLNSEVKYVMHSICR
                     DPPAYAYPPVRDMSAWQTDMIERLHYWAAGISINSCSDLATTMAEIRYHEAVLLVHRP
                     NPRVPEPSEDSLLVCFHHATEVLRKYGTLYRTDYSPLLYTRLTVHSVFLSTLIMLYTV
                     WKIPNIASRVSKHFEQFMADIKVASNMLSSIGEHWLEARKTRDCVDELSDATVKWLLS
                     GRVQLTETASHTNDPPLGASSLQNPELVARASSSSPPGFDSVEFFEEPGSLMSTEWSD
                     LPDFDNLMWEILNFK"
     gene            <1566731..>1567250
                     /locus_tag="TRUGW13939_03007"
                     /db_xref="GeneID:55990513"
     mRNA            join(<1566731..1566749,1566801..1567029,1567142..>1567250)
                     /locus_tag="TRUGW13939_03007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486193.1"
                     /db_xref="GeneID:55990513"
     CDS             join(1566731..1566749,1566801..1567029,1567142..1567250)
                     /locus_tag="TRUGW13939_03007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342086.1"
                     /db_xref="GeneID:55990513"
                     /translation="MTVVHIVFFKFRPEITEEHKATFVKELKQLKALPCVKNNRLIVG
                     GPSITNPIERSKGFEFALLSYHEDRKALEEYQKSDEHHRVTSTYMFPYKEDLMRFDFE
                     VDEEDEWMCMFGGKKE"
     gene            <1567628..>1568704
                     /locus_tag="TRUGW13939_03008"
                     /db_xref="GeneID:55990514"
     mRNA            <1567628..>1568704
                     /locus_tag="TRUGW13939_03008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486194.1"
                     /db_xref="GeneID:55990514"
     CDS             1567628..1568704
                     /locus_tag="TRUGW13939_03008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342087.1"
                     /db_xref="GeneID:55990514"
                     /translation="MSEATTTPQKLYPIPAPRLQEFVQSVLTANGVSPQNAQITASCL
                     VQADLRGVDTHGSNRIPSYMERIRQGVLDASADPTLSQTTPVVALVDGHNGFGFPAAH
                     MGMARAIEMAREFGIGMMSVKHSNHFGMSAWLVQQAIDAGMMSLVFTNSSPALPVWGG
                     REKLMGVSPIACGAPAGKSKPFILDMAPSVAARGKIYKALRRGEKIPTDWALDSEGKQ
                     TDDPAKALEGVMLPMGGPKGSALAIMMDLFSGVLSGSAFAGNVTGPYDPSKPADVGHF
                     LVAIKPDLFMGLDEFKERMDYLYQRVVGSEKAAGVERIYFPGEIEQDMKEERLQNGIP
                     LSEAEIEALNKEANRAGVDPLKVT"
     gene            complement(<1568897..>1570963)
                     /locus_tag="TRUGW13939_03009"
                     /db_xref="GeneID:55990515"
     mRNA            complement(<1568897..>1570963)
                     /locus_tag="TRUGW13939_03009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486195.1"
                     /db_xref="GeneID:55990515"
     CDS             complement(1568897..1570963)
                     /locus_tag="TRUGW13939_03009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342088.1"
                     /db_xref="GeneID:55990515"
                     /translation="MRLSTIITPLLCGLATASTCPYASKARSGSACPYASRARSDESS
                     TILNPRGMPVEGKKGVMMMNRIAPGISKLYVADSDGSNAQLLLGNQTTFDYHAQWSPD
                     GKWIVFTSERAGDGNSDLYRVRPNGTDLQPISTTPSVEDAGSISPNGSLVAFTGTLNN
                     HKANVWIKNLDTGALWNVTNSTEVAGDSALPDGHFRPAWSPDGEWLVFSSDRNTPWRG
                     HNNVSGWEHVQELSIYAVRPNGSDFRRVANKTDYCLGSPKFSPDGNRIVFYEIPTELT
                     YYSRVAEPAFYNVNTGVVSVDFATGADRVEHASADSGGIKTFPQYVDDNTIGFLVKSQ
                     LTNETYPGSINYTSASTQSDVSSRYLNTSLVGYYRSPSWSPDGSKIVYEHVEWDPVRA
                     IDKKMYSWNEEWEYRFTDIFPRMSPGGKVAYTSQQTENASLVIINPDGTESRDIFDSS
                     RFPVQVNGSNTNGTFQASWRDDGEVMAVGLGDWFEYRYESPGWVYLVSANGSWTRQIT
                     NGSTNAGFPTISPDGRWLVWREFDYTTDLVTPLGLRRMDLKTGDVVALTWGWDNTPMF
                     ALDGSDRIVFTRRTSTPVSGPLDDNYDVMTMAVDGSDLKRLTTMACNDAHATWTHDGK
                     ITWASGMFGFQDEAVIYDNNQQPYPMILQMEADGSNMTVLSESRWEDTMPLYIPNDIW
                     VKTGLN"
     gene            <1573234..>1574942
                     /locus_tag="TRUGW13939_03010"
                     /db_xref="GeneID:55990516"
     mRNA            join(<1573234..1573458,1573523..1573548,1573604..>1574942)
                     /locus_tag="TRUGW13939_03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486196.1"
                     /db_xref="GeneID:55990516"
     CDS             join(1573234..1573458,1573523..1573548,1573604..1574942)
                     /locus_tag="TRUGW13939_03010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342089.1"
                     /db_xref="GeneID:55990516"
                     /translation="MDVKPAAIEHLHSADSEKNASSDESLVRFVGSAEQAPQALLTWR
                     MFKLYAILSLGYMCIVLQGYDGSLMGAINSMPQYQRYFGLKAAGPSTGLVFAIFNIGS
                     LAAVPFTGPVNDHLGRRAGIFAGCCFVIIGTCVQAPATSNSMFLGGRFLTGFGQGFAN
                     VSAPTYVSELAHPRWRGPLSGLMQTNYYIGSIVASWVTYGTAFIDGDSSFRIPLWLQL
                     VSSGIVALGIWFGPETPRWLMAHNRRKDAERVLADLHGEGSPDHPDVRLQLAEMENKI
                     PKAGSDKRWWDYRELFNTRAARHRMICVIGMSWIGQYSGNVLVSYYFPVIVAQAGIDN
                     PHTQLLLNALNPVISLVAAVTGALLLDRVGRRPFLLSGVMGMSLCLAVITGCTKLSVD
                     SMNVAAGHAGIFFLYLFSAIFAFCLVPLLPFYVSETLATETRAKGTAVGQVVGSAASI
                     LGQYTSASAISSIGYRYYLVFIFWDLVEFAIIYFFFVETKERTLEEMTEIFEAPDPVQ
                     KSLEKRSDQTVKRTIGLESQD"
     gene            <1575596..>1576723
                     /locus_tag="TRUGW13939_03011"
                     /db_xref="GeneID:55990517"
     mRNA            <1575596..>1576723
                     /locus_tag="TRUGW13939_03011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486197.1"
                     /db_xref="GeneID:55990517"
     CDS             1575596..1576723
                     /locus_tag="TRUGW13939_03011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342090.1"
                     /db_xref="GeneID:55990517"
                     /translation="MALNVPLFPHNYQHGCLRQGDEIYTSARGLYITATNIDAIFRQY
                     TEPEQLQKSATELWRLLETGSLCIPPVMVGDMMRAWVGAEIDTRHSYTPGPRVFLQAE
                     FYYYIDLEWHQRRELIFVAVADDALEYLFAYTQLGKSPSTTANETLTIPRNATPINPD
                     VLMQFICAGRQKTADRNFRAAVSRTLQRIVRHSEFRDELEELPIATDAATCVGYVDSM
                     CQKFSPAIYAIPGQPMRVWPNTIPDQAPVTSFNFLNSVSTSENLVLVVGDSDDRDWEG
                     MRNDEVTPSLGLFAFGNPYTQIPRDHLIDALKLAKTPRFRTYQTVLRGRYHGDMSGKI
                     DNQVGSQQVLAGDTPREKNLRIRAESTTGIDQWISELSSLR"
     gene            complement(<1576886..>1577761)
                     /locus_tag="TRUGW13939_03012"
                     /db_xref="GeneID:55990518"
     mRNA            complement(<1576886..>1577761)
                     /locus_tag="TRUGW13939_03012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486198.1"
                     /db_xref="GeneID:55990518"
     CDS             complement(1576886..1577761)
                     /locus_tag="TRUGW13939_03012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342091.1"
                     /db_xref="GeneID:55990518"
                     /translation="MLDLTDKVVLITGLGQTAPFPETEEKGSWGIGAALATLFARRGA
                     LIFGGNRSLSSAERTKARIDSESISNNNNNNENNKNRSVCDVMVADLTDAASVKALVD
                     ACMAKHGRIDILINNVGRSEPGCPATMAEDVWDAQVDINLKSVYLTCHHVLPIMERQA
                     TGGAIINVSSIAGLRYIGKPQVAYNATKAAIIQFTKATAVIYAAKGVRLNTVVPGLIY
                     TPYTKALAKRFAGESMLEEEYMRIRDEQVPMKMMGDAWDVANAALFLASDEARYVTGQ
                     EIVVDGGITGSTGRT"
     gene            <1581648..>1583255
                     /locus_tag="TRUGW13939_03013"
                     /db_xref="GeneID:55990519"
     mRNA            join(<1581648..1581755,1581807..1582193,1582251..>1583255)
                     /locus_tag="TRUGW13939_03013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486199.1"
                     /db_xref="GeneID:55990519"
     CDS             join(1581648..1581755,1581807..1582193,1582251..1583255)
                     /locus_tag="TRUGW13939_03013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342092.1"
                     /db_xref="GeneID:55990519"
                     /translation="MEAETKNDLGVDEKRLHDDEQNEKAAEAAVLATPTKIAWDGPED
                     PSNPLNWPSSRKISIGIIISLGQLVCLMTTSIVAPALPQIAKDLGLGASETQMSFSIF
                     VLGQGIGSLFIGPLSEVFGRKPLWVSCTFFFILWNSLCPVGKSKVMLIIGRVLSGAGG
                     SCGVILSGPIMADMYPKKDRGKSLAIASLFPYLGPALGPIVGGLVSQHVSWPWLFWVM
                     SIFSAVIVIAGMLIIRESYKPIILKHKADRLRTQGVMEAADAESSPQSLLSKIGVSLS
                     RPLRLLATRLVVQLLALILGLAFGTYVLVLSFFARVFIDQYDQSATSSSLQYIAIALG
                     CTLSTQTGGRLMDFIYARLHTRQPEGAPALPEFRVPILLIGGLLLPAGLFWLGWSAQG
                     HAHWIMVDIGALIFTAGDFLASQAALAYILDEFPTHAASAGAASRIVSNILGFTFPLF
                     APQLYDRLGYGWGNSLLALIWIVVALPVSLAIWFWGNKIRRVGKSKKDE"
     gene            <1583801..>1584127
                     /locus_tag="TRUGW13939_03014"
                     /db_xref="GeneID:55990520"
     mRNA            <1583801..>1584127
                     /locus_tag="TRUGW13939_03014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486200.1"
                     /db_xref="GeneID:55990520"
     CDS             1583801..1584127
                     /locus_tag="TRUGW13939_03014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342093.1"
                     /db_xref="GeneID:55990520"
                     /translation="MDQKPSSLWKIFALSRACSSRGATLVLLLWGSLISAVCFVYFCL
                     YNYIHVKRTHRVLPTYSNTSMSLGSQKEKQQQRLRDVESNLDLEQGLPARSYNLPRTA
                     NVRFRR"
     gene            complement(<1584596..>1586125)
                     /locus_tag="TRUGW13939_03015"
                     /db_xref="GeneID:55990521"
     mRNA            complement(join(<1584596..1584773,1584835..1585187,
                     1585256..1585716,1585788..1585899,1585964..>1586125))
                     /locus_tag="TRUGW13939_03015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486201.1"
                     /db_xref="GeneID:55990521"
     CDS             complement(join(1584596..1584773,1584835..1585187,
                     1585256..1585716,1585788..1585899,1585964..1586125))
                     /locus_tag="TRUGW13939_03015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342094.1"
                     /db_xref="GeneID:55990521"
                     /translation="MATTNGTLRHIPLSYNNADSQASALRLVLSINPHWEGADNRIEF
                     IRFTDGITNTLLKIINRKPGLTEEQIDAEAVLMRAYGNHTEILIDRERETRSHTLLAQ
                     YGLAPPLLARFQNGLLYRFIRGQPTKPADLVEPAIWKAVARRLGQWHATLPVISHASS
                     QAANSSDGEGAVFRPEKTIPVQKGDDITPIRPRQAGPNTWTVMQKWILALPAGTEEER
                     LRRHGLQKELERIVAELDDGNGIGEDGLIFAHCDLLCANVIMIPPTTNGATHSHQDVE
                     EVHFIDYEYATPSPAAFDIANHFAEWGGYDCDYNMMPTRSIRREFLTEYVKSFVKHGG
                     KGADSDQQKVVDKLFQDVDRFRGIPGFYWGVWSLIQATISQIDFDYASYAEVRLGEYW
                     AWRHEQDGTRAQNTGEEMPLRERRWAQEA"
     gene            complement(<1587627..>1588734)
                     /locus_tag="TRUGW13939_03016"
                     /db_xref="GeneID:55990522"
     mRNA            complement(join(<1587627..1587942,1588023..1588548,
                     1588629..>1588734))
                     /locus_tag="TRUGW13939_03016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486202.1"
                     /db_xref="GeneID:55990522"
     CDS             complement(join(1587627..1587942,1588023..1588548,
                     1588629..1588734))
                     /locus_tag="TRUGW13939_03016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342095.1"
                     /db_xref="GeneID:55990522"
                     /translation="MAAKCVHKGCGKVFSDPEEDCVYHPGPPVFHEGQKGWKCCKPRV
                     LTFDEFLTIPPCTTGKHSTVDDTPQEEPPKADASNIATLAEKLDEKAPPTTQPVAAPT
                     AAVPPPSTPAPPPEPDSDDPSLAIPANATCRRKGCNATFNPDILRDNETCTHHPGQPV
                     FHEGSKGWSCCKRRVLEFDEFMKIAGCTEKKRHLFVGKGKAAGEEKIDDVRNDFYQTA
                     TTVNVSLYLKKIDKERAKVTFSANAVEFDLPTTDNKRLKKTYGLFAAIDPEASQYKIF
                     GTKLELKLAKADGQSWPVLRSDDRWTGERIQIGQAGRIA"
     gene            <1589023..>1589331
                     /locus_tag="TRUGW13939_03017"
                     /db_xref="GeneID:55990523"
     mRNA            <1589023..>1589331
                     /locus_tag="TRUGW13939_03017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486203.1"
                     /db_xref="GeneID:55990523"
     CDS             1589023..1589331
                     /locus_tag="TRUGW13939_03017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342096.1"
                     /db_xref="GeneID:55990523"
                     /translation="MHFTRALLNSNAARLTLYTRANCGLCDTAKLTVSKLQKRKAFDY
                     AEVDIMVPEHKQWKDVYEFDVPVLHVQPPRSDKESELRKLFHRFSEAEVEKLVTEAER
                     "
     gene            <1593425..>1593895
                     /locus_tag="TRUGW13939_03018"
                     /db_xref="GeneID:55990524"
     mRNA            <1593425..>1593895
                     /locus_tag="TRUGW13939_03018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486204.1"
                     /db_xref="GeneID:55990524"
     CDS             1593425..1593895
                     /locus_tag="TRUGW13939_03018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342097.1"
                     /db_xref="GeneID:55990524"
                     /translation="MVNPVWGMWIDKINNDVLNAIENDSVEMEAIISRASKGISFLTA
                     NGMAMNDIAVYLNNNNLPRKDVYAKNFGSNPLMPIVYDLQSDTVWRRSERARNVISWI
                     LESTSVNLQTMIELEKKKRDEASQAYLTAQRNVTAIEDIFGISNSDAPLQAVLR"
     gene            <1594234..>1595253
                     /locus_tag="TRUGW13939_03019"
                     /db_xref="GeneID:55990525"
     mRNA            join(<1594234..1594344,1594412..1594491,1594581..1594596,
                     1594652..1594823,1594898..>1595253)
                     /locus_tag="TRUGW13939_03019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486205.1"
                     /db_xref="GeneID:55990525"
     CDS             join(1594234..1594344,1594412..1594491,1594581..1594596,
                     1594652..1594823,1594898..1595253)
                     /locus_tag="TRUGW13939_03019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342098.1"
                     /db_xref="GeneID:55990525"
                     /translation="MIAVRIPQKTVLLAAAKADTTTGVIRTKAEIAIGTGIFMMSIGW
                     MVGQNRRFAWDNQATRHAAWTISEKVLYNISLYQLAARQYVSFGICLRSGAIDNKRNQ
                     SMNELEVALWDYFDTSYLSMAGFPVVLSRKAWIIAINKTGLHFKSTNIRSSAVGFFFA
                     EFSKRKEAYYGRGRSEFLPPLANTYYLVRWLGHGPEYDAWYHVDDLSDAKDLIEDFEK
                     SATVAGPQQRRGRPPRGGGRRRLQRN"
     gene            complement(<1596582..>1597826)
                     /locus_tag="TRUGW13939_03020"
                     /db_xref="GeneID:55990526"
     mRNA            complement(<1596582..>1597826)
                     /locus_tag="TRUGW13939_03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486206.1"
                     /db_xref="GeneID:55990526"
     CDS             complement(1596582..1597826)
                     /locus_tag="TRUGW13939_03020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342099.1"
                     /db_xref="GeneID:55990526"
                     /translation="MDMDWEEDGDVSDIADLDSSLQDFDISLYAIWMASHEVDQKYLG
                     LLAGATSLENPFLSSMLYKILGLSVILSKKLLRARKLRRLDPTRETKSLQLYHHIIWL
                     SREGLVVVEQYILPMVQDYIELKVLAYKLRASFYHIFVLFHNQPAIHTPGISSLPSSS
                     NLQNGNGHAPAASSSEANRASISTTPPTTEGGPVKKASHGGPPGLPSIPKSKLTTSFL
                     LPALDYTMTATPCFVQAATICDTLLPGSHPLRLSVKLEYAAYLYDCLHDADSCRRLAK
                     QAIADVYNAQEGMDDESFEDAAELVAVLGRMVKRGGKTSSAGGSSTAGRDRSRSNDGQ
                     SIISKGTPPKQAPHTPIQQQQTPPRQRTPTRKSNSPASTKAKPSPAASHFKTKATPKQ
                     SPSTVSGGSTTPKEPVPIINPI"
     gene            <1602307..>1603003
                     /locus_tag="TRUGW13939_03021"
                     /db_xref="GeneID:55990527"
     mRNA            join(<1602307..1602453,1602584..>1603003)
                     /locus_tag="TRUGW13939_03021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486207.1"
                     /db_xref="GeneID:55990527"
     CDS             join(1602307..1602453,1602584..1603003)
                     /locus_tag="TRUGW13939_03021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342100.1"
                     /db_xref="GeneID:55990527"
                     /translation="MGPPELPVPLNASLSEDGDPVKLFRCWVRQSCDDCISMSNDVDC
                     SWCPYSSTCVPNPSAKYPLLAPIDYPNICPMGAKERWELRARGLGCNVSTRNFLSVSV
                     AVVSSFALMGLLALLLTCLKAAVRSCSQERSRRERGYLGVVLFRGGDGRSDDNEDPYD
                     RRQRRRQRHRVGVIDERSSLLRRESEGV"
     gene            <1603316..>1604193
                     /locus_tag="TRUGW13939_03022"
                     /db_xref="GeneID:55990528"
     mRNA            join(<1603316..1603357,1603425..1603452,1603512..1603546,
                     1603611..1603766,1603823..1603925,1603982..1604001,
                     1604071..>1604193)
                     /locus_tag="TRUGW13939_03022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486208.1"
                     /db_xref="GeneID:55990528"
     CDS             join(1603316..1603357,1603425..1603452,1603512..1603546,
                     1603611..1603766,1603823..1603925,1603982..1604001,
                     1604071..1604193)
                     /locus_tag="TRUGW13939_03022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342101.1"
                     /db_xref="GeneID:55990528"
                     /translation="MAGFPNVKPAFTVRVLIDDSIPVGSHHRKTSLIVVPMIGGTVTA
                     EPGSTPALNATFVGTGNDYIHGDPDQKRLRLDARSVLKTDDGAFIYVNYKGTVNVTED
                     LSKVLGGTAGDLETPYGDSFTYFNFETGDERYKDLENGVYIGQGHFISKVGEKVIVEY
                     KVSQVIMG"
     gene            complement(<1604288..>1605399)
                     /locus_tag="TRUGW13939_03023"
                     /db_xref="GeneID:55990529"
     mRNA            complement(join(<1604288..1604399,1604477..>1605399))
                     /locus_tag="TRUGW13939_03023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486209.1"
                     /db_xref="GeneID:55990529"
     CDS             complement(join(1604288..1604399,1604477..1605399))
                     /locus_tag="TRUGW13939_03023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342102.1"
                     /db_xref="GeneID:55990529"
                     /translation="MLKILFQPLNPPHLPPATTFHNQTVLVTGSNTGLGRETVRHALS
                     LGASNIIMGVRSLSKGKEASDDILSSIPNASEKTIEVWELDMSNFQSVMAFARRVKDY
                     VENEGKRLDVAVMNAGIASLDWNLSADNWEMSIQVNGLSTALLSLELLPILVRQSSSQ
                     TPKTSEGKRSKPRLIIVASDVHQAALFPQRTAPDILAALNDKAQWEQAQAKNPIERYG
                     VSKLFSQWINIELSKLVPVDELTREPSVVVTSATPGLCASELMREGTPWVFRILVALF
                     ARTAKVGSKAIVDAAARDDGHGKWFENQKPTEPGKIVSSSEGKALRAKAWKEIIEVLI
                     KVDPELKLSY"
     gene            <1606369..>1608305
                     /locus_tag="TRUGW13939_03024"
                     /db_xref="GeneID:55990530"
     mRNA            join(<1606369..1606537,1606603..>1608305)
                     /locus_tag="TRUGW13939_03024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486210.1"
                     /db_xref="GeneID:55990530"
     CDS             join(1606369..1606537,1606603..1608305)
                     /locus_tag="TRUGW13939_03024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342103.1"
                     /db_xref="GeneID:55990530"
                     /translation="MRSALSLLALATAVTTTASPLAGPQQHQQPLLELEPQLGAEKKP
                     SRALTGKFLHVTDLHLDRFYKPGSSTDGDEACHHGNGNAGYLGSAGNDCDSPESLINE
                     TFDWIEKNLKDEIDFVVWTGDSARHDNDERIPRTENQVEEFNAVVAKHFERVFRSDPN
                     QDPVAALSIPIVPNIGNNDVMPHNIFEKGPNRWTEILSNLWNHFIPEEQRHTFMQGGW
                     FNSEVIPNKLSVFSLNTLYFFDSNNAVDGCAQKSEPGYQQMEWLRVQLQIIRERGMKA
                     ILMGHVPPARSGDKQAWDESCWQKYTLWLRQYRDVVVGSLYGHMNIDHFMLQDSEDVD
                     IDNLLLDLPSPRFIEDSDYENFTVQSKASYLTSLRDQWGSFPSPPGSVKDEWSTTDTS
                     VIGTAKGKKRGGKKKRKREFFKKIHGPYAERFSISMVSPSVVPNYYPTLRVMEYNITG
                     IENTPTWVDVQNMDTNERKSNFWDEREIELQKSKLRVPAGPGKNAPPGPAYSNQPLTL
                     LNYAQYYANITESEQSSPPSSSLSSHRIHYELEYRTQDDGVYDLPDLTVRSLFQLATQ
                     IGAGATNGANIQTDELTSDSDIDRKKKKKKKKNKAWRTFLERAFVGLLDDDKFEDIA"
     gene            complement(<1608643..>1609810)
                     /locus_tag="TRUGW13939_03025"
                     /db_xref="GeneID:55990531"
     mRNA            complement(join(<1608643..1608846,1608910..1609624,
                     1609686..>1609810))
                     /locus_tag="TRUGW13939_03025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486211.1"
                     /db_xref="GeneID:55990531"
     CDS             complement(join(1608643..1608846,1608910..1609624,
                     1609686..1609810))
                     /locus_tag="TRUGW13939_03025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342104.1"
                     /db_xref="GeneID:55990531"
                     /translation="MEAKHQRGVSQRPHIKPMGNPREETEKGVTFLKSFSHLIAGATA
                     GMVTAVLTSPLDVLKTRLQSDFYQSQLKKANPNLPLYKSSLLHFRETFGILFSIHRLE
                     GWRGLFKGLGPSLTGVVPATAIKFYAYGNCKTLYPQILGCEENTTLVHALSAATAGAV
                     TGTATNPIWLVKTRLQLDKSRVRESGSSGVPQYKNSLDCVKQVIRQEGVKGLYRGLAA
                     SYLGVIETTLHLAMYERMKSFLARQNASQDGTPSSQATQGIALSSAAGFSKLLAVLIA
                     YPHEVVRTRLRQAPMANGRLKYTGVVQCLRLVWREEGMVAIYGGLTAHVLRTVPAAMI
                     TLGTYELVLKLLS"
     gene            <1610528..>1612439
                     /locus_tag="TRUGW13939_03026"
                     /db_xref="GeneID:55990532"
     mRNA            join(<1610528..1611080,1611151..>1612439)
                     /locus_tag="TRUGW13939_03026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486212.1"
                     /db_xref="GeneID:55990532"
     CDS             join(1610528..1611080,1611151..1612439)
                     /locus_tag="TRUGW13939_03026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342105.1"
                     /db_xref="GeneID:55990532"
                     /translation="MSTTDRDKESNSIEPPALPSKISYWRMLIDQGVVTSDIFNHPYS
                     GSGLEDDPYIVGWIPDDPRNPMRLNRSLKWAFTVMCALSTFGVSLASSAYAGGIDEVI
                     SSFNVSQEVATLGVSVFVLGFAIGPLFWGPLSELYGRQVVFLVSYLGLAVFTAGATGS
                     KNIWTLIILRFFAGSFGSSPFTNAGGIIADVFSAEDRGLAISLYTGAPFIGPTLGPVI
                     GGFLGENAGWVWVQGFLATLAGVIWAVEGLVIPETYGPLLLRKRAARLSKLTGKVYIS
                     KIDNERPKVTNSEAFSTALGRPWVLLFAEPIVLLLSIYMAIVYGTLYLMFSAFPIVYQ
                     EQRGWSQGVASLPFLSVLTGMLLALVYNMWDNQRYKRIHVKCHGFAPPEERLPPSMIG
                     GIAVPIGLFWFAWTNQASLHWIVSVVAAAPFGFGMVLVFLSIMSYLIDSYTIFAASAL
                     AANSIIRSCFGAVFPLFTTYMYHNLGIHWASCVPAFLSLACVPFPFLFYRYGPAIRRR
                     CKFAAEADDFMRMLQKEAFTATPAEKATPNSNVGAETEEGYVQDRPHRVSDASLNESG
                     RLSSESLALEPVVTYEGNPYDIDRVNTQSSAITNKSKSRSIKTWQKK"
     gene            complement(<1612755..>1614609)
                     /locus_tag="TRUGW13939_03027"
                     /db_xref="GeneID:55990533"
     mRNA            complement(join(<1612755..1613130,1613185..1613383,
                     1613439..1613526,1613598..1614147,1614206..1614480,
                     1614532..>1614609))
                     /locus_tag="TRUGW13939_03027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486213.1"
                     /db_xref="GeneID:55990533"
     CDS             complement(join(1612755..1613130,1613185..1613383,
                     1613439..1613526,1613598..1614147,1614206..1614480,
                     1614532..1614609))
                     /locus_tag="TRUGW13939_03027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342106.1"
                     /db_xref="GeneID:55990533"
                     /translation="MAIKNRSGGINFHNVLVTIAVSFGSLTYGYSSSIISSTIGQPGW
                     YSFFNLPSEGEPGYGTTTTNAIATANGLYSAGGAVGSLFIMWSASAIGRKRNIQLGSL
                     LVLLGGALQAGATNLNMFQAGRFIAGLGVGNLVTICPMYLSEISPPQSRGFLVGHHAI
                     FLVFGYMLSAWLGFACYFATEKNPSFAWRFPLSMQCFGPLVLFLSSIFITDSSRWLLQ
                     QGRAEEAWTVLKKLRSNPSDPDDLAIREEMYQIKQQLALEQARLQASGCNPWTAVLKK
                     RSYRKRMIIGFLTQWGAEFGGPLVINNYFVILCTNLGQTGYMPLLLSAVWLTTAGLIY
                     NPFGAWLHDRVNSRRWMFIVGFMGCLVTTSGLAGCIAQYSGTSNKGGNAAGLFFIFLY
                     LAFQGSCCDTTMYLYISEIFPMEIRGIGMGFSLFGQFAATLVLLQTAPIGIQNVGWKY
                     YLVIICWCIFFIPVVYLFWPETAQLSLEEIASQFGDDVAVQLHGLPENQRRELDDFLR
                     EKDITHMEEVVQP"
     gene            complement(<1615280..>1616404)
                     /locus_tag="TRUGW13939_03028"
                     /db_xref="GeneID:55990534"
     mRNA            complement(<1615280..>1616404)
                     /locus_tag="TRUGW13939_03028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486214.1"
                     /db_xref="GeneID:55990534"
     CDS             complement(1615280..1616404)
                     /locus_tag="TRUGW13939_03028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342107.1"
                     /db_xref="GeneID:55990534"
                     /translation="MVSRKKLLILAGDHVGPEIIQEAIKVLGVVAELRPDIKIDIEHG
                     LIGGSSLDAHGVPISDQTLENAASSHAVLLGCVGGPEWEGVPGHLRPEMGVLKLRKRL
                     DAFANIRPCRFFAPSLIDRSTLKPEIVAGVDFTVVRENCGGAYFGAKDEREDIGSDLW
                     VYEKAEIERCARVSAALAMQLSDCGKKRVVWNADKANVLASSRIWRRITHETFSREFP
                     ELKLKDQLADSMAMLLVKSPTKFNGIIHTDNTFGDILSDISGGIIGSLGVLPSASISS
                     VPGQGPCKGVYEAVHGSAPDISGKGIANPVGQILSLALLLKYSFGMAEEAVRLEKAVQ
                     IVLDSSDHQGLGIRTPDLGGSASTKEVGDAICAVYRAGFS"
     gene            <1616800..>1617697
                     /locus_tag="TRUGW13939_03029"
                     /db_xref="GeneID:55990535"
     mRNA            join(<1616800..1617368,1617447..1617606,1617674..>1617697)
                     /locus_tag="TRUGW13939_03029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486215.1"
                     /db_xref="GeneID:55990535"
     CDS             join(1616800..1617368,1617447..1617606,1617674..1617697)
                     /locus_tag="TRUGW13939_03029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342108.1"
                     /db_xref="GeneID:55990535"
                     /translation="MPGRLAGKVAIVTGAASGFGKGIAAKFVEEGAKVIIADLSEDAG
                     LKAAEDLKCTFFKADVTSRDHWQSLLNETLNKYGSLDIVINNAGATYANKPTGSVTDK
                     DFDLVWNVNVKSVYLSSNVIVPYFIDNNRPGVFIQISSTAALRPRPGLTWYNASKGAV
                     SIATKTMAVEYGPNQIRFNSICPVVGSTGMTHLFIGKPDTEDNRSSFVSTIPLGRPST
                     PADVANACCYLASDEASFITGVDLEVDGGRCV"
     gene            <1619135..>1621359
                     /locus_tag="TRUGW13939_03030"
                     /db_xref="GeneID:55990536"
     mRNA            join(<1619135..1619944,1620013..1620737,1620798..>1621359)
                     /locus_tag="TRUGW13939_03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486216.1"
                     /db_xref="GeneID:55990536"
     CDS             join(1619135..1619944,1620013..1620737,1620798..1621359)
                     /locus_tag="TRUGW13939_03030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342109.1"
                     /db_xref="GeneID:55990536"
                     /translation="MEESTDAPFLPSGAGSGLDPYAIPGNMADQLVSPGPYVDGEITD
                     LLSNGISLGYGGLDWLDIQLQEHLPPINIAINTAHSKELIMTPPTDVCYQSGHEIHLL
                     SSPSWHNATQSQNMPMNPAFPRPGPTQPTVHQWPFDGTREQVHPRYRLSPLRDVLQGI
                     FNSTPNSSNPLMRSLVDLLSNKYVPKLDENTNDYEALRAMHLLQRAVDSFISQFHSVL
                     PTIHIPTLKLSSCPTVLLTSMACIGAMLLEDTDALDKAEAFSKICATVILWLGGSDAN
                     SYCDLDYLTACCFYQIYSLGSGNRQLYQDADRSRGVLIGSLRGMGLFKSQIPYEVDKS
                     VPQLQASAGTAETEASWLQWRNQEQEKRLAWSVFEYDCSLCTLTNRRGMVDLGELPSK
                     LPCPEALWEAPSAQAWRTLSSRSSTVYFGLSLMLVIRAITAGKKMPNGLSSWGRRLCG
                     QVIGRLLWDLKQMEGMSILRSLGLPPLFSVENQTKFKLLQTFDNLAREIPNPESTKEL
                     IDSNITQLIIHYSFLNSAENVMELVVFLVRVSATKVSPSGEANLDAAKRQLRKSFGSD
                     LCLTRKLVWHAAQIIGVADEYLVSAPCEILRVFMGCIFLIAFAKYSPAISGTGSSNTV
                     ELDRISKEPGQTELVNAWIRNGGTATIAGAEATNSSQFVAHINNHTQDLMRKVHFWGL
                     SQKFSQILQIFQDIDS"
     gene            complement(<1621496..>1622569)
                     /locus_tag="TRUGW13939_03031"
                     /db_xref="GeneID:55990537"
     mRNA            complement(<1621496..>1622569)
                     /locus_tag="TRUGW13939_03031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486217.1"
                     /db_xref="GeneID:55990537"
     CDS             complement(1621496..1622569)
                     /locus_tag="TRUGW13939_03031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342110.1"
                     /db_xref="GeneID:55990537"
                     /translation="MGEPMREEAESSPSVSRLGSRKDEILALHKCPYDKLPNPKRVWH
                     GEPNSRDEGLGRLVILTPEIVAAAASNIKSGRRVSLSWGMDKLDIANFNRHPSQHHVI
                     PLMNGFAFDDIYIFNPQQSSQWDGLRHFSAPSEDNPSKRVFYGGVESSEIMDRKNTRI
                     GLQHWAKEGICGRGVLLDYVEYAARHGIKYSLFSDHAISLSTLQDVAKEQGVTFQYGD
                     LLFIRIGLVQEWESRMTMEDKMAYASSTNPQHAGIEGTEEMLRWIWDTGFAAVAGDAI
                     SFEVYPPQKEYRRANGDPSVEGVFMHEVILAGWGMPIGELFDLEELAQICKEENRWEF
                     FIASAPLNMPGGISSPPNCLAIF"
     gene            complement(<1623002..>1624604)
                     /locus_tag="TRUGW13939_03032"
                     /db_xref="GeneID:55990538"
     mRNA            complement(join(<1623002..1623145,1623210..>1624604))
                     /locus_tag="TRUGW13939_03032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486218.1"
                     /db_xref="GeneID:55990538"
     CDS             complement(join(1623002..1623145,1623210..1624604))
                     /locus_tag="TRUGW13939_03032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342111.1"
                     /db_xref="GeneID:55990538"
                     /translation="MTSTHDDSNMDKEYPFKLSDPDLLRSDCYINGEWVPSVSGKRFA
                     VEDPGSLQPWTSCPDCVPEDVDQAVQTTYTAAKSYSKFTPRKRAQLLAEWHRLIQASR
                     DDLAKILVYETGKPLYEAYGEIDYGLTFSWWFIGEADRVQGLTASSSIQDRRVVTIKQ
                     PIGVAAALVPWNFPIALVMRKVSAALAAGCTMVVKPSPETPVTALVLANLATRAGFPP
                     GTLNVLTTSLDNTPAVSKALCVHPLVKKVTFTGSTRVGKIVSGLCSENLKKSTLELGG
                     NCPFIVFEDADLDLATEQLMALKWRHAGQACVTANRVFVHREIYENFVHRVVEKTKTL
                     VVGHGMDPKTTLGPMTVARSLDKVEELVREAISKGAKLALGNGRRLEFNDSEPNKGYF
                     MAPCILIDMNDDMLMSSEETFGPVLGIYPFDSEEEVTERANNTPFGLASYVFTENVHR
                     LWRMLENLEAGMIGLNAGNSSAAEAPFGGIKDSGWGKESGKDVAVNEFMISKTGTFTI
                     TGNK"
     gene            complement(<1625212..>1625709)
                     /locus_tag="TRUGW13939_03033"
                     /db_xref="GeneID:55990539"
     mRNA            complement(<1625212..>1625709)
                     /locus_tag="TRUGW13939_03033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486219.1"
                     /db_xref="GeneID:55990539"
     CDS             complement(1625212..1625709)
                     /locus_tag="TRUGW13939_03033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342112.1"
                     /db_xref="GeneID:55990539"
                     /translation="MSNKSLPSGTSAGMSLTDEAIARTHILALIHRYASLAREESDYS
                     MITELFEKDGIINFPDGRQLAPNQLKEIAGGNPPKLLRHHITTIDVQLVSLDEAHSQS
                     YIIAGTHMRMPDHWGRWDDVLKRQSDGRWLFQRKTIMAEQIDPEGWLAETINLAASAN
                     KNERE"
     gene            <1626725..>1627132
                     /locus_tag="TRUGW13939_03034"
                     /db_xref="GeneID:55990540"
     mRNA            <1626725..>1627132
                     /locus_tag="TRUGW13939_03034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486220.1"
                     /db_xref="GeneID:55990540"
     CDS             1626725..1627132
                     /locus_tag="TRUGW13939_03034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342113.1"
                     /db_xref="GeneID:55990540"
                     /translation="MATTKTPISLTHDALAALPDSYFKTVDERNIDALLSLFAPNATV
                     TVQTGNITYSGVSEIRNMFTAFVNNSKTLSHEVKNIVVDPVSRQIVTEQTYSGELMDG
                     TQNDMYNCNIFNVDEDGKFTRIIIWMSGANPLK"
     gene            <1628108..>1628828
                     /locus_tag="TRUGW13939_03035"
                     /db_xref="GeneID:55990541"
     mRNA            join(<1628108..1628234,1628305..>1628828)
                     /locus_tag="TRUGW13939_03035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486221.1"
                     /db_xref="GeneID:55990541"
     CDS             join(1628108..1628234,1628305..1628828)
                     /locus_tag="TRUGW13939_03035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342114.1"
                     /db_xref="GeneID:55990541"
                     /translation="MRSGLQTPGAIPLLAMLVAALLSMTPIVCEAWSKPGRILDSRGY
                     QDVLADGSVVSRPAMEIYLPGDDGTLLESKNAPASRLAQPVSVQKDEMQQISITSLSN
                     NVNVLPFPEKEVTWWQRVCRLSSLASVSFSNASSSSPSSSSAPSSGHADLPKQPGPDQ
                     SSSNKVSMGAKTPQSATVENSSSSLHNSIVDSSSPIERNGSFLAVMVSLIVAIMWF"
     gene            complement(<1629140..>1630614)
                     /locus_tag="TRUGW13939_03036"
                     /db_xref="GeneID:55990542"
     mRNA            complement(join(<1629140..1629887,1629966..1630216,
                     1630282..>1630614))
                     /locus_tag="TRUGW13939_03036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486222.1"
                     /db_xref="GeneID:55990542"
     CDS             complement(join(1629140..1629887,1629966..1630216,
                     1630282..1630614))
                     /locus_tag="TRUGW13939_03036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342115.1"
                     /db_xref="GeneID:55990542"
                     /translation="MATNSPNPLPFSEPPYLRGLPSPYYSESHLEFQKKCRAFLYENL
                     HVHALEYEREGFVPEHVFETFAKHNMILPNLPAPLPVQWLKRLGINDILGVKVEEWDY
                     IHTGIYTDEMSRSGLSGPSTSLTAGMAFGIPPIIKFGSPELQERFLPDLLTCKKRSCI
                     AITEPDAGSDVANITTTAEKSADGKEYIINGAKKWITNGIWADYTTMAVRTGPPGSGA
                     AGLSLIVVPLKDQAGVNRRKIRICGSETSGTTYIELDDVRVPVSNLVGTEGAGMKYVM
                     TNFNHERLTIAVGIVRQARVALSTSFEYVLQREAFSQPLIAQPVVRHRLAKAGAELET
                     LSAWVDQFLYQMTKLSKQDADRELGGLTALAKAKAGMVINECAQCAVLLFGGNGMTRT
                     GRGELVERIYRDVPTARIPGGSEDVLLDLSVRQLVKNYQNGLKKLQRGSKM"
     gene            <1632306..>1634926
                     /locus_tag="TRUGW13939_03037"
                     /db_xref="GeneID:55990543"
     mRNA            join(<1632306..1633982,1634117..>1634926)
                     /locus_tag="TRUGW13939_03037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486223.1"
                     /db_xref="GeneID:55990543"
     CDS             join(1632306..1633982,1634117..1634926)
                     /locus_tag="TRUGW13939_03037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342116.1"
                     /db_xref="GeneID:55990543"
                     /translation="MVEQDKSLVNYVKPWYKRRQTGLSESFDALWEILRGIINDPKPR
                     TIVCVLDAIDECEPISRTLLIEGMGEFDGYQRDKRSQLKFLVTSRPYTEIDRQFRQKC
                     SNLALIDMEDDGLSDQVGKEINLVIDDKIPRIFNSFRHPPNTRTQTEISEKLKGNNNR
                     TYLWLKLMLDAIHVTTLPGDHQWAAFVKQMPTGLFDVYANILDKVDLQKRGETIKLFR
                     ILLAATRTLTLKELNVALVVADRIKENGHNARPAHDLCFFDEHKLVDYIRDISGRTVT
                     IVGPNVYFIHLTMREFLTTGNPPAASWFSQSFQISHNTLAEICIWYILRQFEQQFGKR
                     PLPSAWQCPLQGEKRDQTSYGEWYKGHHRDVKHFVETDPFLPYAESRWATHVRNSGDD
                     LQIKLLPYVLELCGLKSKASIMWFQLYHTHRWFWDVARPTEFPTFVIIATCGLKAVLQ
                     KIWDNSCDANIDFQSQDFLQYSLRLSLLALVAREGHMDVVKFLLDKGAHPNPHPELNG
                     MTPLHHASYRGHHLPSWKFDLRVTESRNTLQLHARLSLHSHVNRNFLVRFLCFQYIKF
                     GRDFSRGFGFALCRLEAAELRLIRWGMSIGIGSPETKLQTENYSPEDIETACRWLEEI
                     QEAFGSALKTSQRYERTVKDPDAVIHLDVEAEIRGGKKGFQTLHNRLRRICDQRLNLK
                     PGTRDRLSWALYGKGSFENLVENISMLTTNLVELFPSKVGTQKELCQFEIKDLDPDSL
                     TLLDKAIGQEDKILRATLDAEAEKWPNLYSNIEVTEHFRGHFGDNIGPGGASRRTIFS
                     GIRAGGNAVAHFGHNVRMQGRTDFDSTQQN"
     gene            complement(<1634609..>1636021)
                     /locus_tag="TRUGW13939_03038"
                     /db_xref="GeneID:55990544"
     mRNA            complement(join(<1634609..1634662,1635295..1635482,
                     1635543..1635750,1635824..>1636021))
                     /locus_tag="TRUGW13939_03038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486224.1"
                     /db_xref="GeneID:55990544"
     CDS             complement(join(<1634609..1634662,1635295..1635482,
                     1635543..1635750,1635824..1636021))
                     /locus_tag="TRUGW13939_03038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342117.1"
                     /db_xref="GeneID:55990544"
                     /translation="MRFSTSAVLVTMLGWIGAATAHSIQLKAHSRECFHETLHKDDKM
                     TVSFQVGDREFGGSGNLEIDFWVEDPNGNRQYFRNSISNEDYSFDAQRDGKHTYCFSN
                     AAWASNSKEVSFNVHGIVYVSESEIKQDPLDYEVRRLSESLEQVRDEQSYIVVRERVH
                     RNTAESTNSRVKWWSLFQLIFLVGEGLFQVWWLKRFFESQAVWIKVFDLELAQFLL"
     gene            <1637065..>1644986
                     /locus_tag="TRUGW13939_03039"
                     /db_xref="GeneID:55990545"
     mRNA            join(<1637065..1637092,1638238..>1644986)
                     /locus_tag="TRUGW13939_03039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486225.1"
                     /db_xref="GeneID:55990545"
     CDS             join(1637065..1637092,1638238..1644986)
                     /locus_tag="TRUGW13939_03039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342118.1"
                     /db_xref="GeneID:55990545"
                     /translation="MARVLTIRYDLHPPVYLNSASSPSSGPVEHLTSLRDGPLATISI
                     DSSRATSPAASSVQAVGSPGQRPSRGSPESLPSLPKYPGAWDSLSSSPENRKANSAYF
                     TAAWGSPYATPSPRRPSWTLSHRPSLGLASRDTSPARGRGHISTRGLESLRNTSASSQ
                     FPRHLYSSIGRPTTRDISGPVVDPSVKQFTQDWINQYLSGQPRTERTNWLSDDEESEA
                     PSFTTARNNFGDDPTEGWLGLDDPRDEELLRTPTAAKSVSKKANGGLDISKRGRSRPK
                     HLSTQSTATLKQEDFWGFAFGDEPQSNAMADIKDTPEVPVENEVATPISPIEKPLPPP
                     PPGNNNNNSDDKPEEDKPEPAPRPAVRQTSQRQKKKIPWRGKACIISVPPHDLRGSEE
                     AVHRLLSKADVEDRLKQWREEGYHVDGFDVFAPELGSVDTQDGGFSRLPYPDPGDFKQ
                     DRESKNYSVRFPNLGEWQAYVNDLQEEKLRKLGVFLGDDEPPAAAASPASMAAMNHVA
                     SFPSHIMSPPIPTSSAASNPLFGSHPFSPHFNQSTNPSTNAESMASPPPQFGAQHPYF
                     GMDGNLVAGLPYPYQPTPPLAGSLTPQSLLNARQASVISPGANGLPSLNSIFSPVSPL
                     NAEDMFSQHSMEGYGGRDFVNASANHDSIGHDYQTRESRAATLIMDEAQANAEHFQSS
                     NVEIAQPTPRGHDRNLSETLQKGLDRYSETDHHLENSIQRQLERSENDLQKSRWALPE
                     EEVQPSPTHPQFPIQDSFSTGHHRLFGEQQPINNTQDADEIDTNPSLAGSPRDNKVDM
                     THHPWHSADPSAGSFATGHKSKSSLTGLNVEAKEFDPTASFSSNAFTFHGDSFETNGY
                     ANGSIFSPASSVFKPSGSLGSFNVTAPAFTPFGNGSLTNENTSFVPNSSKGFTFSAAS
                     FNADAPVFNPGVSLTSNISVAPDQFKSSIFGDIDFSQSSNPSKNSKAIPIVRPDDEED
                     EHQEIVEPGVQGPQKRARRGAGESDQDATLPTPSPLGEAAQAQAPPAPGQGHKPAEGK
                     ENTVPSEETVDVPVKPSSPDTKRRRAEDEEPIEKDTSDIVLDKDIPPAVVKDDTPELS
                     ESKLEPEASVDIPEEQIQDEPKEEPKEESKQEDVVEAIEEPAPALPETVTEPVTDTPK
                     TEPPRRKSIFEAMRSFSFRPSISEFVPSTKQNDETAQPEPKADPTKSEPEKPKAGLFA
                     SRYAVEETETPATPTAESKSEPRSLEAVKEDDREGDQDSLNEAELNAVMDQLNGDDSD
                     VGIERVITPGQVTSHTPETLSAQQPHLPHIIRSDAPSPSPRRNLEQLVRNAPRLGSDM
                     DAQSQNAYSQRDLPSGAQSPVRQLLSMNEHISDWDDVISSGEDEKLVQRSKFFDRHIN
                     DLVGQVLEERLGPLENALGVIQDSVISMNSRSTSRQPLRSRSDVEHSDADDEDDEEDA
                     RPVSPVNKRDRKLEKMRGIILEALSAHGVAKEPSPPAAGLSAIQESIAELKSLAAKPD
                     TPNIKELIQEAFVAQAQTGAKKLTEAEEIGADSLKLQLDGLKSMLRLADERTEQEIKA
                     RRDAQEALMEVQKMLGHTESEAERYRQAAEDAESDLRKLREEKIPQFEKIQNRSEAVE
                     KQQESWELTLSELSAKNIALEGTLDEYRVSHDHWKKKVAATEEENKELHTKTAHLSSR
                     IEDSMRARQSLRSKFDRLQDDMVNVTRDIAREQAKARKIEEDLTSKHNALRAAYDREV
                     KLREKLELDIDELEKSEREASKLKFIFGQSQEENHRLEELVATLRKESHEHQGNAARF
                     EREFNEARESSRVEIQRARTSMEADLESANNQVNYVRAQLEAEINRLESQVENVRLDA
                     DTTKERYELLLEEARENKASALAELGSSKDMAIEEQRKTHDRVLNDLRERHARALHNS
                     SEDRQRIESHTSEKLTLANEKVAHLQDRVAHLEEKLEITKSAALAAAQAAQAKGVSVS
                     PSPAKHSSSPSLSYRQDSGPEKISPQALRESILVLQDQLQQRETRIEELEQEVSEIDK
                     DAPNKIKEKDTEINWLRELLGVRVDDLQDIITTLSQPSFDQNTVRDAAIRLRANLQMQ
                     QQMKEREMAGGQPFPSLADIAASPRSLPLAAAAAWGSWRKGRESFTSEAGGSQTPSKS
                     NNTGGFLSGLLTPPNSNVRYTPKTMTAPPGMGKMGPRRTASESRPLRGSNQSPRSLST
                     RQADKLPAVPQEQYEPPTTPPLLRGSSYDHDAEPNSYDSSALLDDSDSIIAPDSPRAI
                     TEEALFSTHE"
     gene            complement(<1645666..>1646689)
                     /locus_tag="TRUGW13939_03040"
                     /db_xref="GeneID:55990546"
     mRNA            complement(join(<1645666..1646011,1646063..1646157,
                     1646232..1646383,1646446..1646453,1646553..>1646689))
                     /locus_tag="TRUGW13939_03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486226.1"
                     /db_xref="GeneID:55990546"
     CDS             complement(join(1645666..1646011,1646063..1646157,
                     1646232..1646383,1646446..1646453,1646553..1646689))
                     /locus_tag="TRUGW13939_03040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342119.1"
                     /db_xref="GeneID:55990546"
                     /translation="MAYVFSRQQETDPKSPILKLLESRRWISRSITRRAFKLVSKRSS
                     HDGRNYTIPAMDVDLQEARTLFETNFFAVIIMCQTFLPLLMKAKGTVVQIGSVSGILP
                     YVFGSVYNASKAALHSFSDTLRIELEPFNVKVIVVVTGGVQSRIAHEDRKLPPSSIYQ
                     PITTEYNRRVKHSQEGAMDCHVYAQSVVSQVLGNTSSPTSRWYQNWIWEGNRTGMIKF
                     LAGGWLWFGFYGWLFWRMFNLNKLRRG"
     gene            <1647287..>1651032
                     /locus_tag="TRUGW13939_03041"
                     /db_xref="GeneID:55990547"
     mRNA            join(<1647287..1647454,1647513..1647593,1647652..1647765,
                     1647832..1648156,1648211..1648382,1649003..1649016,
                     1649081..1649459,1649519..1650729,1650791..>1651032)
                     /locus_tag="TRUGW13939_03041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486227.1"
                     /db_xref="GeneID:55990547"
     CDS             join(1647287..1647454,1647513..1647593,1647652..1647765,
                     1647832..1648156,1648211..1648382,1649003..1649016,
                     1649081..1649459,1649519..1650729,1650791..1651032)
                     /locus_tag="TRUGW13939_03041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342120.1"
                     /db_xref="GeneID:55990547"
                     /translation="MKPFSRLIRFESEGEAFFADLNTTTEIPSAGSSITAYRTYDDLM
                     NTQDSVEVTFEKILAPLPRFDLPIYCVGLSYRSHAKEAKLNIPVNPPVWTKPPAALAS
                     AEEDIEMSRYCASNFPDWEGELVFVTSRECRDISVDEAESCILGYTVGNDLSCRFFQL
                     PAQNGGQFFYAKAFDKFAPIGPVLVSPELFNSGEKTELTTRVNGKVMQNIEIQKDRVF
                     SPAQVLSFMSQSTTIPAYTAVMTGTPAGVGAFMTPKKFLRHNDVVEVEIDGLGVLRNK
                     ITFPDGQDSQLRKVKCNQQRPTCSRCQEAGIACVYSSKRRKPGPPKGVRRKRRSPQTG
                     PDMLPDPTQLMNELNSEIFPNQDIDSTSTNIDFLSDSGFPGAEAFLGLDFSNTPSTGA
                     SQIQNTSGTTIGLYELPFSPAEELDLLNNFFAYFHPSGFLFQKNKFFAQYHDGLLDRG
                     LINTILVVTLLTLRPRATTDHINLEDLLDRLRNSCSHAIETSSGFLTLDIFRQSCMLT
                     FFDFHQRPGLQSWMKVGQLTRHAYRHGLNQIENPDTCAIYQFPHILHEDIEEWRRVWW
                     FIYTLDSYSNIIAATPFLIDPDGINTALIGQQSTTTGVDGLQKSERAFLAPEPDHLWK
                     TMQTIVANKNELNANIHLITTTILRMAAKLLFLRKQNPSESIFRRIESLKGHISAVRL
                     AMPLRYMKPTRDVIINETKEEHHERLVCILHIHAALLMLSVPPYPHQDENMWLLSWRQ
                     CLEPCDDIVSAVKEWDGSFSSNTDPALCYIVFGSRVIIWLLGKYGFEDDFQVQERMNR
                     ASDILTLFLDHFEPLCCQPTVLKTWFEKLNIQYSGPFGREQVSQLLQSTNVLFPLNAA
                     HPPIQQDQPPNATIPLSLNPVEESGLTISNLFAEDFAIDDLQLII"
     gene            complement(<1651089..>1652168)
                     /locus_tag="TRUGW13939_03042"
                     /db_xref="GeneID:55990548"
     mRNA            complement(<1651089..>1652168)
                     /locus_tag="TRUGW13939_03042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486228.1"
                     /db_xref="GeneID:55990548"
     CDS             complement(1651089..1652168)
                     /locus_tag="TRUGW13939_03042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342121.1"
                     /db_xref="GeneID:55990548"
                     /translation="MSFIIDLVARLPRSVQEWIVAPTSIPDVHNHASKVQLSRLGHVY
                     FEHANLKTFEKFAADFGLIEEKRIGNTIYYRGYGRDPYVYVASQSENRRSRFLGAAFV
                     ARDEENFEKTTRIENAIIKDLSHAPGGGRLVTIPRPNGTFMHVVHGQKERDIDASQEP
                     PSKIIESHGPLNEPFKKGRLGTFQRFKPAPALVHKLGHLGYVCCEFEEELDFYTSNFN
                     FVHSDILRHDKFEWVDFMTFMHLDLGEEYSDHHCFFLGRAPPGTSKTYLHHASFEVTD
                     FDTQLMGHRWLEEQKWKPVWGVGRHILGSQIFDYWLDSSGFKVEHYADGDVVNTDYKN
                     MRSVGGSLAIWGPEIPSDFAANKAG"
     gene            <1652597..>1654664
                     /locus_tag="TRUGW13939_03043"
                     /db_xref="GeneID:55990549"
     mRNA            join(<1652597..1652680,1652742..1652865,1652935..1653060,
                     1653115..>1654664)
                     /locus_tag="TRUGW13939_03043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486229.1"
                     /db_xref="GeneID:55990549"
     CDS             join(1652597..1652680,1652742..1652865,1652935..1653060,
                     1653115..1654664)
                     /locus_tag="TRUGW13939_03043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342122.1"
                     /db_xref="GeneID:55990549"
                     /translation="MESAPVVVVGAGPSGLVFGLCLAKFRIPCIILEKERDIADDPRG
                     VYLAGDALRVLWKLGLGDQMPSIGHDLDTIYFHPSSFKSPPFLTIPIAHDWMGHTIPG
                     GILQSQPKLERALRDFVQKSPFCTLRTSCEVVDREENDDHMIITYLDLENNTKKQIKT
                     EWLIGADGKRGVVRKRFLEPKAGIKQEDGIYRYDGTWVAANLHITLPTPDTHPDLSLW
                     KLGLTPQQVYDLFWPQGWHFCSPPDKATACGRFGPLEDRLWRHEFAEPEWNDAMNAEE
                     LLWEHLTPMITRSEDSSGRNFGSKITYPRDCIEVLRCRPFHFTHKVVNKWFDNQTILI
                     GDAAHVFPPFGGQGIACGIRDAESLAWRIAILAGINKPTPSKTLSNKLLSLWAEERRL
                     GVEISMKQTMMNGKLCNGTAGWFFLTITPMLISLFTSSKFYHLQSPMAWGDISGYQSA
                     KDGFYLKQYAGGKKLAQVYGVAELKADGFSKSPTQRKMILSDHIIHYVPTALTLLVCD
                     QVTPQENSKLNRLLEDVQLHPLILSKQSVIHFNSKYVYRKGSLSNSDKFVSISWSPIP
                     SELTMGSVLRPGYNPKTFQNRLGGERSKYVIIRQDSIVFSIAKDLQQLQSCLDMLKGY
                     VTA"
     gene            complement(<1658508..>1659539)
                     /locus_tag="TRUGW13939_03044"
                     /db_xref="GeneID:55990550"
     mRNA            complement(join(<1658508..1659340,1659419..>1659539))
                     /locus_tag="TRUGW13939_03044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486230.1"
                     /db_xref="GeneID:55990550"
     CDS             complement(join(1658508..1659340,1659419..1659539))
                     /locus_tag="TRUGW13939_03044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342123.1"
                     /db_xref="GeneID:55990550"
                     /translation="MYFDLVQFEPSPMFYAMSDSGDSNKAEKKREYNRNAQRLFRLRR
                     KEHLKNLERAEQERLVNNTDELERLRQEINELRCENDNLRLSASPSRQVSTAPSSVAV
                     TSSPPSQSNSPFPVLDLSDHRHAGYDRALSDVLVPTIEAPSTGVHDLTTSSNVSELDT
                     SFCLLFPQDVATVRRDLHKRMAAVLNMNVLSHPQRHLPTLAALGPSLPPSLRPTLLQL
                     QTPHHAYIDLIPSPTLRDTLIRAGVETANAFLMTAACAIVYETEDLGQLTIWGQDYFN
                     EMSWEFSEDVLKAWPGLLTSEWRDRANFWRRQRNEALINFD"
     gene            complement(<1662092..>1663720)
                     /locus_tag="TRUGW13939_03045"
                     /db_xref="GeneID:55990551"
     mRNA            complement(join(<1662092..1662868,1662929..>1663720))
                     /locus_tag="TRUGW13939_03045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486231.1"
                     /db_xref="GeneID:55990551"
     CDS             complement(join(1662092..1662868,1662929..1663720))
                     /locus_tag="TRUGW13939_03045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342124.1"
                     /db_xref="GeneID:55990551"
                     /translation="MVGRRSLGKPTDSPSRQLIHDLTKDLQAIRLHHEDLKRVYDYRT
                     QSFTAEQDEIDRNHQEVYYAAIDKAYDYYDEHRREAEVVLQDHLREEEEKRRRKEEEE
                     RRRKAEQERLERERIEREEAERKRQEEARREAEQRAQEEEKRRLTAEAEAKARKAAEE
                     DKAVRERQEAEEKERQRQADLQKAEETEKQRQTLGANINTEQEIKEHEQYLELHKYLK
                     ELRKYVVAEGKKDQTLKNTIGDHRRAIIKCIGQLREGQGAIANKGQVNEIREILRKAQ
                     MIPMPCDVRRFFVQPPEEFASLSEEDAKGSAVFIYLLNIFTKAVVSQLINEAGVKLEY
                     AEPVGVVVAQIFSAEQYSFRGHAFSDIFWAKYRAACPALWGFYGNENTEAGRIALGWK
                     RTESGGPFVDEMEHRQRMVGLGSGFAAVTLRNFGKTTRKNPFPNHIFWRTVAKIVFIA
                     PDELQDTHFYILFSMLRFSAERIIGFWGQAGMALLRTAIVNIPNHVTRKQSGAIGQLK
                     VLKGLYATEKSIVF"
     gene            <1666121..>1670406
                     /locus_tag="TRUGW13939_03046"
                     /db_xref="GeneID:55990552"
     mRNA            join(<1666121..1666217,1666276..1668818,1668876..1669235,
                     1669292..1670295,1670367..>1670406)
                     /locus_tag="TRUGW13939_03046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486232.1"
                     /db_xref="GeneID:55990552"
     CDS             join(1666121..1666217,1666276..1668818,1668876..1669235,
                     1669292..1670295,1670367..1670406)
                     /locus_tag="TRUGW13939_03046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342125.1"
                     /db_xref="GeneID:55990552"
                     /translation="MEQQGQSGVPGPAGRRLHIAHRRSPSELTPLMMEQLAIQQQIEL
                     LQQQQQQIAATHQQYVNMGLLQPQQPMGQVPGYSPNMQGQGSMSGVSPQVNAFQFPMQ
                     QQQMGGAMNNGHSHRRNQSALPGMGMGPPPAPSSGASGSAFADIHQGNQNRENNAPSR
                     GRGAPAGGGHQRRHSLALPEAKKAAELAQQKRATAGFQFPAPSPSPGGSGSPADSTPP
                     DDKPKTPQGLGLQRAGGSFRGGAHGRSQSMAVGRGAAGFQFPIPESAQAEPPKRGHGR
                     SQSRNFDGNWRQPNNNNNNNQDQQKSHQGNQQHGGGGFQPGHRSRGSMNQSIGQFQYP
                     NQPQLIQLPQGQVVMAPQMFNGQQLNPLQLAQLQAMQQNGQMNGSIGLQASQHAPQQL
                     SAQQQQQQRKTLFTPYLPQANLPALLSNGQLVSGILRVNKKNRSDAYVTCAELDADIF
                     ICGSKDRNRALEGDFVAIELLDVDEVWTQKREKEEKKKRKDITDTRSGDKVSRSDSGA
                     NGDNQQVGPDGSIRRRGSLRQRPTQKKNDDVEVEGQSLLLVEEDEISDEQKPLYAGHV
                     VAVIERVAGQMFSGTLGLLRPSSQATKEKQEAERAARDGGHGRQSDRHQDKPKIVWFK
                     PTDKRVPLIAIPTEQAPRDFVEKHQDYANRIFVACIKRWPITSLHPFGTLVEQLGEMG
                     DLKVETDALLRDNNFAADEFSEAVLKNVGWEDWTTTSEGDALFASRRDFRDEKTFTIH
                     PTGTRELADAFHMKKLADGKIEIGIHVVDIAHFVKQNSLVDREAKKRGTGVYLMNRVV
                     NMLPSRLSTDVCSLLPGQERLVVSVVFQVDPSTGAVDDNVWIGKGVIKSSGKLTYDDV
                     DATLNGNSDLPLEGATADEIRLLGSITTKFKEARYGNRATNIPSLRLLYQLDDENMPV
                     EHNIFDSSPTHELIEELSHKANFFVARKVYAAMPDKAFLRRQAVPNSRRLQSFVDRMN
                     RLGFDIDPTSSGSLQASLFKIQDLDLRKGMETVLVKAMQRAKYFVAGNLTEEQRQHYA
                     LNLPVYAHFTNPTRRYADILVHRQLDSILSEGAIEFSEDVETLTKTAEQCNNKKDSAH
                     NAQEQSVHIESCRVMDKKRQELGGDLISEGIVLCVYESAFDVLLPEFGFEKRVHCDQL
                     PLKKAEFRKETRVLELYWEKGVPSSAYIPEDERPNASSSRAAHAAAAAQQAEAARERA
                     REREEAQRKQTETGTMSTDDVDALFDDDDDMSEVTEMAAGVSLNSSADRTTHSMPPSP
                     TRNGHPDQAPHRTRSDPKITVSTSDTPEAKMTNKEKYLDLFKLREENGEYIQDVTEMT
                     RVPIILKTDLSKSPPCLTIRSVNPYAL"
     gene            complement(<1671500..>1674200)
                     /locus_tag="TRUGW13939_03047"
                     /db_xref="GeneID:55990553"
     mRNA            complement(join(<1671500..1672492,1672551..1672883,
                     1672962..1673030,1673541..1673632,1673691..1674069,
                     1674126..>1674200))
                     /locus_tag="TRUGW13939_03047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486233.1"
                     /db_xref="GeneID:55990553"
     CDS             complement(join(1671500..1672492,1672551..1672883,
                     1672962..1673030,1673541..1673632,1673691..1674069,
                     1674126..1674200))
                     /locus_tag="TRUGW13939_03047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342126.1"
                     /db_xref="GeneID:55990553"
                     /translation="MRSAFALVAFSAVALAQSTVTPVAVDNPATQYLTETNSLGVVTG
                     QPDAVTSQPAAVTSQPGAASIPAGLTTPVVVPTPTTTTSIGETTGPVSSGTTQTGFTT
                     TASASASGSDTASESGSSASGTGTGTASGSAASSTGTGAAAPGATAGPVDSSAAASSF
                     LGASRSSGLAWPLYFPASCRLLCSLYTPTRTQPFPPPFPLSLCRMVSKLRRLIADHAD
                     LHNADLPPNYLFPGADGLATDDLSQLTVLVAGPHGTPYADGLWRLHLRIPEDYPASPP
                     KAAFKTRIWHPNVEESSGAVCVDTLKRDWEPKLTLRDILVTISCLLIHPNPDSALNSS
                     AGALLQEDYIEFARQAKLMTSIHAPVPNNLKQPVLEAKQRGEDPAMVPRLEPEQQPST
                     QAQETRRIGLVMKPTATAASVEAQDENMQSDSEDLMDDYKENDPSLSPEPITSAPPFS
                     RRNDQEKRPLSVIATAPPRDTDVVMYDSSSDDDGSSDGMTSSARNIAANVTNKTSPAS
                     SFQEYDTPSGTRQQHPQKAFAHASSVLNSSYEIYEDEQGEPATSPNRRVSRGKENVTS
                     TLFSTKNSSSLSLPTTPQTASLVMKAPSQPRAPLGQFHNNPAVATRPLEPTKVTKPAL
                     GSGVRKGSAAVKRKPRIGLRRL"
     gene            complement(<1676032..>1676629)
                     /locus_tag="TRUGW13939_03048"
                     /db_xref="GeneID:55990554"
     mRNA            complement(join(<1676032..1676097,1676172..1676439,
                     1676574..>1676629))
                     /locus_tag="TRUGW13939_03048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486234.1"
                     /db_xref="GeneID:55990554"
     CDS             complement(join(1676032..1676097,1676172..1676439,
                     1676574..1676629))
                     /locus_tag="TRUGW13939_03048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342127.1"
                     /db_xref="GeneID:55990554"
                     /translation="MGFFSRIITLFGLILLAHAGYSAHEHTTLTSNVAHSTVVSSNPL
                     GLLPPDVTIEALVSVVLVSIGLVLGTEKLKPITHSAWAGQIEREGGGRNPYKNLDERA
                     GFWDVRKSRKEFADWMREEGQGAAKRS"
     gene            complement(<1677044..>1678036)
                     /locus_tag="TRUGW13939_03049"
                     /db_xref="GeneID:55990555"
     mRNA            complement(join(<1677044..1677297,1677355..1677731,
                     1677957..>1678036))
                     /locus_tag="TRUGW13939_03049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486235.1"
                     /db_xref="GeneID:55990555"
     CDS             complement(join(1677044..1677297,1677355..1677731,
                     1677957..1678036))
                     /locus_tag="TRUGW13939_03049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342128.1"
                     /db_xref="GeneID:55990555"
                     /translation="MGFTDFVSEAGLTVANSFFATRSYIVGHAPSQADVVTYKAFSAA
                     PDAAKYPHVARWYQHIASYESEFASLPGDPTKAYTTYGPETTDLPTNPKDKPADDDDM
                     DDLFGSDEDEEEDPEVVKEREARLAEYKKKKEGKTKPAAKSIVTLDVKPWDDETNLQE
                     LEKNVRAIEVDGLVWGASKLVAVGFGIKKLQINLVVEDEKVSTDELQQTIEEDEDHVQ
                     STDVVSFNCAFRVFTSFF"
     gene            <1678319..>1680676
                     /locus_tag="TRUGW13939_03050"
                     /db_xref="GeneID:55990556"
     mRNA            <1678319..>1680676
                     /locus_tag="TRUGW13939_03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486236.1"
                     /db_xref="GeneID:55990556"
     CDS             1678319..1680676
                     /locus_tag="TRUGW13939_03050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342129.1"
                     /db_xref="GeneID:55990556"
                     /translation="MASTRLSRWGIASLPRRAPLRTQFLGQAVRARASTTRQALHPLP
                     LRLSNHRHYATGGRPHPPGGTHRMNVGGEEKSALEQYGVDLTAKAKSGKLDPVIGRDA
                     EIHRTIQVLSRRTKNNPVLIGAAGTGKTAILEGLAQRIVQGDVPESIKNKKVISLDLG
                     SLIAGAKFRGDFEERLKAVLKEVEDAEGSVILFIDELHTLLGLGKAEGSIDASNLLKP
                     ALSRGELQCCGATTLNEYRLIEKDVALARRFQPIQVSEPSVASTISILRGIKNKYEVH
                     HGVRITDAAIVAAATYSNRYITDRFLPDKAIDLVDEAASALRLQQESKPDSIQELDRE
                     IITIQIELESLRKETDITSKERREKLQEMLKSKQEEVAKLMEIWNKEKEEIESIKRTK
                     EELEQSRFELEKAQREGNFARASELRYSVLPALEAKLPQEGVEAKEGQTLIHDSVTAD
                     DIGNVVSRSTGIPVTKLMAGDVEKLIHMEDTLRKSVRGQDEALTAVANAVRMQRAGLS
                     GENKPLASFMFLGPTGVGKTELCKKMANFLFSTESAVLRFDMSEFQEKHTISRLIGAP
                     AGYVGYDDAGQLTEAVRRKPYAVLLFDEFEKAHRDISSLLLQVLDEGFLSDSQGHKVD
                     FRNTIIVLTSNLGADILVGSDPLHRHELSDESEVPAPVKKAVMDVVQAAYPPEFLNRL
                     DEFIIFKRLSKSALRDIVDIRLKELQARLDDRRMVLQVDEEVKGWLCENGYDPRYGAR
                     PLNRLIAKEIGNRLADKIIRGEIVAGQTARVKFNAAKDGVEVVSA"
     gene            <1681099..>1684712
                     /locus_tag="TRUGW13939_03051"
                     /db_xref="GeneID:55990557"
     mRNA            join(<1681099..1681435,1681491..1681571,1681622..1681994,
                     1682045..1682444,1682494..1682571,1682633..1682692,
                     1682741..1683095,1683152..1683248,1683293..1683382,
                     1683444..1683618,1683665..1683699,1683750..1683831,
                     1683884..1683995,1684045..1684249,1684306..1684344,
                     1684399..1684537,1684587..>1684712)
                     /locus_tag="TRUGW13939_03051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486237.1"
                     /db_xref="GeneID:55990557"
     CDS             join(1681099..1681435,1681491..1681571,1681622..1681994,
                     1682045..1682444,1682494..1682571,1682633..1682692,
                     1682741..1683095,1683152..1683248,1683293..1683382,
                     1683444..1683618,1683665..1683699,1683750..1683831,
                     1683884..1683995,1684045..1684249,1684306..1684344,
                     1684399..1684537,1684587..1684712)
                     /locus_tag="TRUGW13939_03051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342130.1"
                     /db_xref="GeneID:55990557"
                     /translation="MASLKRRRESVFSSSYQPPHSQRVAPVRAASHHLDGGLSLPHFL
                     QNTQDDRMQEYIPRQAGEEGRNDDNGEVIMAVDLKERGTVGCCYYVAQEEQLKILGDI
                     QHGGKDIIDTLILEINPTTILTSTRAEEAAITVQQGYDDRFNFPYQIDTRPVQEFNFN
                     NARAKLASLEIFQNEDLAQFLVPGGGFTQTEEVAAENLGLSFEKGQVLRLAGAVDIEN
                     SVSIGCAGAVLAYVQRQGVNEITQIGEEFVTQPVRSVEAFFLRGTMHISPDTLSALQI
                     LQSESHPNAFNQGPGKTSSRGKEDFSLYGLFQQHILTPQGKSRLRQCFLRPSTESDVI
                     SERQDIINIFLWPTNASVVQKLTASLKKIKNMRPVITSLHKGLSSGRATFGGLKGTIW
                     STLLNFAFHTIDLQEATREVSWRDSITFRDRALSVLDGFSLHVVGKIVYETVDIQDSQ
                     QQQRTVVKAGVDRELDLLKDRYNGLDSLLKQVAIDVASTIPTNLGIDVNVIYFPQLGF
                     NIAIPFNERGLAAYTGEDDSWEQIFTTENRAYFKDSRMREMDEKLGDIYGLICEREIE
                     IAHELAQRVLKYEQVLLASSDLCGELDCYLAMAKTASIYNFVRPRISQQNDIRIIDGR
                     HPLQELMVSSYVPNDVHLRGGCGSQSDSDITDQNLSHTPSMLMLTGPNYSGKSVYMKQ
                     VALIVYLAHIGSFVPAQSADIGITDKILTRISTPETVSKIQSTFMIDLQQMSLLLKLA
                     TEKSLIVIDEFGKGTDINDGAGLACGIFEYLLSLDEKRPKILAATHYHEIFENGFLPI
                     RRSLSFGHMEVRVDESSQNTSEHLTYLYNVKQGRSNQSFGTFCAAMNGIDLVIVSRAD
                     ELASLSSRGENLVMACARLSKKEEDILEEAESAARNFLELDLSRDSEKGFKDEIADLI
                     TKERVVTTHNERV"
     gene            complement(<1684917..>1686906)
                     /locus_tag="TRUGW13939_03052"
                     /db_xref="GeneID:55990558"
     mRNA            complement(join(<1684917..1686661,1686717..>1686906))
                     /locus_tag="TRUGW13939_03052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486238.1"
                     /db_xref="GeneID:55990558"
     CDS             complement(join(1684917..1686661,1686717..1686906))
                     /locus_tag="TRUGW13939_03052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342131.1"
                     /db_xref="GeneID:55990558"
                     /translation="MAGKKRKVTGRQPSAKRDDVALQSKFNANETFDDSDDEFVAGRD
                     HILLEEGPEAKRRRKIQEEEAFYQPSDEEVLGYDEDEEEIDEEEDGEDDDDYAFESKR
                     QRNGSSPGADEEEEGGLGAWGSTKKSYYNADAIETEADALEEEQEAKRLQQKHLKAMK
                     EADFGFDEIDWLESAKDADKDAQDKDDVITEVLPQLEITDDMSSEEQLKILKSRYPEF
                     EPLSKDFAELEPQYPTFLAAAEKAEAAIGDSDFTPLSTVKFRALSAYLGSISMYFAVL
                     TSPADEEDADKVLALPPTELREHPVMESLIKCRKLWETVKDVEIDDESELEEDESDGV
                     DLDAEESEPELAVQEPTQEKKQKVKTASERKLTKSQRAAEKAQKEAQARRLEKIKKAE
                     TKLADLDDLVKVPSRKSKSQAKTPLPQDDDSDFGDEGALTTREAEEKARKKRSLRFYT
                     SQIAQKSNKRDAAGRNAGGDEDLPYRERLRERQARLNAEAERRGRAQANQAEQLGGDS
                     DDDDRRLAREIRGDAKGTDDDEYYDMVASRNKQKKADKKIRAELAEAAQGGRVEEIEE
                     VGPDGKRRITYQIEKNKGLAPKRNKDVRNPRVKKRKKFEQKKKKLASIRQVYKGGEER
                     GGYGGELTGIKKNLVKSVKL"
     gene            <1687296..>1688487
                     /locus_tag="TRUGW13939_03053"
                     /db_xref="GeneID:55990559"
     mRNA            join(<1687296..1687409,1687475..1687606,1687660..>1688487)
                     /locus_tag="TRUGW13939_03053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486239.1"
                     /db_xref="GeneID:55990559"
     CDS             join(1687296..1687409,1687475..1687606,1687660..1688487)
                     /locus_tag="TRUGW13939_03053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342132.1"
                     /db_xref="GeneID:55990559"
                     /translation="MEYSKTTIAIAVILFGALTYTLYKMLGFGSNQFPVDGKTILITG
                     ASEGMGRSAAIQLAQKGANVVIVSRSPPKLEAALELIKAAAADPSKQRFHYISADLTN
                     PEDADRILDEATKWNNGVAPDTVWCCAGYCHPGYFIDVPIQTLREQMDTVYWTAAYTA
                     HATLRRWLKPVSLGETQVASPPRHIIFTASTLSFFTVTGYGPYSPPKAAMRNLSDVLV
                     QEIEMYNGARRAKDANAPATDVKIHIVFPMGISSPGFENEQKLKPDLTHIMEEADKPQ
                     QPDEVAAIAIKGLERGDFQIITNTIGQLMRTSSLGASPRNNFFLDTASSWLINIACLF
                     IIPDLTGKAFKFGKKNGIPATKP"
     gene            <1688902..>1689954
                     /locus_tag="TRUGW13939_03054"
                     /db_xref="GeneID:55990560"
     mRNA            join(<1688902..1689336,1689418..>1689954)
                     /locus_tag="TRUGW13939_03054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035486240.1"
                     /db_xref="GeneID:55990560"
     CDS             join(1688902..1689336,1689418..1689954)
                     /locus_tag="TRUGW13939_03054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035342133.1"
                     /db_xref="GeneID:55990560"
                     /translation="MFFVPFTTSLNFLFFWMTWTTLVLSHPPLKVELFGTLAVRIIFY
                     LVPSLFFFLFDALLPSASMSIKAQGNIGLPSGHKRKRLGRVEVKIVAWSLVNILLGLA
                     AQGAIEHTLTKTFRFRSAIKVAVSLPYPWAITIDVVRGFIVREILNYSLHRFILHNQR
                     LPLERLHNSWYHGLRAPWPLTAHYDHPICY