GenomeNet

Database: RefSeq
Entry: NC_049563
LinkDB: NC_049563
Original site: NC_049563 
LOCUS       NC_049563            5896210 bp    DNA     linear   CON 05-AUG-2020
DEFINITION  Talaromyces rugulosus chromosome III, complete sequence.
ACCESSION   NC_049563
VERSION     NC_049563.1
DBLINK      BioProject: PRJNA645155
            BioSample: SAMN15229550
            Assembly: GCF_013368755.1
KEYWORDS    RefSeq.
SOURCE      Talaromyces rugulosus
  ORGANISM  Talaromyces rugulosus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Islandici.
REFERENCE   1  (bases 1 to 5896210)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     A chromosome-scale genome assembly of Talaromyces rugulosus W13939
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5896210)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5896210)
  AUTHORS   Wang,B., Guo,L., Ye,K. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2020) Faculty of Electronic and Information
            Engineering, Xi'an Jiaotong University, Xi'an, Xi'an, Shaanxi
            7120000, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP055900.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: NextDenovo v. 2.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 526.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5896210
                     /organism="Talaromyces rugulosus"
                     /mol_type="genomic DNA"
                     /strain="W13939"
                     /isolation_source="air"
                     /db_xref="taxon:121627"
                     /chromosome="III"
                     /country="China:Beijing"
                     /collection_date="2015-07-23"
                     /collected_by="Long Wang"
     gene            complement(<2117..>7102)
                     /locus_tag="TRUGW13939_04855"
                     /db_xref="GeneID:55992353"
     mRNA            complement(<2117..>7102)
                     /locus_tag="TRUGW13939_04855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488020.1"
                     /db_xref="GeneID:55992353"
     CDS             complement(2117..7102)
                     /locus_tag="TRUGW13939_04855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343913.1"
                     /db_xref="GeneID:55992353"
                     /translation="MYNTFFEQLEEFPIVVCRECRHAVWPSQIETHLRRAHRYVSTTM
                     RVTLADDVRTWPNIAHDPIELNIPATRTTAIQQLVAPVDGYRCQLSSHSCQYICTTMP
                     TMRQHWIKHHQWSRTRKIGQPTHMEQKQIQHEQDQACRPVQCQRLFPVKANSQYFAII
                     PETDEAVAPDGDACETLIQNMQAHWRSVQEAADRKIQAGQVDEANPWLRRTEWVKYLG
                     EFDIPDLIQSVSPPPADIDGQPSIEPEAHAIWTAMARLATISQLSVIHQIGVFVRLEA
                     IRTEQHQTRYTPLEAYQDEESIVKQVRPWQEMLMFFWRTQQPHEWTSPPYRFTRRQRM
                     AWERLVDAVRIPPTRQVSKGKVITRSGATRAPWVEEEEEEEGEEEEEEEEERDTMSID
                     SLSVDSNEPDFFNDRSDGIEKTMEETAMGRTVDVDAIFDIERPPENEEEASNITVPPL
                     SPVERACLDFCIELLNQRITRREYDSALVCAAAVLGVREGGFRTPEDYPPILSRVIKV
                     ARFMVVKKAVELSDEPEEEDAAELPSSMDHTDWDSAYGGSPPPSSPGRKGCLQWVTQM
                     MDRFMVRGSQGPTQWMLDLRTYGLKIHYNTTSAGHVQWQNGDELCYKDRQFTMNEFRG
                     MVHAVVQDARRILIDDILGCPSDAVPAIPWDRLYDDPSNNQARWSFLQDTRTQWPVDG
                     EHWMWHRIRQDPAVRRRFIQADGQGFHPARWMAYQNRITAFLEKLLVAIQFTWGQPAR
                     APELLSIRHENSPMGGIRNMFIEDGMVVLVAQYHKGYQLSGDVKIIHRYLPREVGELL
                     VWYLWLVQPFERVVSGNIYQRDQVSSHIWTAHPHQAKWNSERLRHILQRESAMGLRGQ
                     SLHIASYREVAIAISRRYLRNKYRFAADDGDDPEAMDEVQLLADAADRQAGHDPHTAG
                     GIYARESRELFGAMASMRERYRGSSQDWHTWLGFASCQPPSDPDADPFSAPPASSTSW
                     FTDEAQRSREERWQRMQRMDVDQALRDMMGPDAAFRGPQKQIVQAVIQGQSPVIGVMP
                     TGGGKSLLFMLPAWMARGGTTVVIIPLVSLRDDLQRRCAELDIQCVAWNNRQPADGAS
                     IVLITPESAVRDETFSTFLNRKQFTGQLDRIVIDECHIALHDQYDFRKSMTQLGQLVR
                     YRAPMLLLTATMPREDEERLCQRMYFPPSTVHWIRARTSRHNIAYRVVRIARPQEHGR
                     RGDVGAAIMAWIEQEIPRYSPGKVVVYANSRHQTEQVAEALGCGAYHSHTIDRAGMLS
                     TFRQTPSGVIVATSALGMGIDIPDIRCVIHVGRPRSLLDYAQESGRAGRDGQGSTAVM
                     VLDGSGGGWGDPVTDRDAGSLRALEQVQRYIDQPCRRGVFDPYLDGEVDGYQRQQCEE
                     GEAACDGCCAAAIPVETQATSPTTQSETPAISPARRVQVQARSPVPAPARSPKRKLSE
                     AFTMVTMPHARRRGYNEPWEQLRSHIEREARTVDSIREHFDRWVGRCRICAMHEAPSE
                     HFTYQCPRAEGQQAAAWIEETIRKVTGNQREDGRNGYEDYAVCFQCHSPQWICPRWVR
                     VDHGGYQRTKEACRYLETAAHTMAQLLHGPMREVIQPAWERRLAQMPGGGVPHENQAA
                     LIRHFQRKFGKRGEERSGLVEEMTWMCSWVDDTMQVDVESSEDSNSIISHM"
     gene            complement(<9146..>9595)
                     /locus_tag="TRUGW13939_04856"
                     /db_xref="GeneID:55992354"
     mRNA            complement(<9146..>9595)
                     /locus_tag="TRUGW13939_04856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488021.1"
                     /db_xref="GeneID:55992354"
     CDS             complement(9146..9595)
                     /locus_tag="TRUGW13939_04856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343914.1"
                     /db_xref="GeneID:55992354"
                     /translation="MVWERLVNAVQILSTRQVSKGKVITRSGAMRAPWVEEEEEEEEE
                     EEEEEEEEEEEEEEEEEKERDTMSIDSLSVDSNEPDFFNDRSDGIEKTMKKTAIERTV
                     DIDAIFDIKHPLENKEEASNITIPPLSPVERAYLDFYIKLLNQYITQ"
     gene            complement(<12013..>12578)
                     /locus_tag="TRUGW13939_04857"
                     /db_xref="GeneID:55992355"
     mRNA            complement(join(<12013..12219,12333..>12578))
                     /locus_tag="TRUGW13939_04857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488022.1"
                     /db_xref="GeneID:55992355"
     CDS             complement(join(12013..12219,12333..12578))
                     /locus_tag="TRUGW13939_04857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343915.1"
                     /db_xref="GeneID:55992355"
                     /translation="MGENKSSISSIGNDQWSDVEAWLIDSGIASVTAAVHLIKDAGVL
                     GSNTHILDENTDLGGVWNLSGILSNVTFFHLNATHISMSALTRAVKRGDSGLEVVPME
                     DINIGIKYRLELIKLLLQSEEELESKTIDGFFDTTFVETVFWMLWSTT"
     gene            <13419..>15098
                     /locus_tag="TRUGW13939_04858"
                     /db_xref="GeneID:55992356"
     mRNA            <13419..>15098
                     /locus_tag="TRUGW13939_04858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488023.1"
                     /db_xref="GeneID:55992356"
     CDS             13419..15098
                     /locus_tag="TRUGW13939_04858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343916.1"
                     /db_xref="GeneID:55992356"
                     /translation="MPDIAPFRIVVVGGADSGITAAIRSRHLDEHASITVIEKGPYVS
                     HANSGVPYALDGLIETDTALVVQTPAGLKARFNLEVHINTELVSIARAQHTIAVHSQD
                     TKCIYDLTYDKLILAQGAEPARLDIEGTKDAQNIFTLRTQKDIQAIRSYALKNESKRA
                     TVIGGGFIGLKAVENLHRLGLHVDLVEMHDQVYHTVDKDIAYYLQTELLRNGVQVFLQ
                     TRPHKIMTIDAEDYSYIELNNGSILSTDLIITAVGLNPRVSIAQEAGLTVKRGVTVNS
                     FMQTSDPDIYAVGDMIETEGGLGHIPGTLALGGPGSRQGRIAANHIYGKASGYSGYVG
                     TSLCKVFNLTVAITGMSVDRLRGIGYKPQWVTVRIPDHEGYYPSSSQLTLRASFEPYT
                     GRLLGAQAVGKSGVDKRIDVLSTAIQAGMSVFELEQLELSYAPRYGPAKDPVNVAGYV
                     ACNVLRGDVQLIHPDQLIGHIPEWQVVDVRSAENFSQGHVPSSRNIPIDTLRKSLASI
                     HKRLPVLVYSRVGYHGYIAYRILKQLGYQVANLDGGWKLFVSGGYQTIITS"
     gene            <18143..>20654
                     /locus_tag="TRUGW13939_04859"
                     /db_xref="GeneID:55992357"
     mRNA            join(<18143..18178,18259..18803,18867..19812,
                     19863..>20654)
                     /locus_tag="TRUGW13939_04859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488024.1"
                     /db_xref="GeneID:55992357"
     CDS             join(18143..18178,18259..18803,18867..19812,19863..20654)
                     /locus_tag="TRUGW13939_04859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343917.1"
                     /db_xref="GeneID:55992357"
                     /translation="MDIFPTISAGYYINSSESGTSLVRNFETLQRSDVALVGGKNSSL
                     GEMISSLGAEGIAVPPGFATTSNAYWDYIDENNMQEKITILIADWQSGIATLSETGHS
                     VRNLFIRGNWPTHVAAAIREGYRELSVKAGLQNLDVAVRSSATAEDLPDASFAGQQES
                     YLNVSGEDALLRACQHCYASLFTDRAISYRQAKGGSGVMFSIDTESGFDKVVLVNAAW
                     GLGENIVQGTVNPDEYQVFKPLLKEPTLVPIIDKKCGDKTIKMIYSDDNTRTRNVPTS
                     KTERASFVLSNEEILQLSRWACRIEEQYCCPMDMEWAKDGLTNELFIVQARPETVHSR
                     RDAAAAFTTYKVGDKGRLLTTGLSIGDAAVTGRVCLFESIESINEFIDGSILVTQTTD
                     PDWVPIMKRAAAIVTDHGGRTSHAAIVSREFGLPAIVCTGNATYVLHTSQDITVSCAE
                     GDHGFVYAGISDITAETVDLTGLRHTRTNVMLNLANPAAAYRWWRLPADGIGLARMEF
                     VLLDKNAKHQIAKITATYKHKPEYFVDKLSQGFAALCAAVYPNPAIIRMSDFKTNEYA
                     GLTGGAEFEPEEDNPMLGFRGASRYYSPRYKEGFSLECAAVKRLRDEMGFKNAIVMIP
                     FCRTVEEAKKVLNVMAENGLKRGENGLQVYVMCEIPLNVILAEQFTGHFDGFSIGSND
                     LTQLTLGVARDSGELAGLFDEQDAAVKWMVGKVISVARARNCKIGICGQTPSDHPEFA
                     RFLVESGINCISVSPDSFVAVKRHVVASEGGM"
     gene            complement(<20972..>22015)
                     /locus_tag="TRUGW13939_04860"
                     /db_xref="GeneID:55992358"
     mRNA            complement(join(<20972..21415,21474..21703,21754..>22015))
                     /locus_tag="TRUGW13939_04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488025.1"
                     /db_xref="GeneID:55992358"
     CDS             complement(join(20972..21415,21474..21703,21754..22015))
                     /locus_tag="TRUGW13939_04860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343918.1"
                     /db_xref="GeneID:55992358"
                     /translation="MASPNFRIAIVGAGQVGGATAYAMILRSIATELLLVDIDSAKRD
                     AQVSDLSDATYISNSGTRVRAATHHEAGQCDIIIITAGAKNFLAEISILHMYRHIGMI
                     RNVVQAMSPFKSDSILLIVANPVDLLTQIAQEVSRLPTAQVIGSGTFLDSVRLRGLLA
                     DKAGVAAKSIDIHVLGAQGDSQVVAWSTATVGGIPIAQSIPPSTIDQKELERQTKDRT
                     KDIVRAKQATTFGISSIVTSICSSIRHDTRNVRPISHFQPEFGCCFSSLVVLGRKGIT
                     REINMSFESEEQAAILRSANELKETMDRVHENYQD"
     gene            <25910..>26384
                     /locus_tag="TRUGW13939_04861"
                     /db_xref="GeneID:55992359"
     mRNA            join(<25910..26180,26233..>26384)
                     /locus_tag="TRUGW13939_04861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488026.1"
                     /db_xref="GeneID:55992359"
     CDS             join(25910..26180,26233..26384)
                     /locus_tag="TRUGW13939_04861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343919.1"
                     /db_xref="GeneID:55992359"
                     /translation="MEPKDDEYRVHLNGAGPLVTNAIIVHVSTKQTSNIHKQLRLEMD
                     GNSVKVKSSMESSVNGVYVVGDANNDGSTNAHHAMWSAKRAAVNAHVSISKQEYLDDV
                     PSAMVAAVGVGEVFYQDQIEQHELQLDDIEQMYKALGG"
     gene            <28463..>29084
                     /locus_tag="TRUGW13939_04862"
                     /db_xref="GeneID:55992360"
     mRNA            join(<28463..28739,28792..>29084)
                     /locus_tag="TRUGW13939_04862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488027.1"
                     /db_xref="GeneID:55992360"
     CDS             join(28463..28739,28792..29084)
                     /locus_tag="TRUGW13939_04862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343920.1"
                     /db_xref="GeneID:55992360"
                     /translation="MHVSRPLFSGLLLVAVVVASNIDDVPHQCRDICAPVVSLASYCD
                     DRSDRINEDNDDDDDDELSCICNGSDASTSIPMCDVCITEYGNDGSDNDVNDLVQSCS
                     FTTSSYISTSTSTSTATGEITSATTTTSATSATISTSSSSTGQASSSSTSTSASAAAT
                     SDSGAAANDNFNSGMFGLIGAGALAIMNL"
     gene            complement(<31125..>31603)
                     /locus_tag="TRUGW13939_04863"
                     /db_xref="GeneID:55992361"
     mRNA            complement(join(<31125..31132,31263..31334,31444..>31603))
                     /locus_tag="TRUGW13939_04863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488028.1"
                     /db_xref="GeneID:55992361"
     CDS             complement(join(31125..31132,31263..31334,31444..>31603))
                     /locus_tag="TRUGW13939_04863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343921.1"
                     /db_xref="GeneID:55992361"
                     /translation="LIPYTGAGTTASWLGMADLGIAQLHDMKTNAGMIANIEPNRPPL
                     IAKMHTGHEGPFMVAKSVQQYILAGFHIEDQVHTT"
     gene            <34343..>34858
                     /locus_tag="TRUGW13939_04864"
                     /db_xref="GeneID:55992362"
     mRNA            join(<34343..34673,34731..>34858)
                     /locus_tag="TRUGW13939_04864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488029.1"
                     /db_xref="GeneID:55992362"
     CDS             join(34343..34673,34731..34858)
                     /locus_tag="TRUGW13939_04864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343922.1"
                     /db_xref="GeneID:55992362"
                     /translation="MQISHSHNLAVLLCMKVIIGINGLPLISVDNGSVLPRQGITTPL
                     GIDVKDLDLGDISPIEDGWLELDSDDGDGNDLGSSSVSNANGYLGSIGSGQASQNGKS
                     LEGSSAACSLTGCVTSAAASNGNQTSSSSTSTGGLISAPSISGPLIEINN"
     gene            complement(<35540..>37245)
                     /locus_tag="TRUGW13939_04865"
                     /db_xref="GeneID:55992363"
     mRNA            complement(join(<35540..35714,35768..35937,35993..36100,
                     36157..36998,37056..>37245))
                     /locus_tag="TRUGW13939_04865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488030.1"
                     /db_xref="GeneID:55992363"
     CDS             complement(join(35540..35714,35768..35937,35993..36100,
                     36157..36998,37056..37245))
                     /locus_tag="TRUGW13939_04865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343923.1"
                     /db_xref="GeneID:55992363"
                     /translation="MWVYVGLAVIFLALRAIYRLYFHPLAKIPGPKLAAISSLPEFYH
                     DVIRDGRYLWEVEKMHEKYEAGPVVRINPYQVHINDPSFYGEICASGGRKRDKSFAAM
                     AGLRSSESLPSIIDHDHHNVRRKHLNPVFSKKAIVEIVPMIQRKIAMVMEDLETAYNT
                     EGRVVDLEHEFTGLTADTVTEFTYGKDLGFLRDKQFNNVILGAMREMTDQFHVNRFFP
                     FLTPLLSHLPPWFMCQFRPKLAGIYELQKRINKEPVIKNHGINTVMETLTDPSMPAEI
                     RSPEFIRETVNIILGAATEPTSGTLLMGIYQLVQQQPLWLKLREELKAVMPAPTDAPS
                     WLQLEQLPLMRAVFHEVLRFSPGTIRIARVATQETLVCQGHAMPPGSTVSASARLIHM
                     HEDPFPDPHSFNPDRWLEADPKQHNKMLQALVPFSRGPRNCIGYNLVTAEVYMVLAAI
                     IRRFDMELYDTSPANVAFERDCVVARPVSGFWNVKVRLTGVATN"
     gene            <38557..>39339
                     /locus_tag="TRUGW13939_04866"
                     /db_xref="GeneID:55992364"
     mRNA            <38557..>39339
                     /locus_tag="TRUGW13939_04866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488031.1"
                     /db_xref="GeneID:55992364"
     CDS             38557..39339
                     /locus_tag="TRUGW13939_04866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343924.1"
                     /db_xref="GeneID:55992364"
                     /translation="MDFINGKVSSKDLSYPIPFFSPPYEAPTGTMEWNGVSSIIIRYR
                     TDGELIRHLLPDNLTIERNPIVTLMIIDYGPAPLGACFEVFQMVEVLYNGKKFNFSIL
                     LVLDNPRAVYIGRELFGFPKLLGEVEFKPLLADQTAEIRGHCISPLDNTTPALEYSFK
                     PTTRLSSEAASQFGGGGAPVLNLRLIPSSVPGAKPSVREFVEVDFHLEVGEVWEGDCE
                     FKFPSTAESEPFHQLPVVERLSTHLVRKCTSFVTLGEQAFRF"
     gene            complement(<40682..>41290)
                     /locus_tag="TRUGW13939_04867"
                     /db_xref="GeneID:55992365"
     mRNA            complement(<40682..>41290)
                     /locus_tag="TRUGW13939_04867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488032.1"
                     /db_xref="GeneID:55992365"
     CDS             complement(40682..41290)
                     /locus_tag="TRUGW13939_04867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343925.1"
                     /db_xref="GeneID:55992365"
                     /translation="MWYVQLYIIVQQNLNSLERVLKCTEIEQEVKQPFIRTVDIPEHC
                     PSQGGVHFEGYKTRYAPELPPVFNDIGFNVLPGERVAVVGRTSVGKRTLTLAIIRGLE
                     AELSPIKIDDIDISEVTLHQLRQAVTIVSQDPGLFRRSMSENLDPLRCYTNEEMLEVH
                     RKVRLLHAISTDNLNSATTLNYLDHSADALSRGQGQLLCISQ"
     gene            <42941..>45267
                     /locus_tag="TRUGW13939_04868"
                     /db_xref="GeneID:55992366"
     mRNA            join(<42941..43071,43133..43239,43307..43860,
                     43927..>45267)
                     /locus_tag="TRUGW13939_04868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488033.1"
                     /db_xref="GeneID:55992366"
     CDS             join(42941..43071,43133..43239,43307..43860,43927..45267)
                     /locus_tag="TRUGW13939_04868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343926.1"
                     /db_xref="GeneID:55992366"
                     /translation="MSRQSPHLVKVHELWKLIRQRSKEQSYELNGKLLHIAEVVATSQ
                     QASTPQLSEDPKIINRLQDSVDVLFDHLARGWYVYGVNTDFGGSADSRTTEVIELQKA
                     LMQLTQSGIPTKPSNGSLIPGHSTPLEWVRAAMVVRCNASLRGHSAVSLTIIKAIISL
                     LEHGLTPVVPLRGTVSASGDLMPLAYVTGSIEGNPDILLEKHGKVFRSHQALQETGLA
                     PVSLGPKEGLGLVNGTASSAGLGALVVAQAHSLAFLTQVLTGGAVEALRGSSESFHPF
                     IARARPHPGQIECARNIAYFLGGSHLSRDVLEPKSRRREDLVQDRYSLRSAPQWIGPQ
                     LEDLLLADQQISIDLNSSCDNPLVDSYSNDIYYGCNFQAAAVTSAMEKARLALQMFGR
                     ILFAQSTEMIDVHLSGGLPANLAADNPNISFTMKGVDINMAAYMAELSYLANPMSSHV
                     QAAEMHNQSVNSMAFASARMSQDAIDVLTNMCACSVFIVSQELDLRALHMAFIADATK
                     ALASTIELAFSNKVEDDQLNSLQTSVQANVDRAWGSTAKLNLYDRCASLIDSTVPIVL
                     SHVGGAVADITKWKEHAVGVVWKVWKKTFASFSAAPHTSHLLGAGSRVLYDFVRITLG
                     VPFHQGFLEHPTADGQTFHGRPKKTIGGWISIIREIIQCGSIYDDLLALAEGLLPTAG
                     GRNWTNGKNSTMCHGYTNGEVPGWEKSE"
     gene            complement(<46702..>47343)
                     /locus_tag="TRUGW13939_04869"
                     /db_xref="GeneID:55992367"
     mRNA            complement(<46702..>47343)
                     /locus_tag="TRUGW13939_04869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488034.1"
                     /db_xref="GeneID:55992367"
     CDS             complement(46702..47343)
                     /locus_tag="TRUGW13939_04869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343927.1"
                     /db_xref="GeneID:55992367"
                     /translation="MTIQISAENALLARARASHSTEDCMALYHEWAATYNDHLADASQ
                     NYVAPVLVAEAALKWKIHPRGPILDAGCGTGLVGEALSQSLTVTIDGIDLSPAMLKVA
                     RQTGVYRDLVLGDLTQKIEKPDESYDIVTCAGTFTEGHVGPDPALREFVRVTMKNGLI
                     VATILNKIWKSGGYKAEIEKLEAEGLLKVVNVEIKDYRKGAGDKATLVVLEKI"
     gene            <50290..>53284
                     /locus_tag="TRUGW13939_04870"
                     /db_xref="GeneID:55992368"
     mRNA            join(<50290..53196,53246..>53284)
                     /locus_tag="TRUGW13939_04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488035.1"
                     /db_xref="GeneID:55992368"
     CDS             join(<50290..53196,53246..53284)
                     /locus_tag="TRUGW13939_04870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343928.1"
                     /db_xref="GeneID:55992368"
                     /translation="NSNAPAAGPATPRPPARQARPVDQDSDDEPDEQTQQRFTTLERV
                     IDQMNEHIQRLQAAIAERDDHVNQLEAQVMAIPPGEAGTAGNRVKLPKPMTFDGTRSK
                     LKTFLVNMEMHIEANQITHDKKKMIFVASCFTDAAAEWIQPMLSELYTTDRSSWGTIT
                     RELFSNYGMFKQKLGEAFGNIDELRTAERQLRYLRQTGSAQQLATKFRQIVTPLHYDD
                     AIQIATFENMLKEEVQTELIKLDRPDNIDRFIEMAVKIDNKLFEIKQKRQEFQRWKKV
                     GGFPQYANTSAKRGTQYDKDGDVKMQLNNVISKEEMAKRKENKACYKCGRKGHFARQC
                     RSGQNKQNGNVSPQKITTVHQQVAAIHQTIVTPSDSEEEESENEQVDEVKDFWGPILE
                     KEIYESLKKFEQEDSPGQSKGRLRQSSEREPPQEEDANPEEAQPHLRRGQEKGPIREP
                     RREDQYSKTAGRRIDDLSSGSESRHPLTFRDGGKDREVDHEDSDRESDTPQHSQLTRT
                     TNLRRDAARAIDQANETIRLFQKRPPITKKEWDSVLGTSTTVPGIKIEIPETSKEELK
                     TDSEDSETTEEFPEIDYEEPKRECSCKPPKPVCWEDSIQTYRQHILECEKCHEWTFHK
                     CDMHGKKNIALANEFEYVSLTKGTRLCHPMLGHTERCSCMYYPQYGGHHHKKIHWTQC
                     YESKCPTHLEEKEKNKWKPTAPMIIYQPIPDCPKGWNECWCYAEEIWHPFHNSIETDQ
                     CYAKKCPYHEGRVIYTDEDWTEIVLSQKRYLERHRKGHHLIATTIKTGETVIIIKGTI
                     NGHEAKLLLDSGASTNYISEAYVKKNRIQTHETNLWHTVQNFEGQITIEGFVRRTGNI
                     TLKSGEHEESIQLDLSPFERKDFDIILGMTWLRKHNPVIDWKHETVSIDLKTLQTEQM
                     GIKPNQQLKVKHAEEINEIGRQIETRKKPKEIYEKELKEVLDKLPEKYRDFTELFRYR
                     SRKEHKYHK"
     gene            <59507..>60987
                     /locus_tag="TRUGW13939_04871"
                     /db_xref="GeneID:55992369"
     mRNA            join(<59507..59547,59608..59789,59849..59961,60017..60133,
                     60197..60269,60332..60435,60488..60765,60831..>60987)
                     /locus_tag="TRUGW13939_04871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488036.1"
                     /db_xref="GeneID:55992369"
     CDS             join(59507..59547,59608..59789,59849..59961,60017..60133,
                     60197..60269,60332..60435,60488..60765,60831..60987)
                     /locus_tag="TRUGW13939_04871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343929.1"
                     /db_xref="GeneID:55992369"
                     /translation="MSSKILITGAAGYIGGSLTADFLSDKHPSISKDQIIAAVRSKGQ
                     VDTLAKLGIPVLQLDLADEKAVAESILLHNVYVIIHTTSAIDPTAALNLITALGKQNK
                     ASGKKTYFVHTSGLSAFYEGTGWPAGQFKDTDAVFETEKQLMHSFPIRNTDISVIEHA
                     AKQGVTNFVVVPSLVYGEGTGEWNRLSVVLPVYVQASLRNKTVYRFPENTKVSAVHIS
                     DLTALYGRIIDKVLRDETLPCDKEGYYFALAHDLFLGEVLDRMALALKSRGLIAEPGT
                     RVYPNDHAAAESLGVPEQFVQTLWNSGDNIVADVPFKIGWRPAWSKERFFANINDEID
                     AVLEHGKAKSSLIDSLFKAA"
     gene            complement(<61444..>63228)
                     /locus_tag="TRUGW13939_04872"
                     /db_xref="GeneID:55992370"
     mRNA            complement(<61444..>63228)
                     /locus_tag="TRUGW13939_04872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488037.1"
                     /db_xref="GeneID:55992370"
     CDS             complement(61444..63228)
                     /locus_tag="TRUGW13939_04872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343930.1"
                     /db_xref="GeneID:55992370"
                     /translation="MKSPACLAVVALAAGVIAAPTMHSNASNTACIPQNDPNPKQRAA
                     GISARNAGFIYGPSLIGEAAPFPNGTLGNARSKSDYDTWSIDRKEIDSLIANDTEAVG
                     AAIKANGGLKTWQDYEKVLYDGQLINSNPRGVTPGIITNATQDLLFSMERLSEHPYAV
                     RRVLPEEDLPFPLDNDLTAKIVGMNATLESLRDSSKLFIVDHSYQKDYKLATVVQRYP
                     VACSAYFYIDSKSGDFLPLAIRTNVDADLTYTPLDSANDWLLAKMMFNANDMFHAQML
                     HLVISHDVTESVHQAALHTLSENHPIMLILERLMLQGYSSRIVGEELCFNPGGHWDQL
                     MVYSQFGCRDFVTDRWPIDGRFQGGYLENDLKARGLIDDNGESLFKSFPFYEDAKEIR
                     DIYKAFFTSFVDSYYGTENDLSGDFEVRNWFVEANMKAKSHDFPQEEQLTKETLIDVL
                     SHFAFATSVSHHSTNGGAPISSATLPFHLPAIYTQIPKEKGVEDLMPYLPDAATAVHY
                     LGFMASFNRPFYGASGRTLEDAFATTDSMALLNTDANSAAKTFLSSMQNLSQNIRGRQ
                     FNDDGLSQGMPFIYRTLDPAYIPFFCAV"
     gene            complement(<66044..>67094)
                     /locus_tag="TRUGW13939_04873"
                     /db_xref="GeneID:55992371"
     mRNA            complement(join(<66044..66777,66875..66962,67020..>67094))
                     /locus_tag="TRUGW13939_04873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488038.1"
                     /db_xref="GeneID:55992371"
     CDS             complement(join(66044..66777,66875..66962,67020..67094))
                     /locus_tag="TRUGW13939_04873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343931.1"
                     /db_xref="GeneID:55992371"
                     /translation="MSGIHQPNNSAAPSIRIVSMPQLAEAISMDDDWTGTRDAAARRR
                     AQTRLNTRAYRKRKALAKEAEASIAATGTQVNSEVLVKYWDIEQQSVSVVPKSRIKQL
                     YNPRNPLLPNKSVKEQFNFIFPLCPDHLITLLQFNALRALAVNRTLISGILVTPLDCD
                     DEIIHVLPYPTMPELFPPKLLPTTLQQTAPHGDWIDLFPSPEGRDRLIQGAGTFDEDE
                     LWADCIGGLYEGFADDEIERRGIVAWSPPWDITGWEMSEGFLRKWGWLFKGLPGVLEA
                     TNRWRKERGEDPFFNNDCTSHG"
     gene            <67695..>68718
                     /locus_tag="TRUGW13939_04874"
                     /db_xref="GeneID:55992372"
     mRNA            join(<67695..67768,67830..>68718)
                     /locus_tag="TRUGW13939_04874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488039.1"
                     /db_xref="GeneID:55992372"
     CDS             join(67695..67768,67830..68718)
                     /locus_tag="TRUGW13939_04874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343932.1"
                     /db_xref="GeneID:55992372"
                     /translation="MTFHPDTLPDLKGKVFIVTGGNSGIGYYSVAHLAGHGAHVYMCV
                     RSLEKGTAAIANIKEIHPSAHVDLLHMDLMDLTSVVVAAKHFLAREAALHGLINNAGI
                     MATPFEMTKNGHESQWQTNYLAHWVLTERLLPLMLQTAKTLPSGSVRIVNLTSSGHLS
                     APKSGIDFKDTSLKNSSPWLRYGQSKLANILYTKTLHKTYGPGSLNAQNGEGEIWVSA
                     VHPGLVETSLATSVVESRSGIMYILSALRMFGLIWSADKGSWTSLFCAASRDMKPEQC
                     GTYLEIFQRFGEPRWQSGAAKDEILAERLEEWTGDVMRKQGWAL"
     gene            <69343..>71273
                     /locus_tag="TRUGW13939_04875"
                     /db_xref="GeneID:55992373"
     mRNA            join(<69343..69348,69408..69514,69581..>71273)
                     /locus_tag="TRUGW13939_04875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488040.1"
                     /db_xref="GeneID:55992373"
     CDS             join(69343..69348,69408..69514,69581..71273)
                     /locus_tag="TRUGW13939_04875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343933.1"
                     /db_xref="GeneID:55992373"
                     /translation="MKLRCDGLERLPAPCSRCESTGKNCVIDRSFRRVSRRDRLDELE
                     KDLRALQAGVEKPANLNNQSISSGNIEEILPTSDQASTPLIDSGEKIDLPDSHALLSR
                     YRSVLLPHRLEDIELQPQEIIKHVILFYRHYHEHFPILPDIHYLLQNIQTSPLLVWVI
                     VAITSARRPLEQYLRVKLIEPMKRLAGASIMGSDSPSIFLVQALLLLCNWPMPFKATI
                     TDPSWTYCGAAVSIALRIGLHKPAFQVDFMYGFRGDEDGIALRTRSWVACFIMQHRVS
                     IILGLPTMIKLDHTILESMTGYFPHLPQSLQRMLFLTYKIHNFSNQLGQCESTKYGFS
                     PNPLSLVQGFEKDLDLFQTTLKSRREETALLSAKLHLYSYLLSPSLQDHDATESLKLV
                     EGHHITYYVGQAYSCASRIVNLSYDMFSQDPGIESFEGVQEKRHWSVGWTHDLMYAMM
                     VLLWIVKLSDVECDIDAADSILRQGRNIYKQLMTMDDDHHSRVCDLVDYITCMDFNNL
                     KDSRTTLKQTFIRSRMSANIIWNVVYAAKKRFFEQRRTPGDIESNSIDMVCFSADRPG
                     LDDLEPNTYTGDFGNDNISWIDWDSFLPTDGANII"
     gene            complement(<73818..>74894)
                     /locus_tag="TRUGW13939_04876"
                     /db_xref="GeneID:55992374"
     mRNA            complement(join(<73818..74374,74433..74665,74719..>74894))
                     /locus_tag="TRUGW13939_04876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488041.1"
                     /db_xref="GeneID:55992374"
     CDS             complement(join(73818..74374,74433..74665,74719..74894))
                     /locus_tag="TRUGW13939_04876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343934.1"
                     /db_xref="GeneID:55992374"
                     /translation="MMHDRPSFDSLPLHPSDPPYSAWGLYGKDDELGTLNLLSSDCVT
                     KATAEIQYGISISLNLPLDTPDVPMNPERKSCTHKFNIKPRSNDDELDINTQSSTHWD
                     GLRHVGYQKERLFYNGIRQDQICGISSSDVLGVHNISRHSIAGRGVLLDYRSWAISNG
                     VHYDAFTNHSVTLNQLLACAQAQNTQFEIGDILLIRFGWTEDYLGRDDAERKALGGRK
                     YRTFVGVENSLEMAKWHWGNGFAAVASDTNAYESWFPDIKSDLGYSLHEVFLAGWGMP
                     IGELWDLEQLAAECKRVGKWSFFLTSQPLDIPGGVASPSNAMAIL"
     gene            <75186..>77121
                     /locus_tag="TRUGW13939_04877"
                     /db_xref="GeneID:55992375"
     mRNA            join(<75186..75426,75476..>77121)
                     /locus_tag="TRUGW13939_04877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488042.1"
                     /db_xref="GeneID:55992375"
     CDS             join(75186..75426,75476..77121)
                     /locus_tag="TRUGW13939_04877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343935.1"
                     /db_xref="GeneID:55992375"
                     /translation="MLKELKILTPIGMLGYSYNKETFWKSIEGGVDAIILDSGSTDSG
                     PSKLALRKSIQTNEAYEKDLEEIVAACHHYRIPVMIGSAGGDGSTRGVNQIADIVLSI
                     IEGRGYRPMKVIKILAEIEKDIVRDKHRHGLVHPCGIAVPDLVEEDIDQAQTIVAQMG
                     IEPWIKAMNEYPDFDIIIGGRSYDPSPYAAFCTWKGFVDLGLSYHMGKIMECGGICTT
                     PKSREALATIRHDSFDITPLDPKSTCTSVSVAAHTLYEKTRPDILVGPGGTLDLHLTT
                     YEEMDDGRSVRVRGAKFIPVKENEYTIKLEAGKLNGFFSVFMGGFRDTVLISQIDTFL
                     EGMKTYVKDKINFPFDINVQLFGRDAVMGVLEPDSGRTNHELGILLRARAETQEQATH
                     VSQSARVYCMHAPYPGQRATAGNFAMPCAPLDIPMGPVSEFCMYHLMMISDPCEFFPI
                     IATILDGPNTTPQRDSIESGFQTTTNSHKQAHVKPDIANTASASSQPTKTTDTKSNSN
                     MSVLKEVPPAGYSFLADLASVIRSKNAGPYEITFDVMFSTAKARDIVKRANILTVETI
                     SRLYNVPVTDVITCLWWDSAIAFKATIKRPIVSGSFHDGDSHGSAQHMPLMSLPIPVE
                     KLDI"
     gene            complement(<77658..>79117)
                     /locus_tag="TRUGW13939_04878"
                     /db_xref="GeneID:55992376"
     mRNA            complement(join(<77658..78205,78291..78850,78900..>79117))
                     /locus_tag="TRUGW13939_04878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488043.1"
                     /db_xref="GeneID:55992376"
     CDS             complement(join(77658..78205,78291..78850,78900..79117))
                     /locus_tag="TRUGW13939_04878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343936.1"
                     /db_xref="GeneID:55992376"
                     /translation="MSRPPTPPADPPASRAQWRFHALSAPTEWIEDYRPGKYHPVHFR
                     DNLKSSRYRIIRKLGYGSFSTVWLAKDHMRNQYVTVKILIADPDASKHELAILQVLSR
                     SSAQGKSHVMNMLDFFEHKGPNGVHRCLVFELMGPSVASASEDLLDDVVDASSEQQRF
                     PIWMVKRILHHTLLGIEFLHANGIAHGDLQQGNLLFPVKDLSTVGEEELSRNDEISEP
                     VRRLDGRTDLWAPKYLALDQPLSQYIDASPGFNIKISDLGGAFFLSDPSNKLVTPVAL
                     RSPELIFEKKINKDQDIWSFGCLIFELFTSRHLFLVTDMGREEEVNDDHFLQFNDVLG
                     PLPGTLLAKYPRAHIYYNEKGEKVKNYIGELPEGFDPSTIEPSPSLEQAFDKEKPVDI
                     DDEEGYIIKGILRCILDYDPAKRPSASELLKHPWFSAIASEEETNVRNE"
     gene            complement(<81075..>81758)
                     /locus_tag="TRUGW13939_04879"
                     /db_xref="GeneID:55992377"
     mRNA            complement(<81075..>81758)
                     /locus_tag="TRUGW13939_04879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488044.1"
                     /db_xref="GeneID:55992377"
     CDS             complement(81075..81758)
                     /locus_tag="TRUGW13939_04879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343937.1"
                     /db_xref="GeneID:55992377"
                     /translation="MRLSYLFTAFLAGLSIASPIPNPGPAGAAELEVRGHRGGGHGGH
                     GGSGGKGGKGGNGGNGGSQPAGPKIVETEAYKAAHAKHSGLKENDWYYFTVKTPLGQS
                     IPGDAETKTELQQLQHRLGFEHIAVVVGEVVYTESGKGKKHHTIKKDFKATQFDMVKS
                     PENKTIVRSPNWSPQPQKTLAYGGTTTKSKAERAKKNIPKDWKEEHPEYNVDTNSCND
                     FVQNYIAHL"
     gene            <82572..>84155
                     /locus_tag="TRUGW13939_04880"
                     /db_xref="GeneID:55992378"
     mRNA            <82572..>84155
                     /locus_tag="TRUGW13939_04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488045.1"
                     /db_xref="GeneID:55992378"
     CDS             82572..84155
                     /locus_tag="TRUGW13939_04880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343938.1"
                     /db_xref="GeneID:55992378"
                     /translation="MKEWHRTTIDDWVAKGMLNKEFILERLDQRIEDGSPFSQEEKSA
                     LKRVFDSVCSTDGLLTQAAFISFLQTKSALPRSQEAIQAGKLLYTSLAYLSSLPFPSS
                     PERNASRGLSLKQLTRSLVWVLPGSYSAIIEQGSDSRLRTKADHRRLVFQSLASTTHK
                     IQYDYEDARKIARHDAFEVDWESDLEFCSLNHDDDGDEIYHDLLDVLYSTQEEKSPGL
                     ARVPRDAFRPIAKRIATENDVPSLHPIGIPTNQFISLVKLLLALQFESTETEVDLDYF
                     DAAATSICAAFSDHKDTAVITWSAFNCALKDITPYLFDPLYDMLSTSFLEQDPSHYQT
                     GYEPPSEFGDILTLPLVSQLSTFLIGCAYFGDFRRLEHYTPSSLPTPNAFIDAVETAP
                     DEAVIILSGTTKSGDVCTFGVFSREPKADGASVQTNVIPNQVGLEPCSIFQLAPIQDI
                     FRGTPGKPGWTVDSDTVMFGQGGGVVMVLTDGLRRAEIRHHVSERSDSEGVYKPNISR
                     GNWIVELEISQIEIWSEVD"
     gene            complement(<86466..>87926)
                     /locus_tag="TRUGW13939_04881"
                     /db_xref="GeneID:55992379"
     mRNA            complement(join(<86466..87230,87303..>87926))
                     /locus_tag="TRUGW13939_04881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488046.1"
                     /db_xref="GeneID:55992379"
     CDS             complement(join(86466..87230,87303..87926))
                     /locus_tag="TRUGW13939_04881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343939.1"
                     /db_xref="GeneID:55992379"
                     /translation="MEQSHLAALEDFLKNHPGIKCTLPSSPQYLADRKVFILSRKANP
                     LAIAHPETAEQVSVLVQFLRSNGIKFTVRAGGHHLLGFSIEEGALTIDMRAFASVDIA
                     ANRETATVGAGILQHELCNALWDKGLATPTGAIPSVGYLGWAMYGGYGPFSSHWGLGV
                     DQIVAATLVDASGAIVRADDTLLKAVRGAGGAFGIIIDVSIKVYHLKSLLTGAIFYDS
                     QEISKTFMDYNAKYQEISKHGLPKQLTLQQMVVNGPPGRVFCVSFMWSSESIEEGYHW
                     CNKIACLGTVIMNTVEVTTIPKWYSGNAALIPSTMYGSFRTHSVKDMTQEVTGCIGRA
                     LEKLPADPGTMFSIHQLRDTSETPASASVFSTREPHFMLEIVGCATTTEKAETSEQWA
                     FDTWAEVKNTNSSNLLDHVYISLDHVEYPCDLHTLTRYFGDYAQDILTTKKDYDPENV
                     FGLTVPRLGNLL"
     gene            complement(<89166..>90320)
                     /locus_tag="TRUGW13939_04882"
                     /db_xref="GeneID:55992380"
     mRNA            complement(join(<89166..89712,89778..89918,89972..90010,
                     90064..>90320))
                     /locus_tag="TRUGW13939_04882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488047.1"
                     /db_xref="GeneID:55992380"
     CDS             complement(join(89166..89712,89778..89918,89972..90010,
                     90064..90320))
                     /locus_tag="TRUGW13939_04882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343940.1"
                     /db_xref="GeneID:55992380"
                     /translation="MTPKPSFEVPKGAAAKVHIIDSGFRLSGMPTNFLLSPEMDKFDE
                     VPPVGSWFFLVESSTGRKVLFDLGGLSNVGSFPPSVVAVIEDGVELTHVESVIWSHGH
                     WDHVGDIEAVPPATGLVVGPGFKDEFLPGYPTKQHVELPERYFKSRNVQEIEFVPGQS
                     CLRICDFAALDFFGDGSFFLLNTPGHAVGYLSGLARTTTNPETFVFMGCNICHHGAKI
                     RPSNNLSIPAEIHLTPSGKEMSYPDGALFRALNIRWDRKPNEPFFDPVLAIDLPRTIK
                     TIKDAQKVDGQDNVLFVFAHDMGVCGVVDFFPKSVNNWKKECWKEKTHWNF"
     gene            complement(<91161..>93344)
                     /locus_tag="TRUGW13939_04883"
                     /db_xref="GeneID:55992381"
     mRNA            complement(join(<91161..91882,91946..92327,92385..93224,
                     93279..>93344))
                     /locus_tag="TRUGW13939_04883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488048.1"
                     /db_xref="GeneID:55992381"
     CDS             complement(join(91161..91882,91946..92327,92385..93224,
                     93279..93344))
                     /locus_tag="TRUGW13939_04883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343941.1"
                     /db_xref="GeneID:55992381"
                     /translation="MESDKKYSWVELEEAVTKKMVEECKLDACFDLFLNNIKQRHDYK
                     SLPDLATLSKEHEGSYKELQTRLNRLLPGYLDKNESKIMDDTKLQWKLESRWRQVRDR
                     FGDSDGCDSFHETLWNILMDQRYREQVLKDETDSSSSNHIARVEVSRQLKNLIDAQKS
                     TIPFSCGGSIPIRGPDATDNSDSARRKFSGPVKIFWATSNDSKARNLVLPIDDTTLES
                     SQSTLQQLVDDCPLATFGRGQKDVFDPEYRKAGKMDPCHFSTTFHPANFGIIENIEQR
                     LLPSISTTTQNSLGFRKLTAELYKLNVYSGPSGLFRKHVDTPRSENQIGSLVVCLPAR
                     FKGVTFIVQHDGNSVEFEWSNTSDSVIQWAAFYSDCEHEIKTVSEGQRITLTYNLYVT
                     EPVGLNDSPDNGIVQAQSLPLYGWLRDVTYKEEFTEKGGVLGIYCSHSYPHSSGIARL
                     QLPRGLKGLDLLLFSVFRSLGLEVDVLPVLEFGGRYGPGNRELENDGVVKCNKKRYME
                     VWEDFDELLGYLDTGELPEDIEYTEFLPQKVHSMIEVDQYWKLLFMSRRVKGITEASK
                     DRDESGLYTTEGSRVGTTRKQYFVTDKAQEDEGEGLDEASNSVWPAYYLPGIMWVNEP
                     QHEEMAFTQLSYGNEASVNTRYSCAAILVAIPPLNQRKRKRDAAC"
     gene            complement(<94123..>96014)
                     /locus_tag="TRUGW13939_04884"
                     /db_xref="GeneID:55992382"
     mRNA            complement(join(<94123..95563,95619..95824,95958..>96014))
                     /locus_tag="TRUGW13939_04884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488049.1"
                     /db_xref="GeneID:55992382"
     CDS             complement(join(94123..95563,95619..95824,95958..96014))
                     /locus_tag="TRUGW13939_04884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343942.1"
                     /db_xref="GeneID:55992382"
                     /translation="MHVATHAWHAMPRSLATVQWVDRLQKKPQSLCPDPVFSSQTSEG
                     GHVAFVSTARLEDDLLKDWSNRIFEKGFDTILGLSVGKNGCPFVDNPHSDVCIPVTKL
                     FRSLDACLNEESLRQRRGHWSETDIRKEEKEHQIDECLTSAMKAFVARWFPLIPHRNY
                     DVVGQDEALIRESWRMARKAMLRVVNHASYRSILALYLFSQTPIPVGIPEEEELMGIS
                     GLICIHTALLQIQRLRERQKTCQYFGSQVSAWIDAIARSVPTPGLTETHLDFETRAFW
                     AAVIWDTSSSLTSNFRSSLTSGLKGACLEPVWRLARTFLVGSLHSRTDQLRTKTLEVS
                     DEVASQILSAASVCQLYLWKTATSLKEAFREGVEEESVLSSWGAVLDAIDIFQSSIRP
                     LLNACERQLHFLNQLNRFSWYQFSLQYHLGILIIVDALEAAGRSDLLADFAETRCDAE
                     HESFNTLKLGIESKFTIHELGYVPTTVSRSDRLDHSITASFISIDPYPHHVIDSVILM
                     GNFIIDKYCKGKMTDETYSYLSSTLLTSLQQLPQSSKSVQASQKTLQQSFERAKFVNI
                     R"
     gene            <96598..>97506
                     /locus_tag="TRUGW13939_04885"
                     /db_xref="GeneID:55992383"
     mRNA            <96598..>97506
                     /locus_tag="TRUGW13939_04885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488050.1"
                     /db_xref="GeneID:55992383"
     CDS             96598..97506
                     /locus_tag="TRUGW13939_04885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343943.1"
                     /db_xref="GeneID:55992383"
                     /translation="MPSTQIALAGATGNLGIPILKALLDAGFPVTVLSRNGGNAAVLT
                     PYPKIVIKKVNFDSVESLTSALHGVDVVISCVATLAIGSQNPLIDASVAAGVRRFIPA
                     EFGMDSANELCAQLPVCAPKVDTQKYLQEMSKSNPNFTYTAIANGLFLDWGLKNNFIL
                     NMAEHSAILYNGGNVPFSTTNLTNVATAVLGVIRHQPQTANRIVYIHSALVTQNELIQ
                     YAKEIDGKDWKTDIQDTEDTRKGSLVELAKGPQGDIDAAMLGFCVCGSLTTEYGCDFS
                     SHLDNILLGVKKLNKAELRALVASYL"
     gene            complement(<97779..>98988)
                     /locus_tag="TRUGW13939_04886"
                     /db_xref="GeneID:55992384"
     mRNA            complement(join(<97779..97881,97934..98106,98161..98263,
                     98324..98482,98540..98677,98733..98826,98886..>98988))
                     /locus_tag="TRUGW13939_04886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488051.1"
                     /db_xref="GeneID:55992384"
     CDS             complement(join(97779..97881,97934..98106,98161..98263,
                     98324..98482,98540..98677,98733..98826,98886..98988))
                     /locus_tag="TRUGW13939_04886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343944.1"
                     /db_xref="GeneID:55992384"
                     /translation="MVVISRFRSLWGIEPGPNMTGWKKRLVEYKAHGYAGIEVTLTEI
                     DPKHLPLLRSICDETGMLINTLIFSSWPGYVGPRPRGLSPDIHLQFFRKQLQLAWILN
                     PVVINAQSGADYWSWDDSVYFYENALKIERDEGFQGRVCHETHRNRSLFNPYVTDYVL
                     QRVPKLQITADISHWVVVCERLLDQGEEDQDILTRAMANVRHIHARIGTTQSSQCPEP
                     LNPAFAAERQFFDNLWVRIVKLRVKSDPNCHITWVPEYGPFPYHPIGTAQTHSELADS
                     EGKRLEALFKSSVV"
     gene            <99497..>103240
                     /locus_tag="TRUGW13939_04887"
                     /db_xref="GeneID:55992385"
     mRNA            join(<99497..99598,99659..99684,99735..99778,
                     99839..100012,100084..100113,100166..100261,
                     100316..100330,100391..100769,100826..100898,
                     100949..101122,101303..101369,102092..102279,
                     102338..>103240)
                     /locus_tag="TRUGW13939_04887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488052.1"
                     /db_xref="GeneID:55992385"
     CDS             join(99497..99598,99659..99684,99735..99778,99839..100012,
                     100084..100113,100166..100261,100316..100330,
                     100391..100769,100826..100898,100949..101122,
                     101303..101369,102092..102279,102338..103240)
                     /locus_tag="TRUGW13939_04887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343945.1"
                     /db_xref="GeneID:55992385"
                     /translation="MKALNYVGPYVVKVQDVQMPTLEHPDDIIVRVTSAAICGSDLHM
                     YEGRTAAESGITFGHENLGIVEELGEGVTLLRKGDRVVMPFNVADGRCRNCEEGKTAF
                     CTGVNPGFAGGAYGYVAMGPYRGGQAQFLRVPYADFNALKLPPGTEHEADFVLLADIF
                     PTGWHGIEISGFQPGDSVAVFGAGPVGLMAAYSAQLRGASSVYVVDRVPERLRAAEKI
                     GCKGINFTTGDGVDQIINLNGGMVDRSVDAVGYQAVGNDNSKEQPNIVLENMIRVTRA
                     CGGLGIPGLYVPSDPGAGDTASAKGMISLSFGKLFEKGLTLGTGQCNVKAYNRQLRDL
                     IIAGKATPSFVVSHEIGLDEAETAYQKFDKRVEGYTKVHDLINAFSKCKDAGYHGTVL
                     QCYIISNMGEEAPRTTSQWSVVGQNGIQDLLYQEAVPIPPIGDHDCLVKIEAVSLNYR
                     DVAIINNQYPLSVKLPVVAVSDGAGIVIATGSRVKNFKPGDKVCAAICPAHEHGRMDA
                     DKLATTLGGGTDGLLSQYSVCEEGGLLAIPRNLSTFEASALPGAAVSAWNSLYGSENI
                     SSAVTRIKPGDIVLTQGTGGVSLFAIQFAVAAGATVIATTSQSSGPKVDLLKSLGARH
                     VINYREDEDWGETAASLTPNRVGVDHVLDVGGAGTLEQSLKAVRFEGTISVIGFLSGT
                     GLGPGLLSALSRAITVRGVLGGSKLQLEEVIRAVERCGIKPVIDEKVFGLSEVREAYQ
                     YLMDSKHVGKVVVRVS"
     gene            complement(<103412..>104815)
                     /locus_tag="TRUGW13939_04888"
                     /db_xref="GeneID:55992386"
     mRNA            complement(join(<103412..104488,104558..>104815))
                     /locus_tag="TRUGW13939_04888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488053.1"
                     /db_xref="GeneID:55992386"
     CDS             complement(join(103412..104488,104558..104815))
                     /locus_tag="TRUGW13939_04888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343946.1"
                     /db_xref="GeneID:55992386"
                     /translation="MQSSETNPSLVGLAEEITKNAKVLDAYITEKRLPKPTFASEGPL
                     VFPVPQDDHEMQAARLSLIGASRSLLELTLGPLQRLNLEVPTSFQFASALGVANHFRI
                     AEHVPTDSGSEISFEDLSQKVGLDVNRLKRVLRVNTANRVFTEPHIGYIAHTAASKVM
                     LDPDASAWIGHQMEEIYKGSARVIDAFHKYENSDDVNETALALALDGRTYWDYLEREP
                     WKVQRFADALRYVSSHGREDIRHVIETFDWHKFGKTTVVDVGGSSGRVAISIAKVAPN
                     LNFIVQDLPELTATAKKMIESKEPSELESSNRVTFQAHDFFQPQHVRGDATVYMYRQI
                     LHDWPDKDAISILKALVPALNDGDTLLLFEAIQPLPNTVPNEIERLVRAADYLMMQKH
                     NSPERTLDMWMDVLAGADPRFEYVSHYTPPGSNDGMIEVRWNGTKKEDKGKK"
     gene            <106077..>107689
                     /locus_tag="TRUGW13939_04889"
                     /db_xref="GeneID:55992387"
     mRNA            join(<106077..106223,106283..>107689)
                     /locus_tag="TRUGW13939_04889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488054.1"
                     /db_xref="GeneID:55992387"
     CDS             join(106077..106223,106283..107689)
                     /locus_tag="TRUGW13939_04889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343947.1"
                     /db_xref="GeneID:55992387"
                     /translation="MVATAKNEEPGGPGVIEKHSITTEQYRDTFLPRPSDDPNDPLNF
                     PLWLKVTILIQVSLLAFLGTLNTAIINPAYGPLSKEFGITTVRATYQTTVVIALNGIG
                     PFLWIPLANVYGRRPVYLLTTLIGFASALGSAYSKNFAQLIVARVFNGLWPAALGLGP
                     ATVVDLFFYHQRGRAMGLFTVILTTGAHIAPIVGGLIGQFIGWRWTFKFAAILDGIML
                     LVTTFCLPETLYIRDQTRLTRVVSEREVDFTTRTYASRLRLYSDFSELKLRWNQFIIP
                     SIKMAKYPSVLFPALYYAAQYGFASILPAVTVASIFSETFHWNTLEIGLAYGGALSIG
                     SILGEIAGGLVLDAIVNRARHKLGGINPPPEIRLKGIWTGALLVPAGLVIYGFTLHYH
                     VFWFVPLFGMGLACFGLQVLTTTCYTYSIDSYRAHESETAQLINFIRQEFGMTFAFYV
                     VDLCQRIGYQWAFFMFAVLGSGLGFLPILVLMFKGGEIRKRLGEPSDTTMPNTEDFQA
                     VSQGKFQQG"
     gene            complement(<108352..>113521)
                     /locus_tag="TRUGW13939_04890"
                     /db_xref="GeneID:55992388"
     mRNA            complement(join(<108352..109015,109069..109355,
                     109410..109591,109649..110339,111351..111541,
                     111604..113119,113216..113344,113402..>113521))
                     /locus_tag="TRUGW13939_04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488055.1"
                     /db_xref="GeneID:55992388"
     CDS             complement(join(108352..109015,109069..109355,
                     109410..109591,109649..110339,111351..111541,
                     111604..113119,113216..113344,113402..113521))
                     /locus_tag="TRUGW13939_04890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343948.1"
                     /db_xref="GeneID:55992388"
                     /translation="MSASAFRSFGLSPLLLSLFVFLHIIHGVVGGSPPTQSFKSRPDL
                     RPPIIVVQKSTPSKLTPGYFFVTPSDGDNPGPHIFDNQGNLVWTGYAIAGPPISHGFH
                     VCPHQGKDHLCFFQGAQAKGYSRGHGVILDNRYRTVRTVQSGGGMAGSDMHEFRPVGA
                     GKTALLTVYQQRQFDMSTWNIKTGMGWIMESVFQEVDVETSEELFEWRSLDHVDPSET
                     YTWPDHTDTSGNGLDPYAPWDYFHINSIDKNKDGDYLISSRHTCAIYKISGKDGSVMW
                     RLHGTNPTFRNINFSFSQQHDARWLFENSTHTVLSLFNNGYNGFNQTHAYSSGMIVII
                     DHQNLTATMTNEYAPYLNNVLASSQGNTQVLSNGHVVTGWGNSGYVSEHDEHGKLIFW
                     TLIGDGQTMNYRAQKFEWEGYPTDNPAMWTYSRSDEEDSPMTFYVSWNGATQVKSWRF
                     YGAWNQSDSYELLAEIAKRGFETTYTHAGFYPWSYAEAVDAQGNVLGSSSDKFTFVPS
                     PLLREYCADQLCENTLEYGMPDEVDSRPLVPPAGIKTVPWVDNEDSDADADGIPRPVT
                     VPQGHQPSNNSNDSQKKYSFTRGQIAWVIALLVVVIAATIVLNCVYFRRARRSNAHFN
                     RMKESRSSENLGQPDKHHPSAPSSPWWDAWEISTPDLLRSATPSYLSASPACSRQTIL
                     MEWQQGHSRRRSQPVHSETEAMMEYQQEQRRRELSPPKPLPVTWMSLPRKSQLLVLCL
                     CRVFDFLQVASLQAYMFYQLKSFDDTLSDSEISTQAGILQGAFTAAQFATAIPWGRAA
                     DSEWGGRRFVLLVGLLGTAVSCLGVAFASSFTQAVIWRSLGGAINGTVGIIRTMIAEN
                     VKEKKYHSRAFLILPIGFNIAALFGPVIGGMLSDPVSSYPNLFGPNSLFGGDSGVQWL
                     MKFPYALPMLANFFFMIICAILVAFGLEETLEACKGKPGLGFYMLKLLSRILGFGSSR
                     SHSQYSAVAAHDEDATLLDPSKEGYDDTEHSKPRSKRVLRVLPFHRLWTKNVLFTLLA
                     QAFFDFQMGAFNNLWLLFLSTPRYDANDPTSPTRSLPFVFTGGLGMPPQSVGFATSIL
                     GIIGMALQFTIYPSINGRLGTARSYQYFLALFPLAYAFAPYIALAPSTTAPPVQSSGP
                     WVWFSIIIVLFLQVSARTFTLPTSIILLNNCSPHPSVLGTIHGIGQSVSSAFRTIGPI
                     FSGAWYGYGLTIGTVGFAWWIVALVSVFGYLAAIFVYEGSGHEILLPGEEDIELK"
     gene            complement(<115418..>116455)
                     /locus_tag="TRUGW13939_04891"
                     /db_xref="GeneID:55992389"
     mRNA            complement(join(<115418..115856,115909..116012,
                     116074..116246,116311..>116455))
                     /locus_tag="TRUGW13939_04891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488056.1"
                     /db_xref="GeneID:55992389"
     CDS             complement(join(115418..115856,115909..116012,
                     116074..116246,116311..116455))
                     /locus_tag="TRUGW13939_04891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343949.1"
                     /db_xref="GeneID:55992389"
                     /translation="MTLARSDALAPQPWTDVFTDDTCIDRRKCQRTVPMKVLALGVGR
                     TGTASLRIALERLGYLRCYHMMCASVENPPDCLMWHDALAAKYDGEGKFGREEWDQIL
                     GDCQAVCDWPACAFAKELIEAYPNAKVILTTRDVDSWHASVMKTVHWRATDPEHRMAS
                     KVSWAAGMYYPMLNKFFDTFFRGDFPNQGKEVYKDHIEEVRSLVPSDRLLEYKITDGW
                     GPLCEFLGEEVPEAAFPSGNDMANFKKRCSTRNRRQMLNAALQACTMGGALLLTGVAG
                     MMIFNRYTIR"
     gene            complement(<121465..>123465)
                     /locus_tag="TRUGW13939_04892"
                     /db_xref="GeneID:55992390"
     mRNA            complement(<121465..>123465)
                     /locus_tag="TRUGW13939_04892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488057.1"
                     /db_xref="GeneID:55992390"
     CDS             complement(121465..123465)
                     /locus_tag="TRUGW13939_04892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343950.1"
                     /db_xref="GeneID:55992390"
                     /translation="MHSSVAILVLALAPVLIRALCPYAEHMGERDMPSGHPVISTRAS
                     RNSTKGLMLMNRIAPGTSELYIADADGSNEQPLLADPVFEYHASFSPDGEWVLFTTER
                     NGDGNADIYRVRPNGSDLQPLVTTPAVEDSVVLSPNGSLAAYTSTEGMVANIWLFDIA
                     TGRRWNLTDNPEVASTTNKSLPHGYFRPAWSPDGEWLAFSSDRNTEWLGHGTETFLGL
                     SGWEHTQELSIYAIRPNGTGFRQVAKKEGYALGSPTFSPDGTRLVYYEITREDTYNAH
                     SSFGVDSTNTSIVSIDFETGSDRTVEIGGAGLKIFPQYIDDNTIGYFQKGSASEGIHI
                     TNGTYRNTTSETSSVRSPSWSPDGKKVVYEKTSWTVRAFEKPLFSWDDEWEYQFVDVF
                     PHLSLQNRLVMTDKQLGDSSIINSNTTGGDVINVYDPVNSSIITPGEAAQGSGGAYQP
                     SWSTDGEWLTFGAGFWFQGRGSGGGWVIRATANGSYAENLTESATTLDNKTLNSGFPS
                     YSRDGKSIVFRVWGVNSTNGDESQLGLRLLDLESRNVTVLTTGWDNLPFFSPDGEKIV
                     FTRKTSVKNYDICTIRPDGTDLQVLTTTEANDAHAVWSQDGRILYSTGEYGFQYECGL
                     YDNTFQPYGQINIMDADGSNKRPLTNSMWEDSMPLFVANGAL"
     gene            <125613..>127469
                     /locus_tag="TRUGW13939_04893"
                     /db_xref="GeneID:55992391"
     mRNA            join(<125613..125652,125710..125754,125810..125910,
                     125968..126529,126581..126828,126887..127102,
                     127177..127269,127326..>127469)
                     /locus_tag="TRUGW13939_04893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488058.1"
                     /db_xref="GeneID:55992391"
     CDS             join(125613..125652,125710..125754,125810..125910,
                     125968..126529,126581..126828,126887..127102,
                     127177..127269,127326..127469)
                     /locus_tag="TRUGW13939_04893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343951.1"
                     /db_xref="GeneID:55992391"
                     /translation="MQAADKKSVAIIGAGIFGLSLAVALRDKNYVVNVFDRNVYHENG
                     YDPEGDDVQAASVDLNKIFRASYGTKLHYQRLAMESRNAWMIQDNKRGFLGDNDENGG
                     RLFVNSGMLRVQPTTHLDTLEKETLANMERDGLRGTQFVKSSPNDRERAESLGWKAKL
                     LDFDIPETSPTQTFDAVLDSLAGFVRCSSACTYWYDISVAKGVKFNFGKEGSVESLVK
                     IPCSAGTLKEKVIGLKTRDGVIHNADTVVVAAGSFSTQVLPELSYHLESSAGSVASFK
                     INPSQKDLWDKYSPEKFPVITWKASPRNRSGRDTGSIYALPRTPEGYIKIGFRGIKFT
                     NFQPAPEGATFTQDGKWSVPLPADECKTLPEPAMYAMKQFVSIFLPEFEDVPFSTTKL
                     CWYTDSLDNSFVIDYVPDFAENSVFICTGGSGHGAKFLPVLGEHAADILENGDRSTTY
                     MRTFWRWRPGMPRRNGLEDGPGGPRDISGEFA"
     gene            <127955..>129787
                     /locus_tag="TRUGW13939_04894"
                     /db_xref="GeneID:55992392"
     mRNA            join(<127955..128479,128534..128943,129005..129236,
                     129294..129475,129523..>129787)
                     /locus_tag="TRUGW13939_04894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488059.1"
                     /db_xref="GeneID:55992392"
     CDS             join(127955..128479,128534..128943,129005..129236,
                     129294..129475,129523..129787)
                     /locus_tag="TRUGW13939_04894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343952.1"
                     /db_xref="GeneID:55992392"
                     /translation="MLPEKNLNMYTSSQQPGVDFDGQIKESVCVSTRQRYVDKEDADD
                     TTVFYNTHKDSVRPLTPEIERKLVRKNFWFLLLQTWWISFLIHLDKSTLSSASTMGIF
                     QDVDMTKNQYNQLFTLFYAGYLIALWPGAWIAQHVGHKQFICGSLFLWALLIGVHPAV
                     KTGKEMMAVRFLLGMTESQIVPSTAMLHQAFFPPRKSPWVQLLWWAFGSVANVLLTMI
                     SYQLIEDDNHGTLAGSIASWKWLHIVCTALTFMVFVPLVFFLPNTPVDARWLNEEEKV
                     HTIEIIRKTHSGLRNSTFKWSQVKEMILDMKSWLFIIHMFFNELPNNTSQQIPLIIVG
                     YGFTPAESALFNIVKPLWGLILVIASAAMLYGTKLGTGYTCAISYIPCLIGGIIELAA
                     PWSNKVALIVGTQISTFKPSYMMGLSWAGTTATGYTKRLTLMTTCVLSASVANMVSPE
                     FWESKYKPRYVLPWAFMTAFWAISPAMCIIISLYLQRENRRRQELLAQQESESDHEDV
                     LSMNGQVVKIENEDLDTTDRQNLKFTYPL"
     gene            <130909..>131445
                     /locus_tag="TRUGW13939_04895"
                     /db_xref="GeneID:55992393"
     mRNA            <130909..>131445
                     /locus_tag="TRUGW13939_04895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488060.1"
                     /db_xref="GeneID:55992393"
     CDS             130909..131445
                     /locus_tag="TRUGW13939_04895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343953.1"
                     /db_xref="GeneID:55992393"
                     /translation="MLRIRPHSLAKGLYAGIRCFSSPTRRQLIPVHISGQGNGTVQTI
                     TVPGKPFKFSTDAYTMMDGNESHPSPIIYSLASLSSCNQVTGSVVANELGIVIGGWLV
                     TVEGKLPTAVFLEGEKGNPNWESVALKVQVQSNLMGDHDPKFQHFAAEVERRCPMTAL
                     FKRSGMQYTSEWINKPLQ"
     gene            <134660..>135738
                     /locus_tag="TRUGW13939_04896"
                     /db_xref="GeneID:55992394"
     mRNA            join(<134660..134731,134794..>135738)
                     /locus_tag="TRUGW13939_04896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488061.1"
                     /db_xref="GeneID:55992394"
     CDS             join(134660..134731,134794..135738)
                     /locus_tag="TRUGW13939_04896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343954.1"
                     /db_xref="GeneID:55992394"
                     /translation="MAQKYAKDQPQGFSNRIERVAIVGAGGHMGSHIADQLLKTGKHV
                     VTAITRPNSTNQFDENVKVSQVDYSGDDDTALVGALRGQQVLIITMSVTAPRDTTIKL
                     VRAAAKAGVAYVLPNWFGHDPANDKLCDESMLKQSRDSITAEISGLGGISYLLLACNF
                     WYEFSLGGGPNRYGFDFKERTLVLFDDGNVVINTSTWPQCGRAIAHLLSLKELPDDEA
                     DKSPTVSQFRNNSIYISSFQLSQRDMFESVKRVTGTTDADWIITHESAEERWKENEVA
                     VKQGNWSAFTKMLYSRMFIPGSDIGYKSELHNSVLGLPVENLDESTATGIRMGESGEV
                     AYSH"
     gene            complement(<136070..>137056)
                     /locus_tag="TRUGW13939_04897"
                     /db_xref="GeneID:55992395"
     mRNA            complement(<136070..>137056)
                     /locus_tag="TRUGW13939_04897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488062.1"
                     /db_xref="GeneID:55992395"
     CDS             complement(136070..137056)
                     /locus_tag="TRUGW13939_04897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343955.1"
                     /db_xref="GeneID:55992395"
                     /translation="MSQTRYADRPIPQISLRDFEARIDEITAELVDAAENVGFFTIVD
                     HGLELAEIEAMFGNSKSFFGLSDNLKATVPWSSKNVGWEKNSQVRPSTGQPDTKESYQ
                     LQFGANMDGFWVDESHLPSFKKTSLEFMNRVQGISESLMRCFARGLGFEDDFFVKAHD
                     VSRSNSQTVCRLLHYFTLPEDSDGKVYHRAGAHADWDFLTLLFQKQGQSGLEICPGRE
                     VVTEFGIGDVWTKIEPKTEEIVCNIGDLLMSWSDDRFKSTFHRVKAPSEPDDFYGDRY
                     SIAFFNQPCTDSVIQGPLGKYPVITGEQFTANAMKRNFAALQEKLKAIEADS"
     gene            <137345..>139109
                     /locus_tag="TRUGW13939_04898"
                     /db_xref="GeneID:55992396"
     mRNA            join(<137345..137445,137504..138137,138579..139049,
                     139095..>139109)
                     /locus_tag="TRUGW13939_04898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488063.1"
                     /db_xref="GeneID:55992396"
     CDS             join(137345..137445,137504..138137,138579..139049,
                     139095..139109)
                     /locus_tag="TRUGW13939_04898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343956.1"
                     /db_xref="GeneID:55992396"
                     /translation="MAFSITRKRLACAECTRRKVKCDKTVPCHNCVARNISCSRVRAS
                     RFSFDASPSESATCLAESSSPRRTSGNSQVLGLVETLQARVNDLEFALQQANALQTSS
                     SEAIQPQTPLPTTTSSHQREEFPNDASEVEDAATILEFLAWGRRKQSKYQDSFTPRGE
                     LAQRSPGPVDSEDDGPFFSSKESFRSYLETLLPSRSQVVSLVKYHCDCLLWYHGSFHS
                     LVFWRSLEDFYQEDEGHIDNPNVDLQWPRNCNEDDMMTLPDDVPTLMNYSRFFYDIAA
                     LMPRVQDAIASSNTVFTSYEKLLEYDQQMRYLATVRLPYYLQNVPIEPDWPCYVPWAR
                     RCLAISSSHKIIMIHRKFLGLSFTNPMFSRTRRTCVAAARTIINEQKEAAGDHGPILW
                     IHHAFSVAAGLTPQ"
     gene            complement(<139648..>141541)
                     /locus_tag="TRUGW13939_04899"
                     /db_xref="GeneID:55992397"
     mRNA            complement(join(<139648..140100,140165..140624,
                     140682..141361,141416..>141541))
                     /locus_tag="TRUGW13939_04899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488064.1"
                     /db_xref="GeneID:55992397"
     CDS             complement(join(139648..140100,140165..140624,
                     140682..141361,141416..141541))
                     /locus_tag="TRUGW13939_04899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343957.1"
                     /db_xref="GeneID:55992397"
                     /translation="MTIPAGAEPATPSLIESVPSKITRWSYLKDYFTSRNGWIGDYDY
                     MYLITPNIWPLNKKYKNFEAPFYGLNDEVPVFLTVILGLQHALTLVGSVVSPPLAIAG
                     GAFYLDSVQTQYLVSTAFITTGIATALQVTRLHITKTPLFIGTGLLSVVGPTFDLLAI
                     AFNYTNMRYGNGSCPVDSTGAKLPCPEAWGAMLGTMLCTVWVQILMSLVPPRMLNRIF
                     PKIVTGTLLVLVGVYLIGNGMENWGGSSNCNGGTGYYALCPDTAAPKPLPWGDPKLIG
                     LGFSIFITIIIVEIFGSPLMKSASVIFGLAVGCIISGAAGYWSRDNINAAPVGTFLWA
                     HTFSLSVDSALVLPLLIMFVCEAVSCMPDILATAELSGVDIDGTEFNSRIQGGILCDG
                     LGSLISALGTGMPMVSQAGNNGVISLTGCASRRAGWCAAAFLILMGIFGKFGAVFGSM
                     PPSVLGGMQVFLYSTIAVAGVRVLSLVKFTRRNRFILTAALGIGFVDIVSPSWFSRIL
                     DYSGPNVHLQGFEQGINLIVETPFIISAVIGVVLNLALPEDNLIKNDDVIRDRDGSPI
                     LAPSHA"
     gene            <141879..>143475
                     /locus_tag="TRUGW13939_04900"
                     /db_xref="GeneID:55992398"
     mRNA            join(<141879..142373,142441..>143475)
                     /locus_tag="TRUGW13939_04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488065.1"
                     /db_xref="GeneID:55992398"
     CDS             join(141879..142373,142441..143475)
                     /locus_tag="TRUGW13939_04900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343958.1"
                     /db_xref="GeneID:55992398"
                     /translation="MVDQTQISFTMEINLPSSILFSSATIITVNSTRQIIRNGYIHIV
                     GSRIFSVGKDSPMYPLPSNTQYHSCCGKIIIPGLINAHAHLVQSLLRGLAEDLPLHNW
                     LCDAVWPLEAVYAENDGYNATRLTTLEMLKTGTTCFLDPMLTHRAGFANVCKAVGEMG
                     IRGCLGKLVKFTETNRQLSITDPRDKDLLDMSMDSLFQAHRAHNGQHNGRIHVWAAAG
                     TPRGVPISAYQELGEECSSRAVSITMHCAEAPKDLDIYRNTYGCTPMEFIEKAKMTPV
                     KGATSSHKLVLAHMVNLDLVKDIHLLSATGTSVAHNPTSNLKLASGIAPVPAMLSASP
                     LPVNIALGTDGAPCANHYDMFQEMHLAAILHKGYNHDAAVVPAETALEMGTINGAKAL
                     GLENEIGSLETGKNADLVVLDPYGRGNIGISPWDWDDEAGVSPATTVVHGCTGRDVHI
                     TMVDGQILIQDGVLVAGGIGQEAEIVNKAKLAVKEILQRCNENRSEKVGGKLHSGWTY
                     V"
     gene            <143741..>147423
                     /locus_tag="TRUGW13939_04901"
                     /db_xref="GeneID:55992399"
     mRNA            join(<143741..144971,145242..145366,145700..146644,
                     146708..146749,146812..146911,146984..>147423)
                     /locus_tag="TRUGW13939_04901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488066.1"
                     /db_xref="GeneID:55992399"
     CDS             join(<143741..144971,145242..145366,145700..146644,
                     146708..146749,146812..146911,146984..147423)
                     /locus_tag="TRUGW13939_04901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343959.1"
                     /db_xref="GeneID:55992399"
                     /translation="PFQKIIRPCGSNALPGETDRMNLSTQKRKKLKSLFVSKTAIAAV
                     AATIANGGQRRLPRAPPSANLQSNVNSQTQSVLFTLPAEIRSLVFTYALTDYEDTTLN
                     AYGTETDYWYRPGYAGRRCTATELLRVCKRVFQETWFLQFSLAEHSLYLTQEGRAPVR
                     ALATQMSVDRMRRYLKGRRAFAHRQDGMEIPRIHHVRVFAQPWASEFPARLQELLRLP
                     GFEPRVVTITIKYTDFLGWWNNKLLHVDARWMNKVRFPRAVEAIKMDFWMIDRRKNEI
                     DYIAGAAVENWFFRREDGVVFAATGQDVAITRWTGSSTWANRRWIRDESRPNEIDYYT
                     KTVTWKPDPEVKRSGPCPDLEVPDSIAREPLPNIGKISYVVPEKVAAAKVRPDASPEQ
                     VVHALTPEIGRGWCGTGRGDRLTGLPPFFLAQNEISPSLQSGASPGMNGVISNSSHRS
                     AFTPTATLDAMSGYVGDLSGDQEKKLKELWTLLLTPTLSFLATTYGIELPPDKTSATS
                     IFKILSEVQEPTAEAVIAAFTKAASADETTTTNGTAEPDQAAAAGASTNGAAERSSEK
                     REAPVTNGESDTSKQEAEDISSKNVPKEKLSPLMAHLRQTDLKEGQLKSIEKILSSMS
                     PKEMGWTLLNMVKQDNPDAVLLRFLRARKWDVSKAFSMMISNYIWRVESQVDEEILPG
                     GELKSLKQSENKSDKNEEKKGNDFLSQLRMGKAYLHGTDRDGRPVIRVNVRIHKPGAQ
                     TEEALERYILHVIEMTRLMLKQPVETGTILFDMTGFGLSNMEFPPVKFIIQCFESNYP
                     ECLGRLLIHNAPWVFSGVWRLIRPLMDPVVASKVHFTRNINDLSNFIAPENVLKDLGG
                     TDDWTYKYIEPGPKENDLQNDTETQNEVMTERMSIALDFILQTSAWIAETNLASEPAD
                     ETTVRETKDRRADSIARLRKSYWKIDPYIRARCQMDREGAIASEAE"
     gene            complement(<147657..>148513)
                     /locus_tag="TRUGW13939_04902"
                     /db_xref="GeneID:55992400"
     mRNA            complement(join(<147657..147824,147941..>148513))
                     /locus_tag="TRUGW13939_04902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488067.1"
                     /db_xref="GeneID:55992400"
     CDS             complement(join(147657..147824,147941..148513))
                     /locus_tag="TRUGW13939_04902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343960.1"
                     /db_xref="GeneID:55992400"
                     /translation="MGEFQPCGRPTNVELFSIQDKTVIATGITGGIGFEMAQTLAEAG
                     AHIVAIHLPDDSNTELLGQTIRSLNRQFHAFGCDVSDSAGLRSTFDNIWKSGIQPDIL
                     LNCAGFNKRAPIEDIEDEWIDKIFAINLKASYVASQEFAKQLRRLDHRPGKIINIGSV
                     TSFKGMYNVSPYACSKGGVLQMTKAFSNELALMQDKPYNDYIIERTPARRWGTPQDLR
                     GVLLFLASPASDFVTGTSISVDGGMTGQ"
     gene            <149052..>149585
                     /locus_tag="TRUGW13939_04903"
                     /db_xref="GeneID:55992401"
     mRNA            <149052..>149585
                     /locus_tag="TRUGW13939_04903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488068.1"
                     /db_xref="GeneID:55992401"
     CDS             149052..149585
                     /locus_tag="TRUGW13939_04903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343961.1"
                     /db_xref="GeneID:55992401"
                     /translation="MTTERPKAEAVPYRGEPLPHVPEDLVIPGVLNLDDIDEKQWVPQ
                     QENVWFRPLIMSISQGYWVNLLRVRKAGILSRHRHSGPVHASTLRGRWHYLEHSWWAV
                     AGSYSYEPPGDIHTLEVPEGCDEMITLFHVTGSYTYVEPDGTAIGVEDVFSQIQSASD
                     HYETVGLGADYVKQFLR"
     gene            <150168..>150704
                     /locus_tag="TRUGW13939_04904"
                     /db_xref="GeneID:55992402"
     mRNA            <150168..>150704
                     /locus_tag="TRUGW13939_04904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488069.1"
                     /db_xref="GeneID:55992402"
     CDS             150168..150704
                     /locus_tag="TRUGW13939_04904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343962.1"
                     /db_xref="GeneID:55992402"
                     /translation="MSSIERPQASAIPYKGAKLPHVPEDLVVPNVFDNLDFDERYWVP
                     QADNIWFRPLLFCVSQGYFVNILRVRKSGILSRHRHTGPVQATTFRGKWHYLEHDWWA
                     TEGSHAFEPPGDIHTLEVPEGVEEMITLFHVTGAYIYVDPDGNPVGVEDVFSKLQTAR
                     EHYEKVGLGKEYADQFIR"
     gene            <151592..>153461
                     /locus_tag="TRUGW13939_04905"
                     /db_xref="GeneID:55992403"
     mRNA            join(<151592..151645,151698..151802,151856..151984,
                     152049..152497,152598..152882,152938..153032,
                     153087..153155,153211..>153461)
                     /locus_tag="TRUGW13939_04905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488070.1"
                     /db_xref="GeneID:55992403"
     CDS             join(151592..151645,151698..151802,151856..151984,
                     152049..152497,152598..152882,152938..153032,
                     153087..153155,153211..153461)
                     /locus_tag="TRUGW13939_04905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343963.1"
                     /db_xref="GeneID:55992403"
                     /translation="MGGVITTPTFIEQFNNPDALVQGLVTGLYDAGCLVGSIATFFWS
                     EPMGRKKSVYIGVVIVLIGTIVQVTAKTVAHLIVGRIVTGVGVGIMTAIVPTWQAEVS
                     PAQSRGQLLTVQASCIILGYLFSCWIALGASYTNSSFQWTGPIALQAIFALYLGFCMP
                     FLVESPRWLANHKGIGEATAVISRLRGKPIDHPEVLEVRREIQLVLEEETSSGAWCDL
                     FKSTGEQNLRRLMLGVVGLYMQQIGGINSISYYLPVILQEYIGLDLHLSHILTGVAAI
                     EYFIFSMFPILFVEKVGRRNSMIWGAVAQAIIMVIASVGLAVNTSSSLKLTVAMYFLF
                     YAAFAMSYLNVPWMYAPEINSLRMRVKGGAAASASNWLFNGIVVTVTPIGLQNLGWKF
                     YMIFVALNISFIPIVYFCYPETRGLSLEQIDHIFYGKGTTTNWLYQGVRESIHQRRAT
                     IIASDLETSGSGNDLKEKVADCHVENSS"
     gene            complement(<155950..>157452)
                     /locus_tag="TRUGW13939_04906"
                     /db_xref="GeneID:55992404"
     mRNA            complement(<155950..>157452)
                     /locus_tag="TRUGW13939_04906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488071.1"
                     /db_xref="GeneID:55992404"
     CDS             complement(155950..157452)
                     /locus_tag="TRUGW13939_04906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343964.1"
                     /db_xref="GeneID:55992404"
                     /translation="MAPIKLTSKNLSQISANGKTKIPAYPRDAAVKEGIVHIGVGGFH
                     RAHLAVYVHKLMEQHGVTDYAICGVGLQPFDAGMRDALESQDRLYTLIERSAKGNFSQ
                     VIGSINSYIFAPDNREATIAKMAHPDTHIVSLTITESGYYYNENTHELQSEHPDIQFD
                     LDPANSKAPRTTFGFLYAALERRYQQGLNPFTVLSCDNMQKNGSISRHMLVSFARLRD
                     PKVAEWIAEKGAFPNAMVDRITPQTSAADKASLADEFGIEDSWPVVTEPFMQWVVEDH
                     FVDGRPPFEKVGVQVVKDVHTVEQFEKHKLRLLNGSHSIISYGGFLAGYKYVHKVMEN
                     PLFEKFIWQMMQQEVKPLLPAIPGVDLDEYCKTLIERFSNPTIMDQLPRICLNGSGKI
                     PQFIMPSIAEAIWVTSPFRRLCFTTAAWFIYVKGFQDDGTPIDIEEPMLEELQALAHE
                     GGTNPIKLLSVKSLFGDDLRGDKRFIQEITTAMEDITRDGVLKSLPKYID"
     gene            complement(<159366..>161745)
                     /locus_tag="TRUGW13939_04907"
                     /db_xref="GeneID:55992405"
     mRNA            complement(join(<159366..161233,161285..161433,
                     161486..>161745))
                     /locus_tag="TRUGW13939_04907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488072.1"
                     /db_xref="GeneID:55992405"
     CDS             complement(join(159366..161233,161285..161433,
                     161486..161745))
                     /locus_tag="TRUGW13939_04907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343965.1"
                     /db_xref="GeneID:55992405"
                     /translation="MRFYHAVVGALLGALCQSSLAVSTDGLQDLVKRRLPDHVDSFAF
                     SLNASFGTQDGDYIRKNDNFEVSSAPNGTILIHGNSLSALATGLRRYLTEIAHVDIYW
                     FVGSLLDKAPNPLPKLDTPLRGSSIVPWRYHLNTVTFGYTAAFWTWEDWELELDWAAI
                     HGINLALAWVGYEHTLREAFKGVGLTDDLILPFFSGPAFQPWNRFGNIQGSWGGSDLP
                     LDWINKQFELQKKIVARMVELGITPVLPAFPGFVPEGISQVLPEANVTTGATWGGFPN
                     NYTQVNFLDPFDPLFSELQKGVINEQINAFGNVTNIYTLDQYNEILPASGDTGYLHNV
                     SYNTWQGLKAADPSAIWLMQGWLFLTNDFWTDSRISAYLGGVEDNNDMLILDLFSETR
                     PYWQQTKSYYGKPWIWCQMNDFGGSMSLYGQVMNITINATLAVAQSESLVGFGSSMES
                     EQGNEIKWDLLFDQAWSADPIDPVEYFSNWTYSRYTWGSYGDIPQELFTAWEILAKTA
                     YNNTNSSTGVTPKAILELAPSIKGLTDLAGFYPNPTTVNYDPAEIVNVWNLMVKGANG
                     NTWLWEHPSFQYDIIDVTRQVLANAFIDYYNNLVSSYTAGSHEISEKGENILDLLTDL
                     DTVLSKNKAFSLKDRISSARSWAEDVDKDFYEYNIRNQVTLWGPDGEISDYASKSWAG
                     LVGSYYHSRWSIFIEYLAKTDFAQYNDTTLSSQLRVFENQWQTETSLKASTSEANSTL
                     ESILHQLKKSWPSIFESS"
     gene            <162877..>164120
                     /locus_tag="TRUGW13939_04908"
                     /db_xref="GeneID:55992406"
     mRNA            join(<162877..162966,163032..163217,163270..163963,
                     164044..>164120)
                     /locus_tag="TRUGW13939_04908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488073.1"
                     /db_xref="GeneID:55992406"
     CDS             join(162877..162966,163032..163217,163270..163963,
                     164044..164120)
                     /locus_tag="TRUGW13939_04908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343966.1"
                     /db_xref="GeneID:55992406"
                     /translation="MSFFSVLAAVSSLTATAVATSQIVPVTEDSGFWFGNFTVGNSTN
                     LSLLVDTGSGDIIINPGLYKAGSNAENLHENFDNSYGTTQSNGGGTIEIKGPLYSDIV
                     SIGKLSAKQHIGAANNQTGIPHDGIVGFGPSSTEFPGPNAMAFVETLCRDGDLSECRF
                     GLALNSNKTGSLILGEVEPSLYKNNLSLVPSSESWTVNADIYVDGSISNSDTSVVMDS
                     GTATIVGPIDQVSAIFNSTGIQGVRSGGSLFGYFPCDKPPTLGIGLPSQSDAAAAAKK
                     HSPLLSTTTTLFNISSDQWAIANNGHNNCTALLSGQDFGESIWIFGQAFYTGLYVDHN
                     MKDSVMGFASLDSP"
     gene            <164993..>167359
                     /locus_tag="TRUGW13939_04909"
                     /db_xref="GeneID:55992407"
     mRNA            join(<164993..165877,166284..167305,167353..>167359)
                     /locus_tag="TRUGW13939_04909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488074.1"
                     /db_xref="GeneID:55992407"
     CDS             join(164993..165877,166284..167305,167353..167359)
                     /locus_tag="TRUGW13939_04909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343967.1"
                     /db_xref="GeneID:55992407"
                     /translation="MSTTRISEPGDQRAFTYFVGVGLSHSLSPPLHDFVANSLGLGWK
                     FVAHECDSVEEGIRLFRQPSFAGGVVTMPYKTAIMKHLDGLDEQCIKIGACNNVYRAA
                     DGSLRGANTDWCGVEGCLATASDVGKGRPALIVGAGGAARAAIYALHERLACNLIYVV
                     NRDKDEVAALLKDTASYGPGLSVKHLDCLEAAKNIGQESDPFYIVGGVPDYEPQSAAE
                     LEGREILVHFLKNARQPGVLLDICYKPRRTRTIKLGEQYGWHVVDGTMVIGRQVYEQY
                     RLWCGEATANMIPLQEAWTPSFPIDIWLRNCRYLLIDARCSFLVVAALTKKTHIEYGS
                     YDNYLAKMSCAPAISTMSLGRAWVHQMPEKLRQAGLAGFQGVEMFYEDLEYMAKEAYG
                     DCSRPEHILAAARQARSLCDDNGLVVMALQPFWFYEGLIDRHEHELRIEKLKLWFQIA
                     KILNTDLIQIPSNFLPEKHISGDLDLIVSDLIEVADLGLQQSPPIRFAYESLAWSTYI
                     NTWEQSWDIVQRVNRSNFGCCLDTFNIAGRVWADPASPTGKTPNADADIEASLDRLRR
                     TVDVRKIFFLQVVDAEEMETPLIEGHPWHDAAQPSRMSWSRNARLFAYETDRGGYLPI
                     LKVARVIFEDLKP"
     gene            complement(<167520..>169601)
                     /locus_tag="TRUGW13939_04910"
                     /db_xref="GeneID:55992408"
     mRNA            complement(join(<167520..167622,167673..167806,
                     167862..>169601))
                     /locus_tag="TRUGW13939_04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488075.1"
                     /db_xref="GeneID:55992408"
     CDS             complement(join(167520..167622,167673..167806,
                     167862..169601))
                     /locus_tag="TRUGW13939_04910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343968.1"
                     /db_xref="GeneID:55992408"
                     /translation="MAEHDSSSSSKRQRINQACDQCRKRKSKCDGEQPSCATCRSLGK
                     LCTYGTPAKKRGLPTGYVRGVEALLGLFQQSLPNGEYKLRRVLREHLVGHMADSDYLE
                     QASDIWRSSALAKDLDHLLNIADDNDTPRPSSGADRALRLPPIESASPAVQHQPPGDP
                     FERLEQFLDVPPPNLPDNVQEIVDYYFRTTHCWFPILERRTVLRALYHDESHDETGCD
                     REGYRLCLWAIIAYTSATMGGLSSSLGSVNPDSIQAYIRLCLNGNERAFSIGNAQALI
                     ILALFNIGMRRLSVARLLLSQVFCMLVDVSLDDRRRSERYQHTIQGCFFLDRILSTHL
                     CKPPLFPDAQVGELDESALDEWEPWIPLSHDTSISQGKQPLRSISCFNLMNQIAGMLP
                     PFHLTTYSAMQLRDKIEDLGSWYSNLKKQHQLQSSTVASPPILLLHLTYKFSLLVLLE
                     QAQNRGMQIMPLAEETVNWTIQLLIRCFEADSVLFGNPLIVVFAVQIQSYVSRLQVSG
                     SNELNHSIRMRCFRFLENFQKQYKFGRPGAIASDVAPSPMRSQQARGPLAQTVTASPL
                     TNVPGMAISEHPNPTIVQQNAMNVGNYLVADPPTNSSILEKDDFDAMFEDMASMVLPR
                     RYDGEVADFAQNLGFLTSDLDFNSLAFHRTQPGV"
     gene            <169851..>172414
                     /locus_tag="TRUGW13939_04911"
                     /db_xref="GeneID:55992409"
     mRNA            join(<169851..172127,172187..>172414)
                     /locus_tag="TRUGW13939_04911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488076.1"
                     /db_xref="GeneID:55992409"
     CDS             join(169851..172127,172187..172414)
                     /locus_tag="TRUGW13939_04911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343969.1"
                     /db_xref="GeneID:55992409"
                     /translation="MNARSLSTTPSVGSNGNGNGSGTLSGAPPIGEAQLSQKRRRDYA
                     QLEDEDEDPGSPARATLRLRSSLARDSTTFASLVPPPTRSPRLESLDDRPFGSPLQSR
                     RHRGDESIILVGFYGVGKRTLGLIASGALQKEFVDYEEVFKAHTGQSSTEYLEARGFT
                     SYRAVEDELTAEVCRTKRQGCVLVGFFVMPSNRQRKLLGSLAGSNPIIHIQRDLNHRS
                     DKAHPKDGHLDQTYRMSDKLHRRFASYEFFNITQLATDAKAPGPLKLKGTEREFIRFL
                     HRVLPHPETPSYAADLWSRPYTYALQVPTSWLNDPRADFTELDCGADAVSITVDATSD
                     DQENLYFQLSRQTALIRKHSHVPVIIDLKAPVTISSAGYVNLLELALRQAPDFIVISL
                     DVDNSLVERLELAKGRTGIVGKCHRSLPVSDNWNSKEWHDIYEKAEALKCSAVRLTGE
                     AHYSHDSLESIRVMLEARRLGAIPTICYNFGQYGLSSVCLNSILSPVVLPSKSADGVT
                     LVEAQRALYSSFILPRKHFTVFGRTVSYSLSPAMHNAGYAACGMPHTCDFVQSDNVTQ
                     IHDLLKREDQGGFAVSLPYKTEIVPMMDEMSEDARIIGAVNTVVVDRVTTPNSPPRIY
                     LKGFNTDHIGFRSCIERNLSPANAIRPQSSALIIGAGGMARAAIYACVQAGVKNICIF
                     NRTTANAQRLADYFTAACPDTSLYVLDTLATIWPTHVAQPTIIISCIPTHEFAGNDAP
                     DILIPEHWLNSPTGGVFVEFAYKPLITKLVGYMRQRSSQGWIVVDGLDVLVEEGIAQF
                     EVLTKRPAPSHIIRRAVREQYAITVDASSRRSDLTA"
     gene            <172872..>173330
                     /locus_tag="TRUGW13939_04912"
                     /db_xref="GeneID:55992410"
     mRNA            <172872..>173330
                     /locus_tag="TRUGW13939_04912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488077.1"
                     /db_xref="GeneID:55992410"
     CDS             172872..173330
                     /locus_tag="TRUGW13939_04912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343970.1"
                     /db_xref="GeneID:55992410"
                     /translation="MPSILLINGPNLNLLGLREPQIYGSATLQDVENTCRELATQHGV
                     QLENFQSNHEGQLIDRIHEARTKVDIIIINPAGFTHTSVALRDALLGVAIPFIEVHIS
                     NIHTRESWRHHSYFSDKAAACIIGLGTFGYEAAVQHAVRNLLPKAAQSSL"
     gene            complement(<173806..>174253)
                     /locus_tag="TRUGW13939_04913"
                     /db_xref="GeneID:55992411"
     mRNA            complement(join(<173806..174132,174188..>174253))
                     /locus_tag="TRUGW13939_04913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488078.1"
                     /db_xref="GeneID:55992411"
     CDS             complement(join(173806..174132,174188..174253))
                     /locus_tag="TRUGW13939_04913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343971.1"
                     /db_xref="GeneID:55992411"
                     /translation="MSSSEFVHVMESFTLQPDKLQEFFEAVNPVIMKLEKTDPHVWHI
                     YAIHTKTADGLDHVVLVEKYGCSALQMTGIGADKLFNKRFSNEEAMERVHGSPLLVEM
                     AKKINPLLEEPAEFKHGQVVLGFQDRQR"
     gene            <175366..>180971
                     /locus_tag="TRUGW13939_04914"
                     /db_xref="GeneID:55992412"
     mRNA            join(<175366..176370,176885..177007,177367..177494,
                     178722..179159,179226..179779,180111..180580,
                     180651..>180971)
                     /locus_tag="TRUGW13939_04914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488079.1"
                     /db_xref="GeneID:55992412"
     CDS             join(175366..176370,176885..177007,177367..177494,
                     178722..179159,179226..179779,180111..180580,
                     180651..180971)
                     /locus_tag="TRUGW13939_04914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343972.1"
                     /db_xref="GeneID:55992412"
                     /translation="MSPTNRASWLTTKQCPVNVVDSAPYTSPIANELVIRTKAIALNP
                     ADVVVQQLGVLLTQYPAILGCDVAGEVVEVDPSLSDTFKVGDRVTGSAACVHLRDGNY
                     CYSGFQEYVVLKMPFIGKIPEGVRYEEAAVLPLGINTAASCLFSDKTLDLNLPSNEGK
                     TLEKKQTVLIWGASSSVGSCGVQLATHAGYEVVGVASAKNHEMVKHLGARVCFDQNDP
                     TVVDSIVKYLQDKDVVGAFSSVSSEAALDSLCEILDRNGGIKVVASVVPGAEQKASRQ
                     VTIRTNFTTDIEKNSFTRPVWKWLNRVMDESKIKYLPQPEIVGYGLEDVQKGVDLLAK
                     GKVFCLLLLSNIMSPKKVRSLTSRLASSDNALSLFVSETDCVCRFFNPKNFCQQMTGV
                     YSDVGRLWTGARIFADGDEKCRLDERNTRDTMPSKINLNMAAKSGETTAQLQCVQKGG
                     PLQVVQVPKPSVKPDQVLIRQAFVGLNGLDWKQRDSGMFISRWPHVLGVEGAGVIEVV
                     GSDVKHLQPGDEVMAWEVGMAHGEEWGGAYQEHLVMPVRYVTKKPNNISLEQAASLPV
                     CYITAICAIYCLGLNLPVAYLQGKSESKHAPSSVLILGGSSSIGANAIQLLRLAYPSM
                     PIFATSSPHNQAQLISLGATQVFNYRSPGLVSSIKAASPDAAGVDMIIDCLAAGATQS
                     DICDSFDPKGSKRYSSVMSGITVPVPDGVTKFEVNGMILLEIEGGERVIPALTDLIEG
                     GKYQVPLPVNFSRRQESVELKKKMSPRSESVTSRAPTKSLDIHSESDRGQRQDEEIEE
                     EVFGRSEDDIGTPDTSSTSNKERQRGLYAAGRGGYNALKMFNGQVYSGMTVGSSHEWD
                     YDQGLWKETKIEPDLWKIDYQATKRRARKAPKGSGVPVGAQYHWYIIAHQYVEKTDEN
                     TYETHLLGSKYKLAHKSASETSWSIPTVKGQREQEINLLEDAKRRIQNLPPVLASEKV
                     KERKKEKGQQTLDKLFTKRKGACSDEGHQINKIAKLRHDK"
     gene            complement(<176489..>178116)
                     /locus_tag="TRUGW13939_04915"
                     /db_xref="GeneID:55992413"
     mRNA            complement(join(<176489..176493,176578..176801,
                     176858..177220,177272..>178116))
                     /locus_tag="TRUGW13939_04915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488080.1"
                     /db_xref="GeneID:55992413"
     CDS             complement(join(176489..176493,176578..176801,
                     176858..177220,177272..178116))
                     /locus_tag="TRUGW13939_04915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343973.1"
                     /db_xref="GeneID:55992413"
                     /translation="MAETRPKTPRAKFVCHACNVRKRACNKALPACSFCAARNLQCIY
                     DITALGKKGQRKYNPGRNFVALQPPSPPWSASASAPCIASAIPVPEVTLQGSTDIHRS
                     VNQQVLSIFKLTGRTLEDVIEYYFETFQQACPVISPELFKDALSQSSRASDVPPVDYS
                     ILLLAMCLITALPCLDRPLQLSSVTRDWLYATTKSLFAQAHATVSNSLPLIQAAFLIA
                     VCEYSCARPQAAHVTINTCHLLAEILGVKKATLKTSQSPVECFDTQQTEIARRNLTSA
                     IAIFERLILIELDLIKSPPRTECPGMRSWLPLQLGLKYYPESQPPISPASSNVSPKDD
                     DVFECRAQVISFLDLILRTTQSVSETNKESALSELASLDVKLRTFLGDMMFESSKRQN
                     TFCAPVALSIRCLFLLHRTTLGILPTGNDERDHQARTISQAALGTACEMVSDVMKFRI
                     TKKIMPITCYYNLQATIKWLQEWMDYTA"
     gene            complement(<181296..>184280)
                     /locus_tag="TRUGW13939_04916"
                     /db_xref="GeneID:55992414"
     mRNA            complement(join(<181296..181906,181956..182381,
                     182438..182588,182652..182789,182834..182846,
                     182936..183736,183796..>184280))
                     /locus_tag="TRUGW13939_04916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488081.1"
                     /db_xref="GeneID:55992414"
     CDS             complement(join(<181296..181906,181956..182381,
                     182438..182588,182652..182789,182834..182846,
                     182936..183736,183796..184280))
                     /locus_tag="TRUGW13939_04916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343974.1"
                     /db_xref="GeneID:55992414"
                     /translation="MSSDFSILTPNARLGYGYRAEHLWYGIEKYSPKAIIVDSGSTDG
                     GPYKLGLNKMTCGRESYIRDLRPILQACFYKKIKILIGSVGGDGSDKHVQEMLDIVLE
                     ISQQEGFSFKVATIAAGFDKTMIKDRITNGKVGPCGPVEELTVDSVDRTIGIVGQMGA
                     EPYLRALEHSPDIVLGGRSYDPAPFAAFSMHHGVQPGVAWHMGKIMECGGICAVPKGR
                     SMIATMRSDSFDLTPLSPKERCTPISVAGHTLYEKTRPDRLPGPGGVLLLDNASYEQL
                     TEKTVRVRGAKFKPTPVYQVKLEGVEKLGYRTIFIGVIRDPILISQIDEFLADVRAYT
                     QNLFPQLDQSPQCRLIFHFYGRNGTIGPLEPTSTKAYELGILGQVVAPSQDLSYTIAN
                     NARASILHMPYKNQVATTGNFASPLSPHETAAGEETRFFSFCLALENAPAVRPTQPFT
                     EEEKRKVVRKLDLHLLPLCFVLYTFSVLDRSNLGNAKTIGLEDDIDLSGNRYEWLGNI
                     FYIGYIIFHSQLLGGRYLNLTSTSWPGLMVCRFFLGFAETMFGPGVPLYFSFFYPREM
                     LGRRFGIFLSGAALANVYGGVLAYGLGHAWSSISSWKFLFIIEGVPTVLLAVITFFFL
                     PNSPSTARFLNEKEREVARQIAGSQPEDHQHDGLQLGQVGEAFLDYKNYLFAIMNFSN
                     NVSFASLPLFLPTIVSEMGSFTTVEANGLVAPPYFLCFILIIVVSLLSDRMRLRGPFA
                     ALFSLLSAIGFILLGTTESVTSRYIGTFLAVLIFVTTSIVLVWTANTNSTSSKRAGGF
                     WIIMTLGQCGPLLGTNMFPSSQAPLYRTGSWVCCAFALLSSAVALAQSLLLWLENRKL
                     DRIYGPLEELDIDPQIDHD"
     gene            <184671..>185979
                     /locus_tag="TRUGW13939_04917"
                     /db_xref="GeneID:55992415"
     mRNA            join(<184671..184954,185012..185105,185158..185296,
                     185361..185746,185815..>185979)
                     /locus_tag="TRUGW13939_04917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488082.1"
                     /db_xref="GeneID:55992415"
     CDS             join(184671..184954,185012..185105,185158..185296,
                     185361..185746,185815..185979)
                     /locus_tag="TRUGW13939_04917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343975.1"
                     /db_xref="GeneID:55992415"
                     /translation="MTLARLFPFKFSRLLRKNNQAEDLGNLKSCEITTVLANVQRPAF
                     DELPLRKGDPKGSAWNLWGKDDELGTLNLITKDFTRAAATEIKVGKAISLNLPINVPM
                     KPMNPRRKACSHTIIAKGYANDDELDFNTQSSSHWDGLRHYPYSETQQFYNGVVQDDI
                     SGEKANSKIGIQNLASHPLVTRGVLLDWYSYSLDKKLPHSPFTNQSIPLWQLLEVARE
                     QRVSFRRGDILLIRTGWTAVYNKLTDGEKIDLGGREHRASCGVEATRDAIRWHWEQGF
                     AAVATDTVAYESWPSTKPWGVSMHEVFLSGWGMPIGETWDLEELSETCKQLGRWTFML
                     TSQPLHLPAGVASPPNATAIF"
     gene            <186549..>188226
                     /locus_tag="TRUGW13939_04918"
                     /db_xref="GeneID:55992416"
     mRNA            join(<186549..186673,186731..186914,186971..187265,
                     187330..187553,187616..187707,187759..187970,
                     188063..>188226)
                     /locus_tag="TRUGW13939_04918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488083.1"
                     /db_xref="GeneID:55992416"
     CDS             join(186549..186673,186731..186914,186971..187265,
                     187330..187553,187616..187707,187759..187970,
                     188063..188226)
                     /locus_tag="TRUGW13939_04918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343976.1"
                     /db_xref="GeneID:55992416"
                     /translation="MDDSKNDSKNIENAIANDPLARYSDAQKTKALRKLDWSLIPLLG
                     VIYMLSYIDRGNIGNAYTAGMGSAWGIASNQYSWIITAYYLAYIAFQWFILLWKVISL
                     PAWVALMALSWGITSILQAATTNFAGLMALRCLLGVFEAGFAPGVALFLSFFYHRSEM
                     AFRYGLFISFSPIANCFASAMAYGIVHARTSLSSWKLLFIIEGIPTLLMLPLAYIFLP
                     KAPGHCRFLNQIENEIVSLRAAQGRGHEEEGKLNFKQVCTAFYDYKNYIQAVIAFCLN
                     SAFAALPAFLPTIIEDIGYSSVQSQGLSAPPFKNRSVFLSSLSIIGAVGFLIQALVET
                     SGARYFATYLICGGVFPAVALTFTWVTDNQGSASKCGAGLVIFGLLFFAAILVQFLRF
                     LMSRENKRRDERYGIVDSGEMPENVADSGDDHPDFRFML"
     gene            <189348..>190887
                     /locus_tag="TRUGW13939_04919"
                     /db_xref="GeneID:55992417"
     mRNA            join(<189348..189539,189592..189713,189765..189832,
                     189899..190020,190077..190255,190308..>190887)
                     /locus_tag="TRUGW13939_04919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488084.1"
                     /db_xref="GeneID:55992417"
     CDS             join(189348..189539,189592..189713,189765..189832,
                     189899..190020,190077..190255,190308..190887)
                     /locus_tag="TRUGW13939_04919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343977.1"
                     /db_xref="GeneID:55992417"
                     /translation="MPDDDHRFFQFQRGELFLEKARLLLIDEIKADNPKVPTIQGLLI
                     LGGRQCAIGKSSEGWLYTGMAIRMITDLGLHLQKWEMMKECEPDDLEVRKRLYLSVYA
                     WDKSISLCLGRPPSLKELPYSPSSLYDLADDEDIWQPPRVLDTDKTFLATRCYSTRTF
                     IYFCRLSEIIDQSYDTVYNGKADNIKSNAIFSLEEKLRVFHQSLPDCLRIQNPANIVT
                     CVPPHILCLNILYHTMLILIFRPFFMWQWRANLRDHPLALRAQEVCTEEASGVNELIR
                     AYGRLFNFRYQSYLISYCAYTAATIDVRLVHHEDKGLAQNASDRLVITLRMLETEVKQ
                     TPGIKRSIDIIRSHMDQQWVNNSRSLPMETNQNSAGGSNMPSGVLASAYDSQSDQNVS
                     SGSFIFSTQAEDLNDHVLALLPENNGGI"
     gene            complement(<191121..>193169)
                     /locus_tag="TRUGW13939_04920"
                     /db_xref="GeneID:55992418"
     mRNA            complement(join(<191121..191284,191406..191605,
                     191675..192376,192459..192723,192792..193052,
                     193106..>193169))
                     /locus_tag="TRUGW13939_04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488085.1"
                     /db_xref="GeneID:55992418"
     CDS             complement(join(191121..191284,191406..191605,
                     191675..192376,192459..192723,192792..193052,
                     193106..193169))
                     /locus_tag="TRUGW13939_04920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343978.1"
                     /db_xref="GeneID:55992418"
                     /translation="MDPPNQNVKSDQLNPGVNVFRKESALAQYIPGGYSASRCLKLKG
                     RSMSYATFSFAGCAILFFGYDTAVMSQVNNNLDYEREMGVAGGSDRDAAAIGGLVSLW
                     FGGFAIGAFVVGYLADSIGRLKTIQLGCLWGILGAALLASAQNITWLSFARVISGIGC
                     GHLNTTVPVWTSELADPHLRGAFVAVQFTLAMVGSTIVYWMEFACLKTLSESFAWRFP
                     LGFQIIFLLFILLAAPFYPESPRYLAMIGKMKEARSVLRSCRIESNDEAVEIEMRDIE
                     YAMRVETSSTSVSFSSMLLKKDKLHTRRRVILGAGIQVMQKCTGIDFISVYAPNMFAL
                     SGFTGDKPALLAGGNWFGYVAALALSIYLCDHVGRRKMMLTGCTLMGLVLIVGGVLSH
                     ETVSNTNTNPEKANKFGAGVAAILYIYTFIYGSTWLTTCWVYPTEVFPLASRSKGAAL
                     ATVAFSIAGGTINEVIPYLINAIGFWVFILFALVNLAMLIPIYLFYIETANRPLEDLD
                     ILFSSKSPLSWKAEREFIVKLNERNSDMARMDMKGEKIEVEDA"
     gene            complement(<193579..>195321)
                     /locus_tag="TRUGW13939_04921"
                     /db_xref="GeneID:55992419"
     mRNA            complement(join(<193579..193691,193743..194367,
                     194429..194979,195069..>195321))
                     /locus_tag="TRUGW13939_04921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488086.1"
                     /db_xref="GeneID:55992419"
     CDS             complement(join(193579..193691,193743..194367,
                     194429..194979,195069..195321))
                     /locus_tag="TRUGW13939_04921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343979.1"
                     /db_xref="GeneID:55992419"
                     /translation="MRSSLYYLSAVLAAVAGVAADSVNTTVCNGKTFVYEELAGYGYL
                     ASDFQDRYGDSVSLGSSIALDRKTWTQKGDVYEGVMYTVPDRGWNTNGTLNFQGRIYK
                     LKLTLKLKESATVESPSGPNLRITYLDSILLRDPLGQFVTGLDADASGPYLDYSRVPG
                     YPEFPEVPSANFTGDGYGGSGKGGFKMSLDSEGLVLGDNGSFWISDEYGPYIYQFSAK
                     GHLLQAIRPPDAYVPVRNNSVSFSADSPPIYDPDFEVFPSDNPTGRDDNQGFEGLTIS
                     PDGKKLYALTQSALNQDGGLKKKERRHARLAVYDLTKSGPQYSAEYVVPLPFYNDGDK
                     VAAQSEIHYISETQFLVLSRDSNSGHGQDSSESVYRHADVFDISNATNIKSPRNDGYN
                     GTIAPAGVLNSGIIPAQYCPWLDFNVNSQLNRFGVHNGGEQDAWLLNEKWESLALLPV
                     NLNGGKENENEYLLFSFSDNDFITQDGYMNFGQYPYADASGYNLDNQALVFKVKLPKG
                     SNPLV"
     gene            complement(<196016..>197367)
                     /locus_tag="TRUGW13939_04922"
                     /db_xref="GeneID:55992420"
     mRNA            complement(join(<196016..196596,196668..197192,
                     197251..197271,197325..>197367))
                     /locus_tag="TRUGW13939_04922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488087.1"
                     /db_xref="GeneID:55992420"
     CDS             complement(join(196016..196596,196668..197192,
                     197251..197271,197325..197367))
                     /locus_tag="TRUGW13939_04922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343980.1"
                     /db_xref="GeneID:55992420"
                     /translation="MAAEERFDLRWGIMATGNIAYTFTKDLLSDPTTRGTTNVHHVVA
                     AVASSSSAEKTRQFLDKLNLSCAGYSSYEELVADSNVDAVYVGTPHSHHFQHVMLALE
                     EGKHVLCEKPLTVNANQAKILCEEARKRKLFLMEAVWTRYLPLTIDIVDKIRQGTIGE
                     VLRVIADTSFGDEVEKTWGTEHRMLNKDLAGGALLDLGIYSLTWVFQCLYHTLPESQR
                     KAPSAVAAQMTLNYLTGADEATSILLTFPTTTPNNVPEWKSQAIAMTNLRVSTDPDGK
                     NTAGPAIRIQGTKGEIQVEGPSFRPERYHIISCSDGNAQRQPCHVEHLIPQGDRGMYW
                     EADEVARCVKAGKLSSDGLPWDEMIAILEVMDEARRQGGLAYPESIEGTHYSAKQ"
     gene            <198008..>198976
                     /locus_tag="TRUGW13939_04923"
                     /db_xref="GeneID:55992421"
     mRNA            <198008..>198976
                     /locus_tag="TRUGW13939_04923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488088.1"
                     /db_xref="GeneID:55992421"
     CDS             198008..198976
                     /locus_tag="TRUGW13939_04923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343981.1"
                     /db_xref="GeneID:55992421"
                     /translation="MSTITTTKSTATTVLRPHLEALQRDGFVVVRSILPPDQVAVLRE
                     AAAKVTSMTRSGQWPYLRSVPKQFPPWPNTPPPSSEGGIWGVQHLMHPEMPDREKFIK
                     AYFSPRILAVAEELLGISANEIHDEELLVMELFNLLVAPENKAFELRWHRDDVPESVS
                     AEREFELLHQKSPEGKQSHAQYNLALCPDASLIVIPGSHRRVRTESERAADPYEAILP
                     NQLIVKLEPGDAVFYDSNILHRGIYQPKVEGGEETRLTLHGSLGLKDITNADNKVRAT
                     AVLQHGIGFWVGRDDATLGVGERAEKMRRNLISLGRGENVGYSLEG"
     gene            <199338..>202469
                     /locus_tag="TRUGW13939_04924"
                     /db_xref="GeneID:55992422"
     mRNA            join(<199338..199357,199415..199533,199586..199605,
                     199655..201747,201821..202313,202365..>202469)
                     /locus_tag="TRUGW13939_04924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488089.1"
                     /db_xref="GeneID:55992422"
     CDS             join(199338..199357,199415..199533,199586..199605,
                     199655..201747,201821..202313,202365..202469)
                     /locus_tag="TRUGW13939_04924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343982.1"
                     /db_xref="GeneID:55992422"
                     /translation="MDDPIGRQIGHLLSMGFEGTTITPQVRSLIENHHIGAIALQAKN
                     LKNAAQAIELILSLQKVAYDAGHSEPLLISLDQENGGVNSMFDPDFFRQFPSAMGLAA
                     CRASNTKLTQNVSCASAKELVCLGINWLVGPVFDVHSDEEKPQPIGVRSFGEDPEYVA
                     EQALESMLGYRAGGLLTCTKHFPGYGNLDFLGSTSDIPIVSGTFDQLLSTSLVPFQTA
                     IDNRTDAMLVGACGMPDVKGAQVQYACLSHSVVTGLLRRRMGFDGVILSDCLEIEALY
                     ESVGVSQAAVMAINAGCDMIMLCQSHSNQIEAIKGIHTAVESGMISKDHIRVAANRVR
                     QMKLKHLSWDKAWNPGGLSQLDALKPAHRALSKAAYEASITLVRDFGNCVPLPKEVEP
                     DEVLLLLTPLVEPFRPDKPAEQAANHQTTSLSPGPVNIARHFNHRDKQSYLEGESTFH
                     DLGVAIAKKWRGKVVHTSYTASGISPLHEKLVSEAAAVILLTADGVRNVYQYGFTKYI
                     VSLCQSQNQLRPFSGSLKASPVGKPCVVVAVSSPYDFMKDKQVQTYMCTYDLTKPPLD
                     ALVRVLFGKLKATGLPPTARPPRSRTTLHRQLWLVEKFQPERDGQALQDLFDQVRLAA
                     SNTFSDPEAQYPAYCFEAAFYLTSYEPLTKSRHFIVRNSSTQKIYGFCATHYIDFLAR
                     GCISAIVVSTEYRGKGIGYSLHQHALSFLQRFPGIEMVQFGSELPAIFAGIPNRLSAH
                     QLGLRGWVKNRDWDVGNWNHHEFYAIRLLRNWKPSTLPEKVALNHEFKYDSMYAKDEE
                     ELSQHLLMGTGFGVGSSALNHPIVISDLYRRARADPQGCKIVLARNSRNGKIIGSVIL
                     YHSLSQINNFFPVDEKQTGGLAATVVSGTPNAVPVVHGLVTKAATILIEMGFLGAQIF
                     VVGDSVFPPILTSIGFQRVSEFLSISKAVSEITRT"
     gene            <205037..>206477
                     /locus_tag="TRUGW13939_04925"
                     /db_xref="GeneID:55992423"
     mRNA            join(<205037..206344,206394..>206477)
                     /locus_tag="TRUGW13939_04925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488090.1"
                     /db_xref="GeneID:55992423"
     CDS             join(205037..206344,206394..206477)
                     /locus_tag="TRUGW13939_04925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343983.1"
                     /db_xref="GeneID:55992423"
                     /translation="MSDHSPCSEQEKEIDDEINDPRHDTLFPSSRPAEEGASEKRDAE
                     NLTALQNLPQSNEYQLVDASGNLVPSNVHINAQLRGRFSQSENSADAVELIFYRRNKF
                     KVLGTVSIPGGIEAVQVAETGQLLRITGFQAELDAIESLEGAAVRVLQPPPKDKEPTP
                     SSHSRGKKTSEGLCKLGLAYNGLSEENSAPVAWEKLQFRYATTKKRGTWQCFYLRVTV
                     RATLEDGSSPVLCRAQSAAITVRGRSPQSFPDTNKKTTKPAKHLVAATQNSTSNHGRE
                     TNDLAFPMDCAVNTSDSLLFYNFSDLGSWNEGLQWQDDSNGTDSQEYNVTLAGEGNEN
                     DRSSNHNANDSSHSLFIPPMETSLLPSLPDLDSIFNLPNPLSAIPMDNMQMLQNMPTS
                     NPISESPDGDQDEEEDSDEERSTFSYEYIPLSINDWTVPVDAVYRPHGVHARKIPNKG
                     QSITKKRYFLTVK"
     gene            <206992..>208068
                     /locus_tag="TRUGW13939_04926"
                     /db_xref="GeneID:55992424"
     mRNA            <206992..>208068
                     /locus_tag="TRUGW13939_04926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488091.1"
                     /db_xref="GeneID:55992424"
     CDS             206992..208068
                     /locus_tag="TRUGW13939_04926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343984.1"
                     /db_xref="GeneID:55992424"
                     /translation="MISKTPILDCVVIDRGGVVENRHQVHAAVVDAQGRLLYAVGDPY
                     RVTLARSTAKPAQALAILETGAMDKFGFDDADLALICSSHSSEEQHISRVLSMMSKVG
                     VGEKDLRCGGHPALSESVNRLWAKNDYTPTPSRSNCSGKHVGMLAGSKAAGAKLVGYH
                     LPDHPMQLRVKRVIEQLSGLDADDVKWAIDGCNLPAPALPLINLAQLCVSFPSAADVI
                     HQNTMASKRTHRVARIFHAMTQFPELVGGEDRFCTTLMTAFQGDLFGKTGAEGCYTIG
                     IRASEETRQLGADGAIAIAVKIEDGNLSALHSAVIEILAQLHIGTPATRKEMGHFHYP
                     KLLNTTGVVTGQVSHLFQVRSALE"
     gene            complement(<208245..>209873)
                     /locus_tag="TRUGW13939_04927"
                     /db_xref="GeneID:55992425"
     mRNA            complement(<208245..>209873)
                     /locus_tag="TRUGW13939_04927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488092.1"
                     /db_xref="GeneID:55992425"
     CDS             complement(208245..209873)
                     /locus_tag="TRUGW13939_04927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343985.1"
                     /db_xref="GeneID:55992425"
                     /translation="MPSFSLLTAAIAASMISGSSASIQNPEIMPTPPMGFNDWSRLEC
                     AINQSVFTDTADAMVSKGLLAAGYNRVNIDDCWMADTRTEEGKLTWNETLFPKGLPWL
                     GQYLKEKGFHFGIYEDAGNETCGGYPGSYGYEEVDAQTFASWGIDYLKVDGCHVTPTT
                     EVEYHKRYAAWHDAFSKMEDPLIFSQSAPAYFSLWLTGSDNLTDWYTVMDWVPYNGEL
                     ARHSADVLVYVGVEGLSGWDSVMQNYNYNTQLARYQRPGYFNDPDFLIVDNLELTLTE
                     KKSHFALWASFSAPLIISAWIPDLPEDVISYLKNSDLIKVDQDPLAQQATLVSRDDSF
                     DVLTRSLANGDRLVTVLNRGNDTASTTVSALRLGLQATESIYSAKDLWTGEAINFKGE
                     LKINKLASHATAVYRISLSGLQSLTVFPTGMIFNAASTNCLTAGARNQEVKFTTCAGT
                     DDQVWQIRPLTGTISPLSARNLCLTAEGGRTVLKECRLIDFAQDWEYSVRGYLTNKWT
                     HECITEDSGSSSSKCLYEVDSQVWSLPAGVKVHW"
     gene            complement(<210700..>211828)
                     /locus_tag="TRUGW13939_04928"
                     /db_xref="GeneID:55992426"
     mRNA            complement(join(<210700..211095,211154..>211828))
                     /locus_tag="TRUGW13939_04928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488093.1"
                     /db_xref="GeneID:55992426"
     CDS             complement(join(210700..211095,211154..211828))
                     /locus_tag="TRUGW13939_04928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343986.1"
                     /db_xref="GeneID:55992426"
                     /translation="MESAPQKRQRTELQLARKRQADRVSQKAKREQAKRNMDHLETQL
                     AKLQDTVELLSDQLQAMHAELRERDKHCPSHCRPPPPQSTASDVQPLGSLDGDNNAET
                     SKDENPSEVPAKQPSSKKRNRSPADSPLDLIKCLCGVQHQVQSECLEYSTFSILLKTH
                     ENLAEGKELPITTWLPRTPSLVSIFCPAASTNPVIRILGAFFRQVHPTKVSTLLACCL
                     LMYRYLRWRLYPDKETFRDVPEWVHPTEIQKTVPHPVCVDFIPWPKLRDYIVLHKYTD
                     PRHSVSLFIRSIRVRWPDNRDFYTMSAQGELLLDPEFEEAVYRYENWQISKDWIEMFP
                     ALKDYVNVEEDEGDSQTAPNWP"
     gene            complement(<212549..>213791)
                     /locus_tag="TRUGW13939_04929"
                     /db_xref="GeneID:55992427"
     mRNA            complement(join(<212549..212689,212760..213437,
                     213501..>213791))
                     /locus_tag="TRUGW13939_04929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488094.1"
                     /db_xref="GeneID:55992427"
     CDS             complement(join(212549..212689,212760..213437,
                     213501..213791))
                     /locus_tag="TRUGW13939_04929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343987.1"
                     /db_xref="GeneID:55992427"
                     /translation="MKAQGVVLGFLSAALVHGAPASIAPASTAGSKSKSPIYITLEEH
                     YDPPVTDPLQTDPVIQLMAPLMGSGVYGKAVPEAQSLNKTRLDSMDENRIRIQVVSND
                     PTPPALTKPDTVKTMNDQLAAAIAPYPERFRGFCFLAMALPEQAAAELERCVSQLGFV
                     GALVDTHLADETFYESSKFDPIWETAQRLDVPIYLHPTYPMIDDVNGTQGRFKSQDND
                     WPSDVAAMLGTAVYGWHTDCGLHFLRLWLGGVFDRFPKVKLALGHMGETVPYMLDRAN
                     STVAWAKPTGITLPDAWATNVWVTTSGFFSLNPFATLLKTTSTERIMFSVDYPWATNE
                     EGAAFMDSLKESGMVSHKEWEDIAYRNAANFLKLE"
     gene            complement(<214419..>215342)
                     /locus_tag="TRUGW13939_04930"
                     /db_xref="GeneID:55992428"
     mRNA            complement(<214419..>215342)
                     /locus_tag="TRUGW13939_04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488095.1"
                     /db_xref="GeneID:55992428"
     CDS             complement(214419..215342)
                     /locus_tag="TRUGW13939_04930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343988.1"
                     /db_xref="GeneID:55992428"
                     /translation="MDKLLSTADIPSRFLKSAFLIGHVPLKALSTDPRVSFALYVPPN
                     SYSSTPQKKLPLVVYVHGTRRNISPLFSQELTAFADSTPCAILAPVFPTGLDGPNDLL
                     SYTTLRSQTLRSDLALLAILDEISVRWPGINAEKVFMMGFSAGGQFAHRFLYLYPERI
                     VAASIGAPGQVTTLNDQKDWPIGVANIHDLFDRPINKELIGRVPIQLVVGDQDTGVHG
                     GDEFRTWVRQFVKKREEKSETKTALPAMKQGRMESLKSLQETWREDKIDSQLDVVPGV
                     VHSSAGVQADVLKFLGPQIQSWLESQSRSTE"
     gene            <220229..>222018
                     /locus_tag="TRUGW13939_04931"
                     /db_xref="GeneID:55992429"
     mRNA            join(<220229..220656,220707..220911,220961..221292,
                     221372..221763,221810..>222018)
                     /locus_tag="TRUGW13939_04931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488096.1"
                     /db_xref="GeneID:55992429"
     CDS             join(220229..220656,220707..220911,220961..221292,
                     221372..221763,221810..222018)
                     /locus_tag="TRUGW13939_04931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343989.1"
                     /db_xref="GeneID:55992429"
                     /translation="MQKYFGLRGKSLSNALVWTVIMPAYTLFGYLAGVAGGLLELPSW
                     TAMFPQMDTVNTIGAQKSHNTQIQGTVVAIYTLGCLMGSLSCIGIGDKLGRRRTIMLG
                     SLITCIGSILQSSSFSFPQLIAGRIITGLGFGLISATAPNWQTECSRTSHRGFVVMLE
                     GLFISAGLAISGWVNYGMSHTSGDISWRFPLAFSCVFCIVVFLSMPLWPESPRWLVQK
                     GRIDESKYVLAALGDIPIDSPQVLDDIAKIRVSLEETAGGSFRDIFRNGPARFANRAF
                     IAAASQCFQQMSGINGVAFYQTKIFRTYLGLSADNAAILSASVFTWQTIIAPVGVFTI
                     ERFGRRKLMMFGAAGMGMCMAIIAGCVSHPSDLKAVHAAIVFVYLFSFFFVTGYLGLT
                     FLYSSEIAPLSVRTPITALSTTSTWVFTFTVVEATPPGFDSLGWRYFIVYAVLNLCLL
                     LPTIYFLFPETQGLDLESIDRIFLGSQNVFQTIRVAEKLRLEAIPSEENNLSGRQEAD
                     LEAKDVGETKHVT"
     gene            complement(<224653..>226442)
                     /locus_tag="TRUGW13939_04932"
                     /db_xref="GeneID:55992430"
     mRNA            complement(join(<224653..224679,224734..224942,
                     225002..225720,225798..226117,226182..>226442))
                     /locus_tag="TRUGW13939_04932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488097.1"
                     /db_xref="GeneID:55992430"
     CDS             complement(join(224653..224679,224734..224942,
                     225002..225720,225798..226117,226182..226442))
                     /locus_tag="TRUGW13939_04932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343990.1"
                     /db_xref="GeneID:55992430"
                     /translation="MSDIEMKPTSRSHSHVEEASTADYPMKTVDTFHADEAMRVIATY
                     SGDESWTEDEEKKLLQKIDWNLMPILCLTYALQYYDKAMLGQAAIFGLRTDLQLLTGD
                     RYSFSASIFYLGFIVGAYPVMVLAQRYPVERVAAGTVSIWGLCLLLTTQCRNYQALYA
                     QRFFLGVLESGISPMFMIVVSSWYKKNEQALRMGIWYCCTGYISCVSPLINWGLGQIH
                     GGVSSWPYMFYFAGSITFVWGIVLLWVLKPEPISVKVLNERERYIAVSRLRSNNSGVR
                     NTHFKGSQVRELLFDGKFWLLFFIAMLSMIANAPISTFTPILINGFGYSTFNSLLLSM
                     PCSFWSGSMTLSMSYLCYRFTAKGIRSYLFIFTQMIVVFACILLVAVPSTVKGVALFA
                     IIILPSVGSGYGILMGIQMANIAGYTKKSVASAGLFIGYCFGNFIGPLVYRSQDSPRY
                     LIGFLVTIGSSVVSCILMYIYRMICSSENKKRDDAGIVEAYDNAYDDDLTDKKNLQFR
                     YIL"
     gene            complement(<227262..>228996)
                     /locus_tag="TRUGW13939_04933"
                     /db_xref="GeneID:55992431"
     mRNA            complement(join(<227262..227457,227772..228300,
                     228443..228612,228662..>228996))
                     /locus_tag="TRUGW13939_04933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488098.1"
                     /db_xref="GeneID:55992431"
     CDS             complement(join(227262..227457,227772..228300,
                     228443..228612,228662..228996))
                     /locus_tag="TRUGW13939_04933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343991.1"
                     /db_xref="GeneID:55992431"
                     /translation="MASHSLHISARDLALTSIVPPLTTAVYPMTHEKISVVKDTPWFT
                     DNEFKASSSDKFIDVHDPATNNLVTRVPQNTDDELKAAVESANRAWPAWRDTSIVGRG
                     NESCSSLLSLQDFADAKGDVLRGLQVAEQSCGITEQMKGELVEVATDMETRSYRIPLG
                     IVAAICPSRATMILAKLCQKAGFPPGVVDVIHGTAKTVNFIIDEPEIKAISFVGGNRV
                     GEYIYTRGSANGKRVQANLGAKNHAAILPDAIKSQALNAIVGAAFGAAGQRCMALSTL
                     VAVGEAREWLDELTEKTKELSLDGGSELGADVGPVISPHSKNRIEELIASAEAEGATI
                     LLDGRGYKHPEPIPIPLPMFSFTGNKKSIAGGGASNFYGKPGLNFYTQLKTVTSLWKH
                     ENANLVDKVAMVMPTQG"
     gene            <230051..>232061
                     /locus_tag="TRUGW13939_04934"
                     /db_xref="GeneID:55992432"
     mRNA            join(<230051..230274,230321..>232061)
                     /locus_tag="TRUGW13939_04934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488099.1"
                     /db_xref="GeneID:55992432"
     CDS             join(230051..230274,230321..232061)
                     /locus_tag="TRUGW13939_04934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343992.1"
                     /db_xref="GeneID:55992432"
                     /translation="MFVTFAASSPMHCDQDPEKRAPKPKRAPVTRACSWCRLNRVRCD
                     NYHPCRNCRHRKGKCHRDHTAEVATLPSVLKENQALKLRISHLETQIRDRTSSEPLPR
                     NWQRPYLSLGPATDIRRGLVVTNDIGGTPQLYGFSSLRCLSSRITLQLRSVYGWRYSD
                     LDIQCQTAGSPFAWPTNIVSSNASGSPLSQEELTNGAYMTREQEDGCLRLFWQTYHCT
                     VPILDERAFKEHHASIWAGRPADSRIRENSPLVDIVLAVCIQYGMTLVPRENTSGCLD
                     ADINTTDASNAGRWYFQRSQSLLSAYLENPSVMLLQCQIISIIYLRDASFSNMASSAA
                     AAAVQTVYALGFHLDFNGDYCRKEREFHKRLWCMTYALESKISMDLGRPFVTRELNVC
                     LPSDDPELASISSTMFTQPSKLGIRWLSYHVHHVDLIRVARGIYSNLEDNRAYELATN
                     GGKEFYDDPQTMENCSKFLTQQISILLSWLQSVPDILICRRKCSGRSFSTDGSALDID
                     RCAPSWLQMQIFTLELIYHDTIINFCRPFISFQANSRTSTPLSDETAAICLKHAITVT
                     DIVHQVLEETETLYGWHRAYQFQWNATLSMIGFAFGYQESPLVPSALMGIKKAISVFD
                     MFDNNFAAAACVGRITRDLFSMLNQVLKLL"
     gene            complement(<232382..>234395)
                     /locus_tag="TRUGW13939_04935"
                     /db_xref="GeneID:55992433"
     mRNA            complement(join(<232382..232839,232930..233547,
                     233598..233755,233807..234094,234160..>234395))
                     /locus_tag="TRUGW13939_04935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488100.1"
                     /db_xref="GeneID:55992433"
     CDS             complement(join(232382..232839,232930..233547,
                     233598..233755,233807..234094,234160..234395))
                     /locus_tag="TRUGW13939_04935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343993.1"
                     /db_xref="GeneID:55992433"
                     /translation="MSLTNGVQQNGLHQDGSSAYKIADSPLGTRRPLRVVCIGAGFSG
                     LLMAIVFEEKMRNQNITFQIYESNNDLGGTWLVNRYPGCQCDIPAHNYAYSFEANPNW
                     PNYYASSEQIFDYLKGVANKYNCGTYIKYQSTVKSANWNEASGKWELKVHDLERDTEF
                     TDSPDILINAGGLLNNWKWPEIAGIETFQGKLMHSAHWDQEYDFNDKKVAVIGIGSSA
                     IQILPQLATKAKNVTSFVRSKTWISPEGIVEPEKGDPKMDKNQYYDAEELKRFKEDPK
                     YLQEHRRILADRRIRNFKSSMAGSEAQRNADAFYRKTMIERLGDTEKGKDIANWLLPD
                     FPVGCRRVTPGPGFLESLVRDNVNTLWDNIHSITETGIKTKDGRDIEFDVICCATGFD
                     TTFRPRFPVVGLNGIELAKKWAENEPECYFGTTIPDFPNYFTFIGPNSPISNGSLVQA
                     IQMTGVYISQCIEKIQTQGIKSFAVNAKVTSEYNEHTQEYLKGTVWTAPCSSWYKRGT
                     KDGRVVAIYAGSTYHFIESLRKPRWEDYDIEYFSKNRFAFLGNGFTQREARDETVADT
                     QTLDFDEYWNLMVLPDIYG"
     gene            <236539..>236868
                     /locus_tag="TRUGW13939_04936"
                     /db_xref="GeneID:55992434"
     mRNA            join(<236539..236724,236778..236796,236840..>236868)
                     /locus_tag="TRUGW13939_04936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488101.1"
                     /db_xref="GeneID:55992434"
     CDS             join(<236539..236724,236778..236796,236840..236868)
                     /locus_tag="TRUGW13939_04936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343994.1"
                     /db_xref="GeneID:55992434"
                     /translation="VFSKLAKSQYPNVSIDERTDIRKRQVLNILMSDSQRSYCLALRD
                     LEDETATTENLASWVITELYDLVNARYIGYGIF"
     gene            <238536..>239390
                     /locus_tag="TRUGW13939_04937"
                     /db_xref="GeneID:55992435"
     mRNA            join(<238536..238626,238702..>239390)
                     /locus_tag="TRUGW13939_04937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488102.1"
                     /db_xref="GeneID:55992435"
     CDS             join(238536..238626,238702..239390)
                     /locus_tag="TRUGW13939_04937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343995.1"
                     /db_xref="GeneID:55992435"
                     /translation="MSHFESPSLNLVGTLAAQKTSMQVSILFPSGLWLNITIESLTTP
                     AQACTIFAPGTQYTVEATHQCLYRRMLYDRLRQVVPLLIRDGDLCWFLTINKDDNPTE
                     SCLFHGAKLELKPLSKYIPEYGFCFARSAFVSERDRFNPRATRSGFWEEWTQRQPSDV
                     ERLLINRDGWEALYFVQPPASCSDITVSRLRDELCNSLQIIDPGRLSFTSGPYTWNSA
                     FQEDGRSFYETYFTQDIVVDSRHMVTAEKSALVYVTENHIV"
     gene            complement(<240561..>242025)
                     /locus_tag="TRUGW13939_04938"
                     /db_xref="GeneID:55992436"
     mRNA            complement(join(<240561..240800,240906..241605,
                     241667..>242025))
                     /locus_tag="TRUGW13939_04938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488103.1"
                     /db_xref="GeneID:55992436"
     CDS             complement(join(240561..240800,240906..241605,
                     241667..242025))
                     /locus_tag="TRUGW13939_04938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343996.1"
                     /db_xref="GeneID:55992436"
                     /translation="MPNYIKSAAPKPHARPLSTSVPAIVKGVIDDIRSNGDAAVRQYS
                     EKFDKWSPVSFKLSEEEIKDIISRVPEQTIKDIKEVQENVRKFAIAQRKSISDIEIEI
                     QPGVHLGHKNLPISSVGAYIPGGRYPLLASAHMTILTAKTAGVSYVVGCTPPILGEIP
                     SSTVAAMYLAGADEIFILGGVQAVAAMAIGTETMRKVDFIAGPGNAFVAEAKKQMFGD
                     IGIDLFAGPTEVLIVADEAADPFTIATDLLSQAEHGPDTPAVLITTSEDIGRKTIEIV
                     DTLLTRLPTAELAGESWRTFGEVAIVGDLTEAYALADEYSSEHVQILTKRPREALEKM
                     RNYGALFLGEKTCVSFGDKVIGTNHVLPTRKAARYTGGLWVGKFLKTVTYQEVTSQEA
                     SGRLGKLCGRAARAENFEGHARSGDLRDHLATGSEYEWIK"
     gene            <242671..>243949
                     /locus_tag="TRUGW13939_04939"
                     /db_xref="GeneID:55992437"
     mRNA            join(<242671..242814,242891..243105,243183..243333,
                     243390..243422,243476..>243949)
                     /locus_tag="TRUGW13939_04939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488104.1"
                     /db_xref="GeneID:55992437"
     CDS             join(242671..242814,242891..243105,243183..243333,
                     243390..243422,243476..243949)
                     /locus_tag="TRUGW13939_04939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343997.1"
                     /db_xref="GeneID:55992437"
                     /translation="MTTGQPTPLQSDVVLDESLFQANAIHSSTLALNKWLVEQGKQEA
                     KWWETGASAYRDLRATGKTVHPAPVLLPQASQFFVPSRDPSRTIMCRMFRPAVNGLLK
                     GLFLHIHGGGYVLGSATGQDLMCDHIANNTQLLVVSIEYRLAPEYCFPAAAEDCQDVA
                     DWMVLNSKRKFGVEMNFIGGESAGATLSSDVLIHLRGARRLKNVKGAILNYGCFDLSL
                     LPSARLSKSEETPILGYSDLQHFFGKYLPEMTIEDRKLPSVSPAYNELSDLVPALFIV
                     GTEDALIDDTVLMHSRWRRAGNPAVLKYIPGGCHGFMVFDGNEVEVARQGWKLMIHYL
                     RQMI"
     gene            <244532..>247105
                     /locus_tag="TRUGW13939_04940"
                     /db_xref="GeneID:55992438"
     mRNA            join(<244532..244619,244817..245526,245589..245712,
                     245765..245865,245918..246156,246213..246826,
                     246879..247052,247098..>247105)
                     /locus_tag="TRUGW13939_04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488105.1"
                     /db_xref="GeneID:55992438"
     CDS             join(244532..244619,244817..245526,245589..245712,
                     245765..245865,245918..246156,246213..246826,
                     246879..247052,247098..247105)
                     /locus_tag="TRUGW13939_04940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343998.1"
                     /db_xref="GeneID:55992438"
                     /translation="MGGHPPAQQKKATRNRDNTAKNHVCQYCEQLHDRHQTTHHQCSR
                     SSFPSPEIIPSDVFATEPKNIVELHSSMPDTGRSENDVPNSDIISLPFSPSSNATFHP
                     VSFWSDMSQHSSLEGISSLDPNGNLPISILHSEVTSLTDWGLNEISIEKSAQDISSLL
                     LDNTIDSTTKPGFPQEEQQNFLERMKAGKSSPPSPFSVSPPGDSDFWSVLSDESNNFR
                     IPCSPLLDVFSWPEAQLGYVGTEPTQISDPRIDGQLLDTIKQALSKHQSNGRVEISEA
                     QMLEKYLTMFFATLNQHLPCIHESSTSSINPAVTIALIAGGAMYCSKSQAGIALFEVS
                     RRMAGEYMEISQSQTIPPWVLRTLLYNCLFGFPGGSSSNMDSTLGSLRSLVRIASSIQ
                     SFTAASSQMEKSVVVAEWNMFVDNELSKRSIFGVLIVVGMWSTVYGSIDGAAIRHFSQ
                     VHLPAPEVLWKAPTACEWQKLRLNAGSQPLPRFRETVDAVFSNKAYRCGGLASLSIVM
                     GILISADELRSSSPMLPQDLKSRITQAVENWSAMHNEGSTENSDVNFVAYPTAAYIRL
                     SLQVDIKFAMAMFMTRDFQCMRATLRSGNLFEATKHALDGLSPWAMISKIQILMVSIP
                     FTIVISEWVLLKSESSVISTSHMELLSKIGEALGLLIQGSAMTPIGIWKSLHHILENG
                     PTK"
     gene            complement(<247402..>248850)
                     /locus_tag="TRUGW13939_04941"
                     /db_xref="GeneID:55992439"
     mRNA            complement(join(<247402..247680,247731..247824,
                     247888..247920,247987..248140,248190..248432,
                     248487..248631,248699..248718,248787..>248850))
                     /locus_tag="TRUGW13939_04941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488106.1"
                     /db_xref="GeneID:55992439"
     CDS             complement(join(247402..247680,247731..247824,
                     247888..247920,247987..248140,248190..248432,
                     248487..248631,248699..248718,248787..248850))
                     /locus_tag="TRUGW13939_04941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035343999.1"
                     /db_xref="GeneID:55992439"
                     /translation="MRITSVLFNAARYNTIGFIGLGAMGNHMVNNLISKAGQSGGIPK
                     NFVVCDVNPDTVSRIIARHAAANPDIKVESAKTPEEIANKAATIISMVPTANNVREVY
                     LGKSGVIRALEKLSKDDVRRTICIDESTIQQEESRSIANQVKQTGAEMIDAPVSGGTV
                     GARDGTLTIMVGGKKDAFERARPILQSMGQRVLSCGDLGAGLAAKLANNLLLGISMMG
                     VAEAMLLGKKLGLESQQLAEIINTSTGRCWSSEVNNPVPEVRTSSSSPPSHREYEGGF
                     VTKLAHKDLALAVAAAKIVNSPVPLGSLTEEVYRPLAQPGSSFDNLDFSSIYKYFDEG
                     RMPTAREQK"
     gene            complement(<249478..>252756)
                     /locus_tag="TRUGW13939_04942"
                     /db_xref="GeneID:55992440"
     mRNA            complement(join(<249478..250243,250300..251972,
                     252085..252358,252494..>252756))
                     /locus_tag="TRUGW13939_04942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488107.1"
                     /db_xref="GeneID:55992440"
     CDS             complement(join(249478..250243,250300..251972,
                     252085..252358,252494..252756))
                     /locus_tag="TRUGW13939_04942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344000.1"
                     /db_xref="GeneID:55992440"
                     /translation="MTERRASDFAEAEQPSIQQQPPPTASSVQENDAPATKVKRKLPP
                     YLDHFNARDLKVFFRCWVAAWVACLLILISPSLRSLGFGAFFACMVLLMIPPSGIVSI
                     YLLGATTMIMGMLMAWAWGVIAMKAAFAARPAAETQARFASLQQTAAAQANATGTTPT
                     AAAQVLIYEGYMLDARVTVARLRASNPKATFTTIFGIIISDLILTYAPLFPSFQGTLP
                     ETLIKPAAIGVGLGFACSVLLFPRSTSHVLLDSLEDMMDHLRLPLEFTASTLGKKEKN
                     PDGLGPLRMIQTKIVQEYRKMEPAFGFLPLDFSVGLWGSEDVASFKEPARHLVTAVMA
                     LLEFHMTRLFSDSRTENLLRDYVDEIKNDHALDEKHTHDVGGHQRSKMAELLDGFRTA
                     GDHHIGDESAKALIKSSTEAIEVCLESLDLMKECIHMVNSRRWFRRPAAEEREELHRR
                     ATDTLEKLHQIRGSFVNKVTETLIAEYSQFFEDPDAQGDRIPRARGLVVGMVFEEHMA
                     NAIDKTEALMSRIFTVFHKSTKTRLWWPLSLTHAAAWATGTNEKTPMLAPATDDDPYQ
                     VADLTKVAQEKLRISRGYRSRPRSVTGRVVLGTYHWFTSNAGLYGIRMVVVTIALSIP
                     AALPHTAGFYYREKGLWALIMAQTSLLVYMADFTFAVISRVVGTVAGGVLGLLAWYIG
                     SGNGPGSPYGLAAIVGAILTIFIWIRLYLPPSFLQGGIMSGVTFLLVVAYSFDDTHIP
                     QYGNPGVGYTVFYRRLVLALVGVGASIIVQILPHPPSASKHVRKSLSRSIRSLSDHYA
                     LLLSCWGHSRDDGQLLAESVTIQLTESLVLLDGPIALLRFEFSSSRFDSEALDIVKRL
                     CHAMNLNLRRLLVLSGSLPQHFQDNLSRQTGLLDHRIIGEIMAVLGMCEQALKTEDAP
                     PEILPTPLLRRAFEHGRTRVGDFNVTPELVRDEEYRKFCVALSAYLKFLGSIDELVLV
                     VKGVLGEAHLVSKELVDLV"
     gene            <254344..>255411
                     /locus_tag="TRUGW13939_04943"
                     /db_xref="GeneID:55992441"
     mRNA            <254344..>255411
                     /locus_tag="TRUGW13939_04943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488108.1"
                     /db_xref="GeneID:55992441"
     CDS             254344..255411
                     /locus_tag="TRUGW13939_04943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344001.1"
                     /db_xref="GeneID:55992441"
                     /translation="MASELSKALKESFEHGSSIFDSTTSRNVSFQFPLLGFPIKHSLA
                     PVVHNSMFHTKGLPWKYHLLESKDINDLRTKLEVSPSGGQDSSVTIGAAVTMPHKVSF
                     MSHVDELTTEGRSIGAINTIFTRLDQKTGTLRRIGTNTDTIGIARSFTTTPNPLFAGE
                     TEPQIGRERPALVIGGGGASRSAVFALHHFLGAKEIYLVSRLKSETDEIISWFAKSPS
                     FNAKLRAVHDLDESKALTTPYYIVGAIPDIPPQTPGEKTAHAITRELLAGATRASVPK
                     GVVLEMCYHPNIRTTFYEFAEQSGWTVVPGTIAMIWQAVAQQVLWTETEFVNEIAVVD
                     DLKKIVEGKIAGHTQTHEARI"
     gene            <255888..>259300
                     /locus_tag="TRUGW13939_04944"
                     /db_xref="GeneID:55992442"
     mRNA            join(<255888..256457,256907..258030,258443..258645,
                     258702..258865,258929..259163,259218..>259300)
                     /locus_tag="TRUGW13939_04944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488109.1"
                     /db_xref="GeneID:55992442"
     CDS             join(<255888..256457,256907..258030,258443..258645,
                     258702..258865,258929..259163,259218..259300)
                     /locus_tag="TRUGW13939_04944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344002.1"
                     /db_xref="GeneID:55992442"
                     /translation="EELSANEELTVEEVEEQGHEKGEGEYEENLHTPAGTSTIGDQFD
                     NLGPHPSIDPGVTCPWPGQTFVFRDHLTKRVITLEDGNLVLRPNGRSSDRGSHWRCEQ
                     SKSLWLGFRNAVSGTYIGRDGNGKIATSAKDHLQLGSFCTRQLQAGEHVLLVKYYDDL
                     LPLVYDFKDLEFRVGNKGDMERFRAWEFIKTPKDSIAFARSPTKTKMTTEIQTQRALY
                     QEVYGEPLVVKNLEIPKATPGSVIVRIAAAGVITYMKDIYNGKRQHPYPTPIIPGSCA
                     VGRVAELGADSTSLKVGDLVFIDPVIRGRDGTGDIFLFGVHRGHSDGGRKLMEGEWRH
                     GTFAEYAKIPIENCAPIDEKLCCGSTEEGGLGYQVSDLVDLGRLLVPFGGLRDIELQP
                     GQTVIVAQPTGGFGSAAVQVALAMGARVIAMGRNASKLENVVRQMAPFTRPGMLETVT
                     ISGSVETDVKNLQKFRPIDAFFDISPDEAINSSHFKAAILSLRQEGRVSLMGGFRSDV
                     PIPHSMIMHANIRLQGTWMCTRAQVREGIKLAERGLLKLSGSTPKEFALEAWDEAFDM
                     ETPLHPYFPLGIHIPGYVANVNSLPSLLGQFALLWAVVMAVAWLGISRIRPSSSTADR
                     LACVWFCLTASIHLFFEGYFVVNHTTIGGADHLFGELWKEYSLSDSRYLRSDAFLVSM
                     ESITAVFWGPLGFFIAYSIAVQHPARYALQIVISLGQIYGDLLYYATSLFDLFHYGVE
                     FSRPENYYFWVYYFFMNFIWIVIPTYYLKDALNEVISVFRKADQVEKTRRAQ"
     gene            <260435..>262078
                     /locus_tag="TRUGW13939_04945"
                     /db_xref="GeneID:55992443"
     mRNA            join(<260435..260682,260739..261284,261352..>262078)
                     /locus_tag="TRUGW13939_04945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488110.1"
                     /db_xref="GeneID:55992443"
     CDS             join(260435..260682,260739..261284,261352..262078)
                     /locus_tag="TRUGW13939_04945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344003.1"
                     /db_xref="GeneID:55992443"
                     /translation="MLTSVATLALCWLASFQSVTAAAVGEVSQNVRHGDPETVDAVGR
                     ALRFAGPAGNKGKEITYKMNKTSLAKSWNHSTLFALGSNIVDADISVVCETCYIKGSV
                     NGHLTIRDDLNLTEVVHSVASEVENATTAAWDELKEYVKDVAKDIIHFSHIPAFPTLD
                     VDFNLDKTAGLPPIDARFEFDNLELYLDFDLKLDAGTYYTFRLFTSETPAGFSIPGLE
                     AGALFKASLILMTESAIDISSGIHLKLDDGLALDMELFNKKVSGIKMPGATFELLPVK
                     IHGHGSIEAILQLEASVGFNMYTEKMAGLLTASTGVEAEIYAYVADFYVKVDGSSKKH
                     CELAAQAEYYFGLGAAAGATVAVGDYMWGPDPATSTDIWTTTLPRFCAHTKTKSATKT
                     KTHHTKTAAAEVTARAALEDRAPKVTTTVSTTEAYTVVNCLKKGVVNCPVNMQNTTSV
                     EHTLTTVLTLPSGMDATYPANTHASVTSVIPFGTNHHKIAATTGSPKPHAPRKTSV"
     gene            complement(<262505..>265358)
                     /locus_tag="TRUGW13939_04946"
                     /db_xref="GeneID:55992444"
     mRNA            complement(join(<262505..262594,262679..264052,
                     264124..264642,264696..265106,265167..>265358))
                     /locus_tag="TRUGW13939_04946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488111.1"
                     /db_xref="GeneID:55992444"
     CDS             complement(join(262505..262594,262679..264052,
                     264124..264642,264696..265106,265167..265358))
                     /locus_tag="TRUGW13939_04946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344004.1"
                     /db_xref="GeneID:55992444"
                     /translation="MAERTQFADGSGIGSRASSLGASISYIDDGKSMPATKPRDRRRR
                     HRVITSCLECRRRKLKCDKGEVCLNCKSHGRQCVYMSTAADDSHIRRKITQMKDARDS
                     LDQVLVGTSNKETAQRKQYKRDQLLQNSKTPIVAIEDELDDDSRDSDGEDFLEPTPLA
                     IPDAAYAGDERDELDDLGFSFGRMRLGERVGGLFRPRIADELGQSLHSQPFRSTAAAN
                     VSKNQPKGDASSSRSTPELTFVPSMAIIFGAGPSNDEWTTLLPPRAVSDALLNHYWVS
                     VHPVARTLHRPSFALRYETLWELMDGREHIPASLGAIVFSVLLASVISMSADDAVTRF
                     HTSKQEMSNCLQLGTELALSKSNLLRSNKIEVLQALVTYLLPACVEISRAHSALVGMA
                     IRLAECMGYHRDPAEYDFSPVDCQVRRLIWYQICYLDLKTSDVQGPRPFIQSTGYSCK
                     LPLDSNLHASPPSMVSGPVTRWNDLVFSAIRFECQEMQRSCLLLCKRVDLKKLSLTEA
                     VSRVERFNKEIHRKYDAALNEEPQQPLQNAARLVMKLFTSLLYLTLLHRYMNSVTYSI
                     PDRLRQIVLIKGTEALEAAVELETASDLHQWAWYCPAYQRYHTALLLLFEVFTFPLRK
                     HADRIWQCLDFIFAGPLASLKDLPTLETQPKYHEILAQRETKGRYLLGIITEGMQEYR
                     SQRGLRLPVSITESMIIISPRKAGDDSDPTLPLNYAYERPPVEQNSTIFDSISRGNAI
                     RPTSYGQEILLEQQNPTDTEKLPQAPLVPATEEGLFGITTNCGDLYNPLLDSTHLNPS
                     LHPSAMGSQSASMSTYTPQTSGDGDNQEMLDINWELWDSMFPPGVFDGHLDLSDIDMQ
                     EYAVL"
     gene            complement(<267232..>267714)
                     /locus_tag="TRUGW13939_04947"
                     /db_xref="GeneID:55992445"
     mRNA            complement(join(<267232..267370,267425..>267714))
                     /locus_tag="TRUGW13939_04947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488112.1"
                     /db_xref="GeneID:55992445"
     CDS             complement(join(267232..267370,267425..267714))
                     /locus_tag="TRUGW13939_04947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344005.1"
                     /db_xref="GeneID:55992445"
                     /translation="MGNNLMLVGLIFQILTLGLFAVLCLEFIWRVKHYPNRKRAEFQY
                     IRESRRFQGFLVAAFITFITIFIRCVYRVVELAGGWNNKLQREETPFIILESGMVSVA
                     VFAFALFHPGRAFDDSFGNLYSSVEKSSRGEDAEMKLMPQ"
     gene            <271283..>274363
                     /locus_tag="TRUGW13939_04948"
                     /db_xref="GeneID:55992446"
     mRNA            join(<271283..271501,271560..271707,271777..272327,
                     273206..273562,273635..>274363)
                     /locus_tag="TRUGW13939_04948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488113.1"
                     /db_xref="GeneID:55992446"
     CDS             join(271283..271501,271560..271707,271777..272327,
                     273206..273562,273635..274363)
                     /locus_tag="TRUGW13939_04948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344006.1"
                     /db_xref="GeneID:55992446"
                     /translation="MAITITLGPNGHYHVNDGSGYEHDTSANFLPVSGSTKLRRMLHE
                     TNELIVCPGVYDGLSARVAMQLDFKAMYMTGAGTTASRLGMADLGLAQLHDMKTNAEM
                     IVGLDPYGPPLIADMDTGYGGPLMVAKSVQQYIQAGVAGFHIEDQVLSKRCGHLAGKK
                     VVSKDEYLMRIRTAKLTKDRLHSDIVLIARTDALQQHGYEECIDRLKAARDLGADVGL
                     LEGFTSAEQARQAVQDLAPWPLLLNMVENGAGPVITTHEAKEMGFRIMIFSFASLAPA
                     YLGIRSAFERIKTEGIVGTPEGLGPRKLFESSFPETTMKLVDFISVPLVTLTPLVSAA
                     LQYRGADISSLLVEEDSNISYKSVDGQSESLETILADNGVNAIRQRLWVNPADGSYDL
                     DYNLELAKRMVAADMVIYLDLHLSDTWADPGDQTTPSGWSTTDIDTLTWQLYNYTLDV
                     CNSFASESIPLEIVSIGNEITAGLLWPLGSTDSYYNIASLLHSAAWGIRDSDISPQPQ
                     IMIHLDNGWDWDTQSYFYETVLGEGPLLTTDFDLMGVSYYPFYSSSATLASLESSLAN
                     MASTYSKGIVVAETNWPYSCPDPEFSFPSDLTSIPFSADGQTTFLTDLAKVVAGTSNG
                     LGLFYWEPAWIGNGNLGSSCSDNLLVDSSTDVFRSSVEVFSGF"
     gene            complement(<274611..>278319)
                     /locus_tag="TRUGW13939_04949"
                     /db_xref="GeneID:55992447"
     mRNA            complement(join(<274611..275477,275541..275848,
                     275918..276625,276677..276690,276751..276791,
                     277282..>278319))
                     /locus_tag="TRUGW13939_04949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488114.1"
                     /db_xref="GeneID:55992447"
     CDS             complement(join(274611..275477,275541..275848,
                     275918..276625,276677..276690,276751..276791,
                     277282..278319))
                     /locus_tag="TRUGW13939_04949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344007.1"
                     /db_xref="GeneID:55992447"
                     /translation="MENQLILPPIIMGGAGFSYQLHSQPDQIPISKIIRRAFDRGIRA
                     IDTSPYYEPSEQLLGHALTSPEIRDRYSREDYILMTKAGRISADEFNYSPEWIQASVA
                     RSLSRLDTAYLDVVFCHDVEYVSCNQAVEAVGSLFELKRQGKVRFIGISGYSIESLVR
                     VARRVRQVYNQPLDVVQNWAQLTLQNSRLETVGIPALQEEGVTVICNSSPLASGLLRS
                     TSVPSGKLGDWHPSPTGLREAVRAASDWVESQGSTLVNLALRFSIARAMKISSSGKRT
                     RVHTIVGVSSIDDIEDNVKATTAILRRLNSLSNDPTTEEVNVSALTEIREEVEHRDLV
                     LCQGVRRILGDWCSEARTRCNGDTPCGRCFDLHLRCRYDREVKKRGRRSNASKGIQRQ
                     MLARDIADKDTRSPEASSAKRNSTREETEVYQHTPVSNSVELRPAPARTWENGMTQSS
                     QGVGNDPALNRSGFSASTRHTPLVNAPAFDSFCRYSCLEPLLPALKNIIPAEEACDLL
                     DIYFVEPGNSLFSIHSPYVLTPVLRKKSLLSSTNPRPTSPALLSTILWCMAHTANINA
                     FRVPGSRERIINKLFSLSLSFFHQRDMDNWHRVPGGWRFERDFTGALADGFDSNMTWT
                     TFTKKPQPTVDDVLTLTLLTTVISGGEFKSDSVKWSDKAMRLVKYLGYHSEAMICSGT
                     SETSNQPASLEVIVEQEERRRLLDSECHVFIPLDEHVWQNIEKATPEILSSRVYGSAN
                     TISGTGVFEFFLPLMAILGDIIDLRLRRNNPRLGVIDDTSSLNAIKKCLCDLESGLNH
                     FSLLPGVPTPGAHNMAFEDGGSTMFSPTQRSPEFDNNTQYDTRFEHVSTATETRTALA
                     VAYARYIVHVLHVLLHGEWDAITMLEDEGNWIASSNFPECAFQGIAAAQAVSEILEID
                     PELAFMPYLFGIYLFHGSFVLLLFADRMPQVGPNASVEQACEVIIRAHEVCVVTLSTD
                     FQVLFYFLHVIYFYNINIC"
     gene            complement(<278795..>280544)
                     /locus_tag="TRUGW13939_04950"
                     /db_xref="GeneID:55992448"
     mRNA            complement(join(<278795..280056,280118..280220,
                     280338..>280544))
                     /locus_tag="TRUGW13939_04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488115.1"
                     /db_xref="GeneID:55992448"
     CDS             complement(join(278795..280056,280118..280220,
                     280338..280544))
                     /locus_tag="TRUGW13939_04950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344008.1"
                     /db_xref="GeneID:55992448"
                     /translation="MNDEKPGTPAAAVVDDQAINERYADETLRFVEQYGDAVDRLGPQ
                     EERRLVWKLHWRIMLLLSVTNLLLFIDKATLSYASLLGIFEETGLTQSEYNNLNTIFY
                     VGYIVAQLPGHYLMQRLPLGKFVGGAIFFWSLLIFLHDTAHNYGGFIPLRFFLGVVES
                     CVVPAMEMTMGMFFIPKEQAALQPIFWISCLGSGIPAGFISYGLLFTKSTIRPWKFFM
                     ILTGGLSLFLSIYCWFFYPSNPVDAKFLTPQEKIHVIRRVQESTKSSIEQKQFKKSQF
                     TETIKDPISWLFLLQVFTLMLSNSLTYQQTLLFLAIGVSDLGSTLVSVAGAGFAVACA
                     VVAYFLLRWFPNKNAWWALFWMLPAIAGGIGMVAVDWNKKIGLLACLTLAANTWGISY
                     IIALGWTSSSAAGYTKKLLRNVLFMAGYGIANIISPQIWVEKDGPRFYGAWIAQIVIS
                     WAFSPLILFVIRWILVRRNKERRAWIAEQEAQGKSPVGFVEQIDDDGQVVKVQVDISQ
                     LDLTDLENKYFIYPL"
     gene            complement(<281719..>283477)
                     /locus_tag="TRUGW13939_04951"
                     /db_xref="GeneID:55992449"
     mRNA            complement(join(<281719..282084,282142..282430,
                     282489..>283477))
                     /locus_tag="TRUGW13939_04951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488116.1"
                     /db_xref="GeneID:55992449"
     CDS             complement(join(281719..282084,282142..282430,
                     282489..283477))
                     /locus_tag="TRUGW13939_04951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344009.1"
                     /db_xref="GeneID:55992449"
                     /translation="MALISSLNTWTLIPIAAGLYLAIYIVYYRYLHPLAKYPGPFLAS
                     LTDLWQTYQFMTLQQPYYLTKLHEKHGPIVRYGPDKLSVTHESAIKLIYQTPARLMPK
                     TQFYDAYGAAHPNVFGMRDEAVRREFALENPTYQTNQNTDQLHSIRRRHMSHGFSISY
                     VKEMEQYMDINVKILKEKLYSYAASGRPFDLKKALHLYVVDTLGELAFSQSFNVQKPD
                     DESRAPPVKEHSLLAAVTGSWPAMTSNLKTWLPFVPHKGLQKLFQGRQACADLASECV
                     QARLSVLRNDEKSNDFNTAAKRKDLLTNLILAQHPETGARLTQTDLETEAFGFIIAGT
                     HTTGATASLLFYHLLHDPEAMAKCVAEIKENLPSLEPEQDAYPVAQVEASLPFLRDCM
                     KENFRLTPVFTMPLARRIMDPKGLFIGDSHIPTGRNQTSVAVCNHAFHHNPSVWGPNH
                     DLFDPLRWTSDTSVAEKSRLLMHFGMGGRQCIGKTIAMSNIYKLMSTLLHEFDFDLGS
                     EGEKMDVANGLFRGKIPEMVSVGISDLKDPLMVRVKATV"
     gene            <284356..>286001
                     /locus_tag="TRUGW13939_04952"
                     /db_xref="GeneID:55992450"
     mRNA            join(<284356..284502,284563..285057,285110..285798,
                     285875..>286001)
                     /locus_tag="TRUGW13939_04952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488117.1"
                     /db_xref="GeneID:55992450"
     CDS             join(284356..284502,284563..285057,285110..285798,
                     285875..286001)
                     /locus_tag="TRUGW13939_04952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344010.1"
                     /db_xref="GeneID:55992450"
                     /translation="MKNEFSLDEEARNLSSEYRQYLINRHGTVELDPMPDMNDADPYN
                     WPKWKKVINLILVAFHALMGTFTAAAIQSAFVPISEDLGVSVQRASYLTSLVIAILGG
                     APLFWRPLSDRYGRRPIFLLSLICSLVGNIGCANSYSYGTMGLCRAITAFFISPAAAI
                     GSAVVVETFFKSQRARYMGIWTIMVTLGVPVSPLIFGFVADRVGYRWIYYILAITNSV
                     QFILYLFLGPETRYIRNQNAPSIESTVKGNYFKFKRIDPRPLTINDFIHPLSFVFRPC
                     IFIPAAAYAMIFLWGSIMTTIEIPQLYPVKYGLNTEQVGLQNISIIIGSLIGEQIGGI
                     LSDKWMARGWQQKQEHQSDEPVEPEYRLWLSYIGHALTICGVIVFCVQFEKSSSWNVT
                     PLVGAAIAAAGNQIVTTVNITYAVDCYREEAGSVGVFITFVRQVWGFIGPFWFPEMFE
                     NVGFYGGAGIATALLVAVSVVPTVILQWRGHGWRK"
     gene            complement(<286525..>289663)
                     /locus_tag="TRUGW13939_04953"
                     /db_xref="GeneID:55992451"
     mRNA            complement(join(<286525..286557,286605..287233,
                     287300..289047,289103..289362,289487..>289663))
                     /locus_tag="TRUGW13939_04953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488118.1"
                     /db_xref="GeneID:55992451"
     CDS             complement(join(286525..286557,286605..287233,
                     287300..289047,289103..289362,289487..289663))
                     /locus_tag="TRUGW13939_04953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344011.1"
                     /db_xref="GeneID:55992451"
                     /translation="MSRFNVKYLSDELVEQFFCALLEQRSLVYLIIDGLDECQNEKNM
                     RETLFYVATAPRRGMPDFNLKLNEIGDSSPIDFSDIDDRVRSCDGSFVYAKFLMDTLG
                     GEGITCYADIPKVLHEFPQSLNGYFVRTLLKLCEKSKIERSLVRRTFMFLIGSIQSIT
                     WRELLNALAIEHGATHHCRYHVTSIQKIKELCGSFVVSDRSSEDETCCKVKLFHKTLY
                     DFFLQDMEDLPINTSIGQSEPNKIAYLREFFVNPTDASLEIGLDCLWFLRYDRYKSVS
                     NIKALLDANDERDAFLKYAATFWFQHLYDTSPSKELFRDVCAFLVSSNFWTSVGIQTY
                     TAPHLFCRCKENSGYFKMCLDDPTISEDDGLGVPLPKWLRGSLVGEKLDQDFCSFLSD
                     WHKVLAIYPGVLDQCVSLNKMKSHLGAHPVQSDGIRVFNVGVKSNIGEISDIWTNPPL
                     FYKNGLHVELLCSYRMGLLEEATQQKFYYYRIPIFSKRNPIEQHFELALQRSPLCRKG
                     MSVCYRTKDSKIEMWNLDEFLLRLEQIVDGCSNVSEAPTQWPKSSLKAPWRVAWKDNV
                     VTFHRNVSLFHLFRGHQNTDEDDKFDRDLDDGSDKFSSDDENDSSDSDLGYYSYGNEN
                     SDVETASNFSYDNREDNQYSSWKAATAGTRLVGESIPPLWALFDKYTRDIRGFSYTFH
                     PQFPIVIWSYPGVRALVPSSVCDIDGWRIERLPGDLKSEHAYILFRQLRFSTCGKYLY
                     CLDTSFRLRHEHSCQLTLSTYSFAYGRDPASWLKSCGLAQQVTYRITERLETHPLNET
                     LTYWGEDELVVSLPPLTCRPKLIKFSLYKESSSVVEALGQVEGSAVMKTVQVLREPIY
                     FPSFSGRDPRLMYQAGSSKDHELFLYLTTKPWPMRQPRDGETSAAPPAPVVIRWKISR
                     EGGWRIWDADIDGKEEDLNQEMDLCPYQKWSGLD"
     gene            <290140..>290547
                     /locus_tag="TRUGW13939_04954"
                     /db_xref="GeneID:55992452"
     mRNA            <290140..>290547
                     /locus_tag="TRUGW13939_04954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488119.1"
                     /db_xref="GeneID:55992452"
     CDS             290140..290547
                     /locus_tag="TRUGW13939_04954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344012.1"
                     /db_xref="GeneID:55992452"
                     /translation="MLTTNRVESFDSAMISRIHLSLGYSPPDVDTRRKLWLQLLHSIP
                     SDEIELDLDDDVDGLAIANMNGRQIANTVNTAKTIARFEQKPLQLRHIHTVLDVCAAF
                     DQKLKRPPTADPVRNSHKPFMISRKNSILNDDK"
     gene            <291454..>292779
                     /locus_tag="TRUGW13939_04955"
                     /db_xref="GeneID:55992453"
     mRNA            <291454..>292779
                     /locus_tag="TRUGW13939_04955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488120.1"
                     /db_xref="GeneID:55992453"
     CDS             291454..292779
                     /locus_tag="TRUGW13939_04955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344013.1"
                     /db_xref="GeneID:55992453"
                     /translation="MTERKLHLTAFMRPVSLHTGAWRYPGAYADANFNFEHLKSFIQK
                     LEAAKFDAFFMADHLAVLNMPIEALKRSHTVTSFEPFTLLSALSSVTSKIGLAATAST
                     TYDEPYHIARRFASLDHLSNGRAAWNIVTTGNPEASKNFGKEEHLEHDERYKRAREFY
                     DVVTGLWDSFADDAFIRDQASGIYFDPEKLHVLNHKGDNLQVRGPLNIARPVQGWPVI
                     VQAGQSEPGRQLAAETAEAVFCAPIDIEAAKALYADIKGRATAAGRDRNHLKILPAAF
                     VVIGDTVEDAKAKRLAVDSLVHYESAIASLSVTLGTDASGFDPDGPLPTDLPETNATK
                     TGRESVLRLAAKENLTVRQLAQRQGGYGGLAFVGTPETVAEEMGTWLREEAADGFTVV
                     VPFVPQGIDDVTLRLVPELQRRGLFRNEYEGTTLREHLGLPRPNNKFFP"
     gene            <293456..>293773
                     /locus_tag="TRUGW13939_04956"
                     /db_xref="GeneID:55992454"
     mRNA            <293456..>293773
                     /locus_tag="TRUGW13939_04956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488121.1"
                     /db_xref="GeneID:55992454"
     CDS             293456..293773
                     /locus_tag="TRUGW13939_04956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344014.1"
                     /db_xref="GeneID:55992454"
                     /translation="MGNPVWTNGGAKYAIIWTNATIYDHTCKMLGYVEKPLQDVAIDS
                     QLPWTVVLTLLRPNSQYIEFCYASTCYEGNFWCSTQDEYGTTTFECLHAFTCASMDRL
                     ASG"
     gene            <294967..>295467
                     /locus_tag="TRUGW13939_04957"
                     /db_xref="GeneID:55992455"
     mRNA            <294967..>295467
                     /locus_tag="TRUGW13939_04957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488122.1"
                     /db_xref="GeneID:55992455"
     CDS             294967..295467
                     /locus_tag="TRUGW13939_04957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344015.1"
                     /db_xref="GeneID:55992455"
                     /translation="MARTSIRNNTNISFNFYQSGPGPKRVRRRSSRYYPRRFEQRTAD
                     LEDSINYREQDWPFSFPRNKNPHGPRQKPKKVSPTRSSTELKDDVFGTFAMMEERLNH
                     HRSNFMATQDRCALMLAQIFEEAIPILQSQIDEAASLLAIQDVDMADAPPVLDVDDDG
                     DWCMVL"
     gene            <296812..>298764
                     /locus_tag="TRUGW13939_04958"
                     /db_xref="GeneID:55992456"
     mRNA            join(<296812..297016,297069..297201,297270..297461,
                     297518..297669,297726..297964,298039..298310,
                     298362..>298764)
                     /locus_tag="TRUGW13939_04958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488123.1"
                     /db_xref="GeneID:55992456"
     CDS             join(296812..297016,297069..297201,297270..297461,
                     297518..297669,297726..297964,298039..298310,
                     298362..298764)
                     /locus_tag="TRUGW13939_04958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344016.1"
                     /db_xref="GeneID:55992456"
                     /translation="MAWSSVSLALLGALALFFVYKLVAYFKSAQRPPLPPGPKPQFLV
                     GNLGDLPKPGEQEWTHWLKHKDLYGGISSVTVMGQTLIILHDVRLAFELMEKRSAKHS
                     SRPKQAFAGEMCGWEDSLGLSPYNNRFRLLRKNMSKVLGSQVASARFNPLQEAEAGHF
                     LMRVLNDPDSLTEHIRTQAGSVILKISYGYNTESHRPDPLVQLAGKAMDQFAKAGVPG
                     AWLVDIIPSLKHLPDWVPGTRFKRIAREWKGSLTELTERPYAFVKHQMANGVHEQSFL
                     SQLLQQPIATPEELFTVKCSAMSLFAAGADTTVSSLACFFLAMTLFPEVQRKAQEEID
                     RVIGSGRLPVVADRPNLPYIDAIVKEILRWHPVAPMGLPHMTTEDDICEGYLIPKGAY
                     IMPNVWFFTHDPSVYKDPMVFKPERFLASDEQPFPEPDPHSLSFGFGRRICPGRLLAD
                     TSLYINAAQSLAVFSISKGKNGSGQEINPLVNFEPGVVSHPAAFKAAIKPRSEQHETL
                     IRDIEKTNPWQHSDAKILQNVSC"
     gene            <299620..>301306
                     /locus_tag="TRUGW13939_04959"
                     /db_xref="GeneID:55992457"
     mRNA            join(<299620..299706,299765..299903,299949..300130,
                     300177..300213,300278..300345,300398..300780,
                     300839..300906,300963..>301306)
                     /locus_tag="TRUGW13939_04959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488124.1"
                     /db_xref="GeneID:55992457"
     CDS             join(299620..299706,299765..299903,299949..300130,
                     300177..300213,300278..300345,300398..300780,
                     300839..300906,300963..301306)
                     /locus_tag="TRUGW13939_04959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344017.1"
                     /db_xref="GeneID:55992457"
                     /translation="MKYTFVFLLSALFAAIGQASLLDELPSCAATCFKNSLSTTQCSP
                     QDISCLCADASFQGTVQLCLGSGVCTPKEVLTTTNATSSACGLPAHDIRATVIGIPAT
                     FGSLAIIFVFVRIYARLFINKFFAWDDRFIVAALVFALPLNFLMFPMANSGMGKDIWT
                     IPFKDLTQTLKELYFAEVFYMVSEMFTQLSILAFYLRVFDSRLFRNVALAIGVFVICF
                     GISNTMSMILQCTPVSFFWDGWTGEYVGKCIDINSFSWARAAIEILVDLAIISLPIPL
                     LLRLKLSWNKKLQILSMFSIGFLITLVSILRLESLVRFSKSTNTTYDNAPAIYWSVLE
                     CDIAILCACMPALRIILGAVFPEYFGSSFNSEASPSRESNKKSASRQSGMIMKAGSST
                     SSDPEADPINKSIASWGAVPTGTDDRSRTPSPVEMHSVKTDHA"
     gene            complement(<301767..302313)
                     /locus_tag="TRUGW13939_04960"
                     /db_xref="GeneID:55992458"
     mRNA            complement(join(<301767..302009,302066..302163,
                     302220..302313))
                     /locus_tag="TRUGW13939_04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488125.1"
                     /db_xref="GeneID:55992458"
     CDS             complement(301767..302006)
                     /locus_tag="TRUGW13939_04960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344018.1"
                     /db_xref="GeneID:55992458"
                     /translation="MGWCALSCCGLQWVLQTLKRTDMREQLGTQGSGFGDCCASYWCP
                     CCALMQEEKEMVRKSEIVTHAEYQPPQGMMYPPQQ"
     gene            complement(<304745..>305806)
                     /locus_tag="TRUGW13939_04961"
                     /db_xref="GeneID:55992459"
     mRNA            complement(join(<304745..305190,305270..305487,
                     305558..305684,305740..>305806))
                     /locus_tag="TRUGW13939_04961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488126.1"
                     /db_xref="GeneID:55992459"
     CDS             complement(join(<304745..305190,305270..305487,
                     305558..305684,305740..305806))
                     /locus_tag="TRUGW13939_04961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344019.1"
                     /db_xref="GeneID:55992459"
                     /translation="MTELSITKGDLGDLNKKVAIVTGGASGIGKAIVELLTEHGTIVA
                     FGDTDRAAGAVVELSLKSAGKNAKFIYADVTSWTSQVSFFSQVKQEYGQIDLVFANAG
                     IGEKNTVFTDIFDSDCFLTPPDLTVIDVNLRGVIYTTKLALHHLKQNDPPGGSLVLTG
                     STSSYNERPNLPLYSTAKHGVVGLMRAVRHRAPESNINVGLIAPGGTISNLFPRQAAE
                     AFRTQGVPVNEPGSVALAAAYLASSSETNGQGITIIGNKFTEVEDSITETQHLWYGAY
                     NTDMVRKVAS"
     gene            complement(<306529..>308606)
                     /locus_tag="TRUGW13939_04962"
                     /db_xref="GeneID:55992460"
     mRNA            complement(join(<306529..307410,307474..307571,
                     307630..307725,307776..307933,307990..308235,
                     308287..>308606))
                     /locus_tag="TRUGW13939_04962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488127.1"
                     /db_xref="GeneID:55992460"
     CDS             complement(join(306529..307410,307474..307571,
                     307630..307725,307776..307933,307990..308235,
                     308287..308606))
                     /locus_tag="TRUGW13939_04962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344020.1"
                     /db_xref="GeneID:55992460"
                     /translation="MTKLEYVSSSLGPSPDLGDLDDTLHENEWYRQDFGDFTISEAPI
                     YDKRPIRVICVGAGATGLQLAYKAERLLENITIQIYDKNKDIGGTWLENRYPGCTCDI
                     PSHSYQFTWAKNPCWSHFYSGSAEIWQYFKDVATKYNLERYVKLEHQVLTAKWTEEQG
                     VWELTIKSPTGAIIEDKCEILVNGTGVLNNWKYPSIPGLSSFKGKLMHSSNWDSDYDL
                     TGKTVAVLGGGSSAIQVIPNIQPVVKKLIPFLRSPVWVTTGFGARYAGPGGSNYEYSA
                     EQIQSFKDDPKLYDKYCRSVEGELNKRFTLNHLHSMDQKRSREFVENMMKEQLGHNEK
                     LSGHLIPEFALGCRRMTPGSGYLQSLIKGNVDVVTSGAVKFTENGVVDEAGNEHTVDV
                     IICSTGFDTSFAPPYECIGRNGRNLREKFADFPRGYFSTTVDEFPNLFRKFPRTLPPP
                     GVNKYATVFIGPNGPASHSSLLPILEWHTRYLFKMINKLQRENIKCFDPKPECVEEFA
                     QYTHTMMKRLVWSSACRSWFKNGKAHGPVTAIWPGSRLHYFESLDEPRFEDYFITYRS
                     KNRYQYLGNGYTQEEIKSDGNPVWYFDDPFCKV"
     gene            <309121..>311900
                     /locus_tag="TRUGW13939_04963"
                     /db_xref="GeneID:55992461"
     mRNA            join(<309121..309305,309360..309688,309773..309808,
                     309863..309928,309998..310086,310144..310224,
                     310272..310915,310969..311148,311199..311469,
                     311531..311754,311819..>311900)
                     /locus_tag="TRUGW13939_04963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488128.1"
                     /db_xref="GeneID:55992461"
     CDS             join(309121..309305,309360..309688,309773..309808,
                     309863..309928,309998..310086,310144..310224,
                     310272..310915,310969..311148,311199..311469,
                     311531..311754,311819..311900)
                     /locus_tag="TRUGW13939_04963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344021.1"
                     /db_xref="GeneID:55992461"
                     /translation="MRRTTDSGSVRRRKRAMLACQACHLRKVRCNVTQSGPPCINCAG
                     DGVNCELVARGRGGRRHRLVDIVAQKSQDTAAPIQPNREENRLSLVPCEFSALPSSSH
                     APPTPEESEFQPCQVVDGERLMTAASTTDSPTERSHGRKNDAEPRDVDTGFDCILDDG
                     DGEEATACVYTGDQQGLGLVVDILASPLVSDDSAVLHAKECFSLPNASAFFRQYESGP
                     RNVSLLLLWSMFFASINFLDKESVSLAGYSSRKSMKRSLYRRAKALYDADYEKDKIPL
                     IQSVLLLAFWYADSEDRDGSWHWVGIGISLCQTIGLHRNPLNERAGLGRNFILRKKTF
                     SDDRCRLWRLIWWMYYFRDTWLSFGMGRPTRINLDDCDTPIPTPSDVEALCTGLSRQQ
                     EEKYFPKDPKHMLPRVWACLLDTTFALGAVLNHHYRAKPLELDPSTAFALDENQLRQC
                     RAGFPTEEACQGPVVLLHLYHLHVYYEACVIALHRPYMVERPGTHVTPGEAWKVEALQ
                     KAKIAASNINSTLNKISAAQMISSCHSMMVTAMIPALQVHLLQSISEDPFAKCLARNH
                     LNICMIMLKELRQTYWAADFIHSLFSKARKQIDSLKTAQEDLVTSRDQGSSEQETPMT
                     PPSVASFMNVNSIRAATSRTSLPASASLHPIQDNSFENNVPLDVDLALSYDIFPFQFD
                     LFSIDGDLENPAFHSPSSRHVISEGAPSFELSDVDVSVFLGNEDPS"
     gene            complement(<312020..>313171)
                     /locus_tag="TRUGW13939_04964"
                     /db_xref="GeneID:55992462"
     mRNA            complement(join(<312020..312948,313006..>313171))
                     /locus_tag="TRUGW13939_04964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488129.1"
                     /db_xref="GeneID:55992462"
     CDS             complement(join(312020..312948,313006..313171))
                     /locus_tag="TRUGW13939_04964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344022.1"
                     /db_xref="GeneID:55992462"
                     /translation="MADYSSYGEPSAEWLKFANSGFLKPPPAELTLNERRDYLNESRA
                     KLHDEIYGPFKGDIDIFNIDIPSPDGSPIQTRLYTLTRSPLNRNSPLIIHLHSGGWHL
                     GNLKTEDAFCAYLCTLLAEKHASGYAVLHVNYRHTPEYHFPTQLDDVYTVFEYLADNA
                     ALARSMWGIDSKRIILSGTSSGAHLAVGCAILNVQRMKLSPETQADKRIKGLVLTCPP
                     TVHPDLFPYHLVRNKETSSHVQNANEPLLGMDRTRLFWGLFLSASREEKKAAWSERIT
                     DVLISPLTSKVGVFDARLWPMTCFHVAGMDILRDEGLLFEKKLKSNGVKTRLHVYPGF
                     PHAFNMLPQLEESKRWMVNLVEDILSIPSN"
     gene            <313544..>314643
                     /locus_tag="TRUGW13939_04965"
                     /db_xref="GeneID:55992463"
     mRNA            join(<313544..313715,313784..>314643)
                     /locus_tag="TRUGW13939_04965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488130.1"
                     /db_xref="GeneID:55992463"
     CDS             join(313544..313715,313784..314643)
                     /locus_tag="TRUGW13939_04965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344023.1"
                     /db_xref="GeneID:55992463"
                     /translation="MSSLHQNDSKKIALIGAGTIGLSFAALHLSAAVLPPSRVIIYDP
                     RPDLRRYIEANLPEYLATLTGIEKKADIGSSSNEPQSLSVSFLFDEGRLVTSSSLEEA
                     VSQADIVQEQGPEKISFKQWVWSEIEIYAPSSALFWSSTSGILTSVQSTKMKDKSRLM
                     ILHPYNPPHVMPLLEIAVSAVQLPQYTGLDSTIEYWEKLGRKPVVLKEEVTGFVANRL
                     AFALFREAAYLVERGVARAEDIDFIVQQSLGPRWAVKGPFWNYHAGGGEQLGLEGFFD
                     KIGDTIQACWDSLGDLNIKVSGDEVGSMTGWQERVCKQVIEAYGNLGPKDLRERDKKL
                     QDVLNITMK"
     gene            complement(<314852..>315707)
                     /locus_tag="TRUGW13939_04966"
                     /db_xref="GeneID:55992464"
     mRNA            complement(join(<314852..315050,315124..>315707))
                     /locus_tag="TRUGW13939_04966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488131.1"
                     /db_xref="GeneID:55992464"
     CDS             complement(join(314852..315050,315124..315707))
                     /locus_tag="TRUGW13939_04966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344024.1"
                     /db_xref="GeneID:55992464"
                     /translation="MTSGILNLFRLNDKRALITGANGGIGGAMAVALAEAGASIVILQ
                     IPGDTNTSTKDELIALSAEFSVYDCDLTSVSNIRETVKKIIDEDGIPIDILINCAGVS
                     GHKPILDVDDTFREKVFNVNMTANYVITQEVGRRMIERGKGGKILNVSSLAGMLATKN
                     ISAYAGTKGAVNQFTSAFANEWAEHNIQVNCLCPGYILTSLTRGYFENEPGFKDYIMS
                     RTPMGRWGTPEDFRGITLFFCSKASDYITGVRMPIDGGLHGR"
     gene            <316281..>317587
                     /locus_tag="TRUGW13939_04967"
                     /db_xref="GeneID:55992465"
     mRNA            join(<316281..316483,316551..316662,316719..316857,
                     316914..317217,317271..317344,317412..>317587)
                     /locus_tag="TRUGW13939_04967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488132.1"
                     /db_xref="GeneID:55992465"
     CDS             join(316281..316483,316551..316662,316719..316857,
                     316914..317217,317271..317344,317412..317587)
                     /locus_tag="TRUGW13939_04967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344025.1"
                     /db_xref="GeneID:55992465"
                     /translation="MEVPKFANLPSIPGRPTHCSWDVWNSIYQQKTGKERGKDWIGTL
                     NHLTPEVVAAAAKEIQTGDRVSLNWPLDAYTYVGFARKKLEFNIIDGKEITGGRFLAN
                     DDQISFNTQISTQWDGLCHFGHTGTSLYYNGATHEECQSGRQGRPGSVHEWSNVGGVC
                     GRGVLLDYYAYAQNHGINYSPGDTHAISVSTLDKVAAWEGIDFRPGDILLIRTGWTSW
                     HDSLSGDEAQKTALTRDKHNSAGLLAAEETAEWIWNQRFAAVAADNPALEAWPPAGES
                     QLLHEYLLPTLGCPIGELWDLKKLSAVCAKNKRYTFFLTSAPLNVSGAIATPANAIAI
                     L"
     gene            complement(<320770..>321054)
                     /locus_tag="TRUGW13939_04968"
                     /db_xref="GeneID:55992466"
     mRNA            complement(join(<320770..320888,320961..>321054))
                     /locus_tag="TRUGW13939_04968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488133.1"
                     /db_xref="GeneID:55992466"
     CDS             complement(join(320770..320888,320961..321054))
                     /locus_tag="TRUGW13939_04968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344026.1"
                     /db_xref="GeneID:55992466"
                     /translation="MPQPAEHPVLDHIALRREWDRQLEEAMKQIRERALSHQSNQHHN
                     NPQHAQNRQQTGENQQDVDADSPNSQ"
     gene            complement(<324302..>326067)
                     /locus_tag="TRUGW13939_04969"
                     /db_xref="GeneID:55992467"
     mRNA            complement(join(<324302..325181,325234..325379,
                     325435..325796,325852..325954,326008..>326067))
                     /locus_tag="TRUGW13939_04969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488134.1"
                     /db_xref="GeneID:55992467"
     CDS             complement(join(324302..325181,325234..325379,
                     325435..325796,325852..325954,326008..326067))
                     /locus_tag="TRUGW13939_04969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344027.1"
                     /db_xref="GeneID:55992467"
                     /translation="MGSPININVREGMMPSELQAFLDHRGAWYKHRHLLRLNFILLVP
                     LVSTGAVGFDGAMMNGLQTLPQWRTYFNNPSGTLLGIMNAIYPTGKIIGILAASFLCD
                     RFGRKLPMWLGLPTMVVGAAIQGSALNLGMFMTARFILGFGNSLVTLPTPILIAELAY
                     PTHRGKMTAMYNTFYYVGAIMAAWITYGTFKLPDERSWRIPSILQASIPFIQLCFCAF
                     VPESPRWLIAHDQSEKALQILAKHHAANDKSAQLIAFEMAEIRENIQFERSVNAQQLS
                     YMDLFRTAANRRRAYIAVTCGIFVQWAGNGVVSYYLTLVLDTIGITAVSSQTLINGLL
                     QVFNWFAAVLGGALMVDRMGRRTLFLVSAIGMLCSYIAWTVLTSVFVRTLNQNAGHGV
                     VAFIFIYYLFYDIAWTPLMPAYPVEIWQYTMRSRGVTFSLVVNYAGLILGQFVNPIAM
                     KNIGWKYYIVFCCLLAVLVILIYFLFPETKGRTLEEISEIFDGTTTVAGAARRRPMLG
                     HPEQKPME"
     gene            <327535..>329154
                     /locus_tag="TRUGW13939_04970"
                     /db_xref="GeneID:55992468"
     mRNA            <327535..>329154
                     /locus_tag="TRUGW13939_04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488135.1"
                     /db_xref="GeneID:55992468"
     CDS             327535..329154
                     /locus_tag="TRUGW13939_04970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344028.1"
                     /db_xref="GeneID:55992468"
                     /translation="MLTFSPDCTLPEGTVNYVSSPDIRGTLDVLWSCLSILLLCTWTV
                     QHLNVPFKRNPPTKLAQLLQELLLVGEKAFWMLINLIFPEWMFGKALLDLVSARYCHK
                     AMEPYAENDGREWTLSHSFFANIGGFAIVFSDDTPVQSEVKADGSDDATTENSSLEGT
                     NPTELECPDLLSGQIPLVHRQMSGNRNYLTRFERPSPSDDNIWKPNAKNYALANQAIA
                     NATQSVLFSRFNACCRNIVSLQGNVWILDAAQLTKARKFGIIDTLPDVTEEQIMNQTK
                     GDTIVKALALGQSLWMIIQVIGRRATGLNSSQLEIMAVAFSVVAFLTYLCLLSKPQGI
                     ACVTPIHASRYASVEELLEIGLVGPESFLQLPRTPYIGNHYLPQYGPQNGMLSRATVT
                     VVGGVGGLVFGAIHCAAWSYQFPTETERLLWRISSVVACAIPAITTLAAARQWPAILL
                     ALVKQKPPPAPKTNNKSGHFLDHFAAKTKDVPIVYILLLGTYGSIVTLATVVYAASRL
                     YLIVESFRSLGFLPPSVFSTVNWSISIPHVE"
     gene            <329479..>334771
                     /locus_tag="TRUGW13939_04971"
                     /db_xref="GeneID:55992469"
     mRNA            join(<329479..329545,329754..331196,331248..>334771)
                     /locus_tag="TRUGW13939_04971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488136.1"
                     /db_xref="GeneID:55992469"
     CDS             join(329479..329545,329754..331196,331248..334771)
                     /locus_tag="TRUGW13939_04971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344029.1"
                     /db_xref="GeneID:55992469"
                     /translation="MAGAIKDLVELLLTEIAIQGTDGASLVQIWEWVLSFYRAEISNP
                     SEFQLDHALKEDLWQWLTLNPEISVGRDRQYNNLTLSQVEAGDTQAPDLRFFVSEDRT
                     WRALTGHERDDTRVPASEFDLLSIIASCRAEGILQTDLVRRSGQDSRSVPKRTDALHT
                     KGYIEKRPVQARSAKTSLCVFSRFARSASVTAVPVAPTGSQESAFVLDIDAFAQSIFR
                     VLKQHQIISRNDLKEELGLKDHWRWRNLSKAVRKFEAIGCLRRVRARSQFHDTMKAFH
                     PCILLVREPTDADMKLFKSDYKTLFSSMDQESADQDAEDLEEPSELQTLEHVGIRWTP
                     DISVPNLIVDIIDRSGTAGRTNAQIIKEGFGRIFRRPSENTLSRLTEGWQLSQPPHLR
                     HSAVVRDTAQSGTVTHFVHYIYPSFKVLVDRGQADWEAVTFRPRDARSSKLVMPAPDA
                     PSNTDKDGLAPFKGPRGKTTERDFYCVVASKGISSYSVTKSDPVATVKEDGQFAASFQ
                     REYGRTFDTEIIQEPRETSPVVEEVPQDDDAPSFQRIPASNRLGKLSKSDKIEAELAK
                     GARPAREVFAAFGLDDSWTHVAVRLMERPGAGVFVTAKGKARPAGKKQGRPKESRIAV
                     FKSTVLVEFLKATAPPVEEPVEIEPPTVTAAPDTITQPAPIPAEESSNVPSDRRGSTD
                     TQPQTLESSAVPADVMDIADQTVTPAESEQPGLSERVDQTQTAQLPRDTPVEETTAGA
                     ISSTTATPARAAETPLSEDIKPTAPLSQPRIAFPKSRRSDKDGSVARLRRSIIMTLIE
                     QAGGAFPSSSELWHAFASVWIRQHNHSETPDSRTVKGAVKYLVDAGKLRQLTFSGRTP
                     KGEMVTRSIVMKTDLDPSDPLVMSLQDAILKSNYYVPKNIDLDPNIAKIVRGGSSAAV
                     SATYPKVTPVEPSITVQLKNKPAFVVALEKRREESLQKRLQQPVRLMGLQRKGKASNS
                     KGITSFARPKTKKRRRVDSMSSQQGREEGTDYELPRAPMETTLLKHRLSQPLDRALAE
                     VKRQKRESLGTESPYRRFVGEIDYVSQWERINQNANQLEIPPFSDPYQYTDNLSYVHH
                     TIDEPFEQAPIDGMIQFDVDGAPRRRFRRTTAVKARRQRRPAVAKTTPSQESQAQVSN
                     EPEEYEMPLEYMVSQDYEPFVGPPPEDVSTLLDPQLQEATSPQVVDPTKPPMARRRRK
                     GLRELGPRFIERLRYAIVVVRTVAGGPYGKMVDWEHVVRAFPLEDSGLVRQNGKLLLN
                     RDRRQLAQMQEDIRDILLEEYRKPNCSLPSVDFNHLENYDWDALTTWAATQYYSPSAR
                     EVPNLPGSRAQFDRLHEYRVFQPNDQFESIYTQNPSITIAKREGMYSARPFVHTTSKR
                     KKLDGQRKRDEMDTAKSWILSNIIAKDQTYNPVEAKEKLSAFSIDVMDECVKEFVRDR
                     VIMQENRGRVIPGRNYSLTENFYHTFGRRRAVDIDMLKQAAKTKQDLDADFKRDGFSQ
                     FKYTAVDGEALAILALAADGRVHIHPSNPPSDPTGLTEGNYETRALDKAKFKFDMVVA
                     PDSQRYEYGNPVRDVISSHPIPVMEHDKTDQPTLLKKPPLWVDINGNVNHDMWQSVVA
                     SVVGILAVRTNIPAQGIREQLQGYLAIWDVERTLSWLEGVGLASKVDRQEGDAVWKAR
                     GYWWLVLNS"
     gene            complement(<335017..>335940)
                     /locus_tag="TRUGW13939_04972"
                     /db_xref="GeneID:55992470"
     mRNA            complement(<335017..>335940)
                     /locus_tag="TRUGW13939_04972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488137.1"
                     /db_xref="GeneID:55992470"
     CDS             complement(335017..335940)
                     /locus_tag="TRUGW13939_04972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344030.1"
                     /db_xref="GeneID:55992470"
                     /translation="MSPTIRRLMKEAAELSASSSSPSPHFCAHPVSDSNLFDWHFTMA
                     GPPAPSPYASGIYHGRIVLPPTYPLRPPSFRFLTPSGRFEVNREICLSISGHHEESWQ
                     PAWGIRTALTAIRSFMDGDAKGQLGGLDATDEVRKMWAERSRSWSCDCMEGKTNEQFL
                     NEWREVCLEKGVSVDDEGRETVPEELRMSYKKQSEEAKTKSEQTEEAVSSEATPEQQF
                     QEPIIPVPQETSTPAEPERPAQPAQSVPQPTPTRTTTTTTITTTTNTIQTTTPANPSP
                     QDNPWLDRAIVGVVIALLFMIMRRMAAADDL"
     gene            <336510..>337442
                     /locus_tag="TRUGW13939_04973"
                     /db_xref="GeneID:55992471"
     mRNA            join(<336510..336849,336917..337251,337302..>337442)
                     /locus_tag="TRUGW13939_04973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488138.1"
                     /db_xref="GeneID:55992471"
     CDS             join(336510..336849,336917..337251,337302..337442)
                     /locus_tag="TRUGW13939_04973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344031.1"
                     /db_xref="GeneID:55992471"
                     /translation="MAPDTFQFILHDAERPESQQQARAHAARVAHSRKRQFRLIEYHA
                     GKKNKSRKKDKTAARHKKPAESRPSSLEIAIAEDLLIPSPVSQLASDRTDPFVSSARS
                     FTQDEHFLFDYFIQTILPDESARCGFALAMTADKWSQLVEKEWMPFALSQLDALDSFF
                     MHACRHFLVFQHQQHRPDRQRHFMQLATRYKLACLRAVNEAISAGFSVSINNATVATV
                     VLLGFDEMALGDMALSKSHAQGALQIIEHNGGFQTLGMNGFLESLFYKLWGGT"
     gene            <337926..>339026
                     /locus_tag="TRUGW13939_04974"
                     /db_xref="GeneID:55992472"
     mRNA            join(<337926..338655,338716..>339026)
                     /locus_tag="TRUGW13939_04974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488139.1"
                     /db_xref="GeneID:55992472"
     CDS             join(337926..338655,338716..339026)
                     /locus_tag="TRUGW13939_04974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344032.1"
                     /db_xref="GeneID:55992472"
                     /translation="MSTPQTTLPKGSWILITGANGYVASHTAKQFLERGYKVRGTVRD
                     LSKSSWLIEDIFKGYADSGDFEIVQVADLAVEHAFDDAVRGMSAVVHVASIATFDPNP
                     HNSIPQVVLGVTSLLDSSLKEPSVKEFVYTSSIAAKVMPAPENTTHIGPDTWNETAVQ
                     LAWAPPPYDDPARGFIAYMAGKTEAEKALWKFVADKKPPFTVNSIYPGAILGESFAKK
                     HCETPYAWIKVIYDGKREALAGTPATISNDVKDCALLHVAAVLDPEVKNAQLPGWGQH
                     CNWNDILAIMRRLYPEREFIDDLPGMSKQQLTTDCSQALALLEKWGGQKGWKSLEETV
                     ADNMKSILKFYS"
     gene            complement(<339191..>340880)
                     /locus_tag="TRUGW13939_04975"
                     /db_xref="GeneID:55992473"
     mRNA            complement(join(<339191..340638,340694..>340880))
                     /locus_tag="TRUGW13939_04975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488140.1"
                     /db_xref="GeneID:55992473"
     CDS             complement(join(339191..340638,340694..340880))
                     /locus_tag="TRUGW13939_04975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344033.1"
                     /db_xref="GeneID:55992473"
                     /translation="MATLGSPEISPKRRPRTWARRIERLCVTVCGYVPLVFVYGLTSW
                     AVWVEAGIGFLPNKSNWIGFPSSALGITLYILLNLSYTVAVFTDPGSPLTSSTRSSGR
                     GQYSHLPTTELPEYQSFTVNSHGGARYCKKCQCSKPDRAHHCSSCKRCVLKMDHHCPW
                     LATCVGLWNYKAFLLFLIYTSIFCWVCFGTASLWVWQEVLTEMTYIETLMPVNVILLA
                     IVGGIIGLVLTGFTAWHISLALRNLTTIESLEKTRYLSPLRKALDRQRSENLSNNDPT
                     SRESSFSHRLQGYGQQIIEAHANAIPGVTRVEEGEERQSPVADNRGSHQQDYMSFLQE
                     SNSHGTPAQQALHRSYEEMENQRERDRYEDYLDSRDNEAMPSPFDHGWRQNLRHLFGE
                     NVFLWGLPICNTSGDGWYWEPSIRFLEARDRIRKNREDEWSQWLERQRQQSHEYWTSS
                     TGQRQPATTRPVSIQRNIHTGSLGGSLDRPSTGVSMKTLRPMSPRFPDDDSDDDLSDD
                     EEARPKQLSRQGSKAERVLGIIRDDSTPRDDWRNWD"
     gene            <341997..>343650
                     /locus_tag="TRUGW13939_04976"
                     /db_xref="GeneID:55992474"
     mRNA            join(<341997..342483,342540..343537,343600..>343650)
                     /locus_tag="TRUGW13939_04976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488141.1"
                     /db_xref="GeneID:55992474"
     CDS             join(341997..342483,342540..343537,343600..343650)
                     /locus_tag="TRUGW13939_04976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344034.1"
                     /db_xref="GeneID:55992474"
                     /translation="MAANQYFNSFQPQASHHDQLPTYSDDGFPQHPQTASTKPLPEGP
                     PHSPTLSAYDSHNGPYGRRHSQASFTDETAFMGGRNHPNDQYGEDIPLKPNVQQSQDP
                     HWMNQNTAYNSDMPMDPDMSQRKRRGRPAKRGFFKGKIPWVTYLLTIIDIGVFVGELI
                     YSAKLTGSPIEIHPTFNPMVGPSPYVQINMGARFVPCMKNVPGIQNASIPLPWSCPNT
                     TTSDSNAASNQCTLSELCGFSGVPNPKANGSIDDRPEPNQWFRFIIPMFMHAGLVHIG
                     FNMLMQMSMGADMERTIGWWRYALVYFASGIFGFVLGGNYAAQIISSTGASGALFGIL
                     ALFLLDLLYTWRERRSPWVELVFLILEIAISFVLGLLPGLDNFSHIGGFIMGLAMGLC
                     MMRSPNYIRERIGLERMPYVEMSGGAGPPRPENRSNSKVEDNDEFKYNKPLSFFKGRK
                     PLWWAWWLVRVGSLVAVIIGFILLITNFYKYPKSNCSWCYHLSCLPVKNWCSIGNLNL
                     TTS"
     gene            complement(<344377..>344829)
                     /locus_tag="TRUGW13939_04977"
                     /db_xref="GeneID:55992475"
     mRNA            complement(<344377..>344829)
                     /locus_tag="TRUGW13939_04977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488142.1"
                     /db_xref="GeneID:55992475"
     CDS             complement(344377..344829)
                     /locus_tag="TRUGW13939_04977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344035.1"
                     /db_xref="GeneID:55992475"
                     /translation="MSTDMSAFYTPTTPTPTHVSSQCSHSPPIVDELISKYSSSMAAA
                     NNTPTLSYSKQHRNLTLRLVDWICLEYYRYEVTFGVYVMSPGEKFVANTLVLFSLSLL
                     LWTSLLHLPPLLLSKVGRLLWLLTGHSEHATGLFADYISAVATSRRAS"
     gene            complement(<345444..>347845)
                     /locus_tag="TRUGW13939_04978"
                     /db_xref="GeneID:55992476"
     mRNA            complement(join(<345444..346774,346826..347055,
                     347403..>347845))
                     /locus_tag="TRUGW13939_04978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488143.1"
                     /db_xref="GeneID:55992476"
     CDS             complement(join(345444..346774,346826..347055,
                     347403..347845))
                     /locus_tag="TRUGW13939_04978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344036.1"
                     /db_xref="GeneID:55992476"
                     /translation="MNFISRLFKKASHVESKWLPGPVGDMLRSAGIATTTTVPLSTKL
                     VTTTTHVGLDLTTGELVTSSLEDEFTAILVCLDAALQNAGVKGGLGDAHKITAYLLDP
                     ADEPTLQKIFRERYPGNSPAWGTVIVPAIVVPNMRAEVQAEAMILRSFVTEPYPGTMA
                     YEAKPSADGYTYTKKTGLVGGLHTYGVIQPEYRVRKTDNDIPWEAIVIGAGYAGLTAA
                     RDLVKAGKKTLLLEARDRVGGRTWSAEVDGTTFEMGGTWVSHVHGRLFAEMERYGLKD
                     EISMTRTENGGCDYFTLDTGSGSRKFTHKEAGEMTARAWRIFINIDGNNGRDICPLPY
                     STLGNSRVSADKVKAVDQLSCRDRIEQIKDQLTADELALLESLVPHCGGGSVEDIGFL
                     EMLRAQALGSYDISTFEEIWTLYKIREGQSTLARCIFDDAVRLGLQYSFKSPIKSISE
                     REGIVSVISTSNKTYSAQRVVNTIPIAVLPDIHFDPPLSPLRQEAIKINQVDYLTKIH
                     AEVEGDLRGLRGCTWPGDFLYIYGDGFCAGGKSTRITSFAGDNRGKLDPLKEPERLET
                     ALRRFHPMEIKKVVFHDWVSDPYAKAGAAWYRAGFLTKYLAELQKRHGNVLMANADWA
                     HGWKGFIEGAVEQGALAADTVLNELGVLGANAALGEYQSESGL"
     gene            <348409..>349389
                     /locus_tag="TRUGW13939_04979"
                     /db_xref="GeneID:55992477"
     mRNA            <348409..>349389
                     /locus_tag="TRUGW13939_04979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488144.1"
                     /db_xref="GeneID:55992477"
     CDS             348409..349389
                     /locus_tag="TRUGW13939_04979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344037.1"
                     /db_xref="GeneID:55992477"
                     /translation="MTTSPATSIRLPLYDSEITAVEDTQHRPIPSSLCELRRLRKEEP
                     SQDDKIYNDPQIVIEEISVAGAQGPLHAILLTRKSRLTISKLRPGVLFFHGGGRVMGN
                     VYVGLAAVSELVKDLDAVIVSVAYRLSPEASGTDAVEDCYASLVWMSENLSTFNVDPA
                     RFMIAGVSAGAGLAAGTVLLSRDRNGPRVCAQMLACPMLDDRLITLSAQQFENGRGFY
                     TAWGRYAWKCVLGEDAKTGNVNQYVAPGRAEDLSHLPPAYIDAGSGEPFRDEDIAYAR
                     KLWECGVQADLHIWGGGCHGFDLFYPTEIGAQAIQTRDAWMRRTLREKTG"
     gene            complement(<350046..>352101)
                     /locus_tag="TRUGW13939_04980"
                     /db_xref="GeneID:55992478"
     mRNA            complement(join(<350046..350564,350633..350691,
                     350751..350809,350862..351042,351097..351330,
                     351387..351508,351567..351676,351733..351855,
                     351907..>352101))
                     /locus_tag="TRUGW13939_04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488145.1"
                     /db_xref="GeneID:55992478"
     CDS             complement(join(350046..350564,350633..350691,
                     350751..350809,350862..351042,351097..351330,
                     351387..351508,351567..351676,351733..351855,
                     351907..352101))
                     /locus_tag="TRUGW13939_04980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344038.1"
                     /db_xref="GeneID:55992478"
                     /translation="MQDIEKSNSTAKDVDGDHESVAVGVDIDDAILRANGHKPELKRQ
                     FSWISALGLGFSITNSWAGYLSCFGQSLAYGGPQVILLGLVVAFVVQFTITLGLSEIA
                     SAFPSTGGQYHFCWILSPEKSRRFAAYIIGWMSILAWWIVTCSGISLAASTLYGMIHF
                     VKPEFLATNWVVYLFYVAVSVITVVPVFVTSKRLGWLVQTSLVLSVIGMVLVLFVPVG
                     MHQHVNKSSYLVQSGMGTSGWGSGTAWILGISNCMYAFGGTDGAIHISEEMTQPGRRV
                     PQVIIMTLIIGLGTSLPLFIALMYFMTDADAVMNSPLPSMELVFQATGNRKATICLTS
                     LLLVVYILALPSQWVTSGRIAWAFARDNGVPFSKYFSKIDQRLEFPVRTTGVAFIFVL
                     LYGLLYLASTTAFNSIINSAVLFLNITYAVPQGILLFQGRKQHLPPRYLDLGIFGYLC
                     NGFSVLWIVVLGVAVCMPPSLPVSTATMNYISVIVVGLFLIIMLLWLVDGNVNFEGPH
                     IDWDLIKEANTHTLKDPPPRSSSKV"
     gene            complement(<353534..>355370)
                     /locus_tag="TRUGW13939_04981"
                     /db_xref="GeneID:55992479"
     mRNA            complement(join(<353534..353563,353611..353783,
                     353844..354247,354299..354432,354487..354794,
                     354859..355233,355319..>355370))
                     /locus_tag="TRUGW13939_04981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488146.1"
                     /db_xref="GeneID:55992479"
     CDS             complement(join(353534..353563,353611..353783,
                     353844..354247,354299..354432,354487..354794,
                     354859..355233,355319..355370))
                     /locus_tag="TRUGW13939_04981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344039.1"
                     /db_xref="GeneID:55992479"
                     /translation="MASDISPSLKRPTARRKDPACGTCRKKCRKCDRKRPICDRCRTR
                     GLHCEGYPPRFQFCETVTAPVPSASPSGSLVAPEAPTKASTVDSISSQASLSPDHALR
                     NFTTSGSPPPSSPAYSPSSCLAGAPDFNQDISSNRRLIEYFDQFLSEYLTIHVQGTNN
                     PFREHVLPLVYQHQSILHALLGLSACHMHISGRNESQHFVTISLQYRVSALHSLGALL
                     LQEEATGLTNSEEECVLGTVLLLVLHDVCETGISSHGTHLTGVAFLCKRLACPADFST
                     RSKASMFFISALSWLDMLRGFSGAEKLAYSGDVRKCVRDHGSLSLHALVGCPPVLFHR
                     IGQVLEAGKSYLAGDLSIDQFQELLTKAEKFFRGWDPDLAIYPTGHKEWRHLAEAYRH
                     ACLLRVLRFPDAFVISCDDSRIKASVTAIFDVSGADTSSPHQMHYASWCIGEIKHATG
                     FQHPAMTEILTKVWEERGTHLNGWYNVPWMEFITLRHVPTC"
     gene            <355982..>356703
                     /locus_tag="TRUGW13939_04982"
                     /db_xref="GeneID:55992480"
     mRNA            join(<355982..356082,356139..>356703)
                     /locus_tag="TRUGW13939_04982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488147.1"
                     /db_xref="GeneID:55992480"
     CDS             join(355982..356082,356139..356703)
                     /locus_tag="TRUGW13939_04982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344040.1"
                     /db_xref="GeneID:55992480"
                     /translation="MASKAKDPAEMEKASRFAHVPRCEEYDKMISGMLYDSFVPELES
                     ARLKVRIFMHKYNTWFPGGDNVTMETLASERFHLLQIQLGQIGEESYIEPPLNVDYGC
                     NLSIGKRFYSNFGLTILDSAIVTIGDRVMFGPNVMISTATHEIEVASRRDNIEFAKPV
                     TIGDDCWIGGGVIILAGVTIGDGCTIGAGAVVTRDIPGWSVAVGTPAKVIKKVEKLPP
                     VDN"
     gene            complement(<357052..>357955)
                     /locus_tag="TRUGW13939_04983"
                     /db_xref="GeneID:55992481"
     mRNA            complement(join(<357052..357535,357599..357835,
                     357894..>357955))
                     /locus_tag="TRUGW13939_04983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488148.1"
                     /db_xref="GeneID:55992481"
     CDS             complement(join(357052..357535,357599..357835,
                     357894..357955))
                     /locus_tag="TRUGW13939_04983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344041.1"
                     /db_xref="GeneID:55992481"
                     /translation="MPDFKGLDLTGKTAIVTGASRGIGAAIAIQLGQRGANVVVNYTN
                     DKSERKATEVVNKIEAAGSRATLCQASVANVNDIPKIVDAALRLSQTGKIDILIHNAA
                     LGVDANLEDVTQELFQTHFDTNVKGPIFLTKAVIRHISRGGRVVFVSSAAARLGVAGQ
                     TVYGATKAANESCARVWAKELGQSHGITVNCVNPGPVATDQWQESDEQFRQDMQPLIE
                     STPAAARIAEVDDIAPLVAFLCSEDARWTTGSVLCANGGLYN"
     gene            <358458..>360570
                     /locus_tag="TRUGW13939_04984"
                     /db_xref="GeneID:55992482"
     mRNA            join(<358458..358864,358919..360348,360407..>360570)
                     /locus_tag="TRUGW13939_04984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488149.1"
                     /db_xref="GeneID:55992482"
     CDS             join(358458..358864,358919..360348,360407..360570)
                     /locus_tag="TRUGW13939_04984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344042.1"
                     /db_xref="GeneID:55992482"
                     /translation="MPAYASKSSPHPLDPLTVDEVQTVAQTVQKDIGCAANDIRFKVI
                     DLAEPPKAVTLKYLRHNGPAPDRKARIYYHRKRSQSLLVAIVNISKRRIENNYDCPDS
                     QGPVDWEEFELVNRACNNHPEVKAEVAKLKLPPNARILNEPWAFGTDDASERRRLFQC
                     YMYVALTDDPEANHYSLPIPLAPIFDAHTLELVELQRLPMGTGDELDPETQAWDPVKP
                     VEYSAGIMGENAFRKDLKPLQVVQPEGPSFKVLGRRVEWQKWSFQLGWTMREGPVLHD
                     VQYDGRPLFYRVSMSEMTVPYGDPRSPYHRKQAFDLGDSGFGLTSNSLSLGCDCLGHI
                     AYFSGIRVTGHGKPVVMPNVVCMHEIDDGIGWKHTNFRNNKTSVVRNRQLVVQCTATV
                     ANYEYILAFVLDQAANIHIEVRATGIVSTMPIRQGLQVPWGTVVAPGVLAVNHQHIFC
                     ARVDPILDDDRQNTIAYDECHPVFNEPDLDPYGCAFRVNTTSIDKPGGYELDFTKNRT
                     FKIINEARTNATSGQPHGYKLHAVPSQMLMMGPNTFNFRRGIFTSKAIWVTKYQDDEL
                     WAAGEFTNQSQEDTGLAVWANRGENVRNEDVVLWHSFGVTHVTRPEDFPVMPVEKFVM
                     SLKPSSFFELNPSNDVPRSNQSANQSTLHTVSPESCCRSSHI"
     gene            <361067..>363064
                     /locus_tag="TRUGW13939_04985"
                     /db_xref="GeneID:55992483"
     mRNA            join(<361067..361948,361997..>363064)
                     /locus_tag="TRUGW13939_04985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488150.1"
                     /db_xref="GeneID:55992483"
     CDS             join(361067..361948,361997..363064)
                     /locus_tag="TRUGW13939_04985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344043.1"
                     /db_xref="GeneID:55992483"
                     /translation="MTAEEDPLVSALPPATDYLTYLTLLEYQLTPERLPTLHRLLQDE
                     VLTTNIGWDLVQLLLPMLPQSQECLQDIARLGNPREVILRVSDSLMKLEPEDEDNQVD
                     EGEEVAVPGEDFDRGLPQHVMKFNSLIAMLSVLHSRIKTKYPSRFIATSLQAALEAYG
                     SMPTDETTNALLEFLRDLSPTKRPALPPRGTSDSSLVRVLQASAPDPEATYDEPAASD
                     DQAIQLKLVQFALVELLKSYMLSLSTAEDSGMAWALRLQEKLSPKEGRSTDKLSKNNI
                     HSQTEHLKERDLVIGRICALSRDLGIKDEDLVKIATLPAEDHPPPLDFDEPPKTAEEI
                     PLQRHGALLLLAARSAANVLWPGAATARVPVYPDLAVIFSNFIGNAAAEEQPQALHDA
                     LLAITAMSLHDQVEKPTDETQYSDFVLSVTTSSSRQIYNSLRKIPATIARSHPDEVTR
                     FKLIRRILEKEELVYARETAIGWLKDEILNAPEPSTIFHDPHYFSVLFPIMFNVAELE
                     SLADPSSNVVVPFLRFTQTVAPYTHAALSLYYILLSSTQLRDKLELGKTQHAFQTKFL
                     PRLKSTYGAFEDDLPQNGGDGQIEAAIGEDMCHSGMARSVGLLSHVIEQVEEKLGELY
                     AHDEAGDSGQADLAKVEKVKAATAV"
     gene            complement(<363762..>364320)
                     /locus_tag="TRUGW13939_04986"
                     /db_xref="GeneID:55992484"
     mRNA            complement(join(<363762..363994,364056..>364320))
                     /locus_tag="TRUGW13939_04986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488151.1"
                     /db_xref="GeneID:55992484"
     CDS             complement(join(<363762..363994,364056..364320))
                     /locus_tag="TRUGW13939_04986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344044.1"
                     /db_xref="GeneID:55992484"
                     /translation="MGKRKRASCGVSTPVRLTKDRISSCEAIIGYSFINIALLIQALN
                     MSTASVRFEDSWIHVPKNDRLAVYGNSVAESYLCRMWMKRALTKGQWTEIRSSVLGNK
                     NLTRVGFENGLDDCVKLNGGTMSVSANSMATTVEAIMGAVHLDGGDAALATAMMELGL
                     TEHEYL"
     gene            complement(<366067..>370024)
                     /locus_tag="TRUGW13939_04987"
                     /db_xref="GeneID:55992485"
     mRNA            complement(join(<366067..366750,366801..369184,
                     369237..369380,369433..>370024))
                     /locus_tag="TRUGW13939_04987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488152.1"
                     /db_xref="GeneID:55992485"
     CDS             complement(join(366067..366750,366801..369184,
                     369237..369380,369433..370024))
                     /locus_tag="TRUGW13939_04987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344045.1"
                     /db_xref="GeneID:55992485"
                     /translation="MSGGDNPLAYGRYYGESDNTQGGERGLSDSARGLLSDGLKKFKG
                     HYSQGQQQQNYNYGAGTGPSQSGSYDQQQPQQQQQQQQQPQQQHQYQQQPQQYQDPNR
                     PPRQDKLSGFLGKFQDTVSDVGSQLAQKIGTTLDADGYSQYGSSSNNNPNNAQRFKSF
                     APPRENNDVKWHVDGFSYFWAVSRALESAKESIWILDWWLSPELYLRRPPAKNEQYRL
                     DRMLQAAAQRGVRVNIIVYKEVEKALTLSSEHTKHSLEALHPNILVFRHPDHLPDTNE
                     IKNSLAASFQNLSFDGASLSKLPSDTVKAFYGTKGDTVLFWAHHEKLCLIDGKIAFMG
                     GLDLCFGRWDTNQHAIADVHAADLREIVFPGQDYNNARVLDFQDVSHWEQNQLDRKAT
                     GRMGWSDISISLRGPAVEDLRRHFVDRWNYIFDTKYYARNETKYQKLSLYRQSGYGNQ
                     PGNAPPGNAPGNAPPGAPVPPVAATQQSQHPQPPNQGQLSQDPHWQQSQHPQWQGQQS
                     TAQQSYPPPPIQGQSQGQQQQPQWQGQQGQQSPAAQSYPPPPGQQQQSQQPQWQGQQQ
                     GQQSPATPGYPPPPASQPQQQEQPQWQGQSSTTQSYPPPPSQGQQQQPQWQGQQSPAT
                     QSYPPPPDSHGQQQQQWQGQQHDSSTSTPQSGQYFPPPPPGPPPSTGTEYTSQDPSHQ
                     GYGSSQYGSHTQTPTQAPYFAPPPTQGTQESQQSQSRGVYEEGDLSRGYGSNLPGYST
                     EYQGNGRSTSQNFLTDVRGLGHSLRGQLAGQVHQYQDKYITNLGRPAGTQLCQVVRSC
                     SQWSAGIQTEHSIQDAYIAAIHNSQHFVYIENQFFITATGDDQKPVQNKIGAAIVERV
                     LRAARAGQKYKIIVVIPAVPGFAGDLRDDSSLSTRAIMEFQYNSINRGGHSIMELIAK
                     EGFNPMEYIRFYNLRNYDRINTNSTMLQAEKASGVSYEDARRYHDVAEVGSGGYGPGA
                     PAKAFDTTQPYDQYQKAATAYPSATSGRWDSVSECYMLGGEDIRKVPWDSDLPEIDAF
                     VSEELYVHSKVLISDDRIAIVGSANLNDRSQLGSHDSEIALVIEDPTPLDSQMDGKQW
                     QASRFAASLRRELSRKHLGLLKPQDYTRPNANCEPVGVPNEADLNSPESQVVADPLSS
                     TFQSLWNSRARTNTEVFRKVFNPVPDDYVRNWDAYKEFYEYNFRKADVEAEGKRVTRP
                     GRYEWGHVVRDNFAPGPEGAQQVKELLSQVKGTLVEMPLMFLIEEDIAKEGLTLNALT
                     EEVYT"
     gene            <370653..>372654
                     /locus_tag="TRUGW13939_04988"
                     /db_xref="GeneID:55992486"
     mRNA            join(<370653..370676,370727..371166,371234..371252,
                     371427..371732,371789..372405,372456..>372654)
                     /locus_tag="TRUGW13939_04988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488153.1"
                     /db_xref="GeneID:55992486"
     CDS             join(370653..370676,370727..371166,371234..371252,
                     371427..371732,371789..372405,372456..372654)
                     /locus_tag="TRUGW13939_04988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344046.1"
                     /db_xref="GeneID:55992486"
                     /translation="MSNLATLDASQHPNLPQSAQTLFTAKAQKQLSFEEIAKQIGRNE
                     VATAAIFYGQAKASPEDIASLSTVLDVPQGVLEQQLGGFPDRGRSVEMPPREPLIYRL
                     YEIIQNYGYAYKAVLNEKFGDGIMSAISFSTKVEKETDADGNNWAVITLRGKWVRWNG
                     MTTLPHFIGAQLTGKMAAPAAADPAAAALFHCTYADCSLSFDDEEDRAAHKDMEHDYC
                     LRCNVDFPNYETLLKHKIESVKHVVCPICGGEFSTVSGRDQHVLRSHPIDHEIKCPFG
                     RCDKEFKNPSGYISHIEKGKCVSGVNKQTILVRRDMKAMESDMAYRAIQGTFHGPIGQ
                     STEQDADSDGDGGVSVVQDETHLSLIHQPREDDGNKAQAMKFWPPLGADTKELPADGV
                     ALTKRAIEKAAVQPSFRPTPVIPRSGALKVYKTFIPRFSENQYLNQASGKFECCKQEF
                     ATGDQLATHLLSHRAQRFICPMCRKSMQSVTALVSHAENSQKCGLSRRSDASAIMAII
                     TGGLVTADRWIDEDHYNLKYEAATHF"
     gene            complement(<372921..>373275)
                     /locus_tag="TRUGW13939_04989"
                     /db_xref="GeneID:55992487"
     mRNA            complement(join(<372921..372966,373023..373090,
                     373144..>373275))
                     /locus_tag="TRUGW13939_04989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488154.1"
                     /db_xref="GeneID:55992487"
     CDS             complement(join(372921..372966,373023..373090,
                     373144..373275))
                     /locus_tag="TRUGW13939_04989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344047.1"
                     /db_xref="GeneID:55992487"
                     /translation="MFENGFLGLFKSAKPQDEQSQQPTWNASTMTMEQPASYTGEQHA
                     PSPESEQMKLRGGGGCCNVCCGCCAGLCAFECLEECC"
     gene            <374130..>374708
                     /locus_tag="TRUGW13939_04990"
                     /db_xref="GeneID:55992488"
     mRNA            <374130..>374708
                     /locus_tag="TRUGW13939_04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488155.1"
                     /db_xref="GeneID:55992488"
     CDS             374130..374708
                     /locus_tag="TRUGW13939_04990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344048.1"
                     /db_xref="GeneID:55992488"
                     /translation="MADVQETRAKDFIRFKNFAAWTFIVGAPVLLAMPPRKLDLHSFA
                     LTSAFAVSANHLYRQRNPAGRGILDETGVRVFAREDKEDGPANLFKQLPTERAAEVQA
                     QLRAAKEASLTNQTELDKYKSATQFQDRSLPEKIWMGAETEGWKERRLREEQQALAEG
                     KGYGDLIMEHIWDVWNWGKPEDKNDNNTDGKK"
     gene            complement(<376353..>376895)
                     /locus_tag="TRUGW13939_04991"
                     /db_xref="GeneID:55992489"
     mRNA            complement(<376353..>376895)
                     /locus_tag="TRUGW13939_04991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488156.1"
                     /db_xref="GeneID:55992489"
     CDS             complement(376353..376895)
                     /locus_tag="TRUGW13939_04991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344049.1"
                     /db_xref="GeneID:55992489"
                     /translation="MAFHCQQPQNGRRGGRRDFNSNNRRRRSNRPTKQRLPAKDADGN
                     IAMGGMELATPSSFPLGRQNIPGPYRGRNSRGGSRQPRNWNQNKVQKSPRKGTQALRY
                     TPPPPPRPEPTFWEKVNWEPKDTSMEDAPAPPEWSQFSYANTNGLHTQIDIEGDIVMG
                     EAPSLTMTLLTELMSVIELS"
     gene            complement(<377993..>382672)
                     /locus_tag="TRUGW13939_04992"
                     /db_xref="GeneID:55992490"
     mRNA            complement(join(<377993..378451,378511..378663,
                     378742..378790,379196..379930,379982..381792,
                     381851..382221,382291..>382672))
                     /locus_tag="TRUGW13939_04992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488157.1"
                     /db_xref="GeneID:55992490"
     CDS             complement(join(377993..378451,378511..378663,
                     378742..378790,379196..379930,379982..381792,
                     381851..382221,382291..382672))
                     /locus_tag="TRUGW13939_04992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344050.1"
                     /db_xref="GeneID:55992490"
                     /translation="MAETPMKPQKRILGDATMTSGNILPSTLSKKRKLETDEASALQK
                     VAPKRNGVKSFGSSQAQAKSSFEEDLEKLTQDIHGLKENNFEKDQQWERPPLEGFDAA
                     KDNLCFQQIDAEEGTFSGAATVKLFGNSVLLHVENFRHYLYIAAPTGFKQEYIPQYAM
                     WLNSKLGYGGQIIHSAELVIKENLYGYQGKTKKPYIKLTVTDHKDIGKLRNSLEKNFS
                     SLNYKGLWQSVDDGGIMTFDNIQYVLRFMIDTGISGMSWVEAKAGKYQLVPPNFKYSN
                     CQIEARISYTDLIAHSHDGEYAKTAPLRVLSFDIECAGRKGIFPEPNQDPVIQIANVV
                     TRYGESKPFVRNVFVLNTCSLIVNAQILEFEHEDKLLMAWKDFLQKVDPDVIIGYNIS
                     NFDFPYLLDRAKHLKCHNFPYFTRLPNQKSEAKESNLSSKQMGNRDTKTTNTNGRIQL
                     DLLQLVQRDHHLRSYTLNSVSAHFLGEQKEDVHHTMITELHNGTPDSRRRLAVYCLKD
                     AYLPQRLMDKLMCLVNYTEMARVTGVPFNYLLSRGQQVKFISQLFRKALLEDLVIPNL
                     SKQDEGEYEGATVIEPTRGYYDVPIATLDFASLYPSIIQAHNLCYTTLLNKKAVEVYK
                     FEKDKDYIVTPNGDMFCKSNVRKGLLSQILEELLGARKKAKKELAVETDPFKKAVLNG
                     RQLALKISANSVYGITGATVGKLPCLEIASSTTSYGRQMIEKTKAEVEAKYTIANGYS
                     HDAQVIYGDTDSVMVKFGVKNLEEAMKLGEEAADYVSSKFIRPIKLEFEKVYFPYLLI
                     NKKRYAGLYWTNPKKFDKMDSKGIETVRRDNCRLVQTVIETVLHKILIDRDVDGAQDY
                     VKNTISDLLQNKVDMSKLVITKALSKSDYTAKQAHVELAERMRKRDAGSAPTLGDRVA
                     YVIVKGAGGSKNYEKSEDPLYVLENNLPIDTKYYLDNQLANPLGRIFEPILGEKKASQ
                     LLTGEHTRAISVAAPTLGGLMKFAKKTQTCMGCKKPLVGKDEKAGAVCENCRPRMGEL
                     YSKTLKKVSDLEVRFGRLWTQCQRCQGSLHCEVICSSRDCPIFYMRMKAKKDVEDSEK
                     ELMRFDYDPGACAGDGADASPHSPPLADMINTHESSLSSHLTLVKSLAKNTAETDRAV
                     DQVLDSAQKLVESFSLLREQLNKQKFAAKIDTRETHNNGKRKIHAAPKSQQRASTSKM
                     ENNSSSESYQNVRPGQKRSRTDNDADTESSGMGKRTRTKRAIPGADDDVSNYVPVALQ
                     KDDISEQVERRLRLREEQRRVQLDEPGKKRRRSSGTNDAVAAATKPDRAIRKRHKAD"
     gene            <383385..>384470
                     /locus_tag="TRUGW13939_04993"
                     /db_xref="GeneID:55992491"
     mRNA            <383385..>384470
                     /locus_tag="TRUGW13939_04993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488158.1"
                     /db_xref="GeneID:55992491"
     CDS             383385..384470
                     /locus_tag="TRUGW13939_04993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344051.1"
                     /db_xref="GeneID:55992491"
                     /translation="MAQSEPAQHDLRGVSSANRSNGTESPQASYPASPALAFPDSDPL
                     NILDHQRNVHLPSDLHLRDLELMHHYSTVSYKTISRHSAFMDSFQFEVPKIALSYPFL
                     MHGLLALSASHLVHLNKDSERVKEYEELAFGHQTLALRLFRGELDNITPSNSEAMFAF
                     SSIVTVLGFASLQTTGVQSLPPIDEMLQTYNLCRGVSEILQTSNPWLKTSNSWVPNVL
                     ASMRMPEKPLPADIEKNISLLFKLNSDLTVTGQTMEETAASENAISEISTTFQQVHSG
                     FAVAWAFRWPICVAPIFISNLRDRRPMALVLLAHYCILLHKMDDFWWMKGWPRRLLHS
                     IYTTLAPSWRDAIRWPVEVIGLSSPGE"
     gene            <385275..>387554
                     /locus_tag="TRUGW13939_04994"
                     /db_xref="GeneID:55992492"
     mRNA            <385275..>387554
                     /locus_tag="TRUGW13939_04994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488159.1"
                     /db_xref="GeneID:55992492"
     CDS             385275..387554
                     /locus_tag="TRUGW13939_04994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344052.1"
                     /db_xref="GeneID:55992492"
                     /translation="MSMFRSAAEMSPSDPDSSSDEGAPVDNDNYMATDDAGPSSSHRQ
                     QVNEPDIDLENLLLEEEEQASLGNSGTLGGALDTDADGHAAVMTAALLEFFCHTRAMD
                     FLNSKPKSLGRYTRESPEVQKLAKRMYQYKSQFLSKHGIIAGGIDTDDWEWVRKQYRD
                     NLDVIGKASVDGMSRIGTPTIPESRPPSRGPFGSPQRMSASVTSLVQTSKNVPPSLVR
                     TPSHDNAWDLQKLNQHPHSQGFVHFNNLLRSPQQSEPTAVKNSRASSVSDRVSRYAFE
                     FVEVKLLGRGSFGQVFEAKHHVDGQNYAVKKIPLSKKRLEMLQQEGVHHLEHILKEIR
                     TLARLDHKNVVRYFGAWVEENQVLIDTESETEIRIESIQEDPAEEDQSFGIVFGLSSN
                     GGEDDSKSGSTPKHTASESGSHNHLTNDSSQNIAVSNGEEDDDVESVQRNFSLPEHGG
                     FSHDHNSTWDGTDTNIFTRDDSEDVSNMKLSLRDDPQDQTVILHIQMSLHPLTLSKYL
                     SPQNGIRNQNPSLSSPRHCFHILPSLRFFLGILSGVEYLHSKGIVHRDLKPANIFLSS
                     RENEKGACHSCRQNNGHIVNMYRPRIGDFGLVADISHCTEPQFSHATTVQDNSRRFRH
                     VGTEFYCPRKSQLNSTSTQQHARDEDTINEKLDVFALGVILFELTYRLDTRMERQLVL
                     SGLTRGGLQDGVKIPRDFENKVDCGNTTLSNGMSVGQSLSQCIESMLHPDSRARFGCK
                     DVRKYLQQLILMVEESSRW"
     gene            complement(<387951..>389406)
                     /locus_tag="TRUGW13939_04995"
                     /db_xref="GeneID:55992493"
     mRNA            complement(join(<387951..388438,388496..388585,
                     388641..388868,388926..>389406))
                     /locus_tag="TRUGW13939_04995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488160.1"
                     /db_xref="GeneID:55992493"
     CDS             complement(join(387951..388438,388496..388585,
                     388641..388868,388926..389406))
                     /locus_tag="TRUGW13939_04995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344053.1"
                     /db_xref="GeneID:55992493"
                     /translation="MAPITAPYSEPLLPQLDIKNPYYTEIHHNLRRYVRDYVDTNIIP
                     YAQEWEEAGQVPESVRLRHHQLGFGIVHPLTSTEDSANLSLPGNVPRDKWDTWCSLIL
                     TDELIRCGYVGVVWGLGGGNGIGAPPIARFGTLEQRRRWLPGVARGEIRFCLGITEPD
                     AGSDVANISTTAQREGSHYIVNGAKKWITNGIWADFCTAAVRTGGPGRHGISLLVIPL
                     KEKGVTRKRMHNSGVNASGSTFLEFDDVRVPAENLIGKENQGFQYIMSNFNPERLTLA
                     CSALRLARCCAEDSFNYAVQRETFGAPLITRQVIQSKIFKFGMWIEPAQSFLEQLTYI
                     IESTKDRPNSVNIGGMTAQLKVMSTRALEKSVREAQQIMGGAGYNRAGKGARVEQISR
                     DARVHVVGGGSEEVMMSLAVREETKALRARQKASKI"
     gene            <390351..>392137
                     /locus_tag="TRUGW13939_04996"
                     /db_xref="GeneID:55992494"
     mRNA            join(<390351..390600,390661..391414,391465..>392137)
                     /locus_tag="TRUGW13939_04996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488161.1"
                     /db_xref="GeneID:55992494"
     CDS             join(390351..390600,390661..391414,391465..392137)
                     /locus_tag="TRUGW13939_04996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344054.1"
                     /db_xref="GeneID:55992494"
                     /translation="MVERLRPKSLASMAQTVSDRFALVAREDNSKLVGQTQRFELWAT
                     SLGLYHLGHSSLDYRFRDAPSLFEYTVGLLRDLEGLLVQLMDTRNPGHLSSVDTKNTI
                     GSHEQFSDDSGEDDFESSDDESITDLLLGSVSATIDKLYHLSFKIRNPAMRLGFSESL
                     KYHEIDPETGVNLIDQFRENDQRHLEQLFASYRSLSPANFEKDFLVRRLAKANTRRRQ
                     QFGYWKRRAQFETIFKKEIIDKTAPELENDPNLNVPAVPIAPSRPSTATHLNVSKVNM
                     DDDTSMVSSLTIPNMKYEGSGGYFFIPPPPKHLLDGEEFECPYCFTLCPRKMLHQTNW
                     QTHVLRDLRPYICTYEDCRDADQQYDRLGDWINHEAFTHQRKSGINSSNNENLSIQES
                     RKCPFCFEIVGRQHIATHLRRVACFSLPRSTGSDDESSQDSQISGRADLRSNKSRCSE
                     IRCETSFGGAESVSEAGPEVDLKNNIPLTLESLQQQQPDPKDKESKVNIFLERLESES
                     ADSHHTPPGIDPTSISDFGMLHPTAAWCVGFPELENPEILEKFDFDSFLY"
     gene            <392525..>395671
                     /locus_tag="TRUGW13939_04997"
                     /db_xref="GeneID:55992495"
     mRNA            <392525..>395671
                     /locus_tag="TRUGW13939_04997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488162.1"
                     /db_xref="GeneID:55992495"
     CDS             392525..395671
                     /locus_tag="TRUGW13939_04997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344055.1"
                     /db_xref="GeneID:55992495"
                     /translation="MESLEELSRAAANNSTETVAHDAPASHSPSTQVEPLKTSFSDPV
                     LSRNNSQSAASGSTLQIDQHPSVDGTSTLRDDSTDELGKDAEGFFPQLSYNPPTSADD
                     KYTEEFAVADEEPLAPSFERTTSPVTSTQRSKTSFYEKAGEEGVVRMHKFTLYETATR
                     YYLVGIDQLDTRYRILKIDRTSESDDLSLSEEGIVYTKQEMNQLLETIEDGNKSSGGL
                     KLKCSAWALLGFIRFTGAYYMLLVTKRSSVANIGGHFLYQVDGTELVPLTTSASSRIR
                     PEKNSEEARYIGILNNLDLSRSFYFSNSYDITRTLQHNICRERTHLQKDLHSLPDYDH
                     NSMFVWNHHLLSPVVASLKTPYDWCLPIIHGYVDQSVLSVYGRSVYITIIARRSRFFA
                     GARFLKRGANDLGYVANDVETEQIVSEVTTTSFHSPGPRLYANPRFTSYVQHRGSIPL
                     YWTQDSTGVSPKPDIELNLIDPFYSAAALHFDNLFERYGAPIYVLNLIKARERTPRES
                     KLLKEYNNAVDYLNQFLPEDKKIIYKAWDMSRASKSRDQNVIDTLEDISSETLPITGF
                     FRNGDDRESGLQLQSGVVRTNCIDCLDRTNAAQFVIAKRALGYQLHALGVIEGTQVHY
                     DTDAVNMFTNMWHDHGDTIAIQYGGSHLVNTMATYRKTNQWTSQSRDMVESFKRYYNN
                     SFLDAQRQEAYNLFLGNYTFTQGQPMLWDLSTDYYLHHTDPRTWSKLKRPDYITWYTP
                     ENLEKRDEPSSCPPSTTPKDKSITYYDDYWLEYYRPLSLTSFGKIYPLRLNSTLKYLP
                     FRSTQGGRYDLSPFVVRTPPHEPASRERTVPLGHQRKGVKIQEPDSTSDQTSGTSRGV
                     DVMEPIRSWQRQQPSAEKRPPSAGIMKETGATLASSVPTLPSMSTSLTDSTGTGRAPS
                     KAQIAQWTLDQLVSGSLNPSVTSTEAEEYERYINHPLKVPLVVTSDDDLETASSLRER
                     GANLELLEYVNKARGVSAGGMRETFIAEEDLTDYAEFLKVDEDALTVVAEDRDKKRYK
                     RYRQWLKGKSLFKQRVDA"
     gene            complement(<395802..>400010)
                     /locus_tag="TRUGW13939_04998"
                     /db_xref="GeneID:55992496"
     mRNA            complement(join(<395802..396803,396860..397317,
                     397367..397538,397595..397795,398093..398292,
                     398344..398907,398957..>400010))
                     /locus_tag="TRUGW13939_04998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488163.1"
                     /db_xref="GeneID:55992496"
     CDS             complement(join(395802..396803,396860..397317,
                     397367..397538,397595..397795,398093..398292,
                     398344..398907,398957..400010))
                     /locus_tag="TRUGW13939_04998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344056.1"
                     /db_xref="GeneID:55992496"
                     /translation="MLKACSSLWKNNVRLLRKTVCREYSSLPASSIAVHGGCCAPSLN
                     TRRLPLFMPVHKVQEDSPQRANKRRRITTSTSPHRDNMVVQTEEIRQPLPKIELTPLE
                     HLIERLLLDVKSYIEQKNEPTGQDAQQEMVLRFTGGWVRDKLLGVDSHDIDVAISTMT
                     GFQFGNFMKEYLDDPENLAKYKGSGNPALNDDEIVKVHKIDANPEKSKHLETVTTRIF
                     GLDIDLVNLRKETYTEESRNPQMEFGTAEEDALRRDATVNAMFYNLNTSALEDLTGLG
                     LKDLKQKLIRTPLEAYQTFKDDPLRILRLIRFASRLGYRIDDDCKQAMQNESIKDALR
                     LKISKERVGAEVEKMLRGPDPKAALTHIDTLSLHSTIFANLRDEAQADTSSWSLVYDS
                     FDKIAHPADDADDLSQKTKHLHDLLIRDEIDAYHAWIVAAFSPWALVPARPIKSKSEK
                     PPVVARAAEVARDNLRSDNKTVCILKESVGYFTELKSLKDSFLAGEISGTESEIRQRV
                     GLTIRSWKKDWRMVAIMALLQEIMAGAEFSNVIDEYDKFLSYIERESLLNVTELRPIV
                     NGTELSAALGAGRGKWLSIALEKMIEWQLLHPEITEKEEASQNDIATVSIPQGLGEME
                     KTRLAARAYIKKTNNESLDRFEAEVNDEIVTLPALQTELSSPDAQDLSALNEDLLVIW
                     TALREWKFSEPFGADGKEAAQAIYAWLVQISLPSSDFAEALESEYTDDKSKKIKLTTT
                     LKSKRSTFEIAISCIEALNSILPVAEAENAADIFTALASFTNTRDSWTTSKSYHDALA
                     VLQTFSPSENHQRNWDIVEQMSKSKIRPIFAKTRNTAVTGAGRKNLHPMPQPRFDGNI
                     FNPEAKPWKHVDVYATTVLEWVLSLYTSSDIARLENQFQFYVPPILSLLDDESPSFKY
                     RGCHLLISFLKPIQSSNSDLLRRTNLSSVFDDALTPTLLSLPTLTAEDESLQILGITY
                     KALLLTLQTRYHIGQSSSYHQEDNRAAYTSRLTTLLRDNVISAFHHISSYTPTTKTES
                     SMLASFPYPRLSTFILGQLKTVVQHIGIHTTKYLQEIIPVIYNTLTNPFVTAHLPLLA
                     AGVAAAQAVILNSHPRIWRYRGEFLAAFCACWMNISQDEKGTQDIELQTQLRNVMKKL
                     QGATNLLNIAVQSAVSIKEDDLKRIYWTGVVEGDEIDMGKEVEALIAADENLRDLFDR
                     IHEEDLSDDYFD"
     gene            <400475..>402758
                     /locus_tag="TRUGW13939_04999"
                     /db_xref="GeneID:55992497"
     mRNA            join(<400475..401552,401605..>402758)
                     /locus_tag="TRUGW13939_04999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488164.1"
                     /db_xref="GeneID:55992497"
     CDS             join(400475..401552,401605..402758)
                     /locus_tag="TRUGW13939_04999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344057.1"
                     /db_xref="GeneID:55992497"
                     /translation="MTSPEDAAPVKPPPSFSGAPIVVPKSTYSADTVQSPRSFTADLR
                     DAPSIASSTPQLPYRNESPSRSASPSSRLSGSVSLPNRASIGSPLGSLPDVSDSIRSL
                     IIRSFSPSIAIFASDDTEELVRQKGFKGGFRELVRPFGENITGKVVVRDSVGSSRGWD
                     DFSIRFVELSPQRKTQNDPTTPPVSPLVQLEELLQQRLGSADDATNRWSQLTQSPMGN
                     TSVSSPFYQLLLRRLLSVDAPTPHETFSHPVACVITISSRNKTPLESLRQLYTQTSQG
                     STAPPPYVHSEFLRYYVLVHDEDRDDIAESTRLYDQMKRHFGLHCHLLRLRSDQCVVT
                     DDDSTEVPPCEWLSPEEELSKMNETSALIDLGTEVAYLFESDVTAIKTLIRELVVQSV
                     VPFMENKVALWNDQVASKRRGLSGRFMSMSRRWTGFGSSSKSGSSGSSGGMSGNYDAS
                     QGFYKPDVPEALLRKLGDFAFMLRDYKLAASTYDLVRSDYSNDKAWKYHAGAHEMCAI
                     SSLLNPLSSAVKSRVEGIDQMIDTACYSYLTRCSDAVNTLRCLALSVELLKSRGGSAT
                     EGAARWAMRSMELGLAGPIGQALFTERVSACYASKTSTGGAKWGARRRKAAMWSILAG
                     ESWLRLGKPALASACLEDADRLYAEVLDKDGVFPMSDMQEFIDNLKHAVKVEFLESKG
                     VDTSDETIVAGQLGTEETSEKLDTRANRRSIIMASSPLDNGPLSPTKHQGESAKTLDD
                     DFE"
     gene            <403370..>405182
                     /locus_tag="TRUGW13939_05000"
                     /db_xref="GeneID:55992498"
     mRNA            join(<403370..403428,403478..403575,403632..403783,
                     403836..404214,404269..>405182)
                     /locus_tag="TRUGW13939_05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488165.1"
                     /db_xref="GeneID:55992498"
     CDS             join(403370..403428,403478..403575,403632..403783,
                     403836..404214,404269..405182)
                     /locus_tag="TRUGW13939_05000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344058.1"
                     /db_xref="GeneID:55992498"
                     /translation="MQDEGISEEDLYRYTRYRWIFNEQNELSKRYLKFNLRRLIDIAV
                     SVSDGARSCTKVLKCSEGLHNKAFILTMDNGTEVFAKLPNPNAGPAQYTTASEVATYD
                     LLRDVFRIPVPRILAWSSDAASNPVEAEYIIAEKSPGVRLGSIWNKWPRETKLKLIRQ
                     VADIENTLTNIKFPKHGSVYFKEDLRSLTGDAEDLNIDSTNLRRFSIGPLTTAELWTN
                     TRKDMDLDRGPWRDPSEYTQALGRNEMAWIKSRASSRMNYHRSMQEHESTEDGLALLS
                     QYMDVASDLVPPSDDESAASNVLWHPDLHLDNVFVDPDTHEITCIVDWQSACVAPLFY
                     QSGVPRMFRHPGPVQEGWVVPVRPENYDSLSEDEQKKVDNDLESEIMHKYYESQVYKR
                     APRHWAVLEQKIIPIIRKPVWLVSGVWENRNLFFLRQSLMSLATHWEDIFPNSKIPCP
                     INFTDKEVEIHANEEENMDSVGKILTMFRDGGVLPVDGMVERKDYEIARENSSKFKEI
                     FIGLAKDQAEREFFTKLWPYQEPEK"
     gene            <405626..>407283
                     /locus_tag="TRUGW13939_05001"
                     /db_xref="GeneID:55992499"
     mRNA            join(<405626..405675,405727..405964,406023..406232,
                     406287..406481,406534..>407283)
                     /locus_tag="TRUGW13939_05001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488166.1"
                     /db_xref="GeneID:55992499"
     CDS             join(405626..405675,405727..405964,406023..406232,
                     406287..406481,406534..407283)
                     /locus_tag="TRUGW13939_05001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344059.1"
                     /db_xref="GeneID:55992499"
                     /translation="MGDLINYILSHEDAFRRNRLPSLYSDFSIHKDTNPDGYAVNVAA
                     WQKALTNAALAGYVTSGSGQKKDFLSLTTDQNLLHNLEIPEWGRPVALASVFDEAIQK
                     RSMVPQELYKSSAFTLKTSRWRLDPGVLSPWNVMNWSLKRLKGLVVGPGATLGVQTLV
                     LVNNLQETSKRVIDQAASHDCSSLDRIYSKEKFAERFGKVLGQDAELSDNDIDMLLIY
                     LSRDINAIAYDGKTIKFHGGDDTSPITHEDSTIASIKTLISNITEQISRLEQKINELN
                     ANAKTSLNNKNRVSALSALKSKKIAEHNLKQRSDTLNQLEEVYSKIEQAADQVEIVRV
                     MQASTSALRSLHAQTGGVETVENVVDNLREEMSKVDEVGTIINEAGPVVDEGEIDDEM
                     EELEKQEVREKEEKEAEETRERLAQLDSQKHAAEEAAHKLAELQKNNVDTGEDSLLAE
                     SIGRLSNMSLDDKPITKEKEEKEKQPVPAQ"
     gene            complement(<407415..>408866)
                     /locus_tag="TRUGW13939_05002"
                     /db_xref="GeneID:55992500"
     mRNA            complement(join(<407415..408135,408190..408307,
                     408365..>408866))
                     /locus_tag="TRUGW13939_05002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488167.1"
                     /db_xref="GeneID:55992500"
     CDS             complement(join(407415..408135,408190..408307,
                     408365..408866))
                     /locus_tag="TRUGW13939_05002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344060.1"
                     /db_xref="GeneID:55992500"
                     /translation="MDQTFDIPDSTDWLTTPVSGVASVESALRCQVCKDFFDTPVITS
                     CSHTFCSLCIRRCLSAEGTCPACRRQDQELKLRRNWTVQELVDSFQKVRKDLLNLARE
                     SAVRHAEDIDTLQPLAKKRRLDNTTDEHGSSHPELRRTRSRVKAVAVEPTQIPVDEDP
                     QDDDFVPDDGLVACPMCNRRMKEAIVFSHLDICKGPAQRSRESRTARTPQYPPQSHHI
                     QQQQNTKPPERLPAINYSLLKEVAFRKKLKDLGIPDWGPRPLLQRRHTEWMNLWNANC
                     DAKLPKSKRELLRDLEIWERTQGGMAPSLGPPSGPNAIMAKSFDAGAWSTSHGDDFRR
                     LIEDARKKKDMQIRAKEPEVTAQESGNQPIHVEQPIGIEQPISANISSSITQVEVSTA
                     AFPEVPIDLGNPIELNNGLPNSEKTNQAETSTAEVQNDAGGMIFDPAFAPFRWH"
     gene            <409142..>413254
                     /locus_tag="TRUGW13939_05003"
                     /db_xref="GeneID:55992501"
     mRNA            join(<409142..409198,409255..409310,409367..409605,
                     409661..410085,410147..410171,410219..410611,
                     410664..410805,411408..411647,411713..412926,
                     412983..>413254)
                     /locus_tag="TRUGW13939_05003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488168.1"
                     /db_xref="GeneID:55992501"
     CDS             join(409142..409198,409255..409310,409367..409605,
                     409661..410085,410147..410171,410219..410611,
                     410664..410805,411408..411647,411713..412926,
                     412983..413254)
                     /locus_tag="TRUGW13939_05003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344061.1"
                     /db_xref="GeneID:55992501"
                     /translation="MAADYKRYLAENVLNEKRTVTYRLLSRALKIHSNLAKQMLFDFH
                     RTENAKRSKSVSATYLICGVQASGKKSTENGVSNDEDVPMKSSPFMSSMPQPDETEQS
                     IPVTTFVLAREEDLEGAKASFQSISMIHVYSLQVNALQDLNALSDVSREILSSYGHED
                     PLEHGKQWGMIQNEHVKRRKATRPPPPAAAPAAPKPSTPTQEPPQKESDQETTSKPPP
                     QQKNEGKPEKPAPQRKKGDLFSSFAKTKPKTKTESAAGAESAKKDSSTSGIFGGDDAD
                     EGEDGDVFVNSTEDKNTSTRESRKEREARLKQMMEDDDGRVHRPLYHGRTDACIDEEM
                     PDASAESAEEPEPEPEPEPEPEPEPEPKAEPEEPKQEVTVSNGRRRGKRKVMKKKTKK
                     DEEGYLVTVEEPVWESFSEDEPAAPPKKKPALSSTGSKGKKAGQGNIMSFFSKNWARS
                     VSQSRGVYKAALVPSCVLLTSHHHTPRIAMVSAASTPAAIALALLAGHCAAKQPRDDP
                     ALLRRACPDYLDYSQVPHAPYSDGPLKLPFQRPAPECRTFSSQSVEKVISDVTSRLVD
                     KDLAQLFTNALPNTLDTTVAWHVNGTSKQKRGNHYKRNVSESWQGAQSFIVTGDITAE
                     WLRDSTNQLEPYQPLAKNDEALYQLILGAIHTQAEFVIQSPYCNAFQPPPPSGLKATA
                     NTQKDTVHPTYDSSVVFECKYELDSLAAFLSLGNQFHNATGSTEYLTDRWYKALNTVL
                     ELLDAESQPTFDTNGQFVSNVYTFQRQTTLGTETLTLTGEGNPLNKGTGLIRSAFRPS
                     DDATILGFFIPPNAMMAVQLGKTANAVEKAGGDVNLINDLRIRANNLREAVQKYGIVN
                     HPAYGEVYAFEIDGYGSHIFMDDANIPSLLSLPYLEFVEADDPVYQTTRKMILEADGN
                     PYYLSGSAFRGIGGPHIGLTAAWPMSRLVQAQTSNDDAEIIDSINAVVNSSLLGLVHE
                     SINVNNITDYTRPWFSWANSLFAQTILKVAEERPHLIFDSDKPYTVPS"
     gene            complement(<413478..>415331)
                     /locus_tag="TRUGW13939_05004"
                     /db_xref="GeneID:55992502"
     mRNA            complement(join(<413478..414506,414834..414896,
                     414942..>415331))
                     /locus_tag="TRUGW13939_05004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488169.1"
                     /db_xref="GeneID:55992502"
     CDS             complement(join(413478..414506,414834..414896,
                     414942..415331))
                     /locus_tag="TRUGW13939_05004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344062.1"
                     /db_xref="GeneID:55992502"
                     /translation="MELSKHPEDATSDNGMGSFENSEKGLETKLNADAGEDESENDDA
                     YNNQNWFKPAEKRWPGGSEKYTGIEIQEEDEDNSDEGSPATSPGRESVYDTEENDSQC
                     GSIGATKAELHGGLLRNKFRGLRIQKDESEVLFHTTEFDEADLTSFLDSNAIMFLLTM
                     AGYLIRTDRSWSCACTLAISHNASSKTTYGVCIGLKPYEAESLVGFLQREKRYAGNPL
                     FVAVALVEIYIQVTMAMNRRHNKDFYNIQTAMKTDYYIISPKVQRTLDLVEFASRLTA
                     LGSSSVGVTQLCSTQHRIMQFLDDQLKTLKKEAPETDTVLTALGERLAFTRELLQAER
                     QHNEYIKGAAQTQVQMVYSLTAQRDNEHNLNLARLSQKQNRINIQISKFAAYESRISN
                     KMAKESLRYGVDMQIIAAVTLGFLPGTFMATLFSASFWDFQPDNQGRIVSSWVWLYWV
                     LTVVLTVGVLAAWRIMSRVKADGLEPPPEAFVLENLDDSGDIA"
     gene            complement(<415718..>419606)
                     /locus_tag="TRUGW13939_05005"
                     /db_xref="GeneID:55992503"
     mRNA            complement(join(<415718..417153,417222..417279,
                     417600..>419606))
                     /locus_tag="TRUGW13939_05005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488170.1"
                     /db_xref="GeneID:55992503"
     CDS             complement(join(415718..417153,417222..417279,
                     417600..419606))
                     /locus_tag="TRUGW13939_05005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344063.1"
                     /db_xref="GeneID:55992503"
                     /translation="MAAALARRTACQACRYSALQTFAAFSGLAIAQTNRFPNNPPLRR
                     FSAVPYLRTEYPDHSASPAENDPKHEDQLVADEDTDLQSVPWYLRVEPPTKESPVARQ
                     QQIPPVPENSPAIMADLLQNLSVEIGLDDLALIDLRGRDPPSALGGNVIMVIGTARGI
                     KHLNVSADRFCRWLRSSYKLQPFADGLLGRNELKIKLRRKTRKARIAGSTGSTASGSD
                     DGITTGWICVNAGLVDDPGAETLARRGVFEGFGKIQSGTRIIVQMFTEEKRALMDLEQ
                     LWTPKRKRQVDPNPNPEDTPKVVRPGSNNTNHHESNHPLFDTIRPPSSISFHQKRQFT
                     TSSTNRQNSRISNRGQEFYDYLTKEENIFQANSSDLGTGPNDCDSTPLLRRSYDVAKG
                     SQFENSLLRLMLAAAGVTVCHPAYTKEHLWSVYMEHTASGFNLSESYGLDVARSFVTP
                     RSDDVSPSTRESDVEHALRVLDYLSLEGSLRLHLPLFVILYKALIMLSEDQAADTTHQ
                     LSLRIRNVMETFNEEIKGYGSWDMMRLRLEAKDIEGFWQIWHSLPFMNGSRTHDDYEF
                     LFKSMAWCDDAASARESLATWIPMMLREQPPIEPQESLLEAIAYCIQAAGYDNLDFSP
                     EMASSSYWAKLRPTILSYLRTLPENYQQAAYSTLFRREVERFESTMEYMSGVQNDLDD
                     LKPSLFELLAEEQLSSLLPPSIRYLLAVATHRHPRYLLRVLNNFDELYALLSLLVERY
                     YLRTFGGSFTENFYSLKRERVSFTKNGEIPRAQMGAANPVRETLRLRTVDVWKNLAVM
                     VGLPYLKRKLDESYDIHIAPHASSLLGGPRYNPADGLPANPTIKQRLMFYYKWFLRNV
                     YPSVNAAYYFSIVAFNLAYLFDNTKYSSPFLWLIGTRIRRLGPADHRAIANILEAKPG
                     GGSSARRSQRPGSPLLGLLNPQNLYPQVLSSLRYFLPVSIFALKFLEWWHASDFSRQL
                     ARKATENLDLPAPVVTGMTDPSLRKANTSSSPQSTSPSTSLKPALKKTPSNSQPPVSS
                     TSYLPIFTVPLPTSDSGKASACPICLNPLTNPTACQTGYVFCYTCVFHWLNGEHERQL
                     DFMNGVDGGAAWEDEGAGAAVDEGDEKDTDGQDGSSNESPATKAHRSREGRWESGQGR
                     CPVTGRRVLGGTDCLRRVLV"
     gene            <419845..>421649
                     /locus_tag="TRUGW13939_05006"
                     /db_xref="GeneID:55992504"
     mRNA            join(<419845..419912,419971..420020,420076..420167,
                     420229..420514,420577..>421649)
                     /locus_tag="TRUGW13939_05006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488171.1"
                     /db_xref="GeneID:55992504"
     CDS             join(419845..419912,419971..420020,420076..420167,
                     420229..420514,420577..421649)
                     /locus_tag="TRUGW13939_05006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344064.1"
                     /db_xref="GeneID:55992504"
                     /translation="MSMDLDEGVPFSDFHAQQQPEATILCCNCGSPIDGTSAAGALCH
                     DCIKLTVDISQDVQRESTLHFCRDCERWLQPPQTWLTAALESRELLALCLRKLRGLSK
                     VRIIDASFIWTEPHSRRIKVKITIQQEAFQGTILQQTFEVEYVVSTQQCPDCAKSFTH
                     HSWRACAQVRQKVPHKRTFLYLEQLMLKHRAHRDAINIKEVKDGLDFYFAQRNHAEKM
                     VDFLSSVSPVKVKKSQELISMDIHTSSRQYKITFSVELVPICKDDLVALPIKLARSLG
                     NISPLTLCYRVGNSINLLDPSTLQTADVPTPVYWRQPFKNLADVQELAEFVVMDIEPV
                     GESKGRFFLAEVTVARASDLGVSDRTYFTRTHLGGVLHVGDSAMGYHLTGTNFNNPNF
                     EAIEESSHYSSAIPDVILVRKHYARKKKPKSRSWKLQRMAREEEEVGRKQDQERVEAD
                     FEMFLRDIEEDQDLRGTLSLYKTKDEGRKANKMDTTGDGNDMDEDGSDDEVPKINMDE
                     LLDEFDELNMEDAE"
     gene            complement(<421784..>422521)
                     /locus_tag="TRUGW13939_05007"
                     /db_xref="GeneID:55992505"
     mRNA            complement(<421784..>422521)
                     /locus_tag="TRUGW13939_05007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488172.1"
                     /db_xref="GeneID:55992505"
     CDS             complement(421784..422521)
                     /locus_tag="TRUGW13939_05007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344065.1"
                     /db_xref="GeneID:55992505"
                     /translation="MLQTPTTVKRFVLRRRLEEDPYTYPYMITTTARHTGLSRQTTIS
                     DFFQKSCAVYITTPVDTRRPVGKEQLLRTFNYFSKRLDIKAALAENYGDVAMVMRDAF
                     PCKFLACWSPRSPHGVSEIQQAHQRICSQIEARQTDAAISHTSSQLHPLFRAVLIIID
                     RLDDCHAQGGQQRPGLIQLIRSGDDAHLRSGPIDLDPLRFTFWVSDDGNILRGRFENV
                     MLLIMEWRRREDDTTREEEDMETENEF"
     gene            <423383..>424291
                     /locus_tag="TRUGW13939_05008"
                     /db_xref="GeneID:55992506"
     mRNA            <423383..>424291
                     /locus_tag="TRUGW13939_05008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488173.1"
                     /db_xref="GeneID:55992506"
     CDS             423383..424291
                     /locus_tag="TRUGW13939_05008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344066.1"
                     /db_xref="GeneID:55992506"
                     /translation="MATRKRNEFLDLAGSDGEESDRGYDSEAIEESKGRSSKRRRVLD
                     DEDHSEDEDGVDNDATNEHADSRFHLDSDDDDDDLGSTSKQTTKSSQKPTKKKKKDKT
                     GVIYFSSLPPYLKPFALKTLLLQRGFGPINRVFLTPAVASTSGAGSRRSNKRKMYSDG
                     WVEFESKKVAKVCAETLNATTVGGRSWYRDDVWNMKYLRGFRWADLMEQVQIERSQRE
                     AQRRIEDTRSRKEDKVFLSGVEKGKVIEGIRKKREDKAKANDTIPEDIQIRRVFRQNE
                     VKQREENKALNNKMDEDAKRVLGKIF"
     gene            complement(<424728..>426096)
                     /locus_tag="TRUGW13939_05009"
                     /db_xref="GeneID:55992507"
     mRNA            complement(join(<424728..425720,425785..>426096))
                     /locus_tag="TRUGW13939_05009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488174.1"
                     /db_xref="GeneID:55992507"
     CDS             complement(join(424728..425720,425785..426096))
                     /locus_tag="TRUGW13939_05009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344067.1"
                     /db_xref="GeneID:55992507"
                     /translation="MNSEPPDHASLESSPTSIALYHQVAQPTRISSPSASSRANGLPV
                     LEAAPPQNMSTAATTTTTASDEAVSQKLVETPLNARKPVDKRSLEYVSRSGLAGGIAG
                     CAAKTVVAPLDRVKILFQASNPQFAKYSGSWSGLAMAMRDIKRFEGARGLYKGHSATL
                     LRIFPYAAIKFLAYEQVRAIFIPTKDKETPFRRLISGSLAGVTSVFFTYPLEVIRVRL
                     AFETKKTSRSSFRTICSQIYHEQASSRPVAAATASGNGSSTAMATAQTVSSSIKAVTP
                     RTGLANFYRGFAATVVGMVPYAGVSFLVHDTIGDVLRTPNFAPYTTMPKSETPSPSKD
                     QPGKLRVQLTASAELFSGAVSGLVAQTSSYPLEIIRRRMQVGGAMGDGKRLNMAETAR
                     KIYFERGFRGFWVGLTIGYLKVVPMAATGFFVYERMKWYLGI"
     gene            complement(<426779..>434771)
                     /locus_tag="TRUGW13939_05010"
                     /db_xref="GeneID:55992508"
     mRNA            complement(join(<426779..427880,427939..429527,
                     429576..429592,429649..429751,429810..429953,
                     430020..430085,433015..433518,433568..433707,
                     433766..434253,434305..434498,434555..434633,
                     434695..>434771))
                     /locus_tag="TRUGW13939_05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488175.1"
                     /db_xref="GeneID:55992508"
     CDS             complement(join(426779..427880,427939..429527,
                     429576..429592,429649..429751,429810..429953,
                     430020..430085,433015..433518,433568..433707,
                     433766..434253,434305..434498,434555..434633,
                     434695..434771))
                     /locus_tag="TRUGW13939_05010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344068.1"
                     /db_xref="GeneID:55992508"
                     /translation="MPDFYPSLAQCALVAAAFKVLLFPAYKSTDFEVHRNWLAITNSL
                     PVQEWYYEKTSEWTLDYPPFFAAFEWVLSQVAYYADPAMLVVNNLNYDSWQTVYFQRA
                     TVIVTELVLAFALNRYVKSVHPDNTNLAHIASLSILLSPGLLIIDHIHFQYNGFLYGI
                     LILSIIWARRQSTLLYSGISFAVLLCLKHIYLYLSLAWFVYLLRSYCLSPRFRPQIWN
                     TIKLGVSVVAIFALAFGPFAYWSQLLQLKDRLFPFSRGLTHAYWAPNIWAMYAFTDRL
                     LIPLGPRLGLSVNYEAAQSVTRGLVGDSSFAVLPQITKEHTFGLTLFFQLLSLIKLWF
                     RPEWDIFVGAVTLCGYASFLFGWHVHEKAVLLIIIPFSLIALKDRRYLGAFRPLAVAG
                     HVSLFPLLFTATEFPVKTVYTIFWLILFLFAFDRVAPVPERPRVFLLDRFSFVYIAIS
                     IPLIIYCSLIHQIVFGFNRYEFVPLMFMSSYSALGVVGSWVSFMVLFKRKPVQYLPQP
                     PIEDDSSEVWVIPETNEVFTTYESYLHRRDFYKQTRFICEITGHSGLNFYEALQSEMT
                     ESRELNSAFPDALKEPILRRVQFSTVSRVDHLVDEIYEEFKQDFYPGEHVATVLKDNT
                     RLHGIIRDKMNFPRQYYTDGAVKSEAYARYLVRIVDRPNEEALLDQDHITRDRKTFSK
                     QMLRAFIKNNTTRESWNGAPWLVKPSIAEEYKIPIEVPKHLQYGARVAEKKALKRADQ
                     DGHFGFFSSKKLPELKPATGNVTKTKLSPQELARNKAEQFMEYKRSLNGDPSFLVSAQ
                     QGAGPSPVNDEEAERKPLVPVVPLKIEPPPPPVIKYPIEDLDLKHDPGRKSRPKLKLD
                     LNHSSEITDDDNILPHEIKPESVSLFLETWNTLNVYCEVFQLDSFTFDDFVEAVRFSS
                     DEADCELFVELHCAVLKKLVNAQKDNDGAIQVSLPDLPQAESDDSDSEDEDGSEPTPE
                     PEPVVTRMTTRSSLAKAEAATLKENLENGDVSDAEEPRVHRATELFEQYDWIDRLRKR
                     DFRNGGWQVIMAGLLHQLSMRPKMEKVCEGILKHLVPLHIQPTQESVSTQYSTLDVNL
                     RITALQIICLLSLETKAIRNYLEECSNQMTEHRKEKIEHQRARKAALEELRKLHAEKK
                     AHEPEPEKEGAEKEKEKSGKEEKPSSSTVDVEMLDSVRSEDDVDTDEMMDTEDEGPSL
                     RGGTDRILERKRRLEAERERREQLAKQPKGSKTYQRILKKIEDQEAKITALEEEIATV
                     DNDLREADCPRTRCLGKDRFCNRYWWFERNAMPYEGLPNSSTADAKYANGRLWVQGPD
                     DMEREGFIDPPEHIRKNYAKEHRVTPAERKKHEEGETSLLDARHWGYYDEPEQLEELV
                     RWLDTRGLREIKLRKELQLQRGHITKYMKSRNDYLTQATERAESEEPPTKRMTTRTKV
                     FADDQRHRCLKWKNTTALSELGHLHVDAGRPTKRVKRVADEVKELKAANKQGKPLSRQ
                     GSRYKF"
     gene            <432398..>432946
                     /locus_tag="TRUGW13939_05011"
                     /db_xref="GeneID:55992509"
     mRNA            join(<432398..432402,432520..432780,432844..>432946)
                     /locus_tag="TRUGW13939_05011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488176.1"
                     /db_xref="GeneID:55992509"
     CDS             join(432398..432402,432520..432780,432844..432946)
                     /locus_tag="TRUGW13939_05011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344069.1"
                     /db_xref="GeneID:55992509"
                     /translation="MGLIADTPTIIKAAGIPLSRGIDDPRPPEISVTKGIRFNEAGDN
                     ARENFVLSEETQENITKTNRRPYDRVVCGVLLRAYMLAPRQFRVSGDGMWDDEMEWVP
                     VRKLYHDLWPDEEINSPLEY"
     gene            <435165..>436658
                     /locus_tag="TRUGW13939_05012"
                     /db_xref="GeneID:55992510"
     mRNA            join(<435165..435253,435304..435370,435424..435494,
                     435553..435733,435788..436466,436531..>436658)
                     /locus_tag="TRUGW13939_05012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488177.1"
                     /db_xref="GeneID:55992510"
     CDS             join(435165..435253,435304..435370,435424..435494,
                     435553..435733,435788..436466,436531..436658)
                     /locus_tag="TRUGW13939_05012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344070.1"
                     /db_xref="GeneID:55992510"
                     /translation="MKLSASLAFCLTAVSAQSVIESVSFGYGNKISESAGSIPGWTVK
                     GEAHQPQILSNKVILTPPDPGHTRGSLWAENALSESSWNAEFQFRASGPERGSGNLQV
                     WYVKDGESSIGSSSIYTVGKFDGFVLTIDTHGGRGGSIRGFLNDGSITYNQHANVDSL
                     AFGHCDYPYRNLGRPSIVEIKHSGAIFEVIVDQKLCFQTTKVGLPSGYKFGVTAATPD
                     TPDSFEVFKFAVTPGPQAVTPPSGQSQQQQQQVPIQRREQAINPGALNDINSRLAQLG
                     QEISQLSQKSEARHQELLNKAASGSSSPPSSSGPDLSQLTDRLQRIENALSQLQRDVD
                     GRDYRKQFMQLHKAIETSHISLTEALLGMISSATPRMGLFICVVIIFQLILAGTYIFY
                     KRRRNGMPKKFL"
     gene            complement(<437571..>440009)
                     /locus_tag="TRUGW13939_05013"
                     /db_xref="GeneID:55992511"
     mRNA            complement(<437571..>440009)
                     /locus_tag="TRUGW13939_05013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488178.1"
                     /db_xref="GeneID:55992511"
     CDS             complement(437571..440009)
                     /locus_tag="TRUGW13939_05013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344071.1"
                     /db_xref="GeneID:55992511"
                     /translation="MAPNLRSSSRATSNNSRPSTPITTLPASEFTESARPRKQRRTGR
                     NSRIGIEILDDSRDNTAEPQPLGPSSTYKTNADKDLCNRKLDAEMSVNGKLSIDQLIA
                     NSDWPEPTMRDPQPSFKDYPWSSAWYGQNPALLSMRPLGQSPSVADKRKAGIKIPKPV
                     KEAIKEVKDLKKGSKKVVSQGNLVSGSDTPVTIADPTSLPIFPSKEYDVEKLRSVVQV
                     ALRVAEEAGNRAVTQGLRHLWDQGSSDPFALSILDSVMRKNPDSVQKAMFKVVMRDAY
                     KSSILSKDALVPALVNRSLSTASASSLSSAKSAEPKATETPAIGTPVTRGRKRARDSE
                     VLPAPASNTDDAADQKQQVDEAMDEEVEDAASIAKRTRRDNFPEITRESRIRSSLSAD
                     SSSDSSFDDSVVEVRKTRNRRRSTKTAAPRDEGPENNDNCRQCARSGNLLCCDGCVNS
                     YHFSCLDPPLDPANPPEGQWFCPSCQMRNSFGSLVQTLEQEEHDFQLPTNIREYYQGV
                     QTGKGGVYQQVATNLRSGPHGRGRREGKAELEYMTRLFDAKGKIIVCVSCGLTSNGTR
                     PMIQCDYCPCWWHIDCTDPPLSNPPKQLHPSDKTFHNWMCPNHIDHELHVNSSDNETY
                     TSKSRIRRPRNARVIDVDILPEDSEVEELQETESQGIVYRVSEHGVKLNFIERVRIEN
                     VQADVRAAGAKMYSDHACKKLDELVERATEFYKSAAPQISSDIEAAASILSSRSSADR
                     EAIANLVSFATQGSDTQDSQPQPIQPDRVNHLIDALLASSEVGAPRAQTELESLEALK
                     ELITRRIGTLQSSP"
     gene            complement(<442018..>443535)
                     /locus_tag="TRUGW13939_05014"
                     /db_xref="GeneID:55992512"
     mRNA            complement(join(<442018..442220,442278..443087,
                     443148..443252,443314..443397,443514..>443535))
                     /locus_tag="TRUGW13939_05014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488179.1"
                     /db_xref="GeneID:55992512"
     CDS             complement(join(442018..442220,442278..443087,
                     443148..443252,443314..443397,443514..443535))
                     /locus_tag="TRUGW13939_05014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344072.1"
                     /db_xref="GeneID:55992512"
                     /translation="MAESSEVDYTLNNPDTLTKYKTAAQISQKVLESVTGWCLEGSKI
                     IEICQKGDQLLDEEIAKVYKGKKISKGVGHPTTVSPSSFVTPYTPLVSDTEEAETTIK
                     AGEVIKIQLGAQIDGFGTIVSDTIVVPSSESQDVVEGREADLIHATYYANELLLRLMV
                     PPGLLASGTDEEKAKAAAQKPPTQSHISNLIEKVAKTYGVNVVENTTSWLFERNEIEA
                     NKKIILSPGSGVKGEGSAEVGEVWGVEVGLSLGSGKVKTLPQRPTLHRRTTTTYILKR
                     PSSRQTLSEIVKRFGTFPFSLRQLEDEKAAKVGVVECVRGGVVRQYEPAGDSDNAAVS
                     RLLTTIAITKNGLTRLAAPPAPDLTKFKTDKKIEDEEILKILEQPLARSTGSKGKNKK
                     KKKPAKKEGEEGDAE"
     gene            <443958..>444947
                     /locus_tag="TRUGW13939_05015"
                     /db_xref="GeneID:55992513"
     mRNA            <443958..>444947
                     /locus_tag="TRUGW13939_05015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488180.1"
                     /db_xref="GeneID:55992513"
     CDS             443958..444947
                     /locus_tag="TRUGW13939_05015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344073.1"
                     /db_xref="GeneID:55992513"
                     /translation="MGLPLKLLTGLVLFCIIPSSLAIKWFQPNQWVVIKPTDDLSLRV
                     LTHNIRYATSWPFKGEKPWADRKQGLLNELVYNTQHIPESFICLQEVLHVQMVDILSG
                     LNSAAATEEDKSPWAYIGVGRDDGEERGEYSPIFYRPAIWKLQHWETVWLSETPQKPS
                     KSWDAASIRIVTIGLFKHRTTSKTILVLSTHLDDQGSRSRFEAAHIILRKINEYLHRA
                     GGERISGVVLSGDFNSEEHQEAYQVLTAANSPLVDSHALISPAEHYGNEITWTGFGYE
                     DEEPKRIDYILLGPVCRTRGLPWTPRGYAVLPNRFEDGVFNSDHRAVVVDAVI"
     gene            <446236..>448644
                     /locus_tag="TRUGW13939_05016"
                     /db_xref="GeneID:55992514"
     mRNA            join(<446236..448269,448330..>448644)
                     /locus_tag="TRUGW13939_05016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488181.1"
                     /db_xref="GeneID:55992514"
     CDS             join(446236..448269,448330..448644)
                     /locus_tag="TRUGW13939_05016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344074.1"
                     /db_xref="GeneID:55992514"
                     /translation="MPSPDTSDGDLSHAAFAPGDSHPLIPHNGSENTGPEPSGPSQDG
                     ETNGSNLTSISESKQNAKAMLAASGISDHASTPNGANGVNASRKRSRSGSVISPNAPE
                     SLPVRVRETPVDKILLEQYVYREFQHNALAATRNTSQDLLQQKRVERDHLLALRRETQ
                     MNPAALYGTGYEGFGNHRTDLRNQHPQLLYPSHRRRPGGRKARELRVSRKDMKTQSEQ
                     REDLVPIRLDCDWEKVKIRDTFTWNLHDRVTSPELFAEKLVEDLGLAIETSGPLIRQI
                     TQSIHEQLGDYFPHVFMEDEALDPHLPYDAYKNDEMRILVKLNITIGQHTLVDQFEWE
                     INDPYNSPEEFALQMTNDLSLSGEFTTAIAHSIREQVQLFTRSLYITAHPFDGRPVDD
                     PDLKTAFLPSPLLSTFRPFQAAKDYTPYLYELNEADLERTEVSISREQRRQKRSVNRR
                     GGPALPDLKDRQRTIRTMVVSSVIPNSASSIDETHLYKRSGSGRTRRSGAGQRDGIDD
                     SDLSDSDDSSVGSPAIGVHLSQGTARTRGMRGAASAAQAALRANFTHSATPEPSVHEI
                     RAPRRREYREESSEEPEKLVVRLKISKDRFRFFLQEQKNRRQPSTPNVSGHSLPPKGN
                     TPQLQTPVQSTMPPPTAQHQSATPIRPGNTTGAAPTPQIGAVDAPPPPVSAPPPPAPR
                     WLVSGLEQLKRFYPNDQFEGVMRHSAVDTTTMMPVGNPAQANNPRLKYQYLPRIRCLD
                     CPGKLYTPGPGMTVDNFEVHLRNRQHKERVEERVGRRAAAPV"
     gene            complement(<449518..>454106)
                     /locus_tag="TRUGW13939_05017"
                     /db_xref="GeneID:55992515"
     mRNA            complement(join(<449518..451953,452005..453672,
                     453750..>454106))
                     /locus_tag="TRUGW13939_05017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488182.1"
                     /db_xref="GeneID:55992515"
     CDS             complement(join(449518..451953,452005..453672,
                     453750..454106))
                     /locus_tag="TRUGW13939_05017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344075.1"
                     /db_xref="GeneID:55992515"
                     /translation="MPARTRQTRTSNAEVLEPEEDQQGLQRLRFNEPLSWRVGKSAIP
                     VADLLDRLQVLAKELSSMEQDDIDKDSLKKVSQELANGHLLAHRDKGVRAWVTSCVVD
                     ILRLCAPDAPFTGNQLKDIFTCIVTSIIPALGDPSNAYNGQHIYVLNSLAEVKSIVLL
                     TDLDAPDALILPLFSSCFDIVSGSSKASTGEQVAKNVENDMTRLLVTIIDESPTLAPE
                     VVDIIIAQFLRVDPHVIEQPGKKGKKLEIDVNQDTLLLKEYPPAYDMAKAICHACPEK
                     MTSHISQYFNNVIIDASAPSGSLNGPKQSSNRRHSFGESDDEAEDIKELGKAHRLIRE
                     LWRACPDVLQNVIPQLEAELSAESVSLRLLATATLGDLAAGVGIAGPPPAAPMDPAAY
                     PPVTLRDYSQIIPQPNMLQTPLAPKPFAQAHSSAYESFLSRRQDKSASVRSAWTTAVG
                     RILLTSAGGSGLSESDEQSMVRSLANMLRDADEKVRLAGVDAVGSMGFSDIMNKLAIT
                     GGLASADSAISILAERVKDRKPAVRDRAMRVFARLWGVAAGEIEEGNDQVITLIKDAP
                     SKIYDAFYTNDPEIQALIDRVQFEYLLPLSYPPIKAKQTKANSSQRLRGSQESQKDAE
                     GSVDKIRVERILTLLKGLDDKSKRVFFAFQGRQINLRTALTIYLQTCEEYNGGVVEKD
                     EDRVKAQLTRVIDTISKSLPDSQRVSADLWKFAKTHDRRNYQLIRFAMAAQSDYRTVT
                     KAIKELAKRIQSGNTPSLLDTLTPFLYRASSLIFNRSHIPAIMQFSRTDEKGLANSAQ
                     EMLKEISSHNPEVLEAQVQEMCKDLEAQAPSAKSSDDVSVEEILKACSGFAKKLPEKL
                     PKERKFLQALTNYALFSSSPRAAKHAVSIIMAVADKKEMYAKDLVQKCVKDCEFGSDY
                     FLTRLATIAQLNLLAPKQTDAESAKIISMAIDEILLTNRSKEANSEYTWSDEVDEETR
                     AKELALKIIVNRLRGKEGVEDEEFPTLAEPVYSTLNKLVAGEGEISKKKDTPSTQKPH
                     LRLHAAKLLIKLSATHASCDQLLEPQDFHLLALVAQDRLLPVRSAFVNALRKTLSQKS
                     LLGVRWYTIPCLLAFEPSPTLKESTLTWLRSRATLFSRQMQASAKGKEQAVMESMFAR
                     LLSLLAYHPDYPPSSQDTETRLAELADFSRYILFYLSAVANENNISLIYHVAQRVKQT
                     RDGITRSDEITTRLHTLSDLAQVTIRLFADVYAQQHKIGGAGGSGSILETYPGKMRLP
                     SSLFSAMASHKEAQDVADKSFLPEDFDDVLDGIVRSWMRPRKQSHAANAGRKRKSEYA
                     ATNGNGEPKKARKQRSSGGRKSLGTKVFKKKRNAEDEWGSDFDGDEKGTAASRRRSGR
                     GVGKGVSYADRDSDEDDLEMEKIEQNDEEEEDEDEDEENEDGEDDEGEENSDDENKEA
                     SDDNDEEMADAEPSPPPVKTKKSTPAKKASPVQKSTKTESLPVRRSTRRG"
     gene            <454984..>455700
                     /locus_tag="TRUGW13939_05018"
                     /db_xref="GeneID:55992516"
     mRNA            join(<454984..455020,455132..455172,455234..455317,
                     455398..455519,455592..>455700)
                     /locus_tag="TRUGW13939_05018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488183.1"
                     /db_xref="GeneID:55992516"
     CDS             join(454984..455020,455132..455172,455234..455317,
                     455398..455519,455592..455700)
                     /locus_tag="TRUGW13939_05018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344076.1"
                     /db_xref="GeneID:55992516"
                     /translation="MAAKTHIKIVKKRTKRFFRHQSDTFKCVPAAWRKPKGIDNCVRR
                     RFKGTIAMPSIGYGSNKKTRHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIASAVSS
                     RKRVDILAKAKALGVKVTNAKGRVTTES"
     gene            complement(<456178..>457731)
                     /locus_tag="TRUGW13939_05019"
                     /db_xref="GeneID:55992517"
     mRNA            complement(join(<456178..457461,457519..>457731))
                     /locus_tag="TRUGW13939_05019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488184.1"
                     /db_xref="GeneID:55992517"
     CDS             complement(join(456178..457461,457519..457731))
                     /locus_tag="TRUGW13939_05019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344077.1"
                     /db_xref="GeneID:55992517"
                     /translation="MAVPPPDPVIEPPAVVVTPCNPPARYYFEGGFRRVKPYHHTYNT
                     WCKERWRGRTLLDIFASEFRDRTIEYYKEAIEKGLVTVKGEIAGVDTIVNNGSVVSHT
                     THRHEPPVSDLPIGIIHEDDEMIVIDKPPGIPVHGAGRYFHNTIIEILKSERPNLVPR
                     PCNRLDRLTSGVMFLGKTAKATEKFCKQLQARSLQKEYVARVNGRFPDGVVLCDQPIM
                     SISPKLGLNRVRATGKDAKTKFRRLAYYPPQKANDDGSINEEDGYSIVHCLPLTGRTH
                     QIRVHLQFLGYPISNDPIYSNLRVFGPDLGKHDDSDQKDTEIIDRLNNMGKTEMADTA
                     AYRTHITCPPAVPPDTDPNIVEAMLAREHEAAVDRYHLRKGEKLSGGICDVCETPLYT
                     DPGPQELIIFLHAARYSDHACSWSYKSKLPTWAIPPEGREGPTEIPEWRDPGEDEELI
                     INNGYQSKTEDGDDTREDDIMALVHGVGVINVSQRVRNGENPEALVVE"
     gene            <458386..>458939
                     /locus_tag="TRUGW13939_05020"
                     /db_xref="GeneID:55992518"
     mRNA            join(<458386..458456,458516..>458939)
                     /locus_tag="TRUGW13939_05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488185.1"
                     /db_xref="GeneID:55992518"
     CDS             join(458386..458456,458516..458939)
                     /locus_tag="TRUGW13939_05020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344078.1"
                     /db_xref="GeneID:55992518"
                     /translation="MDVRSKKLRTRQNYPFQLEYRTRWSDNDMYGHLNNSIYAFLFDS
                     IINSYLISHCGLDPSQHQKTTEKTHNQIGLVVSSYCDYFASVGFPDVLDLGLRAVKLG
                     SSSVTYEVGVFKKGEDAVKVVGGFTHVFVERETMRPRAGGGGMHDRIRQGLDKLFVGD
                     ASKL"
     gene            complement(<459144..>459650)
                     /locus_tag="TRUGW13939_05021"
                     /db_xref="GeneID:55992519"
     mRNA            complement(<459144..>459650)
                     /locus_tag="TRUGW13939_05021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488186.1"
                     /db_xref="GeneID:55992519"
     CDS             complement(459144..459650)
                     /locus_tag="TRUGW13939_05021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344079.1"
                     /db_xref="GeneID:55992519"
                     /translation="MAPNIFICLRNALCPLYWVEKGNRVNGDVAKDEHWDSPVPGTYR
                     FIPERGWHLIRRDGAEDDKQEQPYVPVVYCRIVHRYLLASDMQQRCRYHKVELHRGEE
                     PQRCLFFRLDDGFTWVIGWDSRGKFIPGPYRKWCYDKELMKMRRMTSYEDSSAATSPS
                     TSRNGSLA"
     gene            complement(<461619..>464408)
                     /locus_tag="TRUGW13939_05022"
                     /db_xref="GeneID:55992520"
     mRNA            complement(join(<461619..461936,462000..462084,
                     462142..462208,462262..462363,462420..462583,
                     462638..462792,462857..463493,463555..463814,
                     463872..463900,463961..>464408))
                     /locus_tag="TRUGW13939_05022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488187.1"
                     /db_xref="GeneID:55992520"
     CDS             complement(join(461619..461936,462000..462084,
                     462142..462208,462262..462363,462420..462583,
                     462638..462792,462857..463493,463555..463814,
                     463872..463900,463961..464408))
                     /locus_tag="TRUGW13939_05022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344080.1"
                     /db_xref="GeneID:55992520"
                     /translation="MASLELFFLYLRIFFISFMSRARSLFSFITSPSIITEHGKLEKL
                     QAKLGSDGAPNSWLQHRHSKLVDPSTYNDLGLCGGLPLRVHKHAHLADKGARRAQEDW
                     KRLVGPIRDFTGCLSPRFNGIAVAIPECIPERLEAVTYANEFAFLHDDILDTVGKEDG
                     EEENNEMARGFESVLEPSRNVKMSASGKSQMQAKLILELLEINEPQAMVLLKSWEGLV
                     KGESGSQHFDFQTLDEYLPHRVVNLGQTFWFGIITFAMGLTVSNKEMELTKPITEPAY
                     ATLALANDFFSWEKEYVEFQGNPTSENMANAVWIIMKEHSVDLEQAKVICQDKIRESC
                     EEYGRRKREFELQSADKVSTDTLRYLSALEFSISGNVVWSQYSERYHFHKPEKWRQVQ
                     NIDDDGAKSDDSGIAMKDSPESTVVDVEDDVPSAFLNFGSSGMTTRSKKTFVSPVLET
                     NLPEMTNQVVLAPFQYVSSLPSKKIRHHAIDALNIWFSVPEADLTMIKDAIDQLHNAS
                     LMLDDIEDNSPLRRGNPSTHMIYGVPQTINSANNLFVMSLDTIRKLENPACLDVFISE
                     LKKLHIGQSLDLFWTSNVRCPTFEEYYKMVDYKTGGLFQMVAKLMAAKSPKSKRKVPG
                     VLTLTTLFGRYFQIRDDYQNLMSKEYTDQKGFCEDLDEGKFSLPLIHCLTTSPNIRLQ
                     SILHQRKTMGKMSFETKKLVLDHLEETKSLQYTKEMLDRLHARLHKELDVLEKQTGVD
                     NFLLRLLLKRLHVK"
     gene            <465468..>469467
                     /locus_tag="TRUGW13939_05023"
                     /db_xref="GeneID:55992521"
     mRNA            join(<465468..465613,465676..466073,466255..466412,
                     466474..467291,467790..467856,467911..469011,
                     469069..469235,469296..>469467)
                     /locus_tag="TRUGW13939_05023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488188.1"
                     /db_xref="GeneID:55992521"
     CDS             join(465468..465613,465676..466073,466255..466412,
                     466474..467291,467790..467856,467911..469011,
                     469069..469235,469296..469467)
                     /locus_tag="TRUGW13939_05023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344081.1"
                     /db_xref="GeneID:55992521"
                     /translation="MIDSLSYTTMPVVLFAGLVLYQLLAFTYRLFFSPLAKFPGQKIA
                     GMTHWYEFYHDVIRRGQYTFHIRDMHKKYGPILRINPYELHISDPGFYNEIYAVQNRR
                     RDRWEWSTRPGGFGGSVGGTNPHELHRRRRAALNPFFSRANIRKLQHEIDQKAVQLVE
                     RLEKEKDRVIKVNHAFAALTNDFDPSFHDNFVAGVSCLNLLRHVFILDRAARALPMEI
                     LSKISNVVAMFWQEKQSITEEVRQILNGTNKAYKERPNRTIYHGILESKLPPEEKELN
                     RLAEEAQITIGAGTLATAWVMSVGMYHLLAPGSVSMLKTLREELQRAIPNPSEPIDLA
                     ALEKLPYLTGVVKECLRLGNGTTTRLQRIAPDETLIYTDPNTGKVWDIPPGTPVSLSS
                     LHIHHDETIFTDPESFRPERWIENPDLDRFLLTFSKGSRQCLGIHLAYAEMYIVLARV
                     FRLYGRKEEGPSKGTSDKLGNLELFQTELRDTVCVADLVVPAVWEGSQGIRLKVTEYE
                     THKTNLLMEQREIILLGLAALAATYQVIVWIYNAWFHPLSGYPGPKLFGASYLPGLYH
                     RIQGDYVLVHTALHERFGEVIRVSPNELSYINPQAWKDITGQGSGRQDMEKDPLSFGR
                     PMPNAPSIFNAHRTDHSRIRRTMSHAFSASALRRQESLIQSHVKMMIQCLNEHNEEVI
                     DMVSWYNFTTFDMFGDLAFGESFGCLTNSLYHPWVKMLIMSMKAGYFIIQAQKYPIFE
                     KVLMSFIPRMMRQRRRDHLALTQAKLAKRMAKPEERPDFLSFILRHQDEATGMSLPEL
                     EINASTLIVAGSETTATLLSGCTYYLLRNPRVMEKLLHEVRTTFKSEDEIDITSVNGL
                     KYMLAVLDEALRVYPPAPGNFHRLVPKEGSVICEKFVPGETQVSVCHYAAYRSPCNFH
                     QPDEFIPERFLGDSKFENDRRDVLQPFGTGSRACLGRNLAYFEMRLLLAHVLWNFDLE
                     LMPRSEKWANQKVFAIWDKPELYVKLKPRAELGVSA"
     gene            <470960..>472423
                     /locus_tag="TRUGW13939_05024"
                     /db_xref="GeneID:55992522"
     mRNA            <470960..>472423
                     /locus_tag="TRUGW13939_05024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488189.1"
                     /db_xref="GeneID:55992522"
     CDS             470960..472423
                     /locus_tag="TRUGW13939_05024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344082.1"
                     /db_xref="GeneID:55992522"
                     /translation="MVTKTYTVGPHNPFEAQYPLSSCDLQVPPVFTCKAFIYSTNGNL
                     SASSPEAQGLVSRLQDSLVSFLQPISPGVLAYPQILGQIVKPVDGGRPCIAVKKSFSI
                     QFKVVEMPDIEFSSLHHNGRFSVDAINIAGFRDGLDRASLMNLPEVSHNFTFQLTFIN
                     GGFVLLAQVAHQITDASGFAGFIRHWFQRARDGSSTYSQVESNPQVSLAMHDKSRLCQ
                     EDIQGDTDALRKLELAYKDVPTVKRPVAIGNGERVAKIFWVSAQSLKDLRTTLQAESA
                     NQPTSFQAVVALLWRCIIRTRLTPENNTPSTMSKGFLVTNMSQRLSPPLPKDFFGNSA
                     TWVFAEIPQSALLEEKRHASAINAIQKTLQEDTTELSLQLANQFISRQMQVGVYPPMD
                     LTGNDVLFNSWEHFYPDLVDLDIGLGSFCTMRRLTDSIVPSLVLILPSYGRRSHGPED
                     KNPCQYPGGIEVQVHLFANQMELLQKDPEWLHYASTI"
     gene            complement(<472971..>475061)
                     /locus_tag="TRUGW13939_05025"
                     /db_xref="GeneID:55992523"
     mRNA            complement(join(<472971..474186,474245..474399,
                     474465..>475061))
                     /locus_tag="TRUGW13939_05025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488190.1"
                     /db_xref="GeneID:55992523"
     CDS             complement(join(472971..474186,474245..474399,
                     474465..475061))
                     /locus_tag="TRUGW13939_05025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344083.1"
                     /db_xref="GeneID:55992523"
                     /translation="MACDSQTSCEGCSCSSQENKKPINIEDCQEELLALRRRTQQLES
                     KLASLKVDGVSREKESSPSRELRSRKWFGKNVKPEMGAIYLERYLNYGITREELTSGK
                     PIIGIAQSGSDLVPCNRYHLELSKRIREGIRSAGGIAFEFPIHPIQESSRRPTACLDR
                     NFAYLGLVEILYAYPLDGVVLLTGCDKTTPACLMAAATMNIPSLCLNVGPMLNGYVKE
                     ELAGSGMVVWKGREMLSAGEMNHDQFIDYVSKGAPSAGHCNTMGTASTMNALAEALGM
                     ALPGSAAIPAPYRERAQCAYETGKHIVEMVLTDRKPSDIMTRGAFENAIVVNSAIGGS
                     TNAPIHVTAIAKHMGVSLTIEDWDQVGFDTPLLLNMQPAGEYLGEEYYRAGGLPAIMA
                     ELLDAGKLRADVLTCTGQTVADNVRGKHSWDRRVIREYKNPLLVDAGFRHLQGSLFDS
                     AIMKTSVISEEFRKNFMENPEDPDAFEGPVVVFDGPEDYHNRIEDESTPIDERTLLVI
                     RGTGPLGYPGAAEVVNMHPPGRLLKKGVHSLPCIGDGRQSGTSGSPSILNASPEAAAG
                     GNLGLLRDGDKVRVDLRKRRVDILISDEELKKRRDELESKGGYHGPESHTPWQEMFRK
                     ETDQLSEGMVLRDAIKFQRVAQRWDEPRHNH"
     gene            complement(<476001..>477550)
                     /locus_tag="TRUGW13939_05026"
                     /db_xref="GeneID:55992524"
     mRNA            complement(join(<476001..476556,476610..476787,
                     476849..477302,477360..477416,477479..>477550))
                     /locus_tag="TRUGW13939_05026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488191.1"
                     /db_xref="GeneID:55992524"
     CDS             complement(join(476001..476556,476610..476787,
                     476849..477302,477360..477416,477479..477550))
                     /locus_tag="TRUGW13939_05026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344084.1"
                     /db_xref="GeneID:55992524"
                     /translation="MRNRLLHVANSIQQWTKPLKLTSTVLSLGHDASKEDIRKAYRKA
                     ALSSHPDKVPEAERETAEIKFKAVQQAYDILYDEDKRHLYDTHGMSAFDGSGNAGMGG
                     GPDLDDILAQMFGGMGGMGGMGDMPGFGPGGRPNKPRKSPNEETKYEVTLEDLYKGKT
                     VKFASTKNVICGLCNGRGGKEKATAKECSSCEGRGQKTVLTRLGPMLTQSTVPCTVCE
                     GQGKFFSPKDKCKKCKGKKVTEERKMLEIYIPRGAKEGDRVTLEGEADQVPDQEPGDI
                     IFHLEEVEHPVFRRAGPDLTADLQVTLAEALAGFSRVVVKHLDGRGIEITHPRTPGEV
                     LSPGQVLKIPGEGMPHKRSDAQGDLYLVVDIKFPDETWAPSPAVLEKLKEILPKPEPP
                     IEAETVDEVDYESNADIEEFGQGDPRGGGGWDEEDGEGETAQCATQ"
     gene            <477884..>480179
                     /locus_tag="TRUGW13939_05027"
                     /db_xref="GeneID:55992525"
     mRNA            join(<477884..478226,478286..478323,478376..478795,
                     478852..479106,479155..479322,479595..>480179)
                     /locus_tag="TRUGW13939_05027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488192.1"
                     /db_xref="GeneID:55992525"
     CDS             join(477884..478226,478286..478323,478376..478795,
                     478852..479106,479155..479322,479595..480179)
                     /locus_tag="TRUGW13939_05027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344085.1"
                     /db_xref="GeneID:55992525"
                     /translation="MISPRYRILTARPAWICIQCRANSSVASRAASPQVHRSKTTVLD
                     KAARTRFAPSPTGYLHLGSLRTALFNYLLAKRTGGQFLLRLEDTDQKRTIPGAEERLY
                     EDLQWAGLEWDEGPNVGGQYGPYRQSERTAIYRAHADSLISTGHAYRCFCSAERLDTL
                     ARHRNEAGLPLGYDRKCADIRPDEAEERAAGGETHVVRLKTDGYPMFRDLVYGKTGQN
                     RTGGKKPVDFIDRVYEDPILLKSDGHPTYHLANVVDDHEMKITHVIRGTEWMASTPMH
                     VALYNAFNWTPPEFAHVPLLVDKNGQKLSKRNADIDISHFRDSGIMAPVLLNFAALLG
                     WSHTSRSDVLSLKDMEEMFNLKITKGNTVVAFEKMWFLQKAHAQRIAAANGLELEELE
                     DKSEAAAKTLVAGTEASQTPLRGVVRLLLQADAKSYTTPEEFINRNKTFFIAPSNRPV
                     YKPAANDSTTVPISALHTAAAALSLVPDGHWTIENHRFNIKSYNTVPPGTETNNIVDG
                     ESTAKLIAQDKAFKKELYHYLRWALSASAPGPGIPETLTILGRAESVRRLEEARRLTT
                     PEVTHVNTCRVPKTPVQAPAMENADKSWMGSLAPKE"
     gene            complement(<480842..>483327)
                     /locus_tag="TRUGW13939_05028"
                     /db_xref="GeneID:55992526"
     mRNA            complement(join(<480842..482769,482825..483039,
                     483099..483151,483211..>483327))
                     /locus_tag="TRUGW13939_05028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488193.1"
                     /db_xref="GeneID:55992526"
     CDS             complement(join(480842..482769,482825..483039,
                     483099..483151,483211..483327))
                     /locus_tag="TRUGW13939_05028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344086.1"
                     /db_xref="GeneID:55992526"
                     /translation="MSVDTSDLTTQVNKIISQLHGIFDDIGVPNHEREAKETELFGAL
                     SVTLNNHLRIINNEKTAMVEEAEHLVQTIRQMEASLDDEKANGQYDLNHGDLRITFPL
                     NRCIAFLKEKYSAISKLHRERFEQVKKLVEALESYSSHLESSFVKIALPPTSPNASIP
                     PNFDLSPSYVAALDNEFTRVYEEYNKRVHLVTATSEEIIKLWAELGTSQAQTDSTIVK
                     YYRDAPEQLGLHDTDLANLKGKRDKLLDEKRNRERKLKDLKTAVEGLWERLGVDERDQ
                     KAFLAANRGCGLRIINEFEEELARLNELKRQNLHLFVEDSRCRLQELWDDLYYSEEEM
                     LDFTPAFSDVYSDALLEAHEAEIVRLEALKEQRAPALELITRHKNLIQERDSLAASSQ
                     DASRLMARGNKGERRDPGKLLREEKMRKRISKELPKVEVELRKLLEKWEDEYGRPFLV
                     YGERYLDELTPAASKMPPRSKTPSGPPPSSAAKARQPQSQGTVRGAPPRSATKTPTGT
                     MRRNQPPPSSVSTTTQQKSPSKIPSRVPLSNMPHGNNSPERRQPQNSYSSNTIRGKMP
                     PRAPPPKMRDLFNDPNEDTPAPSYIMEPSRCESVLSSRSTRPISLDDVYDDRQQRSFM
                     NQSLMSRSRVETTSSHGSSQSLHSTASREMAYPSDSSYSLRQQPPPPAMRQASNSTIQ
                     TASGSENWETYDDVSEPETDASDVYYAKLRAAHGKRFAPDDQQNVIQMGKKMKGIRSV
                     GSDERIIEHNGQFVRIEGSDGGWTDELDSY"
     gene            <483910..>484968
                     /locus_tag="TRUGW13939_05029"
                     /db_xref="GeneID:55992527"
     mRNA            join(<483910..483934,483992..>484968)
                     /locus_tag="TRUGW13939_05029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488194.1"
                     /db_xref="GeneID:55992527"
     CDS             join(483910..483934,483992..484968)
                     /locus_tag="TRUGW13939_05029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344087.1"
                     /db_xref="GeneID:55992527"
                     /translation="MEAAQQSWEFENSVQLADPKRDALYNYDEAAHNELSNAKPWRTD
                     PRYFKSVKISAVAMLKMVMHARSGGSLEVMGLMQGYIAAETFVVTDAFRLPVEGTETR
                     VNAQDDANEYMVGYLQSCRDSGRMENAVGWYHSHPGYGCWLSGIDVSTQAMQQMSDPF
                     VAVVIDPDRTISAGKVEIGAFRTYPDGYTAPKEGTEDDEYQSIPLNKVEDFGAHASQY
                     YALEVSHFKSTLDTQLLSLLWNKYWVATLSQSPLFTTRDYGSKQIMDLSQKVKRAARG
                     IEGGTSRGGPARDQQLGKVVRDGQRVVAEEVSGLVAADIKRTLFQDVGKTASAGEQQ"
     gene            complement(<485174..>488574)
                     /locus_tag="TRUGW13939_05030"
                     /db_xref="GeneID:55992528"
     mRNA            complement(join(<485174..485942,485998..486118,
                     486198..486586,486643..486806,486862..488247,
                     488323..>488574))
                     /locus_tag="TRUGW13939_05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488195.1"
                     /db_xref="GeneID:55992528"
     CDS             complement(join(485174..485942,485998..486118,
                     486198..486586,486643..486806,486862..488247,
                     488323..488574))
                     /locus_tag="TRUGW13939_05030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344088.1"
                     /db_xref="GeneID:55992528"
                     /translation="MSPSSKKHPGASDVEILNEPDWTLTHNHRVGTRGRDARFMGVTH
                     TGDERPFELEKIAEEELDQLREQVSKGELITVRDIMTKQKDFHLERPDVHPNFWRYVL
                     HTTESYIKQEQPWPINKKKEEEQGKKQREKEAEEKEQREQENIKRPGGEKQKQKENEQ
                     KKKGSGEDEERNDNANSKPASSPEEEALLQYLRHEQEYRSLMQTDDGRGRCPIQNERL
                     PEKIDEADQFSPDSWVPRSDKLIRLTGKHPMNAEANLTTLFEAGLITPSPIHYVRNHG
                     AVPHLLWENHKLEVVADKYLVFGMDDLQKQFESVNIPVFMACDGNRRKELNMIMKTRG
                     FNFTAAASGCSYWRGVLLCDVLMFAGVTQLVEKNPEKQFWVNFEGADTLTEGKYETCI
                     PLDYAMDRNNDVMLAYQMNDHPIPPDHGYPLRLILPGWVGARSVKWLARVWISDHENG
                     SHYHIYDNRQLPSFITDTSSDIAQTMFRHHSTICNEQMLNSVIARPAQGEKIDLVDVK
                     KGKMYRITGYAYNGSGDEIDKVEISLDGGEHWLYCVRKYPDAPIRHSLKFWTWLHWHI
                     DLDITKLIRAQSIIVRAFDVHKNTQPPKPVWNIEGMMNNCWYEVKPEVFDDPQNEEAY
                     LLFRHPVDAGNGKNGWMEESTEERIEEVKRKVSAPEKQFTRQEVEKHGNEDDCWIVVN
                     GNVYDATSVLSWHPGGKGAIMAHAGIVHMETTDEFEGIHDDYALGQLKQCIIGKVTQR
                     AMDYMTKDAEQKKQERSQVKHDPEAALDKYKWIQARLLNKAKLSEDTNLYTFGLPPPT
                     TKLGLGTGQHIQVGFHFQDRLVVRPYTPVRPVMESEDDGSFDLVVKTYYPDTTQPGGT
                     MSNILDCLRHGEEIEVKGPAGDIQYQGGGRFVIDGREHRFNNVSLILGGSGVTPGYQI
                     IARILEDQEDNTKIKVIDTNKSEADILMSGDFDQFAKNHADQFAIVHVLSHASENWKG
                     EKGHITEDIIKQHAFEPDRNNVALLCGPPMMIQKIALPVLKDWGYEEDNNLFGF"
     gene            complement(<490436..>494266)
                     /locus_tag="TRUGW13939_05031"
                     /db_xref="GeneID:55992529"
     mRNA            complement(join(<490436..490779,490869..491085,
                     491141..>494266))
                     /locus_tag="TRUGW13939_05031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488196.1"
                     /db_xref="GeneID:55992529"
     CDS             complement(join(490436..490779,490869..491085,
                     491141..494266))
                     /locus_tag="TRUGW13939_05031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344089.1"
                     /db_xref="GeneID:55992529"
                     /translation="MYQPGVAPMALNIHPGFASKSGAITTTLRYAEDDQSDMVSSPPR
                     AASGGRQRSHSIQQELGQSSPQRQMSPIKLTEPLPALYVKALYDYDADDHTSLSFRQG
                     DVIQVLNQLETGWWDGVIGNVRGWFPSNYCAIVTNLDEIEELSSHRMVSDAGDTSAES
                     GLDDDYEDEHEDEFDLEHHNQRDSQPILPIEGTGPGEQEEAAFWIPQATPDGRLFYFN
                     TLTGTSTMELPLENPLLANEFGPRDRNNFFVPDQTRPPPEMMARGVERDEDDYDGSGS
                     EGEGESLMLASRDSISRRRRSLSDDVSPATSMDSLNPSPVSKSTQQKYTSQSSFSHPS
                     GRPSNASSIPRHFVDDTPGSRLSWSDLLENMRNAIEAYRQAIRNGDRSEYVRKAEDIS
                     DHLRLLLAAGSDTTDNHSGNPSIISSNRTLYPHFRDMMSKFSKLVLSSHIATSDWTNP
                     DSAVKCLQEADGVWQGVYGYVEVASQQRGDNINRIVPGFVLNSSSGGHWMNNGIKNSE
                     SGATSFLEPDGQELGQEPSVSLDLALLDQIDLMRKSLALSIRKLEEQLVLSHKAITQK
                     QHQTLSDTICLAAISVVEKYRPWIMTVESINLAPLGTSLQNPQLVDFGMQKQRVYETI
                     ADLVLSCQSVSAPLGDEWAELRGDSLEDRLNGVRSVTRQLEAYASQIGFSLSLLQEQI
                     PEQSRDSNDQTHFVDDGAMDPFQKASNRVDPARRKTTASVVPALPFGLDDDGNKVRRN
                     MEKAQRFFGQAPPTTITREPLREPVAVPEETPWFLNFDHEGEVFYDNKADVPTLKCGT
                     LEGLVEQLTRHDKLDASFNNTFLLTYRSFTTAPELFDKLVQRFSIQPPYGLTPDELQM
                     WVDRKQKPIRFRVVNILKSWFENFWMEINDEANMNLLRQVHDFTKDSIATTKTPGSPQ
                     LLAAVEQRLRGQDTTVKKLVPTQSMPIPNPILPKNMKKLKFLDIDPTEFARQLTIIES
                     RLYGKIRATECLNKTWQKKIALGETEPAANVKALILHSNQLTNWVAEMILTQGDVKKR
                     VVVIKHFVNVADKCRAMNNYSTLTSIISALGTAPIHRLGRTWTQVSGRTSTVLEQMRR
                     LMASTKNFGEYRETLHAANPPCIPFFGVYLTDLTFIEDGIPSHTPSDLINFNKRAKTA
                     EVIRDIQQYQNVPYQLQPVHELQDYILSNMQAAGDVHEMYDRSLEVEPREREDEKIAR
                     YGKNNTDSSPSSNMTIASIVAAMR"
     gene            complement(<497760..>499385)
                     /locus_tag="TRUGW13939_05032"
                     /db_xref="GeneID:55992530"
     mRNA            complement(<497760..>499385)
                     /locus_tag="TRUGW13939_05032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488197.1"
                     /db_xref="GeneID:55992530"
     CDS             complement(497760..499385)
                     /locus_tag="TRUGW13939_05032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344090.1"
                     /db_xref="GeneID:55992530"
                     /translation="MATVFTNGRFFTGSGSKANSEDAAFEECMVIEGDTITHVGHATD
                     EQVAQARADGAAVRDLGQRYVLPGFVDGHMHLLLLGQSLQKLDLDHCTNLADIRTTIR
                     SFAQANPAAPRVLCKGWMQSMMDNEALASMLDDLDPRPIYIDSKDLHSTWCNTAALRE
                     LDVEAMPDPPGGTIHRDPETGNPSGLLSEAVVFSLIWPHLARVASTEDKLNALRGAIS
                     AYTACGYTGLVDMAMDENSWEALLQLRQQERLTLRIAAHWLIVPSTDPAADLAQVDRA
                     SELHAKYNLDTSPDFRIAGIKVICDGVIDGCTAALLEPYTLNGVSCDPLWPAEKLAPV
                     VERAVQAGLQCALHAIGDATVHTVLNVLEAHADPTRRHRIEHLEMTTAEDAARLGKLG
                     ITASVQPVHSDPDILRAWPALIGPERCRRAFAYRDFVDGGAPLAFGSDSPTAPFKPLP
                     NLYTATTRRSARLPASKETVNAHFALPLVIALTAATTGAAYSCFSDTITGRLKKGLRA
                     DFVVVDMEWSADRLLQAAVEETWFDGKAVFTAD"
     gene            <505658..>508273
                     /locus_tag="TRUGW13939_05033"
                     /db_xref="GeneID:55992531"
     mRNA            join(<505658..505793,505851..507013,507081..508075,
                     508132..>508273)
                     /locus_tag="TRUGW13939_05033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488198.1"
                     /db_xref="GeneID:55992531"
     CDS             join(505658..505793,505851..507013,507081..508075,
                     508132..508273)
                     /locus_tag="TRUGW13939_05033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344091.1"
                     /db_xref="GeneID:55992531"
                     /translation="MAPTAPAAATNSPAKKTTAPEKKYKCQFCNRAFSRSEHRSRHER
                     SHTKERPFKCLKCRSTFVRRDLLLRHDRTVHAKDGGVPLVSEGRRRGGNNSNAGVQKS
                     SPAPAASSKPSITIDPATLEQIEASSDGMVDLETAAMLMTDFQHKAAAAATGHVQDRT
                     GSDHSFSPSRTSLLDQHASYLSGNATLPQMPWDSLISPTETKHHPMSAFTSHDANSHQ
                     MSMMDRHMSARDTLAPSLHTLVDSLPVSGNSTPNALSPYPSMTGPVSPVNYRRSPGPT
                     QALTLPKAPQLANEAERQRIVDNIKGADALSSLPSEFQIPSTPSLNKYLSTYFNLYHH
                     HLPFLHQGTFNPTDASPPLLLAVLSIGALYTFEREHAFMLHVGSKVLVNQFLQQKDNF
                     DSRKCPLWAMQSTLLNMVFESWSGDPKGLEWTCSIKSLLANMVAGNRYQLKLRTVARE
                     GRLPSRDQWIEDESCRRTYYAVYIFFGMLTLTFNHTPAMSFDELDSLELPSSESLWNM
                     DVTDEESWRRTLATVIPVNIREAHDRLFQGEQTRYSAFATRVMINALFLQVWSHKRSF
                     EALQDVVTEYKLRLALETWENSLELCEAETIVVPLSTPHKGHPLIFNSMAIYRNTRAR
                     LEVDLKSVQEALRYHSSYEVAAAMTVARDKVKRSPEMNKVIQQCFECIEIAAVQGINW
                     VAKTSATNWSVEHPLCGLDLMVILSLWLYRLEHDEEPATEAEIAIYSKVRNLFDDDAI
                     DAFGKLSSTVSRVWGNILDGVVVWGITKLMGESFKLHAQALVGYEDSLHVAKDQPLHP
                     MPTKSLASVGTAY"
     gene            <509447..>510835
                     /locus_tag="TRUGW13939_05034"
                     /db_xref="GeneID:55992532"
     mRNA            <509447..>510835
                     /locus_tag="TRUGW13939_05034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488199.1"
                     /db_xref="GeneID:55992532"
     CDS             509447..510835
                     /locus_tag="TRUGW13939_05034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344092.1"
                     /db_xref="GeneID:55992532"
                     /translation="MVDDEKIEEVDEEHAVAPLSEITAQRPVEPTDIQQRPGGAPLYD
                     THGGNDAIAELVAEPPVDRTSSTQQQQQQRPPSRRPSAELPSLSNLATKLYTLSYLVF
                     FAILGTLARLGLQALTYYPGAPIVTGVLWSNFGGCVLMGFFVEDRNLFREEWGHPPHS
                     SNQSTDSARIKKHKTVKKSIPLYIGLTTGFCGSFTSFSSFMRDAFLALSNDLTDPSFS
                     SSSATQGRNRGDSFMAVVAVLIFTVSLSISGFYLGAHIALALDPWVPTVPFRITRNIL
                     DRVMVLLGWGCWLGAVFMSIWPPENSWRGQAVFAIVFAPLGCLFRFYVSLLLNPRIPY
                     FPLGTFAVNIIGTGVLGMCYDLQHVSGIGASPASGWAEVYSPSRSSLFGDSDLSSLIV
                     SCQVLQGVMDGFCGCATTVSTWVAELTSLGRRRFAYMYGGVSMAVGLGLLAVVMGSVK
                     WSRGFESPTCTS"
     gene            complement(<510998..>514105)
                     /locus_tag="TRUGW13939_05035"
                     /db_xref="GeneID:55992533"
     mRNA            complement(join(<510998..511344,511410..511550,
                     511786..512194,512257..512470,512528..512679,
                     512731..512833,512890..513151,513204..513276,
                     513330..513374,513428..513936,514003..>514105))
                     /locus_tag="TRUGW13939_05035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488200.1"
                     /db_xref="GeneID:55992533"
     CDS             complement(join(510998..511344,511410..511550,
                     511786..512194,512257..512470,512528..512679,
                     512731..512833,512890..513151,513204..513276,
                     513330..513374,513428..513936,514003..514105))
                     /locus_tag="TRUGW13939_05035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344093.1"
                     /db_xref="GeneID:55992533"
                     /translation="MSDKEVVSFSSGATGSEEWSPDIVVGVDFGMTYTGVAYSCAPAW
                     LPPKTIQRWPGKLPGELANKVPTCIEYEADSTTVKNWGFLCDPEDETSVIREFFKLHL
                     APQYHDPSGPSRAEAQRWFRDYVQCIYKHVANFLASTIPDFPYRKVEFLFSVPTTWKD
                     VRMIEETRALIEQAIVMRTANHRASIGLTEAEAAAVYACKQHYQKGDIIMICDAGGGT
                     TDVNVLRLLSSTNEPTVLQQLGNVEGRPIGSVFIDKAMHKFLCERLSNIISHLPKSPA
                     ETASKMISGRFQRLKCSYGTDATLTPWLKLDVPLRGDEVDFPEAGIQNGQMQISWDVL
                     KKCFDDKIDDICVLLDAQIAQTRSKYPNEEISYIVLSGGFGSSPYVRSRLLGRYSSMT
                     VEYATTSMNHPSQMGLNVLIADEPQLVVVHGLVLDRTQQLQRGVVVFGSRCSPVSYGI
                     ICDMIYDPERHSGEAIRVDPRDDKTYATRQIDWLIIQGNPIPHTGIEKEFQLKLQRDD
                     EDDHWKVHVVMSTLSPAHLPQSMKQGGVQQVCSLDIATGYVNKKLKNRHWYNRKPLYW
                     RATFDVRVVVGAADLKFQLWNKDNRQIMSKEHEPIRVQWEAAEALNETLNGTLAELED
                     TMSDNDINYAHPPYTPMISLRHELGIMFGFAAACILTVVVYYIFWQASQRRAAARDDA
                     RSKDLRARGFHHERGGYHDRALGQYASRDPVAQTQGQTLEFLTSPDQFGSGQNYNNNN
                     GPAEDAVSSSSSSRVPVTMRPAAGKLKFPVYEAELQTFSTESNGK"
     gene            <514585..>515686
                     /locus_tag="TRUGW13939_05036"
                     /db_xref="GeneID:55992534"
     mRNA            join(<514585..515233,515298..>515686)
                     /locus_tag="TRUGW13939_05036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488201.1"
                     /db_xref="GeneID:55992534"
     CDS             join(514585..515233,515298..515686)
                     /locus_tag="TRUGW13939_05036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344094.1"
                     /db_xref="GeneID:55992534"
                     /translation="MATTKTTGVTKGALAGAIVGSIIGTAILAFLAAWLFIRRSQSSK
                     RGGFQRYEREEDNNTAATNKSDQSSRFLPAKANNNNNNNNNQSFSNGASENLLLSSRS
                     LSKYIPDPADDESVIGRVLGVFDQVSLHVDNYYSHTQPVTSPSSPAETAWISQFDTPY
                     LPGPLSALLENPKTRRTTITHALARSLLSAIQPQSATRVSLLPPLFTPGPLASDDQEL
                     NQATYTWRILAAYLARNATPEAVEETQVRQEAAINAFVDNFTSSFAPYADPAHSSEDR
                     ARHLRSVTTAAADLGRWLFGQPCAFDFVYSGPTGNNEVVVLPAIVKVLDEKGQRLATK
                     ATLYQAVTANF"
     gene            complement(<516218..>516691)
                     /locus_tag="TRUGW13939_05037"
                     /db_xref="GeneID:55992535"
     mRNA            complement(<516218..>516691)
                     /locus_tag="TRUGW13939_05037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488202.1"
                     /db_xref="GeneID:55992535"
     CDS             complement(516218..516691)
                     /locus_tag="TRUGW13939_05037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344095.1"
                     /db_xref="GeneID:55992535"
                     /translation="MRLFIVLAVLFISAVVAFIDLPSRSETGCRTSRTGSAPCLQHRG
                     VGGGDVNEDSLNDAHQQPAVVTHNSLPVHQKPEPDSIIYTHQQHSNLDSVPARRWLAT
                     SMSATGLVLKEKFGTTWTLRSRISKARSEGALGLTPWYGMALGLMCTTLAAVMLG"
     gene            complement(<517795..>519426)
                     /locus_tag="TRUGW13939_05038"
                     /db_xref="GeneID:55992536"
     mRNA            complement(<517795..>519426)
                     /locus_tag="TRUGW13939_05038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488203.1"
                     /db_xref="GeneID:55992536"
     CDS             complement(517795..519426)
                     /locus_tag="TRUGW13939_05038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344096.1"
                     /db_xref="GeneID:55992536"
                     /translation="MPPKANPSAPRAGNQPQASREQGNSTTPSASSPPGRPPVQRLQS
                     LTKRTTGPSLSNRAAIGLDDPDKPKPALKFKPRAPIRRTKEERDAILKIEEERNRQRL
                     EEASAIQRSRLGPVKKPRGAFRGRGGTFGGPSMRGGPMRGRGGRFDMDSRASSISRHS
                     MPAWGGGDEGPYYSSDEETGGIRTSIDQINLDRDGDDEDEVDKKGKKAVRSSRPTYRG
                     PLPIRVIRHEHEERVVGVNTEASSSTSAELRREAKEKDQQGDTDGGLFVPQDTEEQKG
                     PAVKPEPAEEDVSMSDLPPAHVDDDDENPLPEQTTKARKTVTIKDPRSLLRTREEIEE
                     FSRHNEDLEMMREILTLEEAERTPAKPSETADTETDGASEPKEETEDEKLADEKNAGK
                     LFLIQFPPLTPNLVIPGEEGTDNQNDTNDDVMITHSNTRTDQPKVKVENEDADSKDHI
                     KQPSKLVTAVEKQLPAGRVGRLNLHKSGKVTLDWGGISFELDKGADVNFNQEALIAST
                     PATGATADELEEKQVWAMGELSGKFIASPEWNRLL"
     gene            complement(<520600..>522731)
                     /locus_tag="TRUGW13939_05039"
                     /db_xref="GeneID:55992537"
     mRNA            complement(join(<520600..521862,521925..>522731))
                     /locus_tag="TRUGW13939_05039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488204.1"
                     /db_xref="GeneID:55992537"
     CDS             complement(join(520600..521862,521925..522731))
                     /locus_tag="TRUGW13939_05039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344097.1"
                     /db_xref="GeneID:55992537"
                     /translation="MNTLHHKDQQAAEGLASLSKIYGDMDRYRGDVMSQHPSPDLPVP
                     KNVAFELLLDENSKVRARIPMRVQIFPHDTTDSIVTTVKNFYGIYDGVASGVSFEDEH
                     GTTLIARYENLKNNMTVYVRVIPAHGYSDNYEQHFYGTAPMDSRKRPSLGEPFQMAPP
                     QTSQALEYSRPPSRPSSRTRRTSASPSGRGRRSASQNKGPSRAGIKSRGSSAHGSFVD
                     ESLAAYSDSEGGHGSINGSRKARSEQFASSEISMENIVQESRRKKPKFESSELPLFVP
                     PQVPLTTSTSSISPQRRSTGQDGEPSPFTRPVQRPFINRAPLPSPQSYGYSENAYGSS
                     STKSSIYSTPIFPEHGTRLRPSAPYLSSGNQQTVPGILPTPDPTIASCISDEDVAMQL
                     IRLGDASNFSHGRNSTSTLDDALSGAADASSTAGTSDGEFSENEDDDELPARSKAIQS
                     SPLLPPGHIKHSHKQLDDILPSYDSTEPSGDEYDHEFQAGHRVKNEYAEENIDDLDAP
                     RAKKQKVKSNGTVSTKSRLQKSISRNGKVVKGRNSAVPRKPKPGLPAFIEPKADATTQ
                     ALSPTPSRKTSGSTANFQHQLAADEEDLSTKPRCQRCRKSKKGCDRQRPCGRCKDAGI
                     GIEGCVSEDEGNGRKGRYGRHMGVPVKKVLDPNNPDEDIEVMPSSTIAIEPLLENSVD
                     KNKKRKR"
     gene            <526327..>528505
                     /locus_tag="TRUGW13939_05040"
                     /db_xref="GeneID:55992538"
     mRNA            join(<526327..526338,526507..527640,527693..528232,
                     528284..>528505)
                     /locus_tag="TRUGW13939_05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488205.1"
                     /db_xref="GeneID:55992538"
     CDS             join(526327..526338,526507..527640,527693..528232,
                     528284..528505)
                     /locus_tag="TRUGW13939_05040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344098.1"
                     /db_xref="GeneID:55992538"
                     /translation="MDARPQRIRVRGDENAPIGDLPNKTIHHRNKSTPALSTALQNGG
                     LRNNAKRTAFADVSNTSYTVRGSKDDIYLSGKNNKAGTISAEDKKPIVLSQPAQRPVS
                     VTGVKAILNSVRPRPSDNVPRQGITDITSYNTANNRKLLTKRSNVVFKDHLPPVVEAK
                     PSTTIKQAGPRASDPVKEDFVSRPSTASSHREYSKKEAKEAPLPAKLNDIEVNPSSLD
                     IHSNSSYVIEPSVPKKVSLSEPAVLEEEQPSRSTLPEAVSLPEVKDAQKSESTLPRDS
                     LDLAHTRSDSAVAPSEPEEWDEFDDNEEDDGYATARSHPSRSENTTGSAAIILVPKYN
                     QKAKKEIAVAKQFVETSRTTDDIEDEMWDTSMVAEYGDDIFDYMRELEIKMLPNAHYM
                     DYQPEVQWSMRSILIEWLVQVHHRFCLLPETLFLAVNYIDRFLSCKIVSLGKLQLVGA
                     TAIFIAAKYEEINCPSVKEIEYMVDRGYTVDEILKAERFILSMLQFELGWPGPMSFLR
                     RISKADDYDLDTRTLAKYFLEVTIMDERFVGSPPSYTAAGAHCLARFMLCKGDWSYAH
                     VYYSNYTYTQLYPLLSVILECCEKPQKHHNAIYEKYSDRRYKRSSLYVEAEIAKGFSI
                     PDIPKESHRFV"
     gene            complement(<529333..>533470)
                     /locus_tag="TRUGW13939_05041"
                     /db_xref="GeneID:55992539"
     mRNA            complement(join(<529333..529592,529653..533175,
                     533228..>533470))
                     /locus_tag="TRUGW13939_05041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488206.1"
                     /db_xref="GeneID:55992539"
     CDS             complement(join(529333..529592,529653..533175,
                     533228..533470))
                     /locus_tag="TRUGW13939_05041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344099.1"
                     /db_xref="GeneID:55992539"
                     /translation="MGGKSKGGGARGGGKPGTKQAKAAAEKASQTAASTPETEGEAKK
                     PTVKQVIGGASWTGKLPVNMLSEHCQKKKWGKPEYIMQKKVADGFVSSVILSKTDLKT
                     KETTTLPPMELPHTHRALAAQPTALEARHFAATYALFRVASEKNIHVMLPPNYRKLWK
                     EDFMEVKNAAVAQDKAWMYGADPFLIKQEREAAEEEEKKKKLERQKAHAKPDDKVNLG
                     LSSAGDNTGRGKAWSRAPKVDLGNRLRREIEELLRSKIIWNPYNVKIPKDRQKQIIDE
                     FSRLGFRRSHIEEAVAECKDREEVLEWLLLHVPEDDLPRWSFPEGYSAGVSLASGNLA
                     HESKIKRLAAAGYPADVCAIILDKNGGDEGLAAESLQNALLEHVPSRVPLESTDEDIW
                     AEEHTTLEAIFGERYKRVSKTVCQVQGEVPGLSKPVTFRFQKPSTPYPSNPPIISILS
                     DGLPAYIRLSAVKKVVQYSMEDLVEQPMVFSIVDWLEVNVPMVIDNPGKLREIASGVS
                     QPAKIQNRSTPLPVRPGRRNPKALGSENGAPSGTSVYESWKQKQNTPSQRDMNQKRRL
                     LPAWGMQEAIIQCVNSYQVTIVSGETGSGKSTQSVQFVLDDWIKRDMGNIANIVCTQP
                     RRISALGLADRVSQERCSSTGDEVGYIIRGDSKSKPGKTKITFMTTGVLLRRLQTGAG
                     PDNDIAASLADITHVVVDEVHERSLDTDFLLALLKDILHRRKDLKVILMSATLDAEAF
                     TQYFGGRAHVGRVNIPGRTFPVEDYYLDDVLRQTGFNNTLASYDSIEGEKEDGSIGKS
                     LRSLGMGINYDLIASVVRYIDSQLGSDSGGILIFLPGTMEIDRCLGAMRAIPNMHALP
                     LHASLLPAEQKRVFLAPPKGKRKVIAATNVAETSITIEDVVAVIDCGRVKETSFDPKT
                     NVVRLQEVWASQAACKQRRGRAGRVKAGICYKLYTRAAEANMAEKPDPEIRRVPLEQL
                     CLSVMAMSGIADAAGFLAKTLTPPETLAVEGAMNLLHRIGALDNQKLTALGRHLAMIP
                     ADLRCAKLMVYGSIFGCVDACVTIAAILTLKSPFVSPREKREDATAARASFSRGDGDL
                     LTDFAAYLQWSERSRSHGFWQTTTWCSENFLSHQTLRDISSNRAQFLTSLKDAGILPI
                     DYKEPSDSTSSPWDRNTKNTTLLRALIAGAYDPQIAQISFPDRKFAASVTGTVELDPD
                     ARTIKFFNQENGRVFIHPSSSLFTVQNYSNAAFLSYCAKMETSKVFIRDLTPFNAYSL
                     LLFSGGITLDTMGRGLVVDNWLHIRGWARIGVLVSRLRMMLDDVLAAKVDNPAADTQG
                     HDESRVIDLVKKLVEFNGMDQ"
     gene            <533740..>534649
                     /locus_tag="TRUGW13939_05042"
                     /db_xref="GeneID:55992540"
     mRNA            join(<533740..533845,533907..>534649)
                     /locus_tag="TRUGW13939_05042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488207.1"
                     /db_xref="GeneID:55992540"
     CDS             join(533740..533845,533907..534649)
                     /locus_tag="TRUGW13939_05042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344100.1"
                     /db_xref="GeneID:55992540"
                     /translation="MADISGSDASDAEAPVATVTSNEKGTPAETGKRNAFTELMSSKT
                     KQPKQTEPTKQNKSQKLGSKFKIRDGLGVYIERPETFSSSVVIYFNDDFVAINDLYPK
                     SSLHLLLLPRDPSKFFQHPFDAFEDHRFLQKVRAEAKKLRTLAAGELRRRYGKYSSQE
                     TARREAMEQDPPADDLPPGRDWEKELMVGIHAAPSMNHLHIHVLSVDRYSDRLKHRKH
                     YNSFATPFFVDIDDFPLAQDDPRRHPGHYLKRDFICWRCSRNFGNRFQELKDHLEEEY
                     EQWKKL"
     gene            complement(<534976..>535882)
                     /locus_tag="TRUGW13939_05043"
                     /db_xref="GeneID:55992541"
     mRNA            complement(join(<534976..535255,535315..535742,
                     535811..>535882))
                     /locus_tag="TRUGW13939_05043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488208.1"
                     /db_xref="GeneID:55992541"
     CDS             complement(join(534976..535255,535315..535742,
                     535811..535882))
                     /locus_tag="TRUGW13939_05043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344101.1"
                     /db_xref="GeneID:55992541"
                     /translation="MGRFGLLPLALLSLQTLFAGCHATDTPESEDAPAPPSLAVTVEA
                     SFPASEIFGIKIVNGQESQALLTFSNEEEVPVTVNFVGGSLMSLDEPSKAVRNLSTTT
                     YGVEIAAGEKETLPYSLTTEMHPQDLRLNLISVLSKNVTQFFTIQAFNGTISVVEPET
                     SIFDPQIIFLYFFILAFFAGIVYFFYTVWVAPYFPQKRRGKSGEAKKSGAAKKTESDV
                     PAVETTATGTATSFNSEWIPAHHIQKPEARKVKGARSKSRA"
     gene            <536408..>537998
                     /locus_tag="TRUGW13939_05044"
                     /db_xref="GeneID:55992542"
     mRNA            join(<536408..536494,536571..536714,536774..537116,
                     537175..>537998)
                     /locus_tag="TRUGW13939_05044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488209.1"
                     /db_xref="GeneID:55992542"
     CDS             join(536408..536494,536571..536714,536774..537116,
                     537175..537998)
                     /locus_tag="TRUGW13939_05044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344102.1"
                     /db_xref="GeneID:55992542"
                     /translation="MVLGSHTQALAKRYEHIKLLEQSKNDLIEDLLARVSDLEDAYQQ
                     SKLDREREIRFNRDIQLHEMELMSQIQRIKKIMDREPYIVVLLDGDSMIFNDEFLRNG
                     EQGGKDAANQLIATLNEYVARNLPNVTSPKIVTHVFANIKGLGDACYNTGIVYKPSMV
                     DDFVRGFNDSQPLFDFVDIGQGKDSADDKISETIKLNLYNCHCHQIFLGCSQDNGYAR
                     LLEDTMADGELIGRISLLEGVPFEKELDSMKASYRVTQFPDLFRTSRITSTPAAPIRA
                     PLKTHTAMLSPHPASATLTRTSTNTSTSSATPTSASSWASVTALNPGDVSLQPAKPAS
                     PAPSGTSTVERNRHGQRIDRMEFRTITKDDLYRVKKMKLCNLHYLLGNCPNTNCYHDH
                     DHKLTKDEKEVLRSVARMTPCHFGMTCDDPKCIYGHRCPQSETGKKECHWGSNCRFEP
                     SQHGIDLTVVKTTKV"
     gene            complement(<538722..>540457)
                     /locus_tag="TRUGW13939_05045"
                     /db_xref="GeneID:55992543"
     mRNA            complement(join(<538722..539110,539166..540138,
                     540188..>540457))
                     /locus_tag="TRUGW13939_05045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488210.1"
                     /db_xref="GeneID:55992543"
     CDS             complement(join(538722..539110,539166..540138,
                     540188..540457))
                     /locus_tag="TRUGW13939_05045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344103.1"
                     /db_xref="GeneID:55992543"
                     /translation="MPPSIPPRFSGVSKAQDSQGHHNVIGVVVDCLPKAKSGGTSYSV
                     TFTIKDSDYGPGNHTWEGLKIKYFNDDEHRLPDVKVNDVILLRQLRVRPHHGSLFGVV
                     SNKDHVSWAVFRQPESSESLTMPAYSPGARALSREEDAYAKSLLNSAVHTESQVPPSQ
                     TKGQAVGLSAEVKPQSTKNRDRFSLIKAVAPKKFADLIVHVVKTWYDDNTVNLYVTDY
                     TVNKALFNYDDDKSDNEDEDEGEGRTGDRFGYLGTSTRVNRIWRGPHGRMTLQVTLWQ
                     PHSAYAKDNVQEDSYVALNNVHIKSETQTGRTEGVIHTDRMYPDKVGIRLLDDEDDDP
                     RFLELKQRKREYWRQNKLKRGQIAEELGEEGGPKKITKKRRKELLRQKKQQQQKQQAA
                     QKREEGQPEIAAILRADKANPHIQAKNPAKVCRTLLDILANSSHVASLPGGIEYRLPF
                     QNVNYRTTVRVVDFFPPDISDFAVSYNPDYETSEDDEDDVSSTRRVRWEWRFCLLVED
                     AKIAPGQSRNRVKLFVSGAEAVFLLKLDAVEYDWP"
     gene            <541170..>543074
                     /locus_tag="TRUGW13939_05046"
                     /db_xref="GeneID:55992544"
     mRNA            join(<541170..541403,541591..542100,542160..>543074)
                     /locus_tag="TRUGW13939_05046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488211.1"
                     /db_xref="GeneID:55992544"
     CDS             join(541170..541403,541591..542100,542160..543074)
                     /locus_tag="TRUGW13939_05046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344104.1"
                     /db_xref="GeneID:55992544"
                     /translation="MADRYIPEHRRTQFKAKNQFKPDELRRRREEQQVEIRKQKREEN
                     LAKRRGIQTSDGGIIGGQVGADSDEEEGGAIEGELNVELPEMVKGVFSEQIDEQIQAT
                     TKFRKLLSKERNPPIERVIETGVVSRFVEFLRSPHTLVQFEAAWALTNIASGSAQQTQ
                     VVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPQCRDYVLSAGALRPLLALIS
                     DGRKLSMLRNATWTLSNFCRGKTPQPDWNTISPALPVLAKLIYMLDDEVLIDACWAIS
                     YLSDGSNDKIQAVIEAGIPRRLVELLTHASTSVQTPALRSVGNIVTGDDVQTQVIINC
                     GSLPALLSLLGSTKDGIRKEACWTISNVTAGNSVQIQAVVDANIIPPLINLLSNGDFK
                     TRKEACWAISNATSGGLQKPDQIRYLVSQGCIKPLCDLLACPDNKIIQVALDGLENIL
                     KVGDMDKESAQGGEGNLNRYALFIEEAGGMEKIHECQNNANEEIYMKAYNIIEKYFSD
                     EEEAGGDIDELAPQQTQTGFALGTNQQQPGGFNFANGGGDSMDM"
     gene            complement(<544020..>547711)
                     /locus_tag="TRUGW13939_05047"
                     /db_xref="GeneID:55992545"
     mRNA            complement(join(<544020..547180,547237..>547711))
                     /locus_tag="TRUGW13939_05047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488212.1"
                     /db_xref="GeneID:55992545"
     CDS             complement(join(544020..547180,547237..547711))
                     /locus_tag="TRUGW13939_05047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344105.1"
                     /db_xref="GeneID:55992545"
                     /translation="MDMSSDVEHDGASSSRRKSGRAVKKPQLFSKAVHSIGLNNPEKR
                     KRNTTLDDGQDDDDDEEQDDDESDSEEDDEDPDSEEERERRKATRKVTTKRKAVKKPN
                     AGPKSSRAAKKPKINGAGKSLAIRPATNGRQSKKPAPKTRTAPPRPIFRAIPEGLYTD
                     VFEQNKDVETVVDEWLSKYEKDPNEGLRALFNLFLQCTGADISVDMADVTDEDHWPQR
                     IQDLQEAHLDTEPSDYPLTSKERSLRNFRTNIVDFCDSWVASLHESSLLYNTFAPGLK
                     AEVWLNIMSSAGNRAFRHTAVVFSICIATSLCHIAEGVTSTVSTSRKQLDTEKRKKTA
                     NKGRIDSIQTTIQENEEKLETIDALLREAFDTMWVHRYRDVDPKIRSECFLGLATWIQ
                     THREMFFEPQYVRYLGWGLSDAVTQVRLAVVGQLRQIYEIKFSIATLRTFTGRFLRRL
                     VEMATRDADSNVRASTVELLGLIRNQGLMDNAEVDQVGQLVFDTEPRIRKSSGRFFAA
                     NLQEIYETHTEEMAEDINETFGDEDDDDYESPKRSWIKFKCLVDILQSYDGQREELAA
                     ERQRMGSLEALSGAPVESRFFLATEAIYAHMEELAQWQSLAGYLLCDHSQVTDSPPQD
                     EASNVRQFYALEEGQDIILLEVLVCAVKLRILEIAKSDVSKRGQKIKSLTDKIPEMQA
                     ETAHNLTQIIPRLLNKFGSTPEAASAVLRLEHLVDLNMVQDLQKDATAYTSLLNDINR
                     QFLTHSDQDVLAEAGVAFLHARTSDEMKEAMEGKVQELWDDMIDAISTLSQNQDVQNG
                     SSVRKNVLTDLANTVTRISNLASIVDCTSIIETPPAVSAKKRKEKPVAPFNTLVHFVK
                     RGLRDEESDDELQSLENELVVNSIKTLLFYFMWKVQNLSSAIKSTNAKFNTAYFETLA
                     KSKDTFAASLTAVMQKRSVMDDIRFSAATTLLDLHTLFGTLRNIGSHIQGRSDLVDED
                     VVLQAQGLAQDIVPSTQATLSRFHDLAERTLAKKLKKDINSAVDDDAPLESAQDIKDL
                     PSDDEDDENEQDDDEVDEAAATERLRATILAEQRLCELTGKIVLAIIGRVLDTSGSQR
                     GKFKQKLLKNKSRLGHNYKEVIAFVEDRKARPAAAARSKDKQPSSKTPPKSTEFVELE
                     DDPIEDDEEERQEAEQEADPIVEEDEDDDLRVRGLVEENIDDENSDQGNGVSEAEPED
                     EDEIMGD"
     gene            <548374..>549432
                     /locus_tag="TRUGW13939_05048"
                     /db_xref="GeneID:55992546"
     mRNA            <548374..>549432
                     /locus_tag="TRUGW13939_05048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488213.1"
                     /db_xref="GeneID:55992546"
     CDS             548374..549432
                     /locus_tag="TRUGW13939_05048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344106.1"
                     /db_xref="GeneID:55992546"
                     /translation="MTFNSPFASSVASPGKGEVVLAVLPPSIPTLAKLTYKYPLKLLS
                     RAPGFIPEHSVLSEGVTKPIHLYLLTYGGGLLPGDHIDVSITLDPRARLVVTTPQGST
                     KIFKTVPNANTAIKTAPERPGLDDRSRQTLNVSIGSQSGLCYLPDPSAPFKDSRYEQI
                     QVFTVDECQKQNRSSLCVLDWVTQGRTSRGENWDFNLWKGRNEVWSEDKTTGKRRLLL
                     RDAVILDDEADASLRPHENDSSSGELIRERTYPHGIIGTLILYGPIFDQLGSFFMTSF
                     GSQPRIGGRNWSATKTAAEPSKQSQVTWTAARIRADFVLVKFGAKDFEAARDWLGTII
                     REEGSIEREFGEEALLCL"
     gene            complement(<549565..>551005)
                     /locus_tag="TRUGW13939_05049"
                     /db_xref="GeneID:55992547"
     mRNA            complement(join(<549565..550588,550650..>551005))
                     /locus_tag="TRUGW13939_05049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488214.1"
                     /db_xref="GeneID:55992547"
     CDS             complement(join(549565..550588,550650..551005))
                     /locus_tag="TRUGW13939_05049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344107.1"
                     /db_xref="GeneID:55992547"
                     /translation="MQNPTLFHGSDGDAFLQIREDTDEDMDDTSLLLPSSSNNCNRNN
                     TNNSNNSTGEEQTDGDDHPRWSPGLKSILASLASNVRRRISLRLPLRHSPQIYSSRKF
                     RWKRMLGLFLLLVFSMIGVIESICMLYGIAITFFSEDFVQTWGKPNGLENWPTDATRD
                     ILPVACHSHNDYWRPVPLFSAVSAGCVSVEADVWLIEDELYVAHSRSAVAPNRTLHSL
                     YVDSLVGLLEKQNPITRFHLFKDRPLQGVFDTDPSQTLVLLIDFKTNGAETLPYVMSH
                     LSPLRDRGYLTYWDGNNVVNGPVTVVATGNAPFNLLTANSTYRDIFFDAPLDAMEDGE
                     SEPMRRRHLAQDQGQGRSGTPSVVGLDTYNPSNSYYASVSFDKSIGYPWHFHITSDQL
                     QRIRAQINGAHRRGLKVRYWGTPSWPRNLRHYIWSVLEREGVDVLNVDDLKGATSEDW
                     RHKISDWWF"
     gene            <551467..>552591
                     /locus_tag="TRUGW13939_05050"
                     /db_xref="GeneID:55992548"
     mRNA            join(<551467..551504,551577..>552591)
                     /locus_tag="TRUGW13939_05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488215.1"
                     /db_xref="GeneID:55992548"
     CDS             join(551467..551504,551577..552591)
                     /locus_tag="TRUGW13939_05050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344108.1"
                     /db_xref="GeneID:55992548"
                     /translation="MPHKHKRRQDDKSTYDLPPSFIAKSLSVHKPKPAEKGKKKPAGK
                     NDKKLSAKKAKESSGWVDDTPRAFARMMQYQATGKRPSGLDDGNGRARGKKRKHGGED
                     KDGAAEVASNKNNQASGDSKKSAGKTPATTTATSTTTLKILPGEKLSDFAARVDQQMP
                     LSSMKKSQRSGQSENLPKIREERITKHEKHLRRLQKGWREDEAKIREKEAEERELKEA
                     ENEDLNDLWKEWQIEAGKAKAKKKGSGAKKKKRKGDDGNGIDDDDDDNDPWAKLNTRE
                     RAAKPLNPLEVVQAPPELTKPREIFRVRRGVGGAEVDVANVPAAAGSLRRREELAKER
                     KTIVEEYRRLMAEKRR"
     gene            complement(<552758..>553645)
                     /locus_tag="TRUGW13939_05051"
                     /db_xref="GeneID:55992549"
     mRNA            complement(join(<552758..552927,552984..553415,
                     553477..>553645))
                     /locus_tag="TRUGW13939_05051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488216.1"
                     /db_xref="GeneID:55992549"
     CDS             complement(join(552758..552927,552984..553415,
                     553477..553645))
                     /locus_tag="TRUGW13939_05051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344109.1"
                     /db_xref="GeneID:55992549"
                     /translation="MASNGRLAAILGPFRLVWPSLQLHYEAFKEAIRNDGLFATFTHL
                     QRIRDTATAKLFTDGFIAFENTTVVPSLVRSAHGKILELGPGAGNQIHRYDPALVDFI
                     YAVEPNPHYEDDIATKVKKVDLQDKYKLLACGVEDSDILSKEGITEGSLDTILSIQVL
                     CAVGDSKNAMKEIYKLLKPGGSFVFWEHVRNKDTATAIAQACWNPTWSALVGCCLNRD
                     LMEEILAAGEWEDPGAIEVADDPYTCLPRIWGELKKKA"
     gene            complement(<554510..>555352)
                     /locus_tag="TRUGW13939_05052"
                     /db_xref="GeneID:55992550"
     mRNA            complement(join(<554510..554863,555002..>555352))
                     /locus_tag="TRUGW13939_05052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488217.1"
                     /db_xref="GeneID:55992550"
     CDS             complement(join(554510..554863,555002..555352))
                     /locus_tag="TRUGW13939_05052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344110.1"
                     /db_xref="GeneID:55992550"
                     /translation="MSSFAKPKPTIVLVPGCWHIPAHYQELIDLLQNAGHPIEFANLP
                     SLNPSDAPRQTVTADIDAVRQKILSQVNKGKDVILLSHSYGGCPGGAAAKGLSPAERP
                     DSGAVIGLVWFAGYLGEGRMGVKDPVDVFYHDVPTEKASWAASKLQTHALAPLISPCP
                     SPAWKDTAFDGRRGYIFARQDHAMPLYFQERMVRDSGVNWNLKELEASHSPHLSKPQE
                     LTGHILEIISSFEARP"
     gene            complement(<556783..>562351)
                     /locus_tag="TRUGW13939_05053"
                     /db_xref="GeneID:55992551"
     mRNA            complement(join(<556783..557322,557377..561813,
                     561869..>562351))
                     /locus_tag="TRUGW13939_05053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488218.1"
                     /db_xref="GeneID:55992551"
     CDS             complement(join(556783..557322,557377..561813,
                     561869..562351))
                     /locus_tag="TRUGW13939_05053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344111.1"
                     /db_xref="GeneID:55992551"
                     /translation="MAPIKRKGAAADGSSSNQQKRPRVSSEGTKKLSGAQQKKLKQEK
                     ESRDTDGKSNGPQQNSDFSILRDEEPSFPRGGGSVLTPLERKQIQIQATRDVLFEQKG
                     PNNSAAAFADDDLDEDVDMEDAAQGTVTAKKSRKSKNKKRDDQEKPTKDGVRIEGLSF
                     KRLAPGTMILGQVASINAHDITLALPNNLTGYVPLTAISKTLDERIEKLLNADEEEDE
                     EEEADEEDILNLSSYFRLGQYLRAYVTSTGNSNATDAGATKTKKRIELSLDPRQTNSG
                     LTKSDLVEDVIVQASVVSVEDHGLVMDIGLEDKDVRAFMSAKEIDPEVEFSNIKEGTV
                     ILCIIKGFNTTKTVVQLSANLQTAASIKKSHYLSSAPTINSFLPGTAAEILLTEVSET
                     GMAGKIMGLLDTTVDVVHSGANSGAIDLAKKFQTGAKIKGRILSTFPNSEPYKVSFSI
                     LDHVLKFAPAQNQSPTKTSSTPSIAAILDAKVVKVEPGLGLYVDVGSSKHLGFVHISR
                     VTDGTVDMISAEEGKFRVGTTHEARVIGYNAVDNLFMLSFEKKVIDQPFIRLEDVTVG
                     AVVKGAIEKLLIGPTGVDGIIVTLADGITGLVPSMHFADGVLQHPEKKFREGSTVSAR
                     ILSVDLDKRQVRLTLKKSLLNNDSAIWKNYNDISPGNQSPGTIINIHPHGAVVQFYGP
                     VRAFLPVSEMSEAYIKDPSLHFRKGQVVNVHALSVDAALGKLAVSCKDPSASTESYRE
                     AFGEIYPGITVSGTVFEKSNDDLLLKLDKFGVIARLSAGHLTDGDASKQNTALSKIRV
                     SQKLHDLLVLNVERSHRLIKVTVKSSLRKSLKEKTLPSKFEDLQEGMSVTGFVRGVTS
                     IGVFVEFLGGLNGLLPKRLLDDEHLNKPNFGLHLFQPLSATIHQIDEDFRRFTLTMRG
                     DSSNDAKTQQAKAKSSSTFEELTNPIDESIKSVSDFSVGKVTKARIASIKDTQINVIL
                     ADKIQGRIDVSEIFDQWEDIKDRKHPLQSFRVKEILPVRILGVHDARNHKFLPISHRS
                     GKHPVFELSAKPSVVSAEEPKSLSLEQIKVDAAMFGFVNNINDECLWINLSPNVRGRL
                     GALDLTDDLSSLADLEENYPVGSALKVRVTGVDVAKGRLDLSGKQKSARELTLDTLSK
                     GMILPGRVTKLTEKQVVMQLSDTLVGVVHLADMADDYSKIDTTLYKKNEVLRVCVVSI
                     DKSKKKVHLSLRPSKVLSSSLPVRDPEITSISQLKANDVVRGFVRRVADNGLFVALGH
                     DVTAYIRVSDLSDSYLKEWKDQFQVDQLVKGRVILADSENNKLQLSLKDSVLDPNYKA
                     PLKLRDLRQGQVVTGKVRKVEEFGAFIVVDGSANVSGLCHRSQMADQAVDDARKLFEA
                     GDIVKAKILKIDTKQEKISFGLKASYLKDEADSDSDEDSDEDLLSDGGAPLESGEDSD
                     EGMSLGGLELEDDNESESDEESDDDIKMGNNGPKDTSGGLDVGGFDWNGNAGQPDPLT
                     TVSRAGNDSDEDADAKKKKKRTRKPEIQVDQTGDLDARGPQSVADYERLLLGEPDSSI
                     LWLQYMAFQLELGEVEKAREIGERALRSISIGQDTEKMNIWVALLNLENTYGTDDSLE
                     DVFKRACQYNDTQEAYERLLSILIQSGKNEKADELFQTALKKKIFSSPKFFINYATFL
                     FDNLSAPDRGRELLSRAMQSLPSHTHVEVTSKFIQLEFRSANGDVERGRTLFEGLLSS
                     FPKRIDLWSVLLDLEIKQGDVEQVRRVFQRLLGDSGAAASDESRKKLKAKQARFFFKK
                     WLAFEENLASSGGSEKWIEEVKARAAAYVNSLQAK"
     gene            <562751..>565008
                     /locus_tag="TRUGW13939_05054"
                     /db_xref="GeneID:55992552"
     mRNA            join(<562751..563393,563450..563560,563615..>565008)
                     /locus_tag="TRUGW13939_05054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488219.1"
                     /db_xref="GeneID:55992552"
     CDS             join(562751..563393,563450..563560,563615..565008)
                     /locus_tag="TRUGW13939_05054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344112.1"
                     /db_xref="GeneID:55992552"
                     /translation="MDGHLQSDPVHILSSQEIPSSPPSIVSEAGARRKPRRPPPVTPR
                     SFKKFFTPRSSLHSANKGIQTSRHVLRELSSTSLNRRGPAFTKAATSQAAGHGILKSP
                     FTETTKTPSRKRKLSFSSTGSPPQSSPLRKVRLTTTLYNERHTNEIVDEIGPPISPLK
                     ALSPPKSLQKQLFPAKPPAGPLRRSKALASTGELCLRSVSGRMNRLTMRSNYGYGWQD
                     QASNFYSRPEDQHQSVNITGDRLALPVCIAPCKTNSLVAIGDEEGGIRLLDSAKDVKN
                     GFSNAHLSFRAHGNSILNLEFSSDDLLLATAAGDQTTLIIDIQTQKPIHCLSNHTASV
                     KHVQFQPGSNNRMVATCSRDGTVNIWDLRCRGYEMPSLQVRCSLASDPDDEPSAPLPK
                     INYPQPVRTVQDAHTFMPKALKLTGDKPETQFSQDNVTVTSLSFLPAGRENLFVTASS
                     TNACVRLWDMRTSYNIRKGHPVPLSTTREPDCHVSHRSWGVTSMALNGDGSRLYTLCR
                     DAYVYAYSTSHLILGGSPDMNMNNTRPRRTGGPNKEGLGPLYRFGDPGLQVSSFYVKT
                     ALRPAKDDRGEMLAVGNSESSAVLFPTDERFLEPTNLADQPELPPNTQAPLGRPGLRR
                     TNSEVGLSGRPESAIPTYRTGTRLVEGHQKEVSAVSWAHGGELVTVSDDFSARCWREG
                     PDARDLRTGGEADGRRWRCGWADTKDSYDDEEE"
     gene            complement(<565655..>567658)
                     /locus_tag="TRUGW13939_05055"
                     /db_xref="GeneID:55992553"
     mRNA            complement(join(<565655..566041,566102..567136,
                     567206..567310,567368..567453,567510..567557,
                     567616..>567658))
                     /locus_tag="TRUGW13939_05055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488220.1"
                     /db_xref="GeneID:55992553"
     CDS             complement(join(565655..566041,566102..567136,
                     567206..567310,567368..567453,567510..567557,
                     567616..567658))
                     /locus_tag="TRUGW13939_05055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344113.1"
                     /db_xref="GeneID:55992553"
                     /translation="MTGIFEQPRNGGTLFLGGQKISGADIRDQNVLATQAISNVVKSS
                     FGPSGLDKMMVDDIGDVTVTNDGATILSLLDIEHPAGKILVDLAQQQDKEVGDGTTSV
                     VLIASELLRRGNELMKNRIHPTTIITGYRLALREAVKYMNENISTKVENLGKDSLLNI
                     AKTSMSSKIIGSDADFFANMVVDAMLLVKSTNQRSEVKYPVKAVNVLKAHGKSATESI
                     LVKGYALNCTVASQAMKTRITDAKIACLDINLQKERMKLGVHITVDDPQQLEKIRERE
                     SGIVLDRVEMILKAGANVVFTTKGIDDMVLKTFVEKGAIAVRRCKKEDLRRIAKATGA
                     TLISTLSDLNGDEKFEASYLGNAEEVVQERISDDECILVKGTKAHSSASIILRGPNDF
                     QLDEMERSVHDSLSAVKRTLESGSIVPGGGAVETALHIYLEEFAVTVSSREQLAIGEF
                     AQSLLVIPKTLAVNAAKDSSELVAQLRVRHAISQRVQEGDANEEEKAIAKKKTYQNYG
                     LDLTKGRVIDSIKAGVLEPSMSKVKQLKSAVEACIAIMRIDTMIKLDPERPAEDDGHG
                     H"
     gene            <567970..>569945
                     /locus_tag="TRUGW13939_05056"
                     /db_xref="GeneID:55992554"
     mRNA            join(<567970..568317,568381..568550,568607..569862,
                     569935..>569945)
                     /locus_tag="TRUGW13939_05056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488221.1"
                     /db_xref="GeneID:55992554"
     CDS             join(567970..568317,568381..568550,568607..569862,
                     569935..569945)
                     /locus_tag="TRUGW13939_05056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344114.1"
                     /db_xref="GeneID:55992554"
                     /translation="MSSQNDAAAQALPDRTQNPAEDKAPEGGEVSKNAAKKAAKAAKL
                     AAGKADKALNKGIGKSEAKQPSSKAAKKKIDGAAQIGIDVSKEEDFPGWYQQVLTKGE
                     MLDYYDVSGCFILKPASFYIWESIQNWFNDKIKKMGVRNCSFPLFVSEDVLQREKDHI
                     EGFAAEVAWVTHAGSTPLEKKIAIRPTSETVMYPYYAKWIRSHRDLPLRLNQWNSVVR
                     WEFKHPQPFLRTREFLWQEGHTAHLTEEGAGTEVLQILDHYAHIYEDLLAVPVVKGRK
                     TEKEKFAGGYYTTTVEGYIPATGRGIQGGTSHCLGQNFSKMFNITVEDPNAKPEEKLP
                     PVYVWQNSWGLSTRTIGVMVMIHSDNKGLVLPPRVAETQVVIIPVGVVKSLPQEDREA
                     VFKEIDELKDKLESVGLRVEADLRDNYSPGWKFSDGELRGIPLRLEFGPGESKGGFVT
                     AARRDVPGKEGKSEIQLKNLTTAVPALLDTIHDNLFRRADEQFRAHRRTLTNWDDFVP
                     LLNAKNVLLIPHCLTEACEDQIKDLSARKAEEDSDVPEDARAPSMGAKSLCIPLEQPD
                     GIEAGVTKCLNPHCEKLAEKWCMFGRSY"
     gene            complement(<570683..>572722)
                     /locus_tag="TRUGW13939_05057"
                     /db_xref="GeneID:55992555"
     mRNA            complement(<570683..>572722)
                     /locus_tag="TRUGW13939_05057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488222.1"
                     /db_xref="GeneID:55992555"
     CDS             complement(570683..572722)
                     /locus_tag="TRUGW13939_05057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344115.1"
                     /db_xref="GeneID:55992555"
                     /translation="MVGLKRFFHTGASPNAGVTPNVTISRDTSSPYNWNGPSLNPSSN
                     PITPVNPAVPDLNQHFEGIERQFEELHESFYDRTISSLRQFRYTGSKSPSPSRSSRHV
                     DVIEALFSGHRYRISPTSLSPSTPYNEDVADRNLDTLPNIVPRNPRYTPIVSTLYQED
                     VADRNMTTSSSSQYGARSHRSTSRPESSRGRGSKPASRGRHAGSSQSHSRPSSEARTR
                     SNLAPSSPTSRQTLKPQASAPDIRSPQIRTPDLASFPRPPTSSGYGYSAEKATIDPRP
                     TVNVAQLKPDRGSKGLSLSRRPSLSRAGSSKNVLDLSIDTGITASKKPSIKIEHRVIQ
                     PPTPKNLDVPQAASIAEIVNSPLPTDTASPFIPEFSHNYNADEIMNMFKQAYISTQVA
                     TPGHPTFETLQDAIIREINSHDAFQTVPVPTTEPPFTPPASDNSFDETILLPPPGPSR
                     TRKDQTEKEGQLSKRIRRGSFARNRGKSISSIKGGEKNLKKEKEPLSFISKRRHTYAQ
                     PPTPDWLRSLQPPIDPPAGATFLAPINSKPQIPPRHPYHVKRNSNPVPPSPSMMAFVP
                     AESQPEYPGYQAPTPIKFTFTSAGRVSSNRVNGRKEQARAQEFAAVDSNNVMYILNPK
                     ESVTPLDLINASQQGCGSRQNLTLMPFQGHGSKQSWENSRTTRVPMRKSSLGSAS"
     gene            complement(<576184..>577212)
                     /locus_tag="TRUGW13939_05058"
                     /db_xref="GeneID:55992556"
     mRNA            complement(join(<576184..577019,577074..>577212))
                     /locus_tag="TRUGW13939_05058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488223.1"
                     /db_xref="GeneID:55992556"
     CDS             complement(join(576184..577019,577074..577212))
                     /locus_tag="TRUGW13939_05058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344116.1"
                     /db_xref="GeneID:55992556"
                     /translation="MADRRRNNGPPNGTRAPVFASLLRSATGEVAQRPQRTRKSDELR
                     KIFLTTGLVPTASGSSYLEIKPARLPTGKSLIAPSTSLKIACTVHGPRPLPRSANYSP
                     NLVLTTHVKYAPFAHRRRKGHIRDASERDLGVHLETAIRGAIIAERWPKSALDVTITV
                     LEAEDDRWWGDASGATDASWGTMNVLAGCITAAAAAIADAKIDCLDLVSGGVAAIVED
                     NEAQKDGKPTRQLVLDPDPSEHKNITAACVVACLPSRDEITELWLKGDTYLGGDQSSG
                     HEALIDGSVDAARGVHTVLCAAVTESGERLLKQTINTPVADTDAEMKT"
     gene            complement(<578770..>581948)
                     /locus_tag="TRUGW13939_05059"
                     /db_xref="GeneID:55992557"
     mRNA            complement(join(<578770..578829,578892..578982,
                     579041..581627,581765..>581948))
                     /locus_tag="TRUGW13939_05059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488224.1"
                     /db_xref="GeneID:55992557"
     CDS             complement(join(578770..578829,578892..578982,
                     579041..581627,581765..581948))
                     /locus_tag="TRUGW13939_05059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344117.1"
                     /db_xref="GeneID:55992557"
                     /translation="MDASTATGAHRPDGNLRERTPASRPVDVRAVDNALADAGYQVVE
                     KENDRPTATFGRTPDGTIFTVPQTHDMVSQLLSPTEPKNLSDLIVLAILAVHILSFAA
                     LPASARIPVFALVYLLWRSAYNGGIGWLLHKQSHHNSMIRWAIKSKIFENPATGENPH
                     PKLYQFFKKDMETMIPKDYSFDDAPLEYNTWLVFRRLVDVILMCDFISYCLFAVACGH
                     RPETETALMTGLRWAAGIALVLFNLWVKLDAHRVVKDFAWYWGDFFFLIDQELTFDGV
                     FEMAPHPMYSVGYAGYYGISLMAASYKVLFISIVAHAAQFVFLVLVENPHIEKTYNPP
                     APRKRSVQHDSSTNSPPASPLKDSFVSTPANESAVPLPSAVHNLLGPQNLDLHRVTDS
                     SIILVQILVAVLTILTPSTTIYQFIFVANAALWRCWYSIGIGYILHRQSKSKSWTRHF
                     VKFGDSTEEAWRQWKGSYHLSMTLCYSTFIAAAWKMYSLPADWNHGLVLLKHVLGASL
                     ILLQTWTSVSIYQSLGEFGWFFGDFFFDAQSKLTYSGIYRYLNNPERVLGLAGVWGAA
                     LITSKGPVIFLALLSHVLTLAFIQLVERPHMQKLYGRSLRQDAGLVKSLKRSLPPPLQ
                     QLGGSVDRMMDESFDFVEELLETARPKLATGVNTFMKDAKSLFSQYPARVTISRLDDE
                     VAAGYDLEDYSLEVEGTESSPSAQVDRSSGREGASAREPLERRGDLKSLIFEYGSPVK
                     VKWTAPLNHSKKDWVGLYMVTDNTRREVTRVSSQGRWIATNEGAYDSLTCEKGLIASD
                     IVVSASHRQDGENRDFASGEMLFSGDKLFWTQGVFEFRYHHNGRHNVMAISRPFEIRI
                     GRFDEDDIEVDNAGVVQAAVEAALLPVVRNCFDQNPEIAPEAADEHFGTLVERDGKYA
                     RRVVFAVHQMFGVEFAPEVVRADGNVRNMAWRICNAKKVLAPYSMSRSKGTTTPTASK
                     D"
     gene            complement(<582823..>583743)
                     /locus_tag="TRUGW13939_05060"
                     /db_xref="GeneID:55992558"
     mRNA            complement(<582823..>583743)
                     /locus_tag="TRUGW13939_05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488225.1"
                     /db_xref="GeneID:55992558"
     CDS             complement(582823..583743)
                     /locus_tag="TRUGW13939_05060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344118.1"
                     /db_xref="GeneID:55992558"
                     /translation="MEEPLRESIKQVDANTWLIGGLILHRSRGYSNTSTWYDQEEDLS
                     YNVTSATIPLPTTVPLAVDDSRLKLVYDVAERSAVWSLGNSAFCKVKLCVDGTTSEAA
                     TLAYVHDKRPNNFEIPRVLYSAESNGRSYLFLSRVPGRTLADAWLTLDEKWKRHYVSA
                     IADVCETLESWKGNTLCGVDGKNAYEPYLLESRAAENYDPQNLLRPCKLMGMDCSKFV
                     FCHADLGPTNVIVEDVPTKGTVGVIDWEIAGFFPRGWIRTKFRISSGLDLPESVGDLS
                     SQQWWRVEVQKLLGTRGFEDYSSEWQAWWY"
     gene            complement(<584194..>585321)
                     /locus_tag="TRUGW13939_05061"
                     /db_xref="GeneID:55992559"
     mRNA            complement(<584194..>585321)
                     /locus_tag="TRUGW13939_05061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488226.1"
                     /db_xref="GeneID:55992559"
     CDS             complement(584194..585321)
                     /locus_tag="TRUGW13939_05061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344119.1"
                     /db_xref="GeneID:55992559"
                     /translation="MLGSLLFGLPLALFATFSQADITKDHDDRLQTAVILDTPTTGAS
                     TTPEGRAFLKLARLDGTTGSQIVEVKGNFSLAPYPDEAWNSWNATTDSLADSETKYVS
                     ANSQRVGPDGRLWVVDSGSLEKFANSSKLISFNLTTNEVDRVYYLGNVTTTDGSLNDV
                     RFNGKYAYLTEYTIGSIIVLDLETGYARMVLREHKSTVALLPLSAEGHLLRDVATGEY
                     DYTNADQLEVSPDGKYFYYQPGIGYMWRIETKYLNEALHNDTMADLLPNYVEPFALTP
                     STGGTAIDAEGTIYYSDGDRQEIRTLAPNGTTTLLVRDSRLLWVDAMWIDTQQRLWMC
                     ASQLNRGTRFIQPDNQTMTIEKPIYVYTIETGHNPSPLDHA"
     gene            <586637..>588106
                     /locus_tag="TRUGW13939_05062"
                     /db_xref="GeneID:55992560"
     mRNA            <586637..>588106
                     /locus_tag="TRUGW13939_05062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488227.1"
                     /db_xref="GeneID:55992560"
     CDS             586637..588106
                     /locus_tag="TRUGW13939_05062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344120.1"
                     /db_xref="GeneID:55992560"
                     /translation="MFGLKPALFLSLAAQGLAYRWFNWQVDITCEATGFFVPDNKTDL
                     AGFVKHHYPLKTMLRPVGNGHGFGNLTTCVNDGQTERDSYVLSLTNLKDLHIHESNHT
                     VTFGGGWDLVDLIPALHEHGLQVHNLGSEKVQNYIGAATTGTHGTGKSNQNLATQILG
                     MRIMDAKGDIHVIDKDQDLDAFRIAIGALGIIVEVTLQAEPLSFLKRTNKVIEGPSNI
                     TKLYEFIAELGEKYEQANINGPNMVWNSSTQQLVPSTNLTVVYWEETNFTGVANCSLD
                     FCSNDCGPCNRDYICYDYKMDGIATTPPGICYRGFMGQFEHFFPIENLAEAGVDYFNY
                     AMSQGDRLGPYQDIKDVLDAQNVARYESDDVTVITRFVKGDDTWLSPVNKYGLKPNAS
                     GIFATLEYSWMPSYNNFTQQWFYQELASEFIPKFGETYDVRPHWNKMQFHNETYTSTI
                     FPKMNDWLEIQEKMDPQCQFVNPFMINALGIDRCQAVFE"
     gene            <594532..>595635
                     /locus_tag="TRUGW13939_05063"
                     /db_xref="GeneID:55992561"
     mRNA            join(<594532..594613,594689..>595635)
                     /locus_tag="TRUGW13939_05063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488228.1"
                     /db_xref="GeneID:55992561"
     CDS             join(594532..594613,594689..595635)
                     /locus_tag="TRUGW13939_05063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344121.1"
                     /db_xref="GeneID:55992561"
                     /translation="MAPALMDPAEYPAPSTKAQSNLVAPEPEHCPGPESEQAGQGDAC
                     NGCPNQSICASAPKGPDPDIPLITARLSQIKHKILVLSGKGGVGKSTFSTLLAHGFAS
                     NPESTVFVCDTDICGPSIPKMMGVEDESIHVSNAGWSPVWVTDNLGAMSIQFMLPNRD
                     DAIIWRGPKKNGLIKQFLKDVEWGEADYLIVDTPPGTSDEHLSVNSLLQEAKVDGAVL
                     VTTPQEMSLLDVRKEIDFCRKAGIRILGLVENMSGFVCNSCKTTSYIFRPTTGGGQRL
                     AKKMNIPFLGAVPLDPRVGMACDFGESFVDSYPDSPASTAIRAVVRAVSEQVGEDPEK
                     VLPDSLFS"
     gene            <596616..>598038
                     /locus_tag="TRUGW13939_05064"
                     /db_xref="GeneID:55992562"
     mRNA            join(<596616..597025,597082..597845,597911..>598038)
                     /locus_tag="TRUGW13939_05064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488229.1"
                     /db_xref="GeneID:55992562"
     CDS             join(596616..597025,597082..597845,597911..598038)
                     /locus_tag="TRUGW13939_05064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344122.1"
                     /db_xref="GeneID:55992562"
                     /translation="MAFLIYIFFFLTTLALAAPTTSRLKSRSFQVDRVQRNGYVAHGP
                     AALSKAYRKFNISSTTTATTASTNSGFQALNFKPINHRYRNKHNAAVGTNSTSAGQNG
                     TVATTSVDGDVEFVSPVSIGGQTIMMDFDTGSSDLWVFSSELSAADQKSHTVFDTQKS
                     STFKKMQGATFKISYGDGSSASGNVGTDVVNIGGASVQTQAVELATQVSGSFLAETAS
                     NGLVGLAFSNLNTVSPTQQKTFFDNIASQLDEPVMTVSLKSDSSKGAYEFGTIDSTKY
                     TGKIANISVDPTNGFWQFTSASFKVGDNGDTKQMTTTTVAIADTGTSLMLVSPEAAQG
                     YYEQVEGSVNSEEVGGYMFPCNAQLPTFTVAVGKSTATIPSNVVSFAQVGTDMSGTEY
                     CYGGIQSSEDSKFMIFGDVFLKTMFVIFDQRGPSLGLATSA"
     gene            <598654..>600009
                     /locus_tag="TRUGW13939_05065"
                     /db_xref="GeneID:55992563"
     mRNA            <598654..>600009
                     /locus_tag="TRUGW13939_05065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488230.1"
                     /db_xref="GeneID:55992563"
     CDS             598654..600009
                     /locus_tag="TRUGW13939_05065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344123.1"
                     /db_xref="GeneID:55992563"
                     /translation="MATASAPESSLLSLLYRSYPTVISPDATELDLAHATPKIFSQNS
                     YTEAEQADAKQWLEAVRGLTAGLAKDDKQVVDTILGTFNTHLSTRTTFLGAKPSVADI
                     AAYAVIGPLVEKWTPEERTGEKGYHYIVRHIDFVQNGSVFGLRIPDEEKISIDLDDVR
                     FVPKPADPKEEKERKKKEKAEAIAAGQEKTMVVGQTKGNKVNDPVHEAPTTTTEEAPA
                     ASKKDKQKKEKKEKKEKAPKPPPAPAAPPSPSLIDLRVGHILRAINHPNADSLFVSTI
                     DCGDALGSDNTSVDEATGKTVRTVCSGLNGLVPLEEMQNRKVVVVCNLKPVTMRGIKS
                     AAMVLAASPKVAEGEDSHGGPVELATPPADAAAGERVFFEGWSSGEPEKQLNPKKKVW
                     ETFQPGFTTTDSLEVAFESAQIPVLQGAEATAAAPAVGKLVTQAGGVCTVKSLKGAAV
                     R"
     gene            <600802..>602762
                     /locus_tag="TRUGW13939_05066"
                     /db_xref="GeneID:55992564"
     mRNA            join(<600802..600884,600951..601636,601699..602018,
                     602070..>602762)
                     /locus_tag="TRUGW13939_05066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488231.1"
                     /db_xref="GeneID:55992564"
     CDS             join(600802..600884,600951..601636,601699..602018,
                     602070..602762)
                     /locus_tag="TRUGW13939_05066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344124.1"
                     /db_xref="GeneID:55992564"
                     /translation="MNRHYAYPNGYSAYPRGGGGTFSISPHKFQPRSQPALRRRRQLL
                     VKLLVVGGISLFILFLIIPSWRPFLIPTISLGLFTSSSDDLSLETVRYYDLSETQGTE
                     MGWHREERVLLCTPLRDAQSHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDDTLNLLSE
                     MLTELQGDSDPKMPYGEISVIEKDFGQKVKQDVESRHGFAAQAGRRKLMAQARNWLLS
                     ATLRPTHSWVYWRDADVQTAPFTILEDLMRHDKDVIVPNVWRPLPDWLGGEQPYDLNS
                     WQESDTALALADTLDEDAVIVEGYAEYATWRPHLAYLRDPYGDADTEMEIDGVGGVSI
                     LSKAKVFRSGVHFPAFSFEKHAETEGFGKMARRMDYSVVGLPHYTIWHLYEPSVDDIR
                     HMEEMELEKKQREQEEKEEEARQQLIKDTFNNPEEQWAKDGAVVKKMDETEEAREREI
                     QRAKDKENGIERDLEEESRIEKEKERKLAVEREKKRAEEKEKLKEEEKEREKKEKERE
                     KKEKEREKKEKEKRKKMSENNNKKPEKKNTNERAVQRPQRQKGADEGPAAKAEKEEIK
                     KEEIKKEEIKKEEVKKKTTPQAEFEMD"
     gene            <603167..>604561
                     /locus_tag="TRUGW13939_05067"
                     /db_xref="GeneID:55992565"
     mRNA            join(<603167..603285,603375..604120,604180..604346,
                     604400..>604561)
                     /locus_tag="TRUGW13939_05067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488232.1"
                     /db_xref="GeneID:55992565"
     CDS             join(603167..603285,603375..604120,604180..604346,
                     604400..604561)
                     /locus_tag="TRUGW13939_05067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344125.1"
                     /db_xref="GeneID:55992565"
                     /translation="MSTQAARNIRLTHNSQQRSFRLLELTPEIAELLSSDNAPVLHLK
                     SSPSDPSAQNTAYVNLCTPDKTFRIRQVQSSNSIHLIQPSTGENSRVVPLKQQKEKEN
                     DGLNEEWADTVSTVAKSQSTLEVHALEEGGASVTQMLAQGLRVYGSEDQEDVDMADSN
                     RREEVVTRAEREGAKKKVIADVPFSEAECNAAWTDICAFVHVDTESNNNVAAFRPSAR
                     MKIDAWKRILQGSVLQSIDLEKQFLANDLWKAVLGDDDDGEEEEPFPRPLFDALLNRL
                     VEKTGSQPLELKWSNLDKDASIKWIGETYLEAFAPVERSAIGRSEFLRAWKDLLPEAW
                     RDAASLDVLPANSYKSPDPVSICFVKESERHKLKKAGEGATGAGAATTKNSRNWHERF
                     RSQRK"
     gene            complement(<604680..>605864)
                     /locus_tag="TRUGW13939_05068"
                     /db_xref="GeneID:55992566"
     mRNA            complement(<604680..>605864)
                     /locus_tag="TRUGW13939_05068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488233.1"
                     /db_xref="GeneID:55992566"
     CDS             complement(604680..605864)
                     /locus_tag="TRUGW13939_05068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344126.1"
                     /db_xref="GeneID:55992566"
                     /translation="MGSADIAMDSDLAGDSPHLKLVPATPEEHLHTLNLNSKAWKGPL
                     ELGQYIEREHHLSQQNLTRDGALTCWILVDGRKPPNSRTILSSCETYRKPAYLAYKGR
                     VEDIVCHGVGSVFARPEFRGRGYAGRMMAELSQILDTWQTENQPRKQGIFSVLFSDIG
                     KKFYSRYGWKPFMSTHITLPSINEDHFKTSVAMAKLPVARPMSADDVRQSMCGEIVEH
                     KERNLLLGASQKSPTAKVAIAPDYDHMSWHWAREDFYVDRGIFANKKPQVRGAAVDHQ
                     NVYCAWVRTLGDSPESHTLHILRFSYDEPVTVPGEMGTIEALAAVIRRAQYEAHALNV
                     KKVEFWNPTSMVEKAAKLLDPDVQVEHREESSVCSLKWNGAKLGLGDEVEWFWNEKYS
                     WC"
     gene            <607693..>609646
                     /locus_tag="TRUGW13939_05069"
                     /db_xref="GeneID:55992567"
     mRNA            join(<607693..607720,607773..607960,608054..608400,
                     608455..>609646)
                     /locus_tag="TRUGW13939_05069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488234.1"
                     /db_xref="GeneID:55992567"
     CDS             join(607693..607720,607773..607960,608054..608400,
                     608455..609646)
                     /locus_tag="TRUGW13939_05069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344127.1"
                     /db_xref="GeneID:55992567"
                     /translation="MDNRPSHRDVSLQPKPNPVSPLNISHFPRKSGYQGGQAVYAPCI
                     QTAPDTSNWSNHFYSPLFALKGFNPSNEAAHTLAIQTNHRSRPTTQPEPAVSFQQPYL
                     HPRGFHRDIPLQTPRPASRLDSHPILPPIFNHQRFIDQTIVKPAEAVPRPFDLEYFYS
                     KRAMKRRPSDDESNTEDPKRPRKGPCYKLIALANEFPFVQHKTIRALLSRHETLLDAY
                     EALYHLEQPDPNDDRNPLTRLRRVRPKNETNIPLEIQREIEQIKKIVADNAKNLVECQ
                     CCFVGVSPKVAISCNGDETHSFCRRCIKKYAETQLGQMNYDIKCIDVSGCHAGFEKAL
                     LQQVVGEKFLKRLEFLQQMDELTKSGVKGLEGCPFCEFKAVCVPLVQVKGTPKFSCQN
                     PDCGKVSCRLCQCESHAPKSCAQAKKERGVPERREVEEAMTKALLRTCPKCGISIVKE
                     SGCNKIQCRCGTLICDVCKANITKAGYKHFSREGCPPSEPDQGQSRLVDEVQRAGNAA
                     VDKIVAGNGNILREQLHIEAPQPQPEPVHFNFAPPPVNMRFPHPLLRADPAPFEPRNF
                     PQYFPQYLPPNNLPNRLS"
     gene            complement(<610719..>611562)
                     /locus_tag="TRUGW13939_05070"
                     /db_xref="GeneID:55992568"
     mRNA            complement(join(<610719..610805,610979..611199,
                     611250..>611562))
                     /locus_tag="TRUGW13939_05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488235.1"
                     /db_xref="GeneID:55992568"
     CDS             complement(join(610719..610805,610979..611199,
                     611250..611562))
                     /locus_tag="TRUGW13939_05070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344128.1"
                     /db_xref="GeneID:55992568"
                     /translation="MATRTTYVHEHVYYLALAGLIIPGSFEVDVEMCQCTTSAQTTSS
                     SDRIQYRKMNVSARIFYRNDWHRFLVIEAKGFQKDWSPPETRIILISGIKPCIQWVKD
                     GPGANDEPTTLLHSKGPAVPKNRPGVENVDAGPSCGCQDRYRKCGGEGGLCLHTGPEP
                     AAGYLRYLTGDCRNALYFNLINVREGDNVVIGQQRPRRQSGLRTPW"
     gene            complement(<613238..>614104)
                     /locus_tag="TRUGW13939_05071"
                     /db_xref="GeneID:55992569"
     mRNA            complement(join(<613238..613411,613467..613610,
                     613670..613769,614079..>614104))
                     /locus_tag="TRUGW13939_05071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488236.1"
                     /db_xref="GeneID:55992569"
     CDS             complement(join(613238..613411,613467..613610,
                     613670..613769,614079..614104))
                     /locus_tag="TRUGW13939_05071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344129.1"
                     /db_xref="GeneID:55992569"
                     /translation="MCPLIDIEWLRNHNNNNNNNIIIIIIIIIIIAAAAARAMAIQNL
                     INVREGGNVVIGQQRPLRQPRAARVSKKKKATKKATKRALRTEGGLSQEIARLEAAEE
                     EAQETSRLRLQRLQQLKEDLKKMEEKEEGEEKGVDGGEDMELCCR"
     gene            <614471..>615016
                     /locus_tag="TRUGW13939_05072"
                     /db_xref="GeneID:55992570"
     mRNA            <614471..>615016
                     /locus_tag="TRUGW13939_05072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488237.1"
                     /db_xref="GeneID:55992570"
     CDS             614471..615016
                     /locus_tag="TRUGW13939_05072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344130.1"
                     /db_xref="GeneID:55992570"
                     /translation="MSTTVYTSESHLCHLRGLIKPGAYEVTVDHFWLNMLIHYFGPRY
                     IFEREAYSRAGVHLRRMNVTMKNFRANGFRRVFVVEAKRLPKSKRYRWDKVFRQLAKY
                     MREVQRDTGGLQTIYGIAAVGDRVRFYEMDCRGNRAGIAAAYPRSTTNPRTLGINTDA
                     GVIHDYLLAIRHEISNGLNTH"
     gene            <615840..>616877
                     /locus_tag="TRUGW13939_05073"
                     /db_xref="GeneID:55992571"
     mRNA            <615840..>616877
                     /locus_tag="TRUGW13939_05073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488238.1"
                     /db_xref="GeneID:55992571"
     CDS             615840..616877
                     /locus_tag="TRUGW13939_05073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344131.1"
                     /db_xref="GeneID:55992571"
                     /translation="MENQRKVHLVGSICGTDTATSAFRKAVTSFSNLPRLPDGEPGYR
                     STFIQWQRGVFKHDPSVLRKYDKSWNSVSEDPVPDDQVKSIVGRILPLKPGYDDAALE
                     SYAEFRRLKDEGVIPAHVRFQVCFPTPFVVVCLVREGFQADIEPLYEKALLSCLENIQ
                     DKIPHDDLAIQWDIAGEMMPLESHFLPHFKPWFPQPYMEGFIERIARLVNTVSPDVET
                     GIHICYGDWGHRHFIDPKDTGLMVTLSNGILASARRPVNWIHMPVPRNIDDEAYFSPL
                     KELKLQPGSDLFLGLVHANDAAGTRLKIDIAKKVLRQVQFGIATECGLGRTPEEDFQS
                     IADITNLYSHL"
     gene            complement(<616981..>620420)
                     /locus_tag="TRUGW13939_05074"
                     /db_xref="GeneID:55992572"
     mRNA            complement(join(<616981..617052,617106..618124,
                     618177..618449,618506..618584,618865..618961,
                     619247..619488,619563..620175,620228..620328,
                     620382..>620420))
                     /locus_tag="TRUGW13939_05074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488239.1"
                     /db_xref="GeneID:55992572"
     CDS             complement(join(<616981..617052,617106..618124,
                     618177..618449,618506..618584,618865..618961,
                     619247..619488,619563..620175,620228..620328,
                     620382..620420))
                     /locus_tag="TRUGW13939_05074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344132.1"
                     /db_xref="GeneID:55992572"
                     /translation="MALLAPEQGIQVDTSDVESLYDEESVLESSKSIVSSVYDYLWEN
                     GRRYHAYRQGQYPFPNDEREQDRLDLMHCLWKDLLNGSLYRAPLHELEVQRILDFGTG
                     TANWAFDVAELFPRAEVLGTDLSPIQPIWSPANCKFFVDDVESEWAYSSLEAFDFIHG
                     RAMGGSVSDWPQLLRRIHTHLKPGGWVELQEFECMVTSDDGTHQGVNELRDWCSTVDE
                     ASVRFGRQIGVAAVLREKLENAGFVDVVDDFYKCPIGPWPRDERLKHIGRVHLACCLE
                     GFEPYSLALFTRILGFSYDKFQAYIHDVKKAALNPDNHLYVGFHFVYGRKRRLDETCH
                     GIMWQTKGRPAGTSILTSSSFGRNINIEVLPKKAGCKLCNIWFSHQGNAWPSRFRALY
                     RSQDGEIKLSEVAALREEDKCMILDEENGEWNTANLGLLTGEQYKPAANKSNCCYLFH
                     ELCWDRVIDHFCPDELDLVSLHKALLHFALKGRSIHGHFYRQAGKLEVYSDEESDGDD
                     NFDPFLLKPTIKQIMRRRIKKPPFLRPKNSIKDSIGNSVNKTDPFAALPAEVRQILAI
                     HLATQDFFALRSASRSIAPLFESTTFWQSRFFIGGEYGYLYHAIREFTSVKRNDKLDW
                     RGLYIRMQKLEYTPQLDFQACVWDSLRQLKSATREFRSSTAKVSQCGHYHNYPISCVK
                     NTHKESIKFGQAEKLRCVEISMVKIGYEAYVTGLIFIFDDQKSVWIGHLLPGIENSNP
                     WLPGTLAFTSHFAYPGHCVVSAHMDNFLGLSFCKDSNGIHSMTIINRDDRPRCIASCL
                     QNTTANSTDLILDKVTEIIVTLDHCKVIDLEIRGPAGKPKKDEEISI"
     gene            complement(<621196..>624429)
                     /locus_tag="TRUGW13939_05075"
                     /db_xref="GeneID:55992573"
     mRNA            complement(join(<621196..622963,623028..623557,
                     623614..>624429))
                     /locus_tag="TRUGW13939_05075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488240.1"
                     /db_xref="GeneID:55992573"
     CDS             complement(join(621196..622963,623028..623557,
                     623614..624429))
                     /locus_tag="TRUGW13939_05075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344133.1"
                     /db_xref="GeneID:55992573"
                     /translation="MEQELLQLLAATQSPAANTRRSAELQLLHLYSNEAFPLSLVAVA
                     SHESVELPLRQSALSVLRAFVLAAWSPVLDEFKGQVLINDANKATLRRALLDLATTTE
                     TNRKIKASASYAVSKIAAADFPEEWPDLLPSLMQIINDQASSDIALHGALKVLLDLVE
                     TGFSEEQFFNIARELVSTLFTVATNESRKTILRALAVSVFRSCFDTLEMVLEQHKAAV
                     KQFMDEALSGWSPFFLTVMKAPLPQRPSEEEEAKDTELPSQWRGAIALKLQAIKTVMK
                     IRMVFPTLLTTQSPQLFTTLWEELSNIQGHYFDMYIEDERQGRLEDADGLPYTLDILV
                     LEEIDLMQALIKAPPVKAELQAQLQNAGQAATSTGWLPEIIKLAISYAQITTEEEGLW
                     DIDVNLFLSEETSVTANYTPRTCGGDLLIKLGEWLKVTVVQALVTYINTLFADPASTW
                     KQREAALYILNQLLRDFNEVEQQIPVDVASGFTNSIQFAFQNEQDFLRARGYLLAGAL
                     SQTAGPGFQQVAASYLDATMKAISQDSSEVVQVASIRVLQDILPALPSTTTQPMQIPI
                     ITSISQFIAAHDLREGTDNDDLKVTLAETLRDTIMVEANVVLDSTALDVLFNVASNGA
                     DNFHLVMIVTESFEDIVQYVSQQGFDAYVRLCEKVLPSLTGAIDVGSMTEESALTVLA
                     ADLLRALADYGSEPLPNGFVATVMPKLNRLLLDSCDGELIRPATLAVRHILAHDFNQF
                     LAWREPEQGKEAIETALVIIDRLLGPDVDDIAAAEVGQLAAELVEKAGSEKLGPYLPQ
                     LLQAVARRLATAQQPQFIQSLILVFARLTLISPREVVDFLAQVDLSGQSGLSVVLSKW
                     LENSVNFAGYDEIKQNIIALSKLYNLEDPRVAQVQVKGDLIIQDTGRIKTRSQARNNP
                     DQFTSVSASLKIIKVLVEELAGASGNKEIDAAAAAALEEADSEDDEWEDIPGNTLDLG
                     LGVTKQELMSFGEGGSESVFAVRKRDDETQGFLVQFFQEASTKPGFQELFNILTPAEQ
                     EKLRSLG"
     gene            <626781..>627620
                     /locus_tag="TRUGW13939_05076"
                     /db_xref="GeneID:55992574"
     mRNA            <626781..>627620
                     /locus_tag="TRUGW13939_05076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488241.1"
                     /db_xref="GeneID:55992574"
     CDS             626781..627620
                     /locus_tag="TRUGW13939_05076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344134.1"
                     /db_xref="GeneID:55992574"
                     /translation="MAMASESSTTVNTMTAATTPLSAPENSLPDTQAAIAASFTNFLS
                     VAMHQILFLRNVYPRATFLPVRAYNYPVRQSRHPKVCDYINDVAIAVESEILKGTITA
                     VTVIISSVRTNQPMERYAFDLSGFPHVPVGELYTTFEERKEEASKPASTAQSIDLESQ
                     FRACLARLASACARLTPLPRDDEFGFTVCIEVREDALPPVGTTKEEQTWIVAEPGQVH
                     VRSCTAPFSVSKVGSHSQQPLLPKINGRAKTVPVRRVEAGELRLELWVEEARQKFDER
                     LVT"
     gene            <629346..>630459
                     /locus_tag="TRUGW13939_05077"
                     /db_xref="GeneID:55992575"
     mRNA            join(<629346..629435,629505..630006,630068..>630459)
                     /locus_tag="TRUGW13939_05077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488242.1"
                     /db_xref="GeneID:55992575"
     CDS             join(629346..629435,629505..630006,630068..630459)
                     /locus_tag="TRUGW13939_05077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344135.1"
                     /db_xref="GeneID:55992575"
                     /translation="MDPPAADAESTKSKNRPQQSCIKCRERKVKCDRAKPCRSCVVRG
                     WQDECEYVRTNEDREQINQADEIDSLRKELNRLKRRWDDVQQSSSSTRTSSTSSPTDA
                     AAIAMAPHAQGDEHAWPRKAQKRPGADAALFFGAQSQQARFVADAGSYQNAGLHHTAA
                     FEYAQGQPTGSSMLQHPPLTRPGSGESFSGQVPGYDFGSPYSWGFNGVPADAPVLYTQ
                     QDHNNTSPPSRNNSTAFAENAMHQLQQHPHANFWRGKGVLMQNIYKIIRDCDEAWVPS
                     IIGIVRGSQSPEDAIRSIHRLMSTSRSPTGSSASAISNQSSPEGWAGYQMN"
     gene            complement(<630548..>631492)
                     /locus_tag="TRUGW13939_05078"
                     /db_xref="GeneID:55992576"
     mRNA            complement(<630548..>631492)
                     /locus_tag="TRUGW13939_05078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488243.1"
                     /db_xref="GeneID:55992576"
     CDS             complement(630548..631492)
                     /locus_tag="TRUGW13939_05078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344136.1"
                     /db_xref="GeneID:55992576"
                     /translation="MTSSPYLTALQRDGFVVIPSLLSPDEIAPLRDAATKATTLTRSG
                     KWPFFRTVPKQFPPWPDVVPPASEGGIWGVQHLLHPAMPGRSEFAQLYFSDKVLRIVE
                     ELLEVGTTTTGQEEEEGGGEEMLVMELLNLLVAPETKDFELRWHRDGISETATSDEEL
                     QLLHTNSPNGRQFHAQYNIALCPDTSLIAVPGSHRRARTDAERNADPYEPNLTGQRVV
                     KLEPGDVVFYDSNILHRGAYQHKPEGGPETRLTLHGSVGLKSQDGKVRATAVLQHGVG
                     QWIDREEAALHAGERAERMRRNLIAMGRGDDVGYALQG"
     gene            <632155..>634835
                     /locus_tag="TRUGW13939_05079"
                     /db_xref="GeneID:55992577"
     mRNA            join(<632155..632254,632318..632465,632524..632682,
                     632732..>634835)
                     /locus_tag="TRUGW13939_05079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488244.1"
                     /db_xref="GeneID:55992577"
     CDS             join(632155..632254,632318..632465,632524..632682,
                     632732..634835)
                     /locus_tag="TRUGW13939_05079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344137.1"
                     /db_xref="GeneID:55992577"
                     /translation="MALRILKGISPSIVFLVVLLVLLPTKASAFGAGNIASISTVEGK
                     NWRHGDIEDTIKALAFIKGHKWTSTMIKRVYFGNWLRDYSQAMDVGTLKNLQADTIRV
                     LVWVLSFMSFGYATGEFEVTADRLGVYRPEEHIDNPKDYADNEDARQFDKRLRPPVRQ
                     VELDIDPETGMKNYIANERGDWATSAAYVKYSMSRSIHYGRMYTSGGHGKGKEEDLCE
                     ALRCLGQGLHTLEDFGAHSNYCELTMREMGYNNVFPHVGTATQITLHGRHVFPLVTGT
                     FGMVDFFHSVLGEANDHFTQSELNEADNALLNAESNSGSSPLNALTGLLGNVPGTKEL
                     VIEAEELKQRSEQQAAANRSQHVHTGYTNSSRGFDEPVAGGFDQSRAYGQDYGAPQHQ
                     QPQGGYATHQQPPTGGASGGSNIPSAVSDFDPQKTVNQIYPILQFRDKVVRRISSIIE
                     KIPGLESLVEKITETVTLFVFSLLAPFIRPLINMASKSMQTGSMGVVESSGKHQYEVW
                     TDPHCSDPTHSMLSKDHFVNILNAPAGQVASAILKYVVPRVLYAWQHVDVPVDQVLND
                     CLRVFHHPATRDMNNEAHRSMFEAVDAWVKSRSDHGRNLNDVLSAEGVRAGKNLKTDS
                     SGESHGPHGAHTGHTHGGGGFPAVGGSLYGAGHSSQGHQQQQQQSHSSGGLPWEQLEK
                     LPIPGISNVSSIANKLGGFGNLLSGVGGLSRDQPDEPQEQQHHGQTHGGYDQGGYQHQ
                     SHHQQYQHGAPPAGDGYGHQPPPHSQYDQQPQYDSGFHLPPPSGYEQYHGSFHEPRDY
                     QPPEQGSHMHEYHEGGHGGGHQHHHHSEHGHGHHSHHH"
     gene            complement(<635644..>636533)
                     /locus_tag="TRUGW13939_05080"
                     /db_xref="GeneID:55992578"
     mRNA            complement(join(<635644..635712,635775..635936,
                     635992..636317,636515..>636533))
                     /locus_tag="TRUGW13939_05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488245.1"
                     /db_xref="GeneID:55992578"
     CDS             complement(join(635644..635712,635775..635936,
                     635992..636317,636515..636533))
                     /locus_tag="TRUGW13939_05080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344138.1"
                     /db_xref="GeneID:55992578"
                     /translation="MSYTPEVTWAQRSSDSDETRNYLWVFINVPDVPPSSADVKVTST
                     SVSFTGTDIKEKKYSVTLELYAEIDTENSKTHHTPRGVEMVLRKKTLGLEYWPRLLKE
                     AKKVHFVKTDFDKWIDEDEQDEAVDDDYAANFGGFGGEEGGLGGIDFSKLGGGNLDGA
                     LGGEEEEEGDEDLPELEGDEKSSGKKIEELS"
     gene            <637035..>637783
                     /locus_tag="TRUGW13939_05081"
                     /db_xref="GeneID:55992579"
     mRNA            join(<637035..637082,637145..>637783)
                     /locus_tag="TRUGW13939_05081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488246.1"
                     /db_xref="GeneID:55992579"
     CDS             join(637035..637082,637145..637783)
                     /locus_tag="TRUGW13939_05081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344139.1"
                     /db_xref="GeneID:55992579"
                     /translation="METIKAVFFGPDPQVQMRKCNQLIRSNTRQLDRDISQLKSLESK
                     TRQLIVNASRRAQRNPSQAKQATAETKTFARELLRIRKQNTRLTTSRAQLQSVQMQVN
                     EAFSVRKIQGSLKKSTGIMKDVNTLVRMPELNNTMRQLSTELVRAGIIEEIVDDALPN
                     DELLDDELEEADAEVDKVLQEVLQGKLSKVEPVRVQQPVEEEAPAEAEFEDQEATLEQ
                     MRGRLEALKS"
     gene            <638447..>640253
                     /locus_tag="TRUGW13939_05082"
                     /db_xref="GeneID:55992580"
     mRNA            join(<638447..638671,638727..638756,639624..639788,
                     639836..639906,639958..640198,640251..>640253)
                     /locus_tag="TRUGW13939_05082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488247.1"
                     /db_xref="GeneID:55992580"
     CDS             join(638447..638671,638727..638756,639624..639788,
                     639836..639906,639958..640198,640251..640253)
                     /locus_tag="TRUGW13939_05082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344140.1"
                     /db_xref="GeneID:55992580"
                     /translation="MSSSKLDQSLEDISKSRRQGGRANRRRSGPAKAATSKAPVGGVK
                     KNTKPARAATKSGAIGPSSPVNESKIIVSGLPHDVGESSIKDYFTKTVGPVKRVTVTY
                     NQNGVSRGIASIIFSKPDTAAKAAKELNGTLVDGRPMKVEVVVDATHAPQVPAPKPLS
                     ERVTQSKAKPRPATATKNAAAAGGRGRVRARKGKNPTQRKKTTEELDAEMDDYFVGSE
                     NAPVDAATNGVAQPAANGDETMAEIS"
     gene            complement(<640727..>648747)
                     /locus_tag="TRUGW13939_05083"
                     /db_xref="GeneID:55992581"
     mRNA            complement(join(<640727..647218,647279..647435,
                     647483..647919,648007..648275,648346..648490,
                     648559..>648747))
                     /locus_tag="TRUGW13939_05083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488248.1"
                     /db_xref="GeneID:55992581"
     CDS             complement(join(640727..647218,647279..647435,
                     647483..647919,648007..648275,648346..648490,
                     648559..648747))
                     /locus_tag="TRUGW13939_05083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344141.1"
                     /db_xref="GeneID:55992581"
                     /translation="MSDGLEKDPIVVVGFAFKFPGDTTDSTSFWNMMVEQRCAMTRTP
                     ADRISEKSWHHPDQSRRGQFYTCGAHYLQEDISLFDAPFFSLSAEEAAGMDPQQRHLL
                     EVTYHALENSGIPLNVAVGSHTSVHVGCFTNDYGLQIFKDIETSADYDVFGVNTSMNA
                     NRISWFYDFKGASMNVDTACSSSLVALDLACQELRSAGSNMGIVAGTNLIFSPDFMQI
                     LSNVNMLSPDGKSYSFDQRANGYGRGEGTGAIVVKRLSDALRDGDTIRAVIRSTGQNQ
                     DGRTPLGIMQPNGDAQSKLILNTYAKRSLSLEPTRYFEAHGTGTPVGDPIEVNALGEV
                     FRSVRTPDDPLFVGSVKSNIGHLEGASGIASVIKTILIIEKGIIPPSANLQRINPKID
                     TEWLRIKFAMTPTPWPTTGLRRASINSFGFGGSNAHIVLDDAFHFLKQHGLSGNHVTV
                     EQPPSTNTLPVNGIEAHDMQYELPMPKLFIISAHDKAGVKRVASAYSSFFQRSPKKKA
                     LFGTFAADLAYTLNTRRSALPHRSFWTASNRDQLVQVEERMVPAQQAVDKLVLGFVFT
                     GQGAQWAGMGRELLEYNVFRDSLTRSDHYLRKFGSTWFLEEEICRGKDTSRINTPEIA
                     QPATTALQIALVDLLRSVGVHPAAVIGHSSGEIAAAYTQGALTAAEAIRIAFFRGICA
                     TKLSLTQQRTGGMISVGVSEDDAAIYIEQIAQTYGHRGLAIACINSQKNVTVSGDETQ
                     IDALREILDRKRIFARKLAVPVAYHSFHMEDISASYRELIGPLDSPPPVSSSHTAMIS
                     SVTGQQIQAKNLRSAEYWVKNLTSPVRFSTAFNKICTKSGKIRKKLDCSHLSQIGVNF
                     VLEVGPHSGLQAPIRNLLELLPWSGGITYSSLLQRGKHAAETFLTSIGNLYCCGAPVD
                     LASVNRLGEFLPTHHKVIHDLPGYPFNHQTSYWHESRIASEFRLDTHGKLDLLGKPAL
                     DWNPLEPRWRNIIRASELPWVQDHVVNGVIMYPAAGMVVMAIEAANQMADANRTISGF
                     QLKDTSFLRALVIPTGESGVETHLHLSQEAGSWTKFRLSSFDNGRWHEHCHGFIKVEY
                     ETGTQNKLDRFSKQQNDITKACVLDVDHDRLYKTASDSGLVFGPTFRSTHSGKISKNR
                     EAMSSVNIYTWPPNEYPQPHVVHPTTLDGIFHLILAILSDGGQKEIPTAVPSGIRRIW
                     IAKNGLSTPCDEPDVKAFACVTNMHSRGHECDIRTLNNAGTAFLAQIDGLQSTIVNTK
                     STDQAQRHKLYHLDTVPDIDLLDQTQLSSYCAQAERAPDPLDYHLDLNFVLYAFLDKT
                     MQNLGDIPHDKIEPHVLRYIEWAQHQLNQFQKGQLPLGRDEWKDLLKDEAYFDAACER
                     VAAANSQGFMFVHTGKNLLSILRGEQDPLQFLFKDGYIHAYYRETNNRPCFDQWDRYL
                     QVYAAKHPKMRILEIGAGTGATTTQALHTLSHGCGRSEANPVYLSYDFTDLSPVFLQH
                     AQEKYKNYPRIKYQVLNIEKDPLQQGYAAESYDLIIAANVLHATPNMEHTMANVRKLL
                     KPKGKLMMYEITQPDIVRSGFVGGLMAGWWAGMEDGRPWSPAMTTTRWADVLTNTGFS
                     GVDLEIPEYNHSDCQETSILVSTAVSNLAPERSLMASDEQFANITFVVNPQSVFQKGL
                     FKQTRESIASQYPGSAVEKIAWEECAFLPSIKKTTLVFLLETDAAFFSQISEANLTKL
                     QKTISQCGHVLWVTAGGGATPKNPEHCMATGWVRTLSNERTMGRICTLALDINGPAHS
                     EQVKYVVQVLAEEIFSNDKEHQESEFIEMDGSLHIPLLKPNLPLSEDVSAAEAEEQVT
                     VKPIGEAGAVKLQTRELGTLGNFQWIEGSNITEPLQADEVEIDVRAVGVNVHDCLVAL
                     GKIPGVFGLECAGIVTRVGSASTFKSGDRVVTFGQDLFQTTIRSQDDKVCKLPASLSF
                     SEAASIPVGFGTAWQAINEISRVQQGDRILIHTGPGGVWPVSVQIAQFLGAEVFVTVD
                     SDEQKSLIQAQYQIAEDHVALRENTSFTDLIMNITQGDGVDVLLINSSVGEDIFVASC
                     ECIASDGRIVEIGEKVSNKLLSVALPEITNISYTHFNSIDWMQRRPKRAKKTIDTVLD
                     LVEQNALRLQPINSFAVDHVKEAFQMANAEQTTDKFVVDLTLDARVPVLLKKSFQCTF
                     NPDVTYVITGGFGGLGRVIARWMVRLGARNLALLGRSGAKTELALELVCELESQNVRV
                     ATPPCDIIDPEAVRRVFQELSQTMPPIKGCIHGSLVLRDRLFDDLTYEDWRVTAECRA
                     AGSWNLETNLPRDLDFFVLLSSASGVVGLPSQSNYASGNTYMDALAKYRVAKGQKAIS
                     IDLGAMSEDGILVETGILDKVLSYGPMAPVSRKALLGLLDHYCNRDLPILTPATSQIL
                     IGLTLSGEGYMGKLFARKRLFCHPEVAISDEQNDNGTPRIDARKALVTATSLQDARDI
                     VSQSLISKLTHDYKVITEDLEIDHQAPLYTLGVDSLLAVELCKWVATEFSADLATFEV
                     LGGASMTTMSTMVATRTQLQHPTW"
     gene            <650906..>651786
                     /locus_tag="TRUGW13939_05084"
                     /db_xref="GeneID:55992582"
     mRNA            join(<650906..650947,651055..651073,651130..651207,
                     651254..>651786)
                     /locus_tag="TRUGW13939_05084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488249.1"
                     /db_xref="GeneID:55992582"
     CDS             join(650906..650947,651055..651073,651130..651207,
                     651254..651786)
                     /locus_tag="TRUGW13939_05084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344142.1"
                     /db_xref="GeneID:55992582"
                     /translation="MRFLCLHGMGTNSEIMESQLSAIRHELGQIHEYDFVEGTIPSPL
                     APELHGFFPPDDTYFNYFHNNSAPSILKALEDLSAFLDREGPYDGIIAFSQGGCLAST
                     FIINHIQQHPNKPLPFKCAIFLSSITPADPNELEKGTIRFIQPDAYGQPLVSGLATTH
                     IWGRNDDHWPGMSEPLYELCDTHKRNVFLHDEGHAIPAARAKEAVLGCVKVIRRTLDR
                     AALGA"
     gene            <652304..>653499
                     /locus_tag="TRUGW13939_05085"
                     /db_xref="GeneID:55992583"
     mRNA            join(<652304..652523,652580..653036,653097..>653499)
                     /locus_tag="TRUGW13939_05085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488250.1"
                     /db_xref="GeneID:55992583"
     CDS             join(652304..652523,652580..653036,653097..653499)
                     /locus_tag="TRUGW13939_05085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344143.1"
                     /db_xref="GeneID:55992583"
                     /translation="MGEPSSPQDSSGYLAESRQDAVRGVAAIFIALDTIVIAMRFTSK
                     RIGSVKFGWDDAWITCGYLFSIAIIACSLVDVDAAGLGLHEDRVFMMNPEDIVLWAKL
                     TLIVAILYQLAVVSSKMGVLLLYLHIFDRRQLRFVCYAIACIVVLNCVSSIIAVLLIC
                     IPLHAFWDHSPNANCVDTNSLFRWTSFANIVTDVVMLVLPVPAIFKMTSSISVKLGIF
                     TTLGMGSVGLVFSILRFAEFFTVDAVVDVTWSGTNLVIWTMIESSIYSIAACLVACRP
                     LARYLWKKTPFGTSIDDVEMQPSARRTFTNSDHQDYRPRPLSGFYGLDSEVDDVYVGE
                     ATSKDVRRSVNTTDTHHRVEIGETI"
     gene            <654342..>657713
                     /locus_tag="TRUGW13939_05086"
                     /db_xref="GeneID:55992584"
     mRNA            join(<654342..654641,654695..654933,654993..655155,
                     655209..>657713)
                     /locus_tag="TRUGW13939_05086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488251.1"
                     /db_xref="GeneID:55992584"
     CDS             join(654342..654641,654695..654933,654993..655155,
                     655209..657713)
                     /locus_tag="TRUGW13939_05086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344144.1"
                     /db_xref="GeneID:55992584"
                     /translation="MADSRAGFDPRGLLIPNIVDRLAETSPDAVFAEYPKAVLTYDDG
                     YRSVTYGQLANAINGVAKWIVDSIGSGDGYEKLAYFGPNDVRYPALHGGAIKAGYCMY
                     FPSPRNSIPAHRSLLEALNCTKLVSPTPRPPPVDAILAAREMQVLNVPSVDELLEKEY
                     PPFPYTKTAAEAAPYPHLTVHTSGSTGFPKPIVTSHGHVSKNITMLTSNPPAGHKSQD
                     QSVRGKRMFLPFPSFHAGGIGTQLLWGIVMGAIIVLPTSGSIPSVGGMVEALKKTTVD
                     IAFIPPSIIADLGQSPELLDFCADRLQSIMYVGGDLPKVLGDRVASRIPIFNQYGATE
                     LGMVPLLQADDRDPLDWKYIQFHPGIGPEFRPYRDQEHLLVLVRNETTEPNIPVFSLF
                     SDLTEYSTRDLFVRHPQKKDLWEWSGRADDIIVFLNGEKTNPISMEHHIVSRNVEVTA
                     AIVVGNQRFQASLLLETPAKDGKPLSPSERAALIEKIWPSIEEANQECPAHARIAKSH
                     ILFTNPDKPIVRTGKGTIQRAGSLALYKDELDSLYRDADRVTAQLESVVTGPGPVDDV
                     NLISQFITDSVTAITKWSALDPTDNLFLRGIDSLQAITLVRWLRQGLQIQNISVPLVY
                     SYPSVEDLAKAIVQLLHNERELEETQKAASRAEARSILSEYQGLIDKPSQHTVILTGS
                     TGVIGSYVLDELLANQSIKHIWCLNRKGKEDSIKRHAELRESRELSPLDLENSRVSFL
                     TVNLAEESFGLAEEVYNQLRKSVTLIIHNAWPVNFNLSLSSFKPQLTGVVNLIDFCSS
                     SILSPHLFFVSSFSSVGSFQNESKVTPEEIITHHEPAINGYVGSKYFAERLLDYAVQK
                     RPGFRASVARVGQVAGAVRNRDLWNKAEWFPSLVISSLRIGALPESLGPELDNIDWVP
                     VDLLAGVLVELALKGGNASSVQVFHPLNLHPTSWEAIKPTVSDELLKLSGTKLESIPL
                     SEWVDRIRQHMEKIAGSHQALAEGEVESFVEKVPAVKLLDFYQTLVDNSQGSNAEGRN
                     VFSTAKAANASQKLQGVDGVRDEWVRKWTREWISSAKQ"
     gene            complement(<657808..>659946)
                     /locus_tag="TRUGW13939_05087"
                     /db_xref="GeneID:55992585"
     mRNA            complement(<657808..>659946)
                     /locus_tag="TRUGW13939_05087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488252.1"
                     /db_xref="GeneID:55992585"
     CDS             complement(657808..659946)
                     /locus_tag="TRUGW13939_05087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344145.1"
                     /db_xref="GeneID:55992585"
                     /translation="MQVATQQREEDTYPSSPLLDEGDEDRKRKRTRTGCLNCRKRRRK
                     CDEGKPACLACQRKDETCLWGMRVTFRAENTQTVKQGHFSVDRQDRADAEYRTPKRFR
                     IMDVTSEVIRDYHQFSPSGEFLTPDATSPSEQALGFEGENEDATAHHVVQPQHTSTRT
                     MPVNGTVSNIEAPRDQSREQFFDMAHSSLPHTETPISLTPTSSVPLNAHESSENNHSW
                     LRHILQPRPNALGEDSVSDAVEPPLPQSFPGYWDSFYSSPDVRYEDGIFLPGSEYLEL
                     HSTLRNHLILEVKSCAPTRRGTPDYTADPFKSLARNEQFETPMSAESRNRQEGPKVAN
                     ENVPSELSKEDEYLLWKNWLDEISPWLDKFDNERHFQYTLPIMARSHDHLGYSMLALS
                     ARQLELKHSELPTERSLLLYHQAIHLLLPQLPTRSTAVIASCVVLCVLEMLSCAPKAW
                     QRHLDGCASLMQAVGINGFVGGVEEALFWCFARMDVCGGLISSTKTLIPISRWVPGVD
                     LDSDISLFQSTTGYDTYANHAVYLLAQVLDLVAPFQLLGRAARTRNSLGDRVFADRWL
                     KLWRYACDWEAKRPEKMKPIMSIALSSISPFPTVLFSNPAGVSGNQLYHTAAMLMLQT
                     KPTSLRLDQKPRSILWHARQICGISMSNDHHGAWTNSIQPLWIAGQWMSHPSEHQAIA
                     DLLKKIEKESGWRTTWRVEDLKEFWGDLAE"
     gene            complement(<660291..>662000)
                     /locus_tag="TRUGW13939_05088"
                     /db_xref="GeneID:55992586"
     mRNA            complement(join(<660291..660655,660708..661002,
                     661055..661542,661604..>662000))
                     /locus_tag="TRUGW13939_05088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488253.1"
                     /db_xref="GeneID:55992586"
     CDS             complement(join(660291..660655,660708..661002,
                     661055..661542,661604..662000))
                     /locus_tag="TRUGW13939_05088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344146.1"
                     /db_xref="GeneID:55992586"
                     /translation="MSFLVGRRLNWAITAVAGSGFLLFGYDQGVMSGLLTGTAFTKTF
                     PEIDTTSTGNGSSSLQGTVVAIYEIGCFFGAIICMLVGERIGRRMCILIGSAVLSVGA
                     ALQATSYGIPQMIVGRIVAGIGNGMNTSTIPVWHSELMKASSRGKGLCIELAINIFGV
                     ALSYWVDYGMSFVDNDAQFRFPIAFQVFFAVLTFAGILVLPESPRWLVAHDRHDEAKQ
                     ILWSIQPNAEEIDIDDPKLNRDISEIVYAIQEEREAASGGSFRTMLKNGEQKFLYRTL
                     LGIGGQFMQQISGINLITYYAPVIFEESVGLSHNLSLLLAGFNGIAYFLSSLVPIWVI
                     DRLGRRKLMLFAAAGQCACMAILAGTVSNGGKSAGIVASVMLFLFNFFFAVGLLAIPW
                     LLPAEYAPLAIRTRAAALATASNWIFTFLVVEITPVSIRNIGWHTYVYFAVFNFCFLP
                     LIYFYYPETRNLSLEDIDKLFTGDKILLHWKPSMDESEGPGPLPATEKKLYGESLQVE
                     FVKHES"
     gene            complement(<662651..>663640)
                     /locus_tag="TRUGW13939_05089"
                     /db_xref="GeneID:55992587"
     mRNA            complement(join(<662651..662854,662910..663023,
                     663080..>663640))
                     /locus_tag="TRUGW13939_05089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488254.1"
                     /db_xref="GeneID:55992587"
     CDS             complement(join(662651..662854,662910..663023,
                     663080..663640))
                     /locus_tag="TRUGW13939_05089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344147.1"
                     /db_xref="GeneID:55992587"
                     /translation="MAPTAVIETMPSSPTPTQNPSQTQSVPYLFALHGKTIAITGGGR
                     GLGMSLAFAVIEAGGHVACLDILPAPSEQEWASLQKLANVSNLTISYHQCDVTSEIET
                     TNKLETIAQEATTKGAPFSGIVACAGIQQQVPALEYDAQDFERILRVNVTGSFLTAKR
                     AARIFVDQKQGGSIVLIASMSGQIANRGLTCTAYNASKSAVHQMCRSVAQEWGTHGIR
                     VNTLSPGQYIKTDMTNALLDANPEVEKIWMAGALLGRLGTPEDFKAPAVFLLSEGSSF
                     MTGADLRVDGGHCASA"
     gene            <664400..>666784
                     /locus_tag="TRUGW13939_05090"
                     /db_xref="GeneID:55992588"
     mRNA            join(<664400..664545,664611..665091,665150..665785,
                     665841..666002,666050..>666784)
                     /locus_tag="TRUGW13939_05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488255.1"
                     /db_xref="GeneID:55992588"
     CDS             join(664400..664545,664611..665091,665150..665785,
                     665841..666002,666050..666784)
                     /locus_tag="TRUGW13939_05090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344148.1"
                     /db_xref="GeneID:55992588"
                     /translation="MSAVEHNTNGLSHQIVVPSQDREKIHLALRTIRCLVADLCEQYK
                     GGHPGGAMGMAAIGISLWKYAMKYSPSNPQFFNRDRFVLSNGHTCLFQYIFLHLSGYT
                     AMTMDQLKSYHSTRTDSICPGHPEIENDGIEVTTGPLGQGIANAVGLAMATKHLGTVY
                     NRPGFSLVDNTTWCMIGDACLQEGVSLEAIQLAGHWKLNNLVVIYDNNQVTCDGSVDI
                     CNTEDVNTKMRACGWNVLDVEDGCYDVEGIIAAFNKARSSTDKPTFINVRTVIGVGSK
                     AAGDAKAHGAAFGADDVTNIKRIFGMNPEEHFVVSEEVYSYFRDAENRGKALEVNWQQ
                     LLEGYSKEYPELHGEFKRRVEGKLTVEDWSRLIPSKEDFPTSPTPSRKSAGLCCNPLA
                     SQVQNLMVGTADLTPSVNMAWKGKIDFQNPDLKTTCGINGDYTGRYIHWGIREHAMAS
                     ISNGLAAFNKGTILPVTSSFFMFYIYAAPGVRMGALQGLQQIHIATHDSIGTGEDGPT
                     HQPIALAALYRAMPNIFYIRPCDSEETAGAFITALQATSTPSIISLSRQNLEQYPQHS
                     SRDGVQRGAYVFVEEEDADVTLIGIGAEMVFAMRTRQLLQRRFNIKARVVSFPCQRLF
                     EQQSIEYKREVLQYRSKAPRVVIEAYAVNGWERYADAGFSMASFGHSLPGAAAYKYFG
                     FDEEIIAPEVVHLVEDVRREGIESLRGEFRDLNPVHH"
     gene            complement(<667235..>668785)
                     /locus_tag="TRUGW13939_05091"
                     /db_xref="GeneID:55992589"
     mRNA            complement(<667235..>668785)
                     /locus_tag="TRUGW13939_05091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488256.1"
                     /db_xref="GeneID:55992589"
     CDS             complement(667235..668785)
                     /locus_tag="TRUGW13939_05091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344149.1"
                     /db_xref="GeneID:55992589"
                     /translation="MLVSSTPHHLSTFPLMSPRTRSQAKSEAKKASATLTGLPTEALH
                     QIFSTFLKHQSTAPDAYFRGTQQQSDERSWHSIQCHALFSLSLVSKRLRDIAQPILYK
                     EFVPGYGDSWKSALYTWDGRLTSFLRTIARRPDLATLVKRIYIHSHLLKSVDAKENQD
                     EIKQAARAVGIEKWQQLSGSELVTILIAKLPNLKHFSLQTVMNPVEGLSSSYLRALGI
                     SVLPLTTIDINLYAATNEPRHDRLFNLEVCAGAILELATNLKTLNLHMCGGIQHQAPI
                     PSLPNLETLRITHSRLNETDLEGLLSSCASLRTFAFEATCIYINALDCVQDFGPRGHF
                     ELKNAVKYLSRHRATLKSLHLDLRERGIAYRDSIERAIPPSFRLRDFKALEHLFLNSE
                     GIYGGGKKHLTAEDQLLVWFLPANIVSLHLEGNSGPRLVKGLLGLAEAASEGRFPRLK
                     QVRCDAGQILDDNAVGSMFAAAGVDFDGDSFPPSNATLPMRVMPIRRPSYSPEPLPLP
                     EDDDPDLW"
     gene            complement(<668938..>669768)
                     /locus_tag="TRUGW13939_05092"
                     /db_xref="GeneID:55992590"
     mRNA            complement(join(<668938..669433,669491..>669768))
                     /locus_tag="TRUGW13939_05092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488257.1"
                     /db_xref="GeneID:55992590"
     CDS             complement(join(668938..669433,669491..669768))
                     /locus_tag="TRUGW13939_05092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344150.1"
                     /db_xref="GeneID:55992590"
                     /translation="MSSTTTVSTVTPAGEQYLPTTAKSPEAQAALATGGYEFPGIPKL
                     DDPYKKRQWQLEHMAGAFRVFARKGFTEGTSGHISVRDPVDPSTFWINPMGKHFGMLK
                     ASGMVQIDENGQVIGGNKTAVNAAGFMIHSAIHWARPDIHAACHAHSPAGKAWSTFGR
                     PLDVINQDACNFWGTQAVYQNFGGVVLGAEEGVRIADALGPAGRVMVLQNHGLLTTGS
                     TVDEAAYLFTLMERSCEVQIMVESTGLPRCASPNVLYRS"
     gene            complement(<670659..>672740)
                     /locus_tag="TRUGW13939_05093"
                     /db_xref="GeneID:55992591"
     mRNA            complement(join(<670659..670686,670757..671162,
                     671242..671859,671926..672328,672411..>672740))
                     /locus_tag="TRUGW13939_05093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488258.1"
                     /db_xref="GeneID:55992591"
     CDS             complement(join(670659..670686,670757..671162,
                     671242..671859,671926..672328,672411..672740))
                     /locus_tag="TRUGW13939_05093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344151.1"
                     /db_xref="GeneID:55992591"
                     /translation="MGDRARFINNIASAVTWPRSTVIPRSWHGYRGSAGRRGHIRNYS
                     DKNSQNRSSWKLSTVTVAVAAGLAAYGVSRAANGRAATSSSQSIGAILDAGRLPIVKY
                     ATLDEMNKAIAEIENQLRDTEDIISTDEEDLKAHGFSEWSSVRLDTLPIAVAYPRNTE
                     QVSTIARICHKYRIPIIPYSGGSSLEGHTAAPFGGISMDFVHMDQIIKINEEDMDVVV
                     QPSVLWVDLNDKLKNMNTGLFFPMDPAPSAKIGGMISTNCSGTNAVRYGTMRDWVINL
                     TVVLADGTMIKTRQRPRKCSAGYNLNGLFVGSEGTLGIVTEACLKLAVQPENFSVAVV
                     PFRTIHDAVSAATRVIRKGLPVAALELMDETQMRIVNEGGMTRPRVWKEQPTLFLKFA
                     GSKAAVEETIERVKEIAYDHGSEGFEFARDEREQVYLWSARKESLYSLLALRKGGEEM
                     WNTDVAVPLSRLADIIVASKEEAASLGINACVKGHVGDGNFHENITYDSTKPGEREKA
                     KIAVKNMVKRAIEMEGTCTGEHGIGFGKKDALQLEVGSQTIGFMVSSCSIEGVHTLML
                     TPANIIQKILKGTFDPHWIMNPGKVFDR"
     gene            complement(<673148..>675338)
                     /locus_tag="TRUGW13939_05094"
                     /db_xref="GeneID:55992592"
     mRNA            complement(join(<673148..673882,674173..674482,
                     674549..675147,675196..675270,675318..>675338))
                     /locus_tag="TRUGW13939_05094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488259.1"
                     /db_xref="GeneID:55992592"
     CDS             complement(join(673148..673882,674173..674482,
                     674549..675147,675196..675270,675318..675338))
                     /locus_tag="TRUGW13939_05094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344152.1"
                     /db_xref="GeneID:55992592"
                     /translation="MLQQGSQASRDSTGRILFQDQQANLRDVFYLQFVITIYCPAYPI
                     LSIDSDALLEAPKSTLDWDRVDGILRYLDTLELPANSHNKEVRANIQNFGVFSLCQGP
                     VDNNFDAATPCISRDCGSEECEMALDSDLRLMDPGGPYENCDAEEAAWNLCNLYEQQV
                     SVDVSDQQVLVDSGASSSPSIHSHHTVQVQGLDPELLALPNNDADDPLTRTYSTLEPL
                     KPPLETLVVPSQERPWKTIHLPRVLQSAGELSFGGTTTRIRAALKNSLLSISAFYLSN
                     DHRAHNRNQKAGNWATVASRYRCDAIGLLKHAVEIDLYADERPRYKEFLATMVSMVTI
                     NNAYGQPPAFREERLYIEEDESPSMMQMVSDGVSSEAQLSAYECIYGIPQSLLLLLKE
                     SIEVIDELNFYRTNADMSYVPENLSRKCDELEQRIMDWPIEESLRRHRGSGSDTASII
                     IYHQTRAFLNALIIFFSQSVTYISHRYLRQYVLAILDSIEAIEQLKAETKILAAPLFW
                     PAFMGATEAFDPQHQERFRQWYRNVEVYGIEVVRTGIQLLHEVWRLGPASNQMPPRWR
                     SVLEIRRDCLMLT"
     gene            <676502..>678179
                     /locus_tag="TRUGW13939_05095"
                     /db_xref="GeneID:55992593"
     mRNA            join(<676502..677049,677111..>678179)
                     /locus_tag="TRUGW13939_05095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488260.1"
                     /db_xref="GeneID:55992593"
     CDS             join(676502..677049,677111..678179)
                     /locus_tag="TRUGW13939_05095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344153.1"
                     /db_xref="GeneID:55992593"
                     /translation="MEGSQSRDKRTAENTEAWILGSGTASLATALYLIKHHKVQPPRI
                     HVLDKHESVEQGSHYKGNASEGYDQFAGCLPVPGGVHMKELLAMIPSTKSEGRSILDE
                     IQKAEADRLSAKEVNRTSFLVQKNGVMEHIPIDSLNLSFKNRISLLRFLLRREKSLAK
                     SQIQDLFSNSFFESAFWAVWSAQFGFQPWHSAAEFRRAVCQYLPEIHGLRILDCLDIT
                     GYYQFEFLYRPIYSFLKSCGVDFRFRTEVKNIEVAQNSNQRTITGLDLIQDQLGLHTS
                     LGKNDIVLVNLGSTISGSTIGTNDTPPTWHSITADDMLDQNWSAWLDLGNKNRDFGSP
                     YNFCTRQSESILESFTITTEDVKFFDKLKEISRCTSEAGAFIFLKDSRWRMSLCIPSQ
                     PVFTEQPRNIRVLWGLAHLPECKGNYVDKPMLWCSGTDIMAELLNHLGLNHQEPMQRT
                     ITIPRAMPRMSAILLTRALNDRPQVIPQAFANVGLVGQFVEIPRRTCVDISYSIRAAK
                     MAVSGLMGSPTFIEPSTSMVSAVWKIMLGK"
     gene            complement(<686613..>687210)
                     /locus_tag="TRUGW13939_05096"
                     /db_xref="GeneID:55992594"
     mRNA            complement(join(<686613..686782,686840..687066,
                     687149..>687210))
                     /locus_tag="TRUGW13939_05096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488261.1"
                     /db_xref="GeneID:55992594"
     CDS             complement(join(686613..686782,686840..687066,
                     687149..687210))
                     /locus_tag="TRUGW13939_05096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344154.1"
                     /db_xref="GeneID:55992594"
                     /translation="MEWSWKLGQVPEISFRDSTKHDIYVPINAALEDKNILEEWNIGD
                     ESIDSVVCMQALCSVSDPTAAAKQIYRLLKPGGQLLFWEHTASQDWVTRQVQGIWNLF
                     WKPLIGNCHLRRNIEQAVMEGGDWKIIELGHDNIEPWQMMPRVWGHFVKG"
     gene            complement(<689018..>691464)
                     /locus_tag="TRUGW13939_05097"
                     /db_xref="GeneID:55992595"
     mRNA            complement(join(<689018..689128,689201..689245,
                     689314..690166,690228..690828,690944..691128,
                     691193..>691464))
                     /locus_tag="TRUGW13939_05097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488262.1"
                     /db_xref="GeneID:55992595"
     CDS             complement(join(689018..689128,689201..689245,
                     689314..690166,690228..690828,690944..691128,
                     691193..691464))
                     /locus_tag="TRUGW13939_05097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344155.1"
                     /db_xref="GeneID:55992595"
                     /translation="MPNSFALALRRRIVRLRLKSRQSLIAATVTIFILFQIFSFQQGS
                     VAWTPWSHKSILKPGDFLEYPTYDRVPDPTQDIIPDENILGITHDQRNEDFYLGGTLS
                     LTSQSGTPKTHPSPFIYDPYPEYNSRKWREKWQGEFKPCLGPRGRILDKTRFPKPSFG
                     SYEALGLDGNVCTDRYGRFGAYGHDEQTSSVVPGFSRPIATLWDEVNWGNLQRMCFEQ
                     NSNRYQTESTEQKKLPLAPPASQQPRTDRSPPSDPKSPQHHSRSAVIIRGWHDMTWTQ
                     NDFNYLRSLIMELSLHSGAEYEVFLLVHVLDDSISISSDEDIQRLKESNIPEEFWGLT
                     VFFNNEMLNNWYPKIVEHKAIFQHFQPVQIFSQIFSDFDYYWQFEMDSRNFGHMYHFL
                     GKAVEFAKEQPRKYLWERNAYFYVPGVHGSWSDFSNMVASKMLGKDSVWGPVPAEGMQ
                     PIGPAGPAPPVPNPQDDNFEWGVGEEPELITFLPIFDPQNSGWGFGDIIYGFPQEAET
                     PRRTSVITMSRLSRNLLNLMHDPLIVAGQAVVSEMSPATSALQHGLKAVHVPHPVFID
                     GQWTPKELDKIYNRGPPEKISGTQGSIWEYNMINRIMYRISFMYSSQLSEDLFRRWLG
                     YKPSLSQYTDGSRHEDAEGLLWYDGGVLKEDIYGRLCFPPIFVHPVKNTDEELTSSRP
                     VHGFSD"
     gene            <698193..>700373
                     /locus_tag="TRUGW13939_05098"
                     /db_xref="GeneID:55992596"
     mRNA            join(<698193..699080,699147..699556,699617..>700373)
                     /locus_tag="TRUGW13939_05098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488263.1"
                     /db_xref="GeneID:55992596"
     CDS             join(698193..699080,699147..699556,699617..700373)
                     /locus_tag="TRUGW13939_05098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344156.1"
                     /db_xref="GeneID:55992596"
                     /translation="MVFVKPTRSLLYHALLTSPVLGGGCWQGSDCTGPLEPSFSGPWE
                     ANSYSPTSRTLAPVSILDSSNNVVSSYPGDSSLIGDDALLVFDFGKEVGGIVTLNYTA
                     SGDGTLGLAFTEAKNFTGSTSDSSNGGSGTDGFQYQNISSTTAADGTYTLPLGNLRGG
                     FRYLTLFNIAGSAPLSVNITGIELELAFQPTWSNLQAYGGYFHSSDSLLNRIWYACTY
                     TVQTNTIPPDTGRVWPPPASGWFNSAVLANSSSVVVDGAKRDRAIWSGDLGISVPSVL
                     IGTGDLESVQNTLTSVYSNQQTSGEFFAAGPPIGMSGSDTYHMISMIATHDYVLYSND
                     LDWLASVWTGYQNAMTFITSKIDTTGLINVTGGIGWGRTSTESGYSTTGNMLLYRTLI
                     SGAKLAEWLGQPSLTTTWEGLAATLKAAINSESYNWDSSVGAFKNTATDSSVYPEDGN
                     SMALYFDGADASYGTNISNQLLTNWGTFGAETPECPGTIVPFIESYEIKGHLAIRETQ
                     NALDLIRLSWGWYLNNPYGTESTILEGYNVDGSFEYRDSGYNKGGTYTSHSHAWSTGP
                     TDALVSYIVGLRPTAPGGSQWTLEPQFGDLTSAEGGFTTPLGKYSAKWALTNSTNSTG
                     YTLEFDVPQNTSGVVLLPSQSKQPQVSWNGTSTLQPVFNASTGLTQVSATGGNYKLSI
                     VY"
     gene            <701210..>702445
                     /locus_tag="TRUGW13939_05099"
                     /db_xref="GeneID:55992597"
     mRNA            join(<701210..701328,701386..701768,701823..>702445)
                     /locus_tag="TRUGW13939_05099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488264.1"
                     /db_xref="GeneID:55992597"
     CDS             join(701210..701328,701386..701768,701823..702445)
                     /locus_tag="TRUGW13939_05099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344157.1"
                     /db_xref="GeneID:55992597"
                     /translation="MSPPLSIGLALVAGLGLTTAQPTIAKRDASSYQQNAVCAADQLM
                     RYYQTDNTGLWGKDLWWQSGNFLSSLATLTSLDSDYLAQHGDVFVNTFQTATGYGPSP
                     HFINGFYDDEGWWGNAFLDVYDVTGNQTYLQAAIIIYQDIVGGLGTPCGGIWWDKAQS
                     YVAAISNGLYIELAAGLAARTGPDQSPGYLSRAEEGWNWFFDVGIVDGNYLVYDGVNK
                     TDSCKPVGLQFTYNQGVILGAAAELYKATGNETYLEQGALLANASTAAGSPVTTDQGI
                     LHDYCDLSGDCDGTIAMFKGAYMRGLRKLQLASPHDNWKDFITTNAQSIWNNDLDIED
                     NSGTSECNLGTDWTGPYTTANVVTQGAALDALIAALAVTQ"
     gene            complement(<702917..>705451)
                     /locus_tag="TRUGW13939_05100"
                     /db_xref="GeneID:55992598"
     mRNA            complement(<702917..>705451)
                     /locus_tag="TRUGW13939_05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488265.1"
                     /db_xref="GeneID:55992598"
     CDS             complement(702917..705451)
                     /locus_tag="TRUGW13939_05100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344158.1"
                     /db_xref="GeneID:55992598"
                     /translation="MKLCYLGEAAALLLSHSSLARAALPSNTTSWQQYVYAPSERRLT
                     PVAVLSTTGNVTNAEALVSGSGIATFNRTAVQTSFPSWPSGTTAQASSEAGSNTVNGA
                     TRTYYANNAIDGDLTTFWNDATAGEYPDTLTITAPSAVTLDGVTLESVSDGVPVDYTI
                     ETWDGSNWNTAGSVTGNNGTRSRVAFDSQISTTQVRLTVTQAQSLGNGEYSRVAELWP
                     GLVADDSVAEAVLDFGQNVVGFLSIEFVGASNNAPGIELAFSESLEYLTDTSDFTRSD
                     NGDKITQGTDHIAVPEAPTNWTDALGCTYNGEQVCSDGLHGFRYLKISIDTLASDDKY
                     STPSGWVDIASVSLNFTAYLGTPASYSGWFESSDTALNQYWYAAAYTNEMTIDTFLLD
                     TVDVRNTGNQTLEGKTVLFDGSKRDRDPYVGDIAVSGKTSYLSHQDTAGAVYNVLADL
                     GDHQSSNGWIPPASLFNYGVNLFDYPFWWVVSFWDYILYTGDVDPVRPYYGNLQNLLD
                     NWVPTVTDSATGLLNKSDSQGWGDYGFLSRYGIVTYYNALYVLALQDAAKIANLLNET
                     SDAEKWLQQADTISQAINDNLWDASVGAYVDELGGTRHAQDGNGIAVIAGIANSTQAA
                     SALGYLADNTAKFWGNAFMDDDSLGSGTSDRVYAFISYFDLDARFLIGDSDSALDEIH
                     RLYGTMIQSDPGITFWEGVGTNGSAYEQAFTSRCHGWSTGVLPVLTHYVLGLKATGPG
                     YETFSIQPAFPTNLTWARGQEATPHGDIYLEWTADDDNTRTITFSSPAGTLANVTVPK
                     ASSVSLDGDVLWSSSNQTSGGDGVAVGDNFVTLIDVASGNHTVVSK"
     gene            <706140..>708439
                     /locus_tag="TRUGW13939_05101"
                     /db_xref="GeneID:55992599"
     mRNA            join(<706140..706214,706268..706354,706465..706681,
                     706734..706805,706896..706936,706990..707154,
                     707220..707475,707541..707553,707660..707832,
                     707922..>708439)
                     /locus_tag="TRUGW13939_05101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488266.1"
                     /db_xref="GeneID:55992599"
     CDS             join(706140..706214,706268..706354,706465..706681,
                     706734..706805,706896..706936,706990..707154,
                     707220..707475,707541..707553,707660..707832,
                     707922..708439)
                     /locus_tag="TRUGW13939_05101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344159.1"
                     /db_xref="GeneID:55992599"
                     /translation="MANESAGAAPTESQRYLSTRGGDYDLSFETVVLKGLAADGGLFL
                     PHEIPIAADWQSWKDLSYKELAFEIFSLYISSSEIPSEDLKEIIDRSYSTFREEEVTP
                     LVHLQDDNLYLLELFHGPSYSFKDCALQFLGNLFEYFLVRKNHGKEGKDRHHLTVVGA
                     TSGDTGSAAIYGLRGKKDVSVVILHPKGRISPIQEAQMTTCTDSNVHNLAVTGTFDDC
                     QDIVKTLFGDADTNQTLKLGAVNSINASRVLAQIVFYWYSYFSLVRKSSSFKLGDKVR
                     FVTPTGNFGNILAGYYATKMGLPADKLVVATNENDILHRFWTTGRYEKNGVQDAKSNG
                     NVTADACKETYSPAMDILVSSNFERLMWFLAKEYAATLGMNDQFNKKQAGQEVLAWYK
                     SLKTTGGFGPVHKDILENGRLTFESDRVSDVETLETIKSCYQKNKYVLDPHSAVGVTA
                     AQRSLARTGPQTHHISLSTAHPAKFSDVVQSALKNEAGFNFEEQVLPDEFKALSQKET
                     RVATVENSWEKVREIVKSYVEEDLKAESSA"
     gene            <711242..>713047
                     /locus_tag="TRUGW13939_05102"
                     /db_xref="GeneID:55992600"
     mRNA            join(<711242..711527,711584..712784,712858..>713047)
                     /locus_tag="TRUGW13939_05102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488267.1"
                     /db_xref="GeneID:55992600"
     CDS             join(711242..711527,711584..712784,712858..713047)
                     /locus_tag="TRUGW13939_05102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344160.1"
                     /db_xref="GeneID:55992600"
                     /translation="MPTEIFDFIIIGGGLAGSALASRLQQGSPSLSILIIEAGTDVSD
                     RADVLDGSQWLSLLGSDLDWAYNTVPQRHVNDRILLNHAGKALGGGSVTNAGVWTRGD
                     KENYDKWAELVDDPRWSYAGLLPYFRKVETYHDPNADPKIHGFDGPIKTESSVDRHYP
                     LHEQVKNAWADVGIPYKPSMNDGDPVGLGQLIENRADGVRQISYSAYDLKNIKILTNT
                     LVKRVIVSDENGRKVATAVELAESNNDGKITNRIITARREVIVSAGAYRSPQVLMLSG
                     LGPKEELQRLGIEALVDLPDVGRHLRDHCYINQWWKLKEPEKGLALGSPAFNKPAFFK
                     GLPIDFLATNQVPKEGLLKAIAADYKEAGIDADPELHELLSQKGHVEVFFMYVGFNQG
                     DPLVVPDGVNVTTAIILLLPSSKGSIRLADTDPKTAPVIDPNYLATEVDRYMLREGVR
                     QTYKVLCDTEIGKSIIASETVESDGHPVTKESSDEELDDLIRRRLLTMFHALGSLSMG
                     KVVDSELRVKGVDRLRVVDASVIPLPISGHIQSAVYAIAEQAADIILASL"
     gene            complement(<718153..>719586)
                     /locus_tag="TRUGW13939_05103"
                     /db_xref="GeneID:55992601"
     mRNA            complement(join(<718153..719112,719192..719333,
                     719393..>719586))
                     /locus_tag="TRUGW13939_05103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488268.1"
                     /db_xref="GeneID:55992601"
     CDS             complement(join(718153..719112,719192..719333,
                     719393..719586))
                     /locus_tag="TRUGW13939_05103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344161.1"
                     /db_xref="GeneID:55992601"
                     /translation="MQNPTQRPPLDEEKDTISGDGNEGTKSLPPPGPGTFPEGGARAW
                     SVVAGAMCISFCTFGYMNAYGVYQNYYSTHQLTDKSSSTIAWIGSVQTCLLLGGGIIG
                     GPLFDRYGAIVIWPTAITFVFSVMMTSLCKEYYQFMLAQGILGGLTCGIMFSPAMAAV
                     SHYFHAKRGAALGITVTGSSLGGVIFPIALSRMFSYKSLGFEWTVRIIGFLMLALLLL
                     AMATIRSRLPPRKDKILLPSAFRKAAFSVFIAAQFLMLWGVFTPFFYLTEYAIARGMS
                     EDLASYILSILNAASVFGRLLPGVLADKIGRFNTLCFFGFCTGILLLCWIAIESNASI
                     IVFAALYGFFSGAIVSLMSPCIAHLAPSPRDIGTYLGMGMAVISLAGLTGTPITGALI
                     DRYTSYTPAAIFSGVSCLVGASLVFLTKVTLIRNPFRRI"
     gene            complement(<720556..>721074)
                     /locus_tag="TRUGW13939_05104"
                     /db_xref="GeneID:55992602"
     mRNA            complement(<720556..>721074)
                     /locus_tag="TRUGW13939_05104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488269.1"
                     /db_xref="GeneID:55992602"
     CDS             complement(720556..721074)
                     /locus_tag="TRUGW13939_05104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344162.1"
                     /db_xref="GeneID:55992602"
                     /translation="MWADIFKDAGWESPKFINAMLDDGLVDDFYTHEVAEVRLDKWSS
                     GRVALLGDAAHCPSPATGMGTSSSIVGAYVLAGEITKYTNPKTRLGGDDPVAAALDNY
                     EKILRPLIIQVQDHASGFWVPSSPWGIVVFNSFIGIAAWLRLDVLGKYILREDVNWTL
                     PEYDELKELKLR"
     gene            complement(<721100..>721825)
                     /locus_tag="TRUGW13939_05105"
                     /db_xref="GeneID:55992603"
     mRNA            complement(<721100..>721825)
                     /locus_tag="TRUGW13939_05105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488270.1"
                     /db_xref="GeneID:55992603"
     CDS             complement(721100..721825)
                     /locus_tag="TRUGW13939_05105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344163.1"
                     /db_xref="GeneID:55992603"
                     /translation="MARLRVLISGGVGVAGPALAYWLSKLGHEITLVERFPTLRASGQ
                     QIDLRGHGIQSMKQMGLEDAWRAKSVAESGIQFVDSAGRRKGFFPVNQTGRGLQGFTT
                     DWEIMRGDLCTLLYDQTRDSVKYRFGVAVEGMAQGVGKDKTVRVSFSDGSKDTFDLVV
                     GADGQGSRMRSMILPPGTKPYRSLHMFLAYFTISQQPGTDYISTAYLAPNKRLLFTSR
                     HSPDSIQAYMGYADDSEKLQCHA"
     gene            complement(<723224..>724596)
                     /locus_tag="TRUGW13939_05106"
                     /db_xref="GeneID:55992604"
     mRNA            complement(join(<723224..723373,723433..723732,
                     723787..>724596))
                     /locus_tag="TRUGW13939_05106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488271.1"
                     /db_xref="GeneID:55992604"
     CDS             complement(join(723224..723373,723433..723732,
                     723787..724596))
                     /locus_tag="TRUGW13939_05106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344164.1"
                     /db_xref="GeneID:55992604"
                     /translation="MFSKVVLFTKFFVAVLPILCERLVLSIRAQIHHYTYKPGSDPRN
                     IIIIGGSFGGQSLAVELAKRIPNGYRVVLIEKNSHFNFSWLFPRVSVVEGHEHKAFIP
                     YHGGFAKLPAGSFHFIQACVVAVDEHAVTLQDGTRLEYTYLAVATGSTGVPPWHLATG
                     EKRDGVEVFRGMQKAIRDAKDLVIVGGGAVGVELAADAKTKYPEKNVSLIHSRSTLLN
                     SFGPKLHDYVMEEFRKLEINVHLGERAPEGVQNEKALDFTLKSGKVVTFDLLIRCTGA
                     KPASSTLSGVSPSSISPSGTVLVKKTLQITDTNHPRIYAFGDVVETGGVRMGRAATFQ
                     ASVVAANITRSIKGKPLKDYKIFSFLGGMIDLTLGLTKSVVYIRDNDKEFLIPRKKKI
                     DLDAYEAWKLNGARPFEDKDYDMKLRA"
     gene            <725842..>727272
                     /locus_tag="TRUGW13939_05107"
                     /db_xref="GeneID:55992605"
     mRNA            join(<725842..725935,726063..726451,726511..>727272)
                     /locus_tag="TRUGW13939_05107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488272.1"
                     /db_xref="GeneID:55992605"
     CDS             join(725842..725935,726063..726451,726511..727272)
                     /locus_tag="TRUGW13939_05107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344165.1"
                     /db_xref="GeneID:55992605"
                     /translation="MVTFEQYMEQATAGGADRQLPGCVVLAANKDGIAYSKSFGPQSV
                     DPASPLSDKPMTPDTTMWIASCTKLMTAISAMQCVERGLLNLDDDASAILTEFKNPDI
                     LVGFDNDTGKPIYEKATGFITLRMLLTHHSGLGYPFIQPKLGQFSKYAKRDAEFGSKL
                     LTESYLFPLLYEPGTSWSYGVGLDWAGLMVERVTSQTLGSYMEENILKPLGMDSTSFD
                     IKNRADILSRRADMSLRTADGAVVPSPTRFFSDNAPDHHGGGGIFSSPGDYVKLLISA
                     LKNDGTLLKPSTMDVLFAPCLPPDAITELRNNRRTQYKTFRESKVGSTAVLQVIQPEE
                     MNYAPGGQISEKEWLGGRKAGSMSWSGLPNLNWVLDRESGIALLFSAQLLPPGDAAIK
                     AAFERFEYAVYNGELGNIGHQN"
     gene            complement(<727525..>728811)
                     /locus_tag="TRUGW13939_05108"
                     /db_xref="GeneID:55992606"
     mRNA            complement(join(<727525..727774,727832..728011,
                     728067..728543,728600..>728811))
                     /locus_tag="TRUGW13939_05108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488273.1"
                     /db_xref="GeneID:55992606"
     CDS             complement(join(727525..727774,727832..728011,
                     728067..728543,728600..728811))
                     /locus_tag="TRUGW13939_05108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344166.1"
                     /db_xref="GeneID:55992606"
                     /translation="MDFQTRDDFNATVDLLLTRFPDTYSSDRGHQVVSWTQCEEGLPY
                     LKDLIEKNENHEVSFSNMQSFAELLLRYLYERENYDTAKQYLEASINTFSDCTSLSYT
                     SAIDLRGLIELDIGHPHDSLKYFEQAFNLRKAVLPEDDPFLAANFVNYGLAFTDIGDL
                     NRARDYLQKSIDIRLKAKSDRIGNSYSNMASLLLRMDKPDEAEDMLKGCPSLANFTGE
                     TFLKTGNPRFSGDMVLLSRIRLKQGLYDDALRLASKALTFRRECLPQRLKVCDSLYQV
                     ADLLQQGDNYEMVSQLLSECVRISEGLPKSEGQRHMARALFKLSKISERRGSLKESAE
                     FLNRANSVKADIANREKSVLDSGNMDADFEHLVPWMLW"
     gene            complement(<728977..>730411)
                     /locus_tag="TRUGW13939_05109"
                     /db_xref="GeneID:55992607"
     mRNA            complement(join(<728977..729681,729731..729932,
                     729983..730075,730359..>730411))
                     /locus_tag="TRUGW13939_05109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488274.1"
                     /db_xref="GeneID:55992607"
     CDS             complement(join(728977..729681,729731..729932,
                     729983..730075,730359..730411))
                     /locus_tag="TRUGW13939_05109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344167.1"
                     /db_xref="GeneID:55992607"
                     /translation="MLQHQSEYTWMSFMISFRMLQPQIFQLSVVAAFDALTSSEKLYA
                     HHMSRAAWAGTRIILRQVSPEANGIFDLIIALHHACDGQWEALSQRTGVGMPDIDRFL
                     DYAATFLSNVGNYIGSGDQKFIPDISPESLTRLAAVSPSATQLLDGIKVQLYQQLPNC
                     LGVPNGLAQSAYYLGNDCLKSPEDTSAILSAMEKKGVFPENTRLRKSTPPDGITVYDL
                     LQASVQQDESDLDILAADKKLRLIRGDHKQELEKICASLLSASQNVANPAQNQLLTEL
                     HDSFLNGDLNTYRSSQRIWVKDKAPRVETVLGFVEPYRDPLGVRAEFEGIVGIADTKE
                     TFVLRKLAEMGSRLIP"
     gene            <730830..>731129
                     /locus_tag="TRUGW13939_05110"
                     /db_xref="GeneID:55992608"
     mRNA            <730830..>731129
                     /locus_tag="TRUGW13939_05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488275.1"
                     /db_xref="GeneID:55992608"
     CDS             730830..731129
                     /locus_tag="TRUGW13939_05110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344168.1"
                     /db_xref="GeneID:55992608"
                     /translation="MDDDAARPSLRTSLRIGPNNAYLHNRPDLGSCLICSGEEVVMTT
                     DDPVNRPLPNYNILEMQWFLQRVCAIAAAAEIDDDLEDGDFFEDAGSYDETVIDE"
     gene            <736675..>737280
                     /locus_tag="TRUGW13939_05111"
                     /db_xref="GeneID:55992609"
     mRNA            <736675..>737280
                     /locus_tag="TRUGW13939_05111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488276.1"
                     /db_xref="GeneID:55992609"
     CDS             736675..737280
                     /locus_tag="TRUGW13939_05111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344169.1"
                     /db_xref="GeneID:55992609"
                     /translation="MRFSLSFGSSSTCSSPSPSSLPPPPAPPPTPNDGLLDITPRKSS
                     FSGAMGMSSACAFPSWPNRPSLWDNSPSAESTASSYLSDEDLFIDSSASSATAPSESA
                     IDEDDQQPPVMIDTLVDNTTAGDMTTEEQVQLMRAAAEENEQRMRFLAHVHAHARAQQ
                     AFKVAQLAAAERENAKRKKKRSGSDKKRRSPSSGSKSSTRL"
     gene            <738366..>739524
                     /locus_tag="TRUGW13939_05112"
                     /db_xref="GeneID:55992610"
     mRNA            join(<738366..738409,738472..738930,738984..>739524)
                     /locus_tag="TRUGW13939_05112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488277.1"
                     /db_xref="GeneID:55992610"
     CDS             join(738366..738409,738472..738930,738984..739524)
                     /locus_tag="TRUGW13939_05112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344170.1"
                     /db_xref="GeneID:55992610"
                     /translation="MSEPEPLLSELCTICHITPPKYRCPRCSIRTCSLACTRRHKNWS
                     QCSGVRDPAAYAPRAQLETTGALDRDFNFITGIERGLERAEREARARGFELEHGYMLD
                     PKVASNNKRKRGGNYSKEDGSSNKKNKPVRGESAFLRAANEAGVRVERSPRGMTRNKQ
                     NKSRVHPKHKCLSWTVDWIHTCGRDTVVQNYLETITIGQAYDRAYPPANNETTSLPDK
                     KETEFPPYRNVYFYIRRNAYHHIVLAPLHPDTTLADALRGRTVYEHPRLYVLPNSPTD
                     IENGDVDDESTILEKTWLRDHSPETESDKNDEDDFTSSEGSSSEESEEDDESESEVSL
                     SDPKLEPVEAKLG"
     gene            complement(<739783..>741266)
                     /locus_tag="TRUGW13939_05113"
                     /db_xref="GeneID:55992611"
     mRNA            complement(join(<739783..740510,740564..>741266))
                     /locus_tag="TRUGW13939_05113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488278.1"
                     /db_xref="GeneID:55992611"
     CDS             complement(join(739783..740510,740564..741266))
                     /locus_tag="TRUGW13939_05113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344171.1"
                     /db_xref="GeneID:55992611"
                     /translation="MPKARPVWVSVSHSVLTSPRQRLWYQSYAPRNRLSEWLLTPKST
                     PDVDFTMTTTLERSLSQTSMSSSLLSVHNDITPPAMPDSRLSIAHRIGYLDSQLSDLR
                     SSVLTSDDYVDRRNREDEHVRREFVAQRTVSERIDGNVKELKSDVSKLKYAFGSLQTD
                     TAFLRNDVNRLQSNFQQLESRMSQMERVRFNSLANTIHAPLNPVPKIDEDGTLRYPNY
                     FPRSVWRFWCLKKRSRVHRLVGLAQFYELEGYEYWGRNYQELQPFDDDDSDSSGSSDR
                     PNNLTLAEATYQYPEACHQALAATLGLNYYKIRKEAGEGPNARIARPPKRHPDEIASS
                     NHSSIKVAKVEKKARRLDDVSPTLLKQLVTGVPSVASKSASSEHEDKLRWRGAGSDIS
                     DETMSKLKGIASDDVAQILRAIERGRLHVQSEQMNISPTESRRSDAVKADNMDTSPIE
                     EDGASVHTVSTELISPGSSLPDTTSV"
     gene            <742143..>743303
                     /locus_tag="TRUGW13939_05114"
                     /db_xref="GeneID:55992612"
     mRNA            <742143..>743303
                     /locus_tag="TRUGW13939_05114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488279.1"
                     /db_xref="GeneID:55992612"
     CDS             742143..743303
                     /locus_tag="TRUGW13939_05114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344172.1"
                     /db_xref="GeneID:55992612"
                     /translation="MRFNPSPILATVALALVPAVTSSNRVEKTTSEDRTTQAVDPACD
                     CYTVSGPDPGYFQHHRFWDFRQVPLNPAAASTFQFQPNSPPSRADYGANAAPVLLKDT
                     PFSSEWAVQDWGRGGTPLFPVTIVNSNKNVYLTSHAAGGGPTFLVMRTTRFEAFSSTA
                     EIETNLLNFMHVSLRVRLRILEKGEDILSPVNAEQALGQRIQSRSDNNTTSEPHSSHA
                     QRRKEKRLLPSVGACVGIFTFFSRTSESDIEILTSDPPNRVHYANQPDYDPIRNIVIP
                     GSQIAADSPTPWTAWSTYRLDWLPTMSRWYVENQEQANLAYGVPVDPSRLVINLWSDG
                     GLWSGNLTVGDSVHLGIEWIEVAYNLTGDVPKLCNRNCRIDNVAVPGIPEII"
     gene            complement(<744410..>747421)
                     /locus_tag="TRUGW13939_05115"
                     /db_xref="GeneID:55992613"
     mRNA            complement(<744410..>747421)
                     /locus_tag="TRUGW13939_05115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488280.1"
                     /db_xref="GeneID:55992613"
     CDS             complement(744410..747421)
                     /locus_tag="TRUGW13939_05115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344173.1"
                     /db_xref="GeneID:55992613"
                     /translation="MAEMDTVMLDAPAGEYGASLDPMEGVVYHPSPSPFGHSHQTPQH
                     APRRNLFSSPSLQPRPTLQLSTLHDRQARRQQLTRRWQPRPNDPFYHDMEEARADNRA
                     EQRQFDRSHLHKRDGARFPFSSPKRTRTAYEQDTSDQRRVIDATPRRVVDAARPLLDV
                     TPPPHIDVPPRQIGAIAPQNLLDGSPRLLVDAAPQPLVNAAPQQIVPVAPQPIQMPQW
                     PAALYRRATWRAAIPPWRRIIVPVSRIAQLARRTAQIGIKQTIRTGLGVASAFAHLFD
                     RREESPMPAPETQIAAPAPAPAPQPAPQPAAEMIEPEEPEDPVSLQLQAELTGHASQL
                     PSPPSPSPSPPPPPSPSPSTPIVFFQPRRRLESPANAISEEDSIRIMVANATREARDR
                     EMAEVAERAAAQTVDEDEAEPQFALVPPLAPWVRSPIRFNPDVPQVAPWPPMSSTPSS
                     PVIIPSSRPVEETPALNLAPPAHPVNEAPALGLVPTLRPIEENPALRLIPSSSRAIDT
                     IPASRPMVPSLHAVEDTPALDLAPIDETPDSNSLRAVDAIPAQHPVVPPLPRPIDVTP
                     ALRLIPSSSRPVETAPSPPPIVPTSPPPHDASFLTPIVPSSSRSISDTPTARPTSSPS
                     RRFPVTPVTRLIPPLMRRYRGTPALRRTTPRVPRPPLDADIEETRDLLSTVTVSGEDG
                     IIPTRIQWWEADTPLGRPVSAVRLFSSNEPPANVSDRTGALYRDEYEEMQREARMRVI
                     RERAMALSRQRVPEGEDAVRPLTESVERQVHAAMSAASNRVLGSTLEGIELTQQKLLT
                     CYKDLEWLNDEVINGHLALTVDYLREKANNTGRNVRPKYFAFSSFFYSKLRDGGYREV
                     SRWARRGKIGGEHLLDVETVFVPVHQQSHWTLLVVSPANKTIEYFDSLGSRWRSFVDT
                     IKEWLAGELGEKYVEDEWTVLRTPSPKQDNGSDCGVFLLTTAKAVALGLEPTAYGPGD
                     VPLLRKKIVAELLNSGFRGDLDPSGPGPARL"
     gene            complement(<748935..>750856)
                     /locus_tag="TRUGW13939_05116"
                     /db_xref="GeneID:55992614"
     mRNA            complement(join(<748935..748999,749051..749308,
                     749369..749577,749635..750405,750473..750689,
                     750781..>750856))
                     /locus_tag="TRUGW13939_05116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488281.1"
                     /db_xref="GeneID:55992614"
     CDS             complement(join(748935..748999,749051..749308,
                     749369..749577,749635..750405,750473..750689,
                     750781..750856))
                     /locus_tag="TRUGW13939_05116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344174.1"
                     /db_xref="GeneID:55992614"
                     /translation="MEKITMEKTQNGNGRTDAGLRSLNHYQHRLPKWRYWPRQKILPL
                     IRYETPYLAWLQEKMRTPTLDSYFAFTANLGTHTFFTIFLPILFWSGYSTLGRGMLNV
                     LAAGVFWSGFVKDLLCLPRPLSPPLQRITMSGSAALEYGFPSTHSTNAISVAIYAIAL
                     LRSTENTMSPVVNIAAQGALYLYAVSIIIGRLYCGMHGFMDVVIGSGMGALIAWVQCQ
                     YGLLFDTWIIAATGKQILLVILIVLALVRLHPEPADDCPCYDDSVSFAGVFIGAQIAS
                     WDFAQSSLAWPEPSPDTIPYRLATVGWPRTILRIVIGVLAVFAWREVMKPLLLRILPP
                     VFRGLSKAGLLLPRRFFTQASDYEKVPQLLKDNDVIPSVSDIPSLFTSIRHPRRRAIS
                     VGPQSEADAYETLAYREKRRRESIGEQSQHLTVEGSVLTNRAPSKLEKYENMMGTGSP
                     RRSPETLAPPSTDTGPDVMPAPRQATDDNDSDEQEIMFAMIKKPRVRYDVEVVTKLIV
                     YIGIAVIVIDFSPYVFDSLGLAP"
     gene            <752050..>752966
                     /locus_tag="TRUGW13939_05117"
                     /db_xref="GeneID:55992615"
     mRNA            join(<752050..752322,752376..752579,752631..>752966)
                     /locus_tag="TRUGW13939_05117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488282.1"
                     /db_xref="GeneID:55992615"
     CDS             join(752050..752322,752376..752579,752631..752966)
                     /locus_tag="TRUGW13939_05117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344175.1"
                     /db_xref="GeneID:55992615"
                     /translation="MAAAAYDRRYSVYNNEKTPPLGTRDRSQSIRVSHSSHGTSSTNT
                     SMSSGKMSQATNITQPPSYSKKFVVVGDGGCGKTCLLISYSQRYFPEKYVPTVFENYI
                     THTIHGRSGKTVELALWDTAGQEEYDRLRPLSYPETDLLFVCFAIDCPNSLENVMDKW
                     YPEVLHFCPTTPLILVGLKADLRNKRTCIELLKTQGLTPVTPEQGQAVAQRMGAAYIE
                     CSSKEMTGVDEVFELAVNTAVGVEDETYSTPGPSGKGPSGRRRVKKRTCKIL"
     gene            complement(<753438..>753956)
                     /locus_tag="TRUGW13939_05118"
                     /db_xref="GeneID:55992616"
     mRNA            complement(join(<753438..753599,753716..753778,
                     753864..>753956))
                     /locus_tag="TRUGW13939_05118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488283.1"
                     /db_xref="GeneID:55992616"
     CDS             complement(join(753438..753599,753716..753778,
                     753864..753956))
                     /locus_tag="TRUGW13939_05118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344176.1"
                     /db_xref="GeneID:55992616"
                     /translation="MSAFAPSASADSKGPSEFEFQRSELVREIALSMESALQNINRLN
                     RNLESIIAVGNEFGSVEALWSQFEHFMGPEDEQDGNHNGQEDEGEGNTQATEDDETMT
                     ENK"
     gene            <754824..>759098
                     /locus_tag="TRUGW13939_05119"
                     /db_xref="GeneID:55992617"
     mRNA            join(<754824..755473,755524..755838,755897..756271,
                     756940..756965,757030..757916,757977..>759098)
                     /locus_tag="TRUGW13939_05119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488284.1"
                     /db_xref="GeneID:55992617"
     CDS             join(<754824..755473,755524..755838,755897..756271,
                     756940..756965,757030..757916,757977..759098)
                     /locus_tag="TRUGW13939_05119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344177.1"
                     /db_xref="GeneID:55992617"
                     /translation="IYQLSFVATRDLSALRLRLHPRLFDMADAAPGQKDPIADVEKSR
                     NETPKQNYPEASPHAVKPSDPPDGGLQAWMIVAGGWCANFVSVGWNNSVGIFQTIYEK
                     ELLSSYSSSSIGWINSLQAFVMFASAPVFGKVFDSYGPRYSMIAGSLLLVLGIMMMSL
                     SKEYYQFMLAQSICTGLGAAAVFFSSSNTIATWFKKRRALAIGIASSGSAIGGVVIPI
                     MVNHLNNEVNFGWALRAVGFLFLGFVVAANFLTTSRVNHVPKRFHIMDFIHPLKEPRF
                     LLSSLACFAFAISVYLPATFIILDATKQGVDRSLASYLLAILNAVSAVGRIVAGRLAD
                     MIGRFNCMIIITLLSAIFSLALWIPAASTAPLVVFAALIGFSNGAFVALVSALVAQIS
                     DIKEIGTRNGTNWFLYALGAFIGTPVAGALIERDDGGYLYLKIFTGVAAFVGTCLWLS
                     EVQEEVVSHGQKIKCDETIPSCNQCTRKGFECPGYNRPVKWSSKYQILDESSTEPKKK
                     AKDIPGFADGARKMQAALASMEEQQSPTESSAAARHRSVFKADGRRTTTPGILMTSED
                     SLSSSGNNSSVSPISLLSSPLSAELPFRSPVSYRSHHTSSSSSSISAQADHSSAAQHR
                     PWWPITKTGVPRFLEDRSTALSRHYFTYFCLNSCCFYSQKNSFRAVVADLMLTSPLIY
                     HSVMALSAAYMGHQRNGMMTASLEHKIEAIGYMKSELLMITEEKPSNQVGPVRVGPEV
                     LISCILLGLTEAWHNPSTPPSNHLNGARILFKNWISDIKKSSNTSLAVACSSPARSFL
                     VGIISYWESSAAVTITQPCEVVDYLVPFCEQEDIKHIYVHAWTGICTPLFIYWSQACN
                     LGRHKSSLRRVFQQVTSATNRERMESNLVERAWKIEQAVLRYQVPEDDKIEDTGDELT
                     PVSHLKNLAHIYKLTTLLELYLDFPQLLQERFSAADWSESTPSPPSFEVGDSPSSVLE
                     MSAKIMVTAMQILSMASFIPPTSGAHSLLVIPLIVAGSLLQPDKIYSLLSNSHGLSSN
                     NPVLSLSAETLALASEEGSYLRWREFVVTQFHHMGRRLGLNTIQGAISVLGEVWRRAD
                     VDRSAAYNNNGLLDLSRPFFYWTDIMTEAEIGTVYA"
     gene            complement(<760567..>762031)
                     /locus_tag="TRUGW13939_05120"
                     /db_xref="GeneID:55992618"
     mRNA            complement(join(<760567..761001,761058..761207,
                     761270..761395,761447..761696,761759..761906,
                     761962..>762031))
                     /locus_tag="TRUGW13939_05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488285.1"
                     /db_xref="GeneID:55992618"
     CDS             complement(join(760567..761001,761058..761207,
                     761270..761395,761447..761696,761759..761906,
                     761962..762031))
                     /locus_tag="TRUGW13939_05120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344178.1"
                     /db_xref="GeneID:55992618"
                     /translation="MGLFDHHDGGSSSHVCSTQSLAQNSTVTVIGDYTFYEANKIVSG
                     AFTAATLLIILTLMTMHAMKMRKSNEQVKILKICFVIPVYSLFSFLSVCFPKAAVFLE
                     PWQAFYESLALGYFFLLLNEWISPSDSQRDLFFSALRVPQKNDAPPLDGLEWYRKRWI
                     FIFQYPVVALGVAVATDITQAAGIYCENSNKPYFAHLWLEIISAVSLGVCVMSILTCY
                     QTLKPNIGGHRALLKLLAFKVLVGLTFLENIIFLILTSTDLLKPTSTLTYADIKTGIP
                     SLIICVQTSLFAISFHYAYNVSEYSSPPKESLISNQDHGPDEGGYGNKPPYSELPPYE
                     ARMGFFRAWLAVLDPREILSAIKFIFTMRSQAEMGTTFDTGYGGNVGLEPLRRNRDSY
                     "
     gene            <763178..>766985
                     /locus_tag="TRUGW13939_05121"
                     /db_xref="GeneID:55992619"
     mRNA            join(<763178..763246,763308..764753,765432..766316,
                     766374..>766985)
                     /locus_tag="TRUGW13939_05121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488286.1"
                     /db_xref="GeneID:55992619"
     CDS             join(763178..763246,763308..764753,765432..766316,
                     766374..766985)
                     /locus_tag="TRUGW13939_05121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344179.1"
                     /db_xref="GeneID:55992619"
                     /translation="MFGVQTASRRSTGCQGCRKGRVKCWEERPRCRRCTRKNIDCEYP
                     DPLDNFRNENSKAANRASTLWRQRAFKIDEDESTTDDDKRVTSPDVDYPHTISRSLQV
                     DSVESRALYLFFQDYGCDSRILSPWVGIFQMLPGLYERAPRNSFTSHAILAVALAYQE
                     RKHKVSRSEVPARTEYSKAIQAINSQLQLQERTPINEILASICLMSQFELMLPSATMA
                     KTNPESRLAHMYGAIAMVQRVEAQAKGQVIDLRVLNLIFLQMTINCLNGRLRPPLSLD
                     SWIRRLDFSMPGPTLLCAMYRIALWQADVDELIQGTQCFDTETETRIRNLIIMMQVED
                     AELETWESSLPLRFQYQARPVSPHDHAMFHSPGAPHTIYEYSFCLTAVPRTLYFAARI
                     ILNQSLQRCCTWMSTWSPKEEEEEYLIQCAILKESIAAMICSISCSVNAVLNDSIQPP
                     GNDDLQNRRGVEAPGLRGVLMMWQLSVSSVATNDPDIMERVGHERSLWLKSVLGHSIS
                     RMLGYLLAFAASSQALTIDYWPYQSFVTEPTFHPPIFQIDKSGAPLADGLIIFTPSIE
                     NITTIGARDLVAGMIMTDDGELVWHDPHFEISTNLFVQSLNGKPVLSHWSGQGSNVGH
                     GYGSVTIMDETYSTIAEICPKIGLVTPDNSVPDCDADLHESYITDRGTILVTAVNATQ
                     ADLSSVNGPSDGWVYDTKFLEIDIATKDIVFEWSAIEAGVPFNLSKTRPDTGLAGNGT
                     SQSSPWDWFHANSVQAVGDKYLVNSRHCWSTFMLDRTGKVEWYIDGSDGGDFKLDSDN
                     LFRWEHHARAQNFTDTSLELHYFNNNNAEWDNGTRATNGLRLGLDLEAKTATVLQKLH
                     SDGIFTESQGSFFPLDNGNTLVGFGSISKIKEYGPEGDLRMTLQFGEDNLVQSYRSYR
                     QEWHATPATLPKAVIKDSAVYMSWNGATEVTQWKVYGPALVGASSMQLLGTVPKKGFE
                     TLFNLTQPALLVKVAAYAGDKLLGTSPIVTI"
     gene            complement(<767171..>768138)
                     /locus_tag="TRUGW13939_05122"
                     /db_xref="GeneID:55992620"
     mRNA            complement(join(<767171..767940,767999..768086,
                     768136..>768138))
                     /locus_tag="TRUGW13939_05122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488287.1"
                     /db_xref="GeneID:55992620"
     CDS             complement(join(767171..767940,767999..768086,
                     768136..768138))
                     /locus_tag="TRUGW13939_05122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344180.1"
                     /db_xref="GeneID:55992620"
                     /translation="MAVDREDDWTGLADAAARRKRQNRLNVRAYRKRKALESKAQSTS
                     SSVSRKKGKPEMSEEQIPCWVEKHQTVVLIPASAVGEFYKSGSPLIPLEHNQQHVGSK
                     INNLGEVFFPISPDHTITLLQFNVIRGLLTIRHLLSAIIPPSSQGNECSTAAYHVLPD
                     LSSCPTSLPASLHPTHLQQTVPHEEWVEGIVHPVMRDNIIRAIGTFDEDQLWSDTIGG
                     LFEGFPDSEVERRGVICWSTPWHFSGWEMSEGFLKRWGWSIKGCESDILGATNKWRTT
                     RGDDPLVIEI"
     gene            <768521..>769522
                     /locus_tag="TRUGW13939_05123"
                     /db_xref="GeneID:55992621"
     mRNA            join(<768521..768594,768649..>769522)
                     /locus_tag="TRUGW13939_05123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488288.1"
                     /db_xref="GeneID:55992621"
     CDS             join(768521..768594,768649..769522)
                     /locus_tag="TRUGW13939_05123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344181.1"
                     /db_xref="GeneID:55992621"
                     /translation="MTFHPDSIPDLTGRVYIVTGGTSGIGYYTVAHLAKHGAHVYLCA
                     RTQNKGITAIDGIKSMHPKAQISLLEMNHLSLASVLSAAKHFLSQESSLHGLINNAGI
                     MATPFEMTPDGYEAQWQTNYLAHWLFTSHLLPLMLQTSKSSPAGTVRIVNLSSSGHYF
                     APNGGINYEDTSLPAASGMARYGQSKLANVLHTKTLHKLYGPSSPSARAGDGEIWASA
                     VHPGLVESNLGTRAETPKIMSTIISIFGAMGARVNADKGSWTSVFCAASPQMKKEQSG
                     EYFQRIAESGWQSKMAKDVKLADELETWTRKVMEKGDWC"
     gene            <769970..>771601
                     /locus_tag="TRUGW13939_05124"
                     /db_xref="GeneID:55992622"
     mRNA            join(<769970..770153,770217..>771601)
                     /locus_tag="TRUGW13939_05124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488289.1"
                     /db_xref="GeneID:55992622"
     CDS             join(769970..770153,770217..771601)
                     /locus_tag="TRUGW13939_05124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344182.1"
                     /db_xref="GeneID:55992622"
                     /translation="MTLNTPPVVLPEQGKKNILITSALPYVNNVPHLGNIIGSVLSAD
                     VFARYCRARGLNTLYICGTDEYGTTTEAKALTENCTPRKLCDKYHAIHANIYKWFNLS
                     FDIFGRTTTELQTQITQEIFLQLHNNNFLKEEVTTQLYCEQHHSFLADRFVEGECPVC
                     GYPEARGDQCDLCGGLLDDPLQLKNPRCKVDNSTPVTRDTKHIFLELDKLQPEIEAFF
                     KQSSAKGAWTNNGKVITAAWLKEGLKPRSITRDMKWGTPVPLPGYEDKVIYAWFDACI
                     GYVSITAAYTDQWRKWWQNPADVQLHQFMGKDNVVYHAVIFPGTQIGTRDTWTKLHHL
                     STTEYLTYEGGKLSKSRGIGVFGDSAQKTGVSSDVWRYYLLSHRPETGDSEFDWDSFI
                     SANNNYLPKNLGNLVNRVVKFVNSRFDSVVPDWTEYHEPSFDEWKADINKLLTQYIHE
                     LDAVKIRAALSTVLHISQQGNLFLQSHKLDNSLAEDQPGKCAAVVGIAVNLVHLLACI
                     IAPYMPDTAMSINR"
     gene            <771608..>771730
                     /locus_tag="TRUGW13939_05125"
                     /db_xref="GeneID:55992623"
     mRNA            <771608..>771730
                     /locus_tag="TRUGW13939_05125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488290.1"
                     /db_xref="GeneID:55992623"
     CDS             771608..771730
                     /locus_tag="TRUGW13939_05125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344183.1"
                     /db_xref="GeneID:55992623"
                     /translation="MDLLAVSDYWNADSIQPGHATGKAEYLFSRIKPEKAEEWR"
     gene            complement(<772441..>774153)
                     /locus_tag="TRUGW13939_05126"
                     /db_xref="GeneID:55992624"
     mRNA            complement(<772441..>774153)
                     /locus_tag="TRUGW13939_05126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488291.1"
                     /db_xref="GeneID:55992624"
     CDS             complement(772441..774153)
                     /locus_tag="TRUGW13939_05126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344184.1"
                     /db_xref="GeneID:55992624"
                     /translation="MSTAKIKPYDIEGLNTVGRVTGTKEDLKDREFMTACPPDVPPRS
                     RIVAVCGITDYKNRASPAKDGFFFSDFYLFHHLLSPGVGVTPQQIWITSEEPRDLIGK
                     YREYVYGDPKGGRRVVLNEDMLQQIQVSGTIRVVQRDQLLERFVSTVREQACLAADAD
                     EHLVILIFGHGQWGTYGVHIGHNGRREIPVLHIEDINRALKPNNKVTLFSTACYSGGW
                     LVQPDVNRYRHINTTGIAAAAPTRESISWPVSASVGRAGGSVFAGSILQSLIDLSESP
                     DRHQILEDPTYIELANSVYVAYNKLNPYPEDQGIHFSAQDDTWEKQYEQRVGIPLSRF
                     RERFESLPSIPDGEYQSRFDLDAPEGPVGRLGTLRKRSKVKFWAYTYMKSNPGITEAA
                     PNMSVHGPILQLLHFKKKLSDEQIDCMYRSLEYRLNVMDQANYFAAIMGVKKTNICDF
                     ILEGYKLTPEKQKLRSFATDLIYEKQLLNKPRYDAGLEYLKPMHYLAILLAESGMDTD
                     EIKEKIDYAVKVKAEGSKVIVSENGEVLNDPELVGNAKRFSKVTKDLGYRVKGLFQQL
                     GLRS"
     gene            <775281..>775801
                     /locus_tag="TRUGW13939_05127"
                     /db_xref="GeneID:55992625"
     mRNA            join(<775281..775626,775695..>775801)
                     /locus_tag="TRUGW13939_05127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488292.1"
                     /db_xref="GeneID:55992625"
     CDS             join(775281..775626,775695..775801)
                     /locus_tag="TRUGW13939_05127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344185.1"
                     /db_xref="GeneID:55992625"
                     /translation="MQKNKGKYNEFKMAGELHEAQLKLHQVQEEVYAWEAFMKAPDSK
                     TLEEPSVDTELQFRIQQKYKEMKPPLSTLKEPEATPEEKDTCAAKVKDLCDEMCSIVF
                     QSPPEPKVFEPDPNFKPTGLRQNAAAPTDDDYKRHEEIASTEIAELDI"
     gene            complement(<776356..>777783)
                     /locus_tag="TRUGW13939_05128"
                     /db_xref="GeneID:55992626"
     mRNA            complement(<776356..>777783)
                     /locus_tag="TRUGW13939_05128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488293.1"
                     /db_xref="GeneID:55992626"
     CDS             complement(776356..777783)
                     /locus_tag="TRUGW13939_05128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344186.1"
                     /db_xref="GeneID:55992626"
                     /translation="MAEDRDQLDDYAFTTRGHAYAIDDLYKSRDRPEILTARKLSSVT
                     WKARQKTVPPPINKQAENKPPGRDEVQVLFVGLFPPTAHEETLTKKLAIKGPVGHALP
                     KDVGYVVQSMQGQPAFRVVVVNKSTIPEGGLKYFVLFEKDHTSGLWNGFTISQELIFF
                     FPEYRHPTKTLSERGKDWSQKVLTACSGGHDTRAEGVAHHTYLGTQNDHQIARLHLEM
                     AKFHLTQNPESLDAIEEMVNNNDRPTSQLKSLVELLLAVDGDFDETHADALTTEVRRH
                     WNGLDSVVSSDGLLSLNKGIVENGHEIDTKYAYVFIALGCTMFASGSSSKQSVVCSAL
                     MLAKTLVSKGEDFDFAIPPTQKTLVKDIFVALLTKIKPLYQSMTETQRRLERQHGKSV
                     LRFDPREIYDHIMQARDQDTLWLLIDQLVAIRSVHVMEAMSQHVSAVASIRDYLKEFL
                     ATLNEADEEDEEDEAEDEEDMDGTD"
     gene            <778175..>781416
                     /locus_tag="TRUGW13939_05129"
                     /db_xref="GeneID:55992627"
     mRNA            join(<778175..778312,778383..778523,778578..778853,
                     778928..780334,780857..781092,781190..781241,
                     781303..>781416)
                     /locus_tag="TRUGW13939_05129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488294.1"
                     /db_xref="GeneID:55992627"
     CDS             join(778175..778312,778383..778523,778578..778853,
                     778928..780334,780857..781092,781190..781241,
                     781303..781416)
                     /locus_tag="TRUGW13939_05129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344187.1"
                     /db_xref="GeneID:55992627"
                     /translation="MTNSKREVEGLASLLSKIRTIPESYDSLASPPQARLQATRKPVY
                     FDDYTEINDEQDRYDDTMDIDFTRGFVYVGGRQYTVRDYLGEEWVERFIMSLHKTQSI
                     PTPKTLISQPHPWQLHGAAKIHKLCLSDIRGAICADAMGLGKTLLAIICMELAKNERG
                     AFSVYVCPASCREQVKEEIIGAYPEGHTPNVLILDDHKMSASALVEGKWDIIICSYNF
                     LTNAYKKQLDFDKKLELFRGGKGPRPPRPVGGLFSDFWRLTALPIKRLVLDECQAIKK
                     EDGKRFQSVKALYSRATILLSGTILSNRWYDVANAVAMLRGHPFDSREKFINAFSAAS
                     RRNTRANSYDEPDFVSVQRFLLGITVARPGNCLVMPDKLTMDFRFVLRSDEQEKVKEA
                     TVKYNKARIAAARGGQNDTESKRALGFAVVAQLLGAHSFLSQGDVSDLPTEAAEVDTD
                     DPEDFLEELTRRMQAENTNPKSRAEWLKFLDTVDKSELAQSSRIGALIRIIHHAKKHW
                     PGEKIVIFSTFLRFLDIIYHVIKAEFGDLSLELNGTLDLKAKTEVQETFKTNKDCKFL
                     LITSGCGGVGLNLQSGSIVIQTEVWWNRNMEIQAHGRCWRQGQERNVKIIRMIASNSS
                     IDDVIKSCQVRKEKENNEIMRVIIRRDDNKCVLELTQVLLKAEDGTTRNVKMAQAIPN
                     MIQHETQNMPEQPNRDTILIVRLTAQPVVGEETRQVKAVAPHSNKVYQAHCLEGDTQE
                     SGSLPADQHVAFMNTSESTPVLTAGQIWSERTSCECGVHAITSVAGT"
     gene            complement(<783595..>783912)
                     /locus_tag="TRUGW13939_05130"
                     /db_xref="GeneID:55992628"
     mRNA            complement(<783595..>783912)
                     /locus_tag="TRUGW13939_05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488295.1"
                     /db_xref="GeneID:55992628"
     CDS             complement(783595..783912)
                     /locus_tag="TRUGW13939_05130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344188.1"
                     /db_xref="GeneID:55992628"
                     /translation="MSKFIEILDEGDGASLAQRKMSESDVKLEDVLADHEATVNRSRS
                     STQSSSKSQHLPSLPWARDASELPTSSSSSSSSSSSSSPTSPQPKVKRLRKFTLTGGF
                     SSR"
     gene            complement(<785331..>786739)
                     /locus_tag="TRUGW13939_05131"
                     /db_xref="GeneID:55992629"
     mRNA            complement(join(<785331..785981,786143..>786739))
                     /locus_tag="TRUGW13939_05131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488296.1"
                     /db_xref="GeneID:55992629"
     CDS             complement(join(785331..785981,786143..786739))
                     /locus_tag="TRUGW13939_05131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344189.1"
                     /db_xref="GeneID:55992629"
                     /translation="MPQQKIPSLKTYFDEIEETNGDDECKAWLNRVFDLKAELANFVA
                     THRAGGGSGKYICFLKGSFNFSFRFSFNDGGPDAIIRFPKPGHTATAYRDEKVTNEVQ
                     VMEYLRQHTNIPIPSIHSWGLLAESPQQLGPFIIMDYVEGVLLSTILKQPDQEDVILN
                     PDIDNTILDKIYGQIASYMLQLLVLRFLASEPSQRTTLQRNLADGPEIAQARFIARHR
                     FAQLISKYYYAEDGGGGGGPFIPFCDDMRPSNMLVNPETLCITAVLDFEFTNAMPAEF
                     TYDPPWWLLLSGPEMWLERCCSMDEFLALYEPRMAQFLQALEQVEKEAASECNKQSNG
                     SPPLSTRMRYSWRTGRFWFDYAARKSFDVDMIYWAALHNGGAGVELLDDKTRTEMESF
                     TQTKMEQLKVYKEECTARFSSER"
     gene            <787177..>788582
                     /locus_tag="TRUGW13939_05132"
                     /db_xref="GeneID:55992630"
     mRNA            join(<787177..787378,787434..787453,787513..787617,
                     787686..788077,788126..>788582)
                     /locus_tag="TRUGW13939_05132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488297.1"
                     /db_xref="GeneID:55992630"
     CDS             join(787177..787378,787434..787453,787513..787617,
                     787686..788077,788126..788582)
                     /locus_tag="TRUGW13939_05132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344190.1"
                     /db_xref="GeneID:55992630"
                     /translation="MALELGSDVWDTPALKPPLNATPDFAHPGGDGGLAVAVIIVCGV
                     AAGIAFCVRLASTFIARRVYVEDGLFFATSGLYAGFLYETYMMDSKYYHVHVWNLPLQ
                     TLSSIVYSTHIMTILYGLCVMLLKVAILLSWLRLFVPMKQRNAKFWTLQALIWANVIF
                     YIVCTFCEIFRCTPREKIWNPVFEGGYCSVNMQDHAKASGFINLVSDVIILLFPQKII
                     WDLHVTRKQKVGMSLLFVVGFFAMAAATVRLYYLFKEFDGADFIYIRSDLVLWMAAEI
                     AAGFLVMGLPSLPKVFRALPGSGSMMSFFKSIWRGLSGEQENSRRGLPSWFKPSPKRA
                     LDSSIVGTTKGGSPANMVFVTSWDPCTQKTTTTTTTTTTSGAGSSESSLKAPGEYGH"
     gene            complement(<789433..>796036)
                     /locus_tag="TRUGW13939_05133"
                     /db_xref="GeneID:55992631"
     mRNA            complement(join(<789433..789499,789570..789827,
                     790349..790491,790616..790744,790794..790859,
                     791005..791341,794091..795040,795092..>796036))
                     /locus_tag="TRUGW13939_05133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488298.1"
                     /db_xref="GeneID:55992631"
     CDS             complement(join(789433..789499,789570..789827,
                     790349..790491,790616..790744,790794..790859,
                     791005..791341,794091..795040,795092..796036))
                     /locus_tag="TRUGW13939_05133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344191.1"
                     /db_xref="GeneID:55992631"
                     /translation="MSPPDNRYDIVIVGAGPVGILLSLCLSRWGYKVKHIDNRPVPTA
                     TGRADGIQPRSIEILRNLGLKRALMANEPAKVFDVAFWDPQPGGNGIHRTGNWPSCPR
                     FIDTRFPFTALVHQGKIEKMFLDEIEKAGTFIQRPWTIVDFKNSGRDEAYPVEVSLKC
                     LDTNVIENVRAKYLFSGEGARSFVREKLGIGMSYKDQISFVWGVMDGVVRTDFPDIQT
                     KCTIHSDSGSIMVIPREENMVRLYVQIASSTDSDWSPRKTATAEEVQEIAKKILQPYS
                     IEWDRVEWYSVYPIGQGIAEKYTLDHRVFMGGDACHTHSPKAGQGMNTAFHDALNLAW
                     KLHAVESGFANRSILESYELERKQIAENLLSFDNKYAALFSKRPPTAEEVGNAKSGHS
                     DGEEDDFVKTFKSSCEFTSGYGVAYEPNVFNWSSSHPAKSPLFGIDGVKLTPGRVFTP
                     TSVTRLSDANFVHLEQEVPANGAFRIFVFAGSPSRNKVAIEDFAQNLEKENSFLSVYR
                     RPDLGHVSYFERHNPHSKLFTINVIFASPKNAVEVSSLPQVIKDYHHHIYADDIPDVR
                     VPHAKFPAHEKLGFDPEKGGVVVVRPDSHVACIVQLVEGSGTVDALNEYFNSFSTNEL
                     GQASSSRLQRGTRQAAGAGVKPLPAIDTDPASSDHPPEPSSPSHQAKQNNQNALLGTN
                     SRPARVRPCTSLIIPIPLLTSSPSVTELRPQDTEEDPYYYTFKVLCSSCREVHPNWIS
                     FTRYEKHEIPGSRGEANFVWKCKVCGKTHSASISAGPNAYEATDNAKAKTQKIVEFDC
                     RGLEFTEFKPDGEWAAKGAESSTVFTEIDLTEGDWYDYDEKASEEVSIKEMTWDIKNV
                     NSNQSTRVPFCRPSTKPSSRKELKKPHANNLFPFRVGSAFVIRLKWGQTEYRGTLESI
                     DSYMNVLLRDTEEFIDGKNTGNLGLVLIRCNNILWMGGADGVEMTDLGLK"
     gene            <791700..>793382
                     /locus_tag="TRUGW13939_05134"
                     /db_xref="GeneID:55992632"
     mRNA            join(<791700..791872,791934..792050,792109..792974,
                     793036..>793382)
                     /locus_tag="TRUGW13939_05134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488299.1"
                     /db_xref="GeneID:55992632"
     CDS             join(791700..791872,791934..792050,792109..792974,
                     793036..793382)
                     /locus_tag="TRUGW13939_05134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344192.1"
                     /db_xref="GeneID:55992632"
                     /translation="MDQPNVFREFSKKVKTVLTSPDPQVILDALRALAEGKEANLQDG
                     RVIEPLGPWESSPETFPNQLRWGRKRLRSESANEPNLWETLALFDGPEGYNQSLVDLP
                     KIAYSDLVARLDQPPPRVVTHIGGVSLPKVLGPSQSQPVQSLDEDLPYISDFLRGNGT
                     ARAVAATRCKFGWERLSVDCLCLYVDADDTTSLENSVTSLADLAMIRESKLCHTGDSL
                     SEAQKLLAPTGITELALKERMYDLRQNRIRRVVRQDGNIYPGQSISLMGEESKGSVGV
                     FLSPCGVDEHKVYALTAHHAVPFKIAGQRVITPGGLDILTQLQRAVDSHPKDIEVLLK
                     RRNEACGYAEYGHIGSNQQGWGSDFTLIHLDDHWIGENDELYDVDLSVLHNPGDIVYQ
                     DGATTGGTVGQIGSSEVLLFERGTASDVVRAKFLAILPLDVPFRDDVCAKGDSGSGVF
                     LPAPQEDGWKFAGQLVSMIDMDGWAGLMIPQSQVFQTLKEKTGKAWRLSG"
     gene            <797156..>798891
                     /locus_tag="TRUGW13939_05135"
                     /db_xref="GeneID:55992633"
     mRNA            join(<797156..797472,797526..798186,798250..>798891)
                     /locus_tag="TRUGW13939_05135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488300.1"
                     /db_xref="GeneID:55992633"
     CDS             join(797156..797472,797526..798186,798250..798891)
                     /locus_tag="TRUGW13939_05135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344193.1"
                     /db_xref="GeneID:55992633"
                     /translation="MADQPTDQREEQHYPDPEDDYPLLLAKRYNHEAKDGQESACDDS
                     IASLVPSSPRSTFSLGRLARGVVDSLMPEPLRPQRVLKKRPAPLDLSPSRNFNASTVA
                     LNERSKYQVRPCSSVYDQHHPWPASTVCSEAAPLHEVDDESYFGPQERSWTGEANERT
                     WASEPTGPLAPMSGSVKGKAAVADGTRHNPVLDTEARFWMPSKTPDEGQPAAEETVLS
                     EEELEQQAVEREEQLVSQVAALRLPTFTRRKQPVVQPSTASSYGDSEPLLPSHGDHVP
                     FDPVDPYHHSGQPKKKTLYGPEGYLGKKKDWKQSPLQKMVSKVGSVGTRVRNSIRRSL
                     ENNAKDQRTELVHGIVMKPNVPIHVARQTQAEIYSKLELFMCVAANEYLLVQLHYNRF
                     VGTDSLRRFVEFWKAKNRPTVPEFQFDLKTQYDIVIHNVRTLEFPGKYGLDPVLLKST
                     LDAWGSVVNQLNVRNFCWPDSAILKLFHDVFPVLEMLGAPTEFMAVFLEMRRLVVEIV
                     EESKKIKKVDKATFEPQSPVPTMPRRGYHSG"
     gene            <799654..>802605
                     /locus_tag="TRUGW13939_05136"
                     /db_xref="GeneID:55992634"
     mRNA            join(<799654..800538,800589..801900,801951..802088,
                     802145..>802605)
                     /locus_tag="TRUGW13939_05136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488301.1"
                     /db_xref="GeneID:55992634"
     CDS             join(799654..800538,800589..801900,801951..802088,
                     802145..802605)
                     /locus_tag="TRUGW13939_05136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344194.1"
                     /db_xref="GeneID:55992634"
                     /translation="MSGPVHTYGATCLRATPKQDLVALRSSSTPPQVHAQFFYTSSLP
                     IDDPLTPLPAPTNSATSNAASVPQPFSARDNITLEQTWRALEASRNARPQQEASESLQ
                     GSRISTLILRGKQSLENATSVSGPSLAARTSEDIAINDQRERGQSLSTTGQRSLGKSA
                     SLKKRDISPLGRRIKSAKRTSASSPGAEDEGFDFSTSHEGQPAGNHISGSPFARSSSR
                     RSKSPSESTLGDGTERNSARFEASARDFKDTDTNLAGDAHLAQDTEAAGEDTENDSAE
                     YKIPVGVSRLHLVELPGLKMKPIYWSPLHDISDVLRATWFYKNTMLPIEPRLANELEK
                     GYHYMRAWTETWQDELNSCVENGAEAETKVMYKLWEDDITAASTATSRPSTMQDGGSL
                     PNASNDTAKEDKKNFSFAQNVSASGSDNEPETNPFKQSSVIFVDGKDAQILRPSLLPS
                     VSRNRRPLSPIRKGRQIGIPVVRGFDRKQWDELHPTKQTNIDMRHYIMRPQMRNARGG
                     QICYACAIEESRPNPSDLIFVIHGIGQKLSERMESFHFTHAINSFRRSVNMELNNEEI
                     WPHIRQDHGGIMALPINWRSTLSLDDAEADPLSVDDDPTANQYTLKDITADTIPAVRS
                     LISDVMLDIPYYLSHHKDKMVRALVKEANRVYRLWCLNNPGFHEHGRVHLVAHSLGSI
                     MALDVLSNQPTKLPDIDFHRDELHMDFFEFDSKNVFLCGSPAGLFLLLNKANLLPRRG
                     RNKPGREGEDMQRGVAGEAKKYGCVAVDNLYNIMHTTDPITYRLNAAVSSELAESLKP
                     ASVPSSSSSFFSSLGSVFRWSSANKGIGSKTPSRPAAVSKLPSNVELETHDFNREEIA
                     ETRMLLLNDNGQIDYYLSGGGGPLNIQYLNMLSAHSSYWILPDFVRFVVVEIARRQDK
                     DGTIPALRAEKKKGWKS"
     gene            complement(<802912..>806706)
                     /locus_tag="TRUGW13939_05137"
                     /db_xref="GeneID:55992635"
     mRNA            complement(join(<802912..804731,804792..804829,
                     804894..804934,805005..805044,805875..805973,
                     806035..806343,806416..806507,806563..806597,
                     806652..>806706))
                     /locus_tag="TRUGW13939_05137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488302.1"
                     /db_xref="GeneID:55992635"
     CDS             complement(join(802912..804731,804792..804829,
                     804894..804934,805005..805044,805875..805973,
                     806035..806343,806416..806507,806563..806597,
                     806652..806706))
                     /locus_tag="TRUGW13939_05137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344195.1"
                     /db_xref="GeneID:55992635"
                     /translation="MVLYPIGISTTAFVVVGAYLLFHGEGEAFNVGQFLESVSPFTWA
                     TIGIAMCIGLSVVGAAWGILLTGSSILGGGVKAPRIRTKNLISIIFCEVVAIYGVIMA
                     IIFTSKLNSVDPENLYSASNMYTGFALFWSGIIVGFTNLICGVSVGINGSSAALADAA
                     DPSLFVKILVVEIFSSVLGLFGLIIGLLVSGKAVDFNGGTGFAVKDVTPETVSPLIHR
                     HAPGLVHGMLAASLQVTPFAVMSRPVAGVRNQSLILTLPGSPKGAKENLEAVINLLPH
                     ACIQAAGANSREIHAGGLKKLESEAAVSATNNNVTKHNDHGHGHGHSHHHHHHHHHGG
                     ESGGHQVPKAHTLPEDRPQSNDPNAGPTRRYRSSPYPMLSVEEALKIIAEETPEPSII
                     EVPIDSNLVGSVLAEDVYAGEAVPAYRASIVDGYAVIAPQESAPGPRTKGVFPVASVS
                     HAQAASMPPPLEQGSIARITTGAPLPPNANAVVMVEDTALASTTPDGKEEATVEILTD
                     EIKPGENVREPGSDVTKGSKILSKGDLISAVGGEIGLLASTGTHTVKIFKKPTVGVLS
                     TGDELVEHDDRRVLTGGQIRDSNRPSLISCLRSWGFQTVDLGIARDTPAGELEQALRG
                     ALRGLGAGQQPPVDIIITTGGVSMGELDLLKPTIERVLGGTIHFGRVSMKPGKPTTFA
                     SVPYKPTSSSSTSPSTPASTSQQERERRLIFSLPGNPVSALVTLNLFVLPSLHQMMGL
                     AASTSHKYASNVGLPIVSAILAHAIPLDPKRTEYHRAIVTASNKDGRLYAASTGLAGV
                     GQRSSRVGSLAKANALLVLRPGVGRIEENQLVEALLMGSIVSDD"
     gene            <807207..>808110
                     /locus_tag="TRUGW13939_05138"
                     /db_xref="GeneID:55992636"
     mRNA            join(<807207..807262,807346..807371,807425..807513,
                     807591..807993,808055..>808110)
                     /locus_tag="TRUGW13939_05138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488303.1"
                     /db_xref="GeneID:55992636"
     CDS             join(807207..807262,807346..807371,807425..807513,
                     807591..807993,808055..808110)
                     /locus_tag="TRUGW13939_05138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344196.1"
                     /db_xref="GeneID:55992636"
                     /translation="MASSQTAVGSYSNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDN
                     TYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDISNA
                     KSFQNTRKWVDDVRGERGNDVIIVLVGNKTDLNDKREVTTAQGEEEAKKNGLMFIETS
                     AKVGHNVKQLFRRIAQALPGMDSEAQRGENQMIDVNINSQPISNDGCAC"
     gene            complement(<808390..>809184)
                     /locus_tag="TRUGW13939_05139"
                     /db_xref="GeneID:55992637"
     mRNA            complement(join(<808390..808629,808695..808905,
                     808964..>809184))
                     /locus_tag="TRUGW13939_05139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488304.1"
                     /db_xref="GeneID:55992637"
     CDS             complement(join(808390..808629,808695..808905,
                     808964..809184))
                     /locus_tag="TRUGW13939_05139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344197.1"
                     /db_xref="GeneID:55992637"
                     /translation="MKVILTGVTGFIGREILDQCLQNPSISSIVALSRRELQPPVTSN
                     SKVKVVVMEDFLVYPKPVLQEISGAEACIWALGKARMPDNETSRKVSIDYTLAAVQAF
                     EQNFLSTPEGGKKFRFVYLSGAGAEKDQEKALWVMQDYRHIRGEVENKLLSYAKDHEP
                     RLESYIMRPGMVLSKEMTIRSLVFGLGPSVKVDALAKVMIDLALHGNERQVLENNDIC
                     EHELH"
     gene            <809767..>810942
                     /locus_tag="TRUGW13939_05140"
                     /db_xref="GeneID:55992638"
     mRNA            join(<809767..809802,809884..>810942)
                     /locus_tag="TRUGW13939_05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488305.1"
                     /db_xref="GeneID:55992638"
     CDS             join(809767..809802,809884..810942)
                     /locus_tag="TRUGW13939_05140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344198.1"
                     /db_xref="GeneID:55992638"
                     /translation="MAFRIFQMPRPKSFLYIMSLQTGASLITLSLLLNKISGLYGLLA
                     LLTGYHLSPVQLSMYIYSLAALGLAVLLFPHIRKQTPLHCLGLAWVYFFDTAINTAYT
                     AAFGATWFLVVSQHYHNAPTSGAGSTIDDISGFTNPTYNVSSVHVAGNVLSPEQDAGI
                     TADPSSAPAGSVADGAGTPSLGDGMQQPESFESMIMISVLLIIRVYFTLVMFAFARQA
                     LRQKLLNASQPRYNQLPTHSRATSVATVASAADIDREPFLPHTPEGQGWHGTAGRAMT
                     SVFRNYWLGTDPSDEEDAAWMSGFGQGAQTNNRDNLSSGISERERRRRSGTGPPKPSQ
                     SVLQAASLMQPVYGEHGSAGVNLQEFHEPR"
     gene            <813673..>818431
                     /locus_tag="TRUGW13939_05141"
                     /db_xref="GeneID:55992639"
     mRNA            join(<813673..813703,813767..813906,813958..818343,
                     818402..>818431)
                     /locus_tag="TRUGW13939_05141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488306.1"
                     /db_xref="GeneID:55992639"
     CDS             join(813673..813703,813767..813906,813958..818343,
                     818402..818431)
                     /locus_tag="TRUGW13939_05141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344199.1"
                     /db_xref="GeneID:55992639"
                     /translation="MASVTTSAQAVARIAYVASDVVLSVQPSLQADSLFSNTLHTLAK
                     EDAPSVLLKGSPEVRAVRFNEDPLLSAFTPVQSGKLVTITTSSSVLLTSIPHLYRLAS
                     HPVVIHVAVESSPFSDFSAISSIRQCGFTFLQSETLQEGQDIALTAHALALKSGKGVI
                     HFFDPANSATDDAILPEDHDVVKKVLNVDAIRPSHTRPAEDETLYADSGRLATVPEDV
                     VERVSRTETAPADQLTSTVASAFTSQDTSSVGSSRRDSSIDSHAMSSAATTVDGSGVR
                     PVNSADIFEWAANIWSTLGESVGRNYRAIEYTGPENASSAIYIFGSTGVFVDALSKNG
                     GIADLENVGIITARLYRPWVGSLISNQIPRSIERIAVLEQVKKTTRWGPSFLDLLSSL
                     TAGPGQARPPRLVGYRLGHVESATVVQALRGILQNLQSDSPIQNLEVGSHQEASVQKG
                     LEQPAIENAYTKILDQLFSKRLYVANQLAASNAGISATIAATPEYGFGSLIARSEHRE
                     RFIGEVEQAAKSKTFATDRPQTWLSKWALNARDTVKANSIAEDVIGRLTMDGSKLART
                     LLEDQKLFYKESQWLIGSDAWASDLGNSGVHHVLASGANVNMLIIDSQPYSEHAAADA
                     TRRKKDIGLYAMNFGNAYVASVAVYGSYTQVLQAMAEADQHEGPSVVLAYLPYNKEND
                     SPLTVLQETKKAVDIGYWPLYRWNPSSDDGEPKFSLDSERIKRELEEFLRRDNQLTQL
                     MRRHPKFANNLSESYGSEVRALQKRKAKDSYEKLLEGLFGAPLTILFASDNGNAANIA
                     NRLGNRGRLRGLKTIVMAMDDYPIEDLATEENIVLISSTAGQGEFPQNGRAFWDVIKN
                     SGDLDLSSIKYSIFGLGDSHYWPRKQDKIYYNKPGKDLDARISFLGGRKLTDIGLGDD
                     QDPDAFQTGYAEWEPRLWQALGVDNVEGLPDEPPPLTNEDIKIASNYLRGTIAEGLLD
                     ESTGAISASDSQLTKFHGTYMQDDRDLRDERKAQGLEPAYSFMIRCRLPGGVATPNQW
                     LQMDAISSAHGNETMKLTTRQTFQFHGVIKSKLRSAMRAINKSLMTTIAACGDVNRNV
                     MCSSLPELSGYHREVHAISQKISDHLLPSTTAYHEIWLKDEDDKKVLVAGDAVQDHEP
                     LYGPTYLPRKFKITIAIPPHNDTDVYAHDVGLIAIKGADGHLEGFNILAGGGMGVTHN
                     NKKTYPRAGSMFGFVPANQAHIICEKIMLVQRDFGDRKNRKHARLKYTIDDMGVDVFK
                     GKVEELLPAGVSFAEPRPFKFASNVDTFGWQKDETGLNHFTFFIENGRIEDTADFSMR
                     TGLRELAKLDKGEFRLTGNQHLIISNIKDSDLPEIKTLLAKYKLDNTAFSGLRLSSSA
                     CVAFPTCGLAMAESERYLPELINKLESTLEKNGLSKESIVMRMTGCPNGCARPWLAEV
                     AFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEDEILDIMKDLLRRYSLERKTDGEIP
                     ERFGDWCIRAGVINETTEGKNFHDNTGEEEEDEE"
     gene            complement(<819017..>820721)
                     /locus_tag="TRUGW13939_05142"
                     /db_xref="GeneID:55992640"
     mRNA            complement(join(<819017..819073,819270..819443,
                     819519..819827,819884..820179,820286..>820721))
                     /locus_tag="TRUGW13939_05142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488307.1"
                     /db_xref="GeneID:55992640"
     CDS             complement(join(819017..819073,819270..819443,
                     819519..819827,819884..820179,820286..820721))
                     /locus_tag="TRUGW13939_05142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344200.1"
                     /db_xref="GeneID:55992640"
                     /translation="MAPRADQARPPPIFSEQDMRTPESDYYKSILPYLHYPAFAPRPE
                     ESDIYVFDTTPEAKAYSFTNSELFESHIANAPKPDARVVSICCRNSLRPLGITEHALI
                     NLMSQYDIDSSFFELALSFGYPPQNSEAGFGGMTVKQRHNGAYDMHYLFTYAEDDNKG
                     GTTTWKIRQVCVFQRYDPSKSENLWILLHARPQSKIQQQIKHTLSTNPALLLGSWASM
                     HILVLSTYLGGWRWCIRNLGDDIIKTSDIVLFLDPLDPKTENHKGGRFHLLKQQYLDD
                     KLVSLAARLGVALTTLRQLEKLNSSFHSKGFSNDEEFHSATGDLMYYTTTLEGHLESV
                     KVLERKVSSIADLLAVVLTVENQAVSIGINNKMLGVNNELVKLTNKSLDENATVRIIT
                     LMTLIYLPASFVALDPGIGSIIDGGTLIKRG"
     gene            <823241..>825467
                     /locus_tag="TRUGW13939_05143"
                     /db_xref="GeneID:55992641"
     mRNA            join(<823241..823284,823546..823640,823698..823759,
                     823817..823917,823986..824403,824454..824601,
                     824654..824923,824983..825136,825194..825282,
                     825337..>825467)
                     /locus_tag="TRUGW13939_05143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488308.1"
                     /db_xref="GeneID:55992641"
     CDS             join(823241..823284,823546..823640,823698..823759,
                     823817..823917,823986..824403,824454..824601,
                     824654..824923,824983..825136,825194..825282,
                     825337..825467)
                     /locus_tag="TRUGW13939_05143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344201.1"
                     /db_xref="GeneID:55992641"
                     /translation="MNVTILTTACAAIIHGTWLSDPLQETKLGRRAALSVSAFFCAMG
                     ALGSAWCEEWWHILICRLILGVGIGAKASIAPVLAAEGAPDHLRGRLLMMWQVFDTFG
                     IFVGFVCFWICRRSWQALLGSAAVPSLILLVLAFLCPESPRFLIRNNKIAKAFISLRQ
                     LRGSDIQAAKDLYYIHSQLQLQTELFDGKRPEKWWEGDSYQEKVKNQFFFKRVWALFT
                     VPRNRRAVVAAFLVMAAQQLCGINVLSFYSSTLFRSVAPSNEETPTSRNCNIADIVNC
                     NSLTDNRVAWQNIGFGLTNFLFTIPAYLWIDRKGRRILLLYSLGGIFFTLIMIAGFFR
                     LINDNDARIGVVSALTIGVFTLFYGIGAGPVPFTFSAEVFPLAFREVGMSFSVMVNFV
                     GLSLLILFVPPLTAALSPKGLDFETYHLLGQSNMLFFFAGLNALAFVLVFFLVPSRTA
                     EISLEEMDAIFNTRTSVHVLDHLSAVLRRPRGQERESEDEETEIPLERTAPGA"
     gene            <826163..>828594
                     /locus_tag="TRUGW13939_05144"
                     /db_xref="GeneID:55992642"
     mRNA            join(<826163..826765,826822..>828594)
                     /locus_tag="TRUGW13939_05144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488309.1"
                     /db_xref="GeneID:55992642"
     CDS             join(826163..826765,826822..828594)
                     /locus_tag="TRUGW13939_05144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344202.1"
                     /db_xref="GeneID:55992642"
                     /translation="MASVIRRFHSRDSQDYIVRLKKDISERLSHAIEAGTGRFAPRND
                     LKRIWTPEILGVLVLGGWWDGSLLAFVEEIHAHFLQTISILIYVGWDDWSRFYEIFFS
                     HRDADEQLCRTDRRIPEYDVQTLKKDDFLGPSFGSKFFDNRYFFCPIDIEEGSHLKFG
                     VGWKLPFLAGKSSHCGIGGSGIVTKEVIAVEHYRSEAGTHLTEKHVARKLFKSKDAYD
                     KEDFNLTMISKCDNQNVRIILPLATVVIEGQYNMLLPPAKMDLDRFLTGELLSPNDCH
                     MDKLLEELIGLGGALAYLHEGLGQNIRTCHADLKTANILVYDDLDSNGRPGVGKWAIT
                     DFGHSVIYRTSAGHRDSACYLPNEASVSDTIAELRDMRGVYQAPEVLHGHMISRTSDI
                     WSFGCILVRVFAFKLDGVQGLRRLDELRRKEDDEVTDCADDYFCKGGSGSSRLNSHVE
                     KWIKRLPDRNTDYSGTFLENCKDLLLRMLCIDRNHRLQASEVIQRLEELRSILHTFSF
                     ASPTPNLPRGSITSSSNSMQSPGLSGSDWSSRVSVDHTAPIGVLPHTRGNTDDDIIRR
                     LSSPNAETRSSNRGSNIPLYDAVGQGSVKDVTSLLMDEDTQIDERCPTGETPLMLAVR
                     LGRKDIVGLLLGQGADCRAYSEEGMMCLHYATRPDASVGLMRLLIQKLQHVDIPMEGL
                     TRETPLMTLIKQWVPATASCKGKFRALVDAGADINLPDIYGVSPLQQAVALGYREVVE
                     LLLENNAEINEAELSTIAQTNAVEKLWRNALEARRHSGRSRHWNRLGIHRR"
     gene            <829152..>836505
                     /locus_tag="TRUGW13939_05145"
                     /db_xref="GeneID:55992643"
     mRNA            join(<829152..829463,829545..829758,829824..830871,
                     830928..833289,833347..836371,836423..>836505)
                     /locus_tag="TRUGW13939_05145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488310.1"
                     /db_xref="GeneID:55992643"
     CDS             join(829152..829463,829545..829758,829824..830871,
                     830928..833289,833347..836371,836423..836505)
                     /locus_tag="TRUGW13939_05145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344203.1"
                     /db_xref="GeneID:55992643"
                     /translation="MNDSWQIAFNRLTPDLKASLDIAVNLVERLYVLTAVLNEAEEKK
                     KLCLQKRLKIRLHGQTIILRDVFDKIIAWVNEVKSIDDIAVQLNSTAASLPWAGVRFL
                     LQFAVAEQHYFESTIHGLELVSLIISHYAAFEALHMRKASLINDTLQSKLTDLYTKIL
                     VFLANGVKYFNQSAAARMSKGVFQSKQSDELGQIAELGGEVGELARMYEARVQHEIHT
                     GVEETRQILDTLQRPVNRLVDESAIYAKTLQEQQFHDFLKWLSPAPFTLHHARHSSER
                     LPDSAKWLFNHPQYVSWKCSSSSSLLLLHGVPGSGKTSLASAVVDAFLEEKDKNPLAA
                     PIAYFYCGDSKVGRGRADPDEVMRSLTRQLAVIDKTKHEIHEQISLEYERREAEAKLD
                     GFEKVPRLRSLECVGLVLNALDSNPATIVVDGVDEVDQQERHSLLKSLIRVRDESSSV
                     IKIFISSRTDSNIFAHLPDAISLRVQDIDTQHDMELFVRHRVSTAIENRHLLSGNVPQ
                     SLQDELVRFLLDRAGEMFLWVVLQLEILCKLKSRSSVLEAMQERSRVTDVTLDHLYCE
                     LIDRRSGTDSFAYDVSMRAFSWIMCMHEPLSSTAFLAAVSTSALEDRLDLTLQELLSM
                     CSNLITLDSKVDTIRFRHSSFKEFLEARPEFDMARAHSVAAVSCLDSCIQEITTDLEN
                     ELRPDKEFKLYATLYWPTHCSEAAVDEDQGSHLSMKLNEFVFSEGETSLPFIAWLNTA
                     QRASNLMANDHVLKKQLNAVLSPTMTPLFTACVYGLISLLKVAVNKLDFVVDVKNSIG
                     YTGLYLAAAFGRPKIVDGLLKSGADVKSQLGMHGNALNAAAFNGHTTVVQVLLHHGVG
                     TQSPSIIEPALNLSFLAEREDIAMMLFQNGIRISCQEDYDKFHEAASQAGFYSLLQHL
                     TKTFPSFGKDKLPSSKAINVSIRKGQLSFLKTHIKKGLLVDHAVATAALFGQTDIALF
                     FLQEGFDIEEEGPFGSPLRTACLMGHQLMSRILLEQGANVNASGKFGDALQAAAMKGH
                     LSITVLLIQHNTDVNSTGGYYGTALQAAAYCGHCAVTKTLIEAGSWDRRAFHAAAKAG
                     QEAIIDIFLEMGYRFEQNAWVATEGYPIKSYKNLLLEALGDQSVSRGTRKVSSSTDSR
                     LSQDFPLSDFQDILKGARGVIVSETHHSPPCNLQKDYPWLDSEESEASALELVAARGE
                     ERIVRKILESKRCLNVNIDEVGRALWVASKNGHTTVVKLIMSSGVDMLSYIPGSLEHA
                     AWNGHITILETILKCEETWDPVGSSFFESYWTEKRSHNTIGFHQLFRTFYTPGSFSNP
                     HALHIIIFGCGGNQPASVAKGLQLADDNDRQKLQGIVLRAAAMSNATNVIGYISSIQL
                     TFDPVDLPLAFQAAAENGATSALACLVEKDQEEYLRIEHYRSAFTSAVTHGHAEVVRY
                     MVDRATLFLSSENVRQSKYIERLSLLMVDGSISYSMVLRQAFEHACAAGYSEIAELFI
                     LGGANLNTSMDDGTYYSTLPKYELQIGLWKTPLQLCLHKSQPRTKDEVTGQEEIIKIL
                     LENNANVNLTAGYQATALHSAALKCTEGTVRLMLDHGANIHAWASKDGTPLQWAAGRE
                     AGSLPIVRLLLEAGAEIPMDGNPEGSSSPVLRAALSFFGLDSSDEQEIFSNKLNDGRF
                     SESESLQEVLSSGPGGVIKLLFQYKPELQAQDERIGHVLQMAAAAGDGEFIQLLIDRN
                     IDVNLSGHYFGNALQAASRFGHVDCVQLLLEAGADINMLRGSHGTPLQAAVKGAHLEV
                     VRILINSGADPNRRLSLVPSQCGYEEKIAITSAIELAVESESVEIAELLINAGARIDP
                     GSPVLHIAAKARGLSMLRLLIHAGAEVNSCVSGHDPVLITACGHGDVQMVELLLESGA
                     DINISRAMSQPSSDEARPKFWLKKFLQMPRENKGENFDTPLTRTDHVRAIEQSLWKGA
                     AVHNPPRTRHILVEACHGQRPKQTIELLLAKLLGSSALTAAFEEALSAARQNHDEESF
                     MLLLANLPKTVFTLYEACMLGSKDAVEAILASGVDVNSDFDNGGRALHIAAHYQRSAL
                     IPFLIQKGADVCHVSSGFGGAVSAALNGFLALKDQRFDGIISRQPTPSRRGPRNRLRK
                     IASQEVDTESYNVVSCEETVGLLLRSGAVANLGPGALGPLLHLAARIGSLSLVQLFLQ
                     KGLDINTTEGPFGSALLAAILGNHEQVIKFLIAQGIDVNIVSPTSGTALYYACRGRDR
                     WLMKTLLEHGADINARGGGTQESPLTAFLSFKRGCPEDLYGIEILLKYGDSLQITTED
                     LLSAVATYNDNRRSAEEVIAAARKSYREELVTMFLERGKKA"
     gene            <836904..>839193
                     /locus_tag="TRUGW13939_05146"
                     /db_xref="GeneID:55992644"
     mRNA            join(<836904..837381,837450..837718,837788..837905,
                     838213..838425,838497..838739,838817..>839193)
                     /locus_tag="TRUGW13939_05146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488311.1"
                     /db_xref="GeneID:55992644"
     CDS             join(836904..837381,837450..837718,837788..837905,
                     838213..838425,838497..838739,838817..839193)
                     /locus_tag="TRUGW13939_05146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344204.1"
                     /db_xref="GeneID:55992644"
                     /translation="MDANDPIVASYDVFLTDSQIARYVFQFPDRDRDPEIGGPYNESA
                     GQKPAVLRMKPKTGLVEIDVPINTSPGHYDTAKGIKYGEALKESRVLKGGGAFGLAGG
                     FNPNAPSRVKMEGGSVEKTEDTKSSKVQTILRTQTLAGRIKDAHEGDPMYMLGAFRGK
                     NLFISPVSAVVQLRPQLHHIDAFDETSKSRVLRGKKDGDDDGAREAEARPVDVKIKSS
                     EAGEGSVPLNVKLLREIQDERWENYEWVDAETEDSWATYETYMIHNNPEELPGLEAAI
                     DEESYLDAMSAPPDRIVYLTNQATPHVTDKLPTCMSNFSPHLRSPAEQTPCNTLTSMA
                     TTQSPAALVAASLQDGKVHLLLAASGSVATIKLPLIISSFAEYSNLSIRVIFTNSATH
                     FLAGQSAEQPTIAAVAQLPNVDGVYVDQDEYSEPWTRGAPILHIELRRWSHLLVICPM
                     SANLLARITHGLCDDLLTSTIRAWDTDGALDGLVHGRKKRIIVAPAMNTAMWTHPLTA
                     QQIRVLEEEWGVQSDGSGWYEVLRPQEKTLACGDTGVGAMIAWQEIVKVIKTRLALE"
     gene            <839772..>843975
                     /locus_tag="TRUGW13939_05147"
                     /db_xref="GeneID:55992645"
     mRNA            join(<839772..840620,840685..>843975)
                     /locus_tag="TRUGW13939_05147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488312.1"
                     /db_xref="GeneID:55992645"
     CDS             join(839772..840620,840685..843975)
                     /locus_tag="TRUGW13939_05147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344205.1"
                     /db_xref="GeneID:55992645"
                     /translation="MLPRAARRRNVFHQLRQSTEQLALPWLCPATLRYHAQLNRPETI
                     SNTSAAAHSEHRRRSSVFQPARHLATAADAPPLSQTGGYVPFENFTYGTAAQAPSFER
                     TESPEFAQSLYDEPAIMIQEGQMITSPMFRRLKGVGGTVEDLTARFSASISCGDLDMA
                     ALSLDRMSKFPNIDPDFFLDLHNNYLESVVDQMINTRRSDEALSKALAMQTWFEVKLP
                     RGRTLQPDARTMAIMLRMALRMLHGSRRDRTVRRYWNMVVEKEFETEVMAMSDLLNDR
                     DWGEISQLCPNQIPNDFVQSDSKSGSADDLRQTDQKGLGLSSLQRTLAGISNDAESID
                     SDAAKQRRLERQVLLEKRAIETAQQRWYKEMDSLKAKGVGDASNNKTISLIMEKWHRD
                     LVDSIKQELVLVDQEMKRNKSRASDKFSKERRDYGVFLRCMQPETLAAITVMHVIQIF
                     TRSGIQKGVKVPIMVTGIGKEIQHELIAQKVLAQNPEDHKRRDAIKKIFENRHGRNGS
                     MRFKKLMKENETLMDADTFWPVNVSAKVGSVLMRLFFDVAKVAVPQVDPKTKEQFMFM
                     EAAFQHSYEIDRGRKFGVLHTHPEVSRKLVRDRPSVLQVRHMPMLSEPKAWTGYQDGG
                     FLGHPSQIMRCAPTDGLQKAYIKKALEDNGLPEIRASLDILGKTAWTINGAVFAVMKE
                     AWNTGEEFPNIPPLDPNLPKPRPAKDDSPAEQAYYNKQLRDLENTVSALHSQRCFMNF
                     QMEIAQAYLNETFFLPHNMDFRGRAYPIPAYLNQMGADNARGLLLFKKARPLGKSGLS
                     WLKVHTANVFGFDKASFQEREEFTEKHLDDVLDSANNGLHGRRWFFQAEDPWQCLAAC
                     LELRNALRLEDPTQYMSQLPIHQDGSCNGLQHYAALGGDLQGAQHVNLEPGERPKDIY
                     TGVCDLVIAQLAEDAAKGNELAQSLQGKMKRKIVKQTVMTNVYGVTFIGAIRQVRRQL
                     VAHYPDLEELSAASIYITRAIFNALGSLFGGAHSIQYWLGDCASRICQSISPFQLDEL
                     AKRTLSEAKEQNVRGEEEHDEDEMEEEEEEFEMNPVKMFRAPVIWTSPLGLPVVQPYR
                     TVKTRRVYTSLQSLNLQQDDGGAGGVVSKRKQLQAFPPNFIHCLDATHMMLSAIECDR
                     RGLTFAAVHDSFWTHAGDVDTMNSALREAFIRMHSDNITKRLAAEFNVRYDGYLFLAK
                     FPSKSPIAVKIVQNRRKNRSTMLSEVVLEYQRQTLLRSDDPEMQAQGRAMTTGASIFE
                     EMNGSNDDIAIPSTLGETATGAINEERKESGRVYSAVDEKDPAIASLFTDLDPQFLEF
                     EITKTDDESEPKAAEENVAPKRNPPNTFTWAWLPLTFRDVPEKGEFDVNRLRESKYFF
                     S"
     gene            complement(<844585..>846993)
                     /locus_tag="TRUGW13939_05148"
                     /db_xref="GeneID:55992646"
     mRNA            complement(join(<844585..844587,844642..>846993))
                     /locus_tag="TRUGW13939_05148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488313.1"
                     /db_xref="GeneID:55992646"
     CDS             complement(join(844585..844587,844642..846993))
                     /locus_tag="TRUGW13939_05148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344206.1"
                     /db_xref="GeneID:55992646"
                     /translation="MASSRVKSTLSLFQKEKKYQWPNPESSIGKFCGTKKGKYTYKRC
                     WKAVGPAQEALSQVATEIDELLAEKCGPVPSSCLVQFDIFMIGAKPATAVPYIMFSCT
                     RYGPRKEALTVVQKSEILNRCPRGIELGQWDKPPTIQNLQPLGSSTESVGTGEITGMS
                     RVHLSPVFDNKPPWKFSAMQLKLYSSHHNSEYLSRGTVGSILEIADKRFYVAPAHIFS
                     ERNYSPHMMSDDDIQEGDSDCEFCGFDDEDERIAEEDEVEFLSQYSVTPDSSDIETES
                     NPDDEYYSSDSEYEDSPSVQYQEEEPVLNTGSSLIADLSPLKTDDTADLLHRVSLDIM
                     MPCITSIELDFSLIEVNKNDHITEMLPTFSRYNVCKVGPGDVDVTAMTGSGELLTGIL
                     SGRPVYTRLPNTRKFQETFEVEISGRLQPGDCGSIVRNARTGDIYGHIFAGCVESKIA
                     YIIPAVNVLEEIERIFNVFPGSNQAMEIIPQCSLPDADSDTKGEHAASEDLFELTDKD
                     ACDSIPRMLVASKRVLTYEDYTIWISSLYSEDIEVDAARSMLDEVHDALPQLPGEPHS
                     YTLGSIGDHNVVIACTSGDSAATSQMLSTFPNIRFCFLVGTDSSLPTTRPSDIRLGDV
                     VVSMRCNCHGGGIKYNFGKTYSIGRAQKKGLLDAPPETLLAAVSRLQEAYKTGDAQVS
                     PSLSRLTSRPTAEEVQFKDPSEGTGQWLEADQKHKHSEEQLEECEHCHNDIRTIQCCH
                     RCNGKPMIHYGLITSGNQVTKDSDIHNLFEEIEKRTKSYASRWK"
     gene            <849052..>851832
                     /locus_tag="TRUGW13939_05149"
                     /db_xref="GeneID:55992647"
     mRNA            join(<849052..849343,849408..851620,851689..>851832)
                     /locus_tag="TRUGW13939_05149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488314.1"
                     /db_xref="GeneID:55992647"
     CDS             join(849052..849343,849408..851620,851689..851832)
                     /locus_tag="TRUGW13939_05149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344207.1"
                     /db_xref="GeneID:55992647"
                     /translation="MTQSQPPGLDTLAEGSQYALEKLQLARQTELPYSKSASSDLAAF
                     KLPGRRDSISDARTNIRKNSTSASVRRRISRACDQCNQLRTKCDGQTPCAHCTEFGLS
                     CEYARERKKRGKASKKDLAEAAAKAATITNRPSVSDSILDSPATNNSQQLERPSFSET
                     AYEPPSYDSARRYSNARPPQLPEPASSRTHHGQHVPSSIENLTINNYGHVQDVDRSVV
                     QMPDLRALPPRSPATLIPAGFNGFHDAYNLMNPEPSNGTSLNGYRFANSGEDTSANNF
                     IGISPPAQSPGWLSLPSPSANFPPLNMPTTSTLRYPVLQPLMPHIASIIPQSLACDLL
                     ELYFASSSTSHFFPQSPYVVGYVLRKTAILHPTRPRACTPALLASILWIAAQTSDAAF
                     LTAPPSSRGRVCQKLLELTVGLLRPLIHGPAPGETSPNYAANMVINGVALGGFGVSMD
                     QLGAESSATGAIDDVATYIHLATVVSASEYKAASIRWWAAAWSLARELKLGRELPPTP
                     SQPRGDDREGNADMEFKHSMANGAPSSGGHVTEDEREERRRIWWLLYVMDRHLALCYN
                     RPLTLLDRDCESLLQPMNDDIWHSGDFANAGYRRAGPSFECTGHSMFGYFLPLMTILG
                     EIVDLYHARNHPHFGIHFQNSSERNNQVAEIVRQLGVYGQSLQEFETRHAASLGLANN
                     ESNNDPNFNAPGIDHVSPSARSTSTAGESLMQTRMVVAYGTHIMHVLHILLAGKWDPI
                     SLLDDNDLWISSEGFVTAMGHAVSAAEAAGDILEYDPDLSFMPFFFGIYLLQGSFLLL
                     LTADKLQGDANPNVVRACETIVRAHEACVVTLNTEYQRTFRKVMRSALAQVRGRVPVD
                     FGEQQQRRREVLALYRWTGDGSGLAL"
     gene            complement(<852313..>852707)
                     /locus_tag="TRUGW13939_05150"
                     /db_xref="GeneID:55992648"
     mRNA            complement(join(<852313..852532,852610..>852707))
                     /locus_tag="TRUGW13939_05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488315.1"
                     /db_xref="GeneID:55992648"
     CDS             complement(join(852313..852532,852610..852707))
                     /locus_tag="TRUGW13939_05150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344208.1"
                     /db_xref="GeneID:55992648"
                     /translation="MTVWFSVDAYDELDINLPFQEAQDIILTGNITGVQFPNLTSVDI
                     FNVQTVASLDCDSVRDTIMTATNTTEYNVHCGTSSLGSHFDLNLGATVAFVVVVGAFV
                     GLA"
     gene            complement(<852801..>853799)
                     /locus_tag="TRUGW13939_05151"
                     /db_xref="GeneID:55992649"
     mRNA            complement(join(<852801..852960,853028..853186,
                     853267..853675,853739..>853799))
                     /locus_tag="TRUGW13939_05151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488316.1"
                     /db_xref="GeneID:55992649"
     CDS             complement(join(852801..852960,853028..853186,
                     853267..853675,853739..853799))
                     /locus_tag="TRUGW13939_05151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344209.1"
                     /db_xref="GeneID:55992649"
                     /translation="MSSRATWMSLFTVAVGLLPTAMAQICTPEDGYRYLVGRQSDLDE
                     ITAKCTTVNGSIAMTVNYTGSFHLPNIRNITNGLRWSLTQLENETPETTSIDLPDLEF
                     LGGSLEISDISTLQSFTAPKLETVEWAANIQCTQEVDLRSLVDLEYLTIIGNISSLRL
                     DSLRQVRQDMTICNKDGGCNPVQPPSNSLNISLPALHDAGHIFLKGRFSDLATPNLTN
                     LTGFGNGFYNFKLLTAGGPPINVSFPELKYIQGEGLWLEGNISK"
     gene            <855158..>856457
                     /locus_tag="TRUGW13939_05152"
                     /db_xref="GeneID:55992650"
     mRNA            join(<855158..855656,855709..>856457)
                     /locus_tag="TRUGW13939_05152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488317.1"
                     /db_xref="GeneID:55992650"
     CDS             join(855158..855656,855709..856457)
                     /locus_tag="TRUGW13939_05152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344210.1"
                     /db_xref="GeneID:55992650"
                     /translation="MPSPAIYWPEDGIENLEGYSSGGYHPTYINDELSNGRYRIVHKL
                     GYGPYYTVWLSRDQEKNRYVALKIVIADVSERSLESKILQHLQAGDVSHPWREYVSSL
                     LDNFSFNGPNGQHMCLVSEVAGCSIAESKENSPNFMFPLHIARAIAAQVTMGLAYMHS
                     NGIGHGDLHARNILLQPIDFDTLSIKEMYQRFGDPFKVPVSRVDNGHIQPCAPTYAAI
                     PMNLIVSSDQVASCRVKITDFGSAFFLGQEPRTLHTPTALLPPEVFFQEAISSSADIW
                     TLGCTLYDILGERPLFETWAGDPDDVLGEMVSTLGKLPMRWWQKWEKRPEFFLENGTW
                     NPNFNRIQTPGFRSLDQRLWQMGRGETLQTCELEEMEMASLKDLLLAMLAYEPSDRIS
                     ANDAMNSRFMLSWARPALARLNS"
     gene            <858853..>860241
                     /locus_tag="TRUGW13939_05153"
                     /db_xref="GeneID:55992651"
     mRNA            <858853..>860241
                     /locus_tag="TRUGW13939_05153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488318.1"
                     /db_xref="GeneID:55992651"
     CDS             858853..860241
                     /locus_tag="TRUGW13939_05153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344211.1"
                     /db_xref="GeneID:55992651"
                     /translation="MSRKQRRMGRRPSSKTLYGSLHIWEYERDDNTAKTNNHRRGPCS
                     TTVSRRDRPLIREKKEDSKQTTNVALDEILRSRSRLQTTTDAMRIVTHDVQFAVIHIP
                     FAMGRSFIHDLRTSIYSILSQSGSTVTDGYIAFMALVAHCQAARLCWSTPDLCRGAKA
                     LQCLRNIKPAKPQDAIGILLLGQILFVFEILTDKFTSSAHSIVQSALISARQWYPLLL
                     QEPKFDTMTICPIFMDTVCCLAYRKVPIIRFPIQHRMIVDRYIGVSSTLLPLLYDLCE
                     ISYVAKSTMTGTISPNSTATTDEDHAEDCYSAIEKSIESWTPILPPDLLSAYDKTEVQ
                     MMLTQANVYRLAGLLVIHRLRYRLGVRDSIAQHYAMCILSEISSSCAGLAQDGGAGGF
                     PIMFPVLISMFEVEGLGEELLEKMSGFMISSVCMSKLRGFVNHVRMAKESGFNGLWFD
                     LVEEHLHYAVIP"
     gene            <863733..>864887
                     /locus_tag="TRUGW13939_05154"
                     /db_xref="GeneID:55992652"
     mRNA            <863733..>864887
                     /locus_tag="TRUGW13939_05154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488319.1"
                     /db_xref="GeneID:55992652"
     CDS             863733..864887
                     /locus_tag="TRUGW13939_05154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344212.1"
                     /db_xref="GeneID:55992652"
                     /translation="MLAARTITAISKYATTTTLRTTAISNRQLLPQTTKRFIGIPPQY
                     LLDDYIPRYQLLTSIDASKKRSLAYAHLRNCNLCPRLCGVNRYETTGICLIGAETVKV
                     NVIAPHRGEEPCIQGFSGSGSVFFSGCNLRCVFCQNHDIAHRRNGFDLTPEALAEWMV
                     KLQDVGNVHNINFVTPEHVVPQVALAILTARDMGLKVPIVYNTSSFDSLDSLALMDGL
                     VDIYLPDFKVWESSSSKRLLKADNYAEVARESVKEMHRQVGDLAFTSDGIAKKGVLLR
                     HLVMPGKEEEGMQIMQWLADNVSKDLYVHVMEQYHPDAHVGKKRRNAATKNKVVEHGG
                     AESSSREDEVRYAEINRAVTDEELGSVKQAAEKAGLWRFCEASEKPGFHL"
     gene            complement(<865063..>867988)
                     /locus_tag="TRUGW13939_05155"
                     /db_xref="GeneID:55992653"
     mRNA            complement(join(<865063..865129,865190..865271,
                     865323..865534,865596..866490,866544..866759,
                     866908..867587,867687..>867988))
                     /locus_tag="TRUGW13939_05155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488320.1"
                     /db_xref="GeneID:55992653"
     CDS             complement(join(865063..865129,865190..865271,
                     865323..865534,865596..866490,866544..866759,
                     866908..867587,867687..867988))
                     /locus_tag="TRUGW13939_05155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344213.1"
                     /db_xref="GeneID:55992653"
                     /translation="MSPALVLNNSAVDIIDIRVKDSGGFSAVDAIQDGLDPPQGKARS
                     FPTLLLYDTVGLRLFEEITYLDEYYLTNAEIQTLETHARAIAKRLPENSQIVELGSGN
                     LRKVEILLKQFEDMQKRVDYWALDLSLEELKRTFVEVSPQSYQYVQLKGLHGTYDDAI
                     EWLKDPENRKQPTCVISLGSSMGNFNRPAAAEFLNQYARLLGPADSLIIGLDSCKDRN
                     RVYGAYNDSQGVTRRFYVNGLIHANEVLGHEAFKLDQWTIESSYNDTDGCHRAFYVPT
                     QDVSINGIRLQKGERILFEEAYKYNAQERDHLWRRAGLINVAALGNATDDYHLHMLSS
                     ASLRFATPPSEYSLGSIPNWEEWKSLWAAWDIVSKTMVPREELLAQPIKLRNALIFYL
                     GHIPTFLDIHLTRATRSKLTEPKNYRLIFERGVDPDVDNPEQCHTHSEIPDEWPALGE
                     ILNYQENVRSRVQRLLKTENLTQNRILSEAFWISFEHEVMHIETFLYMLLQSDKTLPP
                     TGIAIPDFEKIALDARCNEKENEWFSIPQQTFTIGLADDDKAAVPHGSFGWDNEKPQR
                     SVTVPAFEAQGRAVTNLEYLQYMEQSGNHRMPASWVIQAANSWNGTFNGLHADGAASG
                     HGNNMFNYAVRTVFGPVSFVLAADWPVMASYDELSGYAEWKNCRLPTFEEARSIYRHA
                     AALKKERSNGVSNGASNGHRLHNQDSLFVDLSGANVGFQHWHPVPVTPNGDKLAGQSE
                     LGGVWEWTSSLLSKHEGFEAMDIYPGYTSDFFDGKHHVVLGGSWATHPRIAGRTSFVN
                     WYQHNYPYAWAGARLVRDI"
     gene            complement(<868660..>869831)
                     /locus_tag="TRUGW13939_05156"
                     /db_xref="GeneID:55992654"
     mRNA            complement(join(<868660..869244,869295..869546,
                     869610..>869831))
                     /locus_tag="TRUGW13939_05156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488321.1"
                     /db_xref="GeneID:55992654"
     CDS             complement(join(868660..869244,869295..869546,
                     869610..869831))
                     /locus_tag="TRUGW13939_05156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344214.1"
                     /db_xref="GeneID:55992654"
                     /translation="MIARMAIRDDSDSSCAVLNSLLAWAVLVKYGNPKHATKFVATAL
                     SSLKVSMRNGIGRQEALQHIIAGILICSLEMHLFSQSSPVWLLYLSGTKNIINQFYQD
                     NATEDTDQTLLFQWVFYFDTLARLGMRHWNGRQSLGLQLSKGLGLEKGIPQFTFHEIT
                     KHGRRTNKIMELFSEFCYNVLSPDDPRYFSVEYISWLGNIENQLISIREQLQQRVTLP
                     DFNGESESFAVRELFVLAILVYFTKKSTKLIGSSSKTNEWIESAFQILSEIEHCNKPF
                     PLFIFGLEARTDNKRVLILDLIDCTAEKFNGRGLVSVRKLLVKSWVQYDLNAGDYLRQ
                     GRDMCSFLSICNFVPCLI"
     gene            <871103..>871857
                     /locus_tag="TRUGW13939_05157"
                     /db_xref="GeneID:55992655"
     mRNA            join(<871103..871320,871371..871395,871454..871524,
                     871578..>871857)
                     /locus_tag="TRUGW13939_05157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488322.1"
                     /db_xref="GeneID:55992655"
     CDS             join(871103..871320,871371..871395,871454..871524,
                     871578..871857)
                     /locus_tag="TRUGW13939_05157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344215.1"
                     /db_xref="GeneID:55992655"
                     /translation="MPLKIYGMAQSSCTRRVLVTLAEKNITDYELIIVNLPLGEQYKP
                     SYTEKAPFGKVPLLDDNGFLLYESRAICQGRLGGIRIACSIEINFFDVPIYALVWEKL
                     IKQRAQLGEPDEALAKKNLDLLDTNLAVYEKILSKQKYLAGDEITLADLYHLPYGVEA
                     WEVGLRDVVNKYPHVTRWFESIESRSSWERVLIESSL"
     gene            <873619..>874049
                     /locus_tag="TRUGW13939_05158"
                     /db_xref="GeneID:55992656"
     mRNA            join(<873619..873792,873850..873935,873995..>874049)
                     /locus_tag="TRUGW13939_05158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488323.1"
                     /db_xref="GeneID:55992656"
     CDS             join(873619..873792,873850..873935,873995..874049)
                     /locus_tag="TRUGW13939_05158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344216.1"
                     /db_xref="GeneID:55992656"
                     /translation="MSADLDELAYNLSPSESSPGWPTAADLQHGSRERKEKAWRHVLL
                     GKQIVSVVEKGMEETQVSQSILPENHRFIGVGRLELMDYNEDRLTIDVDENTVVREVS
                     FR"
     gene            complement(<874211..>877573)
                     /locus_tag="TRUGW13939_05159"
                     /db_xref="GeneID:55992657"
     mRNA            complement(<874211..>877573)
                     /locus_tag="TRUGW13939_05159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488324.1"
                     /db_xref="GeneID:55992657"
     CDS             complement(874211..877573)
                     /locus_tag="TRUGW13939_05159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344217.1"
                     /db_xref="GeneID:55992657"
                     /translation="MLPKALAASLVSALLLTPTHGYIPTKRSHTPSQSSSASVRPSST
                     AVPGTQTGTATSTGISTGTTGTGSTSVIPSVSTRTGSTRPSSTPGIPSATTGTTTGTT
                     TGTTTGTTTGTTTGTDTGPDTTGTGTNTGSTRPSSTPVVSLTTTGTGTGTGTGVNTGT
                     ATGTATGTGTGTGTATGTGTGTGTGTGTGTGTGTGTTTTTATGTGTDTTTGTGTGTGT
                     GTETGTGTGTGTGTTGTTAVTTGTTGTGTTTGITGTTTGTTTGTTTAPTTAITTPAYL
                     LSSFIISDSITVPAQTSTASGTFSTTTLSATGPPNSYSATTTTGSDHHPTILPVWFNS
                     KGHPVIVFPLSLSGPPGIIPPPPGFPTLDIGPDGNPTPDPNNKPSNSPTDTQPSQTDT
                     QTTKFTGTTTGTTTTTGTTTTGTTTTASTTTSTSTSGSTTYLIVPTDSASSSDRDSFQ
                     STLEDQVGKSNVQASADDENGVGFWRAPLNSTQVEDFSGNSIISYIAPDTLLPVDDFT
                     DPTPDDDDDDSDVSARAVGGSHGYFLNKKKKRAEPHYEELSPIEERAAVPLAKRATPT
                     QQANAVQDLVVVSQAKNTIIELLPDIYQYDPTAGKGITVYIVDSGATTSNSEYSGMPG
                     SKRWLYPGFGSTPDHDQDDKIGHGTCVLSKAAGPEYGVAKNVDVVVVKIQADTSNGFR
                     IPSSSFMDALLEIRTDISDKKLQGKAVINFSFGIELEDSDKNKDTIKRLLQEINGMDV
                     PMTVASGNSARESNRKNVDRYPGLFANDIDGLIVVGAVDNVGNTATFSQGGSLLHVSA
                     PGNKITCADSTGGSKIGSGTSYAAPQVAGLIAYFMSLPGNGLGSIGSGQIPGNVKKLL
                     INSASYPRKSGGDNVIWNMQSVDCGSGTNKRDGSGSCSITTSISGVTETTTATSTGST
                     QTSTGTTSVSTSVSTSASTGVSSTSLPTVISTTLATTTSQPPTTTAATTTTASATSLP
                     ASLTCVSSDDPSVPTGLPQSTMQKDVDNFCKSIDEDYSSHVDCDNKNHGGYMLADSSV
                     CDLTIYSLSLQYYETGATLWFNISLAEGSAYVINSTLCSTAMNEVLNGCPPFEADSSG
                     NLIKYGGSVLLNNGTGGAAEYAMVLESTEAIS"
     gene            complement(<878304..>879836)
                     /locus_tag="TRUGW13939_05160"
                     /db_xref="GeneID:55992658"
     mRNA            complement(join(<878304..878417,878478..879362,
                     879420..>879836))
                     /locus_tag="TRUGW13939_05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488325.1"
                     /db_xref="GeneID:55992658"
     CDS             complement(join(878304..878417,878478..879362,
                     879420..879836))
                     /locus_tag="TRUGW13939_05160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344218.1"
                     /db_xref="GeneID:55992658"
                     /translation="MSLETLRTISPTTNKPVVTRPGVSSEELALLPETAQAAFQSFSK
                     NTTLAQRQEIVARALGILAQKKDALGRELTEQMGRPTSYTGVEIATAVKRGEFLNRAS
                     NAVLGEEGTVDGEAEKGFKRYIQRKPVGAVLIIFAWNYPYLVLVNSLIPAILAGNAVI
                     LKPSPQTPTVAEQIALAFTEAGLPKNVIQYFHCGSLVQLQTLIKSPQINHICFTGSVA
                     GGLAVQQAASDRVVNVGLELGGKDPAYVRGDVDAAWAAEEIVDGAIFNSGQSCCAIER
                     VYVHESIHDAFVAEVKKVLSKYRVGDPFKAETQIGPVISKRSKETFEAHVADALSKGA
                     KDETPENESFKTFPRDGNFVKPTLLTGVTHDMDVMKDETFGPVIPVMKVKGDIEAIKL
                     MNDSEFGLTASVWTKDIAAAEKIIEEVEAGTVFINRADYPSPDLAWTGWKNSGRGVTL
                     SKFGFDQFVKLKSYHIKDYPK"
     gene            <881271..>885769
                     /locus_tag="TRUGW13939_05161"
                     /db_xref="GeneID:55992659"
     mRNA            join(<881271..882198,882288..>885769)
                     /locus_tag="TRUGW13939_05161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488326.1"
                     /db_xref="GeneID:55992659"
     CDS             join(881271..882198,882288..885769)
                     /locus_tag="TRUGW13939_05161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344219.1"
                     /db_xref="GeneID:55992659"
                     /translation="MAHSTLSHDDYTVAWICALPIEMAAAKVMLDEIHHDRIENQPPT
                     DHNTYTLGKLHGHDVVIAGLPLGIYGTTSATAVLTQMRPTFPSLRFALMVGIGGGVPG
                     KADVRLGDVVVSKPTASGSGVIQYDYGKTMRNGCFLPTGFLDKPPRFLLTAMTKIESN
                     HMMGERPIKQIIVDVLEKKKDMRDKFSRPSDDWLFSATYPHQNDDHDCSTCDLNQLID
                     RPGRATNEPYIHYGLIASGNQVMKDAQTRDQIAQDPIILCFEMEAAGLMDQIGCLVIR
                     GICDYCDSHKQKQWQGYASLAAAAYAKLLLSVVGTEFSSEENACLGSLSKINPIEYRN
                     KPKWIKYRAQGTFEWIIETPELRTWLGSQEVSTEVHSNILWLYGYPGTGKSTMAITII
                     EKVLNHPLFVNRDATLSYFFCNSSSQEYRTSIAILGGLLYQIAEQLPQSMKHLLPIFQ
                     ERKENPFDSFDILWNILIDISRVNATCQFYCVIDALDECDQESQKTLLTQIKQTFAND
                     NNSMNIHFLITSRPHPEIRDYLCWFKSKELSTYQEVGNDLRILIRQKVNELSQTKQYP
                     ENVKRKVSEILQEKAEGTFLWVGIVCDDLTSESARNAITKLQSLPRGLDSLYSRLLET
                     ALAKAEKEKHNLILQILSVVTVSRRPLNVAELSIACGLCENEGGENLLISLEVIDMCH
                     LMIVVKDDIVRLLHKSMKDFLLRVQGGNLINLSRENATLAYRCINYFLSNAQSINGMQ
                     NGKVNCGFLEYAVLYWPEHASAAQAEFDVQPAHTHFFQLVSKEREQWLEAYNSELKFS
                     STPKEFSVIHVAAAWNIPNLIDFSMVNISTIQKLKMLFWAYPGTGWYTRPWKGRHLHK
                     ALLNAQDGTGKSPLHWAIIKSHTHIIDVFLQQGADVDLRDNESKCALHFAAEIGDERL
                     VQILLRSPKNLEAKDNQGRTPLLIAVDNLQFEVIHRLVNAGAQVNALNNMNQNALHLI
                     CIKRQSSDSCNLLRYFIGHGISACECDIENMTPFLYAIGNGSEDLAAFLLENGVDVNF
                     QIHRKSWVGRTQNVFLYDEMDNDCEEISEGEQGSGLSALHFSALKGDVRMTEFLLHHR
                     ADPNTKSDAGDTPLHLAIRKELIGIKYQDPWVTDEYAVEMLRDIYEPDSDEATEINQQ
                     IDQARIDVVRVLLESSTVDVNIVNNRGDYPLHLIPYITKYGDIILEMLIYNKAIVSQL
                     NHKNQTCLHLASRAGNLKAIERLIRREECDFTLLDANGLSPLHHAVICDEPHIVRFML
                     DRFQDKEREFWKQLDHLGKNILHHHVQSLLCSRKMIDLLLEYGFPINDLDAEGDSILS
                     LYLSSPHLSVQADTFQYILRKTSTECIKRVDRKGRNLIHLSMRQRRVSNVTILEDLLK
                     SGIDINAKDVEGRGIMHHGAIHGAFNKALTQFLQARPIFKLHERDLHGKTPLEYAEEE
                     ANRERDGVDEDEIQWKQSLQNLRHAELFEIDHS"
     gene            complement(<886577..>887860)
                     /locus_tag="TRUGW13939_05162"
                     /db_xref="GeneID:55992660"
     mRNA            complement(join(<886577..886982,887045..887778,
                     887846..>887860))
                     /locus_tag="TRUGW13939_05162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488327.1"
                     /db_xref="GeneID:55992660"
     CDS             complement(join(886577..886982,887045..887778,
                     887846..887860))
                     /locus_tag="TRUGW13939_05162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344220.1"
                     /db_xref="GeneID:55992660"
                     /translation="MVAISCDEDHPCLNCLRRGMDCTFEHRSSATPPRVNEDFGILSD
                     IRGRMLDSSDAPCPRTLSEDPFRTFSDRLSGGTLFPQEWTAQDPELMHHYTIHTSKTF
                     ARRPQMQETWQVVIPEIAYSYEFLMHGILGLSALHLSYLKPERYSHYLAGAGFHMSLG
                     LRSYRRILLSPSRDNSCALFCFSSLLMVYIHASPTDPPESHSANGLDSIVELLGLCRG
                     TLVLLPYFDRIRTSPLKQLFLREFMVEDANETTNQTTFFKDYGSHLAALQTLITSKIP
                     NATERPTFLQALDRLKASFTCIENASPPLECGMLYVWPLSVEEQYFEFLRQRHPVALV
                     LLAFYCAQLRAFEDYWFVGRQGAVWLEHVEAVLEGRLNEWLLWPRGVFSD"
     gene            complement(<888585..>889568)
                     /locus_tag="TRUGW13939_05163"
                     /db_xref="GeneID:55992661"
     mRNA            complement(join(<888585..889042,889099..889341,
                     889403..>889568))
                     /locus_tag="TRUGW13939_05163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488328.1"
                     /db_xref="GeneID:55992661"
     CDS             complement(join(888585..889042,889099..889341,
                     889403..889568))
                     /locus_tag="TRUGW13939_05163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344221.1"
                     /db_xref="GeneID:55992661"
                     /translation="MAEQGVIDFKLYRYTPNSAAAGLFVALFLLTTIYHVYQVWRGRA
                     WYFMAFVIGGIFQIIGYVCRILAHNNKDSVPIYSIQTILILLAPPLYAASIYMVLGRL
                     IVFLHAERLSVVSVRWMTKIFVIGDVIGFVAQAAGGGIMASGTIENYKLGEDVTVGGL
                     AVQLAFFSVFIVTCVIFHCRIRQSPTHEVTVLSARLREQKRRGWETVLVGLYAASVLI
                     LVRSIFRIIEYVQGNNGFLISHEVFMYVFDSALMFITMFVMNVCHPSMILVGSQKERD
                     AELRAFESDDQS"
     gene            <889857..>890892
                     /locus_tag="TRUGW13939_05164"
                     /db_xref="GeneID:55992662"
     mRNA            join(<889857..890019,890076..890098,890148..890373,
                     890438..>890892)
                     /locus_tag="TRUGW13939_05164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488329.1"
                     /db_xref="GeneID:55992662"
     CDS             join(889857..890019,890076..890098,890148..890373,
                     890438..890892)
                     /locus_tag="TRUGW13939_05164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344222.1"
                     /db_xref="GeneID:55992662"
                     /translation="MATDHSDFKLYRYDPSIGAAVVFIILFIIASGIHTYQAARTRAW
                     FLIPFVVGGHFEWIGYIGRAISGTEAPDFTTNPYILQTLLLLIAPTLYAATIYMELGR
                     IVVLTDGEAHCFIRRRWLTKLFLIGDIISFIMQGGGGGIMASGNLSALKTGENIIIGG
                     LVIQLIFFSLFVTTSIKFHLGLRSSPSRKLLHSQPPWERHMYALYGGSALIFIRSLFR
                     LIEYAQGNDGYLVSHEVYMYIFDAVPMILIMAVFAWVHPSEVNALLKPGGRGRAAERV
                     FWLKMEGGESLL"
     gene            complement(<892957..>893665)
                     /locus_tag="TRUGW13939_05165"
                     /db_xref="GeneID:55992663"
     mRNA            complement(join(<892957..893530,893631..>893665))
                     /locus_tag="TRUGW13939_05165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488330.1"
                     /db_xref="GeneID:55992663"
     CDS             complement(join(892957..893530,893631..893665))
                     /locus_tag="TRUGW13939_05165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344223.1"
                     /db_xref="GeneID:55992663"
                     /translation="MFRIGRGTSCDACNTSNEQHLKRHREIAAMIRELDQRTVSDEEI
                     YEAIHGYSEDLVDEDTNFMKRRTVRDLKLEQGIRLNQGKSTSQKKGIGGILNNLGIEK
                     SVVTSPKKGATLISRLENAIVQDITISANESRGILKRQLGYYRYADWKAFQDMFQSLS
                     LESKASSNDSEQFGNAGLFHSISVGIDKPPKDQTEWKSGKKK"
     gene            <894549..>895766
                     /locus_tag="TRUGW13939_05166"
                     /db_xref="GeneID:55992664"
     mRNA            join(<894549..894737,894798..895015,895085..>895766)
                     /locus_tag="TRUGW13939_05166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488331.1"
                     /db_xref="GeneID:55992664"
     CDS             join(894549..894737,894798..895015,895085..895766)
                     /locus_tag="TRUGW13939_05166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344224.1"
                     /db_xref="GeneID:55992664"
                     /translation="MVNPLIAVPAVTGLAYRAYSRKSLTPVGSLVALVSAAVHTIHPW
                     LTPFVLLAVFYFSGSRATKVKHDIKAQLTLSASGAAGGEGARTHVQVLANSVVASILT
                     LLHTYYLWKQERYSTACFAQGADIGDIFVVGLVANYAAVAADTFSSELGILSKSKPRL
                     ITSPTLRVVPPGTNGGVTLAGLLAGVLGAFIVALASTLVLPFCQQDWSPIQRIQWLVG
                     ITIWGTCGSILDSLLGGLLQASVVDKRSGKVVEGSGGGKVLVQPSSTSTTSTAISEEA
                     KYNSSLHATESVASTATGTRVTRSSAKAKSATAGPVPEQATRKIDTGRDILDNNAVNL
                     LMAAIMSVGAMLVASYLWDVPLSVDGIL"
     gene            <898098..>898514
                     /locus_tag="TRUGW13939_05167"
                     /db_xref="GeneID:55992665"
     mRNA            join(<898098..898187,898256..898311,898370..>898514)
                     /locus_tag="TRUGW13939_05167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488332.1"
                     /db_xref="GeneID:55992665"
     CDS             join(898098..898187,898256..898311,898370..898514)
                     /locus_tag="TRUGW13939_05167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344225.1"
                     /db_xref="GeneID:55992665"
                     /translation="MKICGCFSPVSQRVKALFQRREEPERILEIGPPTNFRREEFTIP
                     LSDEDTLNRHDSHGVIAEKEAAQSSIVDRKTSTSTRDQLRAKIFKLGSRLAV"
     gene            complement(<898615..>900962)
                     /locus_tag="TRUGW13939_05168"
                     /db_xref="GeneID:55992666"
     mRNA            complement(join(<898615..899677,899733..899778,
                     899854..900061,900478..900588,900676..900823,
                     900922..>900962))
                     /locus_tag="TRUGW13939_05168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488333.1"
                     /db_xref="GeneID:55992666"
     CDS             complement(join(898615..899677,899733..899778,
                     899854..900061,900478..900588,900676..900823,
                     900922..900962))
                     /locus_tag="TRUGW13939_05168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344226.1"
                     /db_xref="GeneID:55992666"
                     /translation="MSAQSYYELYRGSSLGLSLTDTLDDLINDGRIEPQLAMKILSNY
                     DRVVTEVLAEKVRARLTFKGHLDTYRFCDEVWTFLIKDVTFKLDTQQTVQADRVKIKP
                     SSMPRSLPWLTNTSTKPEKHSNQDSASPTPRARRASPPRTPRRGNGNNDDQAAAAWET
                     PRHIDVLRSSRSPPTSPIQAIPAEEYIIEGFDNDDMYIMVEDEFYAVAQLFTRHLHQA
                     EYVRRKKEAKKQSALVINNLSRPTDGHTAMRRETLKRKESERLQELQQSALVSPRPRP
                     GTESDPDAEEEDVDDLDEDRRDDPWYGTSLHTLMTSPRKHRSLVGLDAIRSNTRAAAG
                     YRPEVARQQRIQSVVSRDTPAAVSVASVSAATANPVGAASSEDDDDDDDDLEIIESRS
                     SRPVTLPQSSVRTRPPVIKAESPEADIKPSIRQHTTSDGHVSSTHSRQEQSERYQPRQ
                     SKQPDRSATSPSRNVLLGSQANSLRARKRALIDDLDDVAVKEEDQEEKVSIVDIIQGQ
                     PRKSLSSAAHHQNESTAKKSRLNNVPTFLV"
     gene            complement(<901522..>903385)
                     /locus_tag="TRUGW13939_05169"
                     /db_xref="GeneID:55992667"
     mRNA            complement(join(<901522..902749,902799..>903385))
                     /locus_tag="TRUGW13939_05169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488334.1"
                     /db_xref="GeneID:55992667"
     CDS             complement(join(901522..902749,902799..903385))
                     /locus_tag="TRUGW13939_05169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344227.1"
                     /db_xref="GeneID:55992667"
                     /translation="MSESVATEQAVVRDVDRHDEVDDDDVASDLEQPQPRATNVDPVE
                     EFIKPLVLEESRLYSLARRFSEVYRHLALTSDQQFLPTPVTKLPTGEEVGRYLAIDVG
                     GSNLRVAFIELLGEGADTDKSDTIRKAQRQRVRRTLEKAWPIQEHLKMDKADDLFSWI
                     GDCIAEVIADSLSSDATKGKIPEELEMGITFSFPIMQESVSEATLMPMGKGFAITSDL
                     NLRNILLAGYEKHTRRSEDDQPSSKRRKIFALPKLKIAAITNDTVATIISSAYCVKAL
                     PNSRVAMAIIVGTGCNATIPMALDDLHESKAKLVSSREPEATQTVVNTEITISGAAAP
                     LGELEITTKWDVELDRACARPGFQPLEYMTGGRYVGELVRIVLFDYLTNVVGVSKREL
                     PATLVHEYALSTTFLSDKVARIRSDQELATELTRSLPPPESSDWSWDKATAAAFRRIA
                     RAVQTRSAGLIASAVVGLLACTREIQLKDDSSRNTPQPTSANDSKEGNNIQPENIATV
                     ADEKLARNASNRGLIVPVLAPAPADWQSGPEELVVAYTGGIIQNYPNFKETCQSYVDR
                     LIMRTGPQKSGRSVFLREASDGGVIGAGVLAGMVAHQV"
     gene            <905481..>906463
                     /locus_tag="TRUGW13939_05170"
                     /db_xref="GeneID:55992668"
     mRNA            join(<905481..905893,905956..>906463)
                     /locus_tag="TRUGW13939_05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488335.1"
                     /db_xref="GeneID:55992668"
     CDS             join(905481..905893,905956..906463)
                     /locus_tag="TRUGW13939_05170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344228.1"
                     /db_xref="GeneID:55992668"
                     /translation="MPPTTYEVYKELEREERFAPQAGSSQESSYNTWRERAIGRNLRR
                     GIALIIGCWLIYFLYLNRLYAASITQRFSNNKNGVSDYDATADAAVSGQTTRVALEAH
                     IMSKCPDAQDCLQKLVVPAMERISDKVDFELSFIGSVSEKTSDVECKHGPTECIGNIL
                     MLCAANLPFHSANSVVSSTPRTPVIRSLGFANCLISDYEQIPSRSLVESCSLEHGIDF
                     ESLNQCASHEDDNLDDPQDPITDDPSGISLLRQSVKHSEDVGVKTSCTVRVDEKVWCI
                     RDGGEWKDCYNGSGVTTLVEEVERLWEQRN"
     gene            <907140..>910563
                     /locus_tag="TRUGW13939_05171"
                     /db_xref="GeneID:55992669"
     mRNA            join(<907140..907551,907636..907979,908551..909061,
                     909127..909782,909837..909904,909954..>910563)
                     /locus_tag="TRUGW13939_05171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488336.1"
                     /db_xref="GeneID:55992669"
     CDS             join(907140..907551,907636..907979,908551..909061,
                     909127..909782,909837..909904,909954..910563)
                     /locus_tag="TRUGW13939_05171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344229.1"
                     /db_xref="GeneID:55992669"
                     /translation="MAGHTSQYRDTYGDKKRNRDDREKKVHELVDRYESLREPSAALR
                     HIHRDSDFCRLFCEIVEQQIKLIKSRRQEFDDGHITVFDKALKELSYNGSTASNLGVQ
                     ELYIREYIGINPDAPLPNIEETLAKTILIKGFLEKFSLPPLKKSSSPAETEPPRETSM
                     ANPPFSHTDTETYSIFNQDPIVKNEDPNCKNHAEALLKRYFDAKKDFYNLKSENYEEN
                     AVAAKYLRDSAENALIYLKKDDLGCDALLHELQTNQTFGDEKLLPRRWFPSLTAMASS
                     SSYLAPPARYGRQPADSASSDASDAGDTPSTSSSDPQFTPEASGTDEGSPSARPQLGS
                     PELPKLDTNLGKDVEPALSDETESFLSRDDDDNDDGYDSDKYFRPPPRQRKTSHDYTP
                     EEERGVVKRLDKRLVLFLAFLYMLSFLDRSNIGNAKIAGLSDDLKLSSSQYEWLLTAF
                     YITYISFEWMTLMYKVVPARIYIPLCVFAWGLFASCQALGSSFWAMMCLRALLGVSEA
                     AFGPGVPFYLSLFYKREELAYRTGLFISAAPLATSFASSLAWLIIKIGSNAPIAPWRL
                     LFLVEGFPSIVVAVFAWLLIPDSPGTAKFLTVRQRKIAKLRLQGTKLERHESSDEKFN
                     WKAVRAALSDPTSYLVSLMFLGCNIAFSSMPVFLPTIVKNMGYSSLASQALSAPPFLV
                     AFVTVLITASLSDKSRSRSPYLIFHALLSATAYLVIGLAGYFQSYLPNTLDTIIRYVC
                     IYPATCGFFSAITIIITWSMDNQVAHEGKGSSVALLNIVGQFGPLIGTRLYPDSDGPL
                     YVRGMLVCAISMLFVSCLALSLRVILARRNRRNNEQEDKMGIEMAEGEGLISSEGQAP
                     AQAQRFVYII"
     gene            complement(911145..911252)
                     /locus_tag="TRUGW13939_05172"
                     /db_xref="GeneID:55992670"
     tRNA            complement(911145..911252)
                     /locus_tag="TRUGW13939_05172"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:55992670"
     gene            complement(<911468..>913948)
                     /locus_tag="TRUGW13939_05173"
                     /db_xref="GeneID:55992671"
     mRNA            complement(<911468..>913948)
                     /locus_tag="TRUGW13939_05173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488337.1"
                     /db_xref="GeneID:55992671"
     CDS             complement(911468..913948)
                     /locus_tag="TRUGW13939_05173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344230.1"
                     /db_xref="GeneID:55992671"
                     /translation="MLHEILLSLSGQPSPLLDPELELNGASSRSFPLLSPPEKELLGS
                     LARLSRLHTLLRAHTARISSSHHSTICRAVSTAISTEHLRKFQNQILEVEKAVLGKDS
                     GYVGGYGIVPLSTIVLEFAPWTRRLEWLWEVAQLILPESASNDPASTNTCSGASLIDY
                     LRAESHTGYLDLQEIALQLIRAAEKAWMRQLSMWLLYGELPTSGKDDFFVQVAEAEFE
                     DDENGSVKGRVEFALHVELLPKFVSTATASSILFIGKSLNHIRSRRNRSTVDSASGSV
                     TGITLEADHITHLSSLSSPISTSALSSAVTAIRLSVSQTSLSKLLPLPKIVEMLSLIH
                     DFLLLKRGEFAMALVSNADARLATRNQRPGHGSGGGLDSMIIKEGEVSAVLAQTWTEL
                     YALQGEEAAVDEELDLARDLLSLSIQPNKKSGRTMTPSRDAVNTNMAAEISSVSFDDL
                     LLPTATFLSLKIQPPIDLFLSSSDMSIYTIIHSYLLGIRRAQIRLSNLWKHTAMRRIH
                     PTPWGPPRSNGRGGEFRLKAQRQRHNARTIQMRPIWATTSASIFVLSELGGYLQGEVI
                     QESWQHFQHWLEGEVTGLGTGSRPASRPVSRPGTASAAKHASHKPGLRQLISQQGQPL
                     LSQPQPQPQPQQQQQQQQQQQQQHHDPESITVAHRRYLSSLVQFLFLTEVPFTSALRS
                     FLTSIDHLVATISRLETVQRNLDLEADEGVVDALADYAQEEHSLWSELRDARESAETG
                     IKEIVSRLRDIDDSRSGEGRKMFDLSSSATATATTTTTAGSAEARDEYIPRKAAGVDR
                     LLMKLDFAGLNYSGNGNGEEDLVDDDND"
     gene            <914935..>919949
                     /locus_tag="TRUGW13939_05174"
                     /db_xref="GeneID:55992672"
     mRNA            join(<914935..915023,915080..915165,915217..918001,
                     918063..918183,918751..918919,918987..919073,
                     919134..919312,919371..>919949)
                     /locus_tag="TRUGW13939_05174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488338.1"
                     /db_xref="GeneID:55992672"
     CDS             join(<914935..915023,915080..915165,915217..918001,
                     918063..918183,918751..918919,918987..919073,
                     919134..919312,919371..919949)
                     /locus_tag="TRUGW13939_05174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344231.1"
                     /db_xref="GeneID:55992672"
                     /translation="DAKMQLDNAQETVELIKHGEIDESLYSRQLYVLGHEAMKRMGSS
                     NVLVAGLKGLGVEIAKNIALAGVKSLTLFDPNPVAIADLSSQFFLQPQDVGKRRVDVT
                     APRVSELNSYVPISPFESDSLTADLSQLKRFQVVVLTNTPLKDQLVIAEFCHNNGIYV
                     VVADTFGLFGYIFNDFGKNFTVGDASGEDPVSGIVADIDDTGLVSALDESRHGLEDGD
                     YVTFTEIKGMEGLNNADPRKVTVKGPYSFSIGDVSGLGKYQGGGLFNQVKMPKFLDFQ
                     PLQEQIKKPELLISDFAKFDRPQQLHVGVQALHHFAEAHGGQFPRPHHEADADEVLKI
                     AKDLAGQGEETVELDDKLIKELSYQAQGDLNPLAAFFGGLAAQEVLKGVSGKFHPVVQ
                     WLYFDSLESLPESVTRSEETCKPLGTRYDGQIAVFGKEFQDKISNLNTFLVGAGAIGC
                     EMLKNWAMIGLGVGPKGQIRVTDMDQIEKSNLNRQFLFRPKDVGKLKSDCASAAVQTM
                     NPELNNKIITLRDRVGADTEHIFNEDFWDGLDLVTNALDNVDARTYVDRRCVFFRKPL
                     LESGTLGTKGNTQVVLPHITESYSSSQDPPEKSFPMCTLKSFPNRIEHTIAWARDLFQ
                     TYFVGPPEAVNRYLSETNYIEQTLKQAGNEKQTLEHLRDFLVTDKPLSFDDCIVWARN
                     QFESQYNNAIQQLLYNFPRDSTTSSGQLFWSGPKRAPTPLKFDSSSATHLSFIIAAAN
                     LHAFNYGIKAPTNDKDYVRKVVDNMIIPEFTPSSSVKIQADDNEPDPNAQPSGSSLND
                     GEEIQNLVDSLPLPKSLAGFRLVPVEFEKDDDTNFHIDFITAASNLRAENYEIPQADR
                     HKTKFIAGKIIPAIATTTALVTGLVVLELYKIIDGKKDIEQYKNGFINLALPFFGFSE
                     PIASPKGTYQGKNGEITIDKLWDRFEVDDIPLQDFLKHFSDLGLDVTMVSSGVSLLYA
                     SFYPPSKLKDRLPLKMTKLIEHISKKPVPEHQKNVIFEVTAEDQTEEDVEIPYVMTGN
                     KRSITDWVARNDKSGEFKRGASQFRNFISREPGAEFPPEKGRYHLYVSYACPWAHRTL
                     ITRKLKGLEDFIAVTSVHWQMGEKGWRFVTADENLPGEDVHPDPLHPGYTHLRDIYFA
                     VDPEYTGRFTVPTLYDTKSKRIVSNESSEIIRMFYYEFDSLLPEKYQKLDLFPAALRS
                     EIEASNDWIYNDVNNGVYKSGFATTQEAYEKAVTALFAALDKIETHLASRAASSSSPT
                     YFSDGITEADIRLFTTIIRFDAVYVQHFKTNLRDIRSGYPAIHKWLRHLYWDVPAFRE
                     TTQFEHIKKHYTKSHTHINQFGITPLGPVPDILPKDKEVNAVGK"
     gene            complement(<920450..>922613)
                     /locus_tag="TRUGW13939_05175"
                     /db_xref="GeneID:55992673"
     mRNA            complement(join(<920450..920969,921018..921154,
                     921208..921269,921316..921944,922032..922239,
                     922299..922379,922496..>922613))
                     /locus_tag="TRUGW13939_05175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488339.1"
                     /db_xref="GeneID:55992673"
     CDS             complement(join(920450..920969,921018..921154,
                     921208..921269,921316..921944,922032..922239,
                     922299..922379,922496..922613))
                     /locus_tag="TRUGW13939_05175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344232.1"
                     /db_xref="GeneID:55992673"
                     /translation="MGPVETPERVDKLWETIDTRKQGYVDYNGLKRGLKKMDHPLKNA
                     DSMLHQVFKTVDTSGDGRIQYNEFRDFVYHADDALWELFQSIDRDHNGQLDRNELKEA
                     FSKAGITVSNSTLDEFLEQMDQNNDGVISYTEWRDFLLFLPTDTASLRTVLSYYTATG
                     NLNPEGDVDINETLQGLGTEIPTLYHFLHSLANILYHLCQASISRLSAAPFNLVAVAY
                     AETSSAEPASDPELLVLDADLELEWLPVPQTVAMWMSVHSFELKLTDLFPHLGYFIAG
                     GVAGAVSRTATAPLDRLKVYLIAQTGVREEAVRAAKKGAPLSAVGRGLKSLADATQEL
                     WRAGGIRSLFAGNGLNVVKIMPESAIKFGAYESSKRAFARLEGHNDPKQIRPTSQFLS
                     GGLGGMVAQCFVYPVDTLKFRMQCEIVEGGIQGNKLIAETARKMWQSTGGLAFFRGLP
                     LGLIGMFPYAAIDLSTFEYLKSRLLARKARLNKCHEDDVPLSNFATGAIGAFSGALGA
                     SFVYPLNVLRTRLQAQGTVLHPATYDGILDVVRTTYRTEGLRGFYKGITPNMLKVAPA
                     VSISYVVYENSKRALDLK"
     gene            <923161..>924181
                     /locus_tag="TRUGW13939_05176"
                     /db_xref="GeneID:55992674"
     mRNA            join(<923161..923320,923372..923585,923626..>924181)
                     /locus_tag="TRUGW13939_05176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488340.1"
                     /db_xref="GeneID:55992674"
     CDS             join(923161..923320,923372..923585,923626..924181)
                     /locus_tag="TRUGW13939_05176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344233.1"
                     /db_xref="GeneID:55992674"
                     /translation="MAANYWVSTQRRHWMFTRERLAEIRESLWARDKDSSHQVQLPDM
                     RIINIYFKDQICRLAKRMNSRQQAVATAQVYIKRFYTKVDFRQTNPYLVMVTAFYLAC
                     KMEECPQHIRFIAAEARQFWPGKRSEFVANDPAKIGECEFYLISEMSSQLIVHHPYRT
                     VSELSTELELSVDEANQASNLISDHYQTDLPLLYPPHVIGVTAVLLAVLFSNSQRGSH
                     MSMNPSIATSLREGGMGAAMSALGADRQGTGRPDPRIQKVVNWLAESEVDIRAVIECT
                     QEMVSLYELMEGFNLQQVKEVITRMMKTKSMDK"
     gene            <925899..>926614
                     /locus_tag="TRUGW13939_05177"
                     /db_xref="GeneID:55992675"
     mRNA            join(<925899..926195,926291..>926614)
                     /locus_tag="TRUGW13939_05177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488341.1"
                     /db_xref="GeneID:55992675"
     CDS             join(925899..926195,926291..926614)
                     /locus_tag="TRUGW13939_05177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344234.1"
                     /db_xref="GeneID:55992675"
                     /translation="MASTYFYGHHQQHHQQQHHHQQSHAVNAHLQSNNHHGGRRRAPR
                     VASQNAQRQFRGVKSMRELAEAPTVTAFRLRFEAGRSFDLDDDLEFCPNLLTEDDLHS
                     IHSSVSDRSSLSSGSPDSSPLQHQIQPAQQVTPSISLSPGPSTSYVNNVAAATMSNNI
                     NAMHFQQPAAARARKVIPIINPQTGTTMSSPPTSINPGMVQAQRRW"
     gene            <927973..>928401
                     /locus_tag="TRUGW13939_05178"
                     /db_xref="GeneID:55992676"
     mRNA            join(<927973..928099,928184..>928401)
                     /locus_tag="TRUGW13939_05178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488342.1"
                     /db_xref="GeneID:55992676"
     CDS             join(927973..928099,928184..928401)
                     /locus_tag="TRUGW13939_05178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344235.1"
                     /db_xref="GeneID:55992676"
                     /translation="MPSLSLTRTLLRPLATSSSSTCSSSISFSTSSIRQALKEGDANR
                     DKEHISQEYESVKNENLRNAKEGKGGWKNELASESEASVKADRGETGININLQEEIKV
                     KEKKTEVNKGGK"
     gene            complement(<928669..>929457)
                     /locus_tag="TRUGW13939_05179"
                     /db_xref="GeneID:55992677"
     mRNA            complement(<928669..>929457)
                     /locus_tag="TRUGW13939_05179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488343.1"
                     /db_xref="GeneID:55992677"
     CDS             complement(928669..929457)
                     /locus_tag="TRUGW13939_05179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344236.1"
                     /db_xref="GeneID:55992677"
                     /translation="MTNPSQLFLLADHIKLSLLERQRAISLDLEPNTQDGEISRSLES
                     LRDGLEGLENDSNLDADAQDQVTNLRNQYGDLASQFYGEDRPTDTTRVPNDPLLAPDF
                     AHATRGTNLQQPVPQHPVSKSVRFTDADPVDEEHEANRAALLRPYRDEPSPDQGLDAS
                     GLSNQQIHEHHQQVLREQDTHLDSLGESIGRQHQLSIQIGDELEGQVALLDDVDNNVD
                     RHQGRIDTARRRLDKIRRKAGDNWSLMTIVGLIIILVILIVILK"
     gene            <930206..>931631
                     /locus_tag="TRUGW13939_05180"
                     /db_xref="GeneID:55992678"
     mRNA            join(<930206..930745,930807..>931631)
                     /locus_tag="TRUGW13939_05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488344.1"
                     /db_xref="GeneID:55992678"
     CDS             join(930206..930745,930807..931631)
                     /locus_tag="TRUGW13939_05180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344237.1"
                     /db_xref="GeneID:55992678"
                     /translation="MASMDIGELVSLMDLNGGAEEVVDLRALDYVSKYDEHLMCPICH
                     CPFIRPLRLRCDHVFCQKCLNEAITSTTSDPHSFRCPSCRSHAREIFGNVPRLLINMC
                     DDIRVRCPYSDEGCKEIMPRGHVQLHVDKYCDSKLMDCPVSTCTQQTRKKNLSADGKC
                     MHTVLKCEACDEDIVEQDLEEHQNEHCPSLRTNCPDCDALLFVSALEEHVDTCPEAIH
                     ECQASKYGCSARLKRSELTVHERSCPLITMGPYIEAQNSRIDSLDMTIRQLRQRNEIL
                     EDGISNIRSTLVESTQLTPESRQSPSGNESHPHPESGEAEQGDRSSNLSSTTTMTYLL
                     SLHESLREEVSRLSHAITDLDARASMAILNESMRIKEDMAHTSAAINTIRMQIHWLLN
                     PRLQQGHRFASAAGSSSSTTSTGQGAGTAAGPSSGPASRFAYNTEGIPPRRLSDSGRE
                     GTKL"
     gene            <932178..>933432
                     /locus_tag="TRUGW13939_05181"
                     /db_xref="GeneID:55992679"
     mRNA            join(<932178..932237,932300..932317,932410..932954,
                     933006..>933432)
                     /locus_tag="TRUGW13939_05181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488345.1"
                     /db_xref="GeneID:55992679"
     CDS             join(932178..932237,932300..932317,932410..932954,
                     933006..933432)
                     /locus_tag="TRUGW13939_05181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344238.1"
                     /db_xref="GeneID:55992679"
                     /translation="MPPKKGADQPKKKKATVDDKTFGMKNKKGGAAKKQIAQLEAQTK
                     GSKNADEKKREAEKAKREAEKAAAEQAKREAAELFKPVQVQKVPFGVDPKTIVCQFFK
                     KGHCEKGRKCKFSHDLSIERKAAKRDLYSDTRDTEGTETKDKDTMDQWDEEKLRDVVM
                     SKHGNPRTTTDKVCKFFIEAVENQKYGWFWTCPNGGDKCMYRHALPPGFILKTKEQRA
                     AEKALMDKSPLNTLTLEDFLESERHKLTGTLTPVTPDSFAEWKKKRLDKKAAEEEARK
                     AKEHTGRMLFESGNWRGSEEGDEEESEEEDGQGVWNLEALRKETERLRQLKEEDRLAK
                     LHGEPVSEVLANGDG"
     gene            complement(<933777..>936263)
                     /locus_tag="TRUGW13939_05182"
                     /db_xref="GeneID:55992680"
     mRNA            complement(join(<933777..934243,934309..934925,
                     935344..935414,935486..935694,935753..936146,
                     936213..>936263))
                     /locus_tag="TRUGW13939_05182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488346.1"
                     /db_xref="GeneID:55992680"
     CDS             complement(join(933777..934243,934309..934925,
                     935344..935414,935486..935694,935753..936146,
                     936213..936263))
                     /locus_tag="TRUGW13939_05182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344239.1"
                     /db_xref="GeneID:55992680"
                     /translation="MSASKGFAVIAGVGPGTGASIARKFAKAYPVVLLARNPANYEGV
                     VSEINSSGGKAVGISTDVADAASVSNAFKKITSELFPNTPLAAAIFNPGGGFARKPFL
                     ELTEAEYTNSIDIQAKGGFLFSQASLPLLLKGVEEKSEHPPSLIFTGATASVRGSANF
                     AGFASGKFALRALSQSLAREFGPKGVHVSHIIVDGIIDIPRLKHYQLEHEDAKLSPDS
                     IADSYWFLHTQPRTTFAFELDLRPAGVIGLSTALRLQSSLLPSQRILIIARNLPHTES
                     VDYASPWAGAHYRPVPGSSAQVQKESQWARHTYQTFQRIASEDVSSGVKFMPGIEHFE
                     SPTPEYVDAALDVNSSVYAHLGPSFRNIPQRELQVDSNLKLGIEYWTYCVNTPLYLGW
                     LLRRFVLGGGQVRQHALSSLDEAFVVGASDGDGIVKTVVNCSGTGFNDEKSFIIRGQT
                     CLVRNQIPYTLTRHNADGTWSFAIPRPLSGGTIIGGTKQPNDWNPYALPEIRETLLRK
                     AAKWFPFSGSEKAEFSVIRDVVGRRPAREGGVRIEVERVDVVAADTLDGQKRERKNVV
                     HAYGLGGRGVELSWGVAEEVRGLMLQERLIVERASL"
     gene            complement(<937125..>940466)
                     /locus_tag="TRUGW13939_05183"
                     /db_xref="GeneID:55992681"
     mRNA            complement(join(<937125..938622,938692..>940466))
                     /locus_tag="TRUGW13939_05183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488347.1"
                     /db_xref="GeneID:55992681"
     CDS             complement(join(937125..938622,938692..940466))
                     /locus_tag="TRUGW13939_05183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344240.1"
                     /db_xref="GeneID:55992681"
                     /translation="MAFLKLCCNRDAPEDEPSQPPRPQQNNQVESKPQSQSAPVPKPP
                     APTEDVKPSTVVPNGAAVTPLAPTPSLAGEIWDRAYNNLRDGDETESKLVQEYEKILT
                     RELKDDDDGSGTASASLEGVENAIEQHNPDKRRAQMRGIIDAGLKKTEKQANAKSVMG
                     TILGGIAPVTDIIAEAISASPQAALPWAVVTTTLKLLDNPVAESAAQRTGAAYVTKRM
                     SWYWSLCGVLLKKDNALDGGPSEGMRDMLEADLVELYQQLLLFQMRTALACYGNQTLN
                     FLKDLIKGSDWQGSLTDIQDAEKTFRENSQVYDTQKITASFDKALQLQESQLRKKFRQ
                     EKKYLLNWITTIDYGPRQSDHFDKRNEGTGLWLMESDEFKTWQRENGKALIYHGIPGA
                     GKTILTSVVVEEMSTKYYTDDTVGIAYLYCQFDQQDLRPIDLFLSLLKQLTEGLRFIP
                     AHLEELHDRRSGNERPTFADVLKALRSTISEYSKVFIFIDALDECPVTNGNRRDFLLS
                     GLLPNLFTLQTECGANIFATSREVPEIIEMFDREACTRLPIRASDDDIRIFLDTQMRS
                     LHPLVLERPDLQEQIKSRIVEAAQGMFLLAKLHLDSLKGLSSPKKIRTTLDKLPSGLK
                     QLDDVYEGALTRIDNQTTDDQALAKRALAWITFSRRQLTQSELDHAVAVENGSTEFDK
                     ENLSGISYISSVCAGLVTIDESSDQVRLVHYTTYDFLIRFLPPWYPAGNKGVARSCVT
                     YLSFNKIVTEPANDCSKEEIWLGGLYQYSAQNWGYHARTSPIDGEDLVVDFLEDASKV
                     STCITRMSGKTAPLEVENIKKAAGIHVAAYWGLTESLRALYERLKKDPDLNTGAVLEA
                     PDVVDRTPLILAAENGQAEVVKLLIDMGVNKEAQDNDGRTALYAAAELGHENVVKLLL
                     ELGANKEGAYEYTPLGVAVEEGHWTVARILLDNGVNPEGTSGEYCKTALLSTASWGNA
                     DMVKQLLDKGANINAVEPDYSWTALTRAAENGNEAVVKVLLGYDALDIEAYDEYNHGS
                     ALFLAVANGHEAVAKLLLENGANWQAKNEDEETLLDIAVFNGNEEMVKRLLPKIDLDM
                     WH"
     gene            <943067..>944811
                     /locus_tag="TRUGW13939_05184"
                     /db_xref="GeneID:55992682"
     mRNA            join(<943067..944517,944577..>944811)
                     /locus_tag="TRUGW13939_05184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488348.1"
                     /db_xref="GeneID:55992682"
     CDS             join(943067..944517,944577..944811)
                     /locus_tag="TRUGW13939_05184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344241.1"
                     /db_xref="GeneID:55992682"
                     /translation="MVKSLFVPLALSLFAAFNLPYAAAAPAAASYAQKEGFESIPAGW
                     EQVSAASPSQVLNLHLYMTPADASALEELILNIATPGHLLYGQFLSPEKLKEHAAPSS
                     AASDAVISWLTEHNLASDAIQNDGSSLTVQLPVAQAEKMLQTQFHNYKSTATGEVRTL
                     TLAYSLPQSIVDFVETIQPTTDFTELPVDTRIQTMTHELNASAVNSVGDASGCGEYIT
                     PACLQSLYGLPTANANTPQGGIAVPGFLNEYASHSDLDQFLQELRPNFSPRPSFNVEY
                     LAGGKNDESNPGVEASLDVQYTAGLANGIQTNFISVGDASATGFNLVLHKLLRQQTPP
                     SVMSLSYGFDEGALSANLANNMCNLFGQLGARGVSILVASGDGGVAGSRPRTCSSFVP
                     TFPASCPYVTSVGATSGTKPEVGADLSAGGFSNVFQRPAYQGLAVTEYINRLGSQYNA
                     KFNTSGRAYPDVSAQGKSVYIVVKGKGLLVDGTSASAPIFASTIALLNAQRSPLPPLG
                     FLNPLLYLQSYALNDVASGSNPGCNTNGFPAGAGWDPVTGLGTPNYGLLRTLL"
     gene            complement(<944991..>946187)
                     /locus_tag="TRUGW13939_05185"
                     /db_xref="GeneID:55992683"
     mRNA            complement(<944991..>946187)
                     /locus_tag="TRUGW13939_05185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488349.1"
                     /db_xref="GeneID:55992683"
     CDS             complement(944991..946187)
                     /locus_tag="TRUGW13939_05185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344242.1"
                     /db_xref="GeneID:55992683"
                     /translation="MVLDDETLSQSPTNIETWDSPDPSSPQAALFPSKLDREYLRPPM
                     AFYLYTRFLTPQLWEHRVLERVSKHLEMAKGILRRNPSQDEINAFVEHTSREVNMRGL
                     GMPIGLSAGFIHTNLFLRKKLSIPRNVPVFQGIQQAMASVATADKRALVFQAAIRTSF
                     WVLLSMGNFQGFATYQFTLGLSSDERLGSFREAVKKYTNARLQRLEGNSEQARQRHEG
                     REAIRHNPPATAVAEEYPQPDYGRGRESTSSTSTSTSAPDNVWGGREQKQADFTDSFL
                     QDDRSSTDDASPIAFELQTQQNTNKSTNSWERIRQERSQQQPQMTANSPAMWRGRAFK
                     QVEQEQQSQNPTTDYATEEKSRQQERDAAQREFDQMMDAERQLSQGDSSGSSSGENSR
                     KAGRRW"
     gene            complement(<946886..>951788)
                     /locus_tag="TRUGW13939_05186"
                     /db_xref="GeneID:55992684"
     mRNA            complement(join(<946886..949980,950035..950804,
                     950857..951165,951218..951341,951398..>951788))
                     /locus_tag="TRUGW13939_05186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488350.1"
                     /db_xref="GeneID:55992684"
     CDS             complement(join(946886..949980,950035..950804,
                     950857..951165,951218..951341,951398..951788))
                     /locus_tag="TRUGW13939_05186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344243.1"
                     /db_xref="GeneID:55992684"
                     /translation="MADLSWHRSVPSSSQSAASAPPPEQTPWDSDFQPCASTASLFLF
                     AQGSVILCLHHDTLAVERRFSLHQDRIAFISVDNISERGAGRLVVSYDYAQTAIVWDL
                     FTGNEISRFASFEPLHVAAWMRNGNVAFGNGKGEVILFEPSTSEHISARTIFDPITAL
                     APSSDCRTYSIGYQNGSILIAHLHPIFTILHTLTTSRGPSPIICLAWHASSSKQRSDM
                     LATQTLDGDLRVWSVAKPPSKDSPRVIRALKRSEPYSTGPKWIAWSKNGKIIQYSDRE
                     TWVWDVRTKNVTYETIPTIEDVLGMANYGPTATLFSLGPNDTVQQYDVDNPTMVANVR
                     HLPPDRAPAVVEEPPLRSTSPAYFNQSNAIQSAHGFRGPEVSIHEVATQQRANMTSPM
                     SVRSRTNSISSRASSGRVRPFSPPVKSSYSGTTFSMTSPLGRQPSQAGTSIAYGSTAS
                     VVSSVRSRGGSRLRNEVTQSPADKPLEDLFPFTRARLNDVPYNQQAPPLDESRLTPDD
                     LRRQMLRVVFGWEGDIEDLIHDELNRHAPSSQNAIFLSRWLGDHDPMQIMNMLSSGPV
                     SSSAWMFLALSQMGGQEQSNKVGQTFVQRLLEVGDIHASATILLALGDKNDAIEVYVS
                     RSYFMEAILMTSLLLPGDWQRLSYLVRRWGEHVVSHSQQQLAIRCFMCTGAEPSEPWR
                     SPTAPIAPYHDLRVTSPVPEPQSQSQFEEQLKSDQANRMTVKNSSLKLITSFGSQPNE
                     FKFPGLKSDDRTPTNAPGITPIAESAVGESALSPGGLGSYRLNNIRNINQAMSARTAT
                     PGSMHRQRLPSIGETPVDVQPPSFPPRSLTAPPVESSSQRGNSNDSTAEESNEKDGDA
                     PVLLLSSARYEPRRDSHGPSPQTAVQTAPNNFQGIKGLPSPAAGIFDNFKEQSLARNS
                     SQSRKPEGLHIQWPPVDTSEPETGGYPSYSENTDNDGKSPASVFQSLRANKSPSISGR
                     SIDQYINSLDEANYYAKQFRRPHTKSNRHGESSGSEHQNISRNESVESRGRTNARYIT
                     PAKRSPSSPVPMSPEEFSKYNVSVESLGTEKPKQRSRSHHKGTSRGQRSTSRGTEKKH
                     KARSRNSSRRHSRGRSSDRNKSTLQSPTSPLPMSPSDEIRGFGDSLRFVTSDRERLQR
                     SQPRSSSRRADRATSARRDGSPDKRRPRARSSSRQARGAHPAPEPTPQVTPQHPPPEL
                     VEESQKTIPPSDTAPLSSVDRIRKEIAAAELEARRLSLARRPSAPNIPRPGEFKMLTT
                     TQSVGGKAPESPPSSGGSYGQRMRSKSNASKRSPELPNGSDSSSSSRGRSGSIGLPAT
                     PKAMRHPKYSDGYIDAEAPAVPGIPLTLPSTVYQAEAAKISRSMSVPVIDFQKPAPVD
                     IPHHPRYIPNLPRSRSTSRSRGPRGHNRNGSRELGSVPYGPPASVSVNVENEIGGDKA
                     KVPPPIIPELQHLNTPPPPPPIPGVAGSRMKEAGSITTVMDNSRAGYEISRPMTTGTD
                     SRHTRRMSADHRRGGSINESFATKFRNFTGRMRSNSRGPGVQSPPTESSDNTTVSPYE
                     SVRMPMENGF"
     gene            complement(<957207..>958351)
                     /locus_tag="TRUGW13939_05187"
                     /db_xref="GeneID:55992685"
     mRNA            complement(join(<957207..957870,957933..>958351))
                     /locus_tag="TRUGW13939_05187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488351.1"
                     /db_xref="GeneID:55992685"
     CDS             complement(join(957207..957870,957933..958351))
                     /locus_tag="TRUGW13939_05187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344244.1"
                     /db_xref="GeneID:55992685"
                     /translation="MAQSKSTFFVTETVTSYRPQTFDNVVTSFIPLPSAFTPDPHCYT
                     DGFHNNIAEQFDYVLVAFDPSYEYYAGSSSIACVPPEVSDWYLHRTVQTDTTATVQTT
                     TSLPTVRSLMPVTCPDGWYTAGTSTARPTIMQVTCCPSGYSVDPSQDHNIEANCDSTL
                     DPEQSIWYLPTTGEEMLQTAFTDTVHVVAVAVKGYMPLTTTTSAPFSGTSTVAPASSL
                     FTTTSTAVPTSLPSYLPSTPTKSNTPDSQTSSSSSSHTSGGTIAGSVIGSLAAVGLIG
                     LGAFMFFRRRKTRQTKENDNSAKNEEPIPPSTPTLYDYSVVSQSEPGDRSTILSEMPT
                     LSNTPELFSEHDPTSPRTKTESYELE"
     gene            <959259..>960314
                     /locus_tag="TRUGW13939_05188"
                     /db_xref="GeneID:55992686"
     mRNA            <959259..>960314
                     /locus_tag="TRUGW13939_05188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488352.1"
                     /db_xref="GeneID:55992686"
     CDS             959259..960314
                     /locus_tag="TRUGW13939_05188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344245.1"
                     /db_xref="GeneID:55992686"
                     /translation="MPKRTLDAFFKPAAQPPIPKKLKSSPDPSSPPPSKTKYATETIK
                     DASEEELPPESHPAYPFSIAKLPSHVSVGLSFATPAKQPRVINGQPHLNLLYYEPYIP
                     QPTAKEYFHFLRRELPFYRVRYTIKRGPTETVVNTPRYTTVFGVDITSYFSGIKGEGV
                     DKNNALLDSKTNQPIKPDKYKCTPRPIPGCLDLLRRRVEEALADGTTYNFVLVNYYSS
                     GDDSISYHSDDERFLGANPNIASLTLGAKRDFLMKHKPPPSAAKDTSLSGGDKPLKIP
                     LATGDMIVMRGETQANWLHSIPKRKGGETGQGRINITLRKAIVPGGTENYYRYNVGDG
                     GFYRWDDKGKEMVCQNV"
     gene            complement(<960480..>962474)
                     /locus_tag="TRUGW13939_05189"
                     /db_xref="GeneID:55992687"
     mRNA            complement(join(<960480..960612,960682..961536,
                     961604..962188,962248..>962474))
                     /locus_tag="TRUGW13939_05189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488353.1"
                     /db_xref="GeneID:55992687"
     CDS             complement(join(960480..960612,960682..961536,
                     961604..962188,962248..962474))
                     /locus_tag="TRUGW13939_05189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344246.1"
                     /db_xref="GeneID:55992687"
                     /translation="MMLLFSIFALCWASLFPAVAAAAVGDVALHTRDGDADTVDAVAK
                     ALRAARDSTYSMNQTSLAKSWANATLFSAGISGSRSAGQNGTLTADASIELICTACYI
                     NGSVKGSLTISDDFNLTQAIHNVEGEVENATISAVDTLGSYVETVLEDIATLDLAKIP
                     AWPTLDIDFNLANLSSLPSVNGRFEFDALELYLDLELKMNAGATYTLNLFTSETEAGF
                     SIPNLEAGAIFSVTLILISKAEVDISGGIHLKLDDGLALDLELFNQNTSGITLPGAQF
                     EFLPITIEGQGSIQALLQLETRLGFRVSSPELASLFSASTGVEANLFAYVADFLVEVD
                     GSSTDDCEIAAVAEYTLAVGGAAGATVAIDTYQWGPSPNTTTPIWYTTLASICANSKT
                     ASTTSTSATAVDVTARAALQPRDTPVTTTVSTTESYTIVNCLSTGLINCPINLQSTTT
                     VKQTLTSVLTVPSGSSATYPASTHASVTSAIAFGSNVFSIAPTSGTPTSYTPPKPTSS
                     SSGGTGGGSGSSDGGSGGGGGLSHRDKLIIGLTVGLGVPFLAIVIAGLWLIFKRKNSS
                     PVPQPETSVSNTSFPSSDIGNNKTPPLNTYPAT"
     gene            <963731..>965185
                     /locus_tag="TRUGW13939_05190"
                     /db_xref="GeneID:55992688"
     mRNA            join(<963731..963964,964038..964319,964382..964950,
                     965020..>965185)
                     /locus_tag="TRUGW13939_05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488354.1"
                     /db_xref="GeneID:55992688"
     CDS             join(963731..963964,964038..964319,964382..964950,
                     965020..965185)
                     /locus_tag="TRUGW13939_05190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344247.1"
                     /db_xref="GeneID:55992688"
                     /translation="MSTSRIIQLAQKISAQAAVLDSHLQSNGLPQPSFNEDGPTEAFK
                     EGTPDVQQAKSDVLEAMIELRQLIEGPMNNLLPPNNLSPLVAVYRFKLASLVPVGSTI
                     SFRDLAEKSGVREHDVKRIVRYTAVYHRVFHEPKKGFVAHTAASKLLAENPAASHLMG
                     LTFDECWPAHNRAVDAIAQGSEEPNVSGYALANNTSLNTFQFFSENPTRAERFAAAMA
                     TTSTASLEALSTHFAWSELSPNSTVVDLGGSRGHVSIYLAQKFAHLRFVVQDLPEVVK
                     GAADTLPEDVQGRIEFSAHDMFTNQPTQGADVYLLRYVLHDWPDKYCIDVLRKLIPSL
                     KAGAKVVIQDHLLPEPGTMTLRQEMNMRNMDAIMLSLFNSREREVEEWEELFNTADSR
                     FGGFTANRIGEHGSSGVISVEWTP"
     gene            <965717..>966364
                     /locus_tag="TRUGW13939_05191"
                     /db_xref="GeneID:55992689"
     mRNA            join(<965717..966067,966137..>966364)
                     /locus_tag="TRUGW13939_05191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488355.1"
                     /db_xref="GeneID:55992689"
     CDS             join(965717..966067,966137..966364)
                     /locus_tag="TRUGW13939_05191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344248.1"
                     /db_xref="GeneID:55992689"
                     /translation="MDSNRTALKPDMTDASVPTWQDAPATYEETSGRSIAEANEYSTE
                     IHIVDHLRDVLQETEQKISALRNRHAIWGYLNTALKPLRYLCSLAKLVTKLTQFTPAY
                     TVLSAVLYLLKAVEGPHSQTRINPNLEEILTKLIYVDLEIFAQAERPIKKRNIVEFMS
                     TAFLGKDLEVEYLLVKRNLILEELEAATSNAV"
     gene            complement(<967293..>967598)
                     /locus_tag="TRUGW13939_05192"
                     /db_xref="GeneID:55992690"
     mRNA            complement(<967293..>967598)
                     /locus_tag="TRUGW13939_05192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488356.1"
                     /db_xref="GeneID:55992690"
     CDS             complement(967293..967598)
                     /locus_tag="TRUGW13939_05192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344249.1"
                     /db_xref="GeneID:55992690"
                     /translation="MPSSKTDTAIRYPEEQNQHRRIRGVTQDRKWEARMREQAVSNPQ
                     FSNNAATWGPETLLDLKTDQSGNPQPDPAQYRDGNAAVKRGLASGDQDMVAAVNQVP"
     gene            <969243..>971301
                     /locus_tag="TRUGW13939_05193"
                     /db_xref="GeneID:55992691"
     mRNA            join(<969243..969246,969308..969637,969689..970086,
                     970149..971075,971146..>971301)
                     /locus_tag="TRUGW13939_05193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488357.1"
                     /db_xref="GeneID:55992691"
     CDS             join(969243..969246,969308..969637,969689..970086,
                     970149..971075,971146..971301)
                     /locus_tag="TRUGW13939_05193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344250.1"
                     /db_xref="GeneID:55992691"
                     /translation="MATNTGENIIADIIATRPPEEVVEPTGRNSFAIPPHHAQDTEKG
                     LSAAVTSASDDSEYPSPTQEEKTTLRKVPGNLNMIAYALCLVEFAERASYYGSQTLFS
                     NFVEFGLPKGGNGAGAPPKGTQETAGALGMGLQASQGFVLLFAFLAYIVPIFGGWWAD
                     VKVGRYYAIVVGVLICGVAHIIQIIGAIPSVLQQGTAHSAPPFIISLLILAVGAGIFK
                     PNVAPILLDQQVLEKEYTKVLKTGEKVIISPEATTTRAMLIFYGMVNVGAFYQLATTY
                     AEKDVGYWLAFLLSGTIYFLLPILLFFMYKRTRKLPPSGSELPSVFKILGRALKESRG
                     QIWKKNFWDSAKPSTLAARGITVDWSDRLVEDVKRTVSACHIFLFFPIYNMNDGGIGS
                     ISTNQGAAMVTNGAPNDLLNNFNPLTIIVFVPFLSYVVYPLMARWGFRNGPINRMTFG
                     FFLATCAGVYSAVLQYKIYEMSPCGYSASTCDTVAPISIWLQIPNQVLSAMSECFCNV
                     TAYEIAYSRAPPTMRGLVMAIFLFMTALSNAFGEILLPVTVDPYLIWIWAAPAIALAV
                     QSVWFWYKFHDLNNEQFMLDPVSYSEESQETIVEKVKE"
     gene            complement(<971472..>974450)
                     /locus_tag="TRUGW13939_05194"
                     /db_xref="GeneID:55992692"
     mRNA            complement(join(<971472..971877,971963..972077,
                     972148..972401,972461..972592,972661..972880,
                     972952..973040,973097..973217,973268..973300,
                     973353..973394,973453..973514,973572..973688,
                     973737..973886,973946..974221,974288..974349,
                     974406..>974450))
                     /locus_tag="TRUGW13939_05194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488358.1"
                     /db_xref="GeneID:55992692"
     CDS             complement(join(971472..971877,971963..972077,
                     972148..972401,972461..972592,972661..972880,
                     972952..973040,973097..973217,973268..973300,
                     973353..973394,973453..973514,973572..973688,
                     973737..973886,973946..974221,974288..974349,
                     974406..974450))
                     /locus_tag="TRUGW13939_05194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344251.1"
                     /db_xref="GeneID:55992692"
                     /translation="MELNGLSNTQNVHRRVHRAGPEQGFNHLLNNNKLGIIDNPIHYR
                     PPDELKNDVRSFYEDHQLSQELDLELLVRGALLARDRERFMRDISNYDDVEERALEEE
                     DNPRLSRQPKELQVVLLACAIGAIVQGWSQENLTGANLSWPMELFDVVKADGSLTTPQ
                     TWKFGAVNSVTYFSASLIGGWLSDPLNEHVWGRRGALFIAALVSLASSIGSGYVQSWQ
                     QLLVCRLFQGIGMGAKASIVPIFESEVSPPNIRGRFLVSWQSFVAFGLFLGACANLIF
                     HNSWRWQLASAFIPAVPLMFLVLVCSESPHWLVKQNDYPRAWRAFKGLRETPLQAARD
                     LYQLHCQLQVETILLGKGDVVNEIENWTHTVSGKLFQQEARRTNFFQRFAQLFTIQRN
                     RRACLAACVVMAAQQLSGVNIFSFLSNNFISNSGNATVKISNIKSLWLSFGFGLSNAV
                     FSPLAYFTIDSKGRRFLLLLSLFLMIPLLIAAGFSLRINYTDPSNPIRVGVFETFLIL
                     YTAAYSPGAGVVPFLYSSEIFPLVNREVGMSLSCTVNFFLAGVLALTVPQLQSSLGQT
                     RLLGLFAGLDAAAAILVWLFVPGTRRTISLEEFNYIFGVPTRVHVQYQIKKVLPWILM
                     AWIPWFLSDYLPWVIRWYLCCGAGMAEHEQIRDKLDPLEALYQWNSVRRMEAEEYEEG
                     EDDDARSDEVRIARGKNVGLGLENM"
     gene            <975804..>977982
                     /locus_tag="TRUGW13939_05195"
                     /db_xref="GeneID:55992693"
     mRNA            join(<975804..976571,976874..977440,977501..977629,
                     977683..>977982)
                     /locus_tag="TRUGW13939_05195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488359.1"
                     /db_xref="GeneID:55992693"
     CDS             join(975804..976571,976874..977440,977501..977629,
                     977683..977982)
                     /locus_tag="TRUGW13939_05195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344252.1"
                     /db_xref="GeneID:55992693"
                     /translation="MAEVIADMKEQSPPAAHPDDLEAVNEKKTVQRWSETVSTNYADL
                     IFIICSLTTGLCDGVIYASFGCFISMQTGNTIFLGLGAAGIPDNKPYGWLKSLTSISG
                     FFVGSFVFAKIMRYFGNRKRGTLTISFGVQAVMVLVAAAILQSDAIPHSLHDQPSSGP
                     LFLELIPLAILAFQFGGQIAASRGMGFNELPTVVLTSVYFDIASDPGLTDSVTKNVKR
                     NRRIGSVAAIAIGAIIAGWLCRSDAEMQSALWISGFIKKQHLKMAHIAFPKWAKTITA
                     STGRTYSYVHIQPGKTTQPTLLFLHGFPSSSYDWRHQIEYFSDRDQGREYGILAPDLL
                     GYGGTDKPSSPSEYRAKTMCLELVEIMDREGVERVHGVGHDMGSTVLSRLADYFPQRL
                     ASCTFLSVPYTRPGDPFDLQVVNAMTRQFLGFERFGYIEFFVRKESGRVVDEHIDSFF
                     SLFYNSELWKENLAPIGAIENWLKADKRAPLPPFITEEEKATHCKILHGHYNHLVNWY
                     RALVDNINIDDEVQAKLDAKLDMPVLVITEQPGELSIPGSEQMKLVAENITFEQVTTG
                     GHWVQLEARDEVNAMLEKFFN"
     gene            <979612..>980652
                     /locus_tag="TRUGW13939_05196"
                     /db_xref="GeneID:55992694"
     mRNA            <979612..>980652
                     /locus_tag="TRUGW13939_05196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488360.1"
                     /db_xref="GeneID:55992694"
     CDS             979612..980652
                     /locus_tag="TRUGW13939_05196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344253.1"
                     /db_xref="GeneID:55992694"
                     /translation="MATNTLAVVSQSGETLNFYDLTTGTKTGQIEKLRAEPHELCYDS
                     RSNLLYVTHAYEWGWYPQHGEFSKVISVVDAQTRALVEEIPTYPASGAHYAILDEAHD
                     ILYASCENGIGDFHHSGGIIAIDLKTKKVIKAIPSEWKSHWFVMTPDGKRAYTCNKEA
                     GFISIIDLVNEKMVGKIDIPGGCEQPGISQDGKYAYFPTPTIGFALAQNSPEYAIKVI
                     DTSSDQIVKSIPLDTGALTIHVDKQDRLLLGQYCFEKNSSGVKHRNGRLLVLSPEDFK
                     EISSYPTDVCPLTVFSSPDGKRAFAANIFSGTVTVVDLEDQKVERTLDVDTVKPHGKG
                     MLQGAHGLALIP"
     gene            complement(<982636..>983853)
                     /locus_tag="TRUGW13939_05197"
                     /db_xref="GeneID:55992695"
     mRNA            complement(<982636..>983853)
                     /locus_tag="TRUGW13939_05197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488361.1"
                     /db_xref="GeneID:55992695"
     CDS             complement(982636..983853)
                     /locus_tag="TRUGW13939_05197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344254.1"
                     /db_xref="GeneID:55992695"
                     /translation="MYHYSSPPPHGWPAYDYTNSPPMSPQYQSYYPAAYATVSPRTTT
                     KRGHSRKTSFATPRESGFHPAYNNYYEPVVPEYASPRKHDNVSAFSAKKKRKHRASMP
                     GDLPANGFRFGYDSVRPSRTPKRPIIIDLVDDADDEPAYIYREPRRYSSTTQRKPRPT
                     TDHTTFFSQVPPIYEEDVKRSRSRRASTSTASRTSPAKPKVAPPPPAPKPTRKATEEE
                     ARAADIPAGYSIKNWDPTEAPILLLGSAFDANSLGKYIYDWTVYHHGASTPMAEVAGD
                     LWLLLIKLAGKVKRADECLGRVRRPETRELLNDFLESGERLWARFKALLKDCEQFMWM
                     AAKRDAGPKAPVSMGRNAGCEFVESIFGRDRKLEDTEQLMHGIYLWDLRFDANCEAIL
                     RPSRSSSRRQSTV"
     gene            complement(<989424..>992566)
                     /locus_tag="TRUGW13939_05198"
                     /db_xref="GeneID:55992696"
     mRNA            complement(join(<989424..991630,991689..991697,
                     992215..>992566))
                     /locus_tag="TRUGW13939_05198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488362.1"
                     /db_xref="GeneID:55992696"
     CDS             complement(join(<989424..991630,991689..991697,
                     992215..992566))
                     /locus_tag="TRUGW13939_05198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344255.1"
                     /db_xref="GeneID:55992696"
                     /translation="MRTTIFSLMGIAPTAVLGATYLATNTSQFLGVTIPDNDGIPILA
                     SKDQAATIKIYGGILEADTHVNGTVHRWQTTVGQANGALGFSTEDNGIRPTSGFSFTK
                     NGTLVFRNETASHGFRVRCLIPDRVRQQSPKLKARTPRDPHCIHCTPSFPAMACLNDF
                     PSEVLHQITGYFEYKIDLHALSQTSRRFSLIANERLYNNLRQGRYYRDDLFIWAVENG
                     KEACVRRFIQAGIPVPVPLTSRVDHSICIAAEKGYANIVRVLLEYEVHPDSSHWMLRH
                     PLDSPLMIATRRGHESVVKVLIEHGVDLEYARESALEEQITQPLCIAVKKRHVSLVRL
                     LLDHGCNPLTPDYDYDGPRMGCAWEAAAGTDLEILRIFINKGFEPDFSDPAYSYLSRH
                     LEVLLEALQNGDISLVNFLFTHAAKLEPDALDYNDSCRAMLLHALNEGHISIVKFLFS
                     LETEFQVFPEPCDDDFSHVYQRDILYAISYAAGKCPLDAGFLLHKANVNKLIQNKRLR
                     PIVCLMIGAANGGNEELMKRLLDIDWSQIVQAEDWRNHLSSCLVIAARRGYYGLAKLL
                     LDYGADPRGVAKDKRLQRGNIPPIFAAAEKGSVDIVRLLLDRGADPFPQQQFTLLEKV
                     FRQEQTSGEMVRLLLERDILVPKGENGDSVLVYAVNGGAGIFQLVLQQIGGKLPNNYY
                     HREAFEESVRMAETTIMEIFLKAGFDPNSNCLRKRTSLLALAAEVTDPPGIGEQAVDL
                     LLKYGADLEWCDPHANRPLHYCPDKPEAFRLLLKKGANPLSYRDSSCGYTLLNATRWG
                     APSTVKELLQSFDAQDIPFEKVRPIFEEVINDKKRQGRNPKATEYLWRWYYRRVYACQ
                     "
     gene            complement(<993254..>994330)
                     /locus_tag="TRUGW13939_05199"
                     /db_xref="GeneID:55992697"
     mRNA            complement(join(<993254..994147,994196..>994330))
                     /locus_tag="TRUGW13939_05199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488363.1"
                     /db_xref="GeneID:55992697"
     CDS             complement(join(993254..994147,994196..994330))
                     /locus_tag="TRUGW13939_05199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344256.1"
                     /db_xref="GeneID:55992697"
                     /translation="MVQFNGPFGKVGPTYFRHGVRNPPAEPSKDFGGKTVVITGCNTG
                     VGYEAALKIAGLRPKKLILGTRTIAKGEATKTKILAQCPSLDKSVIEVLSIEYASFDS
                     VVQFAESVKQSTQTLDCVLLSAGVAMPSYKPSEGGWEMALKVNVLSAALLAIELLPLL
                     KNTPSSVLEFVGSVGHTHVTSEHVAPLIQDPSASTLAFFNSPDRWTVEKSYCEAKLLL
                     MFVLEGLVESLGGSEGELAQPQDPVLLACCPGQCKTDLGRDFPLTIRLFMKVWNSIMA
                     RSADVGSRTLVTGLQQGEQANGRIWVNDAFDIRSPGLTETEWRAMQKRVWGEAVDVLK
                     KYKPDLAI"
     gene            complement(<994889..>997212)
                     /locus_tag="TRUGW13939_05200"
                     /db_xref="GeneID:55992698"
     mRNA            complement(join(<994889..996701,996761..>997212))
                     /locus_tag="TRUGW13939_05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488364.1"
                     /db_xref="GeneID:55992698"
     CDS             complement(join(994889..996701,996761..997212))
                     /locus_tag="TRUGW13939_05200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344257.1"
                     /db_xref="GeneID:55992698"
                     /translation="MEPISSLASIVQVLSNAATAAIKVARFINDVKHAPEAHDELQSR
                     LSSMRRSLGHLDTAIRDREAHLGSGGHQHHFKQEEQDILQEAIDIKGDCERCAERLED
                     FSKNQNGSLMQRIKGQIVQGIKRPEIQRLESRIQTNVGTMQLLLLFLKTFVHEDQFER
                     EGLLLSIRQQAGELKSLRASFANTFKKFVSQSEHIEDIENVPRHTDSPLSMTTDEDER
                     DLMRTTNRTLETADSLVDKLSRLGSEPSQASVDSESRYDEGSIPMIFQVPIPPTASKP
                     SGHLTLELMTSFLDEWIGQAKEDLAHGDLDECEKNLNNAIKCGCDRFYQHGQVFEQWF
                     ELQLLLAQVYQMQGKSTDAQNLILGLMQPAMENGPEYSRITSVRMAQLYYARACFCLD
                     GYYKSHDITLSDLENIAKEAYTFVDKLKNQNEVENHPGDILSQLLTNCSQIWSQVAEM
                     QGEKVITKVLRERHPQSNGSPAWPHSFQTQPGIENHGRQRSSNLSNLNRQYTYSSSTP
                     NQTFTLETPSETAPTEISSEPTESSGAAVSRGRDLTPKLALISDVEETNAAGLTHLLI
                     AAKTGNWEMMEGLIKRRSANVNARDRDGMTALHHILRGVTCDEAIIRLLLSHGIDANA
                     ADSNGDTALHYSVQFQHRKAARILLKSCKVDLEATNEKGQTAAVLAASRSGAMDISML
                     ELFISHGANLDTAAIPREMRTVVASLKARGGGPGRRQSQSSTGQRSADSVRPSNESLR
                     SGRSSRKWLSFSKR"
     gene            complement(<998074..>1000575)
                     /locus_tag="TRUGW13939_05201"
                     /db_xref="GeneID:55992699"
     mRNA            complement(<998074..>1000575)
                     /locus_tag="TRUGW13939_05201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488365.1"
                     /db_xref="GeneID:55992699"
     CDS             complement(998074..1000575)
                     /locus_tag="TRUGW13939_05201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344258.1"
                     /db_xref="GeneID:55992699"
                     /translation="MSGSAAAKPSPSKTATAPRKRRKRTTTGGAPDDCFACAQNGVKC
                     DRRRPYCSQCLDRGNACSGYKTTLTWGVGVASRGKLRGRALPVSDGQSTASSPKERRH
                     SAFKTSPRPSHRRSSPVKAAPVVPSLSVPEAEPTALYDTTQHWPAPAVQQPDPQNDAR
                     SVPSSHNHVFGLNGPSAMLQRPVDGHPHQIPNYSFHLHTTSSGISEPTQEAWAQPVSV
                     PHTTAYTAYVDYGHPVSLQWQQPTTGKRSASFDDDREIDEAYMASLASETSQPPTTIY
                     RPDQNQVQIQNQHIWAISQSPFANSLPDLLLEQSVGRTPRIRYLISYFAEVIAPVIVA
                     FDSPSNPYRTRILQLAHHSDTLQHAIAALSASNIRQRREEKIHSTERTEPSRMSSMAH
                     RALTDVSFQERHGIRDISGNNNEEIFHKSVAIRSLNAQLADPSKRHDDSVLATLLVLC
                     LFHICETGVAHFQTQFAGVRKLLSMRRRTNLLESEEARWCTRMFTWFDAMTATINNRE
                     GELQGQLLDMTCLSDEEWAMENLAGCDGRLFKVIARLGRLNVLAQNKPVDPSYNIDMP
                     PAMPVLPPSVSHYTPNGMNVAYATNLYSNTLVQVGNAEFWTEWHSVRQQLEGWRLDAL
                     SLAGGHDLNTLSPPYSSGSLSSSPSSAPTFASVPMSPSSKYLVAPNNMTDLSNISEAF
                     RYSALLYTERLAYPDLPSTHPRIQTFVLTAMHYIAAVRSDVYLLWPLFVTGSECVYAE
                     HRAAIRDRCRDIQKDSGFYNNISCLELLEKIWARNPAVQTQDQGIYNSFHGMPGNPVS
                     NMRTQVHHKVTGHSQGFKWQSIVDEEGIDGEYIVI"
     gene            <1002604..>1004094
                     /locus_tag="TRUGW13939_05202"
                     /db_xref="GeneID:55992700"
     mRNA            <1002604..>1004094
                     /locus_tag="TRUGW13939_05202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488366.1"
                     /db_xref="GeneID:55992700"
     CDS             1002604..1004094
                     /locus_tag="TRUGW13939_05202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344259.1"
                     /db_xref="GeneID:55992700"
                     /translation="MAVQRIRRRLRSCSLLLASFFFVFFSIYIYCKPSSNRFYNAHYT
                     DSPVDPFRGRQIAFWNSFREVLDQHAPNCPPPEITGKAEPVPFNALEPTDRPDLLVVP
                     DDHLEAMQSAHSNFVAEIRRSTTLKPIHTPGSRGLVSMAGGAYFPLFLAQLRMLRRKK
                     STLPVEVFLRDTSEYEKHLCEKVLPQYNAKCVVLSELLGSTKHKGVEIEHYQFRTFAV
                     LFSSFEEVVWMDAECFPLHSVEDLLDSDPYNSTGLVTWPDFSASTISPLFYGITQQEI
                     PSTTVRAATKTGVFMISKQSHFLTLLLASYYNYHGPSHYFALLLQGAPGAGDKEAFIE
                     AATALGEPVYAVSERVGALGHVVEGGATEYSAVAQSDPIEDFRLTSEGIWRVKDPAAG
                     KAPRVFFIHGNYPKFTASEDVFGHKWDNPGVHSGRLWTHEPDVIRRFGYDVEKAYWEE
                     LQWVACNYERSFQAWAEKTDVCNNLQEYWNGVFADTPPGDLQFTDQ"
     gene            complement(<1004301..>1004772)
                     /locus_tag="TRUGW13939_05203"
                     /db_xref="GeneID:55992701"
     mRNA            complement(join(<1004301..1004399,1004455..1004567,
                     1004625..>1004772))
                     /locus_tag="TRUGW13939_05203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488367.1"
                     /db_xref="GeneID:55992701"
     CDS             complement(join(1004301..1004399,1004455..1004567,
                     1004625..1004772))
                     /locus_tag="TRUGW13939_05203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344260.1"
                     /db_xref="GeneID:55992701"
                     /translation="MVAHGSASSNVGSRQLYEADDQRVDSRDEILGRERFKEGQTNSH
                     KPNDSKDERSIANRLGREEQRNRKNEEPVNPEAELSKKDPTLPAQLHGNNPSKGAQVD
                     AELKADDKKRLWEKGIK"
     gene            complement(<1006239..>1007432)
                     /locus_tag="TRUGW13939_05204"
                     /db_xref="GeneID:55992702"
     mRNA            complement(<1006239..>1007432)
                     /locus_tag="TRUGW13939_05204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488368.1"
                     /db_xref="GeneID:55992702"
     CDS             complement(1006239..1007432)
                     /locus_tag="TRUGW13939_05204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344261.1"
                     /db_xref="GeneID:55992702"
                     /translation="MPRNTSFASPGRLSPFARHVGVHLDHDTVQGPLSFFNPTRARFH
                     LDDQAQLHPELIDDKLPHAHATQIALPAFLNWRSRDNRKGRHPLGVDASYPESTASFR
                     AVGRGLLRMCTEYPYWDISYLIAVFFTIGSLLFVVSGLFYWLPLVAPSSQFSTEATAG
                     DALSFVGATLFQVGAVLLVFEACNENQTGCFGWALHQVLSEEDRRVLAKVDVHSCKHH
                     HQDMLQADSTKQRQKQQLQTDRKWTWCPSWFELRTHYFHEIGFVASVAMSVGATIFYV
                     CGICTLPPIYNNMSKGALEGVYYLTYLVGGVFFVISSVLYVLETQPTWYTPSPHLLGW
                     HIGVWNLIGSVGWTLAASFGYCSSSWCSYQSYLTLFWASVAFSIGSILLWYEALLKYP
                     VEKTR"
     gene            <1007681..>1008662
                     /locus_tag="TRUGW13939_05205"
                     /db_xref="GeneID:55992703"
     mRNA            join(<1007681..1007755,1007815..1008051,1008105..>1008662)
                     /locus_tag="TRUGW13939_05205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488369.1"
                     /db_xref="GeneID:55992703"
     CDS             join(1007681..1007755,1007815..1008051,1008105..1008662)
                     /locus_tag="TRUGW13939_05205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344262.1"
                     /db_xref="GeneID:55992703"
                     /translation="MGKRKSLKDADNDVSMGDDGSGSESDTDLVNVEFEWFDPNPQVD
                     FHGLKTLLRQLLDTDAELFDISALADLILSQPTLGSTVKVEGMETDPYAFLSVINLQV
                     HKDKQVIKDLISYLTTKSSSTPTLAALSKLLSKPEIPAIGLILTDRVINIPAQVIPPM
                     YTMLLEEVNWAIQDKEPYNFTHYLILSKTYEEVESKLDAGESRPQKKKKKNAAAGGKQ
                     EMFYFHPEDEVLERYTLCHGTYDYTKEQAEGASDSKRAFQEVGIRPAGSLMLIEEGKF
                     EEAVKAITEYVTP"
     gene            complement(<1008832..>1009744)
                     /locus_tag="TRUGW13939_05206"
                     /db_xref="GeneID:55992704"
     mRNA            complement(join(<1008832..1008909,1008966..1009611,
                     1009674..>1009744))
                     /locus_tag="TRUGW13939_05206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488370.1"
                     /db_xref="GeneID:55992704"
     CDS             complement(join(1008832..1008909,1008966..1009611,
                     1009674..1009744))
                     /locus_tag="TRUGW13939_05206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344263.1"
                     /db_xref="GeneID:55992704"
                     /translation="MDAAIDLTDRSKALDLANIRAQLIRLEDTITFHLIERVQFPLNK
                     TIYVAGGVKIPGSELSLMDYLLREQERLQSRVRRYESPDEHPFFPDALEKPILEPLEY
                     PTIVHTNTVNVNASIKQRYVDEILPSVCPNVRADRGASKENYGSSATCDVNLLQALSR
                     RIHFGKFVAESKFQENPEKFVQLIKAKDEKGIDDAITNLKVEQKVLERIKMKAQTYGS
                     DPALAEYSNKVDADAVVNLYKSTIIPLTKIVEVEYLLERLKGTQWE"
     gene            <1010690..>1012871
                     /locus_tag="TRUGW13939_05207"
                     /db_xref="GeneID:55992705"
     mRNA            join(<1010690..1010761,1010836..1011433,1011480..1011665,
                     1011722..1012554,1012605..>1012871)
                     /locus_tag="TRUGW13939_05207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488371.1"
                     /db_xref="GeneID:55992705"
     CDS             join(1010690..1010761,1010836..1011433,1011480..1011665,
                     1011722..1012554,1012605..1012871)
                     /locus_tag="TRUGW13939_05207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344264.1"
                     /db_xref="GeneID:55992705"
                     /translation="MEEYGYDGSQHAAQDDSLLGTGLTTRHIEAFGRKVTSTANHLMG
                     PAATADAHYQTALTEIHRELRRPTAQRRLFALAQTSPTDLVRSKLSTAEIQSRALSSL
                     PDDLLANIPADNSSYSLFQGFQATLPEPEYDEKSHRRRSSKHQKLLDGTAPTKALPSS
                     KGGLQAERSKLNRRLDMMGVRKNMCSAEIHEIDSKIANLNNMRKIVLDRLAGLELDEG
                     ELETKIVDLDTKIEDMEDEEEMVTAQATPKSEADEPSDPALDASFMSESIYQKLPSHS
                     PRGRKMRSIRKKSMPILHEHFEPGTAIKEIPAHNDIITALDFDYPFGTMVSAALDDTV
                     RVWDLHEGRCAGFLEGHHASVRCLQVEDNIVATGSMDASIRIWDLSRAQHVEPTSRID
                     KPTNIEETEDGELNDSSPPLSSHSSSNLEDCELFSLEAHVDEVTALHFRGNTLISGSS
                     DKTLRQWDLVKGRCVQTLDVLWAAAQASTSIPTGPSTTWRPTGRQADASADFVGAVQC
                     FDAALACGTADGIIRLWDLRSGQVHRSLVGHTGPITCLQFDDVHLVTGSLDRSIRIWD
                     LRTGSIHDAYAYDNPITSMMFDSRRIVCAAGESVAKVYDKTDGHHWDCGAGAGEASTS
                     SIVEHVRVKDGYLTEGRKDGIIGVWTC"
     gene            <1013463..>1016572
                     /locus_tag="TRUGW13939_05208"
                     /db_xref="GeneID:55992706"
     mRNA            join(<1013463..1013514,1013565..1015436,1015899..>1016572)
                     /locus_tag="TRUGW13939_05208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488372.1"
                     /db_xref="GeneID:55992706"
     CDS             join(1013463..1013514,1013565..1015436,1015899..1016572)
                     /locus_tag="TRUGW13939_05208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344265.1"
                     /db_xref="GeneID:55992706"
                     /translation="MPPRRSARREDPTYSPSGRRYSLDPESPVRRSGRLGSEGFTPVK
                     EFPLRATTPDARQLHDTLRAASESPTKGRPGSRLGDSTRSSATPSPPIQHTISTTSTP
                     NAPSLNPAIAITDSSPLEQTVRGFSFWRYPQLSNIVGLGNRNRGSSSVLSTPRREDTF
                     DNESVISWRLERELHRDDIQRKEGEEFDTEELEVEEEFDAETSQGQTIRAPPRRLSGL
                     TWANDTNDTTNTTDTSDGPESPEVRTAAARTVISAKAEPNESDESRESSVKPTARVVM
                     SPPVDRPRAPPKLTGKKESRGQNIPWLLVAIAILIPVAAVAVYFFSDRLTPPSNPFAR
                     RPERYTPLNETEGRIITQLTGEVDKLEVQLSSMSRDVHRLSSEQRRVVEQITAVQPVT
                     ETISKINFLSLGLGARVDPLLTSPSIGVRRTFMRRMSEKAFGSKLPRPNPPEVALQPW
                     EDIADCWCGAPGNSGQAQLGVQLGQRVVLNEVVVEHIPFGASPRPDLAPKDMELWARF
                     KPYYGNPAAATTASETPITSTSGKTGWFGRMSSSQSPSPSSSSSQASSTPPSLSSLLE
                     IIMTTLHNAYPSEPKSAYSDDRLLGPSFFRLGKWEYDQTAESVQHFALDAVVDLPMLR
                     VDKVVIRVNSNWGANHTWPEMPNPPRQTQISSSNDSDNETSKPRQKQKQKQKRTISLP
                     ENGIIILHSTNLLSRVTSPPLGMNDAVVTLTDTHVTYIMHISDYRRVDSGFAHLEGII
                     LQHCQNPVDHSGRTAEKSNIITAFTNRETMKERVAEQIRKRRKGSSSSSLFSECALVR
                     WKSPLADDGDDGAEADTDACEGPWLEIDSEGEEVCRGWQQDKRVQVQYVQHMSGNVVD
                     AVVVGVEQK"
     gene            <1018780..>1024160
                     /locus_tag="TRUGW13939_05209"
                     /db_xref="GeneID:55992707"
     mRNA            join(<1018780..1018945,1019007..1019330,1019388..1023571,
                     1023627..>1024160)
                     /locus_tag="TRUGW13939_05209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488373.1"
                     /db_xref="GeneID:55992707"
     CDS             join(1018780..1018945,1019007..1019330,1019388..1023571,
                     1023627..1024160)
                     /locus_tag="TRUGW13939_05209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344266.1"
                     /db_xref="GeneID:55992707"
                     /translation="MTIPTATSPPGSPGIPTRPMSAMIRPPRSTSRMSTGSRHGGSRA
                     SDEDSKTAVKVAVRVRPPLRPNDPGYELIPQRFQRSMVHVTSPTSLAVDVPQGRKLFV
                     FDRVFPETTDQSGVWEYLSDSVNSFMQGYNVSILAYGQSGAGKSYTMGTSGPGEQNDT
                     SAMGVVPRAAQLLFDKLDGPKHGRAQSSGLRTPSRYSVGSPQAFNKPSFEKNWQMKAT
                     YVEIYNEHLRDLLLPDSTPTNDRSTVTIREDTKGRILLTGLRQVDINCFEDLIGALNF
                     GSTIRQTDATAINAKSSRSHAVFSLNLVQRKSPASMMTAKEKRMSVPVEALSSSDAVV
                     TVDSKLHFVDLAGSERLKNTGASGERAKEGISINAGLASLGKVISQLSSRQSGAHVSY
                     RDSKLTRLLQDSLGGTAITYMVACVTPAEFHLSETLNTVQYAQRARAIQSKPRIQQIT
                     DESDKQAVIERLKAEISFLRQQLRNAEAEERKTVVQPERGERSNDREVELQNHLLDMQ
                     ESYTSLSQRHAKLISELSKASDLNTEDPDELAAAIENSSVERLKRSHSFAESVEQVVL
                     EYEKTIQSLESSLSNTRASLANTESSLLERESKCAYMDTLNTQLQARVQKMMDRETNT
                     ETYLHDLESKLDGQSTGEEKNSSVIIELRKEIARVRENEASCEDYISTLEERLADSDQ
                     DMELMQREIHRLEHVVDRQRSLGKLDNLLYELDHIQQNGGAKGQKAEPDVAQPVPQTR
                     ESWSARNRGNTLDILTEAVETAIPEDDDEDLVDRLPDVEETQDEERPRTAESELAALE
                     KTQSKDIETPDDFDHSPAQSKFVAEKLENVTQELLDLRMQHDSTQNEYDILTAKYEEA
                     LRAMSEMQDQIDIARHPAAASLAGETSTDGSRPESFLDNGKSEEMKNGAQRSSSRSLS
                     SELSSVEQSAISQDTSDTTVVSAHEGSVSNGVSHQSEEELKNLRQLLHEHEEGMNLIA
                     QKYAQLEAEHEDTVMLVEQLKSDIQKSKSASSPTSPIGPSAPVIRRMTSQNLASTVNR
                     AHQSLAALRNIAVEEFEQRPDALQNFEQNLSAAMHELHHRMERIQALEAENSSVKKEM
                     EMKATIISGLTRERSSLSGAKPMDMAMVSQMRDQIFQKDNQMKEMQEAHDAREQELRA
                     EIVSLQQALDDRPVSAAPTDTENASADHTARLDQLETELSEWMGKHQTAIASLETSEK
                     QHQSISAELTAALASIDTIHADHAKYVDSLTKENAASLKEAEDAREIQSAKVTSLESE
                     IQDHRSTISTHLATITGLEASHVAAQEQLAHHISTKEANDANSAVYQSRIAELEEEIS
                     GHKALIDSHKSDLANLQDTHSRALSDLEAKGAAADAAKAEHESVIAELNAQHEEALTA
                     LRAEMSGSKDDITSLMKTISAVLNTQVTPVTVSDHLEDLVSEKQVLEGKYGDLIDANE
                     DLTKQLEAKESNVEQTKESPETEARFTELATLVATLEEKLREKEQLIKKKDTTISEID
                     AEKQKSVRLVEELEEQITSTFDQHHNRLSLMQTERTQALIDANAKVATLEREIETYRV
                     RIEQLELQLKNSGNDTSADRTSSITSNLRKSTSTASLPSPPPAIPLPPLPSIASTASP
                     PGSRHTSRELVSPQLIEDQESRIKTIEKHLYAEKQLTATLEEALGDLEAQSNKIKNDM
                     EGWKKKAWQYEDELQQLRKERSSTRLSLQAVEHERSARREAEAARAQLEERMNAINKK
                     KKKSTLNCF"
     gene            <1024890..>1026440
                     /locus_tag="TRUGW13939_05210"
                     /db_xref="GeneID:55992708"
     mRNA            join(<1024890..1025769,1025824..>1026440)
                     /locus_tag="TRUGW13939_05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488374.1"
                     /db_xref="GeneID:55992708"
     CDS             join(1024890..1025769,1025824..1026440)
                     /locus_tag="TRUGW13939_05210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344267.1"
                     /db_xref="GeneID:55992708"
                     /translation="MATTTPSNVIIIHPDLGIGGAERLIIDVALALQNRGHQVTIYTS
                     HRDKSHCFEEARDGTLDVRVRGNTVFPALFCGRFHLLMAMLRQLHLTASVLSEMGRTG
                     KKDTTTTATTSKEEFRDDIFIIDQLPACVPILKWFGERFAALSSSSTKNKQRILFYCH
                     FPDQLLARRNEGGSALRLLKGAYRYPLDWFEGWAMSASDKVVANSNFTKGVVRNVFGS
                     ERLGDVSVVYPCVDTKESSEGKQEEHVDEGNGLWGGKKILLSINRFERKKGIDLAIRA
                     YNGLSAQDRTGTRLVIAGGYDNRVQENVQYHKELNELALGFGLQTVTTKTVISALSIP
                     DSIDVLFLLSVPSAFRDTLLHHSKLLLYTPVNEHFGIVPVEAMHAGLPVLASNTGGPL
                     ESIIEDKTGWLRDTKNVDEWTAIMRRVLVDLTDADLQDMARNGVDRVESEFSLRALED
                     KLEGEVQGMLGVARRPFVDVQQVLVIFLFSGIIGAVAVALVLRSLRNV"
     gene            complement(<1029038..>1029499)
                     /locus_tag="TRUGW13939_05211"
                     /db_xref="GeneID:55992709"
     mRNA            complement(<1029038..>1029499)
                     /locus_tag="TRUGW13939_05211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488375.1"
                     /db_xref="GeneID:55992709"
     CDS             complement(1029038..1029499)
                     /locus_tag="TRUGW13939_05211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344268.1"
                     /db_xref="GeneID:55992709"
                     /translation="MVAALQMSGDDTTVWLDGYYSQKLWLNHVSKSGHGQGSELIASN
                     VQTAGPVTPNHKDEKTDSDISHGSGRGEWDGYFFAENPHSNQDLRELIPPALAALQKA
                     NQSSDGWKTPTTTGPRLAQRAETNFVRKYFYFKLPGYHRCPVFSFAGSHWH"
     gene            complement(<1029739..>1030818)
                     /locus_tag="TRUGW13939_05212"
                     /db_xref="GeneID:55992710"
     mRNA            complement(join(<1029739..1030109,1030161..1030256,
                     1030614..>1030818))
                     /locus_tag="TRUGW13939_05212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488376.1"
                     /db_xref="GeneID:55992710"
     CDS             complement(join(1029739..1030109,1030161..1030256,
                     1030614..1030818))
                     /locus_tag="TRUGW13939_05212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344269.1"
                     /db_xref="GeneID:55992710"
                     /translation="MVRPKWENRPDDQAKLQDFIDRLLNSSASDGVKDLLRHEKQRDL
                     DIISIDNFNMKSVIDKVAAALHQRGNLVLPRPTGRFREKAEIWESELRKLDERNMREL
                     QNCPVTDLHGSFQVFKEQETRAWGLHHEYDMPTQLVEPSGSLDSSLSWRMNQLWNFSL
                     GLEKSEIADLTANGFRVPGTILIICSSTISTIVTMGPTHGKKATIPKKFWNAMSNSLT
                     IFQAR"
     gene            <1031405..>1033596
                     /locus_tag="TRUGW13939_05213"
                     /db_xref="GeneID:55992711"
     mRNA            join(<1031405..1031768,1031838..1032101,1032149..>1033596)
                     /locus_tag="TRUGW13939_05213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488377.1"
                     /db_xref="GeneID:55992711"
     CDS             join(1031405..1031768,1031838..1032101,1032149..1033596)
                     /locus_tag="TRUGW13939_05213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344270.1"
                     /db_xref="GeneID:55992711"
                     /translation="MTLPILPRKESRNDDQFITAVIQSSRSQHVKSITRDHPKLRQVV
                     FHSNEYQSDDFRNKFLNVLEYKYAAAIQQRGQENALPCECCRDNDNRPFTTCVFIREE
                     QSGKCANCIFLRQICTQTKTGHQQRQDGSLRRAHNPKKAPISFARPTIIKRVGYHVIS
                     PDHESLNPGTNSYRVLGNLVLPPPPLGKHRHLAGKYKNELDKLHRRDMSKLPDRPIAE
                     LSSSFLDFKRREAAAWESYEISHPLEDIPGYLTDPRYLVKPSGSLESPLAHRLNQPSF
                     TTTQEYDGETADPTNGCIAMVMGNAYTPGTFLFNQFPRRSYQSEATEGGEFPDDVQEC
                     HVKFTADIADSIYAKVEIFYGVKVEKYTRKSQTFAVLPLWGEFDSIEIRLMYEKDYGN
                     PDKDYMFRRAVLTCKHPQHLMMPGNPKSLGAQQDKITKAAWLMAEGKGHHIPIVPNYY
                     SEEKWKQRAPPKPEGVALGRSAKPVPVIFAGEDTRSWRDFFSKHPHSDNDLRDLIQPA
                     LEALKSASPHEAWAYPEDIPKPVLDWLRGQKQILFPNQQPSNMHEIHERISNILSRAN
                     LLQQPTPADLISSLAMILNHQSQIIGNRRADTHSLWYSGFDGTVLALRCSECEENQIR
                     SDDRPRWSVSSPGTYLCREWNCSKCGKKARMMPVDEDITFSKNDKHELHSTPGPARST
                     WAQNSSGRR"
     gene            <1039901..>1041895
                     /locus_tag="TRUGW13939_05214"
                     /db_xref="GeneID:55992712"
     mRNA            <1039901..>1041895
                     /locus_tag="TRUGW13939_05214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488378.1"
                     /db_xref="GeneID:55992712"
     CDS             1039901..1041895
                     /locus_tag="TRUGW13939_05214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344271.1"
                     /db_xref="GeneID:55992712"
                     /translation="MPEVIDLIDSTPPPSPPPSTQPRPLAVRRSPSKLLPSSPNFLSD
                     EFDPSSSLFVYDELERSVKKRKVTPELPPVKDKLSPLSRVDQFAAKDESFFTFSDDFV
                     DSPALPPPSRGVAAVSRSTTIISTKATTGTMKTYTWEGEESDPIVFTSSAPERTTTKE
                     RQQSRLGHKNSAAITIDDDDDIQDFSDPFTSRDDILDKLLDEPQPTLKRGLSDRTASL
                     LASLNDTTSKTSGGPVRTGKRSNTFEFDDSLSDILEQPKKAPQPKAKPKLSLEEKTAK
                     AKDREAARAQREREKEAEKEKKRMQKEEKAKEKQLAADIAEVNKSKTHKKESMPEMIV
                     DMSQSFEETSIGNQVVEYVKQLGASHTFFESRIPNVVKWRRKKKAQYLEDAGRWEPCP
                     LRIVPEKYVLIMLTAQEFVDMVIDPSGDTSGNSQTLEQNVLKLKHVYPGCNTIYLIEN
                     LSGWMRKNSNSRNRAYQAAVLRQMNDTNQLDNPSQGTENSQANKSRRKKTKKPEDTPP
                     VDDDIIEDALLQLQVTHNCLIYHTASAGETAEWIKNFSEHISTVPYRHVQMTEHDGAA
                     FCMETGQVKTGEDKSDTFVKMLQEVTRVTAPMAYGIITKYPSVADLVKGMKRHGPTML
                     EDVRKSANKNGTLTDSRIGLAVSKRLYKVFMGLDEGSADV"
     gene            complement(<1042084..>1044119)
                     /locus_tag="TRUGW13939_05215"
                     /db_xref="GeneID:55992713"
     mRNA            complement(join(<1042084..1042743,1042801..1043749,
                     1043812..>1044119))
                     /locus_tag="TRUGW13939_05215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488379.1"
                     /db_xref="GeneID:55992713"
     CDS             complement(join(1042084..1042743,1042801..1043749,
                     1043812..>1044119))
                     /locus_tag="TRUGW13939_05215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344272.1"
                     /db_xref="GeneID:55992713"
                     /translation="RAWSSDMADRNNNNSKAQKRRIDKRDFDANRPLLADYGTDEEDG
                     QLPGRSEPESRTSRFSGDGDRPSEGLLSEVVENIVERDRQRLKSEIVRILSFTWSIIA
                     CLGAGSLTAFSLYGPLFLTRLQYSQARVNGVSIAAEIAMYLPVSVFGYLCDRYSPSPV
                     SLLAGVLFGVGYLLAALSYRSGPPVDVGGTGWPYWTMVVAFVFIGMGTCCLYGAAVTT
                     CAKNFGRGKNKGIMLACPIAAFGLSGIWQSQVGSHLLCERLEDGSCGEVDVFRYFIFL
                     SILLLVIGAGGTAALQIVDDEEQEKYIDEAVSELERSGILGEGGFFRPREEVIAAYGT
                     FQNNNDGEDDFDDEDDNETDQRSVTLSEEERIEQRRKLGREEEERRKKNWLLNHETRL
                     FFKDHTMWWLAAGFFFVTGPGEAYINNLGTIIQTLTPISYPAQAPPPAGLASTHVGTN
                     ALASTAARLLVGSITDIFAPPATHQFIYSLENPNRQPVPRSNGITLSRLAFLLPCALI
                     LSLGFLLLASPLTIHHPELFHVTTAFVGFGYGASFALMPIIISVVWGVENFGTNWGIV
                     AMVPAAGAAFWSLVYSVGYQDAIDTDPTDRRGQCFGWKCFGFWAVGCMLSVWAAIAVW
                     LMAWRGWKRRGIVV"
     gene            complement(<1045583..>1046141)
                     /locus_tag="TRUGW13939_05216"
                     /db_xref="GeneID:55992714"
     mRNA            complement(join(<1045583..1045585,1045728..>1046141))
                     /locus_tag="TRUGW13939_05216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488380.1"
                     /db_xref="GeneID:55992714"
     CDS             complement(join(1045583..1045585,1045728..1046141))
                     /locus_tag="TRUGW13939_05216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344273.1"
                     /db_xref="GeneID:55992714"
                     /translation="MGIFMTSLGKEYWQIILSQGICVGIGNGLLFCPTISLVSKYFTT
                     KKALTMGLAAAGSATGGLIYLALVQQLLPKIGFGWTIRLPGFVTLATGGLAGVLSKSR
                     VTSRKSGPSTFKEAPSVFYCIAIFLNFMGLYYAFYY"
     gene            <1047925..>1049354
                     /locus_tag="TRUGW13939_05217"
                     /db_xref="GeneID:55992715"
     mRNA            join(<1047925..1048328,1048385..>1049354)
                     /locus_tag="TRUGW13939_05217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488381.1"
                     /db_xref="GeneID:55992715"
     CDS             join(1047925..1048328,1048385..1049354)
                     /locus_tag="TRUGW13939_05217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344274.1"
                     /db_xref="GeneID:55992715"
                     /translation="MTTAEEQRKLVKYVCQQYHKIPWEPLTRKQLNSSRDRPARGNIW
                     LSRVAFPAPSSPSLRDALYRVINHLRSDYHTITPAEETPILDVGVEFIGERTGVPSDA
                     PELDITEQEKLQALEKECTSDKTILYIHGGGLYFSSPAEYRAASARLAKMTKSRVASI
                     RYRLAPNNSFPAPILDTLVAYASLIHPPPGAPWSAVPADHIVIAGNSAGANLGLGLIK
                     FLLELQKLSGQPVPSIPDFHGRTISLPLPAGIATVSGWCDQCDALPSWHKNGEFDILT
                     VLQPACMPGHPTDSIWPTNPPREHPYCAGATLDHELVSPAAVRDWTGAPPMFFLCGSE
                     ERGIDGNRVVASQAAKSGVIVTWNEYEGMPHDFILIMAKLPQAKHAMALWIRACIDIL
                     ESKKGRQALAKSPAVQWLMPDCKKKIDLGDPRDISPLSFEEVRSKMREYNATRPVWTG
                     KLGEAHL"
     gene            complement(<1049504..>1053023)
                     /locus_tag="TRUGW13939_05218"
                     /db_xref="GeneID:55992716"
     mRNA            complement(join(<1049504..1050305,1050381..1050719,
                     1051256..1051799,1051853..1052030,1052088..1052624,
                     1052687..1052833,1052904..>1053023))
                     /locus_tag="TRUGW13939_05218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488382.1"
                     /db_xref="GeneID:55992716"
     CDS             complement(join(1049504..1050305,1050381..1050719,
                     1051256..1051799,1051853..1052030,1052088..1052624,
                     1052687..1052833,1052904..1053023))
                     /locus_tag="TRUGW13939_05218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344275.1"
                     /db_xref="GeneID:55992716"
                     /translation="MEKSVEDSVREGPDIASPTTFADNGIALIPQPSDDPQDPLNWSI
                     FRKSRLLFVICIASFAGNVAALAGQEAYPLQSKVYNVTVIQSSYSVSAAMCGLATGAF
                     FFVPLGHIVGRWSITFWSLLACLACAVWSACMTRESDYNNFIVSRLFSGLFGAIPSAV
                     GGGMILDIFFLHQRGRAFICYEIAILFGATAGPTFSGFIAGTASWTWCFWWTVPFLAA
                     TALLVFVFAEETSFNRDKAPMQRSQGFVKSRIDTFFPGSAVITIPPKSEIIKSVVAPF
                     AIGLSPATVLCGLFTLVVFGWLLINDVLSPTFLQNPIEEGGYAFTPVQNAAFSMAGWI
                     AIITSQVVGMFAHDGIPLWICKRYYNGVWRPELRLYIMSITAVFVPVGLGVCGAALKQ
                     HYHYMVFALGYYIVAVAVLIAVPVATNYVAESYTEHGTECTLVMTFYRLAWGVAIPFF
                     ITHWIEEVGIEWVYGIAAFVTIGAWLLIMILLWKGPTIRQWSLAKSLVRSEEGQKLFE
                     KSIIYSFFNIHARTMASAEYFASQPAFPDDLQPVAQMATISLAKLVAGSTSEAEAVLH
                     ACRKLGFFLLDLTGDPVGEKLMTEVDAVFDVVRQTMELSTDEKNKFNHDPPRDFRGYK
                     AQGVMKTETGAPDRCEFYNVSQDDLLGQSTPRTNPGPIAANSELLRSYLEHGQFALTH
                     ILRALATQLGLGSETFRDLQTPTRASGTILRLIRYAPSLSPEDMRTGLLPHTDFGSVT
                     LLANVLGGLQVLAPDSAPEDENAWQWVRPRPGCLIVNMGDAMVEWTGGVLRSNMHRVN
                     YAPGNQRHVYRYACAMLVRPYKEATMSRLHGGRIPTVEDDQREGIEIADNTVSSLTAH
                     EWELKKAMILKEGRDCARSRGGRELRPQPVAA"
     gene            <1053832..>1057329
                     /locus_tag="TRUGW13939_05219"
                     /db_xref="GeneID:55992717"
     mRNA            join(<1053832..1053950,1054012..1054388,1054449..1055194,
                     1055886..1055891,1055959..1056438,1056505..1056629,
                     1056690..>1057329)
                     /locus_tag="TRUGW13939_05219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488383.1"
                     /db_xref="GeneID:55992717"
     CDS             join(1053832..1053950,1054012..1054388,1054449..1055194,
                     1055886..1055891,1055959..1056438,1056505..1056629,
                     1056690..1057329)
                     /locus_tag="TRUGW13939_05219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344276.1"
                     /db_xref="GeneID:55992717"
                     /translation="MDEVKSSPPSGPDVGASSPPLTGKQWIQVLSAFVVFLNTWGLLL
                     AFGSFQTYYEQILLPDKSSSEIAWISTICAFLLLVSGLITGPLFDYGYHRPLLLVGSL
                     LEVFGLMMVSLSTEYYQVFLSQGICVGIGGGMLYIPSIAAAAASLQEFRRAKFMGLIA
                     SATGIGGVIYPIMFRRLVSSVGFPWAVRIIAFVMFATYLFSYPILLYKPAASPSIRRW
                     VDMTAFTDLSFLLANLGAMLSAVAYYLPMIYLPLFAETAIPNFGNGNQDLAFYLISIA
                     NGASVVGRLAAGLVATKVGPIETCTMALAGCFVVLFCWTAVNSTGGAIAWSIIWGLVS
                     SVIVAMPGAIIPLLSPSLQVIGTRSGMYWASVGLGVLIGSPVAGALIDLNSVHVHWWK
                     LQIFAGTFMTIAAFCYVYPLIHSQGHDAANYPTVCLVTSPHFLGYKFSPASFWYLYSA
                     DLQLAAMIAEVNNTFDERRMYLLENTVPNDMANADQSKPLNFQCSWDKDFHVSPFSSS
                     KGSYKISVPDLFNSDGSQGTAAVNIRATLLSSKGRGKLVARLWSNAVPLDPAKISIFR
                     ALDFLISWSMAPKDPHIVIEALKLAKKRHLDIYYRPEPRAETIPRHSTRAERYMGVIF
                     REYLEKILLSSSDAFHLRLIDPTTSNPEIAVSFSTPAADQSSPVLRMRILTPKFYYFA
                     LSHQGLKPLLLATFLDPATENRTAHVDDDTTTLIELLTRAATPAKQEKVKKSTNWVIL
                     LLWVFWMMARVRLPFTGVAYPNFGTPAARARTNENRNTENVSYNYEAQNESYFLDDFV
                     RDFHSPLDQIKYVVWGTGLLARELVLNIVGGA"
     gene            complement(<1058016..>1059275)
                     /locus_tag="TRUGW13939_05220"
                     /db_xref="GeneID:55992718"
     mRNA            complement(join(<1058016..1058493,1058549..1059042,
                     1059105..>1059275))
                     /locus_tag="TRUGW13939_05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488384.1"
                     /db_xref="GeneID:55992718"
     CDS             complement(join(1058016..1058493,1058549..1059042,
                     1059105..1059275))
                     /locus_tag="TRUGW13939_05220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344277.1"
                     /db_xref="GeneID:55992718"
                     /translation="MPQVKDGVEDVSRAYVLYITTTIFTAGTLITTAARIGTKLKCKL
                     RLGIDDWLIMLGAALNIVADCFDYKATASGFGRHAMFLSEEDLIEAAKYSQLAVGVAN
                     WAIGVVKLSVCFFLLNLIRGTHKRFRWAIYVMIALTCSFTLIGAILWGTQARPLAKLW
                     DPRIPGTRGSTEDFLIVVYIVYAFGCFTDVFYALSPVYFLWSVQLEWKKKLPIMLLTG
                     VAMLVVVVAVLNIIFARDFLDQEDITWALINEFVCDIIERNFSTMVANLPALWLLVMR
                     LRRRYTTYQSKGSQNTRSGYLPPRLAMSHVDQRSTVTGGTGKAQVSTHALDGHEMTDF
                     SDNSHLLRNLPQYPTVAAHRIHVQTDVEVQDEPRNGPMPQDGRLDV"
     gene            complement(<1060052..>1061469)
                     /locus_tag="TRUGW13939_05221"
                     /db_xref="GeneID:55992719"
     mRNA            complement(join(<1060052..1061172,1061253..>1061469))
                     /locus_tag="TRUGW13939_05221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488385.1"
                     /db_xref="GeneID:55992719"
     CDS             complement(join(1060052..1061172,1061253..1061469))
                     /locus_tag="TRUGW13939_05221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344278.1"
                     /db_xref="GeneID:55992719"
                     /translation="MVPWADGWSSATCIDKELHRSLRSTLLLGFNATSLKKFEPAILK
                     HLDILMDKMLQGSKNQGKWGPAMDMNGWNQWFALDMITDFGFGAPSSLLTNSADRYVL
                     DVLHLAVKNLGVIEQWPGLSYIGLGHIAYYVEALCSFSKVFSLPIGKFVQWHQDFTHR
                     AIMNNADTVSGVLGYVIQSGEGKLGKKGHNKSQMLAEGSFVTFTAADGIGTTLSAVMY
                     YLAHNPRVYEKLAKELRTKFSRDSENKQPRPESITWGPELSSCKYLQACLNEAWRLVP
                     PACGVHWRECERSGVAIGSDEMPFGSDVGMSLFTIFRSTDYFRDAHDFWPERWIKGFL
                     PDAEYQLTRQVFHPFSLGSRSCAGSHVAVMIATVVLANVIVKYDFRPSMLSEASLLGL
                     PDQKLDQERHLQSCDSLPLEFESHFTLPIWKEGPILQFRERSTMFDADTANSR"
     gene            <1063002..>1064782
                     /locus_tag="TRUGW13939_05222"
                     /db_xref="GeneID:55992720"
     mRNA            join(<1063002..1063233,1063296..1063722,1063786..1064128,
                     1064180..>1064782)
                     /locus_tag="TRUGW13939_05222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488386.1"
                     /db_xref="GeneID:55992720"
     CDS             join(1063002..1063233,1063296..1063722,1063786..1064128,
                     1064180..1064782)
                     /locus_tag="TRUGW13939_05222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344279.1"
                     /db_xref="GeneID:55992720"
                     /translation="MVPNPSYIPPKRVAIIGGGISGISCLWGLREEESTEVYLYEADN
                     RLGGHANSVGVKSEDGKVHSVDTGFVTMSEQMYPKFNAFLNALNVPTMETDMSFGVME
                     DDRSVEWGSCSFEGFYGSLSRLFSLWFWRLVFDIIRFNFFATDILSEKVSEELKLASG
                     NEKLSSKKLKLESIGEYLDRKNYSRQFKQYYLLPMIAAPWCMSLSDVANGFPAETLVY
                     FMYIHRMLDTMTETLCWRAFKNGSRTYVEKFVETTPENHHYHLNTPIQRIIRNQGDDQ
                     ASLVFKDGSVDSFDHVVLAVHAHQALDLLGEQSTSLEKDVLGAFRTSRNECVMHSDLT
                     FLPQNPKAHASWICHMRSNRTSDKDMSAGKLSETKPLLETSDSKDSTTATETDGPVSV
                     LFDMNRLQEIPGPGSPGSPGRILISMNPIRTPQSIRTQHLYYHPILDSPSIQASRSLN
                     ELNRASPNVSFAGAWMGYGFHEDGFAAGLEVSHKLRTGEYENQSSVRYGADLAAWVPK
                     LSTRNLMVRSVIGAVQLVIDLKKLLI"
     gene            complement(<1067111..>1071349)
                     /locus_tag="TRUGW13939_05223"
                     /db_xref="GeneID:55992721"
     mRNA            complement(join(<1067111..1069055,1069110..>1071349))
                     /locus_tag="TRUGW13939_05223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488387.1"
                     /db_xref="GeneID:55992721"
     CDS             complement(join(1067111..1069055,1069110..1071349))
                     /locus_tag="TRUGW13939_05223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344280.1"
                     /db_xref="GeneID:55992721"
                     /translation="MSRPRSATGHAPPGSLVTPGAADSHAFSNGQGQQLLHGPGSAAP
                     VHSQPELEHERHRQIPWDQDHHHESWSPKQPAAPTGLSLKRASTTPSEHYQPAPISSI
                     VAAAAKPSFRPHTPQLSERDSIFATHYLPSDNNDVSSAASTPLLRPVRGSLRPDKETL
                     LKLSRGDASPASPISIVSSPRTPPDTAASATSPSNEDNNNKTNTAISPSKPTSQSTPF
                     RRPSDIALQAPSSPLAGSHVGWVKQQETVESSKIAGTHRIAIRETFHPLRKIASEGND
                     SEPSSLATHDHPEHSFLPPTSATPRPRLHNIPMLDSSNGDHEHSFPDPWQTSRHLKHG
                     DGTVDVTWNTKLNRSTSRGRATRVEESIEADLTNTEPASHVRSRKSSHYLGLFKENTS
                     PDRKRRDDRERQLENAGIVSGHELLEEADPESPSTPRPTHAALYQPPPVHDDSRENIM
                     ETEDIVQEPEDTEQVLSVDASELSQHPFRTIPRSLSEEIRNFHLTTGGDRGGSFSPSV
                     PTRFTKVVRREAREFYDGDQSPSSLIDHSTPSSQVCRTDDLGELAVDEDEDEHISSAL
                     YFPHEAAPSATEPSFSKYRHDEEGYTLAKQDVAKPEPTTNHIDISLHSQKDSSILHGD
                     FSALSDAEEKALATISEYSHESTSESEAESTLSTQDEVSSLTDDAEHLAMTPTQRPLR
                     HRRKHTKTGILGAVELKPYRHQVGGHTTVFRFSRRAVCKQLNNRENEFYERIERRHPE
                     MLMFLPRYIGVLNVTFSKKPKHSKKRSTTSNEQTKASIPEPQKSTDLSLPKETTTSAP
                     KSQEQPRIFSQQQITGVIPKVILENNRHIIPTDFFMPRARSAEDARPFGSMSAGYKSE
                     SGENTPKSNLTNDLRQQTISHLRKPKIWGATTVNRKLQEQVLREVFSPPPIHHTRRNV
                     RGHPTLPRYRSDTGRSNGDVSEDRVSSRGTSGGRSPPKSRAIDIVKATAQEGPQLSSS
                     ASSALERHSNPLERIRTSETPPRSSSLAADRTLRRRHSGSGLQRRRSLTSGDSGDLMF
                     FEDDGYGGDQEDAIFTMEGDTPAEPSLSPVDKNSNASLLKTSDSLARSPSKLGSPLQL
                     PTHPPDVDVDSMHVPINPQEAQTKRDDRVQFFILLEDLTAGMNKPCVLDLKMGTRQYG
                     LYADEKKKKSQRRKCQTTTSQQLGVRLCGMQTWNIKKQEYLFEDKYYGRDLSSGREFQ
                     DALTRFLYDGVSHRSIVKKIPSILGQLSTLENMIRNLKSYRFYASSLLILYDGDPSKE
                     PKKIPADSKEPQSNERPTLDRRASDDWHNNNDDVKLKIVDFANCVTGEDEFPPDVSCR
                     PYHLDDIDRGYLRGLRTLRMYFQRILKEVGQEDVFERGETEGLAQGHRTTSQQSSTDA
                     FWVDAVVESDPGEVSF"
     gene            <1074038..>1075080
                     /locus_tag="TRUGW13939_05224"
                     /db_xref="GeneID:55992722"
     mRNA            join(<1074038..1074548,1074632..>1075080)
                     /locus_tag="TRUGW13939_05224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488388.1"
                     /db_xref="GeneID:55992722"
     CDS             join(1074038..1074548,1074632..1075080)
                     /locus_tag="TRUGW13939_05224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344281.1"
                     /db_xref="GeneID:55992722"
                     /translation="MTCSYMNTVLDSVLYKRAIATGVYKQKFLYAAIWGKATAISKFL
                     KEGVLMTQFNNNTYTWSSCDYHNLSHAKRNTPTWDPEIHPLLAAVLFGHVEVVRTLLA
                     EGNANVDFENDSGETALIYAINNDRLDVAEILLEQGANLMVLDENDNKYSPFIYAAKV
                     GNQNALELMLLEFFLLNGVCVNDYFQDGDSLLYHASIKAHYKMIKLLVKYGARMENEK
                     DTGVVSVFHHQPLPAAKPVVRELLKFGCNVANGNRHACALWRIARGYNRTLNPDRKLI
                     GLLQERGFDKEKCRDKCWAKSRYLFQGDDMTSDEFFNYVKGDA"
     gene            complement(<1076367..>1082140)
                     /locus_tag="TRUGW13939_05225"
                     /db_xref="GeneID:55992723"
     mRNA            complement(join(<1076367..1076426,1076507..1077677,
                     1077729..1081765,1082072..>1082140))
                     /locus_tag="TRUGW13939_05225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488389.1"
                     /db_xref="GeneID:55992723"
     CDS             complement(join(1076367..1076426,1076507..1077677,
                     1077729..1081765,1082072..1082140))
                     /locus_tag="TRUGW13939_05225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344282.1"
                     /db_xref="GeneID:55992723"
                     /translation="MTGGDTGLADAQWLEVAGAKPYSLSGNLTIKTINTTPTAMSKEP
                     WLAELPDEDWVSQPSSPCPLPHSPSLPSSPSQQSARKCIGCSHRSRMPKPEPVSPSVR
                     GKNTPRGARQGQTRRGGSTTPTSVRASSSPRQSPSTRSPRVSNNAPPKSSNTKQITPG
                     RKKPASTPLKTMVSAKSSTLKSNVTDGQGTVQVRSGKDDSRGTPEWKRRLIQGGMGPD
                     EQCDLFAPMGLESMFKGPASGGEPEDRRGQTNGAQTNQPVDASRRQSNPAQDGRAKPN
                     SRLRQRSLNTRSMSSKRSKLGLDGVSDMEGRSRTASGEEDRRNEGITPIFLSSSNTVD
                     RRTGSGVLQSALKQLNHIADTSKESRTGSIKQQHKGTNEAGELLNFSSPYFPEDLSTG
                     TQEEAQTKPFVSFRRGGYSDDGSFRMRQLSPSSFPSQLDNSDFRSSPPSQLQDAVPAV
                     TFSPTDDDPRPNTGNMSNSPLKLFGNHDTFTNNKLLRRMSQFEETLGDELSDEDQPAS
                     PTLGTRKTRANRSLPNLRRGQSEDHSPRKIARPVTQDAADPRMNRFGNGQLDGFGFAD
                     ESAHSGRVPNLSFQSRYNRGTQSNRRSYSRVLGRDPLRKAKSFDSIPETRRSFSSRQY
                     ITSRSNENSQLTLHTRRIHSGTTHTSNLPPKGSTPKRRRTREKTDALYDADELAESLL
                     EMNLEERGFRHQLQQSSHFSPATGHSEQERNQWERSNSESPFDTDASKEDLENENYKR
                     SLTTDDYLDQATKVMNFIRAKGKYQSGLTSVEESDITSQDNEEDTLTEISSPENLSRP
                     PSRDGVDMRKYREPKQLHPRVVSHLKKFADKEDAEQLMESVVSHLDKESQSDTKGETK
                     YDGDIQSSPQNIRILPPLKRKHPDEDQTDSIPSTSSNASNARGNIASDMVSHLIPEQV
                     NGMTYDQSTKSWVRQKDARAIERPRGDESEDDPFGSIPDLSVHSTEEVMRSFARTKDG
                     QITEGLRSRIELDTTKLSAGQRPTTRDGPAFIPDSSSVQSKTTRFTSSGPQPETRATS
                     WGTEDITINVRQPSSPHAKHTVNETKSLRPKASGQTRSATISFSSPLVSHIVYTDDAN
                     ETQSNGTTTEHYGERRNNDSSTPGTSLDNRGFVRRPISRIDEQNEESMEEMSLVRRIS
                     TAQASSTPQLHRGGNSLAHLQSAEGDSYSFHLSPLADFTMNQPDDPVNLEISYIAQRT
                     HPSSLREIHGTFELAVQDLVKHITDVEPSEPFWEDIRRLNLRNKGLITLHRLNDFCPR
                     LEALDVSENELGHLIGAPYTIRDLRASQNCLSNLTAWGHLANLQYLDVSGNQIESLDG
                     FSGLVHLRELKANNNKIRSIDGILDLNGLLRLDLKSNALTSIDFEGSELTRLSEIDLS
                     DNQITTIRNLEYLPALETLNISANQLKKLPTVVPINTLRTLRASKNRFDSFDAAMFPH
                     LKLLYLDGNYLSTLSGLSKCSSLEILSVREQFAGTSHDSGSPLDIDIAHLTDIRKLYL
                     SSNSLSERTLSPSAPVLGLQLLDIASCGLQAIPSRFGKLFPNLRVLNLNFNSVSELDN
                     IAGMSGLSRLAVAGNRVGRLRTLCQVLSRIGRSAHHSDSPLRNIDLRGNPLTIGFYPP
                     PISGSGRADTHLKLLEIRRQETEMRKNRIEPDLGSLATTPGVADDFAAVGPKNGENAI
                     ETRTEIEIDDPYTLPLADATADQKHRSHLHESTKKRRMMLELLMYTTTGGSLKMLDGL
                     ELRPILEDEKAGIDKLWAQLERLGVFKKKKLRMMPVKASYPPAQTDSDAWMV"
     gene            <1083155..>1084590
                     /locus_tag="TRUGW13939_05226"
                     /db_xref="GeneID:55992724"
     mRNA            join(<1083155..1083209,1083284..>1084590)
                     /locus_tag="TRUGW13939_05226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488390.1"
                     /db_xref="GeneID:55992724"
     CDS             join(1083155..1083209,1083284..1084590)
                     /locus_tag="TRUGW13939_05226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344283.1"
                     /db_xref="GeneID:55992724"
                     /translation="MKSKHLNLLVGMMAVFERASASLNARDESTYCPPDEYIADNDLQ
                     FSTYCSLNLLAPELGNQPGSSITECMDMCSNYHPACMGVTHYFQNQTCSFKGFDVNTT
                     SLSITDTDNVHSALTNKTEMLAIKADCPYENNTNAMISGFSFQILCDQDMRDYGDFLP
                     WGQTYGNHASTMGECMQLCLDVHPLCVGVSWNPDKKAGWSNCYLKNSQDGVPVVANTR
                     PVSHSGLLVSLPPVDTCSGPGQIVNNNQTFNTTCLEGRVGSSNFTSFYSPKLKNCVGQ
                     CATNDSCVGVLYDNSFHEGIKNCYFLNATGSASTPQNFTYAELVSSDTSASGASPSTS
                     AGATPTQSSDGSSDSSGSSGSSGNSGSSSSKAWIAGPVIGAIAAVAIVVAGWFWWRRR
                     GGGGGGGGRTIAQEPEKQFKAVEVASHSPPQPQSHPQELPNHYQISEAEGSVITPRHE
                     LES"
     gene            <1085387..>1090974
                     /locus_tag="TRUGW13939_05227"
                     /db_xref="GeneID:55992725"
     mRNA            join(<1085387..1087279,1087756..1087824,1087886..1088182,
                     1088240..1088875,1088925..1089158,1089210..1089545,
                     1089592..1090095,1090147..1090545,1090600..>1090974)
                     /locus_tag="TRUGW13939_05227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488391.1"
                     /db_xref="GeneID:55992725"
     CDS             join(1085387..1087279,1087756..1087824,1087886..1088182,
                     1088240..1088875,1088925..1089158,1089210..1089545,
                     1089592..1090095,1090147..1090545,1090600..1090974)
                     /locus_tag="TRUGW13939_05227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344284.1"
                     /db_xref="GeneID:55992725"
                     /translation="MPPHQKFSPVTLEELPIDEYETDSLLGSDDDLDDTTRTAKRRRI
                     ETLGTLYLKGQPLFIASASLRGPFDNGWVNPWKKNRSRHSTNVANTNRRVATTGFRRG
                     ATSATKDKNTGVVENSEKASKTIPNCKDFEYEHNPRDNSVSSTPAELGRQHQGSPFIV
                     KSLDSRMIEPPSTEFLIRHKWLKKDKGSFNIQNYDPPKSPSSRYTSTTSPTKRLKPLN
                     KKPEHRCNRNIASSRTTDFDKKSKSISPNVHNRLSSPSNSARFPDRMHPHLDLNEDSK
                     PPTKCEPMEDSTVVQAAHEGLPIEPTSVSSVHIIPPSSHLPEFKYRLPKSKSAKQPKL
                     ESETISIDGSLKNQRDEREHPPLQSALGNSNSRQASTQTKKDSGTLEASGHSNEHESS
                     EKITSAQIVPRPLPNSGQIISLYSTDLRGGLGADENAGADGEELSTQEALQLAQKSFQ
                     EEFSTPERDLEDISEPKDRFISPSKRITPFSRINTLPSKLEIQLATDVGPEAIQNMDT
                     QALIDSVTPFSVGTIKSAGLRSDSQPHPNVSALNLSLKRRASLAMSPPSSPSGNATQV
                     ASNIHTQVSGNDSFSALPLTLSVTTPATDQQDGQELMTGTDTFDLSQVIQDAGSWLQQ
                     SFDVAKEGKAFNFFDVSPVQLPAESSPAFNDDVACVCTGSDNLFLGNSDGFVHIVSPS
                     FKVVRSFKAYDTGAIRHMKQIEGTSLLVTISEDLPSEPILKVWALDKIEKKTGAPSCL
                     SSLAVQNGRRPFPVSTFAALDDLSQLAVGFANGSVAVIRGDLINDRGTRQRIVFESEE
                     PITGLEIQSGHTTQSLYIATTSRILTFTLAGRGQGQPARVLEDAGCAVGCMTIDKETA
                     DVLIAREDAIHIYGPRGRGPSYAFDSPKTSVHLFRGYVALVCPPKTTSSRLDTLRKFG
                     VGQADDLLNTSTFTLLDTDLNFIAHSEAILSPVQSVFAIWGDLFLITIDGKITRYHEK
                     SLQQKLEFLYQRNLYILAINLAQKAGVDTFQQNVIFRKYGDHLYQKGDYDTAMQQYLR
                     AIDNTEPSQVIRKFLDTQRIHNLIEYLEELHDHEKATADHTTLLLNCYAKLKDTSKLD
                     SFIKAPGELKFDLETAIAMCRQGGYFEQAAYLATKHGENDMVVDILIEDSQKYAEALE
                     FISRLDAEMAYPNLMKYARVLLGHCPQETTQIFIDFYTGNYRPKKESVHTVESEAQPT
                     STVRNLAAFIPLPYVGSNTPTKARPAEAQVSQEIDLTPDIPVYHIPKPRTAFSSFVDH
                     PAEFITFLEALITQKPWNEADKIDLYTTLFEMYLDNAKKSKNAGEKQDWETKAKKLIE
                     GKDIPISTSNVLLLSNLSDFDEGMTLVKEQAGLRSDIFRSYTTAKDTQGVIKALRKYG
                     PVEPQLYVDALAYFASSPKTLEEAGDELDAVLKKIDEDGLMAPLQVIQALSTNAVVTM
                     GMIKRYLSANIERERKEISTNRRLISSYTTETEAKKSELEQLASKPAIFQARQCQSCS
                     RALELPTVHFLCKHSFHQRCLNNTGEDAECPVCAPQNSTIKAIRRRQVESADQHELFM
                     AELQRSKDRFGTVSDFFGRGVMQTQKNE"
     gene            complement(<1091360..>1093205)
                     /locus_tag="TRUGW13939_05228"
                     /db_xref="GeneID:55992726"
     mRNA            complement(join(<1091360..1092190,1092251..1092335,
                     1092388..>1093205))
                     /locus_tag="TRUGW13939_05228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488392.1"
                     /db_xref="GeneID:55992726"
     CDS             complement(join(1091360..1092190,1092251..1092335,
                     1092388..1093205))
                     /locus_tag="TRUGW13939_05228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344285.1"
                     /db_xref="GeneID:55992726"
                     /translation="MGKKEKNQAHEERDQRNRKRRAKQHASTSSEDHDTEPSNSSHSV
                     RANGVAKDGPPADQGRSIRLDDISITKLLSLEETFQSLSEVSGVFKYIKHGAAKAGDV
                     FRPEIELRAENERLQQMMNQITNAVETQQVQDLRQRCHELEEERVNLGEIQQEAEREL
                     QRLVEERETILVERRNMEHEFKKRIETARIRFDQKLTEEKKSLEANLASIKQSEKETK
                     DLNVQLKVQGELAEQKVQDIQYGNEILMAENRRLQSDLGKERSRFSIQSKGIDYYRTN
                     FTKLHQKLEDLVYDFVTGPMNGDQIRAVEATGLEQQEFFKFVPTRDSDVAQYLWRQGT
                     QAFIASLICKHIWQSFPCDHVREFTDTSKVEIAFDTMSRKYAQIDVEKEGIWRNMTYE
                     ILDSFRVQLSKKERPHKDLVSSTVKALGPIIHSSKEEDFAIKLTEVVSEASGLWAAVK
                     TDTTRIYISANPPNENKGGPKWKVASLKGIETLTCSETINIPDAHSLCLFPSITATGA
                     SGKDEVIFPGQTLFADCVAFALGYHEQQESARELKQREWELRYNHRKHSLSQPASSIQ
                     GLPQNLAPALS"
     gene            <1095623..>1097059
                     /locus_tag="TRUGW13939_05229"
                     /db_xref="GeneID:55992727"
     mRNA            <1095623..>1097059
                     /locus_tag="TRUGW13939_05229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488393.1"
                     /db_xref="GeneID:55992727"
     CDS             1095623..1097059
                     /locus_tag="TRUGW13939_05229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344286.1"
                     /db_xref="GeneID:55992727"
                     /translation="MSWPTNEQQVAPLGLSLHDQDKIYAAGDTITGTIHNWNQHRING
                     SWIELILAGRCKSTLQFPRKVYYTHKDRVPLIYHIEKLHPAESDGEIHFSIAIPHRVQ
                     KDLSGLPDLKKRLGYWTHSWSNSPFFNTQSEHELPPSIAVSRSLLVNNGELCGSGHIH
                     YTLTAVISKMGESGEKTEVFCSDEETLDITTSRISVKDWGELSRNNQTTDNSTFTLML
                     PEKGLQFKSKEKPKLAIMKKIEQAFGKNPSLTMATQITFPRVATVGSSITFSLRLGSV
                     SSSHKNPNGFTLPPITLQRVEVCLKDAIALRCSRPVMRLHEHINEFPGRHVGEISCQV
                     NHVFNPMDDGKSYQNRECQVEFEIPASCSPTFMTWNVSNQWYLHVNAFFKCLGKVSTK
                     SYHGSIKLISEPKLSVNSIGEARGLSGKAKEFPRKMVELQGNKAVAELRGDRAVVELD
                     GDKAAAELHGDKVVAELPGHIEVAELPA"
     gene            <1097755..>1099513
                     /locus_tag="TRUGW13939_05230"
                     /db_xref="GeneID:55992728"
     mRNA            join(<1097755..1098055,1098105..>1099513)
                     /locus_tag="TRUGW13939_05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488394.1"
                     /db_xref="GeneID:55992728"
     CDS             join(1097755..1098055,1098105..1099513)
                     /locus_tag="TRUGW13939_05230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344287.1"
                     /db_xref="GeneID:55992728"
                     /translation="MSSQRVIQDSDDDEIGDDCSDVATSIDPLQDPSLLYDAPSTSNE
                     RARPAEHGAELIPTSIPESNLPQVGFDKYLRSESSIIAGDYEDERRVSTADAAPAGAP
                     QPNREYYDQRPGDIFVYPANSSFVVPDTLPLTADMRRPESQQLGHVEATDEHEHPSKR
                     RKISFTQDTLQENLSGGTSGVGVSYDFFASIDPHSPSQAATELRTSIDLPRQAQQAGS
                     EELIPERFETPPPTVPLSEDVLYDEDRAKNEPLPTTINESKGEITCDQGPAFETDNEV
                     LGSKKKRGRPKKQALADKTEDQVEFVSDGIIAPVNQPNKKKLGRPKKQDRDTSPDELA
                     MDEMMKHQTDDVRGQKPISKPDKPKKKKVKRSKTTSDLPNTTSLPNDDRDMRWIDNSL
                     VIDLESTESKPTAVDETAATSISKEELPTKKATGDEKSTTNDTKAEPKKRGRKKKSTA
                     EGPPAAYAESSTVLQDISNTAHLSTKDEHNPNGDQTGDSNPNEISETKRPQKGMEATV
                     PTAETPTKSESTAAKADGENPATIKQAPAKPSPILNTGKVPYRVGLSRRARIAPLLKI
                     VRK"
     gene            complement(<1099851..>1100990)
                     /locus_tag="TRUGW13939_05231"
                     /db_xref="GeneID:55992729"
     mRNA            complement(join(<1099851..1100674,1100732..>1100990))
                     /locus_tag="TRUGW13939_05231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488395.1"
                     /db_xref="GeneID:55992729"
     CDS             complement(join(1099851..1100674,1100732..1100990))
                     /locus_tag="TRUGW13939_05231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344288.1"
                     /db_xref="GeneID:55992729"
                     /translation="MSALRVLSLFPVFLTAAVSVPFLPYHTGRIPLVGSEKGSSSNRV
                     SIDGSVAENSHNGHTVTHRVRIGERCGPDAGYCDEGLCCSPAGYCGTTTAHCFAPDCQ
                     LDYGFCDAHKTPEGLPTADIPRPWIGSVPYGQGIYSCEAPYTFAMTFDDGPNIYTSDL
                     LDVLDNFTAKATFFITGINSGKGQIDDFTTPWGSLIQRIHKSGHQIASHTWSHQDLNK
                     ITPSQRRDQLLKNEAALRNIIGGIPTYMRPPYSDCNVECMEDMADLGYHITYFNIDTN
                     DYNNDDPETIQKSKDIVDKALAKGEETPGHPFMAIGHDIHAQTVYNLTAHILRRVNDA
                     GYRAVTVGECLNDSRENWYRWDYRTE"
     gene            <1103489..>1107187
                     /locus_tag="TRUGW13939_05232"
                     /db_xref="GeneID:55992730"
     mRNA            join(<1103489..1103558,1103725..1104301,1104355..>1107187)
                     /locus_tag="TRUGW13939_05232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488396.1"
                     /db_xref="GeneID:55992730"
     CDS             join(1103489..1103558,1103725..1104301,1104355..1107187)
                     /locus_tag="TRUGW13939_05232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344289.1"
                     /db_xref="GeneID:55992730"
                     /translation="MTFGLQRHKAKWHSPLFYIKEQFDELHKERGKSLVEILSRDSST
                     SSTRDEAQIRLSVIEQALQCLQDIHEAYASPVNSESLILQAPEDAREDARRRRALNTL
                     LDLISIEGVYPSLSTGVGIPLEKRVLTTLPAGVITKQVPEAAEHNLQNEAILRRILST
                     LISIVLDDREGIQMIVQGRILSDIISGTAELAFNARVASEEEKKDFQEKFERIIAQSP
                     TSAILPTLSSFLRPEAASWFKSVISARISQIPLREDGVIHTIWFLASQFAPALGEGVS
                     EQSSEGPPITVQAIMQISKLLSAVPQGMEATAYFQNIAPKLLTLVDCEDADLKRTAAY
                     VIGSGILGKRAYGAPGTIGHSIFIEPLFKAIIATIDDGARKWLRSFSPTAQDTANASF
                     KHPSPGVLVEDVTLLLALERLCTITLQHPNPGLVKRLVQPILLPLWGLACHAQAQDNT
                     TWYEKAWALLQTYFSLSPGFGPFQKLVDNLLWDGGINWTFKNHQDHGVSLIARSESDF
                     NLIQLMDKLDIRTQNFIKLLSSDPQSEDRTGDIFLYVSQKWLLEPSEQPLTLSLSESN
                     TQTSTIIAKLVSTKIAERLLDEFRDTLSRNPLRVLELAQQLIQSELVAMDETERSRIR
                     RQSGKASLESLSHIARPDSNEPGLEDDQKNSIEVLSATFSLLSTILASPEFSMSPTIL
                     PTLENIKTQLERLLPGLPASLHQGGHTVAMLLEIQIASPQETAESKSSISSHLTDFER
                     HRQALQSISSSVPPVQAEGLSLLSKLITKSSPILDIPSTLTLLLSLITEQDQEASANE
                     SFVYLNAIKLVGMLASGHPRTVVKTLVERYADRNEERTLDQRLRVGESLLSTVEDLGE
                     ALTGETAQIIGDGMIGVAGRRGHKPQTHQARKKQMEEAKKAKERKAQENSIKLPAGWS
                     VTSPALSNPEPEPEPEPEPFYEDDDSDAETPEQAALSANILAAWAAGSPSDTEPEDIR
                     VRASAMSILASAIQTNLAGLGLSLASSAVDLALSTLTLEPGPESAILRRASAIVLLDI
                     VKVMDSERESGSKRIGFGFSLTSEGSESIGDQSRRPASIGSIPKILQSLSFVESRETD
                     SIVRGHVRTLVENLETWMEKSLLWGIRAQSVFDGSSSDEPRLELGDRIAGLYLDPLAG
                     RDSQNRPRIEEIE"
     gene            complement(<1107577..>1109915)
                     /locus_tag="TRUGW13939_05233"
                     /db_xref="GeneID:55992731"
     mRNA            complement(join(<1107577..1109622,1109695..1109796,
                     1109853..>1109915))
                     /locus_tag="TRUGW13939_05233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488397.1"
                     /db_xref="GeneID:55992731"
     CDS             complement(join(1107577..1109622,1109695..1109796,
                     1109853..1109915))
                     /locus_tag="TRUGW13939_05233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344290.1"
                     /db_xref="GeneID:55992731"
                     /translation="MSQEEIHDTAKPGLRVALEGCGHGKLHDIYAKVAETAASKGWDS
                     VDLLIIGGDFQSVRNANDLTGMSVPIKYREIGDFHEYYSGKRVAPYLTLFIGGNHEAS
                     NYLRELYYGGWVAPNIYYVGAANVLRFGPLRIAGLSGIWKGYDYRKPHFERLPYNSDD
                     VKSIYHVREIDARKLLQVRTQVDVGLSHDWPREVEKFGDYNRLFRIKRGFREDSESGK
                     LGNFAAKKILDRLRPRYWFSAHLHVRYSATIPHGEYVYQTNGQSTGTTNKRLQTSSPH
                     GLDGAIVSIPSDVANGTNDKDHKIGGVPLAKKKSPPAPFLTQIKGFVPPKSTAEAHLA
                     WGQFSKVAAEQDALDAKKFLENAPRPGETYSLDADFSQTWRKIKPGDLDRKVTNVQKA
                     EETKSAVKNADEIDLDLDDDNSSANTPETEAEKGKAAIKNTDEIDLDDENSSANTPET
                     EAEKGKAAIKNTDEVDLDLDSGSEGGANIEVKKNIVHIQNNTDQAEPSRDENEVSGDL
                     REQLPEGFKRQRQQSASYGPLPDEISNKTTEFLALGKCKSEFACSEYLELFEIAPASE
                     EGDAQGPYTLQYDKEWLAITRVFADSLALGDPGFQISPDLGDEVYKPKILAEEAWVQE
                     NIVDKGRMEVPQNFEITAPVYDPAVSINTTDMPPEYNNNQTAAFCELVGIENKFHLTP
                     EEQERRRALVPRAARNFHGNNRYRIPRHGRHNQSGRGGGKRRGGYNGGSPRQFS"
     gene            <1110362..>1110976
                     /locus_tag="TRUGW13939_05234"
                     /db_xref="GeneID:55992732"
     mRNA            <1110362..>1110976
                     /locus_tag="TRUGW13939_05234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488398.1"
                     /db_xref="GeneID:55992732"
     CDS             1110362..1110976
                     /locus_tag="TRUGW13939_05234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344291.1"
                     /db_xref="GeneID:55992732"
                     /translation="MAENASALRLKFLQHSANLLSSSGVSTAAHLMTLHNRLIHADSK
                     PLKPRQHESWCGACGSFRDSAHTKVSKTKRKITSKKPEPESRDVLEEVVVYQCLRCHK
                     QTVRRLQSYARQQREPSSISVDTQPKAAPTNQHLSTLSTTPGPAPSVASMSSASATAL
                     DNASSKKRAKARKQGGLQALMASKQRSQASNGGSSLDLLDFLQQ"
     gene            <1111252..>1112738
                     /locus_tag="TRUGW13939_05235"
                     /db_xref="GeneID:55992733"
     mRNA            join(<1111252..1111431,1111482..>1112738)
                     /locus_tag="TRUGW13939_05235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488399.1"
                     /db_xref="GeneID:55992733"
     CDS             join(1111252..1111431,1111482..1112738)
                     /locus_tag="TRUGW13939_05235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344292.1"
                     /db_xref="GeneID:55992733"
                     /translation="MSQGENTTEQMDHMLDTMTQKNQQSEESESQFQKLGDVVDNQDD
                     NGVVQVESLCMNCHDNGTTRLLLLRVPFFRDIILESFDCPHCNFRDNSVKSASQIQTY
                     GSKYTLVVENEEDLQRQVVKSDVAIFKLETLEIEMPKGESQLTNVEGVLLKIHSTLES
                     EQSLRKEQAPELYNALEPIIQKIGQMLKREAFPFTISLDDLTGNSFIAPTTHDSGNKY
                     TRRDYARTHEQNEELGISSDPDAQKTEESNMIQSAGNPEDLDIIDGQVYTLPAECPGC
                     AKACVVNMQKVSIPHFKEVFIWSTVCDHCGYRTNEVKTGGEVPEKGKRITLKVDTIED
                     LSRDILKSDTCALYSPELEMWSQPGSLGGRFTTVEGLLTEIRDQLHGQIFDVGDSGAG
                     DSLSSEDKGKWTRFFGRLDAAINGELKFVVTLEDPLANSYVQNLHLPDPDPQLQVEDY
                     TRTDEEDDDLGFKDMKTEGYENDVEKKE"
     gene            complement(<1113154..>1113911)
                     /locus_tag="TRUGW13939_05236"
                     /db_xref="GeneID:55992734"
     mRNA            complement(join(<1113154..1113720,1113776..1113841,
                     1113900..>1113911))
                     /locus_tag="TRUGW13939_05236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488400.1"
                     /db_xref="GeneID:55992734"
     CDS             complement(join(1113154..1113720,1113776..1113841,
                     1113900..1113911))
                     /locus_tag="TRUGW13939_05236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344293.1"
                     /db_xref="GeneID:55992734"
                     /translation="MSVTLHTTHGDLKVEIFCETVPETAENFLALCACGAYNDTPFHR
                     FMPGFMIQGGDISLSRAATAADGHPPILPFDDIPKGGTSIYHPSALNQEIRTPALRHT
                     SRGMLSMASRPVKDRTAPGMQNAAGPTVNGSQFFITFVPAPHLDGESTLFGRVLNLTA
                     QDENGDVLGRLENSKAKVDKKGRVIQPKEGEEIEGEWEALKLVSVTIHANPFAK"
     gene            complement(<1114726..>1116316)
                     /locus_tag="TRUGW13939_05237"
                     /db_xref="GeneID:55992735"
     mRNA            complement(join(<1114726..1115826,1115882..>1116316))
                     /locus_tag="TRUGW13939_05237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488401.1"
                     /db_xref="GeneID:55992735"
     CDS             complement(join(1114726..1115826,1115882..1116316))
                     /locus_tag="TRUGW13939_05237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344294.1"
                     /db_xref="GeneID:55992735"
                     /translation="MPERLEIDGRSPISYDSAHEEEYNVINRLSYLPAIHKLYDDLWA
                     QRNSIAALVKHHLRLRSQDTCSVLPTDQWIRGGFNLCVLVQVVSSGVSRKLVFRCPMP
                     HKVKGIVDEKLSCEVGAYVWMQENCPAIRIPHLFGFGFTDGRSFTHAKCRPFHIRVRR
                     VFWRFIRNFLQLPLLSQYTYHPATDKTHYAYTLLEYIGPETGEMLQNTWEKQRSNPAQ
                     RRRLFRGMAKIVLSLARIPQPKIGSFQFNYDGTITLSNRALSCSIAILENDGAKRVMQ
                     KNDTYNCTDSFVSDMITFHDNRFLNQPNAINNENDCRGQMTVKALLRVIAPRYIQRGY
                     RCGPFLLQLTDFSQGNIFVDRDWNITCLIDLEWICALPVEMLNVPYWLTGCAIDEIQG
                     SHYNEYDEVRQEFIRILEEEEQTIIATHKISVSRNMNKMWETKGMWFWHCISSVNAMY
                     YLLETHLCPLSTAAEKVISNFWDKNAGEVVEKKLADRSKYDEELKACFVSAGSCHDRP
                     NVP"
     gene            <1117028..>1118338
                     /locus_tag="TRUGW13939_05238"
                     /db_xref="GeneID:55992736"
     mRNA            join(<1117028..1117105,1117161..1118045,1118096..>1118338)
                     /locus_tag="TRUGW13939_05238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488402.1"
                     /db_xref="GeneID:55992736"
     CDS             join(1117028..1117105,1117161..1118045,1118096..1118338)
                     /locus_tag="TRUGW13939_05238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344295.1"
                     /db_xref="GeneID:55992736"
                     /translation="MAAFVRVSGPPNGNFLIGYPGISATLPRIEGKVEIRPSVGITAP
                     VNVSLVTVCLQRRESIHPSADSVTKKRLAAPRKEITELVGKEMLLFRCAAGRDYEEVI
                     SMDLPFMLFIPYGRGAQESSRKVPAASIQLPSRTAETYYEIVVTVQQGPSEQRKYTFP
                     VPICRYDTLSTFGMYNRPETSEKVTDHLVTLGISLPRWSYGPLDPVSVYVRLSPNLDW
                     ISKAKKVTINKLTIGIDEEIVYNHEGDESSRKVKTLVKRTEAVGIKLPEQGYSTNLGL
                     VFPTKDLRDSDGILPRGKMAFPSYAVTGFTTTASLYKIEYYLTVKAHLTSARDIVIRQ
                     PIVVCPIDHAGCKEEMEAIEHSARDAAFLNPENPMLPNPTIVRFRDHNALATLGVAVV
                     GKQRKPLID"
     gene            complement(<1118922..>1119210)
                     /locus_tag="TRUGW13939_05239"
                     /db_xref="GeneID:55992737"
     mRNA            complement(join(<1118922..1119116,1119166..>1119210))
                     /locus_tag="TRUGW13939_05239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488403.1"
                     /db_xref="GeneID:55992737"
     CDS             complement(join(1118922..1119116,1119166..1119210))
                     /locus_tag="TRUGW13939_05239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344296.1"
                     /db_xref="GeneID:55992737"
                     /translation="MSAPTQEYFDDLLSQISTNLQNTSNTFGPSSQQYKDVLQTLRNC
                     IKQIEENLKPEKPVPLDPTMLTQAMELLNLSDKNS"
     gene            <1121163..>1125036
                     /locus_tag="TRUGW13939_05240"
                     /db_xref="GeneID:55992738"
     mRNA            join(<1121163..1121281,1121341..1122131,1122181..1122609,
                     1123872..1124371,1124429..1124805,1124874..>1125036)
                     /locus_tag="TRUGW13939_05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488404.1"
                     /db_xref="GeneID:55992738"
     CDS             join(1121163..1121281,1121341..1122131,1122181..1122609,
                     1123872..1124371,1124429..1124805,1124874..1125036)
                     /locus_tag="TRUGW13939_05240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344297.1"
                     /db_xref="GeneID:55992738"
                     /translation="MADVDEDAIPRPAPGSSAAQADTDLSDEVQDFRFLNSLNILNTE
                     NGTLPRRGEKDYEPNPTELQFDVLSASRRAMHNAISHPRLHSSKTNMIGIYAPDGPTP
                     LVTNVVKEPAQNDGDGDGDAAAAKPAKVVKDPMSGIPAESCVYVQNPKGIHFKSTGKM
                     DRWNRAWLLPEEALYYLERGTLDIRWPASITAPLQEGDEESGLPMSLQAAYACLIGQS
                     GLTLERFSVYTGLRRVGYTLIRAPSWYGDQDEDDLGVDDEIEHGPSFTASISNSWNRL
                     YSSVSNLFGENYSEQGPLIGLNIPHSYNDIFRKLAIIPVEAVDQKKPPRRQTEAPFQF
                     AYHVYKPSTPFKKTAPPEPDFRIAVVDARTQTTIPTLTQIRALVETSPLTPPRGDRVQ
                     HQLYMRLRHGYRSAILAVVDQGIVSYMRFTDAGFSNEKLYEIQGPPKGNKGGFRGLFR
                     HIEHLRTPTCLCQAPLTRRTHISSTSVTTTTAAKTRRLSTRANPENTINTRLSERTAL
                     ITGGSSGIGYAIAERFLQEGARRVILVGRQRKNLQDAADQLMRSLAFTQENGDGISSS
                     SSEVATRMPEEDRSRPNTTIPGDDRIQLLVGDISTVKTWMGELEKEMANVDILINAAG
                     ISLSNILAKTSPDDISQTLQTNLEGAILTSRALLRACIRTRAKNHSSSSNQSGPLRSR
                     CIINISSLLALKGITGTVPYAASKAGVLGLTSSMAVEAAEMLRGSKVVLRSNAIVPGI
                     DFSKDHVNSLHTRIPLNRFGDPREVADAAVFLATNEYANNCILNLDGGLSAV"
     gene            complement(<1125372..>1127699)
                     /locus_tag="TRUGW13939_05241"
                     /db_xref="GeneID:55992739"
     mRNA            complement(join(<1125372..1125636,1125685..1126138,
                     1126190..1126365,1126414..1126693,1126747..1126817,
                     1126890..1126990,1127047..1127283,1127341..1127532,
                     1127607..>1127699))
                     /locus_tag="TRUGW13939_05241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488405.1"
                     /db_xref="GeneID:55992739"
     CDS             complement(join(1125372..1125636,1125685..1126138,
                     1126190..1126365,1126414..1126693,1126747..1126817,
                     1126890..1126990,1127047..1127283,1127341..1127532,
                     1127607..1127699))
                     /locus_tag="TRUGW13939_05241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344298.1"
                     /db_xref="GeneID:55992739"
                     /translation="MESQQPTATQAAPRDAYLKRSLGTLSRRIRELIEWSWQSRVLLV
                     GAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRHEHIKKPKALVAKEVAG
                     KFRPDTKLEAYHANIKDAQFNIDWFKSFDLVFNALDNLDARRHVNRMCLAANVPLVES
                     GTTGFNGQVQVIKKNLTECYDCNPKETPKTFPVCTIRSTPSQPIHCIVELFGTSETDG
                     DQDGFDHSEDSENAEEIENLRHEAQALKTIRASIGSEDFAQKVFDKVFKDDIARLRSM
                     DDMWKTRKPPTALDYKTVLENASDIDASVSQNDQKVWTTEEDLVVFKDSLNRLGKRLK
                     ELQENKDGDLEPVITFDKDDVDTLDFVAASANLRSVAFGIDTKSKFEIKQMAGNIIPA
                     IATTNAMTAGLCVLQAFKVLKDDYEHSKMVFLERSGVRAINTDSLRPPNPYCAICSVA
                     QGQIFVDLEHATLNDLVENVIRSKLNYGDEFSINTDAGMIYDPDLDDNLPKKLTELGV
                     KAESLLVVIDEKDEEPFVNVELAVVERAKPTPEKSAVSLAHDIQISKKPPQKPPSEEP
                     LNGTAINGATGKRKRDDEKDGLDGAPDAKRLAQGNGESNEPIVLDDPETGAILIDD"
     gene            <1128814..>1130160
                     /locus_tag="TRUGW13939_05242"
                     /db_xref="GeneID:55992740"
     mRNA            join(<1128814..1129234,1129288..1129674,1129730..>1130160)
                     /locus_tag="TRUGW13939_05242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488406.1"
                     /db_xref="GeneID:55992740"
     CDS             join(1128814..1129234,1129288..1129674,1129730..1130160)
                     /locus_tag="TRUGW13939_05242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344299.1"
                     /db_xref="GeneID:55992740"
                     /translation="MSDDEADPELVELLRQSLGLGKKTGPPPPADTKVLQNARFIFDN
                     SIDVALDPRGTKAAARTIWQQMQQKNYSAKSWSEHDLHPKSKDESTVDFILTMDLLNF
                     SFWSAEPDEQKRFSIEYRGQKWTGYWSLVAALQRALEEDIPITSPDFWLDEDALTEDV
                     LRHVFRSATDEEIPLLEERLECLREAGRVLDEKYDGSFINCIYDANQSAAALVNLLAD
                     DFACFRDEASFDGRRVRFYKRAQILVADLWACFEGESFGEFNDIDKITMFADYRIPQM
                     LNQLGCLLYSPPLESLIRRLQPIEVGSKREVEIRGTSIWCIELIRQEIERLQSESELQ
                     SANSSPQSEAAGEQDKEKDEKDTAVAVAVLHNPGEKPHGRKSYINAILIDFFLYDSMK
                     ELERDGQEAIPHHRTRSIWY"
     gene            complement(<1130392..>1132093)
                     /locus_tag="TRUGW13939_05243"
                     /db_xref="GeneID:55992741"
     mRNA            complement(join(<1130392..1131598,1131666..>1132093))
                     /locus_tag="TRUGW13939_05243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488407.1"
                     /db_xref="GeneID:55992741"
     CDS             complement(join(1130392..1131598,1131666..1132093))
                     /locus_tag="TRUGW13939_05243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344300.1"
                     /db_xref="GeneID:55992741"
                     /translation="MTGLRQIYVNGDYSSSGGGELRCHRLPPQRSVCIWFSPAPAALR
                     PSASGFSQYNPLWEFSSPIIQLQQLNSSTLHFVEDTKMNNRPVEQVLATLLPTHANEI
                     PPELLSLAQSLIAQSRSYTSSLKPEEEIARPFACAEIACRRLARALKLPPLLGHPPCP
                     PRVYKKLYTFLDNSIGGSSKAAGKAGSRTPSRAATTPRKETAATPSNTASARTLQNNT
                     PSKSTPRRSNLLNDRANGTPSKTASVKRARFKEDPLQTSYIIKDAADWVMPSVRTVCK
                     TLSTPAPRMSLLSRPPVSRTLPPHMFTGVSSILHFFSSMTDDAFGKLDEEASDFLEIL
                     RTPGEEKTDDYKEIVMALVVAVYFLVLARRRSPGPVTENTNAESTPTPDESQKMDKKT
                     FSEMRQTALSSLGLSPTDKRHGEDVDAWIALIMDQNWAKGQEWFDNIPSVGQRSDDFL
                     DENGHGLEDDDPMEASTPKRRRTKLFAQAGSNKEGALLPGLGTMMQDRVDYLSEDRRE
                     DYLEWKADMMKRIASMDKSAGAIGRKASVKKQAVAA"
     gene            <1132257..>1132923
                     /locus_tag="TRUGW13939_05244"
                     /db_xref="GeneID:55992742"
     mRNA            join(<1132257..1132596,1132654..1132721,1132777..>1132923)
                     /locus_tag="TRUGW13939_05244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488408.1"
                     /db_xref="GeneID:55992742"
     CDS             join(1132257..1132596,1132654..1132721,1132777..1132923)
                     /locus_tag="TRUGW13939_05244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344301.1"
                     /db_xref="GeneID:55992742"
                     /translation="MPPRRSSGRTTGQQSTLSFSNSRVTKPSATAAAKQIKAEPIAKE
                     IIKEATSDASRVVPVVESPEPPVADIITEKEKDELDEPQTDEDRKALKVSETAIRNYW
                     TEEERRSSTPRVHQKHLDVDEKILRHFDLSSQYGPCIGISRIRRWRRANMLDLDPPIE
                     VLAVLLKERKTPVKERAYVDELLS"
     gene            complement(<1133672..>1135181)
                     /locus_tag="TRUGW13939_05245"
                     /db_xref="GeneID:55992743"
     mRNA            complement(join(<1133672..1134688,1134741..>1135181))
                     /locus_tag="TRUGW13939_05245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488409.1"
                     /db_xref="GeneID:55992743"
     CDS             complement(join(1133672..1134688,1134741..1135181))
                     /locus_tag="TRUGW13939_05245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344302.1"
                     /db_xref="GeneID:55992743"
                     /translation="MSAKSIFEADGKAILNYHLTRAPVIKPTPLPAAATHNPPPKLAS
                     LFFPEGDDVSGVLDQAEATYPWLLAKDAKFVAKPDQLIKRRGKSGLLALNKSWSDARA
                     WIEARAGKEIQVETVQGVLRHFLVEPFVPHPQETEYYININSVREGDWILFTHEGGVD
                     VGDVDAKAEKLLVPVNLKNFPSNDEIASALLKKVPKGVHNVLIDFISRLYAVYVDSQF
                     TYLEINPLVVIPNADATSAEVHFLDLAAKLDQTAEFECGTKWAIARSPAALGLPAPKG
                     DGRVNIDAGPPMDFPAPFGRELSKEEKFIADMDAKTGASLKLTVLNSQGRIWTLVAGG
                     GASVVYADAIASAGYVSELANYGEYSGAPTETQTFNYTRTVLDLMLRAPQHPEGKVLF
                     IGGGIANFTNVASTFKGVIRALREVASTLNEHKVQIWVRRAGPNYQEGLKNIKGVGEE
                     LGLDIHVYGPDMHVSGIVPLALSGKKTDIKEFGTA"
     gene            <1137301..>1139503
                     /locus_tag="TRUGW13939_05246"
                     /db_xref="GeneID:55992744"
     mRNA            join(<1137301..1137437,1137495..1137611,1137672..1137861,
                     1137918..1139013,1139070..>1139503)
                     /locus_tag="TRUGW13939_05246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488410.1"
                     /db_xref="GeneID:55992744"
     CDS             join(1137301..1137437,1137495..1137611,1137672..1137861,
                     1137918..1139013,1139070..1139503)
                     /locus_tag="TRUGW13939_05246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344303.1"
                     /db_xref="GeneID:55992744"
                     /translation="MPSLAPSNGGVQNANDNITRFNPPSRLLSPLEQHTLFHNKTRCF
                     VYGMQPRAVQGMLDFDFICKRNSPSVAGIIYTFGGQFVSKMYWGTSETLLPVYQDVGK
                     AFAKHSDVDTVVNFASSRSVYSSTMELMEFPQIRTIAIIAEGVPERRAREILVVAKEK
                     GITIIGPATVGGIKPGAFKIGNTGGMMDNIVASKLYRKGSVGYVSKSGGMSNELNNII
                     SQVTDGVHEGVAIGGDRYPGTTFIDHLLRYQADPECKILLLLGEVGGVEEYRVIEAVK
                     QGVITKPIVAWAIGTCASLFKTEVQFGHAGASANSHLETAVEKNKTMKDAGFYVPDTF
                     EDLPQVLGDLYEQLVSKGTITPQKEPVPPKIPMDYSWAQELGLIRKPAAFISTISDDR
                     GQELLYAGLPISDVFREDIGIGGVMSLLWFRRRLPPYASKFLEMVLMLTADHGPAVSG
                     AMNTIITTRAGKDLISALVSGLLTIGSRFGGALDGAAEEFTKAFDRGLSPREFVDTMR
                     KENKLIPGIGHKVKSRNNPDLRVELVKEYVTKNFPSHKLLDYAVAVETVTTSKKDNLI
                     LNVDGCVAVCFIDLIRNSGAFSAEEAEDYLKMGVLNGLFVLGRSIGLIAHYLDQKRLR
                     TGLYRHPWDDITYLLPSVSKGAPGAEGRVEVSL"
     gene            <1139946..>1140578
                     /locus_tag="TRUGW13939_05247"
                     /db_xref="GeneID:55992745"
     mRNA            join(<1139946..1140174,1140241..>1140578)
                     /locus_tag="TRUGW13939_05247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488411.1"
                     /db_xref="GeneID:55992745"
     CDS             join(1139946..1140174,1140241..1140578)
                     /locus_tag="TRUGW13939_05247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344304.1"
                     /db_xref="GeneID:55992745"
                     /translation="MVRIKHRYLLVDILYPEYSKSFSSLSSTPHHLKFHQPTADTLTP
                     GLFSKLLRDTVSDLFGDYGVGKLGGASSGNLIIKYLSPATSTLIIRCPRAAYRLVWAA
                     LTYMNSVPISTNTKHKETRTAVFRVVRVSGTMRKAEEEAIRRARREVLRTKGAVKQGL
                     DGLLGGIIQGGEEGEDFIALDVDEDDED"
     gene            complement(<1140717..>1141860)
                     /locus_tag="TRUGW13939_05248"
                     /db_xref="GeneID:55992746"
     mRNA            complement(join(<1140717..1141361,1141414..>1141860))
                     /locus_tag="TRUGW13939_05248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488412.1"
                     /db_xref="GeneID:55992746"
     CDS             complement(join(1140717..1141361,1141414..1141860))
                     /locus_tag="TRUGW13939_05248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344305.1"
                     /db_xref="GeneID:55992746"
                     /translation="MPFAQLVIGPPGAGKSTYCNGMHQFMGAIGRKCSIVNIDPANDK
                     TSYPCALDVRDLVTLEEIMEEDALGPNGGVLYALEELENNFDWLKEGLKGLGGELILH
                     VSEYIVSNENPGADDYVLFDCPGQVELFTHHSSLRNIFFQISKLGYRLIVIHLVDSYC
                     LTLPSMYISALILSLRSMLQMDLPHINVLTKVDNLTNYSPLPFNLDFYTEVQDLNYLL
                     PHLQAEESSRFSHEKFGPLNNAIVDLVQEFALVAFETLAVEDKKSMMHLLQVIDRASG
                     YAFGPAEGANDTIWQVAVREGWGNLEIQDVQERWIDAKDEYDEHERNQLEAEAKERDA
                     AARRAQEDAEELELQNMVSAGGSKVVRKY"
     gene            <1142117..>1143295
                     /locus_tag="TRUGW13939_05249"
                     /db_xref="GeneID:55992747"
     mRNA            join(<1142117..1142129,1142184..1142439,1142494..>1143295)
                     /locus_tag="TRUGW13939_05249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488413.1"
                     /db_xref="GeneID:55992747"
     CDS             join(1142117..1142129,1142184..1142439,1142494..1143295)
                     /locus_tag="TRUGW13939_05249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344306.1"
                     /db_xref="GeneID:55992747"
                     /translation="MSHSNQIIVATPPTDAISAIKFSSDPDSTRLVVSSWDKNVYLYD
                     LRDENGVVGPGKLLQKFEHRAPVLDVCFGANEDEIITAGLDWDVRKIDVNTSTQTVLS
                     SHEAGVKSVVYSKEHSIVISASWDSTLHVHRLNADSTPAVIPLPSKPFSLSVSPTKLV
                     VAMASRALHIYDLKSLAMISDQADFQPPSVNKVEIEPWQRRESSLKFMTRAVACMPDD
                     AGYASSSIEGRVAVEWFDPSTESQARKYAFKCHRKPVDDVDVVYPVNALSFHPVFGTF
                     ASGGGDGVVALWDGIAKRRIRQYQKYPASVAALSFSSSGKYLAVAVSPGFEDGQDDVD
                     PSTVQIFVRELGEVEAKGKGPK"
     gene            complement(<1143498..>1144881)
                     /locus_tag="TRUGW13939_05250"
                     /db_xref="GeneID:55992748"
     mRNA            complement(join(<1143498..1143940,1143994..1144493,
                     1144637..>1144881))
                     /locus_tag="TRUGW13939_05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488414.1"
                     /db_xref="GeneID:55992748"
     CDS             complement(join(1143498..1143940,1143994..1144493,
                     1144637..1144881))
                     /locus_tag="TRUGW13939_05250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344307.1"
                     /db_xref="GeneID:55992748"
                     /translation="MRNDADGKRQAIHSLRLQALPECPARLDQLHQSRGLRCAIPASS
                     PCSTREHAWCLVATAPIIGPSFLMRSIALLSPTIRFPILFKARPVPRLTPNQLISSTE
                     HIKSIPPKTSFETSSRRIYSNMAAVEASKRAAATAAVQNHYPTNAKWVGIGSGTTIVY
                     VVEAIKNSGTDTTLTKFVPTGYQSKQLVTSAGLTAVEFDAIPEGVVLDIAFDGADEID
                     DDLNCIKGGGACLFQEKIVALQAKEFICVADSRKLQSRLLTNWAYIPIEVAPIAALRV
                     LRKLRELGSEGPTVRLNVLGKEGPLKTDQGFFIVDAPFPPLLTTTDIQAGKDGSGKNG
                     VWEVATLAQKIKAIPGVLEVGIFYGLTGPQAQAVGAVGGQKPVAAYFGMPDGSVTVRK
                     ATP"
     gene            <1145104..>1146836
                     /locus_tag="TRUGW13939_05251"
                     /db_xref="GeneID:55992749"
     mRNA            join(<1145104..1145478,1145535..>1146836)
                     /locus_tag="TRUGW13939_05251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488415.1"
                     /db_xref="GeneID:55992749"
     CDS             join(1145104..1145478,1145535..1146836)
                     /locus_tag="TRUGW13939_05251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344308.1"
                     /db_xref="GeneID:55992749"
                     /translation="MTDGFPVALVGPSSKERRYDRQLRLWAASGQQALEQSRVLLVNS
                     DGFIDGSNTPVGGVAGVETLKNLVLPGVGGFTIVDPAVVSETDLGINFFLEESSLGKP
                     RAQETCTFLKELNPDVDGDFKTEPISELLQHPDFLQNYKLVIVSGPIKRSSLDAITYS
                     AEQVGIPLIYVRSVGFYSSFSLQLPVEFPIVETHPDPESTQDLRLVNPWPELHAALSQ
                     VTDLEALDDHDHGHVPYILILLHYLENWKSEHEGKAPETYKEKTAFRELVRSGARTNT
                     PEGGEENFDEAVGAVLKSINPWSLRSNIREIFEMEQCTDLNATSDNFWIIASALKAFH
                     AKYGVLPLPGSVPDMKAKSADYIALQNIYKTKARQDVDEVLSTVRSIEAQLGTRTVPV
                     TEKEVEVFSKNASHVKVIRGRLVPQISAKAGQTLKTIRNSFGNPDSAIAKYVAFEALD
                     IIVDGIQNGHLPSTALDDDATWNATIERLFTTIAEGDDSAVEGESHERVLKAAQEIRR
                     TEGGELHNISSLTGGLVSQEALKVLTRQYVPLDNTCIFDGISSGSEMFRL"
     gene            complement(<1147472..>1148843)
                     /locus_tag="TRUGW13939_05252"
                     /db_xref="GeneID:55992750"
     mRNA            complement(join(<1147472..1148336,1148399..1148613,
                     1148673..>1148843))
                     /locus_tag="TRUGW13939_05252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488416.1"
                     /db_xref="GeneID:55992750"
     CDS             complement(join(1147472..1148336,1148399..1148613,
                     1148673..1148843))
                     /locus_tag="TRUGW13939_05252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344309.1"
                     /db_xref="GeneID:55992750"
                     /translation="MPGPGRLLGQAVVAACLLFGLLFLLYQPSGQPQTSSSRGRRTSA
                     KGLVEDARNSTLGFGAIYVINLPVRSDRRDALSLMSALNGVDVEYIDGVTGDEVPDRA
                     LPPPASHVTLLSGNIGSWRGHLNAIRAVVENNLDSALILEDDADWDLRIHDQMSDFAK
                     ATRTLTQPLAGSKASYADPTFYDPSEGGQPELMNFAQLPRTVLPQVSPYGDDWDVLWI
                     GHCGTEAPNINLKDKDKAKLSKTLPRGRVIQYNDDTVPENHYLNVMEQELDPREIFPD
                     HTRTTHHVMGQICSLGYAVSQRGARRILYEMGVGKFDGPYDIMLRDICEGVNERPKGA
                     VCLSVEPGLFNHHRPVGLSSYHSDISEHLDAPVEVAFSENIRYSARLSIPKLIVGDPE
                     LEDQWPDIVGLEKNDKTEITRKSS"
     gene            <1150389..>1151050
                     /locus_tag="TRUGW13939_05253"
                     /db_xref="GeneID:55992751"
     mRNA            join(<1150389..1150839,1150893..>1151050)
                     /locus_tag="TRUGW13939_05253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488417.1"
                     /db_xref="GeneID:55992751"
     CDS             join(1150389..1150839,1150893..1151050)
                     /locus_tag="TRUGW13939_05253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344310.1"
                     /db_xref="GeneID:55992751"
                     /translation="MQLTQDQLQKKNEEVIGMYQEKCKKHTQMTNLYNLLKSRAMRSQ
                     IQTAASDSVSQTLQSLPRMDNSNTRVPMPGMNNFTSNGSRPMVPQSTRLTSRHFNALP
                     SPEFQTLSSGAERLSRHQRSGGASSREKQGRLGIDLESMPPPPKLPFAAHQQSIPTPS
                     HHRTRLPAAPQAAFVRNEQEQMERATSTVDFSRFKDFTFNPG"
     gene            complement(<1151294..>1154188)
                     /locus_tag="TRUGW13939_05254"
                     /db_xref="GeneID:55992752"
     mRNA            complement(<1151294..>1154188)
                     /locus_tag="TRUGW13939_05254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488418.1"
                     /db_xref="GeneID:55992752"
     CDS             complement(1151294..1154188)
                     /locus_tag="TRUGW13939_05254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344311.1"
                     /db_xref="GeneID:55992752"
                     /translation="MSTAAASVPSSVADPVFSSAAAYNASSSLLSPLTLLKLPLQAIR
                     KAESFAFTTLPQNVARLTGLDGLVNNGAGGEGHAVTAAVVAAATGTGADHAAEGMAEA
                     VMAEGSLNLTDIFQAMRRFSGFFSYMTSRWSLACFSVALILNRVTIYASTRRHLSLPW
                     HKRLALRIVPIIVFVAQILSLLRAMRCQTSPDYSGLRYGHPGKHFSFDHASGGGVLYY
                     LGSSFLPWETDQQSCSAVQMYRHSGSNEIPSGSFTLLWPVFMCLCLSHFVETLSCALQ
                     GRTVVTEAGMSIFEHSLAFAEAETMISQSIGLGMFGLTKPSSAKGDLPVAGEGTSALH
                     LLTRTQVLEKMNVTPELLLIILISCCNSLCSNLLDVIGKQSRYRLVNTTIWGFCFMGA
                     MAWGFSDSRSLGAETGVLKFPTVCIVGFVPHLLILIGIAICLCIYGLAVLITAFALPP
                     DISQPSSTWERFSSAHENMQGASQIRNVRLNMHEDFYTTLLRIGYAALTAASEAVFLN
                     EGRSVVARRRTWLENDRLAEIETMRRRAPVRPSMWAESSTAHLENPTILNFDISSKSD
                     HWESGYKREQKIEKLAHNSRPVHSQGSLGGVGAFQGATRCYHGFSFFRGIFYLISRWL
                     LVGLSKVLNRLGITTRPQWMIRFIGSNKRRKRSRAREAPASLDFWILTEDGELELPED
                     NEFDVEKEMRRREALSQSRWEEADEARLENKLYNWWTAGGSWGNQDESEDYVPLENDF
                     DDTTSVISMQTNDSEWEDYDDASDGRRTPTQKDPFPATRSREGTPLLETLLDTSSLAR
                     LLDPRDQESKNEARILAAHLVADREGRVMTRSRLRAQIESERARILMPARSVSSTASS
                     AGTGNDKSRPTPDEEADILEKLIIARRNEMSSRNHDAPQNSWQTGAAGLGTDGPQCVI
                     CQTTPRSIITWPCRCLCVCEDCRVSLAMNNFGSCVTCRQEVFGFVRLWVP"
     gene            complement(<1155169..>1156408)
                     /locus_tag="TRUGW13939_05255"
                     /db_xref="GeneID:55992753"
     mRNA            complement(join(<1155169..1155483,1155539..1156100,
                     1156164..>1156408))
                     /locus_tag="TRUGW13939_05255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488419.1"
                     /db_xref="GeneID:55992753"
     CDS             complement(join(1155169..1155483,1155539..1156100,
                     1156164..1156408))
                     /locus_tag="TRUGW13939_05255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344312.1"
                     /db_xref="GeneID:55992753"
                     /translation="MPPSTEPPSRTSTPRAFTQQSASAEDILKSQTVGLVNLSDYRKR
                     RAEVFEQKEREAHDKSLGISPSGNSRTATPSQGELTDGASTPASASSDGRPKKKKKTL
                     AKSKLSFGDDEDEAEPDSSIATTSKSKAVSKKNTAEGTPTLQGRKIIANPNAPPPPKA
                     QTKAAIEAEAQARESLRKEFLALQDAIKATEIIIPFVFYDGTNIPAGHVKLKKGDHVW
                     LFLDRCRKVGADLGVAGAQGNGRVKRDSRREWARVGVDDLMLVRGDIIVPHHYEFYYF
                     IANKIPSFSNSGGLMFDFSSEAPPEKEHDPLSRSNNEEQLEGADADPVLTKVVDRRWY
                     ERNKHIFPASLWREYEQGDDFLEKMKSTRRDAEGNVFFF"
     gene            <1157017..>1158120
                     /locus_tag="TRUGW13939_05256"
                     /db_xref="GeneID:55992754"
     mRNA            join(<1157017..1157185,1157244..1157271,1157331..>1158120)
                     /locus_tag="TRUGW13939_05256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488420.1"
                     /db_xref="GeneID:55992754"
     CDS             join(1157017..1157185,1157244..1157271,1157331..1158120)
                     /locus_tag="TRUGW13939_05256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344313.1"
                     /db_xref="GeneID:55992754"
                     /translation="MDEDDDDLYDPADSFPPQQETNGHAQHGGNVNADESYEPEEEEE
                     EEDDASFPNEKRQAPADAPSNLAHLRHAAVANEPLRSASADIKPPTPSIPTQLDTGAA
                     APVQGRPVPTLKSGAAYPAIHTSTVDVDADPIHPTTGKPITSTDLDTDFPSEEDKPWR
                     RPGSDITDFFNYGFDEFTWASYCLKQQGLRNEVTDQKKQLDDMQNFMTMGGMPGMPGA
                     PQAPAPPAQGGGPGGMPGMSAMPAMPGVPDMSPDMMQGMLASMMSQGLDPSAMDPMAF
                     MQHAQAMIQPGGGQQNQGYGGQGNQQQMGYGGGYNQQGGYGGGRGRGGGRRW"
     gene            <1158510..>1159043
                     /locus_tag="TRUGW13939_05257"
                     /db_xref="GeneID:55992755"
     mRNA            join(<1158510..1158512,1158617..1158838,1158904..1158962,
                     1159019..>1159043)
                     /locus_tag="TRUGW13939_05257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488421.1"
                     /db_xref="GeneID:55992755"
     CDS             join(1158510..1158512,1158617..1158838,1158904..1158962,
                     1159019..1159043)
                     /locus_tag="TRUGW13939_05257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344314.1"
                     /db_xref="GeneID:55992755"
                     /translation="MALRNIKNLVPLLDRVLVQRLKPEAKTASGIFLPESTLKDINQA
                     TVLAVGPGAIDRTGNKIPMSVTSGDKVLIPQFGGSAVKVGEDEYTLFRDSEILAKINE
                     "
     gene            complement(<1159457..>1159930)
                     /locus_tag="TRUGW13939_05258"
                     /db_xref="GeneID:55992756"
     mRNA            complement(<1159457..>1159930)
                     /locus_tag="TRUGW13939_05258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488422.1"
                     /db_xref="GeneID:55992756"
     CDS             complement(1159457..1159930)
                     /locus_tag="TRUGW13939_05258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344315.1"
                     /db_xref="GeneID:55992756"
                     /translation="MSSIRELSAFCLALSKICTIQTLLAQPDHTLEWVLAIATKHAVS
                     TTTTAASSEGGTQDETLWSSYLDEQTQWELFLRRAGLNPFAAQIVLDILKNSSMLSQD
                     DTSKDGRLRDLSRFIEMSREARRELFQDAVGQRVLQRVENAVEMDWQVEWAIDLS"
     gene            complement(<1160089..>1163304)
                     /locus_tag="TRUGW13939_05259"
                     /db_xref="GeneID:55992757"
     mRNA            complement(join(<1160089..1160943,1160990..1161711,
                     1161967..1162123,1162183..1162623,1162683..1162799,
                     1162852..>1163304))
                     /locus_tag="TRUGW13939_05259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488423.1"
                     /db_xref="GeneID:55992757"
     CDS             complement(join(1160089..1160943,1160990..1161711,
                     1161967..1162123,1162183..1162623,1162683..1162799,
                     1162852..1163304))
                     /locus_tag="TRUGW13939_05259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344316.1"
                     /db_xref="GeneID:55992757"
                     /translation="MAPSLEEPIVPSAPLEIRSKSLAKGTTTNKFSYEPGRTVVQKHD
                     TYAYEDLLPSFPDLHWDAIGPVPYQEKGLLGDPAFKNLLDAATDVFDYTPKIGTEIHG
                     VDLANLTDAQKNDLARLIAVRGVVFFRGQDNLDVNAQRELGRYFGSLHKHATTATPKN
                     GLEDVHVVYTGDNSLDQRALFSPSFLWHSDVTYEVQPPSYTSLKVLTGPPRGGGGDTL
                     WSSQYAAYDALSPHMQTYLKGLTALHSADMQANDTNALGRTVRRPPVTTEHPLIRTNP
                     VTGWNSLWFNPGFVTGIVGVPKLESDTIVRYLTEIITATQEAHVRFQWGVNDVAFWDN
                     RVTNHSASYGFAPHRRHAVRVAAQAEKPYLDPAARSQEEELAARYGLPVVNKDGTRSD
                     MTSTSRSNPVDTPITLNSTSHTSYIMYCSRDSPLENPTLAASENDPREILSNLRHAHD
                     FSTDDRFIQDIIHNAQKTSIATLQNEKLELGKDGTKYLFSALKEASSLHAGGSSLTEE
                     ERVSCCLSSAVANRDFKSELSHLMTELTQSVNELCRKEDPMLVLNEAIPKLIARETAN
                     GDEGLEFPGHFWELPGIVEQNFKTEKLDASKETASFLKSALGYLDEKEHRREIDRLFE
                     DSALSTSLQGCRPRDMSPLYIVSETLDAYDSPDYQNDLNTADLSQGTENISAEEKHTN
                     EPQKPTKSKYFSSQTTPNTDKAGKRQIDTDHQTTIEPDRVEIETSETVPEEPIQTKET
                     VSNNPKESPTNQEVVSCTPESRHQSPEDVNSFNIPPSLGTLSSFMQTRGHKNKRRKIQ
                     NTSSYFNGPTAPILDTRRATNAERNPPEQSELHKTPTNDCDSYPQFPPRESKQPLLLI
                     LSTSLLHTNRSLVNSLESLSSPTSRLIFRDYTTRNSAALDSNIVEEADIIPSPKQAFY
                     "
     gene            complement(<1164316..>1166142)
                     /locus_tag="TRUGW13939_05260"
                     /db_xref="GeneID:55992758"
     mRNA            complement(join(<1164316..1165279,1165331..1165864,
                     1166069..>1166142))
                     /locus_tag="TRUGW13939_05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488424.1"
                     /db_xref="GeneID:55992758"
     CDS             complement(join(1164316..1165279,1165331..1165864,
                     1166069..1166142))
                     /locus_tag="TRUGW13939_05260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344317.1"
                     /db_xref="GeneID:55992758"
                     /translation="MFGAKSAAPAAGGLSINTSSANSLFSNTAAPTSQPATAGSLFGN
                     QQQKPAGSLFGNTATPNNTQQSGGSLFGGQGSNTTGSTQQSGMATGSLFGAAPATSQP
                     QGGGLFGNTAAKPAATGPSLFGNTNTQQTGAATTGGGLFGNTNTQQQQSGTTGGGLFG
                     NTNTAQTGTGGASLFGGTQGAAAPTQNKSLFGAAPATGGTSLFGGTQNAGQQQQQQQQ
                     QQQKPTLSIFGAQNATQQQPQQPTSAPGTVVQGVRVDASNLLPTTKFESCADEIKRTI
                     EQIDTYVLSQLNMCNEVTDLLPMIAQQGSTIPNDVSFVEGKLETMQHALENDARDINH
                     VRNMVTRNAAEAQVAFRAIDNLKLPLQYQSSSGGWWSVPEQQLSERQSLRSSIKNRKS
                     TLALPHGVEGDSSTTDSIDGVPVNLVEYFSHRSDEMSTVLDGYKKNLKEIEDHLYGVE
                     SSLSRQINEFTASRNRDNTPNGSTAKSQLADLAAALGDVEAGILGVASRLGAAKEEVQ
                     ELAMGPPTLGLGRLG"
     gene            <1166693..>1168086
                     /locus_tag="TRUGW13939_05261"
                     /db_xref="GeneID:55992759"
     mRNA            join(<1166693..1166859,1166912..1166974,1167031..1167899,
                     1167956..>1168086)
                     /locus_tag="TRUGW13939_05261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488425.1"
                     /db_xref="GeneID:55992759"
     CDS             join(1166693..1166859,1166912..1166974,1167031..1167899,
                     1167956..1168086)
                     /locus_tag="TRUGW13939_05261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344318.1"
                     /db_xref="GeneID:55992759"
                     /translation="MASSPTQLNEEPAPELDPKLLATCEASEVPVSSDSRDGSSGIHD
                     TADSNYFKHAEWTPDGTTVVTNSADNHIRTFILPPDLLEEREQPLQLEPYSTIPSTEP
                     VYATAIYPFFSLQDPSTTLVVSSVRDHPIRLSSALAPQTLGTYSLVNPTTEAFITPHS
                     ILYPSHLGGSHFITGSDSLICIFDVSRPGNEGPVTRLPTIPSKRKQIVGGGVGMKGIV
                     SALAMNPAGDGILAAGTFTRHVALYGSRGSGELIGTFCIAKTEADKHIGGSGITQLLW
                     SPCGRYLYIAERKSQGMLIYDIRVTGQLLGWLEGREALTNQRMKADVVATGEQESHEI
                     WAGGTDGAVRVWSNPFASIGAQKPQYEFSMHGDPVTSSVLHPGSSVLATCSGQKQFPD
                     YEQGRQKYDNSLKIWSL"
     gene            complement(<1168274..>1169286)
                     /locus_tag="TRUGW13939_05262"
                     /db_xref="GeneID:55992760"
     mRNA            complement(join(<1168274..1168981,1169046..1169205,
                     1169273..>1169286))
                     /locus_tag="TRUGW13939_05262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488426.1"
                     /db_xref="GeneID:55992760"
     CDS             complement(join(1168274..1168981,1169046..1169205,
                     1169273..1169286))
                     /locus_tag="TRUGW13939_05262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344319.1"
                     /db_xref="GeneID:55992760"
                     /translation="MSSTEFPRIRACLFDMDGLLLDTEDRYTIMTNEILQMYGKPSLP
                     WSIKAQLQGRPAPESSKIFHEWAHLPISHEEYSQKQVELAPKYFTASKPLPGVVKLLN
                     DLRSTENTDKPVYIALATSSHRKNYKLKTDHLADLFALFPEQRKVLGDDPRIGQGRGK
                     PLPDIYLLALETINDELTERGEELIKPEECLVFEDAVPGVEAGRRAGMQVIWAPHPGL
                     LNEYKGREDEVLAGLTGQHKEEEKSEPEKEVQSLQAERLTRGQHPGKLGTLKDGWAQI
                     LPSLEDFPYERYGITIT"
     gene            <1169671..>1175338
                     /locus_tag="TRUGW13939_05263"
                     /db_xref="GeneID:55992761"
     mRNA            join(<1169671..1169775,1169846..1170466,1170523..1170625,
                     1171241..1171337,1171394..1171672,1171732..1171907,
                     1171976..1172346,1172397..1173008,1173490..1173683,
                     1173750..1173919,1173981..1174028,1174091..1174281,
                     1174347..1174688,1174742..>1175338)
                     /locus_tag="TRUGW13939_05263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488427.1"
                     /db_xref="GeneID:55992761"
     CDS             join(1169671..1169775,1169846..1170466,1170523..1170625,
                     1171241..1171337,1171394..1171672,1171732..1171907,
                     1171976..1172346,1172397..1173008,1173490..1173683,
                     1173750..1173919,1173981..1174028,1174091..1174281,
                     1174347..1174688,1174742..1175338)
                     /locus_tag="TRUGW13939_05263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344320.1"
                     /db_xref="GeneID:55992761"
                     /translation="MAQTEPPNANPATENEDENSDDEFHDAHFPAEEEAKLLEESNAC
                     KDQANKQFAAAAYSDAISTYDRALASCPNYLDYEIAVLKSNMSACYLKLQDWKAAVDS
                     ATTSIDCLERCLPKPIKKAEDGEANTEPESKEEDAVVELSGDDEEEETKQLERLQQED
                     SRRQAVKRIRAKALMRRARAKTELSGWANLQGAEEDYKELAAMDNLPPSDQKIVQKGL
                     RELPSRIQVAKEKEMGEMMGKLKDLGNGILKPFGLSTDNFQFTKDEGTGGYSMQFNQG
                     GLKYASLQNRLADAELVASRTTEEGVLDATKDGPTTAHPPIGCDLELGAIQKTLPKKD
                     LHQSDTECLNLNIAVPDGTTSTSKLPVLLFIHGGGLVIGANSWPQFDWTRVIKLSIEK
                     GVPIVAVGINYRVGAFGFLTSEELRSAGYKTNNGLRDQRVSIDWVHRHIGDFGGDPDN
                     ITLAGMSAGGASALQQLHSNTSTPLCKRVLSMSGTNLLLSPLPLAVHEQGYKAATQAW
                     GLDGLSPENRVKAILDTPAAELVAKLPPSVPIGLAADGDAIPTPPNFASISDKSSSGY
                     PKGRSWCKEILIGDAQHDTSIFAYTMGHQSKDCASRFTSALKGALSAHPSDVISHILE
                     AYGLAATTPDAEAWPRVLEFLNDVHFHAAVLAYAGGWPEDGTAYVYYFNETNPFDGPS
                     KGQSSHILDLAYFYQNFNDFLTPDQQEVARAFAEDLLKFVSGKAPWEPCKDVGEGFRA
                     RVFGPSSKGQTRRVIKDAYGGESQRRSVLPQLVQQQGVKWDELAVVFPNMATASLHHS
                     QLNATFNGVQIQSTGIKINKFKGIKYAHIPARFEKSQPVSAEELNGQTIDATQYGPKC
                     PQVDIDVRHLLRIPEDYQINEEPEDEFECLNLDVTVPAGTPAGRNLPVFIWIYGGSQA
                     VTFCSAGSGICDTTKIVGDSVDARKPIIAVVPNYRLNLFGFGDGKGTGEINLSLKDQA
                     LAIDWVRKHISGFGGDPENITLCGESAGGVYVHAHLITGPPVRRAILMSGSLYLTSPM
                     PHSLGKGVLQVCEVRAQELEGKSLRECSQKIFKQILTENNLSRCWMQEEDVLADWETK
                     AEQVEELVIGDTEFESAIWRRGIETLPPSQIISTFTESNSEWGEKLRKAYHIVPGRPT
                     ASTLGALDFVHDVKYSLPIELICEKVQATNKDTKVYRYLVDESNPWQPSARAHHAVDL
                     IFLFGTMDISHNPTAEDLGKDMRRRWINFVNGDKPWAELSTGARFAFGPYGECKEIDE
                     RQYAARRRVHVFSLLREAGAGVYGPIVNKLIAGRISLLN"
     gene            complement(<1175433..>1177234)
                     /locus_tag="TRUGW13939_05264"
                     /db_xref="GeneID:55992762"
     mRNA            complement(join(<1175433..1175695,1175751..1175873,
                     1175930..1176092,1176153..1176752,1176814..1176988,
                     1177040..1177062,1177115..>1177234))
                     /locus_tag="TRUGW13939_05264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488428.1"
                     /db_xref="GeneID:55992762"
     CDS             complement(join(1175433..1175695,1175751..1175873,
                     1175930..1176092,1176153..1176752,1176814..1176988,
                     1177040..1177062,1177115..1177234))
                     /locus_tag="TRUGW13939_05264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344321.1"
                     /db_xref="GeneID:55992762"
                     /translation="MPSTNDLADPKEYQKIFHWAETQKDGVIPSFNTRKNDPYKYQEG
                     FGNHFSSEAIPGTIPQGQNSPRNVRFGLYAEQMTASAFVAPRNANKKAWLYRVRPAVA
                     HQGFTELPDNKDTESCFLPLNPKIHVSPTQLAWLPTEIPTEETDFVSGLRTFAGSGDP
                     TLREGLATHVYAANKSMTKKAFVNSDGEFLIAPEKGALDIQTEFGPLFVQPGEIVIIQ
                     RGIRFRVELPDGPSRGYILEIWGSTFELPELGPLGSNSLANTRDFLTPTAKYEVIKEP
                     WEIVYKLGGKFFKSTQQHSPFDVVAWHGNYIPYKYDMTKFINVGSISVDHIDPSIFCI
                     LTAKSRDLAAPLADLLIFSPRWDVASHTYRPPYYHRNAASELMGLIYGDYGGRSDEFM
                     PGSISFECGMVPHGVAYDQFKAATESAPPVMQISPASIAIMFESSRPFTITDYAWNSN
                     KKHEHEPKMWDNLVDNFSAHQKEIDEILSKQGEVNGKH"
     gene            complement(<1178194..>1180903)
                     /locus_tag="TRUGW13939_05265"
                     /db_xref="GeneID:55992763"
     mRNA            complement(join(<1178194..1178276,1178326..1178526,
                     1178579..1180632,1180685..1180739,1180801..>1180903))
                     /locus_tag="TRUGW13939_05265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488429.1"
                     /db_xref="GeneID:55992763"
     CDS             complement(join(1178194..1178276,1178326..1178526,
                     1178579..1180632,1180685..1180739,1180801..1180903))
                     /locus_tag="TRUGW13939_05265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344322.1"
                     /db_xref="GeneID:55992763"
                     /translation="MPQERFEKGKRLRACSICGRTFKRTEHCIRHERAHFRERPFSCR
                     FCEKSYGRKDLLVRHERTLHADQWAMAQSTASTNNSSQTRTNRRRQSRSSWDPAPALP
                     TPVQSYKPEPQNGVLINNETVIQYESFLPSPRVSSSSEISDPELVSGVSEAFDLDRHL
                     DPSLANLANPVNMVAGAPNEDGSLHFQSSFPLDSHHFSYEPHMSHIQPQEPIQFNYDH
                     GFPLDPSLTMDLPKSDYIPTSSTDTEPGNPNFFTLLPGSSTDDQVLLLNQIITAENSN
                     DGSTNNIFALDKMPSEQRRRGRPSRNSKIRSEPQLPKVMTEETRIFLITDIQERLSID
                     SKELRIPSLQSLHHFMNTFFKSFNNHLPIFHPPSFDISETPSPLFLAMCSIGALFDKD
                     RDTANHLREIANEALQSVDSGSSSRSLWEVQSRLLLTVGAAFGGNGAAVAWALENIGF
                     FHREFAWRRSALSASRETAPENWATWIERESTKRLLFGIFITSSLLTAAYNVSPGIST
                     TEDLKIEMPEPETIWMAADEEHWKEAMAVRVNRPLDVNQALTALLFGKDFNPDLEQQW
                     SPFSAAILMHAVNVHMWHVTQSTQSFMNFSIDAKAEEQMKALCTSQTEESLSRCHRVL
                     ALGKSAGIASTRGSVERTLLFNGMAVLRSCYVRVFTGSGAFNRTMLFCDDGQEVLRAA
                     RDYVQIQQVRSPFLAKAVAQVFDGLLIPIRHGNQLVNKTDVFTCSIEHTVAAWDCALF
                     YTKWVHTLEMQQGFAPPDHEEKKNLDNLSEMLQEVGSNDNGRTSLAASAAKMWASFLD
                     DNWTWEVTWRMGNVLRQLADVYENEKRFLGSRS"
     gene            <1181933..>1182983
                     /locus_tag="TRUGW13939_05266"
                     /db_xref="GeneID:55992764"
     mRNA            join(<1181933..1182150,1182226..1182779,1182853..>1182983)
                     /locus_tag="TRUGW13939_05266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488430.1"
                     /db_xref="GeneID:55992764"
     CDS             join(1181933..1182150,1182226..1182779,1182853..1182983)
                     /locus_tag="TRUGW13939_05266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344323.1"
                     /db_xref="GeneID:55992764"
                     /translation="MATSKDLSAQTIFGIKGFVAVITNGATGVGLMAAQTLVTNGARV
                     YIVSRRQDFLQKAAETVNAGASSGGKLVPITADISQTDGIRTISSEITRLEPDGINIL
                     VNNGNVSPEERARSEAYTIDFSDANAVSKWMTTDGPDAWKDAYSGNIASHHFLTAALL
                     PLLDKGRQQTPGHSSAIINIASAAGLTKTHSHGQFAFSSTKAAFIHLTKEWAHTFLPL
                     RVRVNCISPGIFSPVFPGEGVRDEGQRERLERVGNEIPAGRPGKETDIGAAILYLCSK
                     AGTYVNGQVLHLDGGILLKAPSTV"
     gene            complement(<1183276..>1184545)
                     /locus_tag="TRUGW13939_05267"
                     /db_xref="GeneID:55992765"
     mRNA            complement(join(<1183276..1183481,1183535..1184068,
                     1184119..1184224,1184283..1184324,1184384..>1184545))
                     /locus_tag="TRUGW13939_05267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488431.1"
                     /db_xref="GeneID:55992765"
     CDS             complement(join(1183276..1183481,1183535..1184068,
                     1184119..1184224,1184283..1184324,1184384..1184545))
                     /locus_tag="TRUGW13939_05267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344324.1"
                     /db_xref="GeneID:55992765"
                     /translation="MENNMEIDTARSPEPHHLSPTTDPGSIPTLDGWIENLMSCKQLA
                     ENDVQRLCDRAREVLQDESNVQPVKCPVTVCGDIHGQFHDLMELFRIGGPNPDTNYLF
                     MGDYVDRGYYSVETVTLLVCLKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNA
                     NVWKYFTDLFDYLPLTALIENQIFCLHGGLSPSIDTLDNIRSLDRIQEVPHEGPMCDL
                     LWSDPDDRCGWGISPRGAGYTFGQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNV
                     VTIFSAPNYCYRCGNQAAIMEIDEHLKYTLYVYTLVPIPHSDILTLPAFNLTHAPERE
                     SRWSQDGHQTTSFKS"
     gene            complement(<1185196..>1186325)
                     /locus_tag="TRUGW13939_05268"
                     /db_xref="GeneID:55992766"
     mRNA            complement(join(<1185196..1186079,1186136..>1186325))
                     /locus_tag="TRUGW13939_05268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488432.1"
                     /db_xref="GeneID:55992766"
     CDS             complement(join(1185196..1186079,1186136..1186325))
                     /locus_tag="TRUGW13939_05268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344325.1"
                     /db_xref="GeneID:55992766"
                     /translation="MAGAEDISPDTSRVLDVALQSVRGDGQTEATVGSAYELIALVGH
                     ASMVAAGFRLVGLGEDDNLVGNTDATVLPKEWSAHKNTYSFRYAPSESSIEYILKVNR
                     LGNNAVIMGLAGEDKATSFDLTVDDYISTNAFPLTLASDAVVTLKESFKSSARLEDLV
                     GMFKVHVIQRFQPRSAFKEATRESEDQRATQPEEPPRHDPLRDDQGPVPARPYPFDDP
                     LAAAPRRPGPAGDFAPPGFEDEFEINRPPRGFVPPYGGGGVPRSGQQDLYPQGLGPYD
                     PLRGSFGPGGGGGGMHPTPDDPMFGGSGGQGGYNPRAPPGSRYDPVGPWDAPPSGRGQ
                     GPGGRGFGPGGFGSGGFGGGGII"
     gene            <1187413..>1192138
                     /locus_tag="TRUGW13939_05269"
                     /db_xref="GeneID:55992767"
     mRNA            join(<1187413..1187504,1187614..1188040,1188093..1191786,
                     1191849..>1192138)
                     /locus_tag="TRUGW13939_05269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488433.1"
                     /db_xref="GeneID:55992767"
     CDS             join(1187413..1187504,1187614..1188040,1188093..1191786,
                     1191849..1192138)
                     /locus_tag="TRUGW13939_05269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344326.1"
                     /db_xref="GeneID:55992767"
                     /translation="MPSPLPSSFASAAAGNTQDPRRDSSVGGGEWTRSRMNGATQTFR
                     RPSVATNLSHTRDSSQPMSASTPTSAAYIPPHLSSSYQPRNGSTADSRYSKEQLLSIF
                     KTQRDSGTLGKNMGDHFLATWNPLEDSSSTNGAWGKREDQKDPSSGPEVCWDHLGLHG
                     PLALSDLTDEERELFTTTVNSPLKPPPSSASKDNAGPVTGRKSSISHANTFSTSSPNS
                     ARPPARRRETQDSTGNPMSPTSGTRFFREEPNTTTPPPSLLRRKTDIRDSSSTIRPED
                     KDKAKEITGREGSDISSPFGSLKRSTTNPVVSGLAGATSPWPSGSQNSPMGAFGSFSL
                     AGSNAQPSPATEKRPGYGSLRGESRFKGLLSKDSSEDVGRDKALQRGLDRLTEDEGGS
                     RSHSPWGEPVKTRAVRSETNPFDEARSGSASLGGSQEVASGVDELGFSAFGMTAGVPG
                     LRELIGRGEDPQSPFHGLPGLEPASPTNTNPYQSPRGEKVEEDVDTDGSDVQRTQHPG
                     LSGLRDESSAFGSIRRAGSGLDTSVGDRSQTSSAGPGRNFSGLGGLGAVPGLGGASGW
                     PSAGAIGTPTRERSAFTGFGDPIFGSVAEMQSPSLSSLGGGGFFGSHAGLSNTGSIGR
                     TSKMGALFPSALQEQMQGLDDGSRQQGRVLFDARHNELMSDAEIELNTSSSASSQVPI
                     TSSTSALHTPLAASGEGPQTSQTPSAGSSGTIPTAQQRTMVMPDRMRWIYRDPQGNIQ
                     GPWSGLEMHDWFKAGFFTAELQVKKLEDPEFEPLAQLVRRIGNSREPFLVPQIGIPHG
                     PEPTSAAWTAPSQTGAAQPPFANSFPTFGTTLTAEQQNALERRKQEEQYLMARQKEHL
                     AQQQAMMKQIQLQGGPHNIQPPLQHQSSAHSLQSQPSFGSINSPAAGYQPSPIHGPIQ
                     PPQAMPGYFDAPFRQNSLSLGPQILGTDFGSHDELPGLLDRLNINRSGPFPLNSQSSF
                     GSRQQEAGVNSQQINSMLQDRARLQQEQDQYDKSHPDSLFEQQAREERLRQFHALRTD
                     EEELALRGGEGLPTHPTAALAQQVEQAQLGDEEDDFLENDDESEVSPGEPLSLSQQVQ
                     KAATAQRQQKQAQTEAAWTVKGDPGIPHPFPPPPSASPLPAPAAQRNRQNVADALAAT
                     SRSQSQTPIDTPSTSIAPWAKDTTEAPKGPSLKEIQEAEARNAAQREELAAQARRAQF
                     IAEQERLSQAQQAAAPGLPSTANWASGASPAPPSTASSVWSKPVAKATTAPAKTLAQI
                     QKEEEARKQKLAQATVVQTTAASPTGASAAAAAAAGKRYADLASKVASPMAPTASGAW
                     TTVGAGGKAKAPPVVAPISPAAPAAARSASATMVVPQVAKAKPVAPIRTVTVGTIPTA
                     NPNRATEEFTKWAKITLGKGLDNGINVDDFVQQLLLLPVEAEIISDSVYANSQTLDGR
                     RFADEFIRRRKLAEKGIVEPVSADTKGSSGGWNEVAKKSFSQPKPEEDVTATFKVVAG
                     KKKGKR"
     gene            <1193753..>1195540
                     /locus_tag="TRUGW13939_05270"
                     /db_xref="GeneID:55992768"
     mRNA            join(<1193753..1194233,1194293..1194597,1194670..1194791,
                     1194850..>1195540)
                     /locus_tag="TRUGW13939_05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488434.1"
                     /db_xref="GeneID:55992768"
     CDS             join(1193753..1194233,1194293..1194597,1194670..1194791,
                     1194850..1195540)
                     /locus_tag="TRUGW13939_05270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344327.1"
                     /db_xref="GeneID:55992768"
                     /translation="MSLPKIPEDDSLSQRRASTSPSWSDDNGQPRFIFVLEKNQPETR
                     THAMRTHWQERRKRKTEIRLSDQTTRLLRAKPEKSNSSMSTQKRVQDSRSYTVDSRDT
                     NSTTPQEIGQIVDASRVLAGIPTQFLTGINYALSSSRLDPFDVFPVTLTTEHHKLINH
                     WLVTHATMMFGKMPASEFNPMRDVWFPLDLSNAASFNAIMAHSAAHLAYLYSGTAPTC
                     GTNSSQALKYKANAILILREWMNDPEKSLSNDAFAGTVRLLTFERYWGAEEEWKIHRG
                     GLQRMIEARGGLHELHSDWRLELVVGLVSLMSEPSWFSPANNISSITCPDFLRNAMLG
                     MDFDIKHMRSIWLISFIQDIRNLMSMSSHLYGNGLTKFPALHDAVLLILSDFKTDTDF
                     SSSLMDYDRLELLFSISIMMQESISLSYIHPTHSPLTTKDDTLQLLDISLLAAPEASK
                     TSVHALLSFLRTYFLEFGLSGVHKIEYVMQMTEIVTHLSLEAHRGIEKCLLNMFCRMK
                     NAVMVFHPDEGATPDSLLSFVHGQ"
     gene            <1197020..>1197747
                     /locus_tag="TRUGW13939_05271"
                     /db_xref="GeneID:55992769"
     mRNA            join(<1197020..1197181,1197237..1197340,1197403..1197525,
                     1197573..>1197747)
                     /locus_tag="TRUGW13939_05271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488435.1"
                     /db_xref="GeneID:55992769"
     CDS             join(1197020..1197181,1197237..1197340,1197403..1197525,
                     1197573..1197747)
                     /locus_tag="TRUGW13939_05271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344328.1"
                     /db_xref="GeneID:55992769"
                     /translation="MTSTKPSFTTSLPKFFLIANRVLQWASSVIVLGITSYFINKGVR
                     GLTTTYVEIIAAISVAAFLPAFVSPFLPASVNGIVLGIDVIFSYLWLAAFIFSALDYN
                     RNDCLANAPPGFSCSKKWANEAFIFLTFIFTFFSILFETWTLWLSQLDKHPLLQSHEK
                     TSQPDIERNGAQPTTQNNTEEPTTTTA"
     gene            complement(<1198700..>1200583)
                     /locus_tag="TRUGW13939_05272"
                     /db_xref="GeneID:55992770"
     mRNA            complement(join(<1198700..1198780,1198833..1198996,
                     1199047..>1200583))
                     /locus_tag="TRUGW13939_05272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488436.1"
                     /db_xref="GeneID:55992770"
     CDS             complement(join(1198700..1198780,1198833..1198996,
                     1199047..1200583))
                     /locus_tag="TRUGW13939_05272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344329.1"
                     /db_xref="GeneID:55992770"
                     /translation="MATVSNGSEYDFVVVGGGTAGNAVAGRLAENPDVRVLVVEAGIP
                     NPDQVEQITTPSKAFTLRGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSTCANYF
                     TWIPGSKPTFDDWEDYGGKDWNWDSCVEYLRKCATYHDDEKLYPAELSKIGTGGPVHI
                     SHADLVPEMQPFRDALTQAWVSKGQPLTEDIFSGEMKGLTHCVDTIHRGERQGSFLYL
                     KNKPNVTILYGVQSKKLIIDPETRICSGVTVISEAYNTEISVYASREVILSQGVFETP
                     KLLMLSGIGPAAELAKHGIDPVVDSSHVGQHLVDHPIVPFVLQLKDGYGLDDHVLRPG
                     ALNDKALATYKKDKTGPVSSGFLELVGFPRIDERLEKYPAYREAKAANGGLDPFGPAG
                     QPHFELDFVGLFSTAFQWHFPLPEQGSYMTVIVDLLRPLSEGQVTLNSTNALVQPNIN
                     LNFFANDLDVLAMREGVRWTYNVLTQGSGFKDIVVGEYPWKMPLHSDDDMDKAVLDRS
                     QTGFHPCGTARLSKNINQGVVDSKLRVHGVRNLRIADASVIPVIPDCRIQNSVYMIGE
                     KGADMIKSEHKDLYESKNIPYFVSSRL"
     gene            <1201214..>1203018
                     /locus_tag="TRUGW13939_05273"
                     /db_xref="GeneID:55992771"
     mRNA            join(<1201214..1201244,1201298..1201430,1201480..1201714,
                     1201767..1201859,1201910..1202329,1202382..1202466,
                     1202540..>1203018)
                     /locus_tag="TRUGW13939_05273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488437.1"
                     /db_xref="GeneID:55992771"
     CDS             join(1201214..1201244,1201298..1201430,1201480..1201714,
                     1201767..1201859,1201910..1202329,1202382..1202466,
                     1202540..1203018)
                     /locus_tag="TRUGW13939_05273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344330.1"
                     /db_xref="GeneID:55992771"
                     /translation="MPKPVFTLAEGQPVADPSVSTTLPTTIGSGGLTTLGDTLLIETL
                     THFNRERIPERVVHAKAAGAWGEFEVTSDISSLTSAKFLNGVGKKTPVLFRLSTTGGE
                     KGSADTVRDVRGFSVKFFTEDGNHDIVGNHVPVFFVRDPVRFPSLNRSHKRHPATNRP
                     DWTMFWDFHVNQPESVHALVHLFGSRGIPDSIRRVTGFGVHTFKMVAADGRFRYCKFH
                     FRPTQNITHFSGQEATRVAGANADFHTQDLWDAISGGQFPTWKLYVQVMELEQAETYG
                     RALFDITKVWPHKDFPLIEVGQMTLNKNPENYFAEIEQAAFSPSNMVPGIAMTPDPML
                     QARMFAYPDAQRYRLGVNYTQLPPNRAICPVYAPYERDGMGTVTRNYGGDPNYVRSTL
                     SPGVPSQVVSDVRHTERIAHNAILGQNEILVDDEDYVQPRELWNRVFDETEKRQWVAN
                     VSETLESVPAQLKEAVIAMFSKVDPRIGQLIDAKTKNSSHL"
     gene            complement(<1203937..>1206973)
                     /locus_tag="TRUGW13939_05274"
                     /db_xref="GeneID:55992772"
     mRNA            complement(join(<1203937..1204210,1204265..1204714,
                     1204775..1205361,1205670..1205767,1206376..1206681,
                     1206733..>1206973))
                     /locus_tag="TRUGW13939_05274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488438.1"
                     /db_xref="GeneID:55992772"
     CDS             complement(join(1203937..1204210,1204265..1204714,
                     1204775..1205361,1205670..1205767,1206376..1206681,
                     1206733..1206973))
                     /locus_tag="TRUGW13939_05274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344331.1"
                     /db_xref="GeneID:55992772"
                     /translation="MYVSSTPAPWHCAPHAGMDTDCYLDAADAERPVSQTTLPATCIA
                     TNFPQPPETRRAPGSPRTVRKRRRLRRSPDQVQLCLATKGLIKSNIRSEQQEGVRLLS
                     EIFRSAPERRRECLYYLALGNFKLGNYAEARRYNDLLIDHEPGNLQAASLRQLIDDKV
                     AKEGLVGVAIVGGIALAAGLVGGFIRSFSLSLGSIVGLRIASRAFLRLLLPPDPPIEQ
                     NTEEPPADGFASASPPPLPPFSSRPSRSPRPPSDDSRYSMFNHNPWQNLDDEDDAQYN
                     DSGNGPRLSRHSYRSPDGRITLTRTTITSGMPGGRRRSMGSPESIDTTDPFRQTIGSI
                     FQEITGAYGPRSRGAFTPDREDPWDEENPSSPRDNYNSNAENRGQFGGGNFLRPPGLF
                     PRDTNGRQPVNLPLTNLNDIFNIIRNEADPESMNRHNGEIHILGAGSGNQMHPLSLLV
                     SLLSGGRMGGDAVYSQEELDHVISQLIDQNTNQGAPPATDTAIQSLPKTTINTEMLGA
                     EGRAECSICMDPVELGTEVTQLPCKHWFHGECIESWLKQHNTCPHCRRGINEGDEAPG
                     TRNNPMIIPSSPPNPQSSNDHSGSPYYGGRPQSFGSSSTFSGNGPGPRQGFSAPPEPD
                     RNHPNQDESSSPGGGLSGWFRSHFGSN"
     gene            <1207294..>1208005
                     /locus_tag="TRUGW13939_05275"
                     /db_xref="GeneID:55992773"
     mRNA            join(<1207294..1207320,1207376..1207773,1207828..>1208005)
                     /locus_tag="TRUGW13939_05275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488439.1"
                     /db_xref="GeneID:55992773"
     CDS             join(1207294..1207320,1207376..1207773,1207828..1208005)
                     /locus_tag="TRUGW13939_05275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344332.1"
                     /db_xref="GeneID:55992773"
                     /translation="MLLDEDPATLVHHTIGNFNIQPDKLAVTRINDSLATLQQSRDLR
                     IRDAETSLRKLSRNLKSLETNYDETVAAHDPGRHAHEILDLDAQKFRTAKAASDLEIE
                     SERLEGELEMLKERLAELEAQGLEGDETVRREREADDATILRLKVYRSLGIDVEADEA
                     GNYNKAIIRNSRKGDVHVVNIDPKFSRFFYANYFWQTMQG"
     gene            complement(<1208177..>1208747)
                     /locus_tag="TRUGW13939_05276"
                     /db_xref="GeneID:55992774"
     mRNA            complement(join(<1208177..1208370,1208418..1208442,
                     1208523..1208609,1208688..>1208747))
                     /locus_tag="TRUGW13939_05276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488440.1"
                     /db_xref="GeneID:55992774"
     CDS             complement(join(1208177..1208370,1208418..1208442,
                     1208523..1208609,1208688..1208747))
                     /locus_tag="TRUGW13939_05276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344333.1"
                     /db_xref="GeneID:55992774"
                     /translation="MPNKFVITALTLVATSVAHTAIAPKWMADPKFKSLPAIPRAYST
                     SGWYQGSLFFLITALVNYRWSALDLPNGLTDPVDKGIAGILVFLLYGSSVWYYGHGAK
                     DTSAAVLLAGSVQAWAAFF"
     gene            complement(<1209239..>1210213)
                     /locus_tag="TRUGW13939_05277"
                     /db_xref="GeneID:55992775"
     mRNA            complement(<1209239..>1210213)
                     /locus_tag="TRUGW13939_05277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488441.1"
                     /db_xref="GeneID:55992775"
     CDS             complement(1209239..1210213)
                     /locus_tag="TRUGW13939_05277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344334.1"
                     /db_xref="GeneID:55992775"
                     /translation="MLFQKPPHSTIPASLIRSFSSTRICPQIGPFTRRLFNIPTAPSS
                     ASSQNHNDLPSFLSYAQRTALPETSTTYVGTHYEYTVLKSLRRFAFDLHRIGGRDDAG
                     TDLVGTWHIPGRTLLAPVRVVVQCKALSTKLGPNLVRELEGAFRHSPTGWRTTDKLAI
                     LISPREATRGVRNTLMRSVYPLFWVMMERDGVIRQVLWNSKVEEMMGFAALGVDMRYQ
                     SSPQTSSPSPTVASGDPARPEVVLTWDGTDLPDMDHMEREMTKKETEWLALWDSENLS
                     NAEKSMLLDTVMDVFPDMGPGAVLSCNKEAIATKKDEVLALLKERFPR"
     gene            <1210435..>1211134
                     /locus_tag="TRUGW13939_05278"
                     /db_xref="GeneID:55992776"
     mRNA            join(<1210435..1210476,1210547..>1211134)
                     /locus_tag="TRUGW13939_05278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488442.1"
                     /db_xref="GeneID:55992776"
     CDS             join(1210435..1210476,1210547..1211134)
                     /locus_tag="TRUGW13939_05278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344335.1"
                     /db_xref="GeneID:55992776"
                     /translation="MADILTQLQTCLDQLATQFYATLCYLTTYHDHLPASSPPQSAGL
                     TDTMPSLAKIPRNQPTAAPMPAGAAAKQTTAEQQQGQGSPSLGAGESSTLPPGAGSTA
                     VLMPGQGDPDQPPLPDPPALFAYRQKELARDLIIKEQQIEYLISRLPGIGSSEAEQEA
                     RIRELEGELRHVHVERERKAQELKKLGKKLEAVLGTVERGIFADRKSEE"
     gene            complement(<1211674..>1215293)
                     /locus_tag="TRUGW13939_05279"
                     /db_xref="GeneID:55992777"
     mRNA            complement(join(<1211674..1214468,1214529..1215020,
                     1215230..>1215293))
                     /locus_tag="TRUGW13939_05279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488443.1"
                     /db_xref="GeneID:55992777"
     CDS             complement(join(1211674..1214468,1214529..1215020,
                     1215230..1215293))
                     /locus_tag="TRUGW13939_05279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344336.1"
                     /db_xref="GeneID:55992777"
                     /translation="MASQAALLLDPRSYRKQMNSKGSNKTERTPVNIGNAVTAPAQMS
                     LANKQISGMDGQPPAIRSHPSSPSRKNPPPSKPTATAGNNIEFEFVNTEELSSSEDGQ
                     AHSKRLRQDEGLNLEHRSLIEDLHNVERREDQPKKRIRTDVDEKPIARTKPQFDVSGN
                     SGLGEYMKEGRQLSNQTAQVVDLTREAAATAASASKDDDDDIEVTGSVDLSTQKVCYG
                     KIDGATVQAHLVPKPAPNNFFADWTRDWPAIKLGIRHQPGMGNRIDVSDPHGRTFGAI
                     DARTAAALVPLLDSQHMTVSMTARLELRRRQPNEIEWQHCSEFYRASINLYGMRKHAE
                     MVGDVLGRNNVWLGTPSMVEQGIPVFNPHSVRRRTQPNYGPSNTPRSRTAAPFEVRTA
                     EEVNDAVMKMFDQLRTTDNIPELDASPMVRTPLLRHQKQALWFMIEKEKNRKYGFKEE
                     DNNSLWRMVQASNGSTRFREIISGTVLGEEPPQTYGGLLADMMGLGKTLSILSLVVGT
                     LAESTEWEKRSPLPDIVRNHPGIRNTKTTLLVSPLSTVNNWVSQVKEHLEEGAISYYV
                     FHGPSRTTDIDELRQYDLVITTYSTILSELSGRGSKRGLSPLLRMNMFRIVLDEAHVI
                     REQSTAQSQAIFRLNGQRRWSVTGTPVQNRLEDLASVTKFLRLYPYDEKAKFAAIILS
                     RFKVGDPTVFASLRVLVDSFTLRRVKDKINLPPRQDKIVMLEFSEQEAQLHEFFRKES
                     DLMMKVIANESKGTIGGRMYHHVLKAMMILRQISAHGKELLDKEDRERLKGMSVHDAI
                     DLEEGEGEEPTGAIDRKAYEMFSLMEESSAAVCAVCNKQLVEHATESSTTDTKDPMAV
                     MLPCFDVLCLDCFTPIKKNFVIQSELTSEQTKCLVCEGWIPATYSAITISGLQQYTES
                     RAEAKNSRKKAKMLGEYEGPHTKTKALISHLLDTAEESARSEDQAPIKSVIFSGWTSH
                     LDLIEIALKDNGLKGFTRIDGTMTLAARNQALDIFAKDDSITILLATIGAGGVGLNLT
                     SASRVYVMEPQYNPASVAQAVDRVHRLGQTRDVTTIQFLMKASIEEKIFEMAKKKQQL
                     AEDSMARGKLDKREVQEARMQAYRSLFR"
     gene            complement(<1216268..>1218715)
                     /locus_tag="TRUGW13939_05280"
                     /db_xref="GeneID:55992778"
     mRNA            complement(join(<1216268..1217155,1217210..>1218715))
                     /locus_tag="TRUGW13939_05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488444.1"
                     /db_xref="GeneID:55992778"
     CDS             complement(join(1216268..1217155,1217210..1218715))
                     /locus_tag="TRUGW13939_05280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344337.1"
                     /db_xref="GeneID:55992778"
                     /translation="MPKRPATSGYARLAQAEEDDRDYYDESEGDGPYAVPQTISGGTQ
                     YAPINARGQMHSSGPSTPPEYRRRNPGYTRRRKYSNSSGVDIKAINARLEKWAEEIAS
                     KFKIHKGRGKSPQDEKLEIHHSVFQAPDGVRPFTAAQLETDEHESEERSRRAEFEAVV
                     ESVRTAIELGMHPKLITQGSSGSYFARNADGKTVGVFKPKDEEPYASRNPKWTKWLHR
                     NLFPCCFGRACLIPNLSYVSEAAAYVLDSRLRTDIVPYTDVVWLSSKSFFYDFWERRK
                     AWRGRKPLPPKPGSFQVFLKGYKDATLFLREHPWPDQTNSGFNADDAPKRKKRPWNEA
                     CRPSGVHSDDEDDYEYDAAQARTPSPQSDNSENRFYWSENLKQSFREELEKLVILDYI
                     MRNTDRGLDNWMIKVDWKSEEVSIVADPPKANGQPKEDDQEDAVPNRPVMLDVDRNNS
                     SNRTSPLPYRRHEAMVATSRTGTPSNALEKHASIRLGAIDNSLSWPWKHPDAWRSFPF
                     GWLFLPVSLIGQPFSQKTRDHFLPLLTSTAWWSGTQAALRRVFVQDSDFKESMFARQI
                     AVMKGQAWNVVETLKQPDHGPLELTRRTRVYVWDDLVNVPVAIPMRAPSTEARRHQAQ
                     AFGQDYDEEEMDISAAVSSAPGPDHDLLGFGASTTGDLPNPNRFELARGRASAELGSI
                     GEEPGRDSDTMFDLADDRSRDFASSWAPQPTRPPPRARGNTTDSTQGYQDRSSKHVRH
                     SSFSHRRGSSQWSFGGADDLEGDLGYAAAEGMEGNERKVIVERLEAVKSKNPIFTWC"
     gene            <1220014..>1221898
                     /locus_tag="TRUGW13939_05281"
                     /db_xref="GeneID:55992779"
     mRNA            join(<1220014..1220378,1220491..1220584,1220812..1221120,
                     1221218..>1221898)
                     /locus_tag="TRUGW13939_05281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488445.1"
                     /db_xref="GeneID:55992779"
     CDS             join(<1220014..1220378,1220491..1220584,1220812..1221120,
                     1221218..1221898)
                     /locus_tag="TRUGW13939_05281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344338.1"
                     /db_xref="GeneID:55992779"
                     /translation="RSLGLSHTFTTASTVAPLLFRASPIDPALRSPPSTEPSSRDLAS
                     YNNSSLQIDGHATPNTLPPAPGLNSSTPSSESTPSSTTLPRPSALDSRPDHNSYGVPP
                     SLPGLSALASVASAPTSQIRSSSNNSSNVALSMSYATSSPAATTGGQGNTPPCPASLS
                     LLSLQSPSLPGSPFFFLPEMASTLTDQKRPQLQPVCQNCGTSTTPLWRRDELGSVLCN
                     ACGLFLKLHGRPRPISLKTDVIKSRNRVKTAGQGPKRKSGAGLDVNGLSASRSEAGTP
                     PLGSHGYRRASRKMSPGHSDRSNSPVSRTNTPGVASLHQHNSNIAPQHMFDSVTLGDH
                     GFNPANTLPALQLRQPSPGSTSSLVDRHLEAPQTFEGLLASNTSLKTRVSELEVINEL
                     FRGRVAELEQSDATARRSAMIVRDSEARLRRSLDDAQRREDDLKRRISELELQLNERS
                     GNGFGEPASKKIRLSDVVDYEAGSSSKSPSAA"
     gene            <1224022..>1226509
                     /locus_tag="TRUGW13939_05282"
                     /db_xref="GeneID:55992780"
     mRNA            join(<1224022..1225302,1225376..>1226509)
                     /locus_tag="TRUGW13939_05282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488446.1"
                     /db_xref="GeneID:55992780"
     CDS             join(1224022..1225302,1225376..1226509)
                     /locus_tag="TRUGW13939_05282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344339.1"
                     /db_xref="GeneID:55992780"
                     /translation="MEKGCSGPGIALPMSVMATCDASMVEFSQDDLAIITQYPLSDSF
                     NPVHHLLQEVEHSHLISYNGTADGADPTHQTAISRLLVTLMGEKVAFNLHPRTSSKNI
                     ASELSKLFTRVQDEDFHYDHYRPVIRLILKKASDVDIWKAVLNLITAVSRTTPPASVP
                     LAFDGTPVRSTSSLQKGSEQTRRVVEGRIFEEIRDCTHKGVRGFFKKYFEGKYWSQRV
                     EDGYRRVLDSEDGSRWPDFPNPPTQKDVLDWWFRFQDEFLLDGRSIYFSTASKRDLTG
                     SDADRQVDLLLKLRGADDIRGKHNWKDIQVVGELKRPGAEIGTKGTLLQMARYVREVF
                     IAQPTRRFVHAFAICGTKAEAWVFDRSGPFSSGSFDINEEPKQFFQMIVGYAMMTDEE
                     LGLDTFITNNTITTEGTVGGGGGGSAPGPEAALLTFSWTSDKRAAEKDLLKLARERGV
                     KGVAAVIGYRDITNIAELRGGLTFEKRHTFRSTPSSAKSSFNLSHSHDLRPRPFTRSR
                     SSTGQNQASRKRRSPDKGAPLSKRARSSSQQSGNDPQETELPFTVQSMHPPSLFDRNS
                     KEQGPYDNRILRCLVISPAGRPIYEFCSPMELLVALRDAIRAHQSLYLVGNILHRDIS
                     ENNIIITDPETADGNSGMLIDLDLAKEISSGRSGARHQTGTMEFMAIEVLRAVDHTYR
                     HDLESFFYVFIWQCARNGWERFNRLKERPEDSLLNEWYTGSYMKIAGRKGGHMDANNF
                     EYLLWEFPLELECVKTLCRTLRRILFPIHQDSLFTGTPVKPETLYEPIIQAFDTTIKD
                     IEAVEG"
     gene            complement(<1228392..>1230387)
                     /locus_tag="TRUGW13939_05283"
                     /db_xref="GeneID:55992781"
     mRNA            complement(join(<1228392..1228885,1228941..1229058,
                     1229107..1229122,1229171..1229780,1229830..1229934,
                     1229989..1230121,1230177..1230248,1230307..>1230387))
                     /locus_tag="TRUGW13939_05283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488447.1"
                     /db_xref="GeneID:55992781"
     CDS             complement(join(1228392..1228885,1228941..1229058,
                     1229107..1229122,1229171..1229780,1229830..1229934,
                     1229989..1230121,1230177..1230248,1230307..1230387))
                     /locus_tag="TRUGW13939_05283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344340.1"
                     /db_xref="GeneID:55992781"
                     /translation="MVVGSLHTQRIIAAVAATVIALASGTNYAYSAWAPQFAEKMHLS
                     SKAINLLGVAGNVGLYCSGIPTGILTDAKGPPITLIIGTISLFIGYYPIYLAYEHGAG
                     YLSLPPLLFFAWLTGLGGSAAFSGAIKAAASNFPEQRGTATAFPVAAFGLSAFFFSTM
                     AGIFFHGDTGSLLMLLALGTCAMVSVSGFFLRVLPPTQKYTTIPDRETEDRQQFTYEE
                     PEEIGRQDINSIPSPSQSSSTQPLLHAGREPISGNEAVNGLEDSRVTGEAASLVDAPR
                     SSPYTDEETGSQVQTYHDNENSSHYSDIRGLALIRRREFWQLFLMMGLLSGIGLMTIN
                     NIGNTTKALWRYYDDSADAKFIQRHQVLHVSILSLCSFLGRLLSGVGSDLLVTKLNMS
                     RFWCVLLSAVVFTLTQLAGTTINNPNQLYIISAFTGLAYGFLFGVFPSLVAHKFGISG
                     MSQNWGVMTLAPVFSGNVFNLLYGTIYDHHSIIEENGQRDCTEGLQCYRTAYTLTFFS
                     GLAGIGVSLYSIWLERNVHGKDRGAKIEDHDRTA"
     gene            <1230982..>1232521
                     /locus_tag="TRUGW13939_05284"
                     /db_xref="GeneID:55992782"
     mRNA            join(<1230982..1231032,1231086..1231165,1231216..>1232521)
                     /locus_tag="TRUGW13939_05284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488448.1"
                     /db_xref="GeneID:55992782"
     CDS             join(1230982..1231032,1231086..1231165,1231216..1232521)
                     /locus_tag="TRUGW13939_05284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344341.1"
                     /db_xref="GeneID:55992782"
                     /translation="MGALLSIPMLVIPSAGTMLSVGASCCGAATCSAVCSACGKFQSS
                     MATRIAYAFILLVNSMVSWIMLTPWALEKLEHLTMDYMKIRCDGKECHGWVAVHRINF
                     GLGIFHLFLALLLLGVRTSKDSRAALQNGFWGPKIIFWIGFVVMSFFIPESFFLIYGH
                     YIAFIAAMLFLLLGLILLVDLAHSWAELCLEKIEDSDSRLWRGLLIGSTLGMYTASIV
                     MTILMYCFFANSGCSMNQAAITINLVVMFIVSFVSVQPAVQEFNSRAGLAQAAMVAVY
                     CTYLTMSAVSMEPDDRQCNPLIRARGARTATIILGAVLTMATIAYTTTRAATQGIALG
                     SKGGTSYSPLGSEDNDHGLVTQQPSSRREMRAEALRAAVESGSLPASALDDSDDDDDD
                     EYDTKDDERGSTQYNYSLFHVIFFLATTWVATLLTQNIDLETEGNFAAVGRTYWASWV
                     KIISAWVCYAIYLWSLLAPTIMPDRFDY"
     gene            <1232776..>1236042
                     /locus_tag="TRUGW13939_05285"
                     /db_xref="GeneID:55992783"
     mRNA            join(<1232776..1232808,1232868..1232964,1233026..1233112,
                     1233185..>1236042)
                     /locus_tag="TRUGW13939_05285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488449.1"
                     /db_xref="GeneID:55992783"
     CDS             join(1232776..1232808,1232868..1232964,1233026..1233112,
                     1233185..1236042)
                     /locus_tag="TRUGW13939_05285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344342.1"
                     /db_xref="GeneID:55992783"
                     /translation="MSTIKAIEARSVHQIQSGQVIVDLCSVVKELVENSLDAGATSIE
                     VRFKNDGLDLIEVQDNGSGIAPQNYESIALKHYTSKLSSYDDLTSLTTFGFRGEALSS
                     LCAVSDFHIVTAQADQAPKANKLEFERSGKLKNKQIVAGQRGTTSSAVNLFSTLPVRR
                     RELEKNIKRELGKVVTLLNEYACISTGVRFNVKNTDAKRKTIMLLSTKANATMKENIA
                     NVYGAKTLLTLIPLELDLEFEPSATGKRVDRELNEIRVRGHVSRPVVGEGRGTRDRQM
                     YYVNSRPCGIPQIAKAFNEVYKSYNLSQAPFVLADFQMDTNAYDVNVSPDKRTILLHD
                     SAALIESLKNALDKLFQEAEQTVPQSQIVGTKQQAGIRQHFQEAPAPTAPETDKEEPE
                     PIQAPNKSRAVTGQEEGTHLAIRGDQASNDKNIHSASQLTEETTASSATQEATVASTD
                     KDASSEISEDNEDAEDAVKRIRAKAAENPQTGDTRPQWSSSEKPNVVQNAFDRMRSTR
                     PPTEVATITVGDKTVTSLVGRSSIKKRDSLTAGHSEGKRKSKRRIHTPSKPNIFGQNL
                     KSFAAPGAHDEPSAEEDEYSEAEEGSGEIENEEDEEEEQEGEEGEEGEEGEGEEDVEM
                     PDASTVVVNTNEIPNNQDDIGSVSSVQSVEEEDAEPQSNDDNPDESDEHYINDTEKKT
                     KEEAKVQALIQKAEEKGGQHNDNHVKRGKYIEKDQQSQRDSTKQLVARINSSISRIQT
                     QMEKLHEGLGSYGQSGIPEEEESVRDKTGEERLSLTVSKDDFAKMRVAGQFNLGFVLA
                     TRSHEANEQTGSNRDELFIIDQHASDEKYNFEKLQAETVVQSQRLVRPKTLDLTAVEE
                     EIIRENQPALEKNGFVIEIDDSRDEPIGRRCKLISLPLSKEVVFDIRDLEELIVLLSE
                     APTSNGSKSDVYVPRPSKVRKMFAMRACRSSIMIGKTLTVRQMEKVVWNMGTIDKPWN
                     CPHGRPTMRHLMSLGSWNEYDEYKDRGDIASNSTSDSPWSRFYEWRTREENE"
     gene            complement(<1236189..>1237067)
                     /locus_tag="TRUGW13939_05286"
                     /db_xref="GeneID:55992784"
     mRNA            complement(<1236189..>1237067)
                     /locus_tag="TRUGW13939_05286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488450.1"
                     /db_xref="GeneID:55992784"
     CDS             complement(1236189..1237067)
                     /locus_tag="TRUGW13939_05286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344343.1"
                     /db_xref="GeneID:55992784"
                     /translation="MSQPETYPHPTPTTTNIPSPSSASFTAQSSSSSPSSPPQSSFSS
                     SSPAAATDQDPETTRRTLEARTAFTASLHSAGQNVSSDLRARATDLHNNEAAIQRQEN
                     ELSRHTSDLAKQNEQWEKVVESARQGLKEIGDVQNWAEMIERDLMVVEEVLRLAEDRA
                     QEGDEEEEEEEGVGHDRRRSDAGFDHYSEGEGDLTEREDGVIKGKKVAQEPIEILDDM
                     SSAASEMTGTSATSESSSASSAKNISPPVSSEDEQQQQRQQEQQEQQQKQPQEEENRK
                     SDGEAKQSKGWWGRWW"
     gene            complement(<1237689..>1243143)
                     /locus_tag="TRUGW13939_05287"
                     /db_xref="GeneID:55992785"
     mRNA            complement(join(<1237689..1237786,1237842..1239118,
                     1239173..1242802,1242860..>1243143))
                     /locus_tag="TRUGW13939_05287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488451.1"
                     /db_xref="GeneID:55992785"
     CDS             complement(join(1237689..1237786,1237842..1239118,
                     1239173..1242802,1242860..1243143))
                     /locus_tag="TRUGW13939_05287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344344.1"
                     /db_xref="GeneID:55992785"
                     /translation="MANRYSTFSTNSALGGAKSSSQVSTTSLLNALHTAYSAGQPYQL
                     ESGSSVVVNTWLTAANINPDGTPGGTVDAQLAERAWEHARRRAEDGCIVLSSLHRSTP
                     CLLPAFLSTVPLSTPELLYTAIDAIRPFVTAVTPFNPSYSLYSSFAVSYTFTLSGNVT
                     GATLALSTSGLNVNRGLLDIPAEAGYRAFDVFYYLINAASSNAEREYLALKDPSTYTT
                     LNKSQTYDPPSYLPTADDAAAAEDFRSALKSIGIKGATQRGLISVLAGLLKLGNTLGF
                     LVDQEDLEEVCEEAGELLGVDPEILLHNCATDEREVFVAGVYEAIVDWVIQKANEAIA
                     NQLRDHQENGSSDESGAPYGDDDADTVNMTIIDIPSPPLGKGVALRGIFDDTIGINAE
                     MKEDGLEIVGAGQSVLNEMNNAVVEVEADLGITGGAAARERDYFLDKRQNVLEKVGIE
                     VEMGGFLRDILFPVDSEGITLGKRGRFDLPSLLGSSRVWYHLAVHPTDDAPENMASLP
                     TVTSAWSAGAVSRQLRDWRLPEWANRRHKQLDFTADFDVDEFVTRYSRLGCKEGKDGV
                     ESWTLERGWSNGEVVVGHERIWMREGAWWEAETMLDLKPDGNPFMPSNPFETGYSATP
                     PNPNASGFFPPLPLADSGSFIAGPENLLNVNRQSAMSPGMARSIGPGNTLHSLGVGGD
                     YGLGPKGDDRRADDAYYEAELNRLAGNDAEFGEAKHIEKRKITFGRRLWAGFVMAMTF
                     WIPSFVLRYVGRMKRPDVRMAWREKFVLVFLILLFNGIVAFYIIAFGNLLCPNKNKVW
                     NQQDLSTHQGDNDFYVSVAGKVYDISKFWKLQHSDSTIKTSSSNMQWSAGQVLDAYFP
                     VPLTEACPMFVTDDSIYLQNNNTAATIESSAVHNSGPYLQTNQKSALYKNTWYEKKFL
                     PFLQQYYKGDLVWSTGNVSSQADADARYWAIINDGVYDLTNYFYTLDRMNDIDTYDFL
                     PSAVTTLFKQHAGSDITSKWQDSANFTNALTCMQRVFYVGKVDFRDSPRCTVNNWILL
                     SFTVLIAAVILVKFFAALQLGSKRRPAPQDKFVICQVPAYTEGEDQLRKGLDSLTALQ
                     YDNKRKLICVVCDGMIVGSGNDRPTPKIVLDILGVDPKIDPPALPFKSVGEGSDQLNY
                     GKVYSGLYEYEGNVVPYVVIVKVGKESEQAKSKPGNRGKRDSQILVLSFLNRVHHRAP
                     MSPLELEIFHQINNVIGVDPELYEYLLMVDADTSVREDSLNRLVAACANDAKIAGICG
                     ETSLQNEERSWWTMIQVYEYYISHHLSKAFESLFGSVTCLPGCFSMYRLRTADKGRPL
                     IISDKVITEYADGDIDTLHKKNLLALGEDRFLTTLMTKHFPTMSYKFIADAYASTAAP
                     ETWGVLLSQRRRWINSTIHNLVELAALKDLCGFCCFSMRFVVLVDLLGTIILPATCVY
                     LGYLIYLVASHTGQFPLISICVLAGVYGLQALIFLIKRQWQHIGWMIIYLCAFPIYSF
                     VLPLYSFWKQDDFSWGTTRIVIGEKGDRRVVAVGDEVFDPRSIPFQRWDDYALVNNLP
                     GRRGHGEMMEEKNYGPYMDDAAMEMDDLHSTYSSVKPTSTILTGFPGGRGPYVPPQSP
                     APFGGNNRNSRMSTFSRYTDAPQVGGHGQRQMSMGNLSNYQDNAMNASRLSMPMMQSS
                     ENLLGAPNRQRSPLAGGYGSRPVSTIMDFRSVPGQGPDDTTIVDAIRQVLGEVDLDNI
                     TKKQVRALVEQRLQTELAGERRTFVDRHIDQELANM"
     gene            <1245479..>1251213
                     /locus_tag="TRUGW13939_05288"
                     /db_xref="GeneID:55992786"
     mRNA            join(<1245479..1245591,1245651..1245839,1245896..1251126,
                     1251182..>1251213)
                     /locus_tag="TRUGW13939_05288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488452.1"
                     /db_xref="GeneID:55992786"
     CDS             join(1245479..1245591,1245651..1245839,1245896..1251126,
                     1251182..1251213)
                     /locus_tag="TRUGW13939_05288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344345.1"
                     /db_xref="GeneID:55992786"
                     /translation="MAFNSFAGNAPSHAQSSLPSLPSHLQSDTHLTAHLASRFHVSLP
                     TARLSSQALICTNTYTSSAKGPDGGKEGSAMGEAEDLAKRAFARLGARGENQAVVFLG
                     ESGSGKTTVRSHVLSSFLSFSSTPLSTKLSLAAFVFDSLTTTKSVTTPIASKAGLFFE
                     LQYDSSSTNPTLIGGKILDHRLERNRITSVPTGERSIHVLYYLLAGTSAAEKSHLGLE
                     STGIPSASGGNHKRWRYLGHPTQLKVGVNDAEGFQHFKTALRKLEFPRSEIAEICQIL
                     ATILHLGQLEFMTGQSTTTGAEESGGYSHEGGETVTLVKNKEVLACIAAFLGLSTEDL
                     EVSFRLKSKTLHRERVTVMLDPQGARQNADELARTLYSLLVAYVIENINQRTCAVEDS
                     VANTVSIIDFPGFAQSSSTGSSLDQLLNNAAVESLYNFCLQSFFANKAELLESEEVSV
                     PATSYFDNSDAVRGLLKPGNGLLSIIDDQARRGKTDLQMLESMKKRFENKNPAIEVGD
                     SMAKMPGSNFTAPSTNASFTIRHFAGEIEYPVNGLVEENGETISGDLVNLINTTRSDF
                     VRDLFGQKALHKVTHPKEKTAVVQAQVSSKPMRMPSMARRKFNASSRLTASAPRANND
                     DDSDSHNGSTKTGVTGRKKNNGTGAEQGAAGQFLSSLEIIKQCLTTPNLNPYFVFCLK
                     PNDRRIANQFDSKCVRMQLQTFGIAEISQRLRNADFTIFLPFAEFLGLAEAEAIVVGS
                     DKEKAELVLDERKWPGNEARVGSTGVFLSERCWADISKLGERVLPSYRADSFEDGDAM
                     LQAQGSYSDARVRLINSGENTPSGAFIYGDETKQGGYFGSRDIDGRSDAGASAFNSGD
                     MFKNFETREQMAEKSKERKMEEVDEVADSGSRKRWLFIVYMMTFWVPEFLVRFVGRMK
                     RKDVRMAWREKLAINMLIWLSCAIAIFFVVGFPMLICPHQYVYSASELASNNGADGHS
                     SYVAIRGVVFDLNAFVPAHYPKNIIPTSAFKEYAGIDATALFPVQVSALCQGVNGTVD
                     PSVQLDFTPVNITGSATTISASDSNANYHDFRYFYDDYRPDWFAEQMMMLKASYKKGY
                     IGYSEQYMKTLATKHSKSVASINGNVYDFTNYVAGGRRVLVPPGQSKPTDVNTDFMSP
                     YVVELFSDKSGQDVTKYWNELKIDNELRQRMKLCMDNLFFVGKVDTRNSVQCQFANYF
                     ILAISVFLALVILFRFLAALQFGKKNIPENLDKFIICQVPAYTEDEESLRRAIDSMAR
                     MKYDDKRKLLLVLCDGMIIGQGNDRPTPRIVLDILGVPETVDPEPLSFESLGEGMKQH
                     NMAKVYSGLYEVQGHIVPFMVVVKVGKPSEVSRPGNRGKRDSQMILMRFLNRIHYNLP
                     MSPMELEMYHQIRNIIGVNPTFYEFILQVDADTVVAPDSATRMVASFLADTRIIGLCG
                     ETSLSNAKQSMVTMIQVYEYYISHNLIKAFESLFGSITCLPGCFTMYRIRSADTGKPL
                     FVSKEVVESYAEIRVDTLHMKNLLHLGEDRYLTTLLLKHHSKYKTKYLFRAHAWTIAP
                     DSWTVFLSQRRRWINSTVHNLIELIPLQQLCGFCCFSMRFVVFIDLMSTVIQPVTVAY
                     IGYLIAWLIIDTSNIPLTSFILLGAVYGLQAIIFILRRKWEMVGWMIIYILATPVFAL
                     GLPLYSFWHMDDFSWGNTRVVTGEKGKKVVMSDEGKFDPASIPKKKWEEYQVELWEAQ
                     SQRDDSRSEVSGYSYGTKSYHPAATDYNFPASRPMSQLDLTSRFGSRMSLAPSEMLGG
                     AGNYELSDLTGLPSDDAILAEIREILNTSDLMSITKKAVKVELERRFEVNLDSKRTYI
                     NSATEAILSGQL"
     gene            complement(<1251590..>1252912)
                     /locus_tag="TRUGW13939_05289"
                     /db_xref="GeneID:55992787"
     mRNA            complement(join(<1251590..1251784,1251857..1252227,
                     1252297..1252539,1252571..1252705,1252777..>1252912))
                     /locus_tag="TRUGW13939_05289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488453.1"
                     /db_xref="GeneID:55992787"
     CDS             complement(join(1251590..1251784,1251857..1252227,
                     1252297..1252539,1252571..1252705,1252777..1252912))
                     /locus_tag="TRUGW13939_05289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344346.1"
                     /db_xref="GeneID:55992787"
                     /translation="MSNNALVVRMVDGQPRLSKESAAIPVPDSKQVLVKVSHIAQNPT
                     DVQSFDGNAFGDGAILGCDFAGEVVETGSEATRLQKGDVIAGLVWGDEELIQLCLLLG
                     EIKGLGAYSEYVLADDAISFKVPKGISPAEASTVPLALTTSWLALFSKGCLDIDRSNA
                     GGVSILVWGGSSSVGLYAIQLAALYGMNVITTCSPRHEKLVRSYGANHVFDYRAEEEI
                     VSKIKQAAPNIQYTFDTIGNTSSSTIASLAMHGSGKLCTVRPGKANTDNVASQIAVSD
                     VLVWTAFLKDHRYGSFYWPASKEDFGLSRELFDKLPGWLTAGTIKPNTAKVLGGLDDV
                     PKGFDEHRAGNISGYKIVYELNTAV"
     gene            complement(<1253508..>1256760)
                     /locus_tag="TRUGW13939_05290"
                     /db_xref="GeneID:55992788"
     mRNA            complement(join(<1253508..1254368,1254415..1254612,
                     1254668..1255819,1255879..1256154,1256230..>1256760))
                     /locus_tag="TRUGW13939_05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488454.1"
                     /db_xref="GeneID:55992788"
     CDS             complement(join(1253508..1254368,1254415..1254612,
                     1254668..1255819,1255879..1256154,1256230..1256760))
                     /locus_tag="TRUGW13939_05290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344347.1"
                     /db_xref="GeneID:55992788"
                     /translation="MHKISNFTGQARHGWERMTPAFGMSRPHPDMHPASQSMRRPHVA
                     PALTTPSNADSTVNLSFNVPFSSCLAGPDVEDILHASPGALQRWTFPEGTPEGTPIHN
                     LPVHVSHVEALRGLCRTAAETNRRLEATVTTSEPKTLPSMQRRQQTLVTNVCLSGDGD
                     IVRQTRAKILNETPISLRCANVDVDMHLIMDASTKGIRTNVLEHLDTLAQYTGADIFL
                     LSPKMVDADSAVVSSYGAENSLENRFRVAIYGDMESAEHAKTRMLIMIDQILKRHVDA
                     MKLELTMHTLVCGRTRKNIKLIEAATNTAIYFPPPFPRIFGYTPPGANRRSEDEVYIT
                     GENMESIARAKQKLRELVMVVKIYVKDVVLSASKIDNILLDRLDKVRKVMEANGSYVL
                     FPQLGSQRGLVRIQGTEALHVERTVREIMALAGQFYSASWWTSVPDPSQGGMRPPTPA
                     EIRPMLSDICTNSNADVSFENMGFSINGSDDAVKDAMNVIYQMPFVKRGPYQIRVKIE
                     LANEHKEFVSGKKNGKINKIMGQSNVQIIFDGFNEYNFYIDVCGTQYDATKNGLDLVE
                     QEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKYSVFVKFSNAMDRGGIGKEDDDVKV
                     DNVICRTPARNAQSLDLVKQEIMDMVEKVDAEYVSETVLINRLYHRELLARIREIEEL
                     EKKWNCKIEFPSTELASDIITISGPEYQVPQAVDAFLGMVPENHELSFQSSAELRGFF
                     KSAEFADDVRSKLKDQYEVDATIDTAAELPKAGDESAPGTPPPEDRVVLGYTRNNAGG
                     LKDAIDFLISRLVAHGLDATTIKGAIPRPKSDSFEESLPFFDSKLLQHAPAPLVTDSP
                     TRPSFGDDVSDRGSIFERLRKPGSISSFSSFIGRKNHSASPASFFKHASSNASKASLI
                     SMESRDSGYRNPWNDSGVNLPEEDLHHVGSSHSHNSSTSNGWPARFDMKFPFGTAPGD
                     ITPKHDLRASFDSGRPSTSNSTSGYPAPIGPPR"
     gene            complement(<1259364..>1261757)
                     /locus_tag="TRUGW13939_05291"
                     /db_xref="GeneID:55992789"
     mRNA            complement(<1259364..>1261757)
                     /locus_tag="TRUGW13939_05291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488455.1"
                     /db_xref="GeneID:55992789"
     CDS             complement(1259364..1261757)
                     /locus_tag="TRUGW13939_05291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344348.1"
                     /db_xref="GeneID:55992789"
                     /translation="MAAPTNLSVPVAETRLTSLSVDDELKEYEKILRISEEIFAGTHP
                     RLKVPQQFVRKAPSRTLQTPVASAAIESATTPQPKATPSNASLVKPKSLHGASPAQAG
                     SIAPRPAGAKSHVAPKLAPEIDPIFLTKSDDLVRAEIQLQRRRVENALREQTERTKYE
                     TRQKAVSQDEKPDFDISDVLNQALEIVKPLPSVYDALGANGTNAPSDSFDENSLYSSR
                     APDSPSGGDHEQHAAVQGTTNIIVPSQGSARPAQAEFYEELEETQDEPEYSPPEPTEP
                     MLDVQEDDDYQPPDVPNPRRPIYERPPRYAMRQQSVSPDMRIVRNHITSPAAPQPSRV
                     SPLATAKQPPRLRAAQNDYREEGPTELSSGLSTPDGAIQQLMPRKRRRVQEPRAGSTV
                     HAINSPGPRIKPEPVSPPPFHETQLSRGHVREAPVYIDIASPQYTPSSERREAIPRES
                     VYEHDRYGSSGRDYEPPAEPSTRATSRLSGRRPMRDTEDLRRVASLHYARNREPVYRE
                     YGEPVTRPRSVRASSYAVVERPQHEKATYYEPLVPAYSRHYSQYEDYPPPSRVREFYV
                     EEEPRYIEPQPRRIVVDEYGNQYYEMTPASKIRAMPPPPTRSARPDEYNERVQMRSAS
                     VRAGSIVDDGYGSRRYIQEMAPPPSTSYRRVAEHPRIVSEGQRPYSRSVTEHEPVYRS
                     GSVAVEYTPSSRPSIYIDDDASRQRSIRTSSVRPPSSRYEEAREVIHRMPSVRPNGRE
                     VSAYTGEESRLLPEYGERPVYSSVRPEHEGRYYTEEDGARMAVDSAGDMVHRIPRYQ"
     gene            <1262223..>1267505
                     /locus_tag="TRUGW13939_05292"
                     /db_xref="GeneID:55992790"
     mRNA            join(<1262223..1262288,1262356..1262446,1262498..1262923,
                     1262992..1263136,1263247..1263829,1263882..>1267505)
                     /locus_tag="TRUGW13939_05292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488456.1"
                     /db_xref="GeneID:55992790"
     CDS             join(1262223..1262288,1262356..1262446,1262498..1262923,
                     1262992..1263136,1263247..1263829,1263882..1267505)
                     /locus_tag="TRUGW13939_05292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344349.1"
                     /db_xref="GeneID:55992790"
                     /translation="MASTSEQDGDTRPIFFFDIDNCRFDTLCDGCATSTKGCGLGSQI
                     HEKMQELIDIFFVNHLSIDPDDAVMLHKKYYKEYGLAIEGLTRHHKVDPLEFNRKVDD
                     ALPLDEILKPDPKLRKLLTDLDTTKVKPWLLTNAYVNHAKKVVKLLGVDDLFEGITFC
                     DYAEPKLICKPSREMWEKAEQQAGAKGVENCFFVDDSYLNCKHAEERGWQTAHLVEPM
                     IKLPAKPACKHTIRSLEELRQIFPQSDIIGCGPCISGAARVSRCSAGLGAPERQSQYN
                     NTNPGASPQRNPQARVCNLVTMVDISQGQVVNLLDGRQAAVRFIGPTHFAAGDWIGVE
                     LDEPTGKNDGSVQGERYFDCEHGFGMFIRPSAVASVVGPAPKRESKQAPRATAAAGKP
                     QGASTAGSAALRRTGSAATSAAARRQSTTASPSPAPRAPPSRVLRSPTKSPTKQLGAP
                     SRPSVTTTKPAPAVKPRASISGRQSMGPPASGAAASRMSRQSLTGAQTKLTRPGVSSS
                     GTAGNTPAKRASIRPTLSKTTIEESSSRTSATSEPSTQNESPLEMAQESPDEDAAPSE
                     AVKPDPPRTTSTRVVSTSRGTPQNAATSRELEDMKTKLKVLEKKRTEDRERLKDLERL
                     QSERDKYEGIIQKLQAKYQPQQVELTELKKKIRETEAQLEEAERQQAEHESILEMATL
                     DREMAEETAEAFKLECQDLKIKLEEFQLEVEVLRDENEEYGSVMSPEDKSSQGWLQME
                     KTNERLREALIRLRDMTQQTETELRDQIKELEDDLEEYATVKSQYEETKEKLLTSESN
                     VDDLKQQLDTALGAEEMIEELADKNMQQQEQINDLKAAIEDLESLQEINDELELNHIE
                     TEKQLQEELDYRESVFNEQTRKVSQQDEVIEDLEYTLSRFRELVSNLQTDLEDMRTSQ
                     QLTETEANELSTRSRAMMDLNLKLQASVEKAQTKTIDIELARMEAEESTQHLSIVQLY
                     LPQYFETEKNSVQAVLRAKRVGFKASLISNTVRERLADQAHFPGTLESAFTSYEVIEK
                     TIWISSVCNRFTKFVTSCSPEQFTSFERALFELEPVERTLNNWIESLKRNEFNEKKCA
                     MELQRSIALMTHLAETLIPAELAAYADETHTRSVMTQTYIDHTALALTRLRTLLQGKV
                     PAPAEDDEEGLFFFNKSEALVGQTRGLKVVITKVIRSLEELNSRSLALSEGTAAGFEF
                     AETTAKELAELVRQMGENVAILLGEEGRVEPFTYDEILANMSKTAVSIDQTSAPESED
                     SSALSLLTTKLKVLSGYLDEMSAHASDLAHTAEFERGKHPWIARSEELKSHKVTSPDA
                     DEEIRRLKNELSEASTGLGVKDKTLEEQSMKVELLESRMREASKKASAAKELETQFEQ
                     MQEKETELQTSVEKLTKDLQSAQSERDDFKQRFERAKRASGTAAAITAEGVVVDTEAT
                     LAAMRENEALRSEIKSLQSSVRFLREENRRANLLDPYSIQRSTNLYSWLDAPLTQGKQ
                     SVQEEAKYALAAESRDVLNNLLKLTKETPVTDLASTVPANTKRSTWRPAKSTYRYKVL
                     QNRERYEQWSEWKDDVATRKKEEERILAAKEERALREQQARNNPRRGAGHVKTPSAGY
                     GMMGRAWAILGMQNEIDPKDGGGKGRVEIVESDV"
     gene            complement(<1267919..>1269665)
                     /locus_tag="TRUGW13939_05293"
                     /db_xref="GeneID:55992791"
     mRNA            complement(join(<1267919..1268010,1268091..1268294,
                     1268355..1268543,1268623..1268866,1269207..1269281,
                     1269340..1269465,1269549..>1269665))
                     /locus_tag="TRUGW13939_05293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488457.1"
                     /db_xref="GeneID:55992791"
     CDS             complement(join(1267919..1268010,1268091..1268294,
                     1268355..1268543,1268623..1268866,1269207..1269281,
                     1269340..1269465,1269549..1269665))
                     /locus_tag="TRUGW13939_05293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344350.1"
                     /db_xref="GeneID:55992791"
                     /translation="MHTPNESPSHKPLKVLVIGAGIAGLSAAIALGKQGHEVVILEKS
                     QFAKETGAAIHLPPNCTALLKWMDVDPTTFGGTLLREIHRYDSKGDLIFRNDFSDVRG
                     KWQASVFREHVSPSTPAPHPTGKSCVRWLFPMDKLKFFDSKKDPGVFLEWAAEDRRVV
                     AYPCANNTIFNLCAFMPSSEAAVPEKGDWQASTETETLVNAFKNFSEGVQEIILQAKD
                     AKCWGLYDMGDLTTWSKGCAALLGDAAHPFQPYMGQGGAMAIEDAVCIATLLSSGTTV
                     EKVSSRLKLYERARRPRVEEVLRYTRMNGRDENDESKGARMSPSDMVHFMNVLFSHNE
                     IEHCSKLLAAESST"
     gene            complement(<1270879..>1273403)
                     /locus_tag="TRUGW13939_05294"
                     /db_xref="GeneID:55992792"
     mRNA            complement(join(<1270879..1272333,1272501..1272854,
                     1272993..>1273403))
                     /locus_tag="TRUGW13939_05294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488458.1"
                     /db_xref="GeneID:55992792"
     CDS             complement(join(1270879..1272333,1272501..1272854,
                     1272993..1273403))
                     /locus_tag="TRUGW13939_05294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344351.1"
                     /db_xref="GeneID:55992792"
                     /translation="MSSLSIKRLVALDHDWAVFSSKREKLYDNGRVAREEYTVGWISA
                     LPLEMKAARAMLDDIHDDCESPPTDNNTYIFGSMAGHNCVIACLPAGIYGTTSATIVG
                     NEMRHSFPNMQFCLLVGVAGGAPTENTDIRLGDVVAEFKRDIDFRISKLVSDMLQRHP
                     EMRGEYLHRGQERDILFESEYEHLQGQATCDNCDQHRVRKSPLRASLDPTIHYGTIAS
                     GNQVIKHAHTRDKFAGELGNLCFEMEAAGLMDVFPCLGRYYESIATSFGRAASSALAF
                     DQIEARYMTIKNAHLETCQWLLNHCRYKDWLNPEKMSEHHGFLWIKGKPAAGKSTIMK
                     FIFTRTKYSATGTIIVSYFFNARGEELEKSVLGMYRSLLYQLLHELPHLRQVLDSIHL
                     VSPAQSWSIEVLKNIFQRAVEQLNQYSLMCFIDALDECKEDGIRDMLSFFEQLGHLTA
                     SAGSHFRVCFSSRHYPHISISHGIDLTLESQDGHQKDITNYIHAELKAGTGKAVDEIR
                     DELLNRASGIFLWVVLVVQMLNKEYDRGRIHALRKRLGEIPDGLHELFEDIITRNGQN
                     TEQTVLCLQWILFARRPLSIDESYFAIISGFGRDERFIVEWFPELFSPEIMRLFVLDL
                     SKGLAEITRSRVPRVQFIHESVRDFLLEEGGLGRIQSQPQSFTGSSHDRLKQCCMTYI
                     EIDPAVYMPIKLPLPTASSRCKRSSSANSQKISVSRVCGEKCTPPCQFCRTIRRWIG"
     gene            complement(<1274361..>1275542)
                     /locus_tag="TRUGW13939_05295"
                     /db_xref="GeneID:55992793"
     mRNA            complement(<1274361..>1275542)
                     /locus_tag="TRUGW13939_05295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488459.1"
                     /db_xref="GeneID:55992793"
     CDS             complement(1274361..1275542)
                     /locus_tag="TRUGW13939_05295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344352.1"
                     /db_xref="GeneID:55992793"
                     /translation="MALGSPAAQPTTSDSSNTDSISDYEIVNFQCGVTTNAELTILCY
                     GKRFHIQISAESLHGNLQLEKEYLKLEIDDRMVPINYNQWQKALIEEMEDQSAEEPEE
                     GSCDNEIMGDAMEDICFWIAMKCNPYMRSLGSNSDLNPSTVEDWFYPETLVLNPKVDG
                     KGNLVVLPSPAGDELVAHLITSLPLPLDMVQAVQPLFIHPSKIFLFHEEDMTGPIQRP
                     EKVFTEPGRILFFKPCYHVLQIPREIQAMVRLQETGLNKTLRVPTLHGLVQYQHEPDQ
                     ICGLLLTYIEHHESLGFIEVHETPLALREKWILQIQQTIKALHSEGIVWGDAKPDNIL
                     VDKNDDLWFIDFGGSFTPGWIDEDKAETFEGDCQALDRMVDHLLGGGVFLQPRVHSFP
                     H"
     gene            complement(<1276119..>1277195)
                     /locus_tag="TRUGW13939_05296"
                     /db_xref="GeneID:55992794"
     mRNA            complement(join(<1276119..1276910,1277008..1277099,
                     1277150..>1277195))
                     /locus_tag="TRUGW13939_05296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488460.1"
                     /db_xref="GeneID:55992794"
     CDS             complement(join(1276119..1276910,1277008..1277099,
                     1277150..1277195))
                     /locus_tag="TRUGW13939_05296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344353.1"
                     /db_xref="GeneID:55992794"
                     /translation="MTRGGPHSPFPSSLNNECKKARDILDSFINPSIANSTNTKIVRK
                     AQGLAIFSTFKVGFMGSIRIGSGILVARLDDGSWSAPSAVGTGGLGFGGQVGVEFANF
                     IFVLPDKSSVRAFAQLGTLTLATNISMAIGPIGRCGEAGIGISSKGFGTMFSMSKTNG
                     FFGGLSLEGGTLVESRAANRKFYQRDVTAAQLLSGEIAPPADAEPLMQFLASEAFYPL
                     QDRVSDPEQPPQAHVDTTSELPAGATNQPPAEVLTPGAPRQAPAEEYTESPSIPAELP
                     VGHPIEPVTGSQETQTSILEREIPPQEPPTQEK"
     gene            complement(<1278380..>1279094)
                     /locus_tag="TRUGW13939_05297"
                     /db_xref="GeneID:55992795"
     mRNA            complement(join(<1278380..1278879,1278929..>1279094))
                     /locus_tag="TRUGW13939_05297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488461.1"
                     /db_xref="GeneID:55992795"
     CDS             complement(join(1278380..1278879,1278929..1279094))
                     /locus_tag="TRUGW13939_05297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344354.1"
                     /db_xref="GeneID:55992795"
                     /translation="MFPNILVKAVAGSMAINVASAHMELNWPYPLRSKFDPNTPQDLI
                     DYSMTSPLSMDGSNFPCKGYNTNTPWRSTVEWSAGQQYNISLAGSATHGGGSCQLSLS
                     YDNGTSFHVIKSVEGGCPLQSTYDFTMPEDVANGDALFAWTWFNLQGNREMYMNCVDI
                     TLSGGSGSADAFESAYPAIFVANVGNGCTTVEQQETVFANPGEQVVYGGTVTSSSPVA
                     PVC"
     gene            <1280880..>1281795
                     /locus_tag="TRUGW13939_05298"
                     /db_xref="GeneID:55992796"
     mRNA            join(<1280880..1281162,1281289..1281304,1281369..>1281795)
                     /locus_tag="TRUGW13939_05298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488462.1"
                     /db_xref="GeneID:55992796"
     CDS             join(1280880..1281162,1281289..1281304,1281369..1281795)
                     /locus_tag="TRUGW13939_05298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344355.1"
                     /db_xref="GeneID:55992796"
                     /translation="MSFGFSAGDFIAGANLACTIVRALSESRGASTEYQDVIRELGCI
                     QQTFLQVEQMRASNLFSQATMNAITCIINSSIEVMAGFLERTDKYRQSLSVSAASYQN
                     QNNISHGVLKFQESGSNTQTGQFVSGPSVSETSSIATVASHQSSTYESTAKDEAIARL
                     EMLISDERAQRRARDAAREAAMVKAAADKLAAKERAAADKKLVEEAIARERQKWEKET
                     SHKPLRERMSYAYKRVTGRNYDT"
     gene            complement(<1282407..>1283683)
                     /locus_tag="TRUGW13939_05299"
                     /db_xref="GeneID:55992797"
     mRNA            complement(join(<1282407..1283614,1283671..>1283683))
                     /locus_tag="TRUGW13939_05299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488463.1"
                     /db_xref="GeneID:55992797"
     CDS             complement(join(1282407..1283614,1283671..1283683))
                     /locus_tag="TRUGW13939_05299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344356.1"
                     /db_xref="GeneID:55992797"
                     /translation="MQKKAVEREMQVCHSQPHLVPPMKLVFYDSLPSPGLRPESKSSL
                     PPWMHETKSLASKASRRASILVRRQTPKRPTISAPRDFRRTDMPRGRVASFRPLELSI
                     YLPGNRLSDLPEFNSFDLGAPGQPSPPEKALVSPFNSASHLRRQSGPFQLTRKPIGSA
                     PSRRGSMATLELQLQQNQPRQSSDLATGNPLIPYFSVVSPMSNGPVSPFHQFGELRPI
                     SEPFQKAPQSPTKHKYNKSLPGVSVGIEPFQSPSFPSSSISARHSLESHPNYNGRQGT
                     GKRKQGQSSRSSSMTSMSTIINNNTKKYHHHTPTKSSTSTLPYHSRVRTTSNSTVSSK
                     TPSLSSAITAATTIMPSDKELETAFGTLPVIPASGKTSMVAQDPEVHEEEQMHPSGYE
                     YDQRFPTNVVGLAF"
     gene            complement(<1284585..>1286734)
                     /locus_tag="TRUGW13939_05300"
                     /db_xref="GeneID:55992798"
     mRNA            complement(join(<1284585..1284762,1284818..1285149,
                     1285214..1286245,1286294..1286381,1286438..1286491,
                     1286548..1286565,1286628..>1286734))
                     /locus_tag="TRUGW13939_05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488464.1"
                     /db_xref="GeneID:55992798"
     CDS             complement(join(1284585..1284762,1284818..1285149,
                     1285214..1286245,1286294..1286381,1286438..1286491,
                     1286548..1286565,1286628..1286734))
                     /locus_tag="TRUGW13939_05300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344357.1"
                     /db_xref="GeneID:55992798"
                     /translation="MDLGIAALGGTGSRLTRVSIIISGVASLVATLLSVVSIWLQTKN
                     YRKPLLQRYVVRILLMVPIYAASSWTSIISLKAAMFLDPIRDIYEAFTIYTFFQLLIN
                     FVGGERALIIMTHGRPPVQHMWPMNTFLPKVDISDPHTFLAIKRGILQYAWLKPVLAI
                     VSIILKATDTYQEGYIGATSGYLWTGLIYNLSVTISLYSLALFWICMHNDLKPFRPVP
                     KFLCIKLIIFASYWQGFFLSILQWLGAIPNGVAGYTPDNLAAAIQDTLICIEMPAFAV
                     AHWYAFSWHDFADNRVSSARMPVKHALKDSFGVRDLIEDTKQTFRGNDYEYRLFDSGD
                     NIIAHEESSSRLKRVMEGMRYERGGKGKYWIPKPGEANSRTPLLSGGDQQGRRGSPNQ
                     SKRGSTVEQFRSYGELEETRMDEDDERLFVNARALEFGDWNYPVITANEVPRDQRLPR
                     TISYQSQDSDHGHVVRKSRGHRNSHVSSEDRASRKPRKPAQVERGSSASTVSPSNRSQ
                     VVDLVVENRAAEEREQDKAQRQTGSAWPERQDVHLQRPTGEPVGVVRPQPTEGILSPT
                     LASSTTGVDEDDDETSPGAQSPRYGDFREEQNIWGR"
     gene            <1287146..>1296896
                     /locus_tag="TRUGW13939_05301"
                     /db_xref="GeneID:55992799"
     mRNA            join(<1287146..1287201,1287257..1287292,1287341..>1296896)
                     /locus_tag="TRUGW13939_05301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488465.1"
                     /db_xref="GeneID:55992799"
     CDS             join(1287146..1287201,1287257..1287292,1287341..1296896)
                     /locus_tag="TRUGW13939_05301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344358.1"
                     /db_xref="GeneID:55992799"
                     /translation="MASSTISLQPLTSGPQFNWYFLVELIVCGILALFFLFYFNRLFA
                     TLVSYGIRAYTWHYHRAYVDIQAIQISLLAGRVFFKGIRYHGVNETVLIQGGYVTWNY
                     WKRAVRSVHLAPKQVSTQLDGDADSKSASDNTSNQGADETGGVKAEDRLPCRLTLTLF
                     GLEWFLYNRTPAYDDILSGFTGAAGANQGEDAQDEIPQARSSSRENSPNGVPSRFGRT
                     LSEKSASTGSSSRSSSTGSITSLNAEALESASTFLNLLPIQIECTKGAIVAGNENTRS
                     LMTIMFEKGTGCVDATDAGPLDLYRQLISLQFSRPVIQLRPNPDFRQDQHSAARNLGS
                     LQAEESERKAKRSRFIDYQRRKRQAWHTLRDLVPYFQKSVESFHDKGTNTTSTSQTGL
                     PLDNRWVGLTRYLDETIDDHEGWNAVEYGRYSTILDCPSLTLTYYWDIPGRVPSEDDG
                     PSSSIHKLSGDINGSSPPAWGIDLKIEKGTINYGPWADRERVGLQNVFFPNNFRSAHP
                     AQPLIPGSSRQSTKLKIRVETSDETTLRIPIREESKDWQWKGRANAIRGVSKLKKQKQ
                     KRQGRGKNSEKGKVGPEIRPFGWLTLRVSQDSTITYEMDMVASKTGFFNQLSMDLRDC
                     KLSSSVNHGLLWQSPRQIITCDLSNPLVWNSLHTWSFTVVSHELQLFLLRDHTFLLTD
                     LVSDWLSNSSSEFYTFVPYVYKLKLFFTDVGLYLNLNDSNVINNPSDLDDNTFIVIKG
                     SHLSSEVGINSDTFRPEKSLINFNLDLVDGVVDLLTPIWHTLHTFLKDSSLGSLSKLS
                     LDGNYTLNAETSPTLTDSLMMNITAESPRCYLYGFLIKYFMKIRENYFAENMHFRTLE
                     EFQESANSTEHGDGNAAVNPNKKTNDLDIMINLSIDQPYALLPTNIYDHSKCLRLTAA
                     SLDVDLRFTNYYMDLQASLTPTEVALESLNTDGAPFISNTQLFVDGISVYGHRLFGLP
                     PTEPTYVCNWDFDVGKIVGECNPDFIQSAASAFRNLDFTFDDEENALPPLHTQILHDV
                     TFLRAKIGSIHLSILVDQVALILGLGGIKLDFNDWSRFRFSKRLSLEIPNIVLSAIDR
                     KSAARRQKGSSHVTTYALFETSLDLSMLQQMPNLLEDRKFQQDHIRAHDERTSRTPWL
                     LLDPHINHTYNFKINNTNPPAMILPSMPEPIVGLIDHDGPYSVATREYKGLNHKSSFL
                     SFDNSSLHSRRKDDVLGSVSESRSQRSDVRSKSYSHDAENLQRPLRREDNKSYHKDHD
                     EWHNTQRITSGLSSFWALPHFNYHQVTPDSTHLPNLPDLAPEKEVTWEGDDYTKAFND
                     QQAAHTDIFCTLKPGIRGFSTPEFLHSLSSLVNGLKASDPVDMIDSLQTEVISDIVKH
                     EKSKKKKPKSSTSFSIRIPSAVFSLLNWQESHETSSTYTSQDEYKVSCIRVKATLRTQ
                     SERREHDLIKDSAINTTVHSAAEMISVTALGRQADAFHDQAELTCSLRDIVFWSTSAI
                     GVRSHLQMRSFETLTSSKSVAPLALLVKRTTTLADSIAASFQEVPSTIDRLRYVVWSL
                     TDSAVGMPDSLFLTRPAYVLRVSQSHLRLHESWKIISRLRSIYKNLSPDQQRALKTSC
                     IDLGYLCPASAKERVLKNFNEWRPWDLAHVEKSHAMKVIWGNLTESPAANLDTQSTFS
                     CNTRSLSFVIDPGPKQNDIMLNGISVVFASSSAAAFVNEIDPPKIKKTHSIRIYCANS
                     ALRLRWEILDLVEEVTKTMSNIQLASASVSQVPQNQDQSVSEVHIFVGTDEGSISLDG
                     INLALYLSGYGLKGSFALSPRYGEQKEQMTVLLSANDCSTKFLNRSKVLMLWEIWQPH
                     IYGSRITNSNSESTIHDWKLACSCRNFVYDMRDDPLGLIHAADQVVEDEIRYVLNLIK
                     RLDVNKTAELSPAVIDQPKGNPETHQFHVALFLDDYQLNFRLLPALTYIIDGKVARMS
                     VLSENDSGIEVDFDVKSNHHSFRRVEEARSESVSDIDIPPINGRVVGKMLPQVVSLKA
                     DVTVELVKLEASSLRSLLSAFTRPETSHFISDCTDSLSELRLHLDDVLAKEKAMPHSP
                     VSSRSGSPSREMLYNVRLTMAGWEIHARAPGLKEKGYWADMVFILGSTQLRLDTSEQS
                     YDSSYPDFHVNVSQIGLELKKRSKSHAQQYGKLALDIGLLATSRLNERNEVVRTISLT
                     SKGLDVQLYAATVSLVIDIAAQLQDRIKKLDLSEDMKRFRHLGRLARPRNQGTENQVP
                     RLSITDTDNPQSSAVFEAIYLVELSSIQLSWIMDTNSSPKPGNEAEDLVFSIRRVSFS
                     TSRDNSAKLRIQDTQLQMVPKFEDKRKRSLNSALMPEIVFNVAYLSTKDDLRLAFQAA
                     GKSLDIRATTEFILPARMLQSSIASAAERLREANSMWATSPSPSQTASRNSLFGNKRP
                     SSVLVDVDFAGAIVTLLGRQLDDQQTVLAAKARGGQRSESKYGHYTQGDSTTTASLTS
                     PGVALKVQYGDSGVDDPTLNAELRVNPSSNTLYPTVVPLIKQISSSVKEAVGKQEETG
                     TSSSGMLQTKKLEDSSFDATNPESILGRCKLNIGLRICKQEFGLSCQPIARVAATAKF
                     EDIYVTINTVQSAEHRRFFAILIACNSLQVSVKHVYSNESTASFEVQSMVMSFMNSKH
                     VSTTSGISAILKVSPMKMIINAKQVQDFLLFREIWVPSDDDLPFAKTGATPTPTPAES
                     QALMMQRYQQVASAGAFPWNTAISIDELDIQLDLGQTLGRAEFVIKELWVSSKKASDW
                     EQNLCGGFKVMSIESKGRMSGSVALEKMKIRTSIRWPEESPTSGQTPLIQASLGFSQL
                     QANTSFEYQPFLVADIVAFDFLMYNVRTTSQPSQDRLVSILEGEKVQVFCTTLTASQS
                     LALYQTWFRFAQDKYAAYESSLKEIEKFFRRKSSVLNPSAESSAIPQFKTQEEEVEKS
                     SISLHTDVVVTIREINVGAFPSTFYDNQIFKMEALDAQARFAVSLKDDRIHSSLGLTL
                     GQLRVALSSINRPTAIEMEELSVGEVAARATGSRGGTILKVPRVVASMETWQDVGSYE
                     IDYIFKSAFEGKVDVGWNYSRISFIRGMWSTHSRALASRLGKPLPPSAVRITGGPKPE
                     GEEDQEDTEDEEQQKKMTEGEKITAVVNVPQSKYTYRALEPALIETPQLRDMGDATPP
                     LEWIGLNRDKLPNITHQIIIVTLSEIAKEVADAYTKILG"
     gene            <1298227..>1304376
                     /locus_tag="TRUGW13939_05302"
                     /db_xref="GeneID:55992800"
     mRNA            join(<1298227..1298234,1298322..1298337,1298382..1298484,
                     1298621..1299273,1299332..1301251,1301943..1302001,
                     1302082..1302200,1302260..1302916,1302967..1303985,
                     1304044..>1304376)
                     /locus_tag="TRUGW13939_05302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488466.1"
                     /db_xref="GeneID:55992800"
     CDS             join(1298227..1298234,1298322..1298337,1298382..1298484,
                     1298621..1299273,1299332..1301251,1301943..1302001,
                     1302082..1302200,1302260..1302916,1302967..1303985,
                     1304044..1304376)
                     /locus_tag="TRUGW13939_05302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344359.1"
                     /db_xref="GeneID:55992800"
                     /translation="MVNFTIEEEGSVISGSSSLTLDQIRGLMDRPSNIRNMSVIAHVD
                     HGKSTLTDSLVSRAGIISAAKAGDQRFMDTRKDEQERGITIKSTAISLYAKMSDDDVK
                     DIPQKSDGNEFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQ
                     ALGERIKPVVIINKVDRALLELQVSKEDLYQSFSRTIESVNVIISTYLDKTLGDVQVY
                     PEKGTIAFGSGLHGWAFTVRQFAVRYAKKFGVDRNKLMDRFWGENYFNPKTKKWTKSD
                     TYEGKTLERTFNSFILDPIFKIFAAVNHSKKDEVVTLLEKLEVKLTKEELEFEGKQLL
                     KIAMRNFLPAADALLEMLVIHLPSPVTAQRYRAETLYEGPTDDEACTAIRECDAKGPL
                     MLYVSKMVPTSDKGRFYAFGRVFAGTVKSGLKVRIQGPNYVPGKKDDLTIKAIQRTIL
                     MMGRFVEPIEDVPAGNIVGLVGVDQFLLKSGTLSTSETAHNLKVMKFSVSPVVRRSVE
                     VKNASDLPKLVEGLKRLSKSDPCVQITMSESGEHVVAGAGELHLEICLKDLEEDHAGI
                     PLRISDPVVQYRETVGAKSSMTALSKSPNKHNRLYVEAEPLSEEVSQAIESGKITPRD
                     DFKARARILADEYEWDVTDARKIWAFGPDTTGANLLVDQTKAVQYLNEIKDSVVSGFQ
                     WATREGPIAEEPMRSIRFNVMDVTLHADAIHRGGGQIIPTARRVLYASTLLAEPGLLE
                     PIFNVEIQVPEQAMGGIYGVLTRRRGHVYTEEQRVGTPLFTVKAYMPVNESFGFNADL
                     RAATAGQAFPQSVFDHWAILPGGSPLDSTTKPGQIILETRKRKGLKEEVPGYENVSLQ
                     YLYFLIMCLYGLLISAFSTTTSCKGHLSSRTAPALTIHGGQLLRFTEEQATEVKKWVV
                     KRLEDISDADADVLADYVLALIRSDAPDEEIRQASIENLEDFLKENTGPFVDEIFAKY
                     GPKTDAPAAAPAAPQQQTQPQPQAQGVPSVAPQQQPFVFEGQPQGFGPQGNAQGAWNT
                     SPQNSRKRTFNEGFQQDDQHGDSQRGARSLKTPRTRRGGGRGDHMNGGRGGAAQFPQG
                     MPGFGGMPPGFPGFDQNDPMGAMMAIQSMGFPQMPGMPPMPMPGQPGGDQAKSNEPCP
                     FYETNGICYMGAACPYTHGQSSFVVSGNKGKDEYDPANSTIFDTQRGKDSNRGSDRGR
                     GRGRGRGDRGGMSSRGRGGRPEFSAVGPTDDKTITTVVVDNIPEDKYNEDVIREHFSE
                     FGNITEITMEGFKKNLSLIKFEDHESARRAWSSPKAIFDNRFVKVYWYKPKKPEGDDQ
                     QAPKEQDTPMFDKDAFDARQAEAQKVHEERMQKRKQAEETRLALEKQREELMKKQEEE
                     KAKLLQRLGAAEAGTEANGNAAANGAGAAADGDSSDQTKSLRAQLAALEAEAKSLGID
                     PSAGAQSFRGRGRGASGYRGRGRGGFDPSYRGSYRGAYRGRGAGAGPGRGGVLRLDNR
                     PRRVAISGVELNGDKDEALRQYLIGIGEFESIDRNPDQPDSMVVTFKERYIAEKLMFG
                     TSEIPSVGKVELNWVPNPPISFPGATTTAAAAAAPAGEKNGGDTVMENVEGTNGHGHA
                     GEVDYDVAEDEDSWGIGI"
     gene            complement(<1305384..>1307083)
                     /locus_tag="TRUGW13939_05303"
                     /db_xref="GeneID:55992801"
     mRNA            complement(join(<1305384..1306367,1306427..>1307083))
                     /locus_tag="TRUGW13939_05303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488467.1"
                     /db_xref="GeneID:55992801"
     CDS             complement(join(1305384..1306367,1306427..1307083))
                     /locus_tag="TRUGW13939_05303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344360.1"
                     /db_xref="GeneID:55992801"
                     /translation="MATTTDQAVDLQRRFTSATVAPRGVGAGLQSQALHAESANMPEP
                     SSAFFRPQNHLDGCAANANYNHIPALDTSSLRVSEPSLGPPQIGPSAVPRFASMIAMD
                     ERATPPSPGTTAASTFSTHKKHSILNGLNEYATETTTPSFAQPLVSESWKNGHVRPPS
                     SPARRQVESQVQPNRGHKRTATGDVKMAVSGSQNQFRANGVKGHSRTLSLDSTGSKIA
                     ELSAQLRARLSYAAAKVEKNWQGQQTATTSSRLLKLNDMRNMGDLAAGSRQSQNGSPE
                     GTVLSAPETSSTRALHMDGTSDRTRSSMPPQTTSLQPPKLAPPVNIVPANNPNTARRR
                     PNPNEINGIPGYNPHPRHRRYHSEQQGHPYNSNLSTISGTPSFNSSTLRSHGHAESPM
                     GSSNRSPVKRRTPSQNALMEQDAIETLLFMSSPENSGYHATSRPRQTNVSVSIEAQIE
                     SSFNGNTQTSSQGSNISNSRNAGVVNSFNSGASGAVPAASIGLEAQAGDEIDRLLDQM
                     ETQSGNDAETRLSSYGFTPLGNQEPNLYESSGIKGMRD"
     gene            complement(<1307899..>1314867)
                     /locus_tag="TRUGW13939_05304"
                     /db_xref="GeneID:55992802"
     mRNA            complement(join(<1307899..1311345,1311421..1311491,
                     1311606..1311663,1312708..1313885,1313943..1314296,
                     1314357..>1314867))
                     /locus_tag="TRUGW13939_05304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488468.1"
                     /db_xref="GeneID:55992802"
     CDS             complement(join(1307899..1311345,1311421..1311491,
                     1311606..1311663,1312708..1313885,1313943..1314296,
                     1314357..1314867))
                     /locus_tag="TRUGW13939_05304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344361.1"
                     /db_xref="GeneID:55992802"
                     /translation="MASERLPGNISKKGNNGFALSKAEDGPPPYDIHRVGQYFSNIPA
                     LRFPDLGPATDKTVTKDQCILHLKLLAAFADLRSTVSTVDGLFGIHDSQADKFGGGDD
                     MAKCRALIRIREKRWEVYTSRAVDRYVEWWTKIVPAGQLPTVSQIIQLQYSIIGSNPL
                     PWSANNLPPLDVLMVWHAHMLNPRAYLEDCIRVSKMALWNTDFPWQLIDDAIDTQTFN
                     YNPSDEAIRTFTGITGRLWDNLDESEEKTLECLMCSRQLNVPWTTGEIGHSPDYAFEE
                     CTGYADSGFEAYYVEDLLAFDHPMPGTYLNLNGVPSQLQELSFPNALIKAGQRTVYNC
                     IEPGGTVNDMNGVRRLLEAQMGNLYLIKTISGDGGKVRLTKIQKISIRRMMSHYWENS
                     SMFGLDLVGAVIRQGTFIQKMDNLDWIHSPALSTTMERLILKYMTFLAIMFSNPTKMA
                     VPTLDVDLAWHTHQMSAPRYYYYTTNRSVRSGPRTFTNHDDKVDEGKLSDAFEWTSNE
                     YKVITNGEIYSECTCWYCEATREPILYSGSTMVSSTTRHARTLAKNLHDDPTISSEPD
                     KNPHISTHNAVRSRKVEAPEDVRTMRLRGLWDKACRRAQKRREKEGSAGEGNNTLTMD
                     AYHPMIWGYPYYLPLYSPYMVDPSISTGPYPSNPGWMNANVGGYGNCATGTCTNAVAM
                     EDQKNRAHHKGKEKKKYEGQNPKAFAFSNPGKGRRQAVRSHELKEKRLHVPLVDRLPE
                     EAPPIVVTVVGPPGVGKTTLIKSLVKRYSKQTLSSPTGPLTVVTSKRRRLTFLECPSD
                     SLASMVDVAKIADIVLLMIDGNYGFEMETMEFLNVLASSGMPGNVFGILTHLDLFKKQ
                     STLKAAKKRLKHRFWSELYQGAKLFYLSGVLNGRYPDREIHNLSRFLSVMKNPRPLIW
                     RNSHPYALADRFLDITPPTEIEEDEKCDRTIALYGYLRGTNFPAQGARVHVPGVGDLT
                     VSAIEGLPDPCPTPFMDQQVAKATGKGARRRLGEKQKLLFAPMSDVGGVLIDKDAVYI
                     NVKSATFNRDEDEEDDENRGLGEQLVMGLQGERKLLGEADVGLRLFKDGDTISREDEE
                     VGTGRKHKRSVRFMDDGVGHVSEEEVDDEGFESGNDDELDGGVEGDSADDISDKEGDD
                     EVQTPADFTASFREKQNGQSKNAEDDIAFADSDSDLGSISSVEDQELEDGSDEDEDED
                     EDFEVDDDDDNEGALRWKDNMIENAKALHGKRPSYRVTDLSRMLYDESITPAEVISRW
                     KGEDQAGGDDVDGEEEDDFFKKADIENEGEWEDRTIPVFDYEELENKWSEEDAVEALR
                     RRFVSAKLSEGADSDEDEDEDEGDDEGDGAFEDLETGEVFNGFDEKLGEDADKSEAEG
                     DEAEGSVNLEAEREQNAKKKEELRLRFEEEDREGFANAKNGDRNEDEGEHEFGEDDWY
                     DAQKAQLQKQQDINRAEFETLDAASRARAEGYRAGTYARIVLEKVPCEFSTKFNPRFP
                     VIVGGLAPTEERFGYVQVRIKRHRWHKKILKSGDPLIFSLGWRRFQSLPMYSISDSRT
                     RNRMLKYTPEHMHCFGTFYGPLVAPNTGFCCVQSFSNKLPGFRIAATGVVLNVDESTE
                     IVKKLKLTGYPYKIFRNTAFIRDMFGTSLEIAKFEGASIRTVSGIRGQVKRALSKPDG
                     HFRATFEDKILMSDIVFLRAWYPIKPHRFYNPVTNLLDLDESASGENGWQRMRLTGEV
                     RKAEGIATPLQKNSQYSTIERPTRHFNPLRVPRQLAKELPYKSQITQMRPRKEQTYVQ
                     KRAVVLGGEEKKARDLMQKLSTMHNDKRAKRAAAQEERKQVYRAKVAENAEKRAEREK
                     REKKDYWRQEGKKRKHTDSEGGGRGGKKRR"
     gene            <1315950..>1317266
                     /locus_tag="TRUGW13939_05305"
                     /db_xref="GeneID:55992803"
     mRNA            <1315950..>1317266
                     /locus_tag="TRUGW13939_05305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488469.1"
                     /db_xref="GeneID:55992803"
     CDS             1315950..1317266
                     /locus_tag="TRUGW13939_05305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344362.1"
                     /db_xref="GeneID:55992803"
                     /translation="MASAYSRLPPELLLMILPNLPDLPSLYKFICASSIASAAFTIDA
                     ANILNDVIERSIPHFKTLARVIAVIGSLDIQSKPKTSRSKLFDSLIAKYASLPEGMLV
                     NDTLGARYLLLTAYRVEHLMHICITTLLQNIHEHIFTSQVDENTPFDKLCKLKSLRHG
                     VFFTPAAWWSPSWVERFRVERALWKLFIYWNIRTICCDNILEDDPGLSQYNEKILDIN
                     SDIGVEKGQDGVGPREIDEVNCVSEAIREFLDCNPMIFFTELFAHRRQLCIEKAWSKC
                     SLSLNETESWRFEEPQPLKGTRDDPWGQGACWTTKSNSKFSEFGWRYWHSFNSDNLHL
                     ERHDLWFPDYLGLCLWDYKRLQYLGLNETSASSLDHFLGPPREPDMKFSSPNIWKRWV
                     DLFIHELARLPGGGKQKLSKDCKERIRKWKAAVRLASKDRGLSNTG"
     gene            complement(<1318907..>1319512)
                     /locus_tag="TRUGW13939_05306"
                     /db_xref="GeneID:55992804"
     mRNA            complement(join(<1318907..1318931,1318989..1319059,
                     1319116..1319193,1319245..1319322,1319375..>1319512))
                     /locus_tag="TRUGW13939_05306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488470.1"
                     /db_xref="GeneID:55992804"
     CDS             complement(join(1318907..1318931,1318989..1319059,
                     1319116..1319193,1319245..1319322,1319375..1319512))
                     /locus_tag="TRUGW13939_05306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344363.1"
                     /db_xref="GeneID:55992804"
                     /translation="MKVSTILPWVTLFLASISEARASPNPGNAEVDGFGGNFGGGGRW
                     TVKKREEDGDLEVDGFGGNFGGGGRWTVKKREEDGDLEVDGFGGNFGGGGRWTVKKRE
                     EDGDLEVDGFGGGGRWTVVRSPTWMNL"
     gene            <1320450..>1321601
                     /locus_tag="TRUGW13939_05307"
                     /db_xref="GeneID:55992805"
     mRNA            join(<1320450..1320687,1320754..1320879,1320941..1321080,
                     1321142..1321235,1321318..>1321601)
                     /locus_tag="TRUGW13939_05307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488471.1"
                     /db_xref="GeneID:55992805"
     CDS             join(1320450..1320687,1320754..1320879,1320941..1321080,
                     1321142..1321235,1321318..1321601)
                     /locus_tag="TRUGW13939_05307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344364.1"
                     /db_xref="GeneID:55992805"
                     /translation="MGSNTSLEPLLMEGDRECDNSSPDFNEKNNPRSPFFTRKSLSVF
                     IANFLLLILSVVILVFAKFESSRQSSLCTKEHSFYSPALEGVKYEKVRFAGLPELDSK
                     WRGPPSSLLDEAWDNVTSKVPEIPVDESVVHRTHNQLDINSLTRFPPEFGGQIYSEVE
                     WKHQLHCLNLMRKYIHFDYYKNTTSLFYAYSSDEIVNHLAHCIDMLRQSVMCNADTGL
                     IFSYWIEGHDHKHVDFNNEHVCRNFESLLEYQQQNGHLIAQKLLVRHPGAVDLPDYPE
                     NVTRLMMRPEERNKYYL"
     gene            <1323422..>1324476
                     /locus_tag="TRUGW13939_05308"
                     /db_xref="GeneID:55992806"
     mRNA            join(<1323422..1324061,1324148..>1324476)
                     /locus_tag="TRUGW13939_05308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488472.1"
                     /db_xref="GeneID:55992806"
     CDS             join(1323422..1324061,1324148..1324476)
                     /locus_tag="TRUGW13939_05308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344365.1"
                     /db_xref="GeneID:55992806"
                     /translation="MVWHASWALIGVLVTIIVPSTESNIQFGCTVHQEERRERVQQIL
                     APTCAVGTCDGQYRYLKQVGKGSYSAVIKAQSSTTGELVAIKIFDKKEDKESFDEYIE
                     KVQSEFDLASRLIHPHIIRSLELRQDEETWLYVMEYCDTQLIAKLLSQSMTQNDMSDI
                     FVQLLKAVQYLHTREIAHRDIKIHNIMLCSDGNAKLIDFGEALNVTRAEDGSTDFVGT
                     YEYIAPEVYRTEPYNALKADVWALAILFTALSLQEYPWQRAKMTDSSFSAFAQDPYDT
                     LLVRLPIESHRVISHMLKIEPTSRADLDDIFDDPWIQEASKNYMYI"
     gene            complement(<1324791..>1325917)
                     /locus_tag="TRUGW13939_05309"
                     /db_xref="GeneID:55992807"
     mRNA            complement(join(<1324791..1325240,1325293..1325374,
                     1325470..1325547,1325617..1325792,1325825..>1325917))
                     /locus_tag="TRUGW13939_05309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488473.1"
                     /db_xref="GeneID:55992807"
     CDS             complement(join(1324791..1325240,1325293..1325374,
                     1325470..1325547,1325617..1325792,1325825..1325917))
                     /locus_tag="TRUGW13939_05309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344366.1"
                     /db_xref="GeneID:55992807"
                     /translation="MASQSALQRSLESYKTTSSLQDFHSLHDKVVLQIKAHCLSGGGD
                     GIGLALVKAVAEFGSHVAVIGQREIPHPELQEIQGMHEKIQVKYFCADVAQESLLTKA
                     FDQILSDFGRIDGVIACAGICVEKTFVEHTWEEVVRLQMVNSVGLFFTVQLAVKAMLQ
                     NRPGPDDHTPKGSVILIGSIATDSGVESQGLTAYSASKGAAKGLLHSLAVELAPKGIR
                     VNMISPGHTITDMSVSQWKTRPELETVMRNAVPMGRMADRRDLKGAAVYFLSDASLYT
                     TGSNLVISGGIHAGRL"
     gene            <1326417..>1326866
                     /locus_tag="TRUGW13939_05310"
                     /db_xref="GeneID:55992808"
     mRNA            <1326417..>1326866
                     /locus_tag="TRUGW13939_05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488474.1"
                     /db_xref="GeneID:55992808"
     CDS             1326417..1326866
                     /locus_tag="TRUGW13939_05310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344367.1"
                     /db_xref="GeneID:55992808"
                     /translation="MASSPKYTAREVLDAFYKAEREYMAAAPEDRDFTGIAATLSPNV
                     SMEQTSALPYAGVYVGPDGMQDWTRRMADYFDVVDVQNPEIFERPDSDRIVVLSNVHF
                     KVRSTGQEMDFPFCQAITVDLVRGVIVELRPFYWDVAEVNKALGHGQ"
     gene            <1327703..>1329142
                     /locus_tag="TRUGW13939_05311"
                     /db_xref="GeneID:55992809"
     mRNA            <1327703..>1329142
                     /locus_tag="TRUGW13939_05311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488475.1"
                     /db_xref="GeneID:55992809"
     CDS             1327703..1329142
                     /locus_tag="TRUGW13939_05311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344368.1"
                     /db_xref="GeneID:55992809"
                     /translation="MGIPFDGNSPVPLWIDGTQRVTKTTFDVISPVNQQVLWKASAAD
                     DNDVHDAIVSAAAAFETWRWKKPQERRDIFLRAYQLLKERRDESQAYSTTETGVPVVP
                     FGFEYGTAIDMCLQLAGLTANYGTIVDPDEKNTSAAFISQPYGVVLGIAPWNAPHTLG
                     MRACLFPLAAGNTVILKGPELAPATYWHFVSILHEAGLPAGCLNTIYHRPDDAAAITR
                     QLIAHPAIRKVNFTGSTTVGSIIAGMCGQYLKPCLLELGGKSAAIICADADLGLAAEQ
                     CALGAFNHAGQVCMSTERIIVNVSVVNNFRTALKAAIDRFFSPDNLAPILINEKSAVK
                     VRALLSDAVNKGASVLHGSLSDANGGNNRLRPVVLEDVKPGMNIYHEESFGPAVSLYT
                     VADDEQALQLANDTAYGLTAAVFTEDLRRGLKFAKQLETGAVHINNMTIHDELSLPHG
                     GVGDSGFGRFNASDGLREWFRTKAITWRD"
     gene            complement(<1329693..>1331240)
                     /locus_tag="TRUGW13939_05312"
                     /db_xref="GeneID:55992810"
     mRNA            complement(join(<1329693..1330363,1330417..1330438,
                     1330487..1330568,1330625..1330673,1330747..1330832,
                     1330880..1331022,1331106..>1331240))
                     /locus_tag="TRUGW13939_05312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488476.1"
                     /db_xref="GeneID:55992810"
     CDS             complement(join(1329693..1330363,1330417..1330438,
                     1330487..1330568,1330625..1330673,1330747..1330832,
                     1330880..1331022,1331106..1331240))
                     /locus_tag="TRUGW13939_05312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344369.1"
                     /db_xref="GeneID:55992810"
                     /translation="MHLRDVPEYPAECFPSDMRIYPFTREPIEAASREVESYEVKVIR
                     QHPMSLPQKQLCAWVQTPGPEATIEFRNIEVPTTGPGEVLVKLEVSGVCHSDHHSIYG
                     NTPMTTHIAGHEGVGTIVAVGPNVSEDLLNRRVGVSWLHRACGKCEICKVDYTHCPHQ
                     DNSGRNVSGTFQEYCLADADYVFDIPTEIPATIAAPLLCGGITMYGALVRADLHVGDF
                     VVIPGAGGGLGHLGVQIADSMGLQVIAIDSGPDKEAICRESGARHFFDFRKSGTSLVD
                     DVRSVTGGIGAHAVLCITGAPSAYGSALAMVRSLGKLVCVGIPPASYRLAVNPFEMLV
                     RGLRIIGSTVGNKSHMSSLMDLVLQGKVRPTVQVYEFSELPDVMKKLEHATVAGRAVL
                     KIS"
     gene            complement(<1331562..>1334305)
                     /locus_tag="TRUGW13939_05313"
                     /db_xref="GeneID:55992811"
     mRNA            complement(join(<1331562..1331749,1332201..1332583,
                     1332664..1332819,1332874..1333066,1333137..1333658,
                     1333724..1333991,1334198..>1334305))
                     /locus_tag="TRUGW13939_05313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488477.1"
                     /db_xref="GeneID:55992811"
     CDS             complement(join(1331562..1331749,1332201..1332583,
                     1332664..1332819,1332874..1333066,1333137..1333658,
                     1333724..1333991,1334198..1334305))
                     /locus_tag="TRUGW13939_05313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344370.1"
                     /db_xref="GeneID:55992811"
                     /translation="MLPNSRATPPERQQEQQPKRRRVTQACISCRTRKSRFDYRRHFQ
                     EIEDRLNQLESLFDEGSVNVQSSSMKPWNTGNTTEHNDRNSNTPNLISTSDDPLTGSM
                     GSDDPTDGMGHFVFSDEEDRAYFGPSSNIAFTSDLSRALKRVSRTRGRLSPGNQQTTT
                     LPEFHIARVSRPNSPVPRAAPWVAEDHQEDNVSTSSVFYLPPDQETSALIDQYFANTG
                     LLFPYLHEETFRETYAKLKHSNATTRRTWLGVLNMVLALATHTTVLQIGQVDKRQTQS
                     ERFYRRANGLCAEYVMNGASLEIVQYLLLVSQYMQGTKSSIQTWATHGLAVKVALQLG
                     LHSAEASKRFPSIEREIRKRTWFGCIVLDRTLSMTFGRPASIPENYSRLELPIYFDLI
                     EPRERVIEARHRCRYSTDFFNATIRLYSILGNAIDLLYEGNLGSEDKILNYELITRVL
                     RMRHLLEEWTEQLPKHLGLIRAQNCTSQLGKDPTIDRFRTILTLRYHNIRLLIHRVVL
                     VRLCDSLDDLNARGQDVLALQDVAWSTMQIATDSGKSNSNQVIIQNTTMFTQSNDYHQ
                     DNSVPDEQIADQNLSFLDFDFMANELFDVTDDFLQGRNF"
     gene            complement(<1334790..>1335951)
                     /locus_tag="TRUGW13939_05314"
                     /db_xref="GeneID:55992812"
     mRNA            complement(join(<1334790..1335100,1335166..1335600,
                     1335666..>1335951))
                     /locus_tag="TRUGW13939_05314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488478.1"
                     /db_xref="GeneID:55992812"
     CDS             complement(join(1334790..1335100,1335166..1335600,
                     1335666..1335951))
                     /locus_tag="TRUGW13939_05314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344371.1"
                     /db_xref="GeneID:55992812"
                     /translation="MATETEIVTNPVAPERPETVSGINSSDELTLSLEKLQTKPLWTQ
                     MAKLNPPLPNPSCVPHIWRYNLIRPSLLKAGELVGESQAERRVLMLVNPARDAPYTTD
                     TLYAGLQLVMPNEVARAHRHTAFAMRFIIEGHGGFTAVQGQRITMQRGDVILTPRWNW
                     HDHGKDGSGPMIWLDGLDLPNFRHFPVHFVEHYQQLRYPADDVDSNTSPIVFPWVKMK
                     QALDKIPGNWASKDYLKSDGRQVSKVLGGSAERLNAGTSSPGIRETASSVYHVVSGRG
                     YSIIGENNRITWGPGDTFCIPSWQRYQHFADLKGEQVYLYRFHDKPMLNALGFYRVDG
                     VDVETLVSD"
     gene            <1336265..>1337336
                     /locus_tag="TRUGW13939_05315"
                     /db_xref="GeneID:55992813"
     mRNA            join(<1336265..1336541,1336597..1336733,1336802..1337171,
                     1337227..>1337336)
                     /locus_tag="TRUGW13939_05315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488479.1"
                     /db_xref="GeneID:55992813"
     CDS             join(1336265..1336541,1336597..1336733,1336802..1337171,
                     1337227..1337336)
                     /locus_tag="TRUGW13939_05315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344372.1"
                     /db_xref="GeneID:55992813"
                     /translation="MKLSWQRLIRFESVDGRVLRGEPILPRPDFDLGYVTEKDQLQAK
                     VILGEDPFCESGTTRVSDEVVTVKRILSPLAPSEVPTIRCVGLNYMKHIQQAKRTPPP
                     FPFIFFKPQTAILDHGDNVMIPKIAQDDQADYEGELTIVIGKDAKDVSQEDALDYVSA
                     YTVGNDISSRKLQRDPSYAGRIPQWGFSKGFDTYAPIGPCLLASSLVDDPKTLHLRTT
                     IDGEVRQDESVADLLFDCRYLISYLSQGTTLQKGSLIMTGTPGGVGGDMNPPRWLQHG
                     TQMDVSISKIGTLRNGVAFVQ"
     gene            complement(<1337526..>1338722)
                     /locus_tag="TRUGW13939_05316"
                     /db_xref="GeneID:55992814"
     mRNA            complement(<1337526..>1338722)
                     /locus_tag="TRUGW13939_05316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488480.1"
                     /db_xref="GeneID:55992814"
     CDS             complement(1337526..1338722)
                     /locus_tag="TRUGW13939_05316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344373.1"
                     /db_xref="GeneID:55992814"
                     /translation="MPGDHGFFTPIQSPPAGAALSMYDQEKPVPELFKPITIRSTTFS
                     NRIWVSPMCQYSCNQAGELTDWHLVQLGSFASRGASLTIVEATSVSFEGRNTSEDAGL
                     WSVGQIPSFRRVVNFIHSQGQKAGVQLQHCGRKASVTAPWLGHRPARPEEGGFPDHLV
                     APSAIPYKDDGVWPTPTAMTKEMIQKAVGDFVHSANLAAEAGFDVIEIHGAHGYLIHQ
                     FCSPLTNMRTDEYGGCFENRVRFALEVVQGIRLAIPETTLLFYRISATDWISDRESWT
                     LEESVRLCRLLKDLGVDLIDVSSGGLVPEQNLPALQPAYQAYLSKTIKDEVPGLLTAS
                     VGMIRNGKTAEDVLASGSADVVFVAREFARNPSLVLKIALDLGVKVKWPVQLHRSQPD
                     YLDVDM"
     gene            <1339255..>1341324
                     /locus_tag="TRUGW13939_05317"
                     /db_xref="GeneID:55992815"
     mRNA            join(<1339255..1339443,1339504..1339588,1339640..1339953,
                     1340019..1340273,1340320..1340516,1340571..>1341324)
                     /locus_tag="TRUGW13939_05317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488481.1"
                     /db_xref="GeneID:55992815"
     CDS             join(1339255..1339443,1339504..1339588,1339640..1339953,
                     1340019..1340273,1340320..1340516,1340571..1341324)
                     /locus_tag="TRUGW13939_05317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344374.1"
                     /db_xref="GeneID:55992815"
                     /translation="MPPTILKDGDVQEQQVSHIETSSDADAIEKAIDSDRRPEAQGKD
                     QAELPKGYFYSPSFIGSYCAIGVAFACGTGGFALVAPILSEISRDLGAQGNSNANWVG
                     IVYSLAQAVVLMLVGRLSDIFGRRWFFIIGSSIGLIGSIVGGTATSLGQLIAGETLIG
                     IAAGFQCSFFWVVAEIVPMKRRFIANSGLFLWTLPTNILGPKIAATIQNNTSVKWRGC
                     FYYLTAMNALSVLLWFLFYHPPTFSLLHRNKRVKQLIMGFDFVGLFLFSAGMILLLMG
                     LNWGGSLYPWTSGYVLGTLLSGFATLVVCVIYELRVSLEEPYLPLELFKNIKYTSCVI
                     WCSIEAMTFYAFGLIWPKAVPILYPNLDLASSATISSLVTMSFALGQMSGPFLANWLP
                     AKPLVIIGSFIGTGLLAAVAANPLNMDLTLGMLVTGNLIIGMADGIGLPMTTFPIKNQ
                     ERLGTAGGLSGCIRLAGTSIAVAMYSTILSNRLNQTIPAAIETAALSTGISESAVPEL
                     IAVLNGGGSLSNNTVKGLTTSAIPLIEQAYRLGNSRAYSTVFLSTLGFGGLALVLSFF
                     IGGVDESDGEYVAAVIQNANEVKVTTEKDQI"
     gene            <1341768..>1342235
                     /locus_tag="TRUGW13939_05318"
                     /db_xref="GeneID:55992816"
     mRNA            <1341768..>1342235
                     /locus_tag="TRUGW13939_05318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488482.1"
                     /db_xref="GeneID:55992816"
     CDS             1341768..1342235
                     /locus_tag="TRUGW13939_05318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344375.1"
                     /db_xref="GeneID:55992816"
                     /translation="MASLKPVEKSTLCSLIKDAITQLRSIPPPGYFGMLNRQPYLDGV
                     FWTEDLNPKISGPFTSQEDMNLAIIERLRQIESDPYIRLLRNMIHQTLNGHRTVFTHG
                     DLQPKNIIVQRLGDGDGSPDFRITLLDWESAGWYPEFWDFCNATIACRFKPDW"
     gene            <1344248..>1346293
                     /locus_tag="TRUGW13939_05319"
                     /db_xref="GeneID:55992817"
     mRNA            <1344248..>1346293
                     /locus_tag="TRUGW13939_05319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488483.1"
                     /db_xref="GeneID:55992817"
     CDS             1344248..1346293
                     /locus_tag="TRUGW13939_05319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344376.1"
                     /db_xref="GeneID:55992817"
                     /translation="MCDTNPSNASGANTPAILIGIYGLPGSGKTTMINDLKQQLDDTK
                     YVFYEGSEVIDRVFPGGLIAFQQSSEKEKERHREIAINTIHRECTQSGKTGILAGHFM
                     FWDNQNEEPKTVMTEGDLKAFSHILYLDVPTGEISRRRSCDSARRREDLPIAHLEKWK
                     KQEKEGLQLRCRRHNILFMRLPPHIQLPTVAALIEDFHSHNEPYNFSKARKVLDEAIN
                     ANSDHLETILVLDADRTLSAKDTAALFWDKALSSQSIAMDENPLKKLFDALRYSYTAF
                     RQATLLYEEAVNEETFHALCQDVASETSIYAEFAALLRLVAQQNRVGAIVITSGLRSI
                     WEKVIEKVGLPEQVKVIGGGRVKDGYVVTPAVKHDLVTRLQDKHGLCVWAFGDSPIDL
                     PMLRKADRAIVVVGYKHERSKSMEEPLNSAINIEGLRAQQALLPSSVEPRLDLLQLPS
                     VDLTQEVFLNSLFTRYSRPDLEFCHATEKNAAKMLMAQMRDARNKGPQLRTVHQRVGA
                     YLATEYLTEVIGLEKYTIQHVQGYPTDGHRLLDESRTLIVALMRGGEPMALGINDVFP
                     LAMFLHARISEDIKEHHLEGIVNVILVDSVVNTGKSVLEFVERIRQLHATVRIVVVAG
                     VVQAQSVTKGTAFYKKLTRHTGYPKFHMVALRLSENKYSGRGGTDTGNRLFNTTQLE"
     gene            <1346637..>1347637
                     /locus_tag="TRUGW13939_05320"
                     /db_xref="GeneID:55992818"
     mRNA            join(<1346637..1347381,1347438..>1347637)
                     /locus_tag="TRUGW13939_05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488484.1"
                     /db_xref="GeneID:55992818"
     CDS             join(1346637..1347381,1347438..1347637)
                     /locus_tag="TRUGW13939_05320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344377.1"
                     /db_xref="GeneID:55992818"
                     /translation="MTSASPRRPPPAYTAPSTSTVHASSQVYRDVAATAARPDARILE
                     TSFTIRPCSGQAWIVRAGQVCRLTTPQGPQVGDLNIWNANNPRERMWAARTRQIHSSH
                     VSVGDRLWSNLPYLRPLVTITGDSLGGGQLDQVLDEEGKRREGTEFGTTKWGGRVHDL
                     LGTRCDPYVNLLMGGESFDFHCHSNLTRAVVPYSLTELDVHDVLNVFQVTGLDEQGKY
                     FMEASPAKAGEYFEFFAEVDVLCALSACPGGDLSQWGWEGKEGSDMAATCRPLGVEVY
                     RMVNARLLDGWTQPACAPYKGMHGLRMPVREDDGYVGN"
     gene            <1349104..>1349529
                     /locus_tag="TRUGW13939_05321"
                     /db_xref="GeneID:55992819"
     mRNA            join(<1349104..1349118,1349174..1349214,1349282..1349350,
                     1349442..>1349529)
                     /locus_tag="TRUGW13939_05321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488485.1"
                     /db_xref="GeneID:55992819"
     CDS             join(1349104..1349118,1349174..1349214,1349282..1349350,
                     1349442..1349529)
                     /locus_tag="TRUGW13939_05321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344378.1"
                     /db_xref="GeneID:55992819"
                     /translation="MTLYNVTLKDSVPPEKLEKAKEEARNNGGTIKHEYTLIKGFTVE
                     YPDDHISVLETNEHIHVEQDGKVSTQ"
     gene            <1350126..>1351560
                     /locus_tag="TRUGW13939_05322"
                     /db_xref="GeneID:55992820"
     mRNA            join(<1350126..1350328,1350375..>1351560)
                     /locus_tag="TRUGW13939_05322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488486.1"
                     /db_xref="GeneID:55992820"
     CDS             join(1350126..1350328,1350375..1351560)
                     /locus_tag="TRUGW13939_05322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344379.1"
                     /db_xref="GeneID:55992820"
                     /translation="MARSIRLLSPRRWPSPVSRFHRTYSTTTSSNPAQPWSYPPSWTN
                     VAEDEIAKLAAMRRLPLTLGHLLKHGQPPLSKQALLDSANFTLSLLPARLAYRIQCLR
                     NLPFIVVSNPHVSRIYNNYLHSLSTLLPYQQRRITTLDEEKQFAEVMSDLVQTHSNTI
                     PILARGFLECRKYISPEEVTQFLDSHLRARIGTRLIAEQHLALHFASQPISDENPNPP
                     ASQREQCPPNYIGVIDTMLRPSQIIRSCEHFVGEICELKYGVRPSLVIGGEPDTAFAY
                     IPVHVEYIITELLKNAFRAVVESGNEREPIEVTIAAAPDVPGNHPNPIPHLPHHARDG
                     DVNVEIGQEVPVANENIRLTNASSQSITIRIRDRGGGIPPEVLPQIWSYSFTTFSEND
                     LPGGTNGNIDALNTISGSGGNTSTIAGLGYGLPLSRAYAEYFGGSIAVQSLWGWGTDV
                     YLTLQGVGRIQD"
     gene            <1352086..>1352757
                     /locus_tag="TRUGW13939_05323"
                     /db_xref="GeneID:55992821"
     mRNA            <1352086..>1352757
                     /locus_tag="TRUGW13939_05323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488487.1"
                     /db_xref="GeneID:55992821"
     CDS             1352086..1352757
                     /locus_tag="TRUGW13939_05323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344380.1"
                     /db_xref="GeneID:55992821"
                     /translation="MEAIFNYENFRLAPRFDAQAQSSMLRPNPKLEHALANSSANGLP
                     PINVLPIAGQHLSILTQLIGAKSVLEVGTLGGYSSICFAEAGAKVTSIEIDPKHRETA
                     LQNVAGLDVEVLLGAALDVMPKLAEEGRRFDMVFIDADMTDHWEQFDWAVKLTRAGGC
                     VFLDDVVAAMIKDGHPQEGKESILTQVGRDERVKATLVPTVACHPMAPNPVFNGYVLA
                     IVKDR"
     gene            complement(<1353101..>1353364)
                     /locus_tag="TRUGW13939_05324"
                     /db_xref="GeneID:55992822"
     mRNA            complement(<1353101..>1353364)
                     /locus_tag="TRUGW13939_05324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488488.1"
                     /db_xref="GeneID:55992822"
     CDS             complement(1353101..1353364)
                     /locus_tag="TRUGW13939_05324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344381.1"
                     /db_xref="GeneID:55992822"
                     /translation="MHFFTGLTTLLFTTLALGAAIETRDNTDNADNFNPGDNVQSQSC
                     SPKGGACDQGQTVCCAGLRCYIPPKSGWEPAGPWYTQQGACIV"
     gene            complement(<1354289..>1355459)
                     /locus_tag="TRUGW13939_05325"
                     /db_xref="GeneID:55992823"
     mRNA            complement(join(<1354289..1354522,1354580..1355212,
                     1355277..>1355459))
                     /locus_tag="TRUGW13939_05325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488489.1"
                     /db_xref="GeneID:55992823"
     CDS             complement(join(1354289..1354522,1354580..1355212,
                     1355277..1355459))
                     /locus_tag="TRUGW13939_05325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344382.1"
                     /db_xref="GeneID:55992823"
                     /translation="MMRLWVTLACAQLAAASASRWKSQQFKSIVTFGDSYTDESRLNY
                     FSEHNGTAPPPGWVDPVNNDTASGGYIWARYVADYANVKLYNYAVSGAVCSNKVAPHW
                     FSTINNNFPSVLEYEVPAYLADSKVINANDSRPFLDIPPAETVYSIWIGTNDLGSDGF
                     LRDSQIAGKTIPDYTDCVFSALDQIYENGARYFILQNLAPLQLAPLYATPERHGVFNL
                     KNGNSSTNVTEISYRMWQIVTTANAIYDYQTPFELLVQKRYPGAHFAVMDMYNILQDM
                     YFNPEEYFEHPPNVTGFNNYCDDPNSPSCPRPSNPDSYMWFNPLHPSEKTDTHIAQRY
                     IEVFKGESKYATYWS"
     gene            <1356360..>1357760
                     /locus_tag="TRUGW13939_05326"
                     /db_xref="GeneID:55992824"
     mRNA            <1356360..>1357760
                     /locus_tag="TRUGW13939_05326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488490.1"
                     /db_xref="GeneID:55992824"
     CDS             1356360..1357760
                     /locus_tag="TRUGW13939_05326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344383.1"
                     /db_xref="GeneID:55992824"
                     /translation="MEVKEDVENVHPVVETVASQTTSSENLSTKQDVAFEPIILAKSR
                     KNGTTYRLLEGQQQPQLRNNISFGVGFLEFANALDFAANIWNESPLPRFVVALMATGG
                     SVTLLLSTFALFDFRRSWKNTRILRDERKYLHRLRSENGDQGDLVRDIDRVLSVNYRE
                     LTSEIVDRVAMDFLLGFAGLLVGIGTLIAIPGAQNHQVYLASNFLSGYIGNAFPLLWG
                     VINFVTSMYIWWRFHRQARCAAKFGHLEPLLADIVLRCRQFQRHACLTAINGLVAGVA
                     GMITFKYWWAYVILIPCIVASLFANLYYRMRIGYDRYLMTNTPEAFSAPHNLSLELMD
                     AHIFCVSLRQRALPTQITALGNLEKPDMTVASTLLESNRLFPLFCEWLFNNDERIGQR
                     VFSSEDHSDQIVITGQNFAHADVDRGRFCSLFKDFLLDCGPRHFESRRRYLLELMAYD
                     LEQQHRDEPHGARQAL"
     gene            <1358301..>1359045
                     /locus_tag="TRUGW13939_05327"
                     /db_xref="GeneID:55992825"
     mRNA            join(<1358301..1358327,1358394..1358405,1358483..1358633,
                     1358762..>1359045)
                     /locus_tag="TRUGW13939_05327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488491.1"
                     /db_xref="GeneID:55992825"
     CDS             join(1358301..1358327,1358394..1358405,1358483..1358633,
                     1358762..1359045)
                     /locus_tag="TRUGW13939_05327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344384.1"
                     /db_xref="GeneID:55992825"
                     /translation="MFASKRLGKELIKMKGHLPPGITIVQSENFEEWLMDIRVLDSNP
                     LYQDQTFRLKFSFNSKYPIEPPEVIFIELPSTSETPRPIPIHPHVYSNGIICLDLLSS
                     AGWSPVQTVESVCMSIQSMLTANSKNERPPGDDDFVVRNRRRPRDINFVYEDDNV"
     gene            complement(<1359671..>1361297)
                     /locus_tag="TRUGW13939_05328"
                     /db_xref="GeneID:55992826"
     mRNA            complement(join(<1359671..1360429,1360482..>1361297))
                     /locus_tag="TRUGW13939_05328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488492.1"
                     /db_xref="GeneID:55992826"
     CDS             complement(join(1359671..1360429,1360482..1361297))
                     /locus_tag="TRUGW13939_05328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344385.1"
                     /db_xref="GeneID:55992826"
                     /translation="MVSRDILSSTPQATHGQFLLSSEEERQQPHRFDALHLSSQPSLS
                     LFSAPPMASSLSRVAGRVPKTLGRQQLLLRASTPFARSMSSTPSRRAAEPEPYQATQI
                     IPTDPSFAHLANKGAPEYPDKGSGLESKTEVGGRKIRHYTVNFGPQHPAAHGVLRLIL
                     ELNGEEIVRADPHVGLLHRGTEKLIEYKTYMQALPYFDRLDYVSMMTNEQCFSLAVEK
                     LLNVEIPERAKWIRTLFGEITRVLNHLMSVLSHAMDVGALTPFLWGFEEREKLMEFYE
                     RVSGARLHAAYVRPGGVSQDIPIGLLDDIYQWATQFGDRIDETEELLTDNRIWLARTK
                     GVGVVTAADALNMSFTGVMLRGSGVPWDIRKSQPYDAYDQVEFDVPVGNNGDCYDRYL
                     CRMEEFRQSLRIIHQCLNKMPAGPVKVEDYKISPPPRAAMKENMEALIHHFLLFTKGY
                     TVPPGETYSAIEAPKGEMGVYVVSDGSERPYRCKIRAPGFAHLGGFDQVSRGHLLADA
                     VAIIGTMDLVFGEVDR"
     gene            <1361636..>1362871
                     /locus_tag="TRUGW13939_05329"
                     /db_xref="GeneID:55992827"
     mRNA            join(<1361636..1361683,1361740..1361844,1361900..>1362871)
                     /locus_tag="TRUGW13939_05329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488493.1"
                     /db_xref="GeneID:55992827"
     CDS             join(1361636..1361683,1361740..1361844,1361900..1362871)
                     /locus_tag="TRUGW13939_05329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344386.1"
                     /db_xref="GeneID:55992827"
                     /translation="MAPRIVASAEEASRRKIININAETITNIPSTDFPGHWPGESHEW
                     SLEKFKNSFQVEVHTNEPLDSSFSLIGLDAAIANAFRRILIAEVPTLAIEYVYVHNNT
                     SVIQDEVLASRLGLIPLKGSIEGLNWMRWFKKPTEEDPAGSDPSDYNTAVLRLDIECT
                     KNVDASPDEEDPRIRYNHAHVYARDIEFVPSGRQDQYFVDEGELRPVNPDILVAKLRP
                     GQKLELEMHCIKGIGGDHTKFSPVATASYRLLPEIRILRPIIGEDAKKFAKCFPRGVI
                     GFEKVTSAEASQRGSGYEGHAGEDKAVVVDAFKDTVSRECLRHDEFKDKVKLGRIRDH
                     FIFSVESTGQFPSDTLFLESVKVLKLKCARLKRNLANLMH"
     gene            complement(<1363082..>1364611)
                     /locus_tag="TRUGW13939_05330"
                     /db_xref="GeneID:55992828"
     mRNA            complement(join(<1363082..1363833,1363886..1364182,
                     1364231..1364310,1364360..1364365,1364418..1364519,
                     1364571..>1364611))
                     /locus_tag="TRUGW13939_05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488494.1"
                     /db_xref="GeneID:55992828"
     CDS             complement(join(1363082..1363833,1363886..1364182,
                     1364231..1364310,1364360..1364365,1364418..1364519,
                     1364571..1364611))
                     /locus_tag="TRUGW13939_05330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344387.1"
                     /db_xref="GeneID:55992828"
                     /translation="MPSLAGTASTNTRWKHLYNVLSKPGAFSDEDWVPGPETIEALET
                     SKILVIGAGGLGCEILKNLALSGFKDIHVIDMDTIDISNLNRQFLFRQTDVGKAKADV
                     AAAFVEKRVKGVKITPYVGKIQDKDEDYYMQFKLVVCGLDSIEARRWINSTLIGMVDP
                     ENPESLKPLIDGGTEGFKGQARVILPTLTSCIECQLDMHAPRAAVPLCTIATIPRQPQ
                     HCIEWAHQIAWQEKRKDEPFDGDDLDHVSWIYQHALERAKQFSIPGITFQMTQGVVKN
                     IIPAIASTNAVIAASTTSEALKIATSCNPYLDNYMMYAGEEGVYTYTFAAEQKPDCPV
                     CGNLARTIHVDPEVTLEAFIESLSERPEAQLKKPSLRSEEKTLYQRFPPQLEEQTRPH
                     LRLKLKDLVSDGQEVAVSDPAFTIDFRYKLIFQ"
     gene            <1365002..>1368241
                     /locus_tag="TRUGW13939_05331"
                     /db_xref="GeneID:55992829"
     mRNA            join(<1365002..1366166,1366219..1366305,1366352..1366895,
                     1366945..1367667,1367761..>1368241)
                     /locus_tag="TRUGW13939_05331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488495.1"
                     /db_xref="GeneID:55992829"
     CDS             join(1365002..1366166,1366219..1366305,1366352..1366895,
                     1366945..1367667,1367761..1368241)
                     /locus_tag="TRUGW13939_05331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344388.1"
                     /db_xref="GeneID:55992829"
                     /translation="MDDILTAVKTARNDNQTSLPAAKPLIEPLDETPIKQTTIQVSPA
                     HILEILKTHPGEDELYQALRWLDPTKKNGERGSFDIRHASPLTAPILQTLASNTIPDH
                     WKNVEKSSSKTRGALLRCLCSIAGVRALVTSLQISINALRTSPQKEKDSGRKLAIQDI
                     VSFLAALLKPADFVCRTYKNNASMYDTSSKRRVSWSEFCSLLAGGKVLSTIAEALSFT
                     ETMKGTTSVSWIGEGASFSGWLGLNMSHMVLESGQKDDEFWKAASVMIGRAIGLGHTE
                     KFVHELYTNTFEGDAPSRSWHCFFDLLRPHEQVAIVQSILKDLQATHFSSYEQKGRDS
                     DGIVGGVAALVSHYLEGKTCVQETIQSWLSTGNSNVVTTIGLRRVLLLLYSRDSDTMR
                     DLFTHSLSNFGDAFSIKHSLLQFQEANAQILLLAAGYLYRSQPGEIESIARSSIYLNA
                     VSNRLAASSSRARFLGMVIGMAISELVEPPGKGLKFDLEGLETEEARWYLSLTRMQDK
                     IGSISDLKRSKHGEAEKPKQITANRPRTSRPPTTVHTRPTARIVAIEEIGDDEDEEEE
                     NDEFIPYEKPDSDASDEEEDPTLIQRGKLTAPVYIRDLIAYLRDSENADRYHLGITNA
                     PSLIRRKAAFGTELVESIDGLAMVIVGLQDTYSLPKFHEYRLQAMIALLVAQPVRMGQ
                     LFTSTFFDGDLSQTQRSAILTALGLGARELAGHREDDAKVMGLPSSISHEAFPSKKLP
                     SHLQGLYSETGEESPVSTLTRQMSRTSLQPLALDAADAASGPNALKVRTFSSRMEVER
                     QRQQREAQRKKKTVSTNLHKDLTEGFFHPLVGRFAAMLQSSSSLSSGYSHFNSPNILR
                     LFIQTITLVISTLGPHSPALPTVTQDTFTLILALHGKPISTEPVVLPALLSLFLASID
                     LNTAAGSSAEERLVTDHATEVMELREWTNDVFERTPAASGSTTSPGNPDDMQQTRILA
                     AGILVKIGEVIERYQRRLMGVNVGFKY"
     gene            complement(<1368552..>1370435)
                     /locus_tag="TRUGW13939_05332"
                     /db_xref="GeneID:55992830"
     mRNA            complement(join(<1368552..1370159,1370238..>1370435))
                     /locus_tag="TRUGW13939_05332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488496.1"
                     /db_xref="GeneID:55992830"
     CDS             complement(join(1368552..1370159,1370238..1370435))
                     /locus_tag="TRUGW13939_05332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344389.1"
                     /db_xref="GeneID:55992830"
                     /translation="MSPQAVSSTSTPLYRVFRGLKSTQVIAVPATEAEWLVALNDFKS
                     IYLAGRWKECETKCTRLLEAAKNKPVIHPYLLFLIGTCVEIHARNMHQYSSGKGKKVK
                     EAADWFERCEKALPQSMVVPCPEPTIDNPIFRTPVNRQGLVVAPVDDSPLTAFGERGR
                     FSPHHDEELTHSKHFSFGSNAMVSSLTDMSYLNMETHSPDETDPFISLTPESESARAR
                     LDDWSIPPPPKLAPLPLRIRKVNADDTSKKHVPKIPQFTTIPSPFSQASPTNGIHWFD
                     EDDSSSPLRGVEVQNNEVTEVYGDDPFSDHHVVNARYNYFDYDDEVFRRDMDNAVDFH
                     TSPALSFKYDSFDRDSGRHAVLQREDSSLWFKNHRSSLKPSPLRIRPKKTQATTTPDG
                     GSDSDSTSLACLQRSWEISSFEGTYATDSDAHSLHAVESTWSPLSRQYHASLAAENER
                     FQTLRARITRYNNHLTSLSNQLQETVRCLHQLAMDIDSNRTTHIEARRIQPTKSYWSF
                     AVKNESGSAVDASNSDDYDEHRDKPEMKANLNWAAPGTILNETKEERIKRLRAGRFET
                     VGMQNEKRGHKGRGWYLDLCEEVLDDIEGLMRGIY"
     gene            <1371828..>1373794
                     /locus_tag="TRUGW13939_05333"
                     /db_xref="GeneID:55992831"
     mRNA            join(<1371828..1372046,1372166..>1373794)
                     /locus_tag="TRUGW13939_05333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488497.1"
                     /db_xref="GeneID:55992831"
     CDS             join(<1371828..1372046,1372166..1373794)
                     /locus_tag="TRUGW13939_05333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344390.1"
                     /db_xref="GeneID:55992831"
                     /translation="GIYRFVRLLRSALGGTSPPAQTTSIQLTSAFQAGVQYVFANLGA
                     DHPPILEAMITGHNQRKDQWPTVITCPNEMVALSMADGYARSTGKPQCVIVHVDVGTQ
                     GLAAAVHNASCGRAPVLIFAGLSPYTLEGEERGSRTEYIHWIQDVPDQKQIISQYCRY
                     TGEIKTGKNVKQIVNRALQWAMSDPKGPVYLMGAREVMEQEIEPYTLDQRQWVPVTGA
                     ALPANAVEMIANELVDAKEPLAIVGYNGRNAQSVKELVTLADTVKGLRVLDTAGSEMS
                     FPADHPSWLGMRFGNHEAIKTADFILIVDCDVPWVPTVCKPKDSAKVVHLDVDPLKQQ
                     IPMFYLPSIATYKVDSTTAFKQIHEYIASNAALIQTLSSDEISARQKHVEEEYRRNLK
                     AIADSAAVPSGGDDAYLNSHYLISELRKAAPQDAIWAIEAVTQTLPVADQLQCSIHNS
                     WINCGGGGLGWSGGGALGIKLASDDQHGGKNKGKFVCQIVGDGTYLFSIPGSVYWIAR
                     RYQIPILTIVLNNKGWNAPRRSLLLVHPDGEGSKATNEDLNLSFDPSPDYPGIAKAAA
                     GGELWAGRASTVKELSEQLPKAIQSVLSGKSAVLEAQLDGTDGKYVERK"
     gene            complement(<1374004..>1379315)
                     /locus_tag="TRUGW13939_05334"
                     /db_xref="GeneID:55992832"
     mRNA            complement(join(<1374004..1374295,1374366..1374562,
                     1374787..1375222,1375306..1375423,1375503..1375875,
                     1375923..1376159,1377189..1377637,1377694..1377828,
                     1377893..1378348,1378405..1378550,1378615..1378818,
                     1378882..1379074,1379144..1379242,1379306..>1379315))
                     /locus_tag="TRUGW13939_05334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488498.1"
                     /db_xref="GeneID:55992832"
     CDS             complement(join(1374004..1374295,1374366..1374562,
                     1374787..1375222,1375306..1375423,1375503..1375875,
                     1375923..1376159,1377189..1377637,1377694..1377828,
                     1377893..1378348,1378405..1378550,1378615..1378818,
                     1378882..1379074,1379144..1379242,1379306..1379315))
                     /locus_tag="TRUGW13939_05334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344391.1"
                     /db_xref="GeneID:55992832"
                     /translation="MAPEKHFVSDIGNLVHNALRAQISVNSSLYFDESNLVVFHKPQS
                     SFDKVILIAGGGSGHEPAHTGFIGEGMLDVAVSGNVFASPSASQILAGLRALPAPRGI
                     LMIVKNYTGDRLNFGLAAESAKAEGLQVNMVVVQDDVSIVDPGLVGRRGLAGTVFVHK
                     IAGAAAAAGMDLAAVTRVAQKAADSVVSMGVSLGRSSVPGREAQQEAFPGDEMEFGMG
                     IHNEPGVVRGKLGSLETTVSVMLQALLKPFPTTWYPQPGDRVALLVNNLGGLSLLELN
                     AILDEVIRQVTDAGLQIQYTLADSLLSSLDGPGFSITLFKLDEEIEGFLQASTNAPSW
                     PRNVHPHASSTAARRCLQQENSTGRSVEEFTKGIQVPRSQLQSVLAGIQKSVQSAEPL
                     ITSYDTTVGDGDCGTTLLGGINAIIANIDLGSQEAVGLGSFLHKISEIVERHMGGTSG
                     AIYAIFLRAMSNYLNSLSSESQDTAGIISESLQRSLDTLYRYTPARKGHRTLVDSLIP
                     FVTDFSEKKNLKTAIDAAKKGSESTVSMKALLGRASYVNADIMENQAVPDPGSVGLHE
                     HPNSPNALIQIMPAASTEGSSHNAGPPLLRDMWAFAGVSIMVMILRILAKIRIRKLGW
                     DDILMTFALVSAFFPLETGCLSLIGSAIITVAVLHGYGRSVGTVSDVSTVIMYDYLGQ
                     TFGICGGVMGRIAFIVLINGLLAARKQWRVILWALMVAQIIINVLFILIIFLQCPGHA
                     SAIWSDLDNSGNCWDLRVQTYYGYFEGSFNSATDLYLAAFSTYVFWHLNLKLQVKLGL
                     IVLLGLGIFAMAASIVKTVQIHVLASASSDPTMATVNLERWLYIETYLVIITTSIPCI
                     RPLLRPFNRSREYSHGTRTNNNTHELNSPYVGHSASSFRARTPMSVLSGRTGGSGSGA
                     KVISKRHSDFEEIGSEDETASGSNSGGRGDEESQGLGTRTMRKHRKQRPRQTTQKTIT
                     LNIANGSVLGPNSWHLIDYRNSLSPKPKRRLNPDADRKSDRSRQVRDVVFKALTSSGP
                     VIADFYATWCGPCKAIAPKIAQWSEEHTDIRFLKVDVDKMRQIAQENGITAMPTFIVF
                     KDGQSVQTIRGANVPELQKAIESLAA"
     gene            <1382269..>1384330
                     /locus_tag="TRUGW13939_05335"
                     /db_xref="GeneID:55992833"
     mRNA            join(<1382269..1382383,1382445..1382709,1383025..1383320,
                     1383483..1383794,1383858..>1384330)
                     /locus_tag="TRUGW13939_05335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488499.1"
                     /db_xref="GeneID:55992833"
     CDS             join(1382269..1382383,1382445..1382709,1383025..1383320,
                     1383483..1383794,1383858..1384330)
                     /locus_tag="TRUGW13939_05335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344392.1"
                     /db_xref="GeneID:55992833"
                     /translation="MKEYTPLISLWAQTIILLVYLIQRYRRPKFIRDLPGPRGYPLIG
                     NYIDFPKSHPWLKFKEWGDTYGPIYQLKVFGVTYVIINDAETAEELLSERGFRYSGRS
                     NFEMITMMTGGMDLAITAIKAKPCNGICHQTDRRPSNDYWRRGRKFAASVLGSNMVPK
                     WDPVQAREATRMVVDMVCDPTRYQFWLERASTCASVRLTFGKNLPGAEEAEYHTQRIT
                     ERMHEIERIAENPPSFARFWSEKDDHYNLEWREAAYVIATLHGGGSGTTLSTMQSYCL
                     AMCHFPEWQKRLHDEIEQVVGSERAPNLDDIGNLPIVRAVSKELLRWRPVVPIGIPHR
                     VAFDDEYEGYRIPAGALVVANQWGIHREKQLYPDGDEFDPERWLDMWYSSTYEHPTAK
                     YPTIRRFSAFGIGRRICPGYDVAERALFIQIASLEWACRIKKKKTVNGEEIALPLYEY
                     SSGVTSQPLNFQFDVEPYEARRVEVLKNAWEEAIDL"
     gene            <1384963..>1386729
                     /locus_tag="TRUGW13939_05336"
                     /db_xref="GeneID:55992834"
     mRNA            join(<1384963..1385407,1385464..1385540,1385593..1386405,
                     1386472..>1386729)
                     /locus_tag="TRUGW13939_05336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488500.1"
                     /db_xref="GeneID:55992834"
     CDS             join(1384963..1385407,1385464..1385540,1385593..1386405,
                     1386472..1386729)
                     /locus_tag="TRUGW13939_05336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344393.1"
                     /db_xref="GeneID:55992834"
                     /translation="MSPSAIPVDVRGETDTSAVVVPDPLAINALAAWRTDGAVPTGTA
                     AFSSSDMFKSPACFTRPKAKRWDHILSTEAKARKPSTLKAAAAYLKRPGMISLGGGLP
                     SSENFPFEEISVKVPSAPGFSEEETKKTGKTLTAGKHDISEGKSLLDLEVGLNYGQSM
                     GFAQLLRFVTEHTEIVHAPPYADWQCCMTVGSTYSWDATLRVLCERGDYILTEEYSFV
                     SALETAAPLGIKAAAVTMDEQGLRADALDEVLTNWDEKARGARKPHLLYTVPSGQNPT
                     GATQGAERRAEVYKVCQKHDVYIVEDEPYYFLQMQPYKANVPPPSSREEFLKLLLPSF
                     LKLDVDGRVLRLDSFSKVLAPGSRVSWIVGAEQLLERFMRHFETSVQNPSGFSQIPFF
                     KLLDEEWGHAGYIDWLVHLRLEYTRRRDDMLHACEKYLPQEITSWEPPSAGMFHWIEV
                     SWKKHPGFAKGQSHADIEEAIFTASVDRGSLLSRGSWFRADHSIPEDKMFFRATYAAA
                     PADKIDEAIKRFSEALRAEFSL"
     gene            <1389096..>1391323
                     /locus_tag="TRUGW13939_05337"
                     /db_xref="GeneID:55992835"
     mRNA            join(<1389096..1389313,1389371..1390196,1390248..1390444,
                     1390500..1390622,1390673..1390849,1390903..>1391323)
                     /locus_tag="TRUGW13939_05337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488501.1"
                     /db_xref="GeneID:55992835"
     CDS             join(1389096..1389313,1389371..1390196,1390248..1390444,
                     1390500..1390622,1390673..1390849,1390903..1391323)
                     /locus_tag="TRUGW13939_05337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344394.1"
                     /db_xref="GeneID:55992835"
                     /translation="MTRIISLTALVAALVASSAARPSPNTHAVHEKRGAISSRWASSL
                     RVRSDADVHVKIGLKQNNLHRGHDMLMDVSQPSSDNYGNFYTEDEITEIFAPTDDSVN
                     AVKSWLTSSGIHDLRITHSDNKGWLAFIASGEELESLLHTDFYEYEDLETGDRNIATE
                     QYHVPKHIQEHVDYITPGIRFPFLRNPELAKAKRSSSSRKVYNTFQSRPAPPGKIHGA
                     KNTTTGCDEVITPDCVAALYQIPKRTDTPSPNNSLGIFEEGDFYTQADLDSFFTRFSS
                     YKIPNGTAPTPAFIDGAKAPGDIAGGESNLDFQLAYPIVYPQNITLYQTDDSYYAEGY
                     AQGLFNTFLDAIDGSYCTSCYAGECGNSPIDPVYPNNNTSSGYQGKLMCGTYKPTNVI
                     SVSYGAAEDYVPQSYYERQCNEFMKLGLRGVSVFFSSGDSGVASRSGCLGNDSTIFNP
                     GWPASCPYITSVGATKIPANRTASDPEVAANDPAGHPYSSAYATGGGFSNIFGIPDYQ
                     ADAVANYFKNHNPSYPYYNGSILGENGGIYNRSGRGYPDVSANGDNIAVVVQGEDSLS
                     GGTSASSPIFASIVNRIIDERIAAGKPGPLGFLNPILYQNADAFNDITEGTNSGCGTD
                     GFSTAPGWDPVTGLGTPIYPKLRDVLLKV"
     gene            <1392343..>1394971
                     /locus_tag="TRUGW13939_05338"
                     /db_xref="GeneID:55992836"
     mRNA            join(<1392343..1392789,1392845..>1394971)
                     /locus_tag="TRUGW13939_05338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488502.1"
                     /db_xref="GeneID:55992836"
     CDS             join(1392343..1392789,1392845..1394971)
                     /locus_tag="TRUGW13939_05338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344395.1"
                     /db_xref="GeneID:55992836"
                     /translation="MEVPRASRFLDPSSAMASITKQKADAIRLAKEQAAAVNEMCRRA
                     KTEVPQYEFEELIGKGAYGRVYKGRQLPSRDLVAIKVMDIDNLDYKMNRDMKDESIKD
                     FIHEIKVMNQAKEAGAKNVNVLIEAISIHSQLWVVCEYCPGGSVKTLMRATGDRLDEK
                     FIIPIARELAEGLRAIHDAGIIHRDVKAANVLIQEEGRLQICDFGVAGILQSKMDKRS
                     TWIGTPHWMPPEMFSARGGSTHQYGSELDVWAYGCTLYEIATGNPPNAGLRERMQIGR
                     SLGRSIPRLDGSRYTEELKDLVAFSLESDPATRPTMSDILSHPYITDSEAEYPTNSLS
                     ELVRIYYQWSQRGGQRISLFHPGGAAAAELPENTSFDDDWNFSATDGFERRYSVLDLD
                     QLSASLAEIAEGDETAADNEPDPMGDDSQAPEMTSMEKANFDERVKRGAAAMEGLFDE
                     MKPTYKYETKNDFVPVEAKQRYSDLPLRTTTDRSSVTSTYLDLNLGSFDSSHYAAGSA
                     SQFQLADAGTIRANRSSLRSGRNSDGDQSRTSSSSDGSSTNGDTFQPSAPRPPTMDWK
                     FPSMAVPEDREPDPAPIQSSQDTFKPLSIDKRATRDWKFPSMADTVEEPTHTDYALDE
                     TPSHTIRPPYVQSQQSALDLTLDHDHSRGPSIEITNMDESRPSTATSTVSDYDPFRFD
                     RASDIYATSRHMYNTSSSSTAISSSLDGPGPDDHDDVQEFAKGSVDGPGPIAHEESVI
                     HEESVIDDGPGPDDDEDDDGGPGPDHHDNDSNSDMASSTTAVTPLTAHRAPLHTPRNS
                     TGKDYDSNLLEFPDVQPPSAQSLVEDTPEEVVALELDRLIEKFMQACYSTIDAVEEVV
                     V"
     gene            <1395401..>1396300
                     /locus_tag="TRUGW13939_05339"
                     /db_xref="GeneID:55992837"
     mRNA            join(<1395401..1395669,1395742..1395810,1395895..>1396300)
                     /locus_tag="TRUGW13939_05339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488503.1"
                     /db_xref="GeneID:55992837"
     CDS             join(1395401..1395669,1395742..1395810,1395895..1396300)
                     /locus_tag="TRUGW13939_05339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344396.1"
                     /db_xref="GeneID:55992837"
                     /translation="MPRSPGKPKLVPPPLQKATVKSLATDQPAPAAGNINVQDAVLSR
                     LKKCLARGSHPNTSEKEARAALVIANRIMQQHNITQADMLAQEEKSTKAGSKHVVMEG
                     FVTTAAHAIQKIPYNLIVKWARAHHGRSAAYCYCRGVADGLYKTAIEEKSLEELRARQ
                     AGVTMVKAESSDSSNADDTGSVWESEMQLVRFGESAEKIAQSYLEQNNIKVRSTKKRT
                     ASVKDSNSYTKGKNDSKKINVRQRVIEHS"
     gene            complement(<1397029..>1397823)
                     /locus_tag="TRUGW13939_05340"
                     /db_xref="GeneID:55992838"
     mRNA            complement(<1397029..>1397823)
                     /locus_tag="TRUGW13939_05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488504.1"
                     /db_xref="GeneID:55992838"
     CDS             complement(1397029..1397823)
                     /locus_tag="TRUGW13939_05340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344397.1"
                     /db_xref="GeneID:55992838"
                     /translation="MKITAASALLLAGSAAASPLSGRVARRNGITRPNMRISSNKADQ
                     VSSSSTSNNWAGAVLVDTGFTAVSGKIIVPTPKVPADGDDSTQYCATAWVGIDGDTCQ
                     TAILQTGVDFCIQGSDTSFDAWYEWIPANSVDFSGISFGAGDEIEMSVVADSKKTGKA
                     TITNNSNGQSVTHSFTTDETTSSLCETNAEWIVEDFTLIQGGQQSLAPFANFGKVTFT
                     EASATKGGSKVDATGADTITLVDESGNKLATPEVDGSTVTVTYAGN"
     gene            <1404394..>1406010
                     /locus_tag="TRUGW13939_05341"
                     /db_xref="GeneID:55992839"
     mRNA            <1404394..>1406010
                     /locus_tag="TRUGW13939_05341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488505.1"
                     /db_xref="GeneID:55992839"
     CDS             1404394..1406010
                     /locus_tag="TRUGW13939_05341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344398.1"
                     /db_xref="GeneID:55992839"
                     /translation="MSKDKGFVPITNGPRKFQAPWPALLLTLIALVCMTAMAAIVVIS
                     NNKPVASWAIGPAVLLAFFSSVWSGSLTMLLTMSIAVIWWRAARQGSSLESLHCIWNK
                     GLGLRYISSLRTNSAACWAVLLSWLVIVAQIAHNPLLQRSTRTAVHQTTASDDLTLSV
                     ASKIPDGWIGSVQDASIGRIVTYPNSTSVIRDWWLNATIQTPGSRCNGTCKGRVLGSG
                     IDYTCYSTTSTLDLTALENAGLFIFGINTMMTTDSTGSPVLNLSTLFSSHVDENCTAT
                     LNSWNCSVQAATVEYPFIVENDTISLDTENLYPPVVVEPYVSDGDKSTATRGQGAGPL
                     LGLQDFMHDVLDTNVSLVIDQSRNVSLHTGLLISDIFAQLNNSAYSPAVIGKCRLQWA
                     DPTQYALTAMQAYLFRSSISAAHTNENPQTCPVERTSSVLIFQSNFRFLLGALSVMTL
                     AVICVLAQFWNWWQLGRRVTLSPIEVANAFGALRTNRRNDLCMIDDILKVAGETTVRY
                     DGTRFTENGMVLKTSLPTSSSYVQDAGCKG"
     gene            complement(<1406714..>1407297)
                     /locus_tag="TRUGW13939_05342"
                     /db_xref="GeneID:55992840"
     mRNA            complement(join(<1406714..1407189,1407246..>1407297))
                     /locus_tag="TRUGW13939_05342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488506.1"
                     /db_xref="GeneID:55992840"
     CDS             complement(join(1406714..1407189,1407246..1407297))
                     /locus_tag="TRUGW13939_05342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344399.1"
                     /db_xref="GeneID:55992840"
                     /translation="MKTFASLLALTATCAAAIPAASQTFTLTVSSNDTSLNGLGVVES
                     GNKNGGIGYVQTISSRKDSPTVFFLENGTEGRLQTYSLTDNSLRYAWTWDDTYVGSIQ
                     FDKKGGDDGTIYDIDFKITPDNFLVPAGKFSSFPWSFCPASSDIAGDDNLGGPIYLGE
                     ITCVALAGLNVVASE"
     gene            <1409276..>1410074
                     /locus_tag="TRUGW13939_05343"
                     /db_xref="GeneID:55992841"
     mRNA            join(<1409276..1409563,1409630..1409888,1409953..>1410074)
                     /locus_tag="TRUGW13939_05343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488507.1"
                     /db_xref="GeneID:55992841"
     CDS             join(1409276..1409563,1409630..1409888,1409953..1410074)
                     /locus_tag="TRUGW13939_05343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344400.1"
                     /db_xref="GeneID:55992841"
                     /translation="MLSLVIPSSSPLDQDPSRCIQPRDKLYSLQNLVKDIKSCLGNDS
                     GIGSSAIDEDYLKSLLRKYASNPNDWFRYFYNDYSKNYTRNTIENINQKANILLLVWN
                     PGKGSPIHDHANAHCIMKVLAGELVETVYENPDQEAPKTSPLVVKSENRHQTNDVTYI
                     SDDIGLHRVHNPSTDQIAVSLHLYTPPNAADYGYHIFDATTGKASFVPQARSFLTSGA
                     QNEQ"
     gene            complement(<1411248..>1413068)
                     /locus_tag="TRUGW13939_05344"
                     /db_xref="GeneID:55992842"
     mRNA            complement(<1411248..>1413068)
                     /locus_tag="TRUGW13939_05344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488508.1"
                     /db_xref="GeneID:55992842"
     CDS             complement(1411248..1413068)
                     /locus_tag="TRUGW13939_05344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344401.1"
                     /db_xref="GeneID:55992842"
                     /translation="MNSGRCKAKASAALACTGCRKQHLKCDADKPACSRCLQAGLACH
                     YLPSRRGGRRKSRLNGSSQDHSSVGDSHRDFDLQGEITPSRIHMDGPISMIPQNSVPQ
                     PQRIESPDNQRNSAVGSVWSGVVSGDTMQLLPSPSDIPDEPTPDDRSIRLFYENFHMA
                     HPILVPSSLYGIRNYPVFLQLVVNFIGSHYLPLSPDLQYKDRVAAELASSPDQSPHMV
                     QALLMFAIALYARGEGLEAQSALTRSISLALELGMHRKEFASSCYPTRSIDAESLRRT
                     WWELYITDVLIAALGKKLNFQCASVPHDVALPCEEVTYANNGAIPEPPTIRDFQQRVF
                     ADEESAFSSFSYRIDATKILSRILVLNRLRDCHRDHLQAVENALVSWINHIPAKKVDI
                     VDSYGNVDEMLFQAHLTISYAAMLLHLPRSDFQPISPSTESLFYPWVPHHLPPSFTRL
                     VHSIKATEASKQLSDFISICPAVHRHTPFVVSALVLCGMVQLSTCANHSNECLDHHRN
                     RVILVLGCLKNLKRTWAVAGPAYHHLRSSALQVEKLTTEQSSTSLPAGSIQTEEGNSQ
                     IGLANVNEQRPISQHMTPTFIDPTCSNTFFFNNMPDFDFS"
     gene            <1413448..>1414056
                     /locus_tag="TRUGW13939_05345"
                     /db_xref="GeneID:55992843"
     mRNA            join(<1413448..1413617,1413732..1413909,1413979..>1414056)
                     /locus_tag="TRUGW13939_05345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488509.1"
                     /db_xref="GeneID:55992843"
     CDS             join(1413448..1413617,1413732..1413909,1413979..1414056)
                     /locus_tag="TRUGW13939_05345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344402.1"
                     /db_xref="GeneID:55992843"
                     /translation="MGRVRTKTVKKSAKVLIERYYPKLTLDFETNKRLCDEVAIIASK
                     RLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDVSQTSESGKL
                     DVDQETKDLLKSIGFDSIPVNVVAVSQQQVVERPRRFGR"
     gene            complement(<1414446..>1416908)
                     /locus_tag="TRUGW13939_05346"
                     /db_xref="GeneID:55992844"
     mRNA            complement(join(<1414446..1414605,1414671..1414740,
                     1414806..1414961,1415016..1415457,1415515..1415612,
                     1415663..1415778,1415845..1415959,1416015..1416094,
                     1416152..1416244,1416300..1416465,1416517..1416713,
                     1416772..>1416908))
                     /locus_tag="TRUGW13939_05346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488510.1"
                     /db_xref="GeneID:55992844"
     CDS             complement(join(1414446..1414605,1414671..1414740,
                     1414806..1414961,1415016..1415457,1415515..1415612,
                     1415663..1415778,1415845..1415959,1416015..1416094,
                     1416152..1416244,1416300..1416465,1416517..1416713,
                     1416772..1416908))
                     /locus_tag="TRUGW13939_05346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344403.1"
                     /db_xref="GeneID:55992844"
                     /translation="MADVNKPVDSGSGKPKNNTEYIEDVEHVTKDPRVEAASYGRNLN
                     ARIYNPLAGISKTQLFINVTHFCEAYGLEDKIDTFKKAALLAQSPLNFESIDELDEDD
                     KYHLRRETTHRWHLPKALYYSIALCSLGSAIQGWDNTGANGANLSFPQEFGIENNTWL
                     VGVINSGPTLFGLLSAWAADPLNNWLGRRGTIFLTGLFCVFPVLAQAFTQNWWGLLLC
                     RLFMGLGMGVKISTIPVFSAEVSPATIRGGIVTSFQLWVSFGMFVGYCTNLIFFRIGR
                     LAWRFQLAAAFVPAIPVLIFVWFCPESPRWLMKKGRYREAFESFCRIRNTELIAAREL
                     YYAYCQVIEEHNAFEGKALSTRALEIISVPRLRRAMISSAIIVIAQQFSGINIMAFYS
                     STIFADAGYSVKVSLLASMGYGIVLFVFAFPAVWTMDTFGRRNLLLFTFPNMAWCLLA
                     AGLSFLLPFGSSARVPLIALFIYLFTAFYGPGIGPIPSIYFSEAFPLSHRELGAAFTI
                     CINNSVGSALSLTFPSLLASFGPTGAFGFYAGLNMVAFFFIFFIVPETKQRTLEELDF
                     VFGVPTTRHVQYQVGTWLPYVIKRNLLWQRNAKLAPLYHMEDD"
     gene            <1417718..>1419045
                     /locus_tag="TRUGW13939_05347"
                     /db_xref="GeneID:55992845"
     mRNA            join(<1417718..1417766,1417824..1418008,1418076..1418385,
                     1418436..1418589,1418640..>1419045)
                     /locus_tag="TRUGW13939_05347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488511.1"
                     /db_xref="GeneID:55992845"
     CDS             join(1417718..1417766,1417824..1418008,1418076..1418385,
                     1418436..1418589,1418640..1419045)
                     /locus_tag="TRUGW13939_05347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344404.1"
                     /db_xref="GeneID:55992845"
                     /translation="MGSAGVTTWLDKLEEQLNVDVDWMDPTFTKSLPIVPHDMTSNQL
                     WVDDQMNHPDNQELFLNAVKEYKDEGWLAIYTRVACLMCKENIGNIKGRVLLQVLPSN
                     AYDGQKVLEHARLYAREFAKVGISKDRFCIKIPSTGPALSVCPILKEEGIATLGTALF
                     SLSQAIACSQAGCLYISPYYNETRAHDELDLWPNVEDPATQHTMSPRIIQMLETYRRL
                     YKETGKPQPLIKNASFINVKEAMAAGEMGCDSSTISPQVLTELAKLPYDGSKQPGEGV
                     PKPVHPNNQNTVPTPERLKKIAATDPLAPANWDGKLASTDIDYLANNGAELAKAIAAD
                     PATVSRLKDALELFIGGQNKSRAKIEAALKTLA"
     gene            complement(<1419057..>1420117)
                     /locus_tag="TRUGW13939_05348"
                     /db_xref="GeneID:55992846"
     mRNA            complement(join(<1419057..1419848,1419917..>1420117))
                     /locus_tag="TRUGW13939_05348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488512.1"
                     /db_xref="GeneID:55992846"
     CDS             complement(join(1419057..1419848,1419917..1420117))
                     /locus_tag="TRUGW13939_05348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344405.1"
                     /db_xref="GeneID:55992846"
                     /translation="MASQPIPQTQIDTSPNQAASTANPRWPTMVDGKRKTKKRVRNFT
                     PADRAAHRVFEKSRREAFNDQLMELARLIPAISSAARLSKHTIVNESIAYHRAQDKQC
                     LAGIRGIQALLAERDELLEEVNSLRVLLQPGAITTTSAGRVARPLADEVVEFVRREAE
                     INRINSEAMIRQSRQDSCSTTSPDQNNYSPDGDTTRNRAMEIHQQHHQQSHLDMLAGG
                     PDLLGDVPEDFDFWEDIDPTQAIPSGLQTSAFDLDTAINNEPIPMPQRLGENSMFHGT
                     SSAFPYPNHLGQEGLIAQMGPLELSAFPGTSGRPESTQNPNSNRTEMTQMMSLY"
     gene            <1421150..>1422583
                     /locus_tag="TRUGW13939_05349"
                     /db_xref="GeneID:55992847"
     mRNA            <1421150..>1422583
                     /locus_tag="TRUGW13939_05349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488513.1"
                     /db_xref="GeneID:55992847"
     CDS             1421150..1422583
                     /locus_tag="TRUGW13939_05349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344406.1"
                     /db_xref="GeneID:55992847"
                     /translation="MNGIQNQEPNPIADAIKQITDHYLREASDPENQPICKVADTETA
                     SILTEKYALPDDTPHEIEDVLKEAIEVNDYRIRNGHPRFFGFIPSPILPVAWLGDVVS
                     SVFNVHAGSRMQSSGASAIEKSLIHWMATAAGLPAETAGGISVSGGSMANLTAMILAR
                     DNKLPLDKMQVGVAYVSDQTHSSVAKGLRVLGFRADQVRKVPSNDKFQLDIQALEDAI
                     KTDRDSGLYPFMIIATSGTTNTGAIDPIDAITEIARREDLWVHVDGAYGASAILSKTR
                     RKLFNGLGKVDSISWDAHKWLFQTYTCSFVLVRDKSLLSKSFHTSAEYVQDATDMDYI
                     PNYWNFGIELTRPARATKFWFTLRVLGLDKISSMLDHGIDLAEYAEQQVRKLPQWQIT
                     SPASLAIVTFRHVPEGKTDAQLDELNTKISQQLLAENVAGALTTRVHGRVVLRMCSIH
                     PELSRDSMKDIVARMHDIGQELASCMP"
     gene            complement(<1423275..>1424855)
                     /locus_tag="TRUGW13939_05350"
                     /db_xref="GeneID:55992848"
     mRNA            complement(join(<1423275..1423866,1423937..1423967,
                     1424042..1424067,1424120..1424144,1424196..1424328,
                     1424397..1424441,1424510..1424516,1424597..1424650,
                     1424725..1424759,1424814..>1424855))
                     /locus_tag="TRUGW13939_05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488514.1"
                     /db_xref="GeneID:55992848"
     CDS             complement(join(1423275..1423866,1423937..1423967,
                     1424042..1424067,1424120..1424144,1424196..1424328,
                     1424397..1424441,1424510..1424516,1424597..1424650,
                     1424725..1424759,1424814..1424855))
                     /locus_tag="TRUGW13939_05350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344407.1"
                     /db_xref="GeneID:55992848"
                     /translation="MAQHIYTDLPLEADSSDADSAFGGSNIDSLSYKTSITSSIWNYK
                     YENGRRYHSYREGEYLIPNDDQEQDRMDLLHHVYRLLLKGELNCAPITKDPRRVLDLG
                     TGTGIWAIDFADQFPESEVIGNDLSPIQPQWTPPNVTFEIDDFEAEWPFSRPFDYIHG
                     RELAGSVKDFDALFAQAYKNLAPGGYFEMQSFRIEIFSDDGTLEKAPYTTQWTGLLKE
                     ASEKFGKLMTNMDEWPDKMTAAGFDDVTLRIIKVPMNPWPKDAKQKEIGRYMQVEQES
                     AAPGYTNALLSRVLGWSKEEIDVLLARVVSELRDRSIHQYSKLYVIYGRKPST"
     gene            <1425671..>1429841
                     /locus_tag="TRUGW13939_05351"
                     /db_xref="GeneID:55992849"
     mRNA            join(<1425671..1425899,1426009..1426859,1426919..1427026,
                     1427090..1427256,1427314..1427473,1427527..1427567,
                     1428606..1428700,1428766..1428874,1428938..1429307,
                     1429374..>1429841)
                     /locus_tag="TRUGW13939_05351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488515.1"
                     /db_xref="GeneID:55992849"
     CDS             join(1425671..1425899,1426009..1426859,1426919..1427026,
                     1427090..1427256,1427314..1427473,1427527..1427567,
                     1428606..1428700,1428766..1428874,1428938..1429307,
                     1429374..1429841)
                     /locus_tag="TRUGW13939_05351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344408.1"
                     /db_xref="GeneID:55992849"
                     /translation="MFKMQLAYSWEHGLCLALASWVLYLIAGAVYRLYFHPLARFPGP
                     KIAAVTGWYETYHDLIRRGMFVWELEKMHEKYGPIIRINPNELHIKDSDFYDELYAPA
                     AKKRDKYKDFVILSGTPNASFATVAHNHHRLRRSALNPFFSKMVISRIEPLILEKVER
                     LATRFTEAAQAEDKPVLRLDAAFMALTMDIICHYAYGESYNYLGDDDFRARWREAMIS
                     ALENGILLRNFPWLLPVLQSIPYSVLQVINPNGAALMEWAGLVKLKIEVMMKEHAQGN
                     KASGTIFHTVLDSDLPPEEKSAARLLEEGQSVVGAGSETTANTLTIIMFYLLRDKNLL
                     QKLRAELASASIESPMLQFLEKLPYLTAVINEGLRLNVGVMSRSPRIAHETIHYQGWA
                     IPAGTPVSESSYFVQQDPTIFPNPEEFVPERWIEAQEKGFRLDRYLVCFSKGSRACIG
                     INLAYAELYLTLAKIIPRFEMELFETDVSDIKPERDFFVPVPRLDSKGIRAKVTAFNI
                     PVSSILFYIIICRRYWDFFPAGIMIRPRTVLRLILYGALNWLVLAALYAGLPSFSRAD
                     NGTNYATKVLQSGGKLTRVYGTDDYFNENHAADFPGNNEQRISLALSFQIDADSNKLI
                     ISDMGEVSLRKPEEWNPANKDDDDFFLLDSPLVVSAPAGDDDGVNLPWFDTADAVLMF
                     HFVHRDYASVRLRVVWRENGQKVEVWPDTSRSLAHDNIPLISLTLNSDENSPAKRIAA
                     ASVPPPPLSLSPSVTYHIRLILLAVLAPLTILIMGIFFVISSAISITLSFLSHFLWVA
                     VFVLVARWLYKGRPPVGEYVQKVTDDGKAVIERVGQSLSGWVSSSRKDEEHIVVQDSN
                     LGLERERKV"
     gene            complement(<1429872..>1430997)
                     /locus_tag="TRUGW13939_05352"
                     /db_xref="GeneID:55992850"
     mRNA            complement(join(<1429872..1430570,1430638..>1430997))
                     /locus_tag="TRUGW13939_05352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488516.1"
                     /db_xref="GeneID:55992850"
     CDS             complement(join(1429872..1430570,1430638..1430997))
                     /locus_tag="TRUGW13939_05352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344409.1"
                     /db_xref="GeneID:55992850"
                     /translation="MAQSATLSRMRAPLLAPALLLLATQSQQQSVFKEALRWYDRGLG
                     YVQKTLKSAGSIPDNEMHLLVPAALLMSFFEAINPTLDSGFEQHILGAIILLEAKGPE
                     TFATPEFHDLFLAVRGHAVTVSLMTGKSTCLAEEKWLTVPFMYTTKSPLDRINDCLLV
                     MMNNVSWMEDRPAGLIDPTKSTLDDQCIIRLSCLMVELDEIWSQISHWEIPRSGDNSE
                     TGQFSSGCVYTYTNAHRANSVAIHSLARLTLLLLLDRQTSPMGKGDYREMIMQASASI
                     ISAATYLSTFDIGCAYLRIITPLQIVAQRSPSNSQRDCAVHILQQWWAEKPLKGLTWK
                     ALQTISLSNKKSTLLVGD"
     gene            <1432534..>1433408
                     /locus_tag="TRUGW13939_05353"
                     /db_xref="GeneID:55992851"
     mRNA            join(<1432534..1432636,1432694..1433264,1433324..>1433408)
                     /locus_tag="TRUGW13939_05353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488517.1"
                     /db_xref="GeneID:55992851"
     CDS             join(1432534..1432636,1432694..1433264,1433324..1433408)
                     /locus_tag="TRUGW13939_05353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344410.1"
                     /db_xref="GeneID:55992851"
                     /translation="MSEHSKSCCETPVPGTVAAYQEKGEWIEIDGRKTYISGSKTATR
                     AVLYVFDIFGFSPQTLRGADILADRLSASSPALVIVPDWFDGFVAQKAWVPPVTPEQQ
                     EKLGGFIQNKASPGLVVPRVLELSKSLNKTFPTVEKLGIFGFCWGGKLASLACQDDKD
                     SFVVAVQTSPARIDPEEAKKVSVPMALLLSGDEDVEVASQYAANLTKDTLTERFEGQI
                     HGFMSARGDLEDAKVKEAFERGYEVAGAFFDKHL"
     gene            <1434263..>1437572
                     /locus_tag="TRUGW13939_05354"
                     /db_xref="GeneID:55992852"
     mRNA            join(<1434263..1434368,1434429..1434877,1434934..1435029,
                     1435088..1435310,1435371..1435475,1435543..>1437572)
                     /locus_tag="TRUGW13939_05354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488518.1"
                     /db_xref="GeneID:55992852"
     CDS             join(1434263..1434368,1434429..1434877,1434934..1435029,
                     1435088..1435310,1435371..1435475,1435543..1437572)
                     /locus_tag="TRUGW13939_05354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344411.1"
                     /db_xref="GeneID:55992852"
                     /translation="MHYFYSITLVLIVSVLRCTEAWTLDSSCRSDGNRTNYQATIENG
                     MRQAFIYNEAALDALNAIGSQNNVNDSIHIAQHDLFQYLFRVAMKDGKIDASYSKFQR
                     VRSAFQAVRRFDKTGDGLSSPLAEEVPQDDGLIVYCDWARFEEGKSCSGKEHAGVACD
                     RDLQQDVAMGPLYKSCKTGQTRAPMTFTHHEGKTRYAQIQLCSEYVNNANKYPLKFWK
                     DISLQALLAKPKAVVSNILKGAEPIDVAAAGISHTLFHDMIHAIGQGEIGDVHVHETG
                     VDGLDEDDPERSASYGWANCLRFSPYGPNREKMGEAHALENADNYAYFGLGASLISPT
                     GSGKPQRINPDGSLQVIPISKQRRANVHRRALAISAVPRDEGSTPSNTTGPLPPASPS
                     TKPVTTKPDTTEPTSTKPTDVPPASPSTKLATTKPDTTEPTSTKPIDLPPASPSTKPA
                     TTKPDTTEPTSTKPTEPPASPSTKPATTATTETTNTEPANTQPGTTLTSTKPGSIKPT
                     APQPPESPTSKAATTQPANTQPANTQPANTQPANTEHANTQPVNTSPGTTTLTTTKPD
                     SIKPTDPPPPESPTSKATTTEPANTQPPHTKPATTGPVDSPTASPSTKPPTTKPANKE
                     PTGTTPTSSPSTSPSSKPVTTEPTSTKPTDLPPASPGPKHTSTKPIDSPPASPSTKLA
                     TTEPVTTKPTGLPPTSPIGKATSTKPLDSPPASPSSKPASTGPVTKQPTNTEPVTTKP
                     TRTKPTNSPPTSPSSMPVSPHNSSVASPTPQTSVTPSSTAEAVITPRYDFQDVYGDYN
                     FFDAAQSVLSALEANMVPPVTGITPTPSAKFTTPISSPTTKTPKRTPMPTPTTTTTTT
                     TTSHPKPTPSAPGLWCAPTGGASVGVPVEYAQNNVTDFCKLEESSMFGPARYNLPVVG
                     SNIRNYENEYDLPGVTIYLNISLVSGEFNITKDVCHNTMNEILNDCAPYQKQDKEQHL
                     LKFGGGIPVKGPKGTASFNISLEAAGGTSN"
     gene            <1438774..>1441151
                     /locus_tag="TRUGW13939_05355"
                     /db_xref="GeneID:55992853"
     mRNA            join(<1438774..1438996,1439059..1439184,1439244..1439487,
                     1439550..1440012,1440070..1440141,1440201..1440570,
                     1440622..>1441151)
                     /locus_tag="TRUGW13939_05355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488519.1"
                     /db_xref="GeneID:55992853"
     CDS             join(1438774..1438996,1439059..1439184,1439244..1439487,
                     1439550..1440012,1440070..1440141,1440201..1440570,
                     1440622..1441151)
                     /locus_tag="TRUGW13939_05355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344412.1"
                     /db_xref="GeneID:55992853"
                     /translation="MRSAIRAAAVVALAAPVAHALAPRSQITSDSYDFVVVGGGQAGL
                     VLGRRLSENTNYTVLVLEAGTNGDEYRERIDTPAYSYYDSLWTTPLNWAFSTVPQPNA
                     GDREIFWPRGKTLGGSSAINGLYLTRPGKDEINAWMDMLGDMDGADYWGWDSFYSALK
                     KSETFTPPSDSIAAEANITWDASTHGTDGPIHASYPGYTFSQVGQWIMSLGTVGIASS
                     SEMYGGANYGAELSTSTINPTNWTRSYSRTGYLDPLPDSGNYDVLTDAYVTRLVFKNP
                     SSKGNLTASAVEYTCDGGKTNQTVQINKEVILTAGAVGSPAILLYSGVGPKDVLLDAG
                     VDLVSELPGVGQHVQDHFSATMKWTTNVETSGSIYYDDGADKNDTLYLSYIDSAIAYV
                     NASALFGDEVDSLQQSILSNITSYSPNTTYDAGVVAGYEAICNITANTILNSTVGQIE
                     ILYMNSDANGDVGITAALQHPYSHGRIYINSSNPLDYPVIDPNYLAHPADLDILLKGI
                     KLVRRIGESSPLKSTLIKETTPGSDVKTDDDWLDWLRQSASTEFHPSSSCAMLPQDQG
                     GVVDANLRVYGLANVRVADASVAPFALATHLMSSTYAIAEQASDIILKTYNTTSPSPT
                     VPHLSTSSTAVPDHTPSPTSTRASAASDSRQSPAALWYLGASLAVVFSLLF"
     gene            <1442359..>1443396
                     /locus_tag="TRUGW13939_05356"
                     /db_xref="GeneID:55992854"
     mRNA            join(<1442359..1442600,1442668..1442970,1443052..1443132,
                     1443219..>1443396)
                     /locus_tag="TRUGW13939_05356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488520.1"
                     /db_xref="GeneID:55992854"
     CDS             join(1442359..1442600,1442668..1442970,1443052..1443132,
                     1443219..1443396)
                     /locus_tag="TRUGW13939_05356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344413.1"
                     /db_xref="GeneID:55992854"
                     /translation="MEQKTSFDPSWINKVIDFEASDTFPLKQWKIVDKLNEISVQNDE
                     EDDGEESGHAHMQAIAIFECVNHMDACESAFMKIYMQIPYTGSDNSQPEDRAQQALPK
                     AEITEEMALLALTKQGCKSISPVFNWKREEQDESGPVPGGYLVYLVVADLPGVRISRD
                     DYWNLSRKQRDEVRDAFKVAYTDCLSCGIIRTSGVLGTSLIWDKASKKMFIVGFRYSR
                     AATEKDVWGSHLWLAWGFGERRREVSNMPQPLPSDILEDGSINEALWEL"
     gene            complement(<1443858..>1445394)
                     /locus_tag="TRUGW13939_05357"
                     /db_xref="GeneID:55992855"
     mRNA            complement(join(<1443858..1444017,1444075..1444973,
                     1445038..>1445394))
                     /locus_tag="TRUGW13939_05357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488521.1"
                     /db_xref="GeneID:55992855"
     CDS             complement(join(1443858..1444017,1444075..1444973,
                     1445038..1445394))
                     /locus_tag="TRUGW13939_05357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344414.1"
                     /db_xref="GeneID:55992855"
                     /translation="MTSIMQMITLGSVTFCLIGGVAALSAEQSFYPPALNNTAYIANS
                     SIGTYGGIYRAPTNGPTEGTPYGIYDYCSMPHPRAQEYALPEPLEQGRAKGKLVYLEY
                     LQRHQRRSPYNILPEGENQAYQCDSVRPYLYAGPNAASGVQPIPMYAQTYQDHTNPFT
                     PGVNGTCQYPQITIGGVQDGYRHGRDLWAVYGQKLGLIPREPNSRVWFRSSNSPLTQA
                     TAGAVLRGVWPEYHGALPLHQMVSSVDTVNEGYSCSAVSSTLSDIESTTEWKAHLNVT
                     AELRSILGSMLGATDSSWQGTFDHFSDNFQARLCNGYELPCSVANASNCVTVDMAEEV
                     FRAGDWEWNYYWRTNPDAVKYIQVVEGLFIGEIISRLQAVIDGKSTVDYSHIFIHDGD
                     IGPILGALGIDVLRWPAMGSNIAFEIWETKEKQSPFYARVLYSGHPVQSIYGTLDWVP
                     LSQLVDILKRYVPDDIVSLCG"
     gene            <1445737..>1446882
                     /locus_tag="TRUGW13939_05358"
                     /db_xref="GeneID:55992856"
     mRNA            <1445737..>1446882
                     /locus_tag="TRUGW13939_05358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488522.1"
                     /db_xref="GeneID:55992856"
     CDS             1445737..1446882
                     /locus_tag="TRUGW13939_05358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344415.1"
                     /db_xref="GeneID:55992856"
                     /translation="MKALHTGIAFLPILAKATSLSSYALQNVLSDASPIFGQYSKETN
                     ANTEWMKRYPDDTLLVHMNIPGTHDSATWNYSQATQDAMAGITALNQVTVPPPETFRC
                     QDRSLIDMLNSGIRALDLRYAFDPTNTSLIFYHSQALLSEAANLENVLFGFYQWLEDH
                     PSEIIILSLQYEGSTAKYYANDAEVQLALFDALTSPAAHDYFLQTKDELGTLGDARGK
                     IILMRRFDLDQLPSQYTEALPGLHFSPNLWTDNSPDIELVYNTKKNLTAYIEDYYEPQ
                     TPTGSNATENIQWKYNATIANIRKAALHYPDSLFWTWASSENTGNVPPDWPRIMAVGN
                     STDYTPEGGVNQQLIPFLKELKGKRLGIVMFDFFNQPAHLIDTFLDL"
     gene            complement(<1447248..>1448942)
                     /locus_tag="TRUGW13939_05359"
                     /db_xref="GeneID:55992857"
     mRNA            complement(<1447248..>1448942)
                     /locus_tag="TRUGW13939_05359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488523.1"
                     /db_xref="GeneID:55992857"
     CDS             complement(1447248..1448942)
                     /locus_tag="TRUGW13939_05359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344416.1"
                     /db_xref="GeneID:55992857"
                     /translation="MPNTKPRHPPPEHIHQLWDAYMENVDPVTKVFHVPTIRPAIEKA
                     AANTADIPRGFEALMFSIYSAAVMSLKDDECRQKFSEPRSDLRSRYICATKSALSRAK
                     FMGTSNLVVLQALVLHLLSVRDVYEPRAVWSLTGVAVRIAQGMGLERDGEYLGLPPFE
                     TEMRRRLWWLLKTHDFRAAELCGLAKFRDLDTSADSTRWPANVNDDQLYPGMTSPATE
                     SNALTDMVFISLRDELAKFTVGRVTMYRRQGKHPSQWDLGASGNDKGEVDRACKQIED
                     IFETKYFRYCDPSQPLHLMTMLVGRFALNVIRFLKHHPRRWPSIEQTPLSERQLAWEI
                     SIKLLEQQSMMQSSPTLKRFSWQSAYFQQWHALIHVLDTLKLNPLIEDADKAWKTVRN
                     IYENTPEMISDTKKPIYIAVGNLCLKAYADREAALQSRNVCLPPTPEFISQLHQQRDV
                     LNSQRQVREAQARRLETPISHSYNEHRKLGPQPETDITNLGHGFGYANFQHGTASRSS
                     TLSQTVDTTDDNSFWFNHGFEDSHLYFDDVMKINPDLMLTQDHSWEQWDALLADSS"
     gene            <1449833..>1451107
                     /locus_tag="TRUGW13939_05360"
                     /db_xref="GeneID:55992858"
     mRNA            <1449833..>1451107
                     /locus_tag="TRUGW13939_05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488524.1"
                     /db_xref="GeneID:55992858"
     CDS             1449833..1451107
                     /locus_tag="TRUGW13939_05360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344417.1"
                     /db_xref="GeneID:55992858"
                     /translation="MRVLISGAGVAGPTLAWFLAKTGASITVVEKSQAILPHGQNVDL
                     KGTAVTVIKKMGLLDRVRQSNTTEKGTQFIDSKGDPFASFPVKGGFSASLSSEFEILR
                     GDLAAILYKASRQSPNVEYLFGTTIKEVTSNDNDTVTVKFSHDKVEEFDLLVAADGQW
                     SKIRQQCFPAECVNVIDKGMYAVYWTVPRLPSDNDWWNIYVALRSRIITLRPDPYGTI
                     RAMFTRMPCSEDEKMAWLEATKNGKQAQQELIRKDFADAGWQSQRLLNDLEHAPDFYF
                     QVLQQIKMSKWSNTRVVCVGDAAYAPSPVAGGGTSLAIIGAYILAGELSKLDEHERPS
                     KALEAYESIYRPFVEEAQKIPSFVPAIAHPKTAWHRLLLQYSLWTLAKVLSVVAAIPR
                     LAKSFDQNSKDDFPLPYYPKLDIKTSQIATSS"
     gene            complement(<1451239..>1452963)
                     /locus_tag="TRUGW13939_05361"
                     /db_xref="GeneID:55992859"
     mRNA            complement(<1451239..>1452963)
                     /locus_tag="TRUGW13939_05361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488525.1"
                     /db_xref="GeneID:55992859"
     CDS             complement(1451239..1452963)
                     /locus_tag="TRUGW13939_05361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344418.1"
                     /db_xref="GeneID:55992859"
                     /translation="MAAELGLAINIFQAFETCIKAYQFISVANNTDRDSNNFFSRLQW
                     EHYRLLQWSKSTGLETGEPSEKLNWQYATQLLGEQETLLSSAAKVKMRYNLDVSEEQV
                     PWSRQKEDLKERYVSGFIESLRRLRPELYTQRTHTSKSKNGPIKRLRWASVDKVQADR
                     IVKDISELNDRLEALLDSADREWMRDSISDMLRDIISRCNNAGDIETIQSLINPKAVS
                     SNDALAAAATLKQMRILMRKGTSGLSEMSLPELRQLSYRRLKPCSPSQSLQYRELEVC
                     KYDGVDMIVDWRTVPSATWNVVERHMQCLALILSKTDDPSFHTLPLLGLLAWQEQCRF
                     GFVHKIPPRSKACNGTWHHKSLHAIISDHTMVSLTTRVDIAIQMAQTILQFHTAGWLH
                     KAIRSHNIIFLTSDSDNTVASLLRDPYLVGFDYARPDSKSGQELTELPDTPLLMDLYR
                     HPKSRGIHRQSYQKQFDLYGLGCLLLELALWKPLVKIATLSHGIDIQEILDATDSDNY
                     DVQFPSFLNFEHNEKLLMLVEHSAGFKFCEAVKTCFSAESLTGGTGTNTSLGAQKQVL
                     EHLRRCKL"
     gene            <1453199..>1457165
                     /locus_tag="TRUGW13939_05362"
                     /db_xref="GeneID:55992860"
     mRNA            join(<1453199..1453713,1453769..1454064,1454386..>1457165)
                     /locus_tag="TRUGW13939_05362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488526.1"
                     /db_xref="GeneID:55992860"
     CDS             join(1453199..1453713,1453769..1454064,1454386..1457165)
                     /locus_tag="TRUGW13939_05362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344419.1"
                     /db_xref="GeneID:55992860"
                     /translation="MDFWHVRPKIAAAFRGLSTHSQGETDVDDLLGRLCYPPRTASSD
                     KPPRIDSEKFVEIAKLLKTIDKQHGRPNHSAWAMRPRTYCVLRNIERLDLLDVFSHEG
                     LTDFNLPYSDNTLPDFVQGPELREKFFLSQICVLTDARTFEEPGGPHVSIDGNAQQHF
                     HHKRDLGQGGFGAVDEVMSRLSLKSYARKRVVRGDNNSLKNRRAQKYLIEELNTLKAL
                     SHRHLVRYIGSYTDEDHIAFLMAPVADCNLRNFLHNISNFPAFSVSLRYFYGLSDKKV
                     QPFVWDRIRATYDWLDVLREDNTSAEQDNEVLTWTRDLLKKQPKERLSSSQLMHRISH
                     SPSFHSFCCFECWPDYERNDRLPKELPSEEMAAIGAMDVNDQVTALFEQEPFDGSKVE
                     ETERHQTIEDWINSTRTESVNFRTLSHNDTRSGLSTEFTPNFIINQDTEEPFHDGNEG
                     ELKEEEKTILAQPLPANDDTLMAEDNPPPSLSVPGSFPQFDYEDDHDVIATPKVSSDE
                     SNGDSISELARISTIEHNPWAQEDDTSHTGIKYMPAISTKENDHDQNLDLNQNSYELL
                     KGTQDIPSLEDFHSSTVLVDVFGPNVWDDTVEWETAPESVFSVESNHSKKTIGTKPTI
                     EEPYQEPTNETSVQRNLSIPTLPGSKEIESRNIKQEYTCARKDVDVIDITSDQEVATV
                     PLEEKTKDPLAISVEVKEDHDSRKRESSSSTRSEKRADSSGSLPKPHDTQNAPEASTS
                     PMKREVDKSHDSQKRKASSSSISAEKAKSLENALVFLSNDYDSSTTDIEESGPGIQLI
                     TDSTRNNKSKKLWDMQDGILTIKKKETNDKEKSAKTEKLSLLNIAILNAAQKKSDEEA
                     KSDPKKKPYTVFSPQVYMETAWEAASTQVTQNTGKSLHNISLRKWWDRDIRLLESMCR
                     DGNAPAVRLLLKEGCNPGTVQKPRASPLLAAVKGGTAQHYKCVQALMRSGVNLDVKDK
                     RTGKTALQLAIEKPNFKGHTNLVRDLAAGGAKINTKDYNGEGPIHSVFRDEGSLHLEK
                     FRLDALACLLKADINGEADVNVPTGHELSCPLHLAVRRNSPVAVGMLLYKGAEINARN
                     SFGLTPLLMAATQWESQLREDQETVLKLLLQSPDVQVNEKSGMKMQTALHQAVLHASP
                     SAVKILVDFNVSTSIRNTDGKTALGLATDLDGKKWKEEKKRILEILKSQK"
     gene            complement(<1457273..>1459784)
                     /locus_tag="TRUGW13939_05363"
                     /db_xref="GeneID:55992861"
     mRNA            complement(join(<1457273..1459109,1459167..1459514,
                     1459681..>1459784))
                     /locus_tag="TRUGW13939_05363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488527.1"
                     /db_xref="GeneID:55992861"
     CDS             complement(join(1457273..1459109,1459167..1459514,
                     1459681..1459784))
                     /locus_tag="TRUGW13939_05363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344420.1"
                     /db_xref="GeneID:55992861"
                     /translation="MKLCTICTVYYCPVREKGGFAPGALENLQPTKSLRHLIFTDHKE
                     WDLNHIQRGHTILRLRPDRVACHDATATMAILQFISAGIPRVAVPTTVHSDHLMVSEK
                     GADLDMSRALGEHAEVYDFLSSASKKYGIGFWKPGSGIIHTVIFENYAMPGGLLIGTD
                     SHSPNAGGLGMMGIGVGGADAVDAMSGMPWELVTPKIVGVRLTGHLSGWTSTKDIICN
                     LAGILTVSGGKGRVIEFFGPGCETLGATAMATICNMSAEIGSTSCIFPYSDAMGRYLR
                     ATQREQSVNVSNKSKAALLTADEGSESYYDDVIELDLSSLEPHVNGPYTPDLSHPISQ
                     LKDTVTQKDWPLELSHAMMGSCTNSSFEDLEKTRQIVAQARTAGFPKFKTPFMVSPGS
                     EQIRATAEANGILQELRDAGALVLSSSCGPCVGSWDRKDVDVRGKEKNSVISSYNRNF
                     VGRHDSNPATHSFVTSPELVTAFAYAGRLDFNPLTDSIIPDKGSPNSIRFSPPVGQEL
                     PSRFETGLDTFQEPSPEGNLSTVTISPDSDRLQLLQPFNPWKVGCTQNMELLIKVKGK
                     CTTDHISPAGPWYKYRGHLENISNNMLTTATNAFIDDSRMLGHTRNPLTYGIQVVPEV
                     ARDLKQHQIHWCIVGDYNYGEGSSREHAALEPRYLGGVAIIARSFARIHETNLKKQGM
                     LPLTFNDPADYDLIREGDKITLIGVEDDDFQPGSQVAMQVKPREGDSWEATLNHSYHA
                     GQIPWLRAGSALNHIKATLLSQ"
     gene            <1460110..>1460848
                     /locus_tag="TRUGW13939_05364"
                     /db_xref="GeneID:55992862"
     mRNA            join(<1460110..1460163,1460225..>1460848)
                     /locus_tag="TRUGW13939_05364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488528.1"
                     /db_xref="GeneID:55992862"
     CDS             join(1460110..1460163,1460225..1460848)
                     /locus_tag="TRUGW13939_05364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344421.1"
                     /db_xref="GeneID:55992862"
                     /translation="MGLQSDAVNALRRFASCDIGDALVKLGVPNGGYLSGLKMFSPGL
                     MCTKTRLFGPAYTVRMVRDSDKASPSLTKHFADAISRDSVVFISQPKGIVSACWGGLM
                     STRAKTLGAAGVVIDGRFRDLAEHQEMGIKLFARDTSILGSASLTRSSELNVPVIYES
                     EAGEAVTVRPGDFIVGDADGVVAVRVDKIESCVDLCQERYEIDEETLKHLKNGEEMGP
                     TIKKLRK"
     gene            complement(<1460910..>1464906)
                     /locus_tag="TRUGW13939_05365"
                     /db_xref="GeneID:55992863"
     mRNA            complement(join(<1460910..1461022,1461193..1462136,
                     1462189..1462778,1462952..1463364,1463440..1463537,
                     1463871..1463960,1464026..1464181,1464236..>1464906))
                     /locus_tag="TRUGW13939_05365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488529.1"
                     /db_xref="GeneID:55992863"
     CDS             complement(join(1460910..1461022,1461193..1462136,
                     1462189..1462778,1462952..1463364,1463440..1463537,
                     1463871..1463960,1464026..1464181,1464236..1464906))
                     /locus_tag="TRUGW13939_05365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344422.1"
                     /db_xref="GeneID:55992863"
                     /translation="MTPPPATVDQFREHLRKLGLTNSVLTHGLSYGADCSSLRTFVLE
                     LEPNKTKAIGVIDPAVVTPEELVSLHNSGIRGIRVNMYKYQAMHDVERQMAALRDHSR
                     ILQQHCPGWSMAFTHTHPEFWARLKPFIEQEIVPTRIKLVTDHFALLKGSSLLPAENG
                     VATDVTQQPGFKEITDLVRAGHLFVKISAPYRVSKQAPNYEDLKPLVRAFFDANPRQT
                     LWGSDWPHTPEMKVRTYEEAMAEVSCLDVDDLAWLKSLRSWVSAEEWGALMVSNPKSL
                     SSSPSQNYGVDTGLWANDKIEFLLADVKLSVMEVFQRVVTARELVSRALTLMAATPTF
                     PSHVTLSYATRCLSRIRWLEESIRLLDPEFDLSQGPDVESYSTNISFPMRESILGTPP
                     RRLDGADGPESFTSLAPKDYTPEVSPRKRPYASLQASEEDVPSIEARSVAIDLGMISL
                     HSDSRQKSYLGSSSGVLFTKLIGAENDLPEPQEARTLFGVYFQEIHIDYPFLDPASII
                     NAYNALVLCVGRGYANKTDRNGWIEDIPPFSYNGKLDKVGDQIFTPISFFTAVFHAFM
                     VFSLAATLLTRNKNFDFSPTRFYKVALTAATEGISTISLPGLQSILLLTTQGMIGPAD
                     FNIWTLGHIAVSHCIDLGLQREPRATVDGSLTAVSLKRLVFYTVYKLERTIATIQGRP
                     LGIRDETFDIQLPDARGIRYNSASIAGCHDSTFPSPQQLNDLEISIHQFKLDQYVSEI
                     KLLFYHLHTNDRVFNFSRDHAENQTRLKAALDHWIAETQKICSRPVNHDSVGEEAVKP
                     SCEYLKLELLYHATLTLLHQPSQSTPHPTQSALHVCYESSRKRIHIYKQLHDEQGLFF
                     NWRDIHGIFASGATIIFCFWSSHEIQSMTPLAEALCDLRTCSNLLSIGGQWWPSVRGG
                     KQSFDKLVDLTIKRLSNLQNNNDGPSAPSRIQSQPRYSHDSLLRLDSASSVVGMGPVS
                     PSETDQGNTGHQSTYDEPDVESMDTFMDSFFFDYLQGDWSWDPFSKFSSTDI"
     gene            <1466920..>1467885
                     /locus_tag="TRUGW13939_05366"
                     /db_xref="GeneID:55992864"
     mRNA            join(<1466920..1467091,1467182..>1467885)
                     /locus_tag="TRUGW13939_05366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488530.1"
                     /db_xref="GeneID:55992864"
     CDS             join(1466920..1467091,1467182..1467885)
                     /locus_tag="TRUGW13939_05366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344423.1"
                     /db_xref="GeneID:55992864"
                     /translation="MVNPGHFIYPPPNSETDVQKYNYLDTVIVSWETLAQNVTPTYLS
                     IYYFLNDGNGWQLGYNQSVPTEGSRKVDLNIIEAGYYGQFNLMYWLPNNGGLGKYLSE
                     FFTVNHDKDSEPVIWGSTSSATSSATTTSTSSTATSTLSTSTLSTSTLTTSTLATSTL
                     STSTVTTSLITSTLAATATTLATPGAASASTPGQASTATGEGSQSSSSGLSKGAIAGI
                     VVGVVAAVLAVLAIAMFLFRRRNKSHTQIRDTTPRELDEKVNEQLILQPVSELPATNR
                     TAELSSSRMVAELPS"
     gene            <1470939..>1471994
                     /locus_tag="TRUGW13939_05367"
                     /db_xref="GeneID:55992865"
     mRNA            <1470939..>1471994
                     /locus_tag="TRUGW13939_05367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488531.1"
                     /db_xref="GeneID:55992865"
     CDS             1470939..1471994
                     /locus_tag="TRUGW13939_05367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344424.1"
                     /db_xref="GeneID:55992865"
                     /translation="MGKQSTVLVTGANGYIAAHVIADLLSSGYRVVGTVRSQSSAEKV
                     LSAHAVHNEQDQQNLSIQIVPDITTPGAFDKAVQADDITAVIHVASPFHLVVEDNERD
                     LLIPAIQGTKTLLESAATNSNIKNVVITSSFASIVNIGEGLRPGYTYDETDWNPATFE
                     DGKNSESGSFAYCTSKALAERAAWDFVRDRKDQISFTLSTICPPKIFGPAFSSPTRSE
                     SSSLGISMKDIYDLVGGVEKTVPQTQFWAWVDVRDVARAHVKALEVAGAAQQRFFITG
                     GRYSYQEIVDVLRQSDRIPQNVKTEKLPLGTPGQGYAGEFVYNVNNEKSKTLLGLEYR
                     SLEASVVDAAVQLVTLV"
     gene            complement(<1472049..>1473026)
                     /locus_tag="TRUGW13939_05368"
                     /db_xref="GeneID:55992866"
     mRNA            complement(join(<1472049..1472294,1472355..1472613,
                     1472687..1472825,1472879..>1473026))
                     /locus_tag="TRUGW13939_05368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488532.1"
                     /db_xref="GeneID:55992866"
     CDS             complement(join(1472049..1472294,1472355..1472613,
                     1472687..1472825,1472879..1473026))
                     /locus_tag="TRUGW13939_05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344425.1"
                     /db_xref="GeneID:55992866"
                     /translation="MLDQHSQVSIAQIVFYVPAVIAAVTLLFFRRAVKGLPRYAWYVL
                     TLFTLMRLAGGIVEILHVNNPSSTGLIIGATILLNTGVLPCIAATIGLVNIITRIDYR
                     DDRRLHYLEVASRLLFITAIGLLLAGGILEGNYDDINSVRIGTKLARAGYYVVAAFVG
                     GMIFFQAFFWLQRRNLSQNSMLILVGTTLAMPLFIVRLTYAFLSIYRAAYDDTWNPLN
                     GPIAPFLVMALLMEYSVVIIYLYSGFRIKPTTRVEDDGESAVALK"
     gene            complement(<1473360..>1474229)
                     /locus_tag="TRUGW13939_05369"
                     /db_xref="GeneID:55992867"
     mRNA            complement(<1473360..>1474229)
                     /locus_tag="TRUGW13939_05369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488533.1"
                     /db_xref="GeneID:55992867"
     CDS             complement(1473360..1474229)
                     /locus_tag="TRUGW13939_05369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344426.1"
                     /db_xref="GeneID:55992867"
                     /translation="MEGPFRVQPKRPVDRIIDCLCQAPAIYKDAEAFENSPPLKQLEF
                     HIGCITKCWKMDCILQEVYDDLEKEFPSPMYWSVLATEPNTADDPMRGKVFPVAYHFP
                     SLIVARSLMLYWSSRLLVWTGFFFLYSGILNIEIDAADARCSNYPDCAAFDDDMCYCR
                     YLVAKPTGWYQYDRSRLKPLDGRKDLRLLMYNVCQSVEYCLNNGVLFGSWSVSTPLSF
                     VYETTKNFPGFERELAWMEATLRKLQENGLRIIKYSTTINNPKNAKPEEFLEAENNDS
                     SGASQVGSESGLA"
     gene            <1476680..>1478923
                     /locus_tag="TRUGW13939_05370"
                     /db_xref="GeneID:55992868"
     mRNA            join(<1476680..1476905,1476973..1477066,1477127..1477154,
                     1477214..1477260,1477315..1477392,1477443..1477508,
                     1477559..1477596,1477653..1477726,1477788..1477883,
                     1477952..1478006,1478073..1478126,1478191..1478418,
                     1478467..1478541,1478598..1478717,1478781..>1478923)
                     /locus_tag="TRUGW13939_05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488534.1"
                     /db_xref="GeneID:55992868"
     CDS             join(1476680..1476905,1476973..1477066,1477127..1477154,
                     1477214..1477260,1477315..1477392,1477443..1477508,
                     1477559..1477596,1477653..1477726,1477788..1477883,
                     1477952..1478006,1478073..1478126,1478191..1478418,
                     1478467..1478541,1478598..1478717,1478781..1478923)
                     /locus_tag="TRUGW13939_05370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344427.1"
                     /db_xref="GeneID:55992868"
                     /translation="MGDKLNPASQDIELNQSSQPPEEKHWYRSTLFNAFVIGGVGFLA
                     PGLWNAMNSLGAGGAEKPFLVNAANALVFGIMGFLCLFGGPIANRIGFAWTLVLSTLG
                     YPIYSAALYTNNRYGNVWFVLVGAVACGFSAGLFWAVEGAVALGYPEVSKRGKYMNIW
                     LIFRTGGPLVGGAIVLGLNHSSAAAKKGSVGWQTYIVFVILQCLAAPLAYFLTPPQKV
                     QRSDGTHIKVAARLSFKGEFWALWNLSKQKRVLLLLPLFWAAYFNQYNGNFETYYFGL
                     RARALIGFIVNFSTILGSQLMSLFLDWKGMPVKKRISWGFYYVIFLHLVAWIYAWVVQ
                     EKYTREQPVFDWVDKGFVEGFFVLALWEFSRQSLQNWMYYMVSVTTDNISQLTRLSGI
                     LRGQESFAQAVSFGINTREWYGGRVPLAVNTILLGLAVLPTWIVVKDLNPDDIATDSD
                     DPVQDEVPLPSAIVEKVAVRDGL"
     gene            <1481445..>1483265
                     /locus_tag="TRUGW13939_05371"
                     /db_xref="GeneID:55992869"
     mRNA            join(<1481445..1481705,1481769..1481965,1482019..1482128,
                     1482186..1482334,1482386..1482524,1482595..1482897,
                     1482982..>1483265)
                     /locus_tag="TRUGW13939_05371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488535.1"
                     /db_xref="GeneID:55992869"
     CDS             join(1481445..1481705,1481769..1481965,1482019..1482128,
                     1482186..1482334,1482386..1482524,1482595..1482897,
                     1482982..1483265)
                     /locus_tag="TRUGW13939_05371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344428.1"
                     /db_xref="GeneID:55992869"
                     /translation="MSPSQQNRADESTPLIPAAEDDNNSTAPNKNDTNIDKPLPVGQI
                     MLLCFARIVEPIAFFSIFPFINHMIEECGDVAETDVGFYSGLIESIFSLTQMMLMIPW
                     GRASDRFGRKPILVISLAGMSVSCALFGTSQKIWHMILFRSMAGMFSGTIVTVRASIS
                     ENSTPKTQARAFSYFAFSNNIGICLAPLMGGALSRPVSQYPSVFGNIQFFKNYPYALP
                     TFVTGSVGAVACIVSAFFIKETLRTKVEGSNEPSKPMNTSELLKAPGVSSVLFLYTYT
                     MLLALGYTAVMPIFYFTSIGLGGYGFSEFQISIFIGIGGFAQSIWLLFVFPSLQRRIG
                     TGGILRVCSSVWPFWFFFTAGANTLLRLGWSNVFWVYAPTVLVAGSGVAMAFTACQLA
                     INDISPSPETLGTLNALSLTFQSAIRTAAPALFASLFATGVKHQIFAGYLAWVILVVL
                     AAGLRIGMRWLPAKAEGKLELENEDEETGA"
     gene            <1486208..>1487200
                     /locus_tag="TRUGW13939_05372"
                     /db_xref="GeneID:55992870"
     mRNA            <1486208..>1487200
                     /locus_tag="TRUGW13939_05372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488536.1"
                     /db_xref="GeneID:55992870"
     CDS             1486208..1487200
                     /locus_tag="TRUGW13939_05372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344429.1"
                     /db_xref="GeneID:55992870"
                     /translation="MLILDGPPLRLACDRCHKRKQRCTRTGINDNKPCERCREAGSQC
                     IYSPPSRLGRPSNKAKRERQHISNGNIMTTRSRPSSNTTSPTPPPPPSHSFSLSASSV
                     SLPTYMPMANGQSNTKIRRSHSTMAAASLRFKPPSPPSVSSQVSDTTPSPSSYNFGSP
                     PLHTMDAAGANVPFQNFQMPRSQPQQCHQQAVSGSTTVLSSEHYPSSVLVAPEQQSWY
                     PHTQEHGNNIIFDSPTYNDATILLGQQHPRQQPQPQPQPLYTIDTWPNSLVTHGALQL
                     QAGQEAPRMAGSDGNIYSRGKWSGQPVADPQVAMNLGIPVTMAMDGNEPMYYYW"
     gene            complement(<1489936..>1491179)
                     /locus_tag="TRUGW13939_05373"
                     /db_xref="GeneID:55992871"
     mRNA            complement(join(<1489936..1490031,1490116..1490598,
                     1490658..1490718,1490792..1490828,1490900..>1491179))
                     /locus_tag="TRUGW13939_05373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488537.1"
                     /db_xref="GeneID:55992871"
     CDS             complement(join(<1489936..1490031,1490116..1490598,
                     1490658..1490718,1490792..1490828,1490900..1491179))
                     /locus_tag="TRUGW13939_05373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344430.1"
                     /db_xref="GeneID:55992871"
                     /translation="MPRRKALIIGINYFGSKHELRGCINDAYNVRDYLVQERGFSPNQ
                     RDMVVLSDDPDNFGTPFYPTGHNMLAAFQWLVSQNSPGDSLWLSYSGHGGQVEDEYGD
                     RESGFNDTICPVDFEQNGQLTSSTLHKAIISRMPPWARLTILFDCCHSGSAVELPYTY
                     RPDADGNINMIDNVKEGMRLAMEASSLLQTGFSMDRMDDARSLVAEATTFFHSLHNQR
                     NQEEAGEDGLVDEGFHEDWRNEGKDAWMFSGCADDQTSADTRIQGQSTGAMSWAFMNV
                     MRENPEQSYIEVLQNTRHLLQQHYSQIPQLSVGGEYDLDQMVS"
     gene            complement(<1492079..>1492729)
                     /locus_tag="TRUGW13939_05374"
                     /db_xref="GeneID:55992872"
     mRNA            complement(<1492079..>1492729)
                     /locus_tag="TRUGW13939_05374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488538.1"
                     /db_xref="GeneID:55992872"
     CDS             complement(1492079..1492729)
                     /locus_tag="TRUGW13939_05374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344431.1"
                     /db_xref="GeneID:55992872"
                     /translation="MAQTAQLNAILDGFKDKVPETVYTTVNESRANFINSFNTSAAIQ
                     VGDTLPEFSLSDAVGTQRSSSELLSKGPLLVTFYRGEWCPFCNIILSNFQKILPEIQA
                     KGVTFVAISPELPNQTLSTSEKHDLQFPVLSDVGNQFAKKLGILFQQPDSLRPIFDKL
                     GHNLKERNGDDSFVVPVPATILVGKDGKVKNTYINADYTKRVEPQEVLKWLGELKN"
     gene            <1493105..>1495155
                     /locus_tag="TRUGW13939_05375"
                     /db_xref="GeneID:55992873"
     mRNA            join(<1493105..1493175,1493244..>1495155)
                     /locus_tag="TRUGW13939_05375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488539.1"
                     /db_xref="GeneID:55992873"
     CDS             join(<1493105..1493175,1493244..1495155)
                     /locus_tag="TRUGW13939_05375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344432.1"
                     /db_xref="GeneID:55992873"
                     /translation="PATIIHPGECDLGHAAVPNAGGVKSQQRIPLVSNNDSSHEDLEA
                     LQQRLHSLESLILQLSSSNNTNHDRAAVNDYMNPDKAVGILSHKHTSGSKVTPMSTTY
                     DTPFSSEQNFDTAPLIDLFSRTLDVRSEDSTIKYDFGHTSQPLPVDEYISALRALVPR
                     IDDLLLILESTAPYWFIWPTQPPGSGEEIFGERYGSVVMVKNFILASFESQAPLAVAK
                     SIIWLALCVQQLPADAIQHRKTYLPASLQTLFDAYMAGADAILTGLGESIPSVERLEC
                     LLLFSKCCVNMGKPQRAWLAVRSGINCALILNLHRSTRHRTLTQNSLWSHAWQTDRQL
                     SSILGVPYSVSHPAPAIGSDQSPISMLFYCVNDMIGRVSDRNQGLLHISIESMEAELQ
                     KYITMLPQDWWPVMPPEDLSFEALYARQTSKLFLWRLKELSYFPGMLKALENPQSSQD
                     SRERAVEACRNMISAYEVFRNSSKSALVICDLMDFLVFNAALVITIHLLASSSSLNTA
                     KDAEDWGIITHLIQTLQQLSRAIECSVAEQSATLLQYIYTAHHGIYEGPEEYAAVIPW
                     FGKVKIRSVPRQQEAPSLPTPSSEIRGESLYSMIEFGIDSVPSGVGSSLGSGSDSWIN
                     QYNDYELGIDWTSTENVDWEYDWNQIFYNGNPGTNI"
     gene            <1495503..>1496501
                     /locus_tag="TRUGW13939_05376"
                     /db_xref="GeneID:55992874"
     mRNA            <1495503..>1496501
                     /locus_tag="TRUGW13939_05376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488540.1"
                     /db_xref="GeneID:55992874"
     CDS             1495503..1496501
                     /locus_tag="TRUGW13939_05376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344433.1"
                     /db_xref="GeneID:55992874"
                     /translation="MGLTWSLFFPPQPTLTAANLPSQEGKVFIVTGGYSGIGFELCSI
                     LYQAGGKVYLAGRSEEKAQAAIEKIKALLPSKNNSPVASSKPGELVFLSVSLDDLQTI
                     KPAADKFLANETRLDVLFNNAGISNPPRGSVSSQGHELQFATNCLGPHLLTQLLLPVL
                     LRTAKSSPSSNVRVIWSGSIVVDLSTPEGGPSVADFEHPSADQQVNYTNSKVGNWYLA
                     NSLAAQVGEHGILSLAQNPGNLKTALTRHVPAIIPILVAPILYSAKFGAYTTLWSAFS
                     TDLTTEDGGKYILPWGRLHPSPRKDLLAALQSEEDGGTGSAFKFVDFCDRNILEFK"
     gene            complement(<1496595..>1498293)
                     /locus_tag="TRUGW13939_05377"
                     /db_xref="GeneID:55992875"
     mRNA            complement(join(<1496595..1496919,1496981..1497330,
                     1497392..1497455,1497510..1498080,1498131..>1498293))
                     /locus_tag="TRUGW13939_05377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488541.1"
                     /db_xref="GeneID:55992875"
     CDS             complement(join(1496595..1496919,1496981..1497330,
                     1497392..1497455,1497510..1498080,1498131..1498293))
                     /locus_tag="TRUGW13939_05377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344434.1"
                     /db_xref="GeneID:55992875"
                     /translation="MSTQDHALPLRESPLGISVLIVGGGIAGLMAALEMWRQGLDVKI
                     IERAPARLTAGDGFTISHTAMRAFNKWPYLKQKNKEITWNPWLAWHNFKGERVTEPVS
                     MNFTATKDNEKGAYEETDGLSPEMHRHSRPRFHLMLETQLEQVGIKIQYGHRAVRYFE
                     TPEKHTAGVELDDGKILEADLVVAADGIGSHSTKITIGEEVRARSTGISIYRTSYPVE
                     IVNSDPEIVEKFGNAPNGSPLIQMWMTDGLFASFARNDFEMGWSITHKKAKSSSESWS
                     KAVSVEDVFESIPEMNDWPGYARRVIELTPKDKLLDFEMVWRDPQPIWTSSSGLVVQI
                     GDAAHTFLPSSGNGANQGLEDAISLAKCLRIAGKKENIPEATKVHNKLRYERVACLQK
                     IGICNQVTQYGHKDKGVLNYTPRPKYLRMLMAPWTWKHDPENYAEAKYHEALGALKDG
                     TPFQSTNIPHGHVCKPWTFESVIKAMEDGGDADFNGDWES"
     gene            complement(<1498923..>1500146)
                     /locus_tag="TRUGW13939_05378"
                     /db_xref="GeneID:55992876"
     mRNA            complement(<1498923..>1500146)
                     /locus_tag="TRUGW13939_05378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488542.1"
                     /db_xref="GeneID:55992876"
     CDS             complement(1498923..1500146)
                     /locus_tag="TRUGW13939_05378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344435.1"
                     /db_xref="GeneID:55992876"
                     /translation="MHFRQLALAALAVLPALGELHTSSRWILDSNNQRVKLRCVNWAG
                     HMEARVLEGLNKQSVDTIASWIADNGFNCVRLTYSIDMALDPDVSVSDSFAAAGTKWG
                     SESNMADAYNDAVSNNPFLANASSIDVYANIIDALDSKGVMTLLDNHVSEASWCCNLT
                     DGNGWWDTASGYNDLNSRFFNTTKWLAGLEAMATFAVDHPGVVAMSIRNELRPTPILQ
                     DLGHDDWYNYVNQGALAVHKANPKVLIVIGGSQSATDMSFIRNKTLDVSQWADKHVWE
                     FHAYSFTVTFPGNGDCTVANTEYGALDGFVLTQNQSYTAPLILSEFGVGMTGGPNSGL
                     SDKDNSYLQCLVKYMESNDAEWAVWALQGSYYVRDGTFDYDESYGLLDHDWSDWRNSN
                     FTGMLGQMWNVTQGP"
     gene            <1502117..>1503169
                     /locus_tag="TRUGW13939_05379"
                     /db_xref="GeneID:55992877"
     mRNA            <1502117..>1503169
                     /locus_tag="TRUGW13939_05379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488543.1"
                     /db_xref="GeneID:55992877"
     CDS             1502117..1503169
                     /locus_tag="TRUGW13939_05379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344436.1"
                     /db_xref="GeneID:55992877"
                     /translation="MANPLDSMKSTWREADKSTWSTHHYIIDFLNVYHTDLDKPVPVF
                     SKDDKIPHIPQLPQHLWVMFYAMIPLGIHQALLSVYPLGVGRLAAFTLYFISFNAIII
                     REVHILRRLAHQHGFLDGDVHGRDGVPDIGVSRVAKSLYKTTGSRLALAIYISYNPAI
                     SPLDVMSQPSWWGWLLLEIGLYGIVLDFWFYWYHRAMHDVGGLWKFHRTHHLTKHPNP
                     LLAAYADHEQEFFDMVGVPFMTYVTLRAIGLPLGFYEWWICHQYIAFTEVFGHSGLRV
                     HLTAPSTMAWLLEIFDANIVVEDHDLHHRKGWRKSHNYGKQTRLWDRIFGTCIDRIES
                     KAQNVDYVNKGDMPIF"
     gene            complement(<1503618..>1506716)
                     /locus_tag="TRUGW13939_05380"
                     /db_xref="GeneID:55992878"
     mRNA            complement(join(<1503618..1503662,1503721..1504071,
                     1504137..1504804,1504860..1505064,1505177..1505201,
                     1505671..1506446,1506521..1506612,1506674..>1506716))
                     /locus_tag="TRUGW13939_05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488544.1"
                     /db_xref="GeneID:55992878"
     CDS             complement(join(1503618..1503662,1503721..1504071,
                     1504137..1504804,1504860..1505064,1505177..1505201,
                     1505671..1506446,1506521..1506612,1506674..1506716))
                     /locus_tag="TRUGW13939_05380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344437.1"
                     /db_xref="GeneID:55992878"
                     /translation="MPQGINNPFSTSLQSDCKKAIKILESFINVDNPSSTAKAILRDA
                     QGLIIFTAFKAGFMGSARFGSGIIVARLDDGSWSPPSSINIGGVGFGGQLGFEFTNFV
                     FAVPDKSSVRTFCQIGSLTLGTNASLALGITGRSGEAGLGANWRGVGSMLTLSKTNGL
                     FGGISVEAGTFIEGRGSNKKFYKYKVTAAQILSGEVEPPLEADALLRTLASIEFRSTR
                     QQTGPQQSIQQPHPGMVEMSAGSESQQPLELPSLEGPRQLPSELHGQYNPHAQAAELP
                     SLPIVSHRHNDPLAKAVKLPHSPANSQGLLFGSGQLFWLQHIILFAMDSPISQPLTLK
                     CGLELKNRLVKAAMAELMADKNGLPAEASDKIYAAWGRGEWGMVLTGNVQVDAAHLGT
                     AQDNTVNPKIEEELLSRWKSWASVCTQNGTPTVMQINHPGRQSPIGAGSRSIFSKTIA
                     PSPVPMDLGNGLIARAASAMVFGCPRQMTQTDIDNVIQQFAHTSRLAAKAGFQGVEIH
                     AAHGYLLAQFLSAHTNRRTDSYGNSAAGRAKIVVEVIKAIRGSVSDKGFCIGIKLNSV
                     DHQSAKELKECVEQLKLIVEAGVDFVEISGGTYENTTMFQDISSPPSEKSARTVAREA
                     FFLEFAETIRDQFPDTPLMVTGGFRTRGGITEAVQGGGCDLVGIGRPAVLNPALPKEV
                     LFNPAVSEEDSRLITRSVAPSRLASWTGIKAVGSGAESMWYSKQMRKVDSVI"
     gene            <1509231..>1511594
                     /locus_tag="TRUGW13939_05381"
                     /db_xref="GeneID:55992879"
     mRNA            join(<1509231..1509472,1509535..1510438,1510493..1511191,
                     1511247..1511421,1511476..>1511594)
                     /locus_tag="TRUGW13939_05381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488545.1"
                     /db_xref="GeneID:55992879"
     CDS             join(1509231..1509472,1509535..1510438,1510493..1511191,
                     1511247..1511421,1511476..1511594)
                     /locus_tag="TRUGW13939_05381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344438.1"
                     /db_xref="GeneID:55992879"
                     /translation="MASRATFLLLCLGLLLALTTLTTEAAPSNAKRSGYVVHEKRETV
                     HPRWTKRDRVPRHKMLPMRIGLMQTNLEKAYDHLLDVSHPESENYGKHWSPEDVIKAF
                     APSDETVSKVKSWLVDSGIPADRVTHSDNQGWLAFFATPDEAEDLLQTEFHEFEDSVT
                     GGVTPACDQYHVPHHIKDHVDYITPGIRLLAPVDDSQQFKSEDMIRVRRDNEKKSRSA
                     RIMHSLRTQADESIVETMLQSKNAEGKGSDLSTCDVAITPACIAALYKIPENKRKPHP
                     NNSLAVFESELQFYLQEDLDLFFANFTKQIPKGTHPIAANIDGGQQATTDPYQAGGEV
                     NLDLMLAYPIVYPQTIVDYEVDDFLVQSNPNDTYNMGGFNNFLNALDGSYCTFSAYNE
                     TGNDPDLDQEYPDPNSGGWGGPLMCGVYKPTNVISVSYGGQEADLPLSYQRRQCLEFA
                     KLGLQGVSFLFASGDSGVSNYPEKAGGIDGPTGCLGSDLDVFNPTWPNTCPYITNVGA
                     TKVYPGKTVSDPESAVFDPAGHPYSVNFSSGGGFSNVYPIPNYQQDAVATFFEKHNPP
                     YPHYSALAPDTGDIKQLVDIDALRGDTKGIYNRIGRGVPDVAANGDNIAVYVGGNFSL
                     SGGTSASTPIFAAVINRINEERLWAGKGPLGFLNPSLYANPSMLNDIKNGTNPGCNTN
                     GFSAVPGWDPVTGLGTPNFPKMLEYYLKLP"
     gene            <1513727..>1515269
                     /locus_tag="TRUGW13939_05382"
                     /db_xref="GeneID:55992880"
     mRNA            join(<1513727..1513901,1513994..1514112,1514166..1514227,
                     1514293..1514318,1514369..1514718,1514775..>1515269)
                     /locus_tag="TRUGW13939_05382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488546.1"
                     /db_xref="GeneID:55992880"
     CDS             join(1513727..1513901,1513994..1514112,1514166..1514227,
                     1514293..1514318,1514369..1514718,1514775..1515269)
                     /locus_tag="TRUGW13939_05382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344439.1"
                     /db_xref="GeneID:55992880"
                     /translation="MEEAGLPQSEGPPPLPYSLRQRKKSIAFFWTLFVIDTLGQPLIL
                     YWALKYCTSLSLNLVFSISTAALGGISVFEYFYRLYNLMRKDSRARPLNARKSWLDFF
                     HINFTIVWLILAVELIVGTVSPDPHVRLLAMPLPTVMFYFGGVHLTLDILRMAGFKAP
                     FRISSTHQGSAMPTALYVLVEDIVAVDGGGGQKFRYALRTRYLSSPYFRRMLFEMNCF
                     WAGGSLVAAAAITAIIFTTSEDVAYTLGWSLPFAWATVWTLITFPWVQAELRREKETW
                     DRVRHFGGGEPFTDDITVNPRTRYNSFQARILPFGGREKQVQDGPSPPGSSTVTDDTN
                     THANTTLTDDNNNTHNHNHNHTNSNDNTTGSKIQDDDNDNSNAQPDGVVAGDETPVDT
                     RDHDHETQEKEPKPDV"
     gene            complement(<1516015..>1524834)
                     /locus_tag="TRUGW13939_05383"
                     /db_xref="GeneID:55992881"
     mRNA            complement(join(<1516015..1516084,1516147..1520186,
                     1520239..>1524834))
                     /locus_tag="TRUGW13939_05383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488547.1"
                     /db_xref="GeneID:55992881"
     CDS             complement(join(1516015..1516084,1516147..1520186,
                     1520239..1524834))
                     /locus_tag="TRUGW13939_05383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344440.1"
                     /db_xref="GeneID:55992881"
                     /translation="MFFFSPTTILVGVLLLYVSSFILFAIVRIATGVSIQRIGYFSLR
                     RIAYAPQDGVQIDLRGLGLSLHRPSFSQPTWISLRLTDLKVTLDPKLLKNGNNGKGAL
                     SRPGSANGTPALPQDASFGAATTKSPSRRSETWKRLTRLKERIKRLHSYIHWVAMIDV
                     HAINTSVHFVDAGHIQVGALTMAVDTRRKMVERGRLFRHKKQQSQESRPAEWILTVRN
                     ILLAVDGREPMELLDNLQLNIHGHLYRDLEGLRDTSVAVKIGRLHVPYDDLMILSQRV
                     REVEKTHLKPESPTETDDEISFADFVEELDKPGSREDVIVQTVADSKEFVSSILRGIE
                     EIQLALSFFRVSRGVPITLAGEKELQLNLVTHEIGIDLHRMDPKSPAHRMYFQKRDVA
                     HQALLAAISVSVSLEDCSGATDRLLYIPMATTTIKTTFPSKTVSFSDEHDADARNSNV
                     LFANLVITSPSLDMETRHVSQFFRLAQAKPSSPRRKKRDNHHIISRLLPKASIKLSVH
                     EPVVRFVLPIPEEDAVDPGDYNLLISSISSISLDIESSHSAEAGIDYSLSSVYRVSSH
                     QLYYQTPAGVKHNLLQTKNMEVRVHLNATPEVCVFVSGSLNSFSIHMVNADVNRGIKQ
                     VVEQFKAQLKPRRGMQSTTSEQKVSFLRRLPPWLMRVQFEASELTFEVSGPPPGSSKT
                     PRGVALQLESWTADYRAQKLEPMKISSRRRTSSHSHPSISDDPAFRFPPTSPPRRSAN
                     GHADGRRLAVHFRGLEGFVIEAEDYMEPESFLSLPRCEVAFSSQSDLQGPIFHINSSM
                     KALYLEFSLYRTYSLGVAGNVLHETFMRSSAEKASKDYQFKAFSKTSLPAPVPPSQRA
                     ELTTIDLRVGLVQVKAIMPDDPRLMLQVYGLAAGSHRWSAPFFRCQLARLHVAAPRMK
                     GVWARFISMTTMRVDLRENRKMHGREFRIERSIDVSADFIRLGVPHHLIVHRVFNNFT
                     NTLKALKALRHRYKTDSDEDILHKDPEGPKIVPRISLRSKALAFQLEDDAFEWRLGCI
                     YRAGLVEQRHRLAREEAFRLKAQKVKDADNRRNSSRYRAHSAHPDSHLGRRSDDRRRS
                     ASVGPRESRRSFDNKARYGRVRYDTDGAASISSTAKISEKEALRRLQEYNSRNWKTKI
                     DAAMQFQAKSISNLRNAFAGVDQPPDDVEDDEPILAIPNRPSLMSTLISDLHLIIDKP
                     SFPVTEYASFLHKIGKGMPVDMQYSLLIPMNIHLDMGEARVTLRDYPLDLLHIPALRP
                     GQSPRLPSWSLKTDFVIAEEYRNFESTRDVRVCIVPPAKSPDGDVTEGVYVNIRRTVA
                     PVKTYSEPRFEINTSLPTSFTWCMSYQPVIQDMMKIIEGFTKPEVDLSERVGFWDKIR
                     LSFHSRIRVWWKGDGDVHLRLKGSRDPYIITGFGAGFVMCWRKDVQWDIHPNDDPKEF
                     MTVASGEYVLAVPDYSHEARYSYEYAMDDSKSQASIQSSKNAAHFKKVLMKLSGNVKW
                     LAGLVFERNVDQGRCFDFKPHYDVVLRNPLYIDGSMKKDYDAFRGFRSNHIHLSVSVM
                     APSTPDQITPNYNTVHLTPRIFTHFFYWWSLFTGVMSLPVRQGPLWPGVTKTSKKFGR
                     HLATVKYKLILSPLFVSHIYKHKEPEDYGEDVVAATGLKVRLANFKFDLHQRREQVTT
                     PIRGRLKQLKSSAMRINRAELDFEAADFRAVSASIEGTTMEDVEARPEEIVSSLQQPT
                     AAVDLSRFTIPDQDLSWIDMDDFVELDWILPQESTPKTQILPLAYTPRFTYFRQTDHN
                     STSLAKTGFSAFGDEPTHECVMSQGNDPRRVQMDLIKGRIANLQIQSENHELQLNEHE
                     LQLVQEGGENHDLKVKHELLVRQAESLARRRKFLTAGLRHLEKLIFGEENDNDATSSE
                     AQESDWSSRTGENLESNSDGGESVIDGNYEPPDVELATDFNNRFTIHNPQVKWNNSLR
                     DIMVRYGHQVSQRRGFVYYMSRQAVKFITDIVDEQNKNKRKRKGFFNRSPDREDSQER
                     KDDDSVEERIEQLLHDAKRFVNADDPSTTSPNERAHPKSGDFSDNISPEFTPQNSYHL
                     HLIAPQIQLQSDKNPRSVTLVAAKGMALKVVSIMDKRRVSDDVSGLVQRRFSVHMDGA
                     QFFVATQKNLKAHLQFYAGNKYGNAPGSAWPPWLTLEAMFDFELNPFGFSRIIQRTSA
                     SLRYDKFNNLRLKYNDEVAKGEGDSTLHHDYGEGRVDQVWVDFPDVRAICDSNEYYTM
                     YIIVLDLLLYNEPLEKVRSEKLEKIMFASDFSDLRGAPEMVYKLQERIRQLEEIRDYF
                     QIQAQHLDVQGWQDRITLEKDLVSCEDELFFIMKAITTSQRRTDERALSQASASLRYC
                     LSASDIVWHLMRDKNEPLVEFQLRNASYERTDHTDGSNHNMIEIERLYALNLLENALY
                     PQMIVPYMDHKSRIESGDMMLRVQWYMLEAVAGIPVLDQFEVNLFPLKVQLERELGKK
                     LFEYIFPGMGSNAFEGSGGFSPFMVKHIIPVDEEDEEEDNAGDGELTPDFVSTPRSQA
                     SSLAGDDSQAPAGPGSIELRLQPTLSLPDNRKGQQHGNQLRPSRFRVAPMTRITKDNN
                     RLSPGDRPGLPLRSPTQIGGLSKKKSAESIRALTRSSTEKAASIMSSNSTTVGEPKKF
                     SLRGAKKEQTDDITQMMSRASNYMILANVKINDVVLCLSYKGRGERNIEDVHDFVFRL
                     PVLEYRNKTWSNLELALRLKKDVIKALISHAPAILGNKFSHPRPTKQQQQRLRELATS
                     SQIILPSSDASSALGISSPRNIASRSSHAETSGSSSLHQSVSGSDTYPLGQTASYSSS
                     HVSSREPSIMISEPPTADAEQEEEPSKRRSFTSERPPTSRSSIGGNSHEESSKRSIRN
                     LGRKLLYRHSVNTNE"
     gene            complement(<1525699..>1526570)
                     /locus_tag="TRUGW13939_05384"
                     /db_xref="GeneID:55992882"
     mRNA            complement(join(<1525699..1526009,1526064..1526180,
                     1526248..1526364,1526420..>1526570))
                     /locus_tag="TRUGW13939_05384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488548.1"
                     /db_xref="GeneID:55992882"
     CDS             complement(join(1525699..1526009,1526064..1526180,
                     1526248..1526364,1526420..>1526570))
                     /locus_tag="TRUGW13939_05384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344441.1"
                     /db_xref="GeneID:55992882"
                     /translation="PFFPAPSRFGFISSPCHRNGRRDTMSNEQKKSPLTDPAVLVSSL
                     KVGALSACAGLTYGGASGILRATKHPIIHSISHGIHWAAWGTSFWWMRNNIISIHYQD
                     NATPKDRVYASAVSGGLSGGIVTRLMGGKFTPGLVLFSLFGYVGQKTWNFVERRQQEN
                     EGKGPKPILQRMAESKWVPLRSLSDDEFRNLLNEKLLSIEVDISLLDEKIQSLERERA
                     LEQSQKAPESSQS"
     gene            <1527133..>1531229
                     /locus_tag="TRUGW13939_05385"
                     /db_xref="GeneID:55992883"
     mRNA            join(<1527133..1528312,1528985..1529139,1529202..1529793,
                     1529866..1529957,1530021..1530225,1530298..>1531229)
                     /locus_tag="TRUGW13939_05385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488549.1"
                     /db_xref="GeneID:55992883"
     CDS             join(<1527133..1528312,1528985..1529139,1529202..1529793,
                     1529866..1529957,1530021..1530225,1530298..1531229)
                     /locus_tag="TRUGW13939_05385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344442.1"
                     /db_xref="GeneID:55992883"
                     /translation="FRYERGAIPLGSYAAKYPSILQRNQNVTTPGRNSTGNSTIPGGN
                     STIGGNSTTPRVSTWISKFPTPAQNSTPKAQPSPVANSTTPGVSNKFSTPAQSSTPKA
                     HPSPTANSNGSSRGTPHPTSTFASGKSPGHAGTSAKSSTPASKPTSTGTSAKGSTPTS
                     KPISAATSAKSSTPGKASQATSHPDSPSSAQSPPPNASSPGSLPASIPSSHVSTSGSP
                     ATTSQPTSTPNPHPSHGDTSATDLPVSTDPSSTGSVGPSQTSNATIFPILFGGLYKNR
                     NTVLDDDKHKTDYVNQIHDSRTKIKNYLDYLPNKPDTNSVQCSSNKRKRSLISDIAGF
                     AGNVVKLVTCADQLLDNLDGVVKGVHPSINDIDTLTGAINVIGDDINTDNKDNTNDNQ
                     PNESEIKNFEQELTEQLGEGNFNTTRGSPQLGVVFWSAWLNSSQVEEFSNSSVVSGIV
                     EDQALSTTGWAPYDITGGPYPSPRSTNTSDISKRANSSRLISQYDALASLRVVSQPHN
                     VTIIDLTDDYKYNSAAGSGITVYLIDTGANPQNSEYYSMPGTKRWMFPQNAGEPGAVI
                     RTQSDEQNHGSCVLSKIAGPKYGVAKDVDVVIVKVPTAAMQDTVMASGMLELLAEVSE
                     DIAKNKLQGKAVINFSGGSFDPVRLSYIATLRGILRLDVPIVCTAGNFGEDVAIEHWP
                     AAYADRYDGIIVVGASNNDGIKQDFSQPGPVVSIYAPGFNVTCADSIQDNIIRYSGTS
                     LAAPAVAGLAAYFMSIPEFESEIQQQGRVAGNVKRLITRLAYPRHGGVPVLWNRENSD
                     SCVNFQRRDGSSAKVCSVRTSTKPTSTKPTSTKPASTKPIPKATSTDGVKTSHHAQPP
                     PPITHCNAVFVPPKTIARSTFTAASYCACNGGWLLDLGTTVGANHYTTYTCNVGTKST
                     MAVGNVAHTTTTSADSTTTCTAHVTQKVSEKESDAPPISLTVNITNENVGQIGYNSGN
                     LNWANKFNVGGLPWVLVLTPTTGDPNNNGQGGQNLPEWRNGPLVFAYSRLIWDSKSEN
                     CDVVTHDDLSTRVMNCIFECP"
     gene            <1531629..>1533673
                     /locus_tag="TRUGW13939_05386"
                     /db_xref="GeneID:55992884"
     mRNA            join(<1531629..1531689,1531763..1532103,1532200..1533020,
                     1533079..>1533673)
                     /locus_tag="TRUGW13939_05386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488550.1"
                     /db_xref="GeneID:55992884"
     CDS             join(1531629..1531689,1531763..1532103,1532200..1533020,
                     1533079..1533673)
                     /locus_tag="TRUGW13939_05386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344443.1"
                     /db_xref="GeneID:55992884"
                     /translation="MGLYTDLPDAITEVDVIIAGGGTAGCVVAARLAEADPSLSILII
                     EGGPNNDIPSIGVPVLFLSHLMPTGKTNIFYAANKEKQLGDREIFVPSGGVLGGGSST
                     NLMMYSRAQRSDFDAWNTPGWSAEDMLPYLRQLETYHGPGAKDRHGYDGPIQVSRGTY
                     RATRSEDDFISAAGKVGFPEIEDLQSLDANNGVQRAMRYISPDGKRQDAASKYLQPKL
                     QDGHHKNLHVLVEAQVVRILFDKENRRAVGAEYRPNPDSQWGVPNLHPIRTVKARKLV
                     IVSCGACGTPSVLERSGIGRPSVLTQAKIPIVADVPGVGDEYEDHQLLLYPYKSSLDP
                     EETLDAITSGRRNPEEIIKNNDDILGWNAQDITCKLRPSDTEVAALGPEFQRSWDADF
                     RDNPNKPLALMSLLSCFPGEPTGIPAGQYFAMTIFSVYPYSRGHLHVTGPDIGDRLDF
                     ETGFFTDTNGIDLKKHIWAYKKQREIARRMQTYRGEHAPGHPPFPASSKAACTSTQGP
                     LVDVQDIEYTSEDDTILEKWLRENVATTWHSVGTCKMGPREEKGVVDSKLRVYGVEAL
                     RIADLSILPHNVAANTNNTAFAVGERAADLFIEELGISK"
     gene            complement(<1534086..>1537026)
                     /locus_tag="TRUGW13939_05387"
                     /db_xref="GeneID:55992885"
     mRNA            complement(join(<1534086..1534415,1534500..1534830,
                     1534893..1535002,1535059..1535166,1535340..1535392,
                     1535449..1535584,1535889..1536287,1536346..1536414,
                     1536493..1536955,1537016..>1537026))
                     /locus_tag="TRUGW13939_05387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488551.1"
                     /db_xref="GeneID:55992885"
     CDS             complement(join(1534086..1534415,1534500..1534830,
                     1534893..1535002,1535059..1535166,1535340..1535392,
                     1535449..1535584,1535889..1536287,1536346..1536414,
                     1536493..1536955,1537016..1537026))
                     /locus_tag="TRUGW13939_05387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344444.1"
                     /db_xref="GeneID:55992885"
                     /translation="MAEGTLASAVAVVAQPEESEQEPAHASPETGHKRRPSSISDSGS
                     KRRRTSDGSPSDSRRSPSQHATDPDSRRPAAAPARRGGFVAEERKRSKRLFGGLLGTL
                     SQSSSNTAQKRRADIEQRQQAKLRMQDERHTEAKQKKKDDIIAERRLQQKELDRGAMT
                     AKHKNLLQTANFLRTKTHPILLWLPFQLRPEDDDIIDKQIEEAKETIAKEEAEFEERW
                     HGKDEKEDSERDTDNKNAPPDDATQENDGPKQHDPEESSTQNANDNTKLEPEPAAEEP
                     VSSGNNEEEKDGSAAPTGTSQRNEDEGEEVMEEDKEDMLKLIRTNSINFKKQLSKMAS
                     KVDKINYTNDSRVERRSVILNGRNYSYLYGEPASGKWKATIFFLHGFPDLAVGWRYQI
                     PHVLQLGFRIVAPDQLGYGGTDAPVDPKEYAYKKIAADFKQLATQLGESKIILCGHDW
                     GAALTYAIYHHQRDLISHIITVCVPYGPPRAKFISLDDIVANLFPHWGYQLQFRSGEV
                     EKVVHTKEEIGQFLLALYGGKTSAGEWGFDPRKGIALDKIGQFQPSRVLNGEDLEFYA
                     NEYTRHGVNGPLNWYRLTEINHTDEKQYVSQPNIEVPLLFIQALKDLALPPSMGKSMQ
                     KYVPNMTLDQVNTSHWALTEDPENVNRIIGGWLGKQFSLDGQSKL"
     gene            <1537320..>1537646
                     /locus_tag="TRUGW13939_05388"
                     /db_xref="GeneID:55992886"
     mRNA            <1537320..>1537646
                     /locus_tag="TRUGW13939_05388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488552.1"
                     /db_xref="GeneID:55992886"
     CDS             1537320..1537646
                     /locus_tag="TRUGW13939_05388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344445.1"
                     /db_xref="GeneID:55992886"
                     /translation="MSRHHPDLVMCRKQPGISIGRLCDKCDGKCPVCDSYVRPTTLVR
                     ICDECAFGNYQNKCIVCGGEGISDAFYCFECTRLEKDRDGCPKIINLGSSRTDLFYQK
                     KNFRNQ"
     gene            complement(<1537842..>1539115)
                     /locus_tag="TRUGW13939_05389"
                     /db_xref="GeneID:55992887"
     mRNA            complement(join(<1537842..1537961,1538023..1538274,
                     1538335..1538969,1539097..>1539115))
                     /locus_tag="TRUGW13939_05389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488553.1"
                     /db_xref="GeneID:55992887"
     CDS             complement(join(1537842..1537961,1538023..1538274,
                     1538335..1538969,1539097..1539115))
                     /locus_tag="TRUGW13939_05389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344446.1"
                     /db_xref="GeneID:55992887"
                     /translation="MQSGISVSSELQNAFQAFTADDSQFALPVTITSESLQPKPAIPF
                     SGSFYSSVPTLQSVLEPKTPIFLIIRHSPGTLVALTYIPSNAGVRAKTLFAATRSTLA
                     RELGSEKFTTTVFATEEEEIVAEQAWRERDLEGNGSPQAGYEREELMDDKERELDAVR
                     RAEEEARHGTAGRDVGTGGTLGRVSGYATGGSVDMPMPVDEDIKSSLRSIQDGQLVQL
                     SIDVRSETVKLASADSSVAPSAVASKLSDSSPRYSFYHYPGSDVVVFIYTCPSSSSIK
                     EKMLYASTRRMAIRLGELEGIKVDKKIEGSSPDEITESRLQEEVSPPQDEAAPKRGFA
                     RPKRPGR"
     gene            <1539974..>1541966
                     /locus_tag="TRUGW13939_05390"
                     /db_xref="GeneID:55992888"
     mRNA            join(<1539974..1540283,1540342..>1541966)
                     /locus_tag="TRUGW13939_05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488554.1"
                     /db_xref="GeneID:55992888"
     CDS             join(1539974..1540283,1540342..1541966)
                     /locus_tag="TRUGW13939_05390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344447.1"
                     /db_xref="GeneID:55992888"
                     /translation="MADSCIVCLNDLGGGAPSSPAPVVVPSTPPRVDNRDNDDAASDE
                     PPPAPEPLSDVSSKQSIARLVPCLHAFHDDCLKPWVERANSCPVCRASFNTVELCDTV
                     GGPAVSIYPVQNKVQEAELDPFMILEEEITDDSDSQPCVICGDNDNEDVLLLCDGCDV
                     PSHTYCLNLDDVPAGSWYCETCQTQRTLNAVSEPPSRPNRSRQPERRTRAQQRSLRNR
                     NQANSLQWAAVWQSVYDRLNLDLDFPFDDTEHPVTRGPILRRNRAVPTRSRRDSTRAW
                     QRRLELAERQGNGRVFRDPATIIDEYVPRPSRPRVPRAPTPQPESVEEVRAWNAFERA
                     RELEDDPNPSRKRREPTESPSPEPTEPERKLKRPRTRRTEELAAIATQTSNGEASRSA
                     ARVQSDNPVTSGPSFLQSLLKEVEDSSNTRRNHSLGPSVHTNTPTEFHNTSGPSSPSI
                     SPASSNPSSPRLSPTSPPPLSRRRAVSPMQLSSSPASSPAPEFSPSVSPAQSQDDLNI
                     NGSPAHPDRRHHRSHRRDHIGARSNDNSPSRKLSLSVKTDVQRLVGSELKPFYQGKVI
                     TKEEYTDINRTISRKLYESVGDVATLEGDYLTELRGFANREVAKAIDLVRSKTSSSDG
                     GVPSVPEAHVTTTSAGEEEG"
     gene            complement(<1544068..>1545815)
                     /locus_tag="TRUGW13939_05391"
                     /db_xref="GeneID:55992889"
     mRNA            complement(join(<1544068..1544965,1545018..1545307,
                     1545363..>1545815))
                     /locus_tag="TRUGW13939_05391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488555.1"
                     /db_xref="GeneID:55992889"
     CDS             complement(join(1544068..1544965,1545018..1545307,
                     1545363..1545815))
                     /locus_tag="TRUGW13939_05391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344448.1"
                     /db_xref="GeneID:55992889"
                     /translation="MASSSSLFDSQATTPTRASFDQQSSTPHNGRLDTIPSAMYTDDG
                     QDDGSNSPSISPEKADLEAGPGLKTEEASEKAPQADPNLVVWSGPDDPENPQNFSVPF
                     KWTITMLLSSLTVWITFSSSVFSQATLVTAELYGVSTEITTLATSLPLFGFAIGPLVW
                     GPLSELYGRKRPLFFGYLVFILFHIPVAVAQNLQTILVARFFIGFFGSAPLAVIGGTL
                     ADIWNPVDRGVAVAFFSGATFGGPTFGPIIGGFVVESYLGWRWTAWITLIASATFMII
                     AFIVVPETYAPVILQQRAARLRVETKNWAYHATLDENPPKMGDIVTRYLLRPFQMLFL
                     EPILLLVTIYLALIYGILYLTFEAYPISFQEVRGWSHAGVAALPFLSILVGVFIGGAL
                     IIFVTKTRFARKMKQQGRVVPEERLPPMIIGSILLPIGLFWFGWTSNKNISWVPQVIA
                     GVPIGAGILVIFMQGLNYIIDVYLMYANSAIAGNTLVRSALGGAFPLFATQMYQKLGV
                     DWASSLLGFLTVAMIPIPILFYIYGAKLRSMSRFNPRV"
     gene            complement(<1549222..>1550223)
                     /locus_tag="TRUGW13939_05393"
                     /db_xref="GeneID:55992890"
     mRNA            complement(join(<1549222..1549841,1549908..>1550223))
                     /locus_tag="TRUGW13939_05393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488556.1"
                     /db_xref="GeneID:55992890"
     CDS             complement(join(1549222..1549841,1549908..>1550223))
                     /locus_tag="TRUGW13939_05393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344449.1"
                     /db_xref="GeneID:55992890"
                     /translation="NAMSSSATVTVAESQRQQIPRTPPPKTITTITTPPSTRTRLVGS
                     NDCHDFSSPMTNSLITASLPQTTTCPHCGEHPSPQEAAVAQQRIQELEAQVKRLTARA
                     SEMALDLNNDDNESQTRTSTSSAADQPPRTPSQQQQHQHQQQQQQSQSRFANFASYFP
                     SYRRGGSKGSNSSNTPPHTSHSAYHPTSSPPQPSSQPLSYAHHQHGLVSSPIAETGPG
                     DAELQTALNREQTLRKEAESQLSQANSELEELTAQLFSQANEMVAQERKARAKLEERV
                     ALLEKRDGDKRKRLDRLEKAIERVERVRALVELKQ"
     gene            complement(<1551064..>1552904)
                     /locus_tag="TRUGW13939_05394"
                     /db_xref="GeneID:55992891"
     mRNA            complement(join(<1551064..1551566,1551634..1551736,
                     1551795..1552116,1552172..1552457,1552511..1552570,
                     1552620..1552677,1552732..1552752,1552809..>1552904))
                     /locus_tag="TRUGW13939_05394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488557.1"
                     /db_xref="GeneID:55992891"
     CDS             complement(join(1551064..1551566,1551634..1551736,
                     1551795..1552116,1552172..1552457,1552511..1552570,
                     1552620..1552677,1552732..1552752,1552809..1552904))
                     /locus_tag="TRUGW13939_05394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344450.1"
                     /db_xref="GeneID:55992891"
                     /translation="MTMDNAKQKQPWSDFRSSKSFIVIVVSIAIFADVFIYGMVIPLI
                     PAILRDRLHLPDDQLQKWLSILLATFGGALLLSSPVVGYFADRGSSRKPPFVIGLVAV
                     AGSTVMFWMARTPTAMIVARMLQGVADAAMWTVGNALVVDTVEKEQLGSAMGYVSMSM
                     TVGTMAGPALGGILLDQAGYDSVFILALAMIGIDIVFRCLMIEPQSKKASKNRIDGET
                     DPLLADQQPSYRTTTGDEEQASPGRVVSTSSIPPIVRLAMSGQLLIVLLASIVDGALW
                     TSFESTIPVFVIKTFGWDSFGIGMSFFALTIPAIISPIVGYAIDRYGPRVVSSISFAS
                     LTPIFISFRFVTDDSLQSRIVFIALLVATGFSFSAVLLPLMVELSEPIERQEREFPGT
                     FGDAGASGQAYGLHSSAWACGTLAGPILAGALVETVGWEVMNLVLAAMSGGTAVLLVS
                     TDDKVGQLVWRAWRVVAGGLGLGSGLDSRVEG"
     gene            complement(<1553994..>1555897)
                     /locus_tag="TRUGW13939_05395"
                     /db_xref="GeneID:55992892"
     mRNA            complement(join(<1553994..1555069,1555135..1555428,
                     1555481..1555579,1555678..1555722,1555779..1555832,
                     1555894..>1555897))
                     /locus_tag="TRUGW13939_05395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488558.1"
                     /db_xref="GeneID:55992892"
     CDS             complement(join(1553994..1555069,1555135..1555428,
                     1555481..1555579,1555678..1555722,1555779..1555832,
                     1555894..1555897))
                     /locus_tag="TRUGW13939_05395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344451.1"
                     /db_xref="GeneID:55992892"
                     /translation="MAPKPKAQKMSIGTFLADENFGSWADEMEDMPLTTSESRSTYGG
                     GGTSAFGDRRVVSSSAGFGNGFNEDRERPSFASRIDLPLPTEPPYTAHIGNLSFDASS
                     TDVSELFADCEVTNVRIVEDKLNHTPKGFGYVEFASVEGLKKALTFSGTSLQGRGIRV
                     SIAEPPKDSQQSRDFSDWSRKGPLPDLPRRGTDRPQRDFPDNVSETGSARGERRRFES
                     DGKPRDFSNWERKGPLSPVAGAPGREGGRPRNIEGSSFRKSSPAWGEGRSQDGSRPPR
                     REFQERPERPERTPTAADLDNQWRARMRPDAPPTPKEPSAPSSPVAATATPVTSAAAP
                     APAVRPKLNLQKRTVSESAPGAAAGAGDSKASPFGAARPIDSAAREREVADKRDRARK
                     EAEEKSKAEKAEKQRQSKEKAKTEKDSDANGAKDTDPEAPKKSNFELLQRAGEGEDEG
                     AADDEDKEATEEPTAAKEATSEPAAGKPATATTTTGGSWRKAEPAAAAATEADEEGWS
                     TVSTGKRNKGRGRGA"
     gene            complement(<1556897..>1557453)
                     /locus_tag="TRUGW13939_05396"
                     /db_xref="GeneID:55992893"
     mRNA            complement(join(<1556897..1557043,1557103..>1557453))
                     /locus_tag="TRUGW13939_05396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488559.1"
                     /db_xref="GeneID:55992893"
     CDS             complement(join(1556897..1557043,1557103..1557453))
                     /locus_tag="TRUGW13939_05396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344452.1"
                     /db_xref="GeneID:55992893"
                     /translation="MALRSVSLITYRRQSNQRAHFAIFVLSDPNENLGTRIHVIGAPM
                     AGYRLEFKRKYSVDLTQQPHTAYLIGQIDSQYLADDGNIKAGDYYTPKGAIELVASQI
                     PPPRRSQNFLAPVNDTTNKRCQEWTMEYVRRLVDLGYIDASAIQIVQSKRDPPTHGIG
                     LQPVE"
     gene            complement(<1558262..>1559211)
                     /locus_tag="TRUGW13939_05397"
                     /db_xref="GeneID:55992894"
     mRNA            complement(join(<1558262..1558689,1558743..>1559211))
                     /locus_tag="TRUGW13939_05397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488560.1"
                     /db_xref="GeneID:55992894"
     CDS             complement(join(1558262..1558689,1558743..1559211))
                     /locus_tag="TRUGW13939_05397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344453.1"
                     /db_xref="GeneID:55992894"
                     /translation="MANIPQAKTSSLPDAKTKEMNFLDSSFFKTHPGKPLPSPAEVAA
                     RSKDFSKHRPTPVKFDDLNLIVKFGCRVVVEEAISMRMLRKILADKVPIPEVYGWKVD
                     GDYVFIYMELIQGESLYNRWDHLIELDRESICHELRDIVSSIRQVEQDPIDPFIGSMT
                     RKCLLDYIFEHIPPGGPFKSIKEFNDWFSTLPQRWLPDSQKYSDPYRPYLPDTGTIKL
                     THGDLHQGNIMISSTSPPRVLAVIDWAHAGWYPDYWEYCKALYTTTIEGEWRNVWIPK
                     FLGPYTTEFKVFAEYIMQIGAV"
     gene            <1559898..>1560311
                     /locus_tag="TRUGW13939_05398"
                     /db_xref="GeneID:55992895"
     mRNA            join(<1559898..1559944,1560011..>1560311)
                     /locus_tag="TRUGW13939_05398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488561.1"
                     /db_xref="GeneID:55992895"
     CDS             join(1559898..1559944,1560011..1560311)
                     /locus_tag="TRUGW13939_05398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344454.1"
                     /db_xref="GeneID:55992895"
                     /translation="MVGLSRSSFNYYVELSYDGIGITSSQMAGRSGSSFSLTPGNQEA
                     LEEQLRVAKSQATPKRSATLASAVRSSVASKRSRVASDTSDSSAASVSAQRSRARSGV
                     PKYIDDAAAPPVL"
     gene            <1561170..>1561619
                     /locus_tag="TRUGW13939_05399"
                     /db_xref="GeneID:55992896"
     mRNA            <1561170..>1561619
                     /locus_tag="TRUGW13939_05399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488562.1"
                     /db_xref="GeneID:55992896"
     CDS             1561170..1561619
                     /locus_tag="TRUGW13939_05399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344455.1"
                     /db_xref="GeneID:55992896"
                     /translation="MSVKCAMFSEEKQSSTLTYTPKFNGIIHLMFTAIFLVKTELSEA
                     KQDLQQLSFHWNTIPETRNLSKYICKHCKSPFPISYPFNRHMNHKHNETLDIKADLTC
                     QYCVLQGMMKENNDENYDELDIIQQIMNETTSHIDNDEVRQQHRSLA"
     gene            <1562932..>1563567
                     /locus_tag="TRUGW13939_05400"
                     /db_xref="GeneID:55992897"
     mRNA            <1562932..>1563567
                     /locus_tag="TRUGW13939_05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488563.1"
                     /db_xref="GeneID:55992897"
     CDS             1562932..1563567
                     /locus_tag="TRUGW13939_05400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344456.1"
                     /db_xref="GeneID:55992897"
                     /translation="MAVGSLAQVDEKYVDDWGDLTLTGDILRDPIKLFKREDILSGRW
                     NLEEVLYDTGVGSVAQTAPEELVSHTVTNNTDVAEKPHVDLSKTVSETSSFTFTTGIT
                     IEAGLAFQAGIPFVAEGKIETKASAKYEFTWGHSKTFSTTIGHQVPVETPAHSKVRAT
                     SYVKSSKLDVPCKMKWRSQLDNTVIAHSNLVYHGVSYWDFSVEYDEEKLPH"
     gene            complement(<1563949..>1564224)
                     /locus_tag="TRUGW13939_05401"
                     /db_xref="GeneID:55992898"
     mRNA            complement(<1563949..>1564224)
                     /locus_tag="TRUGW13939_05401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488564.1"
                     /db_xref="GeneID:55992898"
     CDS             complement(1563949..1564224)
                     /locus_tag="TRUGW13939_05401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344457.1"
                     /db_xref="GeneID:55992898"
                     /translation="MGLLVPADSEELRGVILFVGLDIQPVCNVRGDGDTKDISIATRE
                     GYGFVRPVPSIDEKGVKRDVKRDVEDVEMEDVEMEDAEEDVEMMDVT"
     gene            complement(<1564850..>1566300)
                     /locus_tag="TRUGW13939_05402"
                     /db_xref="GeneID:55992899"
     mRNA            complement(join(<1564850..1565558,1565610..1565734,
                     1565793..1565865,1565918..1566065,1566117..>1566300))
                     /locus_tag="TRUGW13939_05402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488565.1"
                     /db_xref="GeneID:55992899"
     CDS             complement(join(1564850..1565558,1565610..1565734,
                     1565793..1565865,1565918..1566065,1566117..1566300))
                     /locus_tag="TRUGW13939_05402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344458.1"
                     /db_xref="GeneID:55992899"
                     /translation="MAREFDLILLGPTGYTGKFTAEYLYKAFPTTLKWALAGRSASKI
                     EGVLREIQAENVGSAEPEIIPVQLNKSELDALAKRTRLIINCVGPYHLYSTPVVEACA
                     ENGTHYVDVTGETPWLKRIVPKYHETAKKNGAIMVPSCGVESFPADIVAWLAIDHARK
                     KLSAEPTDAVGCIYDFKSAGLSGGTAYSILSTIESMSFSDLLKFSDSQGLVASPRPPA
                     PQKSLLELVSGARQVPDLGALTTCPTTVADESIVNRSSTLMPAHYGPNFSFRQYLRVS
                     NVFTATLFHYAFTIGIGLLVFAPFRWLVRQVWPAPGTGPTREETKNDISEWRVVVPTN
                     QLGSTGKPKKVMGSIFYLGGHYELTAVAVSCAAKAILEHEDEVKSVSTGLVTPATLGQ
                     AYVDELENGGFKFQVKVLDE"
     gene            complement(<1567244..>1568428)
                     /locus_tag="TRUGW13939_05403"
                     /db_xref="GeneID:55992900"
     mRNA            complement(join(<1567244..1567857,1567912..1568110,
                     1568162..1568211,1568264..1568311,1568362..>1568428))
                     /locus_tag="TRUGW13939_05403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488566.1"
                     /db_xref="GeneID:55992900"
     CDS             complement(join(1567244..1567857,1567912..1568110,
                     1568162..1568211,1568264..1568311,1568362..1568428))
                     /locus_tag="TRUGW13939_05403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344459.1"
                     /db_xref="GeneID:55992900"
                     /translation="MATKSSPNGNGKKPASAATNFIAGGGAGMMEALACHPLDTIKVR
                     MQLSRRARQPGAKPRGFVATGADIVKRETALGLYKGLGAVLGGIIPKMAIRFTSYEKY
                     KQFLSNKETGQTSRKGTFLAGLAAGVTEAVAIVNPMEVIKIRLQAQHHSLSDPLDTPK
                     YRSAPHALFTVVKEEGFSTLYRGVSLTALRQGTNQAANFTAYTELKAALQRWQPEYSN
                     SELPSWQTTIIGLISGAMGPFSNAPIDTIKTRLQRTPAEPGQSAVSRITAIASEMFKQ
                     EGAKAFYKGITPRVMRVAPGQAVTFTVYEYLKGKLEKSNWSLAGGKYEE"
     gene            complement(<1569624..>1573308)
                     /locus_tag="TRUGW13939_05404"
                     /db_xref="GeneID:55992901"
     mRNA            complement(join(<1569624..1570904,1571898..1572789,
                     1572851..>1573308))
                     /locus_tag="TRUGW13939_05404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488567.1"
                     /db_xref="GeneID:55992901"
     CDS             complement(join(1569624..1570904,1571898..1572789,
                     1572851..1573308))
                     /locus_tag="TRUGW13939_05404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344460.1"
                     /db_xref="GeneID:55992901"
                     /translation="MANDLSSSSQSLYASTSSLPNSKQCSQTYKSASQLFLTRRLQES
                     LTTLTPIITTTPSATTAEDLPTTNGSGDSAFAPIAFASSNVRIKVWNLYITLLSNIVD
                     LGPEDGKIEFGQKEWKALVAKVRDGTVWEEIVQAGYQGREGSVDADVVSNLGTLLLTH
                     SASQALNQQRLETYLSAYGQPNLDVAAHLANNSESDVRRLSRNGGTDTPKDLSARVKI
                     IELFTLHVLPRNEEWEYATEFIQLSEVLDEERKESFLQTLTDLKEEKERGIQRAAELQ
                     REKEAEIERQIQEEEKRKKAEAVEQRPQKNGTGHKRTSTETDYGIEKNRPNGVAKGRS
                     TKTEKSSTSKPSSSSSASGRTSFPPSSSSSSKNVKKTEKAAAPVSRRLHGVYNLLRNI
                     LQNVKHSVVGNPMAFLRTILFTLGILMALSRQDMRERIRRLTDSGWQKIRGTVGMGMK
                     PCRSIMGAEKTLEQDANLTLTNNNNNDINQINEANNTPEEQAESKESTLKKIALFILS
                     QWLLIGMGVACVLAYFFPNVAKHGGVIRSEYSVLYGAVALVFFISGLSIPRQKLYTHM
                     FNWRLHVLVQVTSFLFVPAVVVALVHLIVATDPAAHIDRAVLAGYILTACIPTTIASN
                     VVMTRAAGGDDAAALVEVLIANFLGPFMTAGWTVSLIPKTPEFAPWRDGGSSNMSGMY
                     KDVFKQLGLSALLPLIIGQLVRWTWERQITALLQRFYVAKLSTACMLLLIWTTFSSAF
                     ATGALQQLSTQSIVFTVLFNVALYLFLTVVCFYAAQPPAFIRKGTWGKRIFRPAPPEE
                     TIAICFCGPAKTTALGIPLLYAMYTSMDLFTKAKTSIPVLLYTTEQICVAHFMVYVLR
                     RWKRRLEGKGIQDEENAVTG"
     gene            <1574085..>1575975
                     /locus_tag="TRUGW13939_05405"
                     /db_xref="GeneID:55992902"
     mRNA            join(<1574085..1574340,1574398..1574490,1574558..1574793,
                     1574859..1575492,1575542..>1575975)
                     /locus_tag="TRUGW13939_05405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488568.1"
                     /db_xref="GeneID:55992902"
     CDS             join(1574085..1574340,1574398..1574490,1574558..1574793,
                     1574859..1575492,1575542..1575975)
                     /locus_tag="TRUGW13939_05405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344461.1"
                     /db_xref="GeneID:55992902"
                     /translation="MDDAEWDTVTVQTWSLHLPEILQHLSSCSFVALDFEFSGIAAQR
                     PFDSARRVAPLQERYADIKEAAEKFQILQVGLTIAHEDPVSGTYTLKPYNVHLSPLVD
                     PILGIDRIFSISSGAIQFLLKTNFRIDTPFTQGVRYLTQKEEELAIKEACKHSSHSRS
                     ETVVQMKLSKKENAESVAFLAVVRKDIDEWVAGGERAADYLNVPSRQSKMFKGKPTVT
                     SLNRFQKRLVHQLVETEYPLLTTVGRNDFVTITRYDEKREEGILQQKTQRAEKRLIEQ
                     RGFRWIIEALTGGDLSQLEAKIFDPVVLDCGNLSRETAVKNFAESLKANLQKNRPPVV
                     GHNLFTDVVYMWQCFFGELPDRVEDFVKLVHAKFPLLIDTKYMFTHDCGDVNPIASLG
                     SMDEALKGITDPEIVIDAKHTRYRRAQHLHEAGYDSFLTAKNFIKQASQLPQARRRTT
                     AEPQIPKTKPTHQPIVVDVVKKPAAPLKGLSFAELQSKFAHQNLFDTLPEDTDSPDES
                     DETSDDEAKLIPPFSSPVWKVYGNKLRVFGTSERVCALDGET"
     gene            <1576461..>1577630
                     /locus_tag="TRUGW13939_05406"
                     /db_xref="GeneID:55992903"
     mRNA            join(<1576461..1576506,1576590..1577278,1577328..>1577630)
                     /locus_tag="TRUGW13939_05406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488569.1"
                     /db_xref="GeneID:55992903"
     CDS             join(1576461..1576506,1576590..1577278,1577328..1577630)
                     /locus_tag="TRUGW13939_05406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344462.1"
                     /db_xref="GeneID:55992903"
                     /translation="MSSGSNSARKIAGLLRPSTFDAAICRSCQQTISPGRRNYASAAS
                     TVAGSDIQNAEIPLASSSEAVTPSFTLKAGIVLSRPPQITRDLTPFEKAFYFYQRRLN
                     ERLALPFTRYFYFKRGTPADEDWKRKYKDRTTASRDIGKYNAYTKEAWNDELLLGAAE
                     SEPTHQTEMLLQDAEVVTTTSSEGNTTKKVDIQRPLPRVTEADQANDQKSLDRLLQRT
                     LYLLVQTKEGYWKFPSSHIGLEENLRGAAERTLSESAGINMNTWFVGFHPIGHHAYSF
                     KAPKPDEKSQELVAGEKTFFIKGRIMGGQADLSSNTLDIKDYKWLAKEEISKYVLPQY
                     YSSVKNMLAER"
     gene            <1578129..>1579303
                     /locus_tag="TRUGW13939_05407"
                     /db_xref="GeneID:55992904"
     mRNA            join(<1578129..1578617,1578681..1578783,1578831..>1579303)
                     /locus_tag="TRUGW13939_05407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488570.1"
                     /db_xref="GeneID:55992904"
     CDS             join(1578129..1578617,1578681..1578783,1578831..1579303)
                     /locus_tag="TRUGW13939_05407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344463.1"
                     /db_xref="GeneID:55992904"
                     /translation="MAELPPLFKQRFDETKVSYAQLGSSGLRVSVPILGGMSFGHKDW
                     RAWLEDDEEKVGKLLKGAYDRGLNTWDTANAYSGGVSEEMIGRAIRKFEIPRHKLVLM
                     TKCYFPAVEQPAVRYLSYPEHFTGHKDYVNQYGLSRAAIFNAVNASLERLQTDYIDLL
                     QIHRFDYTVPPEETMKALHDLVESGKVRYIGASSMWTYQFAQLQFIAEKRGWTKFISM
                     QNHYSLLYREEEREMNKFCDETGVGRIPWGPLNSGILARPLSQQGKTDRWQESKREFS
                     AADQEIVRRVEEVAGKKGWTMSQVALAWIIQKKTTPIVGFSSLERLDEAVEVKGKTLT
                     EDEVRYLEEPYQPKPIQGHK"
     gene            <1581388..>1582215
                     /locus_tag="TRUGW13939_05408"
                     /db_xref="GeneID:55992905"
     mRNA            <1581388..>1582215
                     /locus_tag="TRUGW13939_05408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488571.1"
                     /db_xref="GeneID:55992905"
     CDS             1581388..1582215
                     /locus_tag="TRUGW13939_05408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344464.1"
                     /db_xref="GeneID:55992905"
                     /translation="MPPDRSSFSALNLPPSFSLPICMDYFTLSAGPNTNLWRKPPNGD
                     TSTAPMVFTSLRRPFVVAEVTISADWEMEWDQGGLVIFAGSAPGQSSVVEPLPFSGGG
                     GGSHHHHHHRGTRNSAFSRSCKWVKAGMEFSSGTVNASSVSATSDGADWCLSPLAMPN
                     IPTNITSLRIKLERVGHSLWIWYQIPSLSPYAVTPGAVGSTWKKLREVTWFFYGVEDK
                     CVHVGVYASRPTSIQRGGTVWEAMNGVRNDASVGDDGGGSGGGGNKLVVEFEDLEIF"
     gene            <1584769..>1590021
                     /locus_tag="TRUGW13939_05409"
                     /db_xref="GeneID:55992906"
     mRNA            join(<1584769..1584799,1584872..>1590021)
                     /locus_tag="TRUGW13939_05409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488572.1"
                     /db_xref="GeneID:55992906"
     CDS             join(1584769..1584799,1584872..1590021)
                     /locus_tag="TRUGW13939_05409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344465.1"
                     /db_xref="GeneID:55992906"
                     /translation="MAAVAAATEPVLDDAKNGLSVAATPADVEDTTASKKKKKNKKKK
                     GKKNAAAEAAPAAAAATETPGESQEADDDVKAEDEKAPEAADKPVEEVKADAVAESTP
                     EAPAEVAPPVEEKAVEEKAEEPSVTESAPEPPKEQAAESSESPADAPVEEQKEPESKP
                     AEAAEEHAPVEPTEAEPATEESAPEPAAKEEAQPAEETATVEGQAPESKESEVPEAAA
                     ESNTVEPVAAAPEPESQETEAANTTPEAPVETATAEEVSPPAEEEAKDEPVVQETAET
                     VEPSTEKAESAPEPAVAEAPSTEEPKEEPKEEAKEKPEAVNTVDEAESIAPASDEPVA
                     KEEEPTVEQPVETTGNAKEAAAEPVVEAFTKEPTAETPEEPAATTEEAAPEPVKEEAP
                     VKPSEPAVEPAAEEEKTAEPSEPVVAAVEPTAAATEAVEEPAAETTQATEETALAEEP
                     EAAVEAKTELVAESANTSDEKPAEAAPETSEAPAEKTADVAEDSEDKETAVEESKPEA
                     VETTEPAAADVPVKETPDEKAADEPEPSLEKAETSTETVEPTHEPVEQPTEVAEEPAK
                     EQAAEPAPAVEESAIEVAATEAPKEAPAAPAVEETVDQTAAEPVEAAEPVAEAAEEFA
                     KAEEEPVTEAKEAPIEAPATEETPASTTEAAVEPAVSEAVEAVAEAEQPEEKPEEPAA
                     VEAVKESSTEPATEAAAPEPVEHSEAEKPTEKAVEETAAAEPATSEAVEAAAEVEQPK
                     EKSEEPTVVEAVEESSAKPATEAEKPVEEAIEEPAAAEPAASEESAAVKESSTEPAKE
                     AAAPQPVEPVEPSEAEKPTEEAVEEPAATEPVEEPSAVEATAPQVAEPEAVEEPVKEA
                     ATEVEAPKPAAPEPAEPEAEKPTEEAVEKPAAVEPVEELVAGEVTAPEAVEPEAVKGA
                     ATEVEEPKPTEAEPSQEPVETVSTEEVKEVAVEEPTPVTAAAEPQSAEEPAAKPSEAP
                     IEQPSTETIEEKTGEPAVEAVKEEPAEPAAAVDETQVPEVLSTEATVETAAKEVPEPA
                     SEATEASFEPVAPAEEPVEGTKAAEPVEPTIEKEEPVEEVKASESVEEPVEETQATDV
                     PSTEAPAEPTVETVIEPTPEDTEAPAEEPKAEEPVEEVKASEPVEATVQATEEAKTAE
                     TTETTETPLETVEAEATDKAPEVEEIKAAEPVEAPVEAPVEATDEAPEVEGTKAAEPV
                     EAPVDAPVEAPVDAAVEAPVEAPAEAAVEEPVEETKAKEVPAADEVESAAEPITAPAE
                     FEAVEEKPVEALVEAPVEAPVDAPVEAPVDAAVEAPVEAPAEAAVEEPVEETKAKEVP
                     AASEVEPTTEPVTAPVEVKAVEEKPVEAVNEGPAETVQETPAQPTEEKTTVEEPTNSQ
                     EETAEKVEESEAPSTSEKVGIAAGVVAGAGAIAAAAVVASDKTAEGKPKEKTPEPIEE
                     PSKVDHVEALPVKAEKAEPVAEIKEPAPAEKSVTDVQETPVVNGDKAVPVEEQVPEAP
                     AVEDKKELVPVAEDKPTVTKAPSKEFGSDALHAIEAVGGAGAVAAAVAVVSENTIASG
                     SKESQPKEAVVEDQKTETVPIPTIEAPSEGADGKKAVDVKEPPTPEPEADPALQLLAK
                     DRETLLKQLGGSVSALNLLGDSTAAGERIKSFCQESYVSEPAGPSATNETEAAPSSSK
                     PAKDDGKPQKDDDTRSTAGGSATAISLKSENWLKAIFRSIWNTIFGNFFGIRRGRSAE
                     "
     gene            complement(<1590361..>1592427)
                     /locus_tag="TRUGW13939_05410"
                     /db_xref="GeneID:55992907"
     mRNA            complement(<1590361..>1592427)
                     /locus_tag="TRUGW13939_05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488573.1"
                     /db_xref="GeneID:55992907"
     CDS             complement(1590361..1592427)
                     /locus_tag="TRUGW13939_05410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344466.1"
                     /db_xref="GeneID:55992907"
                     /translation="MAPSRATKRIRLSPSDDEASPAPKSATIKQNFYSNAAEWDLEQD
                     YEQRPRKGKKKAQEKTRLPIKTSEGLVQVSESDDAAAGDADSFLDSDSENDSAEKEDE
                     EEKEEKPAGPKVPLKVQVVQAKEEMAHIAMLINEDPEEHIKLFRKLADYVDKTSTHPA
                     IKKLALATQAAIFKDVIPGYRIRPIAEEVGKNEKISKEVRQLRGFEQSLLSSYVHYVQ
                     QLTTLCRGSRQRNNKDEAGLRTVAVGCVCNMLIAVPHFNQRLELLKILVNRLSKRRVD
                     TDFVKCRETMEEIFAKDDDGIVSLEAVGLLSKMMKAKDFHVHESTLDTFLHLRLLAEF
                     SSKGSRDRVDREEPETYGKKGKNKKEFRTKKERKVEKERKAVAKDMQEADALVSHEAR
                     ERNQAETLKLVFGTYFRILKLRHPKLMGAVLEGLAKYAHLINQNFFGDLLEALKDLIA
                     RLEIEDNLDNGDDGDEDDNDEELTARQSTREVLLCTITAFALLEGQDASKAASSLHLD
                     LSFFITHLYRALYPLSTNSDIEYNPEKALRLPDPGTRQADNNTTFQRRNKVNFQTPMV
                     LLLRCLQSTLLARNLGTVPPMRLAGFTKRLMTTALQLPEKSSIAALALLGKVAKQHGH
                     KVAPLWNTEERKGDGVFNPVAVDVEQSNVFAGTVWEGELLRLHYCPEVRSAALDIDKL
                     IASTGR"
     gene            <1592691..>1595020
                     /locus_tag="TRUGW13939_05411"
                     /db_xref="GeneID:55992908"
     mRNA            join(<1592691..1592950,1593014..1593182,1593294..1593402,
                     1593847..1594028,1594089..1594132,1594191..1594267,
                     1594330..1594504,1594573..>1595020)
                     /locus_tag="TRUGW13939_05411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488574.1"
                     /db_xref="GeneID:55992908"
     CDS             join(1592691..1592950,1593014..1593182,1593294..1593402,
                     1593847..1594028,1594089..1594132,1594191..1594267,
                     1594330..1594504,1594573..1595020)
                     /locus_tag="TRUGW13939_05411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344467.1"
                     /db_xref="GeneID:55992908"
                     /translation="MRSLTEEETKTLFQKLAHYTGRSLNQLIQPTDEDERYVFRIQGS
                     RVYYVKLSIANLATSIARDNLLSLGTCIGKFTRTMKFRMHITALDVIAPHARYKVWIR
                     PNGEMPFLYGGHVLKAHTLRWSEDCPENSGCVVFSQADTPLFGVSARSSSAASKLEPT
                     AITVFRQADLGEYLREVSFSKRDPSPPSPSFYFFPFVCAYTRPHWPLTYPPSMPPYNS
                     SQKQSIAQFVDLTQEKDSTAAKYLRASAWNVEQALDAYFGAAKSGSSSSTVAALNKIF
                     DSYRDDPKENPDTIGIEGAMKFLEEIQVRLDEVVCLGIAELLKSPSMGEFTRQEFVDG
                     WKNAGADSIPKMITHAATLRKRIPTHTESFRKVYRYAFPLCRMQGQRNLSFEIASEQW
                     QLFFTSANGGVEWNTATTPWLDWYIEFLEWRNTRVVNKDLWEQTEVFLRKSIEDESFG
                     WWSPDAAWPGVLDEFVAYVQQAKRGEKARAGEEMEFE"
     gene            complement(<1595361..>1596218)
                     /locus_tag="TRUGW13939_05412"
                     /db_xref="GeneID:55992909"
     mRNA            complement(join(<1595361..1595684,1595747..1596022,
                     1596087..>1596218))
                     /locus_tag="TRUGW13939_05412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488575.1"
                     /db_xref="GeneID:55992909"
     CDS             complement(join(1595361..1595684,1595747..1596022,
                     1596087..1596218))
                     /locus_tag="TRUGW13939_05412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344468.1"
                     /db_xref="GeneID:55992909"
                     /translation="MSVKFQEKVTTRTRAVGAEDLTHELAHKVGERLTGGDTAQGYLA
                     AYLKQLQTNPLRTKMLTSGVLSGLQEFIASWLAHDVSKHGHYFSSRVPKMSLYGMFIS
                     APLGHVLIGILQKIFAGRTSLKAKILQILASNLVIAPIQNGVYLTMMAIIAGARTFHQ
                     VRATVRAGFLPVMKVSWITSPLALAFAQKFLPEHAWVPFFNIVGFFIGTYVNTHTKKK
                     RLEALRRQYDQRRGDRPGDYGRRDY"
     gene            complement(<1597039..>1598308)
                     /locus_tag="TRUGW13939_05413"
                     /db_xref="GeneID:55992910"
     mRNA            complement(join(<1597039..1597560,1597633..1598007,
                     1598071..1598221,1598295..>1598308))
                     /locus_tag="TRUGW13939_05413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488576.1"
                     /db_xref="GeneID:55992910"
     CDS             complement(join(1597039..1597560,1597633..1598007,
                     1598071..1598221,1598295..1598308))
                     /locus_tag="TRUGW13939_05413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344469.1"
                     /db_xref="GeneID:55992910"
                     /translation="MKYNRLGQSGLKISKVVLGAMSLGSSDHLKWAIPEDQALPVLKH
                     AFDRGINTWDTSDVYSFGESERIIGKALKHYNIARERVVILTKCYGGIPEPADFIGLS
                     EEEQLRMLSVNDGIMVNRIGLSRKHILDAVDASVERLNTYIDVLQIHRLDRNTPREEI
                     MKALNDVVESGKVRYIGASSMHAWEFQALNNIADKHGWHKFISMQDYHSLLYREEERE
                     MHAYCRDAGVGIIPWSPLARGLLARPYKVTKEQPTLRQTSDVYSQLLVGEVTEMDVNI
                     INRVEELAEKKRCSMAQIAIAWSLKKGVNPIVGLASINRVDEAAEAVALASNGLMTEE
                     DVKYLDELYIAKGELWMVE"
     gene            complement(<1598634..>1599749)
                     /locus_tag="TRUGW13939_05414"
                     /db_xref="GeneID:55992911"
     mRNA            complement(join(<1598634..1599622,1599674..>1599749))
                     /locus_tag="TRUGW13939_05414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488577.1"
                     /db_xref="GeneID:55992911"
     CDS             complement(join(1598634..1599622,1599674..1599749))
                     /locus_tag="TRUGW13939_05414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344470.1"
                     /db_xref="GeneID:55992911"
                     /translation="MADVRSRKPASDRRKQQNRQAQKGYRERQKRRMQALERLVNEQD
                     HHTVDSAFTNNGSTSTAVSPESGGASLATSTSSRTEPPELSERKRVFDQLMHEIDSVD
                     ETVYSRIVSGELPISQIFRAGLRHVLTQPPQNSLSNDTLSVDGIDPTLRTDKILVPEN
                     KMQVHVHALPDIYANHLRLKQFTIISALRASAESVGLTFSKLSSSDTESPFYRGPLPR
                     DDAKTIITKETFDNITPHLRPTVAQLRHRHHPYLDVLPFPTLRERIIEACSLDSPLLD
                     EEDLCDDLQKDGLICWGSYLGDGNGATGSGAPWDYRSWEAQPWFLKKWWFFVGGSQGE
                     LFQQTQWWHKMRGDRLVAPW"
     gene            <1600731..>1601972
                     /locus_tag="TRUGW13939_05415"
                     /db_xref="GeneID:55992912"
     mRNA            <1600731..>1601972
                     /locus_tag="TRUGW13939_05415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488578.1"
                     /db_xref="GeneID:55992912"
     CDS             1600731..1601972
                     /locus_tag="TRUGW13939_05415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344471.1"
                     /db_xref="GeneID:55992912"
                     /translation="MPETIAVIIIGAGLSGLALAQSLSRHNVSCKVYESDYSLNARTQ
                     GYRVRISDEGIQALEESLTKADFSILESSCNISPGPSNVPQATLDAISGGTCGPLFRP
                     GAKTPMPASPLRKPLSADRGVLRRSLLEGIEDRVVFGERFKYYVEAANEEIIAHFESG
                     LEVKGSVLVGADGTWSPVRQSLLPSFTLVDTEARLIFGKTDLNEKIVQDLSPAALQGL
                     TFIRDTGFNCLLEPMRFRKDINDLPVDYIYWVLFLRCDSENTPENILDLTSTEITDLT
                     RQLTSHWHFSLKTLFENSHAGQSSVLRILSVKPNIPDWAQGSKASVRVTLIGDAAHAM
                     CPTAALGATTALRDANMLSMSLKAHGIGPQALREYEDVMRKYVSEALDNSLLGGRNVF
                     QMRPFDQLPEVQARNSSVVDH"
     gene            <1603252..>1604439
                     /locus_tag="TRUGW13939_05416"
                     /db_xref="GeneID:55992913"
     mRNA            <1603252..>1604439
                     /locus_tag="TRUGW13939_05416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488579.1"
                     /db_xref="GeneID:55992913"
     CDS             1603252..1604439
                     /locus_tag="TRUGW13939_05416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344472.1"
                     /db_xref="GeneID:55992913"
                     /translation="MLSLHQDQEGLHRSECELRRRTWWHLVFLDIEASVSSGLQNLIR
                     PCDHDIPLPVLTKEDMGLGEADKDGSAVVIAMQGHWLLAQEIHQWFKQRPSHDDIIAF
                     RGRIETLVSRISGDSALARWARKFLQLQIDRAYCMAGLQFWQLDQFKGTSCGNEAVCT
                     ARSFLRIYLDLIQIGRDIAFEWFIPGFIQPIHALMILLKHLSGCSDPECENSEKTHEL
                     LTQVIDRRREWIMRGPIRPLPRKLMLGSETISTRVGVSVTPMTDPRYRMLWTLKEEVW
                     RRFGWIATITPIATTTTDYGVSGYPSTIHDETRGDHYDEKGQGSTSLSLCEVGLHFPT
                     GTRANSHETSDMPCNLQPFGTLNSSNDGENNLPDKYVHLDNLGHPDILASVNWDSWLN
                     NFE"
     gene            <1606859..>1608502
                     /locus_tag="TRUGW13939_05417"
                     /db_xref="GeneID:55992914"
     mRNA            join(<1606859..1607164,1607225..>1608502)
                     /locus_tag="TRUGW13939_05417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488580.1"
                     /db_xref="GeneID:55992914"
     CDS             join(1606859..1607164,1607225..1608502)
                     /locus_tag="TRUGW13939_05417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344473.1"
                     /db_xref="GeneID:55992914"
                     /translation="MHAATYTAIFGLLIGLYIVTRRKSTSSLPLPPGPKPLPIIGNVH
                     QAPKSHAWRTYRAWSKEYGPIIHVNMLGQPVIILSTSEVAHDLMGKRGAIFSDRPRLF
                     LATELALKGLNILMMNYTEQFRQHQRLQVSVLNATPAAAYLPFQALESHQLMCDLLEN
                     AGGAGADVQGPFQRTVASIIHTLLYGFRVKDCNDPVIRAVIQLNEEFSEFVQVGAHIV
                     DQFPILNNLPSFLAPWKAKAENHYSTKYVLRDQNFQRGLESDAWNISKHLKKTVEKDG
                     LDMPLDELAFELGTMIDAALDGTTDSLVWFVVACITQDRGFVTKARDELDAVVGRDRL
                     PAPDDKPNLPYITAVAEEIFRWRPVGPEGVPHLNKEEATYNGYTIPKGSVIVPNVWTI
                     SREEALFGPDPDDFIPDRWLEEDGKKLKTLPSAVFGYGRRTCPGRYFARNVIWIVVAQ
                     LLWSFDIKAGLSEETGEPIPVDPIACTYGLVMRALPFKATFSPRDSQVRKVIARDGDT
                     YSKDHAAMLNQIGAEFAKL"
     gene            <1609185..>1611216
                     /locus_tag="TRUGW13939_05418"
                     /db_xref="GeneID:55992915"
     mRNA            join(<1609185..1609263,1609328..1609583,1609637..1610089,
                     1610157..>1611216)
                     /locus_tag="TRUGW13939_05418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488581.1"
                     /db_xref="GeneID:55992915"
     CDS             join(1609185..1609263,1609328..1609583,1609637..1610089,
                     1610157..1611216)
                     /locus_tag="TRUGW13939_05418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344474.1"
                     /db_xref="GeneID:55992915"
                     /translation="MGLALGADRRTSNVDLMPILSACQQEEEISHELHALRSAEEIPH
                     KRVLSLNPVPNIQTVPQKGNSTEPALCASDIPEHAVSWLGTTDKDAACSYNLGKLKLE
                     PGTTIELFQYFDVHYRPHALFLQPVTSLADLLSRSPLLFWTIILISGRDHEKFVGLNH
                     EVATEHEELMSPLLQKAIQRIETIHALLLLCMWPVPQSKYFQNPAWNYAGLAIHAAMQ
                     LHCHSPLGSGTEQNEWPGFGLATEGEVNTVDQARTWLGCFRIGTAIATFSGLPPPIST
                     RQRMRSIDKSLLTVSNLVPSSWNTLFSILKITASAMDTLDNIEDHALHFSVTQVFSEQ
                     LDELKQSHIDSWRVELEIEWCNAKLYLFALTFTTPANADPSQTTQTRIHRQTILQKAF
                     EVASSLITQFMKLGQLCASDLHPGGLLKFLPELYFTSLFNATTFLFRFMATFMTLTTA
                     QGSQAMGLIIEAHKIFQSYPERRELTRAAIHIEALIDILKQGATISTSELVVKNKLGA
                     SIMFDAIFHACRQRNIDPRTGRPLAVQEWRTVNETFAERLPGTPAQKLGTDVRGSNLG
                     NNDLESDQRFTTLAEQNSQWWEEWDKYIDFFQVGEEHLDMDLDPLLDGN"
     gene            <1611777..>1613736
                     /locus_tag="TRUGW13939_05419"
                     /db_xref="GeneID:55992916"
     mRNA            join(<1611777..1612237,1612299..1612665,1612713..1613328,
                     1613392..1613516,1613569..>1613736)
                     /locus_tag="TRUGW13939_05419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488582.1"
                     /db_xref="GeneID:55992916"
     CDS             join(1611777..1612237,1612299..1612665,1612713..1613328,
                     1613392..1613516,1613569..1613736)
                     /locus_tag="TRUGW13939_05419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344475.1"
                     /db_xref="GeneID:55992916"
                     /translation="MRVSWLLLHVSSFLGYVEAHNEMCKSTPNDASWPSLCQWNHLNE
                     SLSGRLIHPSPPALACHPSYPGFNNDTCTNITSSWSTFAFHQDNPISTAWNNINNDSC
                     LPNASAPCSGLGYPVYVVNATSAKDVKLAIDFARENNVRLNVKASGHDYIKRSAAPYS
                     LSIWTRYMVGGYEYHDHFKPKNCNITIDTTAVTAGAASYVSDVYYNLHQHNLTVVDGM
                     GPEVTMGGYLTGGGHSPISNIFGLGSDQVYEVEMVTPTGKITIANECQNTDLFWAVRG
                     GGGSTFGVLTKVTVRTVPSSPIAVYDFTIEAQINSRAYWDSVAYLLAQYPTLSDSNVA
                     AYTYMYPNTSAAGLGGDIASFEAVFALYDPASANILENLLKPFLHHVNETYSGQITTK
                     ATSTIFPNFYSMFLKYADDGGAGVDKVVGSRLLPPETLTKDAFRGALMDFMGDAGGRL
                     YMVSGKGVWDAKPRGGSDAVNPAWRKALIHAVASQDWTPFDETERATVEHNINNVQVE
                     ALRRLVPESGAYLNEAYWNEPNFQQAFWGSNYERLQKIKKAVDPDDVFWCHVCVGSEE
                     WKEVRHRLCRVR"
     gene            <1614589..>1616343
                     /locus_tag="TRUGW13939_05420"
                     /db_xref="GeneID:55992917"
     mRNA            join(<1614589..1614819,1615275..1615474,1615542..>1616343)
                     /locus_tag="TRUGW13939_05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488583.1"
                     /db_xref="GeneID:55992917"
     CDS             join(1614589..1614819,1615275..1615474,1615542..1616343)
                     /locus_tag="TRUGW13939_05420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344476.1"
                     /db_xref="GeneID:55992917"
                     /translation="MTYQSLPPENNPPPGFQRRPRIRRGVAREPRAHISPIPEDSAST
                     AFPLTIQGPGQRIVRPLPPIPAGAGQPAQARGPLCARIASNSTCAKMADDKEKSVPPG
                     QDLNASDELAPQTPGAAGKIGSYKTAIDVLSKTDETVLRLKKFLSTPSGVDSALSTIG
                     YSSHILHHVLNSSPLTAVQTRIKFFLLQRLGGKLTAPKPPVPSYARPAPLLALSSLIS
                     ETRYTLRLFELVTIWAWGSSVYKSPPKDRTLKAIAYVEVLSILVYQALENGSYLASKG
                     IAWQTLVKRTGGTAKWSLWSVRAWFIYILLQFVRLYQDSVLFSRQEEERKKQRNEQVS
                     AGEKAVSESEQEENETRRLAIRAWRKKLINNLAWGTLCTHWSVEGGVGVPVYLNGFIS
                     LLAGIWGTYDSWQATALA"
     gene            <1617214..>1620025
                     /locus_tag="TRUGW13939_05421"
                     /db_xref="GeneID:55992918"
     mRNA            join(<1617214..1617263,1617329..1617356,1617413..1617468,
                     1617524..1617773,1617838..1618981,1619031..1619378,
                     1619436..>1620025)
                     /locus_tag="TRUGW13939_05421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488584.1"
                     /db_xref="GeneID:55992918"
     CDS             join(1617214..1617263,1617329..1617356,1617413..1617468,
                     1617524..1617773,1617838..1618981,1619031..1619378,
                     1619436..1620025)
                     /locus_tag="TRUGW13939_05421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344477.1"
                     /db_xref="GeneID:55992918"
                     /translation="MSAEPDHVKSKGKVNLNDPSGAEAKDELDTATAILKKKKKPNSL
                     IVTDAVNDDNSIIALSNNTMETLQLFRGDTVLVKGKKRKDTVLIVLADDDLDDGSVRI
                     NRVVRHNLRVKHGDIVTVHPCPDIKYAKRIAVLPIADTVEGITGSLFDVFLAPYFREA
                     YRPVRQGDLFTVRGGMRQVEFKVVEVDPPEYGIVAQDTIVHCEGEPIQREDEEGNLNE
                     VGYDDIGGCRKQMAQVRELVELPLRHPQLFKSIGIKPPRGILMYGPPGTGKTLMARAV
                     ANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKRDKT
                     NGEVERRVVSQLLTLMDGMKARSNIVVMAATNRPNSIDPALRRFGRFDREVDIGIPDP
                     TGRLEILQIHTKNMKLGEDVDLEAIAADTHGYVGSDIASLCSEAAMQQIREKMDLIDL
                     DEDTIDAEVLDSLGVTMENFRFALGVSNPSALREVAVVEVPNVRWEDIGGLEEVKKEL
                     IESVQYPVEHPEKFLKFGLSPSRGVLFYGPPGTGKTMLAKAVANECAANFISVKGPEL
                     LSMWFGESESNIRDIFDKARAAAPCVVFLDELDSIAKARGGSVGDAGGASDRVVNQLL
                     TEMDGMTSKKNVFVIGATNRPEQLDPALCRPGRLDTLVYVPLPDQASREGILKAQLRK
                     TPVAPDVDIPFIATKTHGFSGADLGFVTQRAVKLAIKQSIGIDIERQKEREAAGEDIE
                     MDEADVEDPVPELTRAHFEEAMASARRSVSDVEIRRYEAFAQSMKNSGGSAFFRFPSA
                     EEVTGGDGQNGFGEAGNDDSLYD"
     gene            complement(<1620597..>1621235)
                     /locus_tag="TRUGW13939_05422"
                     /db_xref="GeneID:55992919"
     mRNA            complement(<1620597..>1621235)
                     /locus_tag="TRUGW13939_05422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488585.1"
                     /db_xref="GeneID:55992919"
     CDS             complement(1620597..1621235)
                     /locus_tag="TRUGW13939_05422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344478.1"
                     /db_xref="GeneID:55992919"
                     /translation="MPSETTTATTTTSSSSSSSETLEAEIYKHLTETSALDELHAELL
                     FSLQRAGWTERIQSLTLDLLRAGRCSQFDELVDVVVALAAGEAHPTVPEADSDSSNST
                     TTTTNGHGGTTNGVGSSEPLFNNLDVRIPKDVVDQGVKALKDSIRPIATIEGDEDTSS
                     AAEADAPSSHNTSKSDKKPNKTSTKDSRLKTAADASPSKNAAANKKAKSGGK"
     gene            <1622521..>1624871
                     /locus_tag="TRUGW13939_05423"
                     /db_xref="GeneID:55992920"
     mRNA            join(<1622521..1623019,1623074..1623760,1623818..1623960,
                     1624016..1624609,1624662..>1624871)
                     /locus_tag="TRUGW13939_05423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488586.1"
                     /db_xref="GeneID:55992920"
     CDS             join(1622521..1623019,1623074..1623760,1623818..1623960,
                     1624016..1624609,1624662..1624871)
                     /locus_tag="TRUGW13939_05423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344479.1"
                     /db_xref="GeneID:55992920"
                     /translation="MSLFGTSPDDDDSAAANPSRRSKSSLFDDEPPTHHRSGSALFAD
                     DSNSGDSPWDMPTPKKAGQQNLVKNLLPATDAPETYIDAYELVLDAGNRVGADVGLTA
                     VRQILSSSSLNAADQAKILNLVLPGGQDSASGLGQNEFNVLLALIGLAQEGEDLGYDA
                     IDERRNNLPQPKISYLDDLKSPSEPEPVSQAQEEPSIPTAEQPATPRQASFGASDPDP
                     WGSPDLHRGHNHTSVPSNEPPLNGFGSVRSGTNGWAASVPESHNGGPTNGQIPPSSSG
                     SGWSAYNNTTAAPFGSSGQQPELGGFGQQGREQDNTSPQNRAIGSGGVTGLGVEETVT
                     VILLPEKEGVFMFQHRNYEVKSARRGSSVVRRYSDFVWLLDCLQKRYPFRQLPLLPPK
                     RVSVNGTHLSADSTSFLEKRRRGLVRFTNALVRHPVLSQEQLVVMFLTVPTELSVWRK
                     QATISVQEEFTGRSLPPDLEDSLPPTLNEMFDTVRSGVKRSAEIYINLCTLLERLAKR
                     NEGLAADHLRFSLALQSLTEATKTTYAIDTNDVPLLNDGINATARHLSASQSLLEDEA
                     KAWGDGVLEDLKRQRDCLVSVRELFERRDRYAKDNIPQLEKRIESNERKLQELRARPQ
                     GTVKPGEIEKIEESIFKDKESIVQQHARGVFIKECIRDELAYFQQSQYHISRLHQDWS
                     QERVKYAELQADNWRNLSDEVESMPNGD"
     gene            <1627885..>1631145
                     /locus_tag="TRUGW13939_05424"
                     /db_xref="GeneID:55992921"
     mRNA            <1627885..>1631145
                     /locus_tag="TRUGW13939_05424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488587.1"
                     /db_xref="GeneID:55992921"
     CDS             1627885..1631145
                     /locus_tag="TRUGW13939_05424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344480.1"
                     /db_xref="GeneID:55992921"
                     /translation="MVWEQLDVDKPHVAYMILGGFTSLFMLCSLFVKERLYIGEATVA
                     TLCGIIFGPYAANLFDPDSWGNVDKITLECSRIVLVVQCFAVGVELPKSYMERHWKSV
                     ALLLIPVMTYGWLMTSLFIWWLVPPLSWLESLACAACVTATDPVLASSVVGKGKFAKR
                     VPKHLRDILSAESGCNDGMAFPFIYLSLYIIRYRPDAHTVSFHWFCNTILYECIFGAI
                     FGFLIGYIARHMIKYAEKKNLIDRESFLVFYFVLALFCAGSGSLLGMDDLLIGFAAGV
                     GFSNDGWFTAKTEEAHVSNVIDLLLNLAYFVYFGSVIPWSSFNMPEIGLSPWRLVVIA
                     LLVIFFRRIPIMMVLKPIIPDIKTWREALFAGHFGPIGVGAIFAAILARAELENESTE
                     PDPQAELPHLGQKNYYIIQLIWPITTFLVIASIVVHGSSIAVFTLGKRINTLTITLSY
                     TTANEDGPSWMNRLPRVASMSKSSVSLRKAESNETTTNGEVPEYPPGTLGPIGVPGNF
                     LRRVHDDDEESSRKTPSIRSKRRRKRRKNIGGPISQSAIMPARRPDATAEEKAEIGEK
                     SDEPSPAGEEERDETDPIEREETDRIRREDSPPHRERKLVGREPEIEVYQEGHTMIIE
                     DAEGNVLKTEDISGESPEEQKQHILDWHKRIQTDKSGEFAKSESQPHGKTEGEEIKKE
                     AEEVVTNQYRTMRQRFGQWTGWGKEKTADTEAGPSKAKAKPPRQSAHAYQFGNTIIVE
                     DEDGEVIKKYTIPTADAATPVAAAAAESQVRKGLTRMGTWVGMKEGEPIKEEAVGPSF
                     GEDDDGLRFTVAHDPALETQGVDVKGRRMSKQDFIKEISKLDPRARHNLVKETDAPQA
                     VKKVAREDAKTQEKIEKTIEEDPAEGAAMPQDPNADDDSAEEVSDTESERDIPTHDVA
                     GVLAKFSGNAQERRRRLAGEDEDLAQEEDSEDDGTERVPPSAKRAGLNTLRRNVLAAD
                     DDTGETPAERKRRLAALGEIEHKDDEDDDEEAELAGVPRRLKAAVVREPSDSEDEGDD
                     TPTARGSIQFADGTRPARVTSESTDTSNGGRSARNVYGHGSRQHKVSWGGERGRSR"
     gene            complement(<1632219..>1633802)
                     /locus_tag="TRUGW13939_05425"
                     /db_xref="GeneID:55992922"
     mRNA            complement(join(<1632219..1633246,1633311..1633472,
                     1633532..>1633802))
                     /locus_tag="TRUGW13939_05425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488588.1"
                     /db_xref="GeneID:55992922"
     CDS             complement(join(1632219..1633246,1633311..1633472,
                     1633532..1633802))
                     /locus_tag="TRUGW13939_05425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344481.1"
                     /db_xref="GeneID:55992922"
                     /translation="MLLLKTQYHDDSDADDEYERSVLASPRLPTDSEISPTDSGSLST
                     EHTPTKYGNSSDDHGLPRTIISEWTAEECADFVAGLGLRQYRAAFLENEIVGEALIAL
                     KHEELKEMGITSAGHRLTILKSVYDTKMKQDIPIDPDHYVAPSADHNLTEPATYGDIS
                     RLQQTMRSRDERILTLEIEIRRVTEEYRRLRQELLPIFKMAKDRSQPLPYQPPNHTGP
                     TSSPAELYHDPLLGVSLNSRADTSALGKPHSRMYNGGTTPKSSNSPTHIPQSIHHDGR
                     LYNDGATLDPSAAAMVASSHLTTSMTGGAQISPGIPSPTSPAQTQQTLGPRSYARDGR
                     NTTSTVRPGYDHEETPHPNPSSTPTPGSGSRGESKNTDSAAPSVEIFKSFRVSMEDPC
                     HKVLPAALKKYNINADWRQYALYIVYGDQERCLALDEKPLILFKQLDKEGRKPMFMLR
                     KSAPADGTAASYPAPAGPAPSSAGFDTNRPVPGGVL"
     gene            complement(<1636006..>1636759)
                     /locus_tag="TRUGW13939_05426"
                     /db_xref="GeneID:55992923"
     mRNA            complement(join(<1636006..1636143,1636199..>1636759))
                     /locus_tag="TRUGW13939_05426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488589.1"
                     /db_xref="GeneID:55992923"
     CDS             complement(join(1636006..1636143,1636199..1636759))
                     /locus_tag="TRUGW13939_05426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344482.1"
                     /db_xref="GeneID:55992923"
                     /translation="MTPTLDTLEQPIGLRPDLVAAQTRRIRVKQHAGFGPSDFTVTGN
                     NDSEPESSLTKLFSVDGPVTSWQQRRNFRDGSGLPLFEVARKKAGVTWFVHLPGDNGE
                     PIATITPRFHALKDKFDVYFNNAAGNGEKVQLEVRGQDIWKLRTNVYFGEHMVTTCKR
                     TDKMSVYVPGKSIEWDVDVVQGMDMSIVSLIVVVMAHQMYQTSYPSSESSRKTAKKED
                     ITDEKADVSSIRKA"
     gene            complement(<1637629..>1639398)
                     /locus_tag="TRUGW13939_05427"
                     /db_xref="GeneID:55992924"
     mRNA            complement(join(<1637629..1638434,1638495..>1639398))
                     /locus_tag="TRUGW13939_05427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488590.1"
                     /db_xref="GeneID:55992924"
     CDS             complement(join(1637629..1638434,1638495..1639398))
                     /locus_tag="TRUGW13939_05427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344483.1"
                     /db_xref="GeneID:55992924"
                     /translation="MKAASIFVGLIGAAAAASISDQGHPNFHKRDACSGNTATDRQTW
                     CDYDLSTNYYDEVPDTGVTREYYFNIEEVTVAPDGYSRTAMAVNGSIPGPTIIADWGD
                     YVVVHVTNSLSSAKNGSSIHFHGIRQNYTNPNDGVVSITQCPTAPGQTTTYTWRATQY
                     GTTWWHSHIGLQAYEGVFGGLLINGPASENYDEDKGVLFLNDWSHQTADELYESAQVN
                     GPPTLDNGLINGTNVYGDDGASNQTGYRFNTSFTAGTSYRFRLVNAAIDTHFKFSIDN
                     HTLTVMAMDLVPIVPYTTTVLSIGIGERYDIVVSADQSSVADNFWMRAIPQEACSDND
                     STDNIKGIVYYGDSASTPTTTGYSYTDSCDDEDISDLVPYLSQSASSPYYNSSEPVTL
                     GTNSDNLFRWKLNGTSMQIYWDNPTLLQIYNNETTFTNYSGVVELPEANKWSYIVIET
                     ALTVPHPIHLHGHDFYILAQGTGTYDSSDIGTLTNPPRRDVAMLPGTGYLVVAFKTDN
                     PGAWLMHCHIGWHTEEGFAIQFLEQYDEARALIDYDTLNSTCEAWDAYVEESSVEQED
                     DGI"
     gene            <1640314..>1641036
                     /locus_tag="TRUGW13939_05428"
                     /db_xref="GeneID:55992925"
     mRNA            join(<1640314..1640473,1640554..1640610,1640675..>1641036)
                     /locus_tag="TRUGW13939_05428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488591.1"
                     /db_xref="GeneID:55992925"
     CDS             join(1640314..1640473,1640554..1640610,1640675..1641036)
                     /locus_tag="TRUGW13939_05428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344484.1"
                     /db_xref="GeneID:55992925"
                     /translation="MFFNILTCLACTLLSLVISSSAFVSRSTPSAGEEFSLYAYGDSV
                     GGLPLFYSDGKAAVGILSSSNSSASNVTFERTSDSSTGSLVGNPPNGTSASSANSSWS
                     DQFLYIPSSSSSSNEIGFTSESGDNATTTKFVFYGQTLLVKDESGDIVSSFYARQSSS
                     EGGGVYSLLWNVTEDHDAVFPVSLRTVAASNA"
     gene            complement(<1641199..>1645101)
                     /locus_tag="TRUGW13939_05429"
                     /db_xref="GeneID:55992926"
     mRNA            complement(join(<1641199..1641891,1641943..1644719,
                     1644780..>1645101))
                     /locus_tag="TRUGW13939_05429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488592.1"
                     /db_xref="GeneID:55992926"
     CDS             complement(join(1641199..1641891,1641943..1644719,
                     1644780..1645101))
                     /locus_tag="TRUGW13939_05429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344485.1"
                     /db_xref="GeneID:55992926"
                     /translation="MAAGLDQSGVSAIALTPRRALLAFLILIALPIYYCPQTKTFNFS
                     HFAPARRSCIWSTSVPVFDSRKLGFYSAVLSPIGACITSMASAVADRVMGQAEQQKLH
                     PFFGQYTKPPQAPASPLLPPSHEAAVPPFYQEPTPSQCASIGDRDAKFQQEFLPAEPP
                     QDSGPEDGLDTHRRKRLKTSVSITTPEGAITAPQNDTTHSDTSAAQENKNSVLPPRKI
                     LKLNLNGKLLSSPPVQQTETPPGAAIPTPQNDPTHSDTSVAQENKHSVSPPRKILKLN
                     MDGKLLSSPPAQRTETPGTRGRPKRAAKKDKSRIVTISYKSKVIGQNIDTILGGLERH
                     KTPASSVTKATPAPPPKATPKTTHPFFLKRPTSQPSREIPSSTSESSENKQGSLEPKP
                     QQQTNWPSQFSRSLLPKFPEPIPPVWPPRDLAHVRGVEVVASNTPAVTLPDRRKNKER
                     ILRVNDSENILLAQHQQVWSEIEESSTAELSSLRLPSRSVVSGLRLQKDLGSQLSHGP
                     NSQNQHGPGYCGEPGRQHPAIAKLYASIATNTNMTAFDTGQCDTVQWAHKYAPLVADE
                     VLQAGPETRMLRDWLRHLKISAVDTGKTGSGKKSKHSTGRKTKRRKVATKLDGFIVSS
                     EDEASEMSELSDDDDDELAADFAVSSKRTVIRVGDSVGKFKKGENSRMTNALLISGPN
                     GCGKSASVYAVAQELDFEVFEINSGNRRSAKDILERVGDMTQNHLIHLEGIERQDDEP
                     NFEPQQIDVKQNKLNAFFNAKATSKAIPKATRPRKDSDNDIPQKKLGPEGARSQKQSL
                     ILLEEVDILFEEDKNFWMGVLALIGQSKRPVIMTCNNEELIPLQDLSLHAILRYRPPQ
                     PDVAVDYLLVLAANEGHMLQREAVTDLYFSCNQDLRKSIMELDFWCQMAVGSQKCGID
                     WILDRSSQGAGIDADGEKLKVISLQTYQRFMGWFNRDHMLTKNSLARETELLLEGVNW
                     WQLEFDAEEETPATARTTASISTTPNSSETHLEQLRHAATLADNHSALDILAHSWSLN
                     QKEDDLDPSIPDLPKNQKYNYQEGYPLLNAAYKSDYTGLSASIGSTAQVLLHSTMFDE
                     NPQELEANAKRVLARQSRPKSNSFSTANYISAFESIMQSNDSILAHAASSSESDVAGV
                     VEDIAPYIRSIMSFDLRLERYRLQLSGILTQEPRNKRVRTTRASRAALEGGDKSNTRR
                     ERWFSQNANPKQILATGSSEWQDALVQAGHFSVTPAALGNTSSSQSDSDNSEGVSRVD
                     V"
     gene            <1645263..>1648213
                     /locus_tag="TRUGW13939_05430"
                     /db_xref="GeneID:55992927"
     mRNA            join(<1645263..1645427,1645484..>1648213)
                     /locus_tag="TRUGW13939_05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488593.1"
                     /db_xref="GeneID:55992927"
     CDS             join(1645263..1645427,1645484..1648213)
                     /locus_tag="TRUGW13939_05430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344486.1"
                     /db_xref="GeneID:55992927"
                     /translation="MDLPPPSVLAQLPRPLQASAGRTQIGEVFSLAESKKRKRYEVAV
                     AVDGEGLNIYNVQSPKLITSHAVPPQSVFSCRPCAIRRRIQETSVVKRHIYAAVERPK
                     HEIKGFFEETVPGSATAPVIATSSYTLKDAQSPTTFVGIIPRESNDDSNDELFDLLSV
                     HRDGQVRRFTSDLKTQKWSIQHKEVKNEVGAAFLVEFDDARRSLLKKRPDLAALAIGD
                     VSASPANNPSVLLLVSHPVSEDGSSKLALDDVKVHIFAIPVTYDSAAGIVDDFQKLRH
                     LHTVQLPKVEGIEIDSREPQWTFHSGSAGLSLSFQKGYINCDLSQYSPTVTTKFVLND
                     EHFSSIMRISPYSVIGAGKSLVGLYDTQYSSVQRRIGTRDLSPAKSKEFDPKAAMTFV
                     GYFAKLGIVLAVKDSALLSFDLSSTHTIRGTSLKRQRDGLLIDAIGKGVSSSASWNTA
                     EAGDCLGLSNKEENSRWNTLKEGLNSAIKATDPTAFDNAVTSYFGTEKLLSLPQTSAN
                     LEKALFILSKIFTVRQQQEAGNLRNDSATLKLALWPKKTFDWLVKSGLFTLDHIDAAV
                     RRANKPRILPPFQTGSLVQALADFDAVSLKPLFLLLRSSLSLLPPDELTRALKVFIDL
                     ARASSVALDQPEIMAITGAADVEMDDDSSSMPATEPATTANDNDKNNSNNNNTTTKTN
                     VSLQDAFTGLNLTLSKLHAYPINRVVSSLRSTLSNTDTLAIVHHLRVSLATGGYTARF
                     TENPPVPLDAIKAAPRLSLDTIVDLMNASVDAIGPSGWISAVEFVGTAVNESEMIAHM
                     QSEVSAALAGVEEAAYMKGVLGEFIRYGSQVTAASTNTNNPADKSSSKAITAALTTTT
                     DNSNNNNSSSSITDPAPGVKREYDTYGKLWETYTFPKAGEEDGKILPLSLNAPTTGES
                     SSSLEQQVAAGAGRTKIQKSTGAVQNRTNREMAYLQRRAVPDYSVIRIHL"
     gene            complement(<1648840..>1652462)
                     /locus_tag="TRUGW13939_05431"
                     /db_xref="GeneID:55992928"
     mRNA            complement(join(<1648840..1648925,1648981..1652304,
                     1652381..>1652462))
                     /locus_tag="TRUGW13939_05431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_035488594.1"
                     /db_xref="GeneID:55992928"
     CDS             complement(join(1648840..1648925,1648981..1652304,
                     1652381..1652462))
                     /locus_tag="TRUGW13939_05431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_035344487.1"
                     /db_xref="GeneID:55992928"
                     /translation="MMAAQDPTVVANGDNLLSIQEMPGDVTDMSLQESKPADSKQHTA
                     PAPGGPPPKTDKPRPHVCTTCGRSFARLEHLKRHERSHTKEKPFECPECTRCFARRDL
                     LLRHQQKLHMTAAPSRPRNARRESTGAAGAGANRVRKNSIAGSTSSTMRPRANTISHV
                     DNSALGMINVANANVTRPGQPGHTYHPSLGSVSGAPAFENRGYSAMHPPINGLPKIET
                     SGLPVDMGHGLRTAPVYGSFDLGFGDHFFGGSTINPAQLHFGGSPQFGHDTPASPFNQ
                     AFHPLASVPDPMLDDDGNFDWVNGFDTTVPLGTTSDSAIEESSPSAMSTESQSRTSEP
                     MMEAPAHIASSASWQSPFPAAQSAPYAMDFSPSMQDLGFSAADTVSPKSLMTPIHFTD
                     PFTSNLSVPMSQSMLGGHSQSMFSSSMVANGESPNPLNVPFASSPLRNSFSTTSPDTV
                     TDSTRQTLLANMSQPTGGTRQNRYSQPSNNRDSSSRTAGLNNSYLLPTTFDLQRYIQA
                     YIVYFHPHLPFLHIPTLDFQNPEFTNSLRTASGHLNLSSTGVAGGGGCLILSMAAMGA
                     LYEFEMAVSKDLFESAKKMIQLYLEERRKADMSAALS